3MLRH

Crystal structure of anti-hiv-1 v3 fab 2557 in complex with a ny5 v3 peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
226
Chain Sequence
EVQLVESGGEVKQPGQSLKISCKSSGYNFLDSWIGWVRQIPGKGLEWIGIIYPDDSDAHYSPSFEGQVTMSVDKSISTAYLQWTTLQASDTGKYFCTRLYLFEGAQSSNAFDLWGQGTMILVSSGTTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
total genus 40
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlrH01
3VXQB 1NLBH 4OD3H 4QRRE 1JZ4A 4LBEB 3VFRA 1NGYA 1PD6A 2Z31C 5SWSE 4YFEA 4NQUA 2YD8A 1QSFA 4X6EA 2BERA 4XP4L 2CUHA 4JVUA 4M62H 4YC2C 5FA3B 1U2HA 1EGJH 4P5TD 4QTHA 4XVUD 5T3ZE 5GXBB 3ZE0F 4OLWL 3MV8E 3AU1B 4MJIA 5KTEH 2Q3ZA 4PGEA 4M8QA 4LGRB 3HE7D 4G3YH 2EDXA 3LKOA 3QNZB 5HHMB 3G08A 4JY6A 3LD8B 2J8UB 1U8JB 2Q8AH 1QTYT 2CH8A 1AY1H 4HKZA 2DWDB 1RUQL 1JTPA 4I5BA 3W0WA 2Y5TB 3BP7B 1GAFL 1YEHH 2GJZB 3J7HA 4YPJA 2DJSA 1UGNA 3QZWB 4QY8A 4Q0XH 1I75A 4Y1AB 1M7DA 3B3IB 2HT3C 5MEPA 1KCVH 1LEGB 5DHYB 3ARYA 4NRZB 4MS8C 4E5XA 2XACC 4Z18A 1HEZB 2DLGA 4TVPL 4OCLC 4FZEL 3OJDA 3TO4B 3PABA 5C0AD 1MIEL 1KT2A 1WCBB 3Q5OA 4XAWL 4OFIA 5ETUA 3WBDA 4C56D 2Y36H 3D85A 3QHTC 3MFFB 3RWCB 5F7WC 5AYUL 5L2JB 1CFQB 2QBWA 4HQQH 2SEBB 1P4BL 3GIVB 3NH7H 3MGTB 4HGWA 3JV5A 5DJYA 1FG2B 1S8DA 4I5BB 4KI5C 5EZLB 5JIKA 1FGVL 2B2XL 2FRGP 2DWDA 2ZCHL 4XRCA 4YIQB 5JA9A 3BQUC 4JZNA 2LU4A 4WI3A 2GQHA 1CT8B 5IWLA 2EDBA 1WAAF 4HDIB 4K9EH 1X9QA 3F5WA 4MX7A 3VXTA 1T2XA 1ZT1A 3GMPA 4HWBA 2J6EL 4ETYA 1GGUA 3BQUB 4YDIL 2XN9E 2VUOA 4YBLC 1ZVYA 1F4YL 3B5TA 4NUJA 4QTHB 4BH7A 1G9NC 5JHDA 1I1RA 2FYYA 4NBZB 3RZWA 4Z6AT 3TESA 3CFBA 1RMFH 2ICWJ 1Z5LB 3LSOB 4HH9A 1KTLA 2LU7A 2DL2A 2VXQH 3LMJH 5TE4L 1LILA 4JFEB 4DUVA 4LSPL 2IBGA 1XF2B 5F9JB 3VXQA 4JFED 4NUGL 2GUOB 1AR1D 4L8BA 4NGHH 1VFAA 3U7YL 2GITA 4FQJH 1YEEL 4LCWB 3RDTC 5I73B 3Q6GH 3WN5C 2BVQB 1R3HB 1XCQA 2L7UA 2FZ3A 3GSQA 1HHJB 2AEWA 3LQAL 2VJXA 2G9HB 4JG0L 4RDQF 3DSNA 2X05A 2B4CC 5HHOD 4PGZA 4YHIA 4R90H 5BZDA 1F11A 1J8HE 1RIHL 5CSZA 1NAML 2MCPH 4J6RH 4RZCB 5J1AB 4LPTA 5MEOB 1VHPA 5FKAB 3PL6C 3MGOB 5I1LB 2YZ8A 4PJHE 2R2BB 4NZRL 1KJ3H 4F57L 1BWWA 5EU3B 1RFDH 4G8GB 5DD6B 3FN0L 5TFSL 3TWCH 4NNYB 4WWKD 5DVMA 3I6KA 4CNIA 5T5FL 3MLXL 3JBG7 3HC4L 3PXJA 4RAUB 1T3FA 3UZQA 3WFCL 3WLWD 4DW2L 4QF1B 5C0JA 2GTZA 4N1EA 1Q0YH 4OZFA 5E9DD 4O4YH 4XNYH 5JNYA 3IJYA 1Z2KA 4L9DA 1SY6A 3BRFA 2VABA 2ENYA 3U4EA 1XEDA 2EIEA 4Z7WE 1IQDA 2LE9A 3MRPB 3LPGA 1W0WB 4K3JL 4M9PA 3RUGF 2X1WL 2APVA 1TETL 5H2BB 4HIEB 3H9YA 3VFUB 1G7PB 5DTFA 3DO3A 1HHGA 3DXAD 2DQHL 3GBNL 2R0WH 4XPHL 1LO2L 3SKUD 3DXAB 4UQ3B 5I66B 1HH9A 2VZUA 1T21B 3KPTA 1DL7H 2VL4A 1FZJB 1P7QB 5GRYA 1I3VA 1WQVT 2PF6A 3QXAA 4JFHD 3OHXA 2CRMA 4LLDB 3H0TB 3KPPA 1JWMA 5ID1A 1E28B 4O5LH 2EYRB 3BKML 1N0XL 3CX5K 3U9PH 4HV8A 1BBJB 2K7QA 1X6NA 4ZTPH 4UT6H 2X70A 3NACL 4I2XA 5HHMD 3C5SA 2YD2A 3RVXD 1RJZB 4MLIA 1VGEL 4ZPVA 1E4KA 4AMKH 2AI0L 1JGDB 1MREL 4NDMA 1S7XA 3WJLA 5IKCB 2H8PB 1WIPA 3BGMB 5E2TH 3IXTB 3VFUA 2EZ0D 1DDHA 3KXFD 1I9JL 4OZIA 3WIIH 1IQDB 4XVJL 5JHDE 3JZ7A 5FDWA 