3MLRH

Crystal structure of anti-hiv-1 v3 fab 2557 in complex with a ny5 v3 peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
226
Chain Sequence
EVQLVESGGEVKQPGQSLKISCKSSGYNFLDSWIGWVRQIPGKGLEWIGIIYPDDSDAHYSPSFEGQVTMSVDKSISTAYLQWTTLQASDTGKYFCTRLYLFEGAQSSNAFDLWGQGTMILVSSGTTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
total genus 40
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlrH01
2EDTA 1J0IA 3OKDA 4M1GH 2PYFA 3GJFH 1F4YH 1JWSA 1Q94B 1Z5LB 2O5YH 4JKPL 4NUGL 2YPLD 1GGIL 3QEHB 2VITA 4NM8H 1PYWA 4JO1L 4IJ3C 5E6ZA 2H1PH 5IG7A 5GS3A 3JWOL 2VRAA 5E2UL 3TNMA 4U1HB 1T83A 1IARB 4PJHB 4U49A 4UDTA 1QSEE 3DETD 1M6OA 3S4SB 2R4SL 2BOCB 4KVNH 3TWCL 3SGEI 5CGMA 3HCVB 5F9DC 3TJEH 1MFAL 4J8RB 1QHPA 4K94L 4XH2A 4KJYA 2IG2L 1MHCB 1DLHA 2ZCHL 1PLGH 1WV7T 4XNUH 3MFGB 5HI5D 2EKJA 3O4LD 3A0OA 2PO6B 4XXDA 3G9AB 1TJGL 1MCHA 4FFZL 5C08E 2WZPD 2JB6A 1FQ9C 2W65B 5CLTA 5J4MA 2YC1B 5C09B 4QTHB 1SEQH 1FC1A 4F33A 3VXRD 1YQVH 4YO0A 1H8NA 2EDJA 2WWMD 2HT3C 4YHML 2OXHA 5I16A 5EO0A 3E6FA 4LVHC 3RI5F 3PL6A 4PRAB 2Q86B 2ENSA 5CBEB 4M6OL 5T1KA 2NY1C 5D2NB 2DIAA 2NMSA 4TNWK 3NIFF 3F7YB 1YEIL 2VH5H 4XAKD 2BFVL 1QLRB 1FG2B 1RIHH 5MENA 3O3BA 1YUHB 3IDYB 4JFXA 4HKZB 2CLZA 3BUYA 3QT2A 1X5JA 3IFNL 3OAYK 4BELD 1JNLH 4XMLH 2F5BH 4PJ5D 3BQUA 2P46B 1AHWC 3O6FD 2AVGA 1N7MH 2F8XC 5JORA 4PJFB 3F58L 2WQRA 5FGBC 2IANE 3U4EA 5E7FA 2E9IA 3LOWA 3O0RH 1A6AB 4G42A 1LK3H 3CCHB 3UROR 1N5YH 4YR6B 5DGRA 1ZHKA 1FIGH 1L0QA 4ZOBA 3GMRA 4D0CA 2C3VB 4WY7L 3QHFH 3BPCA 3BP7A 2YD2A 4RGMC 3KWWB 1XF1A 4O2CA 4DFHA 4HJJH 2J8UF 1JGEA 3L95B 1G7QA 1FLTX 3G08A 1KB9K 4U6XA 4RX4A 1BVLA 4D9QE 4X80H 3O6LL 3NIDF 4JHAH 3SCMA 1H5BC 1DUZA 3VH8A 3PXJA 3MRBB 2VDOL 5FHAL 4PRPE 4MNGB 3D39A 5EU4A 3MRCA 4HWBH 4QXUL 5H2BA 4NQCB 1E28B 1PKQA 3KJ4B 2A77L 3PJSA 1XF4A 3L3OA 3VXTB 1ZVSA 2BCKA 1F4HA 2PW1B 5DMGC 5FM5M 4UUJB 3OJ2C 5HHXL 4CMMB 2F15A 5E9DD 1J12A 3QI9A 3TNNB 5HYFA 2HTLC 4PGJA 4P2YA 4KRLB 1UEMA 5GSVB 3L3KA 3D85A 5F9WB 4DFIA 4DN3L 3DX6B 3L3DB 4ZTPH 1O0VA 1IM9B 3DURB 3JV5A 5J3HD 1IGIL 1W0WB 3ARZA 4AIXA 4OCRH 1IKFH 1NC4A 4P4KD 5EO9A 2X41A 5D7KD 5I9QC 1TQBB 1L6XA 2G9HA 1BBDH 4JQXA 1NAMB 3QO0B 4X6DB 3ZE1E 1PBYA 4HWZA 1SM3H 5CKGA 2AJYH 4HS8L 1OTTD 2IPTH 2MCG1 5CKAA 2H41A 4DVRH 4UNUA 3OR7B 3VFPB 3H9YA 3O3DB 2D4FA 4PB0L 1F4YL 1J8KA 2O5YL 2H8PB 5SWZD 3HR6A 5E8PA 2NTFB 4Y2DA 3GM8A 5DVNA 4QHNB 4NM8L 1AGDA 4AEFA 3AM8C 1QSZA 3QXAA 4PYHA 4OV5A 2B1AH 5I66B 3GNML 2H1PL 4X98A 3CDYA 2R0KH 2PXYA 4O51B 1I1FA 5MEOA 4UNTA 1FO0B 1I4FB 2E6JA 1T04A 3HB3D 1ITCA 1ZLUK 4PP2A 4LCWD 3U0PB 2ED9A 3DPBA 2K7QA 4PTUB 5EZLB 3TJEL 3V5DB 4ZNEE 3RY6A 1CICA 3MRNA 3EUUA 4OZFH 1RI8A 3MV8A 1MI5B 3S36X 1PLGL 4OUUA 5CJQH 4Y4KD 4XNUL 5BV7H 1YPZA 4P2OB 4PJ7A 4MNQD 1VFAB 3L5WA 4R3SA 3B8SA 2VDNH 5ESAB 4LGPB 1LO5B 2YBRA 3QAZC 1PKQE 1LMKA 1ODAA 3KYAA 4HUMB 1DCLA 1SEQL 1MAMH 5IEKA 5FGSA 1U3HA 1YQVL 4UINH 3MROA 3NGBB 4NFBA 3KDMB 5KSAD 4ISVB 3V6ZA 4L8SA 3FT4B 3WLBB 4ZFOA 4J3XA 4BKLA 4P2RA 1M7IB 4LEOA 3BX7C 2YD9A 4ZOAA 4K07A 3U7WH 1KTLB 3THMH 1I8KB 3DSFH 3QXTA 3UDWA 2VH5L 5DYOA 4MQTB 1RIHL 1UJ3A 3X17A 3G6JB 5ESVB 4P46D 4X4XB 2F53B 1ZHLB 2H3NB 1L6ZA 3IXTB 1DEDA 1FP5A 1JNLL 1DSFH 4XMLL 4OI8A 5SWSE 4LHUD 4B5EA 1QFOA 4UIMB 4X4ZA 2WIMA 3BDXA 1QA9B 3C8KB 4X8JA 2VIRB 3CAFA 3O0RL 3VFVA 2VLLA 1LK3L 4APQC 4Z77A 1N5YL 1AR1C 3IVKB 3U2SA 3BP5A 4M93C 4X5LA 1H3XA 1UEYA 2NY0D 4NN6C 4CNIA 1HKLL 5JMOC 3M17A 2FWOA 4BUGA 1YEFH 43CAA 3VWKD 4J3WA 4D3CH 5DQ9B 4HJJL 2VXQH 1OT2A 5JHLL 3CDGB 4K8RH 5IM7A 1U8NB 4YC2B 1PAMA 5A3ID 2BSTB 4MD5B 1B0WA 4I0PD 1S9WA 3ULUF 4X80L 4JHAL 2GT9A 3Q48A 1DVFB 2ADGB 3KYMB 5CJ5A 5B39B 1RUMH 3SDXF 1TTUA 3BWAB 4A6YH 3CXHK 3FQNB 2IBZX 4HWBL 5IBLD 3O2DA 4GRWB 1QLEH 3HPJB 1I9JH 3MBED 3LRSA 4N0FB 3HC0B 1ORSA 2AABH 4XNZB 2AGJH 1D5MA 5J7CC 1TVDA 1IL1A 2XZCH 4ZTPL 4BQ8A 4K8RC 1NCAH 4F7EA 3OGCB 4EI5B 4KHXH 3CSYB 5DJDA 4OCRL 1IKFL 2F9BT 4J7RA 5KSBA 4P2RE 1JGLH 3PWUB 3S5LG 4DUVA 1Z9SA 2DM3A 4LPCA 1BBDL 1J1XH 1FVEA 1DLFH 2WP3O 4WEUD 3CFEB 5C3TA 1AKJA 1SM3L 5D2LF 3WIFA 4RNRA 5D9SB 1XF5B 3P73B 4RMQA 4YBQC 5DTFB 1MEXH 1WITA 1Q9LB 2IPTL 3MXVH 3CX2A 2J6EA 4PIRF 4XVTH 5AYUH 3AREC 3ZKND 2NR6C 3RDTD 4JZOA 3HI1B 3N06B 3D3VD 1OHQA 3HKFA 4KDWA 3R06B 3UP1A 1JTTA 3T09A 1LE9B 5JNYA 3LKOB 2B1AL 4TQEH 5EUOA 5FKPA 4O58H 5EOTA 5ITFA 4GXUN 2R0KL 5GSRA 3OZ9H 1OP5K 5E94A 4ZSOE 5JZ7C 4X6CB 4OF7A 2DMBA 3WDJA 1FFPB 4KDTA 1Q94A 1Z5LA 3QEHA 5AZ2H 1XAUA 5DRXB 4W70A 3H9ZA 5CJQL 2VWEC 5BV7L 1U8HB 4U1HA 4IEFB 4OLUH 5E8NA 1V3MA 4PJHA 1JZ7A 3MGTB 3TPUB 2BRRH 3OAYH 3S4SA 3RUGE 2VDNL 2BOCA 2VISB 3AROA 3K7UA 3HCVA 2FX8H 3FO9A 4J8RA 4ODBD 3DO7B 1YN6A 1F6LL 2CIIB 1MHCA 4NYLA 1MAML 1N5AB 4NQTA 5JHDB 3W0WB 2ZG1A 4F7PB 2AI0H 2O5ZH 3BI9X 1B0RB 1GGBH 1EA9C 2P7TB 25C8H 3VXUB 2W65A 1FYTA 4P5MB 5T3XH 2YC1A 4FQXB 3W11D 3SQBA 4ZNCD 5C09A 4QTHA 1IC1A 4ACPA 3BPLC 4U05A 3U7WL 3THML 3QA3A 4NN7C 5MHSD 3TA3B 2X4SB 3WUZA 4WU7A 5CINH 2QTEA 4Q6IB 1J10A 3C2SA 4U0QB 2H6PB 4GBXC 4PRAA 2Q86A 5CBEA 2R1XB 3MV7A 3HMXH 3B83A 1DSFL 2VZOA 3P9LA 3SN6N 5D2NA 5D7LD 3OXSB 3WKMH 4IRJB 4O9HH 3QQ9C 1UA6H 1YY9C 