4MB5A 3JTTA 5FK9A 3RVVC 1A64A 2VDQL 5F3BB 4O2CB 2FNBA 3U7WL 3MRGA 3BZ4A 2X7LB 1BVKA 3CGTA 4CNIB 3D39A 2K3TA 4NNYA 1DVFC 1PGRB 3QEQB 3REWB 3D18B 4HZLB 1KPUB 1U8LB 3SDDA 4GMSH 3QDGA 4NQED 2LTQC 4AM0B 2VLKE 4W70A 1Z9LA 2CQVA 1BIHA 1ZLUK 3FO9B 1RUKH 5EOCJ 3ALWA 3TYGL 4WIQA 1BZ7B 2D7QA 1ZEAL 1MJJB 4QXTA 1D5BA 1HCFX 4HC1L 2EDWA 1QYGL 1YYLH 4ODWA 3S4SA 5EORL 3L95B 1IGFL 4ZTOL 3U0WH 3ARGB 1AP2B 4M6OL 4PJBB 3RA7H 5DHXB 4XBGB 5JPNB 1N6UA 4G7VH 3QHFL 2BNRB 4X98B 5C8JB 3V6OA 1XF2A 3SDYH 4DZBB 1UM5L 3L3JA 4K23H 1J1XH 4Q9RH 3IFNH 2O5YH 2A6KB 2BOCA 5KOVC 5JW5B 3KGRA 1MFNA 3UX9B 3WJLC 1RHHA 1QQDA 5ISZD 1ZT7B 3K4DA 4BH7B 4NUJB 2Z91A 4JR9L 1EUTA 1ZS8A 3EDKA 5T1KD 5CBEB 4QXWA 1SYSA 5T1LA 4MAYD 5ITBH 1DBAL 4ZSOE 3O3DB 3GMPB 1JZ6A 1C08A 1RUMH 1I1AC 3GB7B 4HJGB 1QLEH 1RJLB 4HUXA 1A6TA 2R4RL 5EC2A 4ZAKC 5KVFL 2AXGB 3NA4A 25C8H 5HHOB 3K8KA 3QO0B 1R5VB 2YN5A 3LQMA 3MGTA 4JM2B 3GIVA 4RFNB 5T3ZH 1TVBA 3QI9A 4HMEA 1M4KA 3OXRA 4JRYA 4XXCA 2ITDB 2I24N 3W82A 1WWWX 2BDNL 2MHAB 4HUUB 5GSRA 1W2KT 1K85A 1JF6A 1I9EA 1R5WA 4CW1A 2YD3A 3MV9E 1WLHA 2AEQL 3TZVC 5D7KE 3LHPH 5TF1H 5F8QC 1LEIA 2DQJH 2BHUA 4XPBL 1KC5L 3JWDC 3N85H 4OLZL 5EZJB 4NO0D 5DA0B 2VDPH 2JJSC 4Q74A 5IBLC 1ZA3A 4Z77B 3ULVC 2EDRA 2BSTB 4LASH 5KOMC 3G5ZB 4TULH 2FGZA 4OF5A 2BFVH 4CN6A 5DHVA 4CJ1A 4ZFFB 3MJ8A 1UKQA 5FUOL 1X5LA 1S3KL 3P9LA 5ACZB 4J1UB 3BIKB 2C9AA 2EC9T 4M43L 1MJUH 2XQYG 2X41A 1U8JA 4WHDA 2AJZB 1U8PB 3V52L 3HTLX 4DKFH 3OKDA 4EN3B 1D6EA 4FQPA 3PDDA 4LEOB 3GK8L 3CFEA 4JPVL 2OS7A 4JO2H 3MRRB 4M03A 3MUGB 1A7RH 2P4AB 2YK1L 4KKNA 4O9HL 3GI8H 3HMXH 1NFKA 2OJZH 4EEEA 1IM3A 4N0FB 3FQNA 4FTVE 4I3SH 5KG9A 4NN7B 1CXIA 2IANE 5I15L 1JRHI 3BH9B 2NX5E 3EOTL 4PJIA 1CK0H 2A6DA 5F9AC 2X9YA 4G7YH 4AG4H 4U0RB 3JUYA 2CSPA 4ZS6D 1V7NL 4LVOC 2ARJQ 4GMTH 1UG9A 4H8WC 3O11B 2IMNA 2V7HB 2E6QA 3DOSA 2X4OB 3CH1A 4JN1L 5EO9A 4KK6D 2DYPA 3IU3A 3KPRE 3M17B 3V8OA 3V0AC 1J0JA 3MCKB 4MA1B 2FH8A 1IAMA 4UILL 3VXUD 4EIGB 1JF1A 4X6FB 4XXCC 3QG6A 5GGSY 1W72H 4XNXL 4HXAL 4F9PA 4O58H 3VW3H 3HUJF 1RZJC 2PO6B 3D5OF 1YNLL 4D0BB 3OKNB 3WFDL 1OCWL 2FR4A 3FONB 5KN5B 1EBAA 3L7EA 1FDLL 1EJOH 4M7KH 1YNKL 4QXGH 2C26A 1B6DA 1DFBH 3SCMA 4HWNA 4WENB 1GHFH 3B43A 5AG8A 5J9PA 2W59A 1I3GL 3VE0A 1F3JB 1E27B 2OXGA 4PG2C 4PREB 2YC1A 4L9LA 4RFOL 1JNNL 2N1KA 3G5XB 3RY6C 4CBPA 5D70H 2D7TH 3MYJA 4XC1H 4PJEA 4KVNL 4ISVB 4JFFD 1R3KB 3VJ6A 5KAQG 5GS2H 5BS0D 4KRMB 3VXRA 4YEFA 5FM5M 2P8MB 3C5JA 4YDKH 4IOFD 1FYTE 4NZUH 1UXSB 4WDIA 5CMAA 1BVLA 3PHQA 4PJ8C 5IW1B 4D0CA 1CS6A 2JJUA 1T03H 4QHUA 1RZKL 2DQFA 3CFKB 1BGXL 1U8KA 2O5XH 3QQ3B 4M1CD 1U95B 1UFUA 3TH3T 4Y7MA 4W6XB 2H2SD 5CJ8A 2X9XA 4J3UA 4ZO7A 3ARGC 2WBJA 3MRLA 3L7FA 1V8HA 1FFRA 5TF0A 4HWBH 5DZLA 4OIIL 3GSVB 2VLKA 1RK0A 2HA1A 3TN0A 1DZBA 2F8OA 4U7SA 2HFEB 3M8OL 5FUZL 4GXVH 43C9A 3BZEB 3QIBA 1M05A 1AC0A 3I2CH 4KKAD 5AZEH 4F8QA 1MF2L 2HT4D 1NBZA 3QFJE 1HNGA 2Z92A 3VCLB 1AE6H 2VQ1B 2ZCLH 4M61B 3KVQA 5MENA 3H3KA 3MV7D 5IT2H 3CFDA 3AMKA 5GGRB 1LNUA 4QRUA 4JRXE 3CK0H 2OI9C 5F1NA 4YBQD 5EOTA 2NLJA 5GS0H 3X3GH 5F6HI 1SEBA 3SGKC 5KS9E 5D1QA 3V2AR 5IESH 4OF0A 3ULUD 5JORB 3QDHA 2O61A 5KVDH 3A6BL 3O41A 4Y16C 4Y5XA 2EIDA 5DFWH 4YXHH 2F74A 3IGAA 3X13A 2P8LA 3TVMD 1XF3A 4U1JA 5F89B 4YR6B 3EOYG 1NEZG 4KK9D 5JPMB 5MI0C 4NNPH 3WDHA 4YK4C 3OAZH 4OV5A 2GI7A 2F53D 4ZYKB 4G8EA 2NYYC 1ZLSL 1T1YB 1BJ8A 4BFGA 4N0YH 1DUYA 3TH2T 5HHNB 1MCKA 4GH7B 4ETQB 3VMOA 1UVQA 5L6YL 4U1SA 3V5HA 5KAQF 1K4CA 4X80L 2AV1A 3BHBB 4FQXB 3RVWC 3TV3H 3UTTA 2Q7YA 3OAZK 5JW4Q 4OIAA 2PW2B 5DRWA 4UNUA 3P4NB 4EDXA 3VD4A 3V8CA 2ZKHH 4N5UA 2ZNWA 1T4KB 4A6YB 4NQXA 4BZ1H 1KN4H 5AZ2L 3PWPD 1A1MA 1JGVL 4JFOB 1T6WA 5FYJH 3QIUA 3QXWA 1T2QH 3N1MC 1JCKA 3BJLA 5FOBA 3BPOB 3ZTNH 4NKIH 5DJ6B 2ATKA 2BOBA 5IF0B 3V4PH 2CK2A 4UIMB 4R3SB 3KYNA 3ILPB 5IVZB 2B20A 3ISWA 5DZOA 4MJ5A 2ESVD 4WY7L 2VXUH 4JB9H 1OGAA 3IDGB 3ILQC 1TJHL 3O4OC 1B0RA 3ECBB 3SKMB 4MXQD 3L6FB 5FHAH 2PYED 3LPFA 4GRWF 4NQDB 4L3CB 1G9MH 3SPVB 1Y6KR 2FL5A 1A0QH 3RIAK 5EU6B 4PJDB 4FZ8H 5C0CE 2Q1EA 5INCB 4X5LA 4MD0B 3IFOB 3MA9L 4PJIE 1PZ5A 4LLWB 5JXED 4Y19B 5C0DB 1QD0A 3HG1D 4JFYA 1JYWA 5F6IC 4LHUA 4U6XB 4J12A 1NKOA 2W9DH 4FS0A 4P2OA 3KPRA 5KSVB 2DKMA 1JF5A 1W72B 1E6JH 3NCBB 3RBSA 2CKBL 4J23A 4ZUSA 3MFGB 5DMYA 4BKLA 4ZXBD 4GKNB 5D1ZC 1VEOA 3LKRA 4POZD 3IFOA 3DUSA 4KZDL 2LFGA 5T3XH 2VQUA 1CFTB 3RAJL 4K55A 1ZHBA 5I1EH 5JO5A 4PJDA 3WE6A 1MEXH 4PJGB 4L1HA 4JHWL 5J13C 4LSRL 1I3RA 3UO1L 4URTB 1AR2A 2A77L 2C3XA 3EYVB 4HPYL 2OQJB 5E1HB 4EI5C 3MRHB 4N9GB 1E4XH 4KDWA 2CDGB 4U1LA 1UVQB 2FX7H 2XRAL 4R4BB 3LN5B 1DUYB 3QCTL 1UQSA 1TZGH 2XZZA 1NFDE 3JTSB 2MQ0A 4MA7L 3TZVA 4MXWH 4QRQB 4G8EB 4RMVA 5IJVA 3C60A 5DJ6A 2NR6C 4WVRA 5IEKA 5FOBB 4CAGA 3VH8G 4JHAL 4YXLH 2DL9A 2ADJA 5CZKA 3UPAA 3HNTL 4D9QD 1ODAA 4GAFB 2RFXA 4KK9C 2APTA 3GSOB 3EFDH 1JGUL 4NQXB 3GSXB 5IOPA 1JIBA 1KGCD 3RWHB 2FGWL 1QOKA 1P5UA 3PQYB 4Z95L 4Y5XB 2AJYH 5GIRB 5D1XC 1NCTA 3BH8B 4NRXA 1FIEA 2FWOA 5FA4A 3DROB 4OKVB 1RD6A 3STLA 1DANU 3ZO0A 1FL6B 4UNVA 1A3LL 3Q6FB 3VXRD 1MFBL 1EHLH 5F1NB 3NCYS 1P7KB 1KN2L 1TITA 3OL2A 4NZTH 4H0GA 1BBDL 4Y4HD 1HINL 4AEIH 4TUOA 3TF7C 5TH2B 1U58A 1JZ2A 1YDPA 3O45B 4V1DD 4QTIL 1VGKA 1Q9WB 5C0NC 2XQYK 4LSSL 2R4SL 3EKCA 1U58B 4RMWA 1F8TL 2FIRT 4XWGH 4R8WL 1IARB 5CINL 5E2VH 3WLBB 4YHKL 2VYRE 3WHXB 2BSED 4B50A 5E03A 1Z3GH 2GJ6D 3RI5F 1ADQL 4XP5H 4Q9QL 2EIZB 3P4OA 3WN5B 5A1AA 2QHRH 1CU4L 3SGEH 1FYTB 3FO2A 5FYLE 2H32A 3SDXA 1RHFA 3MRIB 1RZKC 1JE6A 2AABL 3WFBL 4OKVA 3UYPA 5EOCH 1IC4H 3DO7A 4XMLH 5SWSD 5DFVC 5I1IL 2VZTA 1LO5B 1S7QA 1NQBA 5C08E 5ISZB 4WFFE 3MRFA 3QCVL 4RMSA 4AIXA 4QRUB 3QUMH 2ADGB 3NCJL 3BEVA 3QEHA 2RFXB 3OB8A 2W65B 4M02A 1URLA 3MJ7A 3RX5A 2C1PA 1NMBL 4L4VE 3RGVD 4H8WL 5DQJA 2IQ9H 3FRPA 1IGYA 2C3HA 4QRPB 4F7CB 4OI8A 4JVWA 4MXVF 4MJ6A 3S36H 1MOEA 1LE5B 1KNOB 4IMLA 4JO1H 1OAUL 5A3ID 2HFEA 2VXVL 3VGAC 1NDGB 4LRNH 3CX5J 3TN0B 3SDAA 4U1LB 3WO3B 4ZFGL 1HZHH 2BXYA 2NXYC 2YUXA 4LU5L 2CIKA 1TNNA 1LEKA 5I1DA 5J12C 4OTXH 3O9WD 3NMEA 3K81A 2A6IB 5AG9A 2LV4A 2XN9A 4CMHC 