5B21A 2EE6A 3WHXB 4HFUH 1FG2A 1YUHA 4HKZA 2VERN 1NUNB 1MFBH 1ZVYA 1RHHA 3QQ3B 3VFWA 3QPQD 2GSIA 4LVOC 4ZXBB 3IJSB 4YAQB 1YEFL 4PJFA 4WHCA 4D3CL 3F62A 3S34H 2VXQL 1EDQA 3LQMA 1WIPA 3VFMA 1KPVA 5D6CB 4K8RL 5C3LD 1A6AA 4JO2H 1N2RB 4PUBH 4JRWA 2FO4B 3NZ8B 2W0FA 3SKMA 2D9CA 1T5XB 3I02B 2C3VA 3QUKB 5T3ZH 1RUML 4DKDC 4A6YL 1NANI 4CKVX 4PJHE 1QLEL 3KWWA 4Q6YA 1QVOB 1OTUD 1I9JL 2Y36H 5BS0E 4IJ3B 1KLGA 3RBSA 3UYRH 4Y4FD 2AABL 4KI5E 2AGJL 3MRBA 4IOFC 4MNGA 2I9LB 3HZKB 5KSVB 2LU7A 2XZCL 4XMKL 4NQCA 4RCAA 1E28A 1NCAL 5DA0B 5AAWA 3VXTA 1UM5H 1KIRA 3ROOB 3V7AE 1JGLL 3RPKA 1ZLUH 5F6IC 3BOVA 4CMMA 3TNNA 5ENWB 1J1XL 4DZBB 1DLFL 1B0GB 3GJFB 4NQDD 5GSVA 5DD1H 4U6YA 4JFDE 3L3DA 4G80A 1F3JB 1IM9A 3DURA 1CL7H 5GISH 4PRHB 1MEXL 1NBZB 3MXVL 1P5VA 4XVTL 5AYUL 2OCFD 3IDNB 4LVNC 2LU3A 3SHSA 3OXRB 3VMOA 1NAMA 3S8WA 3W9EA 5GS1A 2VDMH 2FZ3A 5FF6B 4U0RC 5DHYB 4LSDA 5FK9A 4MYWB 1DFBH 2BVPB 3PWLB 4HEME 4LVHB 3FFCD 4PV9A 4M43L 3UTPE 4TQEL 4O58L 5AZEH 3KNBB 2VLJB 5CSBA 2NY1B 3OZ9L 3O3DA 2OYPA 1A6WH 2FL5B 5L6YH 2H8PA 2NTFA 3WFCH 2BY1A 5AZ2L 2DQJH 5KG9A 2FEEI 4QHNA 5MEPB 4O00A 4HK3N 3FL7A 5I66A 1V3KA 3QG7H 1EFQA 4O51A 1BD2E 4LLQB 5I2IB 5C07B 4OLUL 1PKOA 4QRPE 1AHWB 1I4FA 2BRRL 3CC5A 3QULB 4PTUA 5EZLA 2FX8L 3V5DA 1IBGH 1YEEH 2XY1A 4M6NH 2DBLH 1MI5A 3P9WB 5D70H 4C54A 4FFWD 3WS3B 5K59E 3MMEA 4KKAC 1K6QH 2AI0L 2B4CH 2A6IB 2QR0B 5ESAA 1GGBL 1ZKAA 1LO5A 4MNGE 3KPTA 5D7JD 25C8L 1VEMA 4MJ4A 1J05B 5T3XL 1PZUB 2EIBA 1W72A 3QDMD 2VSDA 2YSSB 1H5BB 2YMXH 2FJFB 4LP4A 3RVUC 4R26H 2WP3T 4AMKH 2AEWA 2LABA 1C7SA 4KQ4H 4ZAKB 5T33H 3KDMA 4MXWH 5CINL 2DMCA 1M7IA 4KJPD 4KI1A 2WUBL 5J1TC 3RVVC 2QQKH 3CMOL 1DP0A 4W6YB 2EIEA 1KTLA 3PWPD 1I8KA 3WKML 4O9HL 4X6BB 1UA6L 2B4CC 3CSPA 3CSBA 2OP4H 4X6DE 4HFUL 4P2CG 3K8KA 4YDIH 4Y5XC 4MZ3A 4E41B 4FG6D 2F53A 2H3NA 3BW9B 2L7UA 3F5WA 1MFBL 1N3NB 5I9QB 2CO6B 3NCFB 4WDIA 4YQXH 4PD4J 5C1MB 4PJ9D 5SWQB 4UIMA 1KYOJ 2X9WA 3S34L 1C1EL 3EIFA 1QA9A 3C8KA 2VIRA 3WN5C 3FMGH 4JO2L 4PUBL 3IVKA 1S78D 3CVHH 4OZIB 1MFNA 2PYEB 5T3ZL 1JZ6A 4FQ2H 1VPOH 3H6JA 4BA8A 3ARGD 5DQ9A 3OJVC 3FN0L 2DIBA 4ODUB 1U8NA 1CLZH 2Y36L 4MD5A 5DD0H 3ZT5A 1ACYL 3UYRL 4X5XB 3GMPB 1DVFA 1FVCB 2ADGA 2XNAB 4NKMA 4N9GB 5B39A 5FV1L 3BWAA 3FQNA 4ZUVB 3S98A 1CZ8H 1IAKB 1DBAH 3PWVB 1OP5H 1OCWH 3HPJA 3IJHB 3KXFE 1QFHA 4PTTA 1UM5L 3NTCH 4LSQH 5CEYB 3C09C 4Y19B 3BO8B 3W39B 1LD9B 4MXVF 5M95B 3FRPA 1HSBB 5DD1L 1T7VA 1NGZB 1FC2D 4NDMB 4CDGC 4RMVA 3WDHA 2D0FA 3QAZB 3OGCA 1CL7L 3HNTH 5EPMB 5GISL 4EI5A 3W82A 3ULSB 5KVMC 3CLEH 3PDOB 3PWUA 1P53A 3DVGB 4OLEA 4RGOH 4BZ1H 4IRSD 2C4FU 3CFEA 1MVUB 4JO4H 3HG1B 2VDML 3LEYH 4WFHE 4V1DB 1TJIH 1DFBL 2OTWB 3P73A 2E7HA 1C8PA 1Q9LA 5IROA 5HDBF 3G6JE 4IBLT 2R9HD 5BV7B 5I1KH 1MELA 5AZEL 3LIZH 2OQJA 4Y0GA 4Z7WB 4TTGA 5AG9A 1VADB 3HI1A 1J8HE 4H1LH 1A6WL 1QFWI 5F1IB 4D2NA 5L6YL 3C9NB 5ALBH 1FZOB 3WFCL 3MOQA 3H0TB 1NH6A 4KRPC 4KWUA 4KZEH 1LE9A 3LKOA 4M48H 3VA2C 3QG7L 3HNVH 4O2EA 2FIKA 2BK8A 1FFPA 2QKIB 2IPUG 3DUUA 1A9EA 2AV7B 4AENA 4APQB 4M6NL 2DBLL 2R4RH 4M93B 4OF5A 4OJFH 5D70L 1U8HA 3TZVD 5ETUB 4KU1A 1F45A 2OS7A 4FP8H 4NN6B 3VXMD 3MGTA 3TPUA 3T2OA 3MXWH 2AV1A 1K6QL 1M1SA 2MKLC 3FQXA 2O93L 1CXKA 4EUPG 4GRWE 1GGCL 4ERSL 4WEBH 1L9MA 4K7PX 4PJAA 5C0FA 1N5AA 3W0WA 4R26L 5EU6B 5JW4Q 4AMKL 4M7JH 4KQ4L 4ELME 2OR7A 1N64L 5T33L 3IJYB 4MXWL 1QFUH 3G5VB 2P7TA 3VXUA 4P5MA 4OSUH 4FQXA 3JV6B 3T0EA 3VGBA 5DD5H 2QQKL 5C0CB 2MHAB 3DV4B 4P5TD 3HAEH 4WUUA 1UM6H 4OLXH 2X4SA 2OP4L 4Y4HD 1ZLVK 4Q6IA 3T0AA 1VFBB 3QCTH 4YDIL 4OQ1A 2H6PA 3E0GA 5EULV 1X5HA 2V5TA 3CFIC 3EKCA 4A6YB 1QG3A 1G7LB 3OXSA 4IRJA 5E95B 4MXQD 2FGZA 4YQXL 5HHVL 2W1NA 3ARYA 4Z78A 3F7QA 2C3XA 6CGTA 3H3BC 1X5ZA 1CI5A 4L3AA 3FMGL 4HH9A 3O81A 3CVHL 4G6JL 5TGBB 3AREB 3QQ3A 5GZND 1KGCE 1OPGH 3ZHDA 3D5OF 3IJSA 1OAQH 1VPOL 3OWEA 3IDIA 4FQ2L 2L4OA 4OGAC 4X6CE 4YAQA 5I17A 5IFJB 1WICA 1KCLA 3QUYD 1KCSL 4WWID 5TDNB 5D6CA 4WO4D 1CLZL 5DD0L 3HHRB 2FO4A 5F7HA 3NZ8A 3ARRA 4J1UA 3RQ3A 1T5XA 2KZ1B 1LO4H 3U48A 1CZ8L 1DBAL 1I3VA 1OCWL 1QVOA 1ZT7B 1MLCB 3NTCL 3BISA 3MLRH 1FPTH 2NY7H 4LSQL 4RMWA 4JRYB 2CQVA 5JIHA 3QIUC 4IHOB 1WBXB 4XPBH 2QADC 5JHDE 3W0WE 2I9LA 3DV6A 3QJFB 3ZYJA 1BZ9A 1TLKA 3HNTL 5HYEA 4WI4A 1S7XA 2EH8H 3ARBC 4HUKB 4QXGH 3PABB 5HY9A 3IFLL 4OM0H 4HUVB 5ISZA 4RGOL 4BZ1L 3ULVF 1BFTA 4NQVB 1V5JA 3U83A 1B0GA 1EUUA 3GJFA 4JO4L 1BBJB 3LEYL 2YXMA 4DN4H 2DQEL 1TJIL 2Y1VA 3BEVB 4ZS7H 1NBZA 4LSUH 4N5UA 1B6UA 5I1KL 1I3UA 3LIZL 3OXRA 5L7XH 4NZDA 5C0NC 3X14B 4NN7B 4LOUD 3DETC 2HWZH 4LRNH 2CD0A 2G5RA 3KLSA 4OI9A 1BZQK 5FF6A 5DHYA 4HLZH 4GOSA 2EXYD 2BVPA 5C0IB 3PWLA 4ODXB 4AJ0A 1U8OB 4GBXB 2VLMD 5DSCB 1B90A 4M48L 3HNVL 1EHXA 3CUPB 3KNBA 1LP9B 5CIPH 1WBYA 5KANI 2F54B 4PLJC 4BZ2H 1YPZF 4PJ7F 3KLAB 4JFYB 5MEPA 5F3BB 3UTQA 2R4RL 3GKZA 5FFLA 4LLQA 4NO3A 3QCUH 5I2IA 3C6LC 4CW1B 4FP8L 5L9DH 4BQ9A 5C8JB 4CRPA 3MXWL 3R0NA 1LQSR 5FGBA 4HT1H 2XTLA 1WWBX 4QCIB 1D5BB 3GHBH 1AI1H 1JWUB 1OAZH 1T1ZB 5FUCC 4Q9RH 2COQA 4WEBL 2WUCH 3F7PC 5GGVY 3B9KC 4F8QA 5J6GA 5IVZA 4U6HB 3WS3A 1EIBA 2IH1B 4M7JL 5CP7B 1FGNH 3WUWB 3PUCA 3I2CH 3V7AG 4AH2A 1QFUL 4YFLF 1J05A 5IJKA 3EOYG 1VSCA 3LDBC 2XWBB 5DD5L 1YMMD 2YSSA 1AC0A 5IMMA 3ET9F 4YPJA 1HIMH 2OXGA 1UM6L 4OLXL 4R7NA 2M8XA 4ZAKA 3EOAB 5JPMB 1BJ1J 1AGBB 3KYNB 2FHBA 4B0MM 3RIAF 3QCTL 5EBLB 1R3LB 2YK1H 2R2CA 4PRHE 4BFIB 5F6IB 1FHGA 2HLAB 5KVDH 4L8DB 5F7MC 5LGJB 1K2DB 2UY7A 3LCYA 3HE6A 3HRPA 2X7LB 4E41A 1F3DJ 3BW9A 5FYLD 1IZJA 3I6GB 1KSRA 4KV5F 4LVNB 1M7DB 1OPGL 1BX2B 2IQ9L 2VLJE 4HWBA 4ZYKA 3L3HA 4P5KB 1OAQL 2CUHA 5SWQA 2XOTA 4U0RB 2Q1EA 3QIBD 2O26U 1KJ3H 4LCWE 1D5ZB 4OZIA 4GG6B 4OLVH 5CJBA 2ERJC 1LO4L 5C07E 2I26N 4QYOA 5TQ0H 3SDDC 3L6FB 4ETQB 2IGFH 5DUMH 5TQ2L 3NFPB 2CUMA 3KHQA 4ODUA 1ZA6B 3MLRL 1FPTL 3BH8A 3AM8A 5CJ8A 3GJEA 2NY7L 1IC4H 5JQ6L 1NEUA 2G60L 3KPQA 3NCJH 1YYLH 1QD0A 3GMPA 4X5XA 5EBWB 2XNAA 1MHEB 5KZCD 4N9GA 2D03H 4LSTH 5EIQA 5KSBF 4JB9H 5ELIA 3IT8D 4HWUA 3WFBH 3ZZ1A 3CX5J 1RZGA 3GSUB 3IJHA 2JIXD 4HJ0D 1QPXA 1IVLA 2BNRD 2XN9B 4PRID 3DJ9A 5JA8B 2EH8L 1N6QH 3QEQB 4OM0L 5CEYA 4Y19A 5D7IF 2N7BA 3BO8A 1PG7W 1LD9A 2FYYB 1D6EA 1HSBA 2NY6C 1NGZA 4NDMA 4FN0A 1NFDB 4DN4L 1EV2E 3QUZD 3TIEB 4ZS7L 5EPMA 3VWJC 1EVUA 5FA3B 1RZ8B 4LSUL 2OR9H 3SGDI 3U7YL 3OG6B 1QRKA 4H20L 3AXLB 1MUJA 2HWZL 3FB7B 4LRNL 2X1QA 5EUOF 3HB3C 5CEXB 4GMTH 3IS0X 4OT1H 4V1DA 2OTWA 5FOJA 4OZFA 3TFKD 1X5AA 4LMQE 1OSZB 4OFYD 3QRFM 4Z7WA 3L5JA 1Z3GL 5E5UB 4IRZH 1F6AA 1VADA 3BKYH 4FS0A 4KUZH 5F1IA 1RV6X 4TVPE 4BZ2L 4Y5XB 5HVWA 2E27H 1KCVH 2OZ4H 3B2VL 1ZLVH 2ATKB 4ZPVB 1V7NH 3QCUL 4FQPA 1KUMA 4OZIE 2PYEE 4RBPK 2HN7B 1ORQA 2I25N 2DBJA 4MA1C 4U6VH 4HT1L 2AV7A 4BH8B 3Q5OA 3GHBL 4WEMB 5LXGL 1Q9WB 5DFTA 1QRND 1U8PB 5DF0A 3WN5B 4Q9RL 5DGQA 2HLFC 2WUCL 1E6JH 3T2NH 3QIWA 1WT5C 3LB6C 4UV7H 5IVXB 5EU7C 4KY1L 5JIPA 5ETUA 3G6DH 1U42A 2H2PD 2YN3A 1FGNL 4PB9H 5IJVA 1YEGH 3I2CL 4HXAH 3N1MC 4QOKD 1EGJL 3ARSA 3WFEH 3ARVA 3SDAD 2NX5B 5B3NA 2VLRB 4IIQC 5D1XD 1HIML 5EU6A 1B2WH 1RFDH 2Z92B 4LPVA 4RIRB 3QXWA 3IJYA 1EO8H 1LDPH 1G7IB 3G5VA 5FM8A 3CVHB 3MQIA 2YK1L 2D7PA 3OB8A 3LH2H 5CEZD 5DD3H 3EOBA 5C0CA 3C09B 1R5VB 1DQMH 3BN9C 5KVDL 1UFUA 2ZOKB 3IETB 3VWKC 3T1WA 1P9MC 1S7UB 3O41B 4L29A 3O8XC 4RA0C 5ID0A 1FORH 5FKAB 2JELH 4ENED 3BKMH 1VFBA 3HG1E 1GC1H 5D1QB 3D3VE 1REIA 4OGYH 4PJBE 5IQ7H 1ZXQA 2YPVH 3TT1H 4A6YA 1KJVB 5J6HB 4QTIH 2EYTA 4JGJA 2SEBB 3LQAC 5IBLC 4AQOA 2BOBB 4M4PA 1TIUA 1FV1B 4C4KO 4LFHG 5TE6H 1KJ3L 4M7KH 2MWCA 3DUHA 5TGBA 5EZIL 3BP6A 4YFEA 3AREA 4GRMB 1SY6H 4PD4K 5INCB 4R9HA 1ONQB 4OLVL 4U1MB 4FQJL 3CFBB 2IADB 1MAKA 3O6KL 1KYOK 2ICWB 5TQ0L 1GC1C 5MI0C 5IFJA 4PRNB 1G1CA 2IGFL 2V17H 5DUML 5TDNA 3T3MF 1G0XA 1OVZA 4KRPB 4JLRA 4IM8A 1IC4L 5B39G 3RWJB 3NZHH 4NC2B 4N5ED 3NCJL 1YYLL 4EXKA 2C3HA 4EDXB 4NQXB 1B4JH 3RX7A 2D03L 2R56L 4I9WE 3TYFB 4JB9L 3WFBL 4WHTB 1Q0YH 4JGUA 3CZJA 1ZT7A 3X3GH 4XCYA 4LMQI 3AS1A 1N6QL 4OI7A 3FRPG 4JRYA 4IHOA 4PG9B 3P9MB 5F1OB 3PP3K 4JRXA 2HFFB 1KIPA 1K4DB 2A83B 3QJFA 4JPVH 2Q3AA 4GXVH 2KDGA 4LLMB 1NDGB 1OAXH 5DURB 4PJGF 2OR9L 3PABA 3QEUB 3ARDB 2PN5A 1U2CA 3K0WA 4PJIF 4RISH 5C0CE 1QFPA 4OZHF 1ZGLM 1IGTA 4OT1L 3BEVA 3RHWK 5K93A 2QQNH 3O4OC 4V2CB 5IT2L 1EAJA 4IRZL 3BKYL 4ODWB 4LPYA 4G8GB 4CUCA 1U3JA 5C0IA 2E27L 2E6QA 2OZ4L 5HHMB 3PGFH 1BFVH 2ZOLB 5DSCA 3CUPA 4X7SH 1EZVY 1V7NL 4L4VD 2EEBA 5J1AB 2H26B 3BHBB 1CGVA 3MNVB 2C1PB 4RMUA 2F54A 2X9XA 5IR1A 1JRHH 4KTYA 3OHXB 1YC7A 2DWEB 4FA8A 5IBUB 3KLAA 1C16B 3BPOC 4QRUB 1E6JL 3PQYD 3ZTNH 1AO7A 4UV7L 4NRXB 4ODHL 1EBPA 3G6DL 3UAJD 1T21B 5F44A 3R8QA 4PB9L 2AEPH 1YEGL 2YS4A 4HXAL 4JKKA 4QCIA 3FRUB 3WFEL 1CGXA 3DHMA 4G6FB 3HMXA 1T1ZA 2IALB 4CVWA 1YNTB 3TEUA 5KJRH 5LAXB 1AGFA 5GRUL 4MB4A 4NZUH 5ICXA 2X40A 2O61B 1CD8A 4U6HA 5BRZA 4HCRL 1RFDL 5CP7A 2IH1A 2VWEE 3DO3A 3IRZA 5C9KA 3WUWA 1LNUB 2GJ6D 1EO8L 1LDPL 2NY3C 1TJHH 1ZK9A 2Z4QB 2IFGA 3OKMA 2RIKA 1A4JB 5J11C 3LH2L 4TOYH 2XWBA 3TO4C 5DD3L 4NZJA 1A64A 1CN4A 1DQML 4N8PA 2CH8A 4RGND 2A9NH 3EOAA 5JPMA 1FDLH 1KTKE 2AK4B 4Z6AT 1AGBA 1FORL 5EZOL 2JELL 4C56B 3BKML 2NNAB 1JNNH 1R3LA 5EBLA 3KLHD 2NY2C 5DK0B 2WLYA 5DXWA 4OGYL 3O9WD 2HG5B 4BFIA 5IQ7L 3ARBB 4KGLA 2YPVL 1ZHBB 3DVIA 3TT1L 2HLAA 5HI3D 4L8DA 1J5OH 5LGJA 2D0GA 5AD0B 1GOFA 4QTIL 4NUJB 4JFFB 5KVFH 3ARTA 3U36B 2X7LA 4R4BB 5KOVC 5LCVL 4QRQA 2EYSA 4GAJH 4M7KL 3I6GA 1SY6L 4GRLA 1M7DA 5DD6A 3UX9B 1BX2A 3MRIB 3T1FB 1UG9A 1LP9E 4I3GA 4YDKH 1WCQA 3B43A 4P5KA 5D5MF 1AP2A 1AGEA 5DEFB 2V17L 2YPKB 1IGYB 1AE6H 1JF6A 5T3XE 2XFXB 3PGDB 1D5ZA 3NZHL 3FKUS 3EYFA 4GG6A 1KN2H 3O4LB 2DWDB 3M8OH 1B4JL 4XAWH 3P30H 4KVCH 4MHHI 4A2LA 4CU7A 2VL4A 3L6FA 4GAYA 4L8CB 3QDJD 1GRWA 4XVSH 1Q0YL 1X5XA 3NFPA 3X3GL 5B3JF 1ZA6A 1XIWC 3DX8B 2ID5A 3HZYB 2OJEB 2L7JA 3C6LB 5EBWA 1MHEA 3T3PE 1MAJA 1WIUA 3VGFA 1OGTB 4H88H 4JPVL 4S0TD 4MAUH 5ACZB 4XVUD 3GSUA 4ZUUB 3V6OC 4RBPH 2XN9A 4PBVC 1OAXL 1PEWA 4FQIL 3QEQA 1IC7H 4QWWC 5CIPB 4LLVB 3B9KB 2NYYD 4LGSB 1I8MA 4RISL 1F3RB 3V5KA 3RKPA 2FYYA 3T4AB 3ZE2E 4M7LH 4PJXF 4MA3B 4HIJB 2QQNL 2WBKA 5FA3A 1H15A 1RZ8A 5CZKA 1TVBB 3ESVF 3D87B 2H32H 1BLNB 4PJ8A 4DGYH 5A1AA 3B9DA 2P45B 3AXLA 1HHHB 4UTBL 4L4TD 5CEXA 1X5YA 3RGHA 1F00I 2GCYA 3QFJE 4C4KT 3NIGF 3H7BB 3PGFL 1BFVL 1JMXA 1BVKB 1UKTA 4TPRH 3EO0B 3GMLB 1DQJA 3NH7H 4FFWC 4X7SL 1FZKB 