2EDTA 2RBLA 3B6SA 3RY6A 1RU9H 5I1CH 1S9YB 5EIIB 4PJAE 4GOSA 4ODSL 1KACB 4X9HA 3STZA 3DRTB 1U95A 2H6PA 3AB0C 4FQ2H 5KN5A 2GIYA 3SKOB 1JPTL 1U8KB 4HKXA 1CGSH 1VFUA 5C2BH 5GGQH 4PJEF 1JNHA 1W72A 1YNTA 4KUCF 2GAZB 3VFPB 4IRSD 2KDGA 1R5IB 3TJHC 1IZKA 1QSFE 5I19L 1I7ZA 3LPWA 3K8LA 3QJFA 1IM9B 4YFDB 15C8H 4HFUL 1QRKA 3KJ4B 7FABL 5E6ID 5CP3A 3ARED 2O5ZH 1BOGB 4S2SA 3TO4C 4APQC 5LBSH 5C0RL 4Q58C 3MV8A 5INCA 4KAQH 4NHCL 4Y4KA 5GQBA 3ULUF 2Z9TA 2FL5B 4Y16D 4KTDH 3LRSA 4LGSB 4D3CH 5DC4B 4PV8A 4Z76B 2YEZA 3D2UA 3LZFL 5GHWL 1A8JH 1P4LA 1DEDA 2HAZA 1M71B 1DQQB 1EJ6A 3OBAA 1B0WA 1MCPL 1YEJH 4V1DA 1G6RB 2A1WH 3W0WE 5CKAA 4KHXL 5IW6A 5EZIL 3P11H 2FHFA 2ICCA 2Z35B 3LIZL 1KB5A 4LPUA 4OGXH 3T0VA 4GRLD 3PWVB 5F21B 1PLGH 1H5BB 1KIRA 4QHLA 5EUKA 5IROA 2NY0D 5F7NC 2CK0H 4ZFZA 1MWAL 3MOQA 4DK3A 4YBLB 3ARQA 1OY3B 2CO7B 4YX2L 1OT2A 3SDXE 4J1UA 1FPTH 4OZ4B 1GGIL 2B5IC 1KCUH 4RGND 4HCRL 5HYSA 1DBBH 5MERA 4RDQG 4EUPA 2ORBL 4GAJH 3C2SA 3BHBA 5K9JL 1HSBA 4P49A 4BZ2H 3T2QA 2R9HC 4ZQKA 1T7YA 1V3LA 3EIFA 3P73B 4ETQA 2F19H 1P9MC 4P23D 3FQNB 4N0FA 3O6MH 4YAQB 4KKBC 5LQBH 3R0NA 3UBXB 5C0CB 4O02H 2BY1A 5IQ7L 4B0MM 3C8HA 2NNAA 4N90D 2MKWA 4PRHA 3VA6A 3E2HC 3VFMA 4GRMB 5E94A 3EO1A 1YYMH 3VGDA 5CCKL 5T33H 3P4MA 3GMNA 3CDGB 5F9WB 2J3SA 4I3RH 3GMRB 2E9BA 2XIDA 3MA7B 2IEPA 3LVEA 3CVIL 5ACLA 4MA3B 5IWLC 1OGAD 3MJ8B 3ZE2F 1SEQL 4HGMA 2HKFH 5IHUL 4M7ZB 3MXVL 5F9WC 1U8QB 3D3VA 5CAYB 3OZ9H 5DR5L 5F70A 3MROA 4JZJB 4GQ9L 3T0BA 2FHBA 1CXKA 1RURH 1NGWB 2HJLB 3UDWA 4HPOH 4RBPK 4TTDC 2MHAA 5IFJA 3IAGC 1IAOA 3PWJB 1OWRM 1XGYH 5LVEA 3GRWA 5GGVH 1FO0A 4XPGH 1ES0B 4U6HB 3RVVD 1T22B 1EEYB 3QEUB 5IVXB 5LGJB 3BKYH 4MJID 3JV6B 1FLRL 1AP2A 3ZE0E 1PG7W 5JW3L 1HQRA 2XG4A 3IDXL 3T4AA 1JV5A 5HHOA 3MTRA 5IUSA 1AIFB 1N59B 1IL1B 2XTLA 4N0CD 4WW2A 2FBJH 4OD1L 4AIZB 3L7FB 5KJRH 1UACL 3HFML 1LD9A 2DMBA 4NO2A 2FX8L 1ONQB 4GKSB 1NBQA 8FABB 5L7XH 1KJ2A 2XTJB 4EQ3A 5GS1A 3O6FB 5IW1A 3B2UD 2BOCB 1H3TA 4BSVB 1FZOA 2E6PA 4DZBA 2QR0B 3GBMH 4Z8FH 3O2DL 5C08A 2XTJC 3MRNB 4MDIB 4ODXA 3X14B 5LKNA 2Q87A 4XB8A 4OGYH 2EDNA 4R0LC 1CD0A 4RX4A 4OZHB 3V9FA 3ZDXF 5ITFA 1BZ9B 1EO8L 1PYWA 4E42A 1BIIA 5JZ7C 2MPAL 2AKRA 3IETA 3SJVB 4H5SA 4PRIB 3VWJB 1MQKH 1PFCA 4ONGH 1G7LA 3HCVB 2J4WH 2HVJB 1BZ7A 4X4XA 5CZXD 2A0LD 3R06A 3X3FH 5CZVH 3MCLL 3O6KH 1CLOL 1G7HA 4YXKL 5EIVA 1RJZA 4HWEH 3L3HA 5AYQA 5HGDA 3QULB 1MCWM 4AM0A 1H0DA 4M6NL 2VZ1A 4WUUE 4G8IB 4LVHB 4BFIB 1AKJB 3RP1A 1OAQL 3BXNA 3UYRL 1JHLL 1ZHLB 1A1NB 3E6HB 4K3EL 2X4SA 4ZMAT 3OTTA 4L3EE 1E6OL 4KI5E 4PD4J 3CXHJ 4LLMB 2EE3A 5DD3H 3R4DA 5E8OB 4MNGA 1FCCA 1U8IA 4D9RD 5T3XE 2A0LC 3DXAA 5H35B 2YPLA 4M6ML 2NX5B 3UTSB 3OKOB 3L3KA 2DM2A 4EI5B 3WFHA 1ZLVK 3ZDZE 2OK0L 1JGDA 2VB5A 3FMGH 3RNQA 5TQ2L 5D1ZD 5DRXB 5F93C 1AD0A 3BH9A 1OQXA 1HDMA 3V7AE 5KG9B 5FGRA 1VA9A 5GRVL 1T3FB 4OBRA 3TJEL 4AL8H 5J6GB 2CGRL 3PWNB 3V5KA 4NM4L 4OBSA 3ZT6A 2OSLA 2B4CL 4HIHB 5I16A 4OLUL 3MRRA 3QUYC 1KPVA 1T5WB 2X4UB 1LE9B 4WWKB 2D2OA 2AJ3A 5FYJU 2E6JA 2AEPH 4D9LL 