4NNPH 3T8XA 3P4OB 5F7UA 3RU8H 3RL2B 4M1CD 2MQ3A 1S7TB 5IB1B 4YDVB 1JRHL 3RVXD 5JTWA 1D9KD 5D7JC 4XT1C 5L8KB 2BVEA 2DLTA 1I7ZA 3SJVE 1UJTA 5JXEA 1F11B 4Y5XA 2VKXA 1OLLA 1E4WH 2AQ1A 3D0LB 2ATKA 4ZPVA 3ZTNL 3WJLC 4GG6E 2HN7A 2EO9A 4J3SA 5C6PB 4UOW0 1S8DB 1T1WB 2AEPL 2QJDA 4PJAF 2ZSWB 5JXAH 1RZKC 3RGVC 2BY2A 1F4XH 4BH8A 3LZFH 4P3CH 3WN5A 1TNMA 1U8PA 2AS5M 1ZSDB 2HKFH 5KJRL 1YEJH 1T4KB 4H0IA 2ARWA 5IVXA 2GKIA 3SY0B 4U7KA 2ERJB 3TVMD 1FFQA 5CBAB 2ENYA 4Y1AA 3CPLA 2C3GA 1EFXA 2EDYA 3SDDB 3DMMD 4YE4H 1RZJH 1TJHL 4FG6C 1ZT1B 4LQ1A 1MJ8H 4RZCA 3NVQA 2NX5A 1DANT 4TOYL 5I1CH 1JJUA 2VLRA 3WV0A 3SBWC 4PJ9C 4LBEB 3H3PL 1GOHA 2Z92A 3JSSA 2A9NL 3NCEB 2XTJD 1R3KB 4RIRA 2NZIA 1FDLL 1G7IA 1NFIA 4LEXH 1FCCA 1NFDE 3GMNB 3VFSB 1OSPH 3CVHA 3LS5H 1C5DB 1S78C 3V6BR 5F1KC 3DOSA 4HIHB 3KPNB 3QWRA 1BIIB 4EBQH 5HHOD 5A2LH 2EKSB 1R5VA 5BJTB 4DQOH 3EJYD 4ETYA 1WC7B 1J5OL 3SKNB 1SBSL 3H7LA 5JOPD 1YY8B 1SJVA 2NY6B 2ZOKA 3IETA 5KVFL 1S7UA 3QUXA 1NMCC 5FKAA 5E2JA 5D1QA 3VWJB 3PP3H 3DARA 5HGAA 3JWNC 5IESH 1UCTA 4GAJL 3EDJA 3QHZH 5J6HA 1A1MA 1KJVA 4Q7DA 5GGQH 1JTOA 1JHLH 4LDLB 4NRZB 2SEBA 4YDKL 2XZQH 4LKXB 3WBDA 5E4EC 5EWIH 4WFEE 1FV1A 3IDUA 1AE6L 2PTUA 2P43B 4OLWH 4MJ5B 4XWGL 4GRMA 1KN2L 5INCA 5GRXG 1ONQA 2CJUH 3PV6B 4XPAH 2IADA 3M8OL 4XAWL 2VMFA 4NQEE 3P30L 4KVCL 2J8UB 1FRGH 5HYJD 5DDHB 1KELH 2ZG3A 4PRNA 3C8HA 4XVSL 4GUPB 4LVEA 3UTTA 2VJXA 4KRNA 3RWJA 2X4OA 2IAMC 4MA7H 1Q72H 2RBLA 1MFDH 4EDXA 1EHNA 4NQXA 5IVXE 2DKSA 3VFNB 3TYFA 5KSAB 3VXSB 4H88L 4MA1B 4JFPB 4MAUL 4AYFA 4WHTA 3QDGA 3TCLB 1U8MA 5F89B 1IILE 3I85A 1GCFA 1IC7L 4XHJC 4LGRB 4PG9A 3P9MA 3BZEB 4H1LA 2HFFA 3CX5K 1K4DA 2A83A 3TT3H 2IH3A 3EDDA 4XCEB 4M7LL 1FVDB 4YH6A 4LLMA 4YXKH 1NDGA 3S35H 4X83A 5DFVD 1XGUB 4G9FD 1UB6B 4X0KA 5HGDA 3ZT7A 2X4RB 3RIAK 3QEUA 4DGYL 3ARDA 4LHUB 1SYSB 1S9XB 3MV9D 4ZUWB 1ZHNA 4IIQB 3VJ6B 5TF1H 4QY8A 2ZUQC 4FZEH 2AKRA 1GXEA 1MY5A 3VG0H 3TF7C 2VUYA 1A7NH 2FJHB 3ZHKA 5KN5A 4M02A 4G8EA 4TPRL 3L3IB 3UMTA 4YGVB 3NH7L 2A6JB 4U33A 3PHQB 4V2BA 4HG4K 2P42B 4NNPL 5DZLA 2DLGA 4MAYD 3VWKB 4ODWA 3O8XB 1EBAA 2P24B 3IFOB 5SV3A 3VFOB 4NZTH 1CFQB 4KRMB 1IAMA 2ZOLA 4X7CC 5D96C 1E4WL 4M9PA 2BDNH 3FB8B 1HEZA 2W9EH 5J1AA 4KXZI 3UYPA 3MNVA 1Y6MR 2VDKH 2GI7A 1XR9B 3FHQA 1G9NH 5JXAL 3OHXA 2DWEA 4I4WB 1LO3H 2P5WB 3CH8A 4LF3B 1F4XL 4F7CB 1WBZB 3LZFL 4P3CL 2HKFL 1QSFD 2JJTC 1YEJL 4PBWD 4QRUA 5I1EH 3HAEA 5HDQH 1DN0A 1JVKA 5IWLC 3B5HA 3H8NA 3U46A 2Z8WC 3QCVH 1T21A 4R97C 1QNZL 3C6SB 1QSVA 5MI0B 4J3OC 1NGQH 4OGZA 1RZJL 4YE4L 3IF1B 3MACH 3FRUA 2RHEA 1MJ8L 3DXAD 1KBGH 2IALA 1YNTA 4KKCC 5LAXA 1BREA 5I1CL 4G3YL 3O2VH 1G9NC 2Z8RA 2BNUB 3MRPB 5IK3B 3MJGX 1LNUA 1EK3A 1BVZA 3LSOB 1OSPL 1A4JA 3LS5L 2BMKB 1N6UA 1JYWA 5EZJA 2BNQD 1P1ZB 1KEML 2ICCA 1NKRA 4EBQL 5J9PB 4DQOL 3QJHB 2BVQB 2AK4A 3V4UH 5FDYA 4IMLB 3DYOA 1MCPH 4C56A 3ME0A 4U31A 3TBVB 2NNAA 4WO4C 1U6AL 3KPMA 5IESL 4HEPG 2HG5A 4BK5A 1TCRB 1T89C 1ZHBA 3QHZL 2WBJD 5GGQL 1JHLL 3F7VB 2OI9C 4GXUM 4IMKA 4YIQB 4NUJA 2XZQL 3U36A 5EWIL 1IGJB 4QXWA 3MRMB 3RZWA 5D4QA 4R4BA 4HZLB 4G8GE 4EKXA 3O4OB 5L0QC 4OLWL 2EECA 3ZDYF 2CJUL 1QSED 4HX1B 3MRIA 3T1FA 3IU3A 4PS4L 2XWJA 5E24E 4H5SB 3ORJA 1F13A 1KELL 4W6XB 5DEFA 5E1AA 2YPKA 5J57B 2XFXA 3X11B 5HBBA 1X5FA 3SKJH 1XT5A 3SDXB 4IOSD 4MA7L 1Q72L 3O4LA 1MFDL 2W0KA 1O7SA 2GITB 2DWDA 2OLDA 2EH7L 4HDIB 1KCKA 1A2YB 3SO5A 4L8CA 4KK9D 1HWGB 1OP3H 3LS4H 1EPFA 4NJAH 2Y5EA 3WXVH 3BPOB 3GZKA 4MJIB 2VDQH 3DX8A 5D1ZC 1NLDH 3HZYA 2OJEA 4LAQH 3VXRA 4JFZL 1L4IA 3DBXA 4MQSB 3HE7D 3WS6C 4W81A 3GB7B 1OGTA 2BJMH 1R24A 3BQUC 4YEFA 3CU7A 3TT3L 3WMSA 4HJGB 1RUAH 4ZUUA 1ZAGA 4YXKL 3S35L 3MCKB 5CIPA 4LLVA 3B9KA 3K4ZA 4B7IA 3HC4H 3LPGA 2BHYA 5I1JH 5TF1L 4JZNB 5D2LB 3T4AA 4POZD 4FZEL 2ICWI 5I8EB 1GHFH 1S7VB 2NY3B 1C7TA 4WW1B 1A7NL 4MA3A 3UJTH 4NQSB 3UBXB 2FO1A 3OKEB 5J11B 2JJVA 3AU1A 5GJTH 3ZKSD 1TVBA 2ZUVA 1T3FB 3TO4B 5ADOH 2PTTB 4PJ5A 4XPFH 1BLNA 1XZ0B 4XX1E 1GAFH 2XWTB 2UYLA 4PLKC 4XB7A 2VAAB 3O6FA 1X44A 3X12B 1Q0XH 3UZQA 4JE4B 1G1YA 2HJKB 1P4LB 1JHKH 4JFFE 3HC3H 4NZTL 1HINH 4WI7A 2NY2B 3H7BA 5D71H 3BYTA 3GMLA 2BDNL 1FZKA 3P4OA 4WHYH 3QI9C 2BRQA 4OFKA 4U7SA 5T1DH 2VDKL 1S7TA 3FFDB 4HUXB 5IB1A 4YDVA 1G9NL 2R8SH 1NBQA 1LO3L 1F11A 4D9QD 1BJ1H 1TQCC 3EHBC 3OAUH 4FZ8H 4Y4FB 5I1EL 3D0LA 1XGYH 5FYLH 3A6BH 5HDQL 1YN7B 2AJXL 1PG7X 3G6AB 4UIKL 4PRPD 1HYRC 3QCVL 4HUNB 1T1WA 4MQXD 3IKCB 3DX9A 1NGQL 3MACL 4WWKD 4MCZB 2W60A 3ULVC 2IEPA 1ZSDA 2XV6B 1NDMB 4P59H 3CMGA 2NLJA 3WUWG 4PY7A 3O2VL 3PIQB 2FRGP 3I9GL 4U1NB 2UZIH 3DECA 4N0UB 3SDDA 1G7MB 2HRLA 1J87A 3TGXA 2FH8A 1ZT1A 4J6RH 4QHUB 3S37X 4P4KA 2PW2B 1KPUB 3PL6D 5FO7B 4Y2DC 1S9YB 2DQHH 1RJLB 3MRRA 3CFKB 5FCUH 5FUCE 1XIWB 2GYSA 5T1KD 5FDWB 3QHTC 3ETBF 1R3JB 5GPRA 4LBEA 4HKXB 4JVPA 1LEGB 4ESKA 3QXUA 4KK8D 1R3KA 1D5IH 2NW3B 4JM2D 3V4UL 1KOAA 1LE5B 1MCPL 3VFSA 3GMNA 2APXA 1MFEH 1JWMB 1C5DA 4LSSH 5CGYD 1HH6B 3MLVH 4HIHA 3KPNA 1BIIA 2LAAA 1AGCB 2EKSA 5BJTA 2RAMA 5SX4H 4PJEF 3SKNA 2J8HA 3OX8A 4RFEB 1YY8A 4QKXB 4J4PC 3ZDXF 5SWZA 4HWEH 4IOIB 1FSKC 2PNDA 3GSWA 1AIFB 3VWJA 1ZLSH 5HSFA 2UZXB 4JJHA 2Q7NA 1DZBA 3WJJA 3MUGA 1PGRB 4U3CA 4NRZA 1U3HC 1ZA3A 2OL3H 1KEGH 1T2QH 1JCKA 1P2CA 5GGRA 3T65B 1CFBA 3SKJL 5IBTL 4Z7VA 3HA0A 2W38A 3PV6A 4MNQA 4FTVB 3Q6GH 4OF0A 2J8UA 4D0BB 5DDHA 3D25B 5D7JB 1TZGH 4YX2L 5KS9F 3LS4L 1QYGH 4NJAL 1UJ3C 2H32B 3WXVL 5LVEA 4TRPL 2WK2A 3LKSB 4AG4H 1A6UH 1NLDL 4LAQL 1KJMB 4KKLD 1PY4A 1ZE3C 5KSAA 3K1KC 2BJML 4KFZC 3D85D 1T1YB 4JFPA 3I84A 4MJ6B 1RUAL 3RGVB 3NACH 3TCLA 2FECL 3MFFB 4TNWF 3BJ91 1YMHB 4QF1B 4OFPA 5I30H 2G75B 5GRJH 4GW1B 2R1WB 3PWPB 5DRNB 5HYQA 3HC4L 3BZEA 4X7FC 5I1JL 3ZKMD 5A2IH 2VO5A 4P2QB 4XCEA 4P46A 1W2KT 2OZ4A 1U9KA 3UJTL 2J88H 4L5FH 1XGUA 2H2SC 4HMDA 3V52H 5GJTL 1UB6A 5SWSD 5ADOL 3MBXH 3LN4B 4XPFL 5F9OH 3NIFE 1GAFL 4LHUA 1SYSA 4OLYL 4ZUWA 4PJ9B 2D7QA 4IIQA 3GSRB 3UEZA 4U1SB 3S37H 1Q0XL 4MMZC 4YLQT 4K23H 1JHKL 5DQJB 3HC3L 1HINL 2FJHA 1YJDL 2AQ2A 2EDHA 4M5ZH 3L3IA 1H3VA 3MRDA 2A6JA 3RTQC 2PXYD 2NXYC 1GZPB 4LLUA 5T1LB 4OB5H 2J6EH 3JWDH 3S9DB 5JDSA 4LRIA 3VWKA 2PCPB 3OKKB 1P9MA 3TLRA 3O8XA 1H9VA 1NMCB 3HPLB 4OQTH 3RUGF 2P24A 2R8SL 3IFOA 3VFOA 3V2AR 4LSPH 1CFQA 3MRKA 4I0PA 3IFPB 3RJQB 1CICD 3OAUL 4FZ8L 3C5JB 1XGYL 5FYLL 3FB8A 4HCRA 1FNHA 3A6BL 2VXVH 4S10A 1HH9A 4KKBD 4KH2A 1LO2H 5EO1B 1XGPB 4P3DB 2DYPD 3EJJX 3BZFA 3T0BA 1XR9A 5DRWB 1NEZA 2D7OA 1Q1JH 1JUFB 5E4EB 2J8UE 2P5WA 5JW5B 3C08H 4LF3A 3MBEA 2J8OA 1WBZA 1OB1A 4ORZC 1BQLH 5DQDH 3NIDE 4WIQA 4P59L 4MVBD 1EXUB 3JWDC 5C70A 2ORBH 3C60C 3BWUC 3C6SA 2A0LC 2UZIL 4GLRH 4MQ7B 1HI6B 1XCTB 3JTSB 4ZO7A 3VXSE 3IF1A 4J6RL 4P2RD 5EOCJ 3O3AB 3AUVA 5FCUL 4K7FB 4ODVH 3G04A 5E56A 5DWUH 3MRPA 5IK3A 4QT5B 3MLZH 1D5IL 2LAGB 4CBPA 3U30B 3WFZA 3LSOA 1GZQB 1MFEL 5ICYB 4JQIH 3V0AC 1SY6A 4LSSL 4UT9H 4ZFGH 3MLVL 1P1ZA 1UENA 4HK3J 4YHPA 3RDTA 1K85A 3QQ4B 4KK6D 5DO2C 3BZ4B 2BVQA 4WENB 1DQTA 2OTUB 5CMAB 4IMLA 1VERA 2V7HB 3TBVA 5FV2A 3MZTA 1ZLSL 2ZP0T 3EAKA 4I2XB 4O4YH 4XZUB 3T08A 1TENA 3BGAA 1U93B 3F7VA 3FOLB 4YIQA 5GHWH 2ZUQB 5I18H 4EVNB 1A22B 3MRMA 2E9JA 2YD6A 2FD6H 1T2QL 2VDRH 4Y2OA 3D0VB 1Z9LA 3VXPB 4PJCB 3GDBA 4JPWH 1K9TA 1KB5H 4CU6A 5BCAA 4KI5F 1R6VA 4HX1A 2E8ZA 3PQYE 1I3RA 3Q6GL 4MB3A 4H5SA 4KROD 1LVEA 1TZGL 4DUXA 1QYGL 2P5WE 2VKWA 5D96B 4HV8B 4AG4L 1A6UL 1O7VA 3MUY1 3RVWD 4RDQG 1MWAH 2GITA 1JZ8A 4HDIA 3N1FC 1MCJA 2P5EB 3STZB 4PLNC 1EERB 1VEOA 2CR3A 1Y6NR 5I75C 3HZVB 1DQQB 3GIVA 1QEWA 5I30L 3M45A 4P5TB 5GRJL 5BO1L 4M8QB 1QACA 2ZJSH 4IDLA 1TZHA 1P7QB 3GB7A 4R97B 1I9EA 2A73B 4K3JH 1FNSH 1K3IA 4HJGA 1ADQH 2J88L 4L5FL 4WNQB 3V52L 1YEKH 3MBXL 3MCKA 5F9OL 2AP2A 1JPGA 2ADIB 4XGZB 4JKWA 1F8TH 5EU5B 4JZNA 3I3EA 2H9GB 3S37L 5SV4A 5I8EA 1S7VA 2PYFB 5EUKA 4K23L 4NBZB 1CR9H 3NCYP 4M5ZL 3QG6A 4NFDA 1T3FA 2PTTA 5DJXA 5GS0C 4R90H 3K2MC 2XWTA 3WIHH 2VAAA 5DMKB 3STLA 4OB5L 3JWDL 3TNMB 4UDTB 4OQTL 2HJKA 1BF2A 1HYSC 4WO4B 1CTNA 4LSPL 2Q7YB 3IXAB 4GMSH 3PWNB 4KJYB 4M1DH 2VXVL 1DLHB 1LO2L 4O02H 1FNFA 4DGVH 3FT3A 2OI9B 2EEDA 2DQTH 3BYYA 5IBUG 1KV3A 5BMFH 3MRGB 1Q1JL 5F9WC 4XXDB 3C08L 1EVTC 5BS0D 3ZYIA 3V8CA 2JB6B 1KN4H 3ULUE 1BQLL 5DQDL 4Y4FA 1KXQE 4KI5D 1E4XH 2DTMH 4N90E 1YN7A 5FGCB 2ORBL 3G6AA 5BZWB 3SDXE 1G0DA 2ICES 3E3QC 3IKCA 4YO0B 2PO6D 5GS1C 1INQB 5TFSH 1QZ1A 2Z91B 4MCZA 2YN5A 3IB4A 3O9WC 5BVPH 4ZOEA 1NDMA 5HI3C 4H25B 4MJIE 3PIQA 3VDAA 1JGVH 2FSEB 5C0BE 2GJJA 4U1NA 5FEBA 1HOCB 4KJQC 1BIHA 1UWEH 1JHTA 3O11A 1F2QA 1G7MA 2XACC 1K4CA 4QHUA 5CP3H 2PW2A 1IAIH 1KPUA 5MENB 5FO7A 1S9YA 2R0LL 2APWA 1RJLA 3CFKA 4ZFGL 1XIWA 5D1ZB 12E8H 3MNZB 1R3JA 5IB3B 1FGVH 1WAAA 4HKXA 2FBOJ 1LEGA 1CQYA 1A7RH 2ARJQ 2C9AA 5D2LE 1OGAE 1LE5A 2FR4B 1VDGA 4XX1G 3FFCA 1A7PH 4H26B 3V6OA 3I3DA 2HT4D 3UTPD 4O4YL 2V9TA 3U4EB 3TH3T 4KMLB 1HH6A 4PJDF 4NO0D 4AM0A 4XPTH 5HDLA 4RFEA 4MA8L 5K9JH 5GHWL 1AQKH 3REWA 3FCTB 4IOIA 2FD6L 2VDRL 2AJ3B 5F9AC 4O2CB 1T03H 2UUDH 1BD2D 1BQSA 3G08B 3TBTB 3HRZB 1BVLB 2OX5A 4JPWL 3VFUB 1KB5L 4QRPD 5LGHH 1OQOA 2DLFH 1UVQB 2HVJB 4X7TB 2QQLH 1WWCA 3VH8B 4FXGB 4N0CD 4UILH 1J0JA 1NGXA 1PJ9A 3D39B 3BRGC 2NY5H 3MRCB 5H2BB 4NIKB 3T65A 3WDIA 2APVA 3AY4C 1MWAL 2Y25A 1CXIA 1XEDA 4D0BA 2AEIT 5D7JA 2FATH 2BSED 3EO9L 2H32A 1JP5A 4QXTA 3NAAH 1N4XH 1YMMB 2F19H 1NC4B 3LKSA 4HLZG 2XYCA 4UQ3B 2ZJSL 2B39A 3O6MH 5JOFA 4X5WA 5C2BH 4FQQB 1TFHA 1T1YA 4K3JL 4WI3A 4HWZB 1FNSL 4N0UE 1ADQL 3IDGB 5I15H 2XTJE 3KPRE 1CD9B 5T1MB 3MFFA 3N1PC 1YEKL 1YMHA 2A6DA 2J12B 1A1OA 2G75A 2BSRB 4GW1A 2R1WA 3PWPA 5DRNA 3UTZB 2XZZA 4Q9QH 4NCC1 1F8TL 3ZE0E 1IGCH 3ZT6A 1MCWM 2V2TB 2X5PA 4P2QA 3E6HB 3VI4F 1CR9L 3F8UB 4Y2DB 3V6OE 1MCDA 3WLWC 3LN4A 1C12B 4R90L 4X98B 2VXTH 3SBWA 5I8CB 3FZUD 4PJ9A 3WIHL 3GSRA 4FMFA 1DVFC 4LCIH 1YNKH 5C0DA 3EYVA 3GGWB 5DQJA 2JE8A 2K3TA 2KUTA 3FOMB 2ESVE 4TSAL 1GGIH 4GMSL 4XXCC 5FYJH 3WNMA 1UH4A 1JPST 2A9MH 4UBDD 1I8IB 4M1DL 3MV8B 3T0WA 2MOVA 2DQTL 5C0AB 1YPZB 5BMFL 2PCPA 3OKKA 3A6CH 3D18A 3MCG1 3QZWB 5FYKE 4I3RH 3L5WB 1FSKB 2YBRB 1MCBA 1H8SA 1KN4L 3IFPA 5TDOB 2Y72A 4RAVA 1E4XL 2DTML 4Z76B 3BGMB 1AD0B 4I5BB 2ZCHH 1XGPA 4P2OD 5F6HI 1MH5B 1I7RB 4HUUB 1U3HB 5DRWA 4FTVE 3MROB 1JUFA 3KXFD 1WTGT 5GGUB 5TFSL 5L2JA 3RWEA 2BNRB 3V6ZB 5JW5A 1WUNT 3KS0J 2AJZB 1W0VB 2YRZA 4ZFOB 4BKLB 1JZ5A 3UBXI 1N59B 2EDLA 1IFHL 4P9HH 5IROC 