1JUFA 5DD0L 4I3GA 5CSZB 1D6EB 2B5IB 4GKOA 3RL2B 2R0LH 2CR3A 2BNUA 4X7SL 2CDFB 2JJSA 5IEHA 2G9HA 5C0BD 2BX5A 4PB9L 4YDLB 2YOCA 4P2RA 5I74B 1XF5B 1NEUA 1NGXB 3P77A 3MBEC 2ZNXA 1Q1JL 4ZD3H 3AS1A 3G04A 4OZHA 3TC9A 2GUOA 4L8BB 4HJ0C 4IJ3B 4ZSOA 4FQ1L 4PJCF 1HXYA 1OAKH 3H9SB 1CGTA 1ZE3C 4ZFOL 4KTEL 2FEEI 1TDQA 3I6KB 3RDTA 3FB5A 4G6MH 4V2BA 1KCLA 1Z5LA 4HH9B 3DSFH 4H88L 1CDGA 4XMKH 2YRPA 1FFQA 4KK8D 4LCCB 1B4JH 8FABA 4AK1A 4R7DB 5FECA 1CGXA 1BD2A 2NY1B 1OLZA 3QRFM 1MPAH 4NFDA 1HKLL 3QG7L 4QNPF 1NCAL 4FQIL 1G1YA 4XPTL 1FORH 4NKDB 1JYXA 5F97E 1QO3A 4HG4J 2XZAL 5CWSA 3U0PB 2J88L 3ZDYF 3QUZA 4Z78A 4N0UA 1DLHA 1MHCA 1CE6A 2WUCL 1FG2A 5CBEA 4PV9B 2FJHA 3TP4A 1GH7A 1HQ4A 2R69H 35C8H 2BXZA 4BSJA 1MCLA 4GW1B 4HT1H 1NGQH 5ETUB 1FN4B 3F7QA 5GGRY 4L5FL 1UCBL 1RK1A 5FO8A 1AGEB 3F12A 1H3XA 2ZSVA 4PUBL 4JQIL 1I8MA 3BVNA 4OLVH 4FFYL 5ADPH 1A6UH 1KXQE 2FIKB 3EOBA 5JHDB 1OM3L 2V2WB 2X1XR 1H3PH 2D03L 1J0HA 4A6YH 2WWMD 1MVUA 3IU4H 4Y1AA 5J12B 3BGFB 4J3OC 3OAYH 4PRNA 1UZ6F 5EU6E 1SHMA 5CWSB 3U0PA 3BD3A 1D5ZB 5I1JH 1F90L 5B38B 5GZND 5E08L 4ODTL 2QSTA 1SMAA 1N5YH 1A1OB 4KZEL 2W0PA 4K3HA 2B0SL 4ZFOA 5KVGL 4K94C 4PGEB 3GKWL 5BVJB 2MWCA 3RVTC 3RWDA 1ED3B 3GJFA 4QKXB 2YD5A 3K80A 3QEQA 4YUEL 5F8RC 2BNRD 4B53A 5L9DL 3D39B 4WEMB 1VKXA 4C83A 3BD4A 4R97C 5KBNC 3VDAA 3ZT7A 2UZIL 5CP3H 4UT7H 4APQB 4PJ5D 5B38G 3PL6D 4AZ8A 2AVGA 5AUMA 2BVPA 3FQWB 5GISH 1YEGH 2EXWC 4X83A 2MNUA 2NXZC 1MVFA 3P77B 3QZWA 1UZ8B 4QY8B 5D7IE 4HUVA 3VXMA 5F96H 2NTFA 1VPOH 3NAAH 1QUNA 4D9RE 3U9UA 4ODHH 3HAEG 2H2PD 4P4RA 5K9QG 4NM8L 4NQCD 4P23C 4LLQA 1K2DB 3HI5L 2AJ3B 3GI9H 1CLYL 2UVEA 2WIMA 3O0RL 4LEXL 4HV8B 1KG0A 5D7SH 1JWMB 5F7EH 5ID1B 2R1WB 1FZMA 2BNQB 3I75B 5DRZA 1V7MH 1TLKA 4YLQT 1F4XH 3S35H 4PP1D 4P4KD 3F7PC 4XTRC 4RGNC 2DI7A 2WMPA 3QNXB 4LBEA 2DTMH 4MXQC 4RGMB 4ORZC 4I13B 5HI4C 1FNLA 3K2UH 5DQ9A 4D8PB 2AGJL 1FNGA 1Q0XL 5T1DH 2MTPA 5BQ7A 1GPOL 3LRHA 4MWFA 2J5LC 4NCDA 3QEGH 3EYFB 2ILLA 4MNGB 4KI5D 3QJFB 4PJXA 3FRUB 4DN3L 2R0KH 1YPZA 3RUGA 3IS1X 4GSDH 4RAUA 5E6IB 1CN4A 5DQDL 1JNHB 3GUTA 3VRIA 4LHJB 5HY9A 2HMIC 1GGTA 2ICWB 3SKOA 1H0DB 4GRLA 4P57A 4K71C 5I74C 2OP4L 2VLME 4F33B 5JZ7D 1IAIH 3B6SB 2P48B 1PAMA 1K4DA 5ID0B 5IV2A 1I1YB 5DC9B 4UTBH 4YHIB 3GNML 4WCYH 2AAVA 5IBTH 3T2NL 3SY0B 3AS0A 4RWYH 4HKBB 5CEZH 4KVCH 4P5TA 5IVXF 1T5XA 2FEEL 3MLUH 4KRPB 1YN6B 4OD2A 4P5MA 4FXLA 4MZ3A 3A0OA 5CILL 3AXLB 2FDBP 3N50A 2C1PB 1G7IB 5I1KH 4WW1B 4QRRB 4X5XA 5GPRA 4R4FH 1ND0B 5ELIA 1F42A 2I60H 4XPFH 3VD5A 4HUWB 4GG8A 3SGJC 1JMXA 3NA9L 3BQUA 4WUKL 3HHRB 1OB1A 4Y2DA 3VXTB 1T2JA 3P4LA 2P43B 2P8PA 3TBSB 2JB5L 5T5NF 2F8XC 5KW9H 1WT5C 3TT3H 5HYJB 1KBGH 4G9DB 4E0RA 3VFVB 2QHLA 2PYEB 1MI5D 3OXSB 2QTEA 4FXKB 3UJJL 2AJVL 5DJYB 3JV6A 4HD9A 5EZLA 4S1SL 5B8CB 3HE6A 5ADOL 3VFOA 1CDHA 4FXKA 3ZSSA 5LWYH 1UWEL 1NL0H 2ZG1A 4JRYE 3VRJA 2OR8A 4N0UE 1EGJA 5B4MC 4ZAKD 4PY8I 4JM2F 5HI3D 1PSKH 1VADB 3L9RA 2RR3A 2OR7A 5KVMC 3Q6FA 2W1NA 4XB7A 4NSKB 3TN0C 4JZJA 2CMRL 3K2MC 1FL6A 1GL4B 1A22B 