1UKSA 2ZPKL 1Q9KA 4FXLA 4RMTA 1JGVL 2VZSA 1XCTA 2VL5B 1UWEL 3L9RA 3IU4H 4XTRD 1GYAA 4K94C 1IAIL 1EHLH 4K7FA 5E5MA 2D7NA 2GFBB 1T7ZA 1HE7A 12E8L 1UWGH 1CGTA 1QBBA 4I18B 1FGVL 2RR3A 1CXLA 2OL3B 4WFHD 4QT5A 3A67H 1A7RL 2GSGB 1MPAH 2XG4A 4AK1A 1CF8H 1A7PL 1GZQA 1K5NB 4P2QE 5ICYA 4A2MA 3PGCB 2D4DA 5E2WH 4LK4A 4Z77B 5B38A 3U2SB 4XP9H 3QQ4A 4XPTL 4EN3C 1AXSA 4WFGE 3BZ4A 1HDMB 3QQNA 5EC2B 1MJUH 1AQKL 5LQBH 5DMIL 5CMAA 1QTYT 5GRYA 1FCGA 2V7HA 4XI5C 4NT6B 4I2XA 1T03L 1OT1A 4XZUA 1MCWW 4GS7C 4LFHD 5GS2H 5LGHL 2EDRA 2QHLA 1U93A 5IKCA 5FGRA 2QQLL 1SJHB 4HBCH 5DEZA 3MLTA 4UILL 3QR2A 1SVCP 1TZIA 2NY5L 1F4AA 1OAYH 1QRNB 1SYVB 4PJCA 4YNYA 3MJ8B 4GQ9L 3GKWH 3TZVA 5F7KC 3VXMA 3RTQB 3T0EC 4FQ1H 2NXYB 1ORSB 4YPGA 3UTSB 1D5MB 3D2UB 4N9OB 1E6OH 4JFEE 4QOKB 5IF0B 5FHAH 5I19H 3OJDB 1KCUH 5DFVC 4O5LH 3NAAL 1N4XL 2F19L 4HV8A 3RZCC 4MGXA 5KSBB 3O6ML 1RD6A 4N8VA 3KGRA 4F3FB 2P5EA 3STZA 1AKJB 3RNQB 4XNXH 4EI5D 1QBMH 5I15L 2JJSC 3HZVA 1DQQA 5D7IB 4MDIB 5LWYH 5IVOA 4P5TA 1JYXA 4M8QA 1QOKA 1X4XA 4LU5H 4WTWA 5IWLA 3C60B 3TBSB 3B2UD 1Q38A 1IGCL 5LGKA 2A73A 3VGGA 4F15B 4Q2ZA 5HGGS 2B20A 3SDYH 4HS8H 1R5WA 3JUZA 4JY4B 5JNYB 4NHCH 5FKPB 2VXTL 2ADIA 4XGZA 5ITFB 4Z0XA 1CFVH 5EU5A 1BAFL 4LCIL 1YNKL 2H9GA 4PR5B 4UT7H 2GY5A 4GKSA 4JY6A 2OM5A 4PB0H 5JPNA 3AGVA 3QP3A 5FYJL 5CZXD 2A9ML 4S1DD 1KGCD 2HMID 3GNMH 4WTZA 1I9IH 3SKOA 5DMKA 3RL1A 3FB5A 2KQMA 2W91A 4QRRB 5E8NB 5I74C 2XPGB 3A6CL 4I3RL 3QUYA 4ZUSB 2IPUK 4F37F 2QLVB 2GK2A 5BXFB 2UWEB 4WO4A 4RRPA 2VN7A 2Q7YA 3IXAA 4NHUA 3M07A 3PWNA 1KIUA 1T1XB 3FO9B 1T89A 1YN6B 5EB9A 4NYLB 1HN1A 1A7QH 5HHNB 2QV2A 3MRGA 3RRQA 5I1HH 4NKDB 2YUXA 3GM0A 5EA0H 2MQ0A 3FONA 3VMNA 3HS0B 1FYTB 1V3JA 4P9HL 1P69B 4HGMA 4Q74A 5BZWA 5JHDD 3GSVB 3W0WD 2FGWH 2VXSH 2YEZA 3X13A 3H42L 1QLFB 3QA3B 2RJMA 4KGJA 1INQA 2HT2C 3IU4L 4WU7B 2P5EE 2Z91A 4L3CB 2MSPA 1EHLL 1KTDB 3TJHD 4FFVD 4FQXD 1VGKA 3RWIB 1OQXA 3MV7B 4H25A 1UWGL 4MXVE 3FO2B 3P9LB 4XBEH 2FSEA 3TA3D 1HOCA 3A67L 3FO0H 1MPAL 4Z7OF 4MLIA 1CF8L 3LKPB 4KZDH 5I75B 4MS8D 2VLKB 3CDCA 1KB5B 1MF2H 5E2WL 2HTKC 5D1ZA 3P0VH 3MNZA 2XIDA 4XP9L 1RHHB 5IB3A 4IRJD 4JDVB 3VFWB 3VRJB 2YA0A 3WS6A 3RVTC 3S7GA 2GSIB 1MJUL 5LQBL 5I6XC 2FR4A 3MTRA 5CFHA 4H26A 5IUSA 5HDBE 5F7EL 3VFMB 1KPVB 3UPRB 1MWAB 7CGTA 1Q9OB 4Q9CA 4X7DC 2W0FB 3SKMB 3FN9A 1UC6A 3LAFA 1HKLH 4HBCL 4ZXBD 3FCTA 4Z7VF 4G43A 2AJ3A 2AQ3A 4L9LA 1OAYL 4EI6B 5CJXA 1E4KA 5JHLH 4YHIB 4LSRL 5IJKC 3TBTA 2NY4C 3HRZA 3GKWL 3VFUA 1KLGB 3HE7C 2DQFB 4FQ1L 3TN0C 2UY6A 1UVQA 1ZT4A 2HVJA 4X7TA 3D9AL 3HI6H 4FXGA 1E6OL 1NMAH 5IB4B 5I19L 3JV4B 4WI5A 4ZAKC 5L88H 5D72L 1KCUL 4O5LL 2WNGA 4WRLA 1KIRB 3ZYOA 3P0YH 3ARWA 1J9CT 3QISA 2ZSVA 2ADFH 4U6YB 4XNXL 1QBML 3H9HA 4G80B 5T5NF 3HE6C 1I9RL 5TF0A 4DVBB 5LWYL 1YMMA 3V4VL 1A02N 4UQ3A 1F42A 4LU5L 4HW6A 2F74B 3W5MA 4FQQA 5JOEA 3W9EB 5GS1B 1MQ8A 2FZ3B 1H3UA 3IDGA 4PJGB 5E2VL 4P57B 5FK9B 3SDYL 4PRHD 3BE1H 3O9WB 5T1MA 4PV9B 4PJIB 1XF3B 4JKLA 5MENE 2BSRA 4XWOD 3UTZA 4NHCL 4OZHB 2YA1A 1CFVL 1T7XA 3WE6B 2Y6SC 4N0RA 2V2TA 1NMBH 4ZS6C 3UBXG 4UT7L 2HT3D 3QNZB 1INEH 4YUEH 3E6HA 4KJWC 3C5SA 3BH9A 5KG9B 1BWMA 2VLJD 1C12A 2NY1D 1I9IL 5I8CA 3LV3B 1KULA 3UPAA 1RQ5A 3GMMB 3GGWA 1A14H 2FHCA 4X4MA 4R2GD 3FOMA 3CC5B 4U3XA 2L0DA 3PNWB 3J8F7 1TETL 1I8IA 3Q0HA 5C07D 1HILB 1A7QL 1TVHB 3OJMB 4J4PA 5C0AA 2KZWA 3MMEB 3QDJB 5I1HL 3QZWA 3F6IA 1SEBA 5EA0L 3EFFB 3F12B 3VG9C 3D39E 3OKNA 2X1OA 2B0SH 4O2FB 5TDOA 2JTDA 4Y88A 4M9OA 3G5ZA 4Z76A 3BGMA 3U7AA 1AD0A 4JCMA 4I5BA 1W72B 5FUOL 5DMYA 4RWHA 2X4QB 4GT7A 4ZPTA 2FGWL 2VXSL 3LKRB 1MH5A 4JM2C 1I7RA 4HUUA 1T22A 5GGUA 1Z9MA 2BNRA 4PRIA 5DK3A 2AJZA 1W0VA 3NPZB 4MDJB 1RUQH 1N59A 1P6FA 3CZFB 5BV7C 1JBJA 2VAJA 5FAAA 4XBEL 5E00B 1I7TB 3QUZA 3FO0L 5EOQH 2VL5A 5FA4B 4BYHA 2FBJH 4KZDL 1A5FL 2EE3A 2BVOB 3VW3H 1H3PH 1KT2B 4TUJB 1MF2L 4PJBF 5DMGD 3ULVE 3F5WB 2GFBA 4EJ1C 3P0VL 2W9DL 2P4AB 3TIDB 4R4FH 4L4TB 4I18A 4KDVA 4PGEB 3VD5A 2OL3A 4WDIB 1MRCH 1AQDA 2GSGA 3GMQA 1JI1A 1CXFA 5DJ8B 1K5NA 3DROB 3GEWB 5E8EB 4P23D 4AQ1B 3V4PH 3QWQB 3PGCA 4OFYA 3FTGA 3NN8B 3U0TA 3RX8A 3VD4A 3QIWC 1DANU 4XCNB 1HDMA 5L8JB 4NBYB 5EC2A 5IW6B 1EEZB 4TVPD 2VUOA 1YC8A 2KH2B 4UMGA 1MIEL 4NT6A 4MD0B 4H0GA 4JVUA 2IFFL 1UWXK 4KKLC 2PYED 5D5MB 1KPRB 3HI6L 3MV8E 5ACMA 1SJHA 3IAGC 3EYOB 4NKMB 1NMAL 4U1JA 3JBG7 5C0AE 1YPZE 5L88L 4PJ7E 4RFOH 3MGAA 1QRNA 1SYVA 3OV6A 4MMXC 1ZLWK 3MJ8A 4G6AC 4PTTB 3BP4A 3GSOA 3BIAX 2MPAH 3BIBX 3P0YL 2R2HB 4X6FB 3RTQA 4MZ2A 3N9GL 4UT6H 4WVRA 4CMHC 3UTSA 2ZUTA 3D2UA 2E5EA 2DQCH 3B6SB 4QOKA 1BQHB 4EZMA 5B8CA 5IF0A 2ADFL 3OJDA 4RA3A 3V6FA 4XMKH 4JJ5A 3SDAA 1M4KA 4R0LC 4H8WH 5F21B 3VGAC 3S36H 1INDH 4NFCA 3UC0L 2A74A 4OTXL 3HR5A 1WZ1H 5D1XA 4JFHE 4LCUB 1FL5B 1PQZB 4P4RB 4F3FA 2GW5A 3VE0B 3JXAA 3RNQA 3MOAH 5H35B 3BE1L 5D7IA 2EYRB 4MDIA 1XGRB 1BJMA 2ZNXA 4WV1A 4EUPH 3C60A 3TBSA 2OQJB 3BRFA 4JCLA 4OQTA 1NL0H 3MREB 4PJXB 1RK0B 3NFSH 1NMBL 3HG1D 5DJYB 4H8WC 3KPLA 3QWOA 1AY1L 1INEL 4X9HA 2ZCLH 4YUEL 1XR8B 1EEYA 5HPMA 3C5ZC 1P5UA 2ZG2A 4M03A 4JY4A 4M43H 1KTRL 5J12B 4N1EA 4O2EB 3CFCH 4XPGH 1XGQA 1X6LA 3L3JB 3VD7A 3B3IB 2FIKB 4PR5A 1A14L 3S97C 5E6ID 2D7TL 3DUUB 3L7EB 3PHOB 4GFTB 4I48B 1A9EB 4AENB 2X2YA 4KV5E 3P77B 4X6EB 5EOCH 1JL8A 1JYNA 4EN3B 4QRRA 5HYJB 4JFQB 1DJSA 2IC2A 2XPGA 5HYSB 3LQZA 2AV1B 4ZUSA 3FQXB 5BXFA 2UWEA 1TDQA 2B0SL 3CH1B 2Z93A 1T1XA 4GS7B 4APQD 1AR1D 1IGMH 3TP4A 2Z9TA 2WWKO 4PJAB 4I9WD 1S5IH 5C0FB 5HHNA 5HVHB 4NKDA 3UTSE 4OFIA 3HS0A 2GQHA 3LKQB 1RUQL 1A6ZB 3EZJB 1WK0A 4JQVA 3T0EB 5HXMA 5CLWA 4D9RE 3ALPA 3GSVA 4R4NC 5KSBE 1J0KA 1QLFA 4WUUB 4HUWB 5EOQL 4OZGA 2FBJL 1WAAF 1PDKA 1DQLH 2HYMA 4L3CA 1F97A 3VW3L 1H3PL 1KTDA 3RWIA 1G6RH 3VXNA 4WUKH 3RZCB 4GW4B 3MV9B 5C0CD 2WUBH 2R1YB 4R4FL 3FO2A 3CMOH 1MRCL 3I6LE 5IB5B 2YR3A 3BAEH 4K3DH 4PFEA 4Z78B 1DBKH 4K8RD 3LKPA 4FQCH 1PW3A 2VQUA 4TTDC 3V4PL 2VLKA 4RMRA 1KB5A 4PPTA 4HH9B 5I73B 4AZ8A 3M1BA 3VRIA 3MC0A 1GGYA 4JDVA 1V8HA 3RJDA 3VRJA 5EUOE 1IRAY 2NZ9C 4KROC 4KUCD 3MJ7A 4FNLH 5HD8D 3DUSB 1GSMA 3IDIB 5I17B 1D7FA 1K8DA 1C1EH 1IQDB 5K33A 3UPRA 1MWAA 3ARED 5SX4I 2NR6D 1Q9OA 5E2TH 3D69A 5IGXL 4J1UB 4YHZH 4YFLI 1U8LA 4QRRE 5DA4A 3IDXH 4RFOL 5JDJA 2E9BA 1IKNC 3L7FB 4EI6A 4F7MB 5I1IL 1QSFB 3FN0H 4YHIA 2WSKA 1HXYB 2MPAL 1ACYH 1CG9B 1A9BA 2DQFA 5JZ7D 4UT6L 4CADB 4HD9A 3WO3B 3WD5H 5I74B 2DQCL 1ADQA 3RKDC 5IB4A 3JV4A 3DV6B 3MNWB 1VA9A 1BZ9B 4H8WL 4AIZA 4WI2A 3S36L 1INDL 1S7XB 1FYTE 4BSVB 2DQUH 1WZ1L 4L1HA 5HY9B 2BX5A 5C09E 5ISZB 1R5IB 1NC2B 3ZE2F 1YYMH 3MOAL 5IB2B 1RUKL 1WTLA 1VFMA 4DVBA 2BNQB 4FHBD 3WIHA 3MV7E 2F74A 4GRLC 1NL0L 3U9UB 3NFSL 3VCLB 5D2NE 2JCCA 4YFDB 2EZ0C 2DL2A 4ZFFB 2ZCLL 5F7DA 4WI8A 1YDPB 4PJGA 4P57A 3RWFB 3O9WA 1CK0L 3R4DA 1XF3A 4PJIA 2Q6WB 1CGUA 2VLKE 4OZHA 1NCCH 3CFCL 4XPGL 3BD3A 3ARPA 3WE6A 1WBYB 3QNZA 3WNLA 2DM7A 3NOIA 2WLZA 1EJ6A 4GBXD 4PJFE 4KI5C 1UH2A 4FRWA 1UZ8B 1QSEB 3UTQB 4F9PA 4L4JA 5EOCL 4ALAH 3LV3A 2YZ8A 3QQ9D 4NO3B 3MJ6A 3GMMA 4WI6A 3MRHB 5KBNC 5I6XB 2LU4A 5T3XD 1VKXB 4ZQKB 5E0QA 1U2HA 1CXEA 2JB5H 3PNWA 1IGML 5I1DB 4YBLC 1S5IL 1HILA 5J6GB 5IVZB 1TVHA 5C08B 1TNNA 4Y8DC 3QDJA 5CP3A 3LKNB 4AH2B 3T3ME 3EFFA 4OCSH 3F12A 4JAMB 7FABH 4K3EL 5IVNA 4D9LH 4O2FA 1CDUA 4NQCE 5C0EB 1GGCH 2NY4B 4ERSH 3BGFC 2DM2A 3UZVB 3HE7B 1NLBH 2IQAA 4Y7MA 3TN0B 4PJ8C 2X4QA 3LKRA 4OAWB 5IMMB 1ZOXA 4R7NB 4GW5A 1N64H 3EFDL 1DQLL 5JW3L 2X4NA 4XMPH 4MDJA 4QRSB 1G6RL 4WUKL 1T66C 3CZFA 4XC3H 3AY4A 8FABA 2BERA 4IOFD 1ZLWH 5IW3A 5FECA 5E00A 3RHWF 1I7TA 5JA9A 3BAEL 2Z35A 4QHKI 2FCBA 1VHPA 1QFWH 4K3DL 5FA4A 1DBKL 3OAZK 4FQCL 1QR1B 3E3QE 4MD4B 2LE9A 3HE6B 2BVOA 5DJCA 5JXEC 2NW2B 2FEEL 1KT2A 4TUJA 1CFSB 5GGTH 3P2TA 5BW7A 3PV7A 5T3ZD 4PJIE 3TIDA 4L4TA 3GI9H 4PGEA 1PY9A 1TITA 2IANB 4FNLL 5HHVH 1NBVH 3QFJD 4ZYKB 3L3HB 3VU2A 1KLFA 5DJ8A 5E8EA 3DROA 3X3FH 5KSUB 3MLWH 2RFXB 2A1WH 1NCWH 3QEGH 3NN8A 5E2TL 4G6JH 4S1SH 1NAKL 4PJCF 2NPLX 3HUJA 4XCNA 4YHZL 2N7AA 1D9KA 4YDJB 5IW6A 1EEZA 3SJVD 4KK5C 4QYOB 3IDXL 1S9KC 4LIQH 4YHKL 1KCSH 4MD0A 4GO6B 3VH8G 3BH8B 1WWAX 2XQBH 3GJEB 4PRPB 5TPWH 4F37K 2WWKT 5D5MA 2JJWA 5FO9B 3KPQB 1IZKA 1KPRA 3WD5L 3EYOA 1MI5E 2XY2A 3L3GB 2EXWC 1RZGB 2ITDA 4XXCA 1NBYA 3QH3B 1G9MH 2E7CA 1AFVH 1HQRB 2R2HA 3TVMA 4X6FA 2DQUL 1TTFA 1LWRA 4LQFH 5J89A 3DMMA 1FO0H 3B6SA 2LVEA 5B4MC 1BQHA 5L2KB 1D6EB 4GSDH 3GK8H 1YYML 2DIJA 3QUXC 5CD5C 1FFNB 1LEKB 3VG9B 1RMFH 5D1QC 2XN9D 3OBAA 4I77H 4NKQB 2FX7L 3F7RA 3GJFK 4DK3A 1CXHA 3IFLH 5E1HB 4LCUA 1FL5A 4KKAD 4JM2B 1MUJB 1PQZA 4P4RA 3VE0A 5CGTA 1G9MC 5H35A 3ECBB 2DQEH 4G6MH 2EYRA 4OZFB 2W59A 3GMOB 1XGRA 4TVSa 1NCCL 2F53E 4KQ3H 4BJLA 3MREA 4PJXA 1RK0A 1TCMA 2E7LC 4HGWB 5DJYA 3W9DB 1F6AB 4ZG1A 1DUYB 1N26A 1I1RA 1XR8A 4WJ5B 4TULH 5F97E 2CXKA 4BM7A 4S1RH 3Q3GB 3ILQC 4ALAL 5A40E 3L3JA 3U79A 1DBJH 3B3IA 1LILA 3ROLB 1ORQB 4WFED 4UZGA 1CTOA 5D6DA 4XB8A 3K4DA 1P84J 1BMGA 3T0DA 2JB5L 3PG2A 3L7EA 2I27N 3PHOA 4I48A 1LEIA 3SDCC 4P99A 3QNYA 3P77A 4X6EA 4NQED 3QIWB 4EN3A 5HYJA 4JFQA 4DOHB 5HYSA 5IJVB 3KAAA 5FO8A 2EDNA 1WVZA 1VFUA 4OCSL 7FABL 4D9LL 3CH1A 4HHAB 3RPIA 3S88H 1BP3B 3DIFB 4XCCH 4TSBH 1J11A 2JLLA 1NLBL 3ARDC 3V95A 2R23A 5BQ7B 3QFDB 3ZO0A 5B3JE 1PFCA 4XMPL 3QNXB 5TE4H 3LKQA 1FBIH 1A6ZA 1E4XI 4QLRA 1T6WA 4FABH 4XC3L 3EOBB 4Z7NF 4CMHB 4WCYH 2I60H 2WM0A 1KCRH 2XQYG 4HUWA 1QFWL 4HC1H 3LHPH 5ID0B 4OD2B 4L29B 4K3HA 4GRWH 1QHOA 4G9FA 4R0LB 3VGAB 5SWSB 5IHUH 4ODTH 1XFPA 1FG9C 5GGTL 3GO1H 4YHLH 3RZCA 4GW4A 3MV9A 3WNNA 2R1YA 3GI9L 5M7QA 3MOBH 4U4BA 4LNRB 3ZKXC 5IB5A 2EDBA 1NBVL 2EYTB 4WFFE 4PJXE 1HXMB 3X3FL 2JJSA 5HI4C 3MX0A 3MLWL 4Z7UA 2DRUA 2A1WL 1NCWL 4PJEB 3PDGA 3QEGL 1YA5A 3U6RA 1GOGA 1NCNA 1OTSD 3BP6B 4S1SL 2ICWJ 2IQ9H 3LD8B 5ANMA 4KKNA 1S5HB 3DUSA 1NJ9A 4K55A 1RHFA 3NIGE 2ZCKH 4WW2F 5JW4R 1HHIA 3AFLA 4LIQL 4DAGH 1IQDA 3C5ZB 3TBYA 4Z9KB 4JLRB 1ES0B 1DQDH 2XQBL 4NCDA 5TPWL 2DYPB 2CRYA 2GEEA 2V5RA 3GIZH 1KXTB 3MLYH 3ZLQC 2DLEA 3L7FA 4OD1H 4F7MA 3A6OA 1QSFA 5TQ2H 4KRPD 1G9ML 2VDPH 4XCYB 5F1SA 3ZTJG 1EHAA 4EUPB 1AFVL 3VRLF 1HXYA 1JNJA 5JQ6H 1CG9A 2G60H 4Z5RB 4LQFL 4CADA 5KS9B 1N6VA 4PJAE 2I9TA 1FO0L 4PGBA 4JRXB 3P4NB 3SGKA 1KIPB 4GSDL 3GK8L 3MNWA 2DI7A 3ARFC 1DBBH 1RMFL 4G8IB 4CVXA 4I77L 2AJUL 4GG8B 3VXUE 1U3ZA 1JPTH 4BSVA 1MRFH 2GIYA 1R5IA 3T0EE 1NC2A 3TH2T 3WFHB 5J1SC 4IMKC 1UADC 