4NQSB 1LEGA 3DROA 4Z0BH 2PNDA 2R23A 2XG5A 1G6VK 3HLAB 3INUH 4HBCL 3N9GH 2W9EH 4MA3A 3EFFB 3EYQC 3W0WB 1RZ8A 3DX7B 1R3JB 2KL6A 4JDTH 2XZQL 5F1IA 4MYWB 1FH5H 2GEEA 4JY6B 1FGNH 4OD2B 3QJHA 1WC7B 2ADJB 3VFMB 2LVEA 1J86A 3JV4B 2HFTA 2F5AL 3BO8B 4NN5C 2NNAB 4MJIB 1CGYA 3SOBH 3T2OA 4EI6B 3ULVL 2CJUH 3GHBL 5C0CA 3D69A 5BJTA 3QIBD 4YNYA 1XR9B 2GSIB 3QWQB 4HULB 3D6GA 1S7VA 1LO3H 3PGDB 2K1MA 1IAII 3LN5A 5KSAD 2CDGA 3HE6C 3QUMB 4HZAA 2OQJA 2HTLC 4MS8D 2HLFD 5IMLA 3WL9B 3LN4A 1AGCA 1YY9C 4HS3B 1I3RB 1AI1H 4LGPB 3F7VB 1C7TA 4QCIB 1T04A 3LDBC 2HWZL 4XX1G 2QQLL 3A67L 2F5BH 1DBJL 3QO1A 2EKSA 2I25N 2GT9B 4YHLL 1HH6A 2N7BA 1MLBB 4GKNA 1WZLA 1H3GA 1SYVB 4P2OD 1ZGLA 5CJOH 3D48R 1IFHL 5HJ3A 4K7FB 1KIRB 1CF8H 4OQTL 4PJ5A 4U1GB 1U6AH 4C56B 5IM7A 3MR9B 2E8ZA 5ICXB 1QRNE 5DT1L 2G5BA 1RIUL 5EPMB 1WITA 4WNQB 2DAVA 2VTFA 4MCZB 3GJEA 2YEZB 3V95A 4MD4A 4U1IA 1CXLA 1T1ZB 4XBPB 3BPCA 3QAZB 1I8KA 5TDOB 3IDUA 3RVTD 5C0EA 2IF7A 4BA8A 3K74B 5FGCB 3R1GL 1NDMA 5HHPB 1SYVA 1NBVL 2NW2A 2ARJA 1M6OA 1N3NB 3WNOA 1HH6B 4HK3N 1JZ7A 1CR9L 1T0NB 4JPWH 1YMMB 2NTFB 1JWSA 2PW1A 2VDLL 3TIEA 4FNLL 3RZCA 2FSEA 4WI2A 5GS3A 5GRZA 5F9OH 1QPXA 5L0QC 3QDJA 3LN4B 2FO1A 2J12B 3FQWA 3BE1H 4OCWL 3CXDL 3QUMA 2PW2A 5DRWB 2HVKB 4P9ML 4M7ZC 4WFHE 5LXGH 1VKXB 1W8NA 1I7UB 2BJMH 3TZVD 2QSVA 4JREB 5DUMH 3BDYL 5I0DA 3BSZH 3BDBA 4XHQA 5TE7L 3VGAB 4ZXBC 5BRZA 2OBGA 5BW7A 3WLWC 2C4FU 1L6ZA 3QDMD 4LSUL 4GRWE 4PR5A 5IBUG 3AMLA 4XNQB 1V3JA 5D72H 2V6HA 4TNWF 4MJ6B 2I9LB 5SV4A 3TBVB 2EKJA 4G8GD 4IS6B 4I77L 2DKSA 2PTTB 1I85C 4LAQL 5E9DB 3LS4L 1T7WA 5D5MA 2HT2D 1ZT4B 2WWKT 3BEVB 2WIIA 3QEHB 5DD1H 4KV5F 5DJXA 4AENB 3OGCA 5DO2D 1VFBA 1RV6X 3W5NA 1TFHA 3D85D 3REVA 5JDSB 2G60L 2V2WA 3B2VH 3K1DA 3RWGB 3MV01 3EOBB 2Z4QA 2LAGB 2BSSA 4YFLF 2ZOLA 2YD6A 3NZHL 4LF3B 3O9WC 1VEPA 1VADA 4Q7DA 3QIWC 4G9FD 2A6JA 2IADA 1MFCL 3LEVH 4N90E 4UAOB 1FN4A 4R26H 2EDEA 2HFGH 5DZNA 1FC1A 2AQ2A 2FX9L 2RCSL 3VXPB 2FB4H 4K7PX 5F7DB 2X4RA 4TUJA 4ELMF 5D7LD 5BOPA 5ERWB 3OXSA 1WFOA 4KDTA 3LKNB 4E0RB 5D6DC 5A2LH 4IOFC 2UZXB 3VXSE 5EO1B 4FQCH 1BFVH 1DVFB 3TCLA 5J11B 5TQ0H 1YJDC 3HUJB 4NQVB 4KJPD 2I5YL 2BHZA 1L7IH 3GIZL 4I4WA 4LOUD 4UV4L 2XKNA 1KEMH 4M1GH 5E99L 3I6LD 1HYSD 2H26A 3L5WA 1IQWL 3MBXH 4XAKE 4LHQB 3HMWL 5C71A 2B1AH 4F7EB 3FQTB 3T0EE 3PP3K 1C5BL 4JQXC 3DIFB 2FHCA 5FHBL 2IPKB 2CIIA 4JPKH 2Y07L 4QRRA 2R1XA 2DQIL 2R15A 2ZJSH 2DI9A 5FAAA 5SWSA 1GGYA 1IAIM 3LEXA 4XCFL 3RZCD 5C09A 4C57C 5FM8A 2EE2A 3CFJA 5GZNC 1G9MC 3WO4C 1NAMA 5MEQA 2E7MA 3B4NA 3WUWB 3ZL4L 3STBA 2JCCB 4K3DH 3VWKD 2CDFA 2J8UE 5I9QC 4OFYD 4XXDA 3SDCB 2V7NA 4G80B 2BNRE 1OGAE 4F33A 3MLPA 4RA0C 5J9PB 5FV2A 5DRNB 1ZANH 4M5ZL 4QT5A 4UZGA 2ZUQB 2IH1B 4RISH 1KLUA 3KNBA 4X7CC 3PWNA 2PR4H 2F53E 4NC0B 4HUKB 1A4KA 1UM4L 1HHKA 3U6RA 4PP1C 3OKNA 5JR1H 3BKJL 3UC0H 3P30H 3GSNL 1AR1C 4P59H 4CU8A 2JIXB 1NC4A 3S4SG 1J87A 1DCLA 4OQTA 3U1SL 1U42A 4JKPH 1ETZA 1YECL 1RZJL 3QUXD 3TFKD 3OKOA 3RU8L 4X6DE 3HNVH 5TGBB 2YPLB 2QADB 5EO9B 2IAMB 4WV1B 