1WGOA 4WUUE 5IB2A 1Y18B 1IGTB 1RU9H 3CIQA 4NGHH 3T77B 4G6ML 2XKNB 4K7PH 2BNQA 4LLYB 2YD1A 3GRWH 2YD4A 1JI2A 4NC1E 2JK5B 4KQ3L 5FB8B 3U7YH 2QBWA 3U9UA 4H20H 3VCLA 3KPSB 4LPXA 2GTZA 4ZFFA 1YDPA 3RWFA 4TULL 4HSQA 4S1RL 1A6TB 2Q6WA 4X99A 3CDFA 3CNKA 5GZOD 5HI5C 1DBJL 1Z3GH 3SE9L 5EBMA 2XKSA 4XBGA 5IR1B 1L7IH 4G8GD 1C08B 2YD8A 3QRGH 2R0ZH 1MSPA 1AC6A 2Q87A 1UZ8A 4OD3H 5HHQB 1A6PA 1QSEA 3OAZH 3B2VH 3RUGB 1AO7B 2V9RA 3MYJA 3UJJH 4JKMA 3S4SG 4KROB 3MRHA 2WWMC 5ERWA 1VKXA 4ZQKA 4M61B 3BRDA 2CRIA 1NCDH 3S88L 2VQTA 5LXGH 3B5TA 4FXKA 4XCCL 4TSBL 4M7ZC 1AGFB 3MYZA 5I1DA 1IC5L 1SVZA 5ICXB 1T0PB 4KY1H 5C08A 3VFGL 3KYKH 5BRZB 3PXHA 4OGAD 4E9LA 5CAYB 3LKNA 4NRYB 2MJWA 4JAMA 4MS8C 4QNPF 1EGJH 5K9KB 4G6FD 5TE4L 1FBIL 3OKMB 5C0EA 4FABL 1ZEAL 3SGDH 3HE7A 4JHZA 3TN0A 1W8NA 4OAWA 4WCYL 1UACH 2I60L 3O6FC 3ZDZF 1KCRL 5ISZE 3IS1X 3FQWB 4HC1L 3LHPL 4L3EB 3MR9A 1JV5B 2NQCA 5EBGA 1JK8B 4QRSA 4ODTL 5IHUL 3GO1L 4YHLL 1SMOA 4PRDA 2J3SA 1AJ7H 3LRHA 3QIUD 4JGMA 3MOBL 1R3HB 2OR8A 2QADD 1CGYA 4UB0H 2MNUA 1QR1A 4MD4A 3HZMB 4U1IB 2WBWB 4MSWB 1R3IH 2NW2A 1EX0A 3O2WH 1CFSA 3ARBD 5ESQA 4QRQB 2EYSB 2J5LB 1YNLH 2XRAH 4GRLB 5DD6B 5HTSA 2IANA 4YK4C 4C83A 1RZIB 4JFFD 1RIUH 4Z0BH 2VZVA 1AP2B 1AGEB 2ZCKL 1RUPH 5KSUA 1KLUA 1N8ZA 4DAGL 2RFXA 5FM4A 1ROWA 5F7NC 1DQDL 5EZIH 3J7HA 4GAFB 3EYFB 5C0ND 3DHJA 3V0WH 4FQJH 4YDJA 3GIZL 3O6KH 3MLYL 3OR6B 3NFNA 4DKAA 4CN1A 5BS0B 4HXBH 4GAYB 2FJGA 1U91B 4OD1L 5J3HC 2V6HA 4P4KC 2VDPL 2N56A 4JDZB 4EOWL 2M2DA 4PRPA 5FO9A 2VZUA 2DOCA 1CQKA 3RY4A 3F6LA 3U4BH 2V2XA 2R56H 3BDBA 4WWKA 4GH7B 3L3GA 4LARH 4PLJD 5CILH 1IT9H 1OTTC 1DBBL 3QH3A 4KMTH 4XWOC 4DTGH 1ZGLP 1HQRA 2CRZA 1JPTL 2UVEA 5EC1B 3K8LA 4YBLB 3C6LD 1MRFL 4JFDB 1I8MB 3S3PA 2DN7A 3V5KB 5L2KA 5GRVK 3VGHA 4M00A 3EGSB 1RU9L 3LN5A 2PETA 1FFNA 1LEKA 4NGHL 1E27B 4F7TB 3T4YA 5C2UB 1GVIA 4K7PL 5A16B 1H15B 3GRWL 2QEJA 3BGFB 1JMZA 3B9KD 4ZDHB 5AEAA 1JYVA 2WIIB 4PJ8B 3WJJC 4JM2A 4P49A 5DJ0B 4HS6B 2ZUXA 2VABB 4R2GC 5MEQA 5DZNA 1T7WA 3ECBA 1YZZA 2GCYB 5GRZA 3TCXA 3GMOA 1UZ6F 1JTPA 2Z8SA 4XVJH 1AD9B 4NO0B 4E41E 3TYGH 4Y4KC 1DQJB 5IT2H 3T8XB 3V9FA 5MERA 4HGWA 3W9DA 1DUYA 4PGDB 4W4OC 4NN5C 3JV0A 1L7IL 3P4MB 4WJ5A 1I7ZB 3QRGL 1BD2B 2R0ZL 2VZ1A 3AAZB 4OD3L 2X89D 1CE6B 4QRPB 3Q3GA 3BXNB 5DVKA 3OMZA 1QO3B 2UWEF 3UJJL 3ROLA 5ITBH 5KSAC 4ZNEA 2HJLB 3BUTA 3G5YA 2IBZY 3VDBA 1NCDL 2XXMB 3IRPX 3ZDYE 2Y7QB 4ZO9A 4PY8I 4ODHH 4UTAL 3KYKL 1HHKB 3DYPA 4Y1AB 3CPLB 2DD8H 4TVPH 1EFXB 1FL3A 4NWTH 1D5XB 4P46C 4PREB 4HHAA 4RZCB 2XA8H 4OZGF 3DIFA 5GRUH 5C0GB 1UACL 2OJZH 4HCRH 4Y19E 3SDDD 4OCNC 5BQ7A 3QFDA 4P23C 5L2KE 1NFIB 1CCZA 3QNXA 5AWNH 3G5XB 4HS3B 1AJ7L 3EDFA 2NY0C 2OK0H 1RIVH 1EMTH 3U4AA 4LRIC 4OD2A 3QUXB 4UB0L 5EZOH 4R0LA 1R3IL 5SWSA 1T0NB 1X7QB 3O2WL 4V1DE 5A3IC 4I0PC 5HGAB 4BH7B 1MCCA 1BJ8A 1YNLL 4TSCH 1GL4B 2XRAL 4M1GL 1A1MB 1CD0A 4F9LC 2NY6D 4LNRA 3SE8H 2FHFA 1RIUL 4Z0BL 4HK0B 3GI8H 4Z7WE 1MY7A 1HXMA 3K8MA 3VWJD 4G8FB 4M8VA 4NJ9H 1MJJB 4PJDB 1RUPL 3MBEC 4LKCB 4PJEA 3MJ9H 5LCVH 4JFOB 3OKLB 4UDUB 2DKUA 3QBTB 1FNEB 1VB9A 3V0WL 1U3YA 3ISWA 4KVNL 2Q76A 1S5HA 4HPOH 2PF6A 4HXBL 3FT2A 2AW2A 1HWHB 4E5XB 5JW4N 3C5ZA 3UTTB 1XF2B 1CFTB 1G9EA 4W4NA 1ES0A 2DYPA 2X4OB 2KL6A 4C57C 5DUPH 3KXFB 5IHZB 3U4BL 3O45B 3MRFB 2CKBH 4WI9A 4DOHE 4LARL 3ZKQD 5CILL 1IT9L 3ZYZA 5ICZB 3FQUB 4HKJA 3QDGB 4KMTL 5KTEH 3SDCB 4EUPA 5A2FA 4DTGL 1U8MB 4JANA 3ZKNC 4NOFA 5KANG 3NBNA 3VFTA 1BQHG 4Z5RA 2BZDA 3RDTC 3C8DA 3OF6A 4ORGB 1S9VB 1Y0LB 5KS9A 4BFBD 4H1LB 3VXSD 1F90H 3H9SB 3P4NA 3OKYA 5EU6E 3ES6A 2IH3B 4G8IA 2JCCF 4GG8A 2HLFD 4FQIH 3LB6D 4X0KB 5HGDB 3PWJA 6FABH 2ZKHH 4I13B 1ZHNB 3JVGA 3WFHA 4QY8B 5GGVH 1JPFB 5E6IC 1MVFA 1G7PA 4R6UA 2E9WA 1Y18A 3SKUD 2AKRB 5C9JB 1PZ5B 3T77A 2XKNA 4LLYA 5KN5B 4G8EB 2F5BL 4XVJL 3EZ8A 3TYGL 1QQDB 1J8HB 2JK5A 5HGHA 5EH1A 5LJYH 5FB8A 1M71A 1N7ML 4UTBH 3KPSA 3QUMH 4NCC2 1KG0B 1K3ZA 1H0DB 1HZHH 4BFGA 5CSGA 4ZSOA 3RBGA 1A6TA 1FIGL 3MV01 4N8CH 2PR4H 1ZS8B 4PJEE 3BN9D 3QHFL 2P44B 5EDXA 1HEZB 4X9IA 2J7LA 5DUBB 3ZDXE 3ZKXB 4MLSA 1JZ2A 2VYRE 3O8XD 5ITBL 1RJZB 1KFAH 1C08A 5C6TH 3MA7A 4NZRH 1JZ4A 3CFDA 3W11C 5ECJE 5HHQA 3QB7C 5HYSG 3HAEB 1WFNA 3RUGA 3OSKA 1DN0B 5GJSH 3U46B 4YHNA 3FAXA 1P84K 2DD8L 4TVPL 5KOMC 2Q8BH 5E08H 4G9DB 2P5WD 4M61A 1G6RA 4NWTL 1L0XA 4Y16D 2X1WL 2XA8L 4Z7QF 4KTEH 5HDOA 5H37G 4ELMB 4UOJA 3RIFF 1UKQA 4JREC 1GGTA 2OTPA 2VOTA 4JRYE 2OJZL 1F02I 4QRTA 5KS9E 4NRYA 4JRXE 1IKNA 5K9KA 5AWNL 1QKZH 4U7MA 3MLUH 1BQUA 5EZJB 4CL7A 3QPQC 4NPYB 2OK0L 5HD8C 1RIVL 1EMTL 3H3PH 2JJUA 2VC2H 4Q58C 5IMLB 1I7UB 3FQWA 4L3EA 2AJYL 5JMRA 1JV5A 3ARFB 4HULB 2FX9H 2ADJA 1XMWA 4X8XA 1JK8A 3NA9H 3K81A 4DVRL 5GRWA 3KPMB 3UZEA 3VI3F 4TSCL 1MCFA 3BN3B 3MSPA 1R3HA 3SE8L 1SBSH 2X1XR 2GUOB 3GI8L 1U8QA 2FLRT 3ARXA 3KPSE 2YPLB 3HZMA 4U1IA 4NJ9L 3HUJF 4MSWA 1OTUC 5I1LB 2YD7A 3MJ9L 4CDHA 4Y4FC 5CUSH 1NCUA 1NGPH 4YZFF 2AEQH 3ESUF 4AEHH 1GPOH 2FIRT 3VXQB 1RZIA 3IU3B 4PBXA 2XWJB 3B9EA 4HPOL 2YD3A 4EQ3A 2F54E 2YUWA 5E1AB 2MQCA 2B7DT 2I5YH 4XWGH 5CD3B 1WZLA 3HNSH 5DUPL 1AO7E 2CKBL 3OR6A 3CSGA 5BS0A 2D2OA 5MP6H 3ULUD 1U91A 1T80A 3SGJA 4N90D 2ZUWA