1J5OH 2IGFL 4WTZA 2FJGA 1MFEH 3SE3C 2DKUA 5HI5C 4KK5C 4OLXL 1QNZL 2DQEL 3CD4A 1GOGA 1Z9MA 1A1NA 3E6HA 1J0ZA 4G8FA 1ZHKB 3T2PA 1KCRH 2JB6B 3MRJB 5IIEB 2R2EB 4HG4K 5AD0B 2O26U 3LH2H 3PWUA 4PRIE 3GEWB 3U4BL 1IC1A 4NWTL 2VIRB 3K46A 3F7RA 2HVJA 4PS4L 1U92B 1UWGH 1VFMA 2VDNL 5C9JA 1HILA 4MHHG 1BQSA 2Z93B 5KSBA 3EYSL 2JLLA 2XICA 2DQTL 4DZ8A 3BPLC 3OKDB 1OD9A 4UV7L 3OB0K 3WSQH 1CIUA 1BIIB 5EU7C 1N2RB 4MNHB 5D71H 1OP5H 4HGKC 1S78D 4H20H 4ZUWA 3ULSA 4TSAL 2CRIA 3KPOA 1SBSH 3V4VL 3RGHA 1DSFL 1Z0MA 4LCUA 2A73B 3O3AA 4XT1C 5EA0L 3MYZA 3LY6A 1I1AD 1R3IH 4LOUC 2V5SA 3LS5L 3X14A 4EDXB 5C08B 1N6QL 1AFVH 2OL3H 4WI9A 4DQOH 2VERN 1IEHA 3JWOL 5FF6B 1TCMA 4NRYA 4PGDA 4YHOL 3MLSH 4S1RL 3T3PF 4ZFOB 1D9KA 2CDEA 3SQBA 1NGZA 1QLRA 1TZHB 1ZSDA 2WBJC 1TVBB 4WW2B 1TIUA 4N8VB 5JIHA 3MCG1 1XF3B 3LAFA 5DJ8B 4YJZL 4M5YL 3M1BB 3BP6B 4PRDA 4UIKH 3QQ9D 1OPGH 5FEBA 3SGKA 2ZUVA 2DQGH 2B8OT 5J89A 4U7MA 5IB1B 4YBQC 5GJTL 5IMMA 2GY7B 4WW2C 4ZUTA 4DKAA 1ES0A 3G6AB 3LKSA 5T1LD 3OKMA 4FP8H 3RGVC 1W0YT 3IDIB 3VRLF 1GIGH 3O8XB 4Y2DD 3KLAB 2GTWA 1WUNT 1N4XH 1XH3B 4R2GB 4MSWB 2A74A 2GTWB 4L9LC 3S34H 2VLJE 3MLVL 4I8DA 4U1HA 3D3VB 5D7JA 4CDGC 1RVFL 2EH7L 4TPRL 2F54D 1I9RL 1MHCB 4TRPL 2P7TB 3IKCA 1QO3B 4NKDA 1VACB 3KPMB 5K93A 3MOAH 4PJ7F 1QFUL 2F58H 3VG0H 1T1XB 1HNFA 1J1OL 2KQMA 4ODWB 5C0IA 1RUPL 1INDL 1D5BB 3FQRA 4LPXA 2CUIA 5K9OA 1AXTH 1UCTA 3CU7A 1I9IH 1IGIL 2JCCE 4HX1B 5ABDE 2YSSB 4MNGE 5B3NA 1A14L 3G6JF 4G6KL 4UT9L 1EUUA 4IEFB 1MFAL 1RI8A 3BP5A 3CC5B 3BMWA 2VLJB 3GO1H 1DLFL 4YDLC 1HSBB 3EHBC 2P24A 1D5XA 1GC1H 2AJUL 3BZ4B 1NCNA 3SDCC 4TNVF 3D39E 1X4YA 1KGCE 3T04D 1R3KA 4ISVA 4JG1H 3C9NB 3H7BA 1JJUA 4ZPTA 5INDB 5C0AB 1MRFH 1K8DB 4N8CL 3T0EC 3CZJA 5KSBB 1BJMA 3QFJD 4B41A 4FMKA 4HIHA 5I16B 4JFPB 4F9PC 5JW4R 4P3WA 4OM0L 2ZOKA 1A9BB 1V3MA 1IC7H 5IW6B 3HRZB 2ICWI 4PJ7B 1KENL 3I3EA 4GLRH 2Q20A 1E28A 2PETA 1DQLH 1NLDL 3K4AA 2IPTH 4NO3B 2D0HA 1DBKH 3QXAB 4LQFL 1BJ1H 1FYTD 4YK4B 5I8OH 3VXUA 3KYOA 3MCKA 3AC0A 4PJFF 5IVOA 5I8CA 1PEZA 3MXWH 2D9QB 4PTTA 4BQ9A 3F65A 4LLAA 3SE9H 5A3IC 4POZC 4WO4B 4WU7B 4P46C 2MKLC 2R0ZH 4DKEL 2R56L 1PKQB 3LN9A 3QR2A 2EYTA 4YDJB 2VZSA 1NCDH 5H2BA 3O11A 3NABL 4M7LT 1CDCA 3CMOH 4MA8L 4EBQH 2H9GA 4HWUA 5JXEA 4N8PA 3FT3B 2A6DB 3ESVF 1MHPL 1QVOA 3PWPB 4DGYH 3MRBB 5F6HJ 1WBYB 3KR3L 4XCEB 4X9GA 3RL1A 3SE8H 2HH0H 2VLJA 2FD6L 4X4MA 3DJ9A 4GT7A 4PJ7A 1SBBA 5D93C 3W2DL 3PJSA 5J8OA 2XI9A 3SJVE 1JGEB 2DLFL 3HI6L 2DJUA 5DJZA 4ZOCA 5DMKB 2XN9B 3OQ3B 5TDPA 3MRCA 4L8SA 1QEWB 1LEKB 3QHZH 4NYLB 5FGBA 4H1LB 1U8HA 5GJSL 4PRIA 5C0IB 3SDAB 3MMEA 2DQCH 1NDGA 2YKLH 3SDCA 5J56B 4ZPTB 1BX2A 1JFQH 3C6SA 4A2LA 3PDOB 4UDTA 2JCCA 3GSQB 4Z7VF 3WYRA 1JRHH 4R4NC 1GGBH 5GS1C 1LO4H 1EK3A 3SDAC 3PWPE 5HYEA 5D7JB 4LCWA 3AVEA 3OF6D 3RUGE 4LSQH 5ICYB 5ILTH 5T1KA 1IKNC 3EJJX 1DANT 3CC5A 5JHLH 4MB3A 5C86A 1JPSL 2BSRA 2BRRL 4IOIA 3DIFA 3K8MA 1CVSC 1BOYA 4F15C 3LSOA 1QBBA 1UYWL 4EN3D 4LVNC 1UWXH 4P9HH 5K9OB 2X1PA 5F7YC 5SWZE 4K07A 2EH8L 5IGXL 1LO0H 3JSSA 3MNZA 1JV5B 3CLFL 3QO0A 4OFVA 3NIDE 12E8H 4KKLC 1XFPA 1DUZB 1IEBA 5HHOE 2OTWB 4XVTL 5ICZB 4HUXB 2IJ0C 4OSUH 2UUDH 3EYUH 1XGPA 4U6HA 3LKNA 4WTWA 1ZSDB 4L4TD 3BRGC 2OTUB 3Q1SL 4U1HB 4TUOB 2E7LC 3DV6A 3MUY1 1XR8B 1F3DJ 4XMPL 3VXME 3ARBA 5I76A 1YEKL 1MCOL 2HTKC 5IR1A 3MRMB 3RY4A 2ED7A 3O8XA 3LQZA 1OTUD 3BPNC 2H1PL 2VC2H 1FIGL 5I1HL 4FFWD 4PJFB 3MODL 5BO1H 5L8JB 2PN5A 3V0WH 3HR6A 4YHYC 5FYLL 3SE4C 4PJBA 1DEEB 3FQUA 3QXDA 1LMKA 2YPVH 2RQ8A 4PRPB 3RJQB 2IAND 2QQNH 5GGSB 2NY3C 1MI5A 5D5MB 5DWUL 4N8VA 1PQZB 2Z93A 4JN2B 3ET9F 1HILB 5KANI 2Y5TA 3BP7A 5I8EA 5IJKA 2DIJA 2V2TA 4FQLL 5FYKL 2YZ1A 2QLVB 2VKWA 5IMOA 5DUPL 2GK0B 4JAMA 3DGGA 4KY1H 3NTCH 4XNQA 2CKNA 2R2HA 4YEEA 3SKNA 4IDJL 4HH8A 4KRNA 4DVBA 4MD5A 3H3BC 1QFOA 1YEDB 1R24A 3MSPA 4JQVA 5EOQL 1ZHKA 1A7PH 2FEDC 5LCVL 3EYVA 5TE6L 3MLWH 2E9WA 4KUCD 3NN8A 4X6EB 4I1NB 4PJXE 4JGJA 3SDXF 2NXZD 1EFXD 5IROC 3QBTB 4JDZB 2P5EB 4F3FA 2W9LA 1KSRA 2A9NL 4ZUWB 3LKRB 5TGBA 4DTGL 1FCGA 4DGVH 1O0VA 3RVXC 3L5XL 2X89D 3ZDZF 3CDYA 3KPRB 5CGYC 3OPZH 4BQBA 3O4LD 3BGMA 3TFKC 4KJYB 5KANG 1U92A 1JNLH 1MRCH 4YWGH 5I8KH 4NJAH 3KPSD 2HYMA 1XGQB 3JXAA 4MAYB 4OUUA 1ZA6A 1HCVA 5HPMA 3HPLA 1CGWA 1TZIB 5IJKC 4TUKL 4LSVH 4WI7A 5F7MC 1DQQA 4K3GA 4PGBB 1OAZL 2VE6B 4L3CA 1OAXH 1F00I 2GYSA 4LARH 1P7QA 4KQ4H 4GBXD 1KLGA 5GGTA 3OMZA 1AQKL 2WLYA 4HJJL 3WIHL 2WWMC 3UJTL 4BM7A 1OGAB 2ERJC 3KJ6H 3NZ8B 4ZXBA 1FFOB 1VB9A 3PGCB 5CHNB 2PTUA 4HUNB 5KS9A 1HHGB 3ZHLA 4PP2A 1P53A 5DFTA 3WXWL 5IF0A 1U8OB 4PJ5B 2JIXD 1E0OB 1L9NA 2XWJA 2DBLL 4K7FA 2HFFA 5JUEH 5CUSH 4UTAH 5I18L 1N64H 3IJYB 3TBYB 3SQOH 1XGUB 4B5EA 4PJBF 1IKFH 5DEGB 1EHNA 3MV11 4FQQB 5EC1A 1RUAH 3DVNA 1JZ8A 2DWEA 5FO7B 4ALAL 1DBMH 1MY5A 1G7JB 1PG7H 4UB0L 1S9YA 3R8QA 5ISZE 5JOEA 5LAXA 2DQDH 4JZOA 3DARA 3ZHDA 2VDRH 3I6GB 1FAIH 1IC5L 1IGML 4GLRI 5FKAA 1KJ2L 3I84A 5DMIL 3Q48A 3P9MA 4PJHB 1K4CB 5AWNL 4GG6E 4J4PC 1MCRA 1GGCH 5DJCB 4XXDB 4QNPE 2PO6C 2VZVA 1R6VA 1A6VL 3X11A 3MZGB 1LE5A 2HKHL 5EH1A 2FZ3B 4GS7B 1IGYB 1KEGL 3G6JA 2HMID 4IRSC 3JWDL 4FABH 3QJHB 3EO0B 4ZDHA 3HC3H 2AJXH 4TSCH 2ADGA 1WVZA 3GMQB 4FFZH 2DM4A 1KJVA 3BP4A 1TTGA 5C7XL 1NEZA 1KIPA 5GS0D 4AEFA 1IGCH 4EDWH 4LCWE 2OJEB 4LF3A 3WIHA 4RAVB 3MOBH 4W4OA 1FV1A 1ZVHA 4OUOA 5D1QB 3MRIA 4YHMH 4HSQA 4K94H 1WZKA 5D2NC 2NLJB 5EOTB 2H26B 1D5MA 5I30L 4NKOB 1INEL 1TJIL 3L3IA 1A5FH 1KB5L 3FJTA 3UAJC 4XI5D 4JO4H 3FOLB 5A16B 2YS4A 4KROC 3IFLL 2D0GA 1ZT4A 1U3HD 1CT8A 4YO0B 3T3PE 4J2XA 3VRJB 4G8GE 3DVFA 2ZUUA 3O45A 2FO4A 1WWCA 1QBML 4IRZL 4PR5B 3ZKXC 1MCBA 1CFQA 1EBPA 4XP9H 3WD5L 1EMTL 1IBGH 2NY4C 1I8IB 1RULH 1WBXB 3LQAC 2E7BA 5D5ME 1NH6A 3WO4B 1WCBA 4TSBH 3P0VL 4MNQE 4DGIH 1J1PL 3BT2L 3S9DB 4Y2DB 1UA6L 1I1FA 3FFCD 1KFAH 4RGOH 3V6OE 2I07A 4LIQL 4C54A 2NY2B 2VN4A 5E9DE 1VFBB 1AO7D 4ERSH 4Q9BA 3EO9H 4KHTL 4RMUA 4WDIB 5CMAB 3RZCB 3TIEB 4XP1L 1MHHA 5IW3A 2H3NA 2XZCL 4G5ZH 4Z7VB 3QT2A 1YMMA 3DYOA 3ULUC 2ICEA 1K8IA 5IFAH 1U41A 5C0CD 3SBWA 3AGVA 3TZVB 2GW5A 4M8QB 4AT6A 2HRPH 3UEZA 4RWHA 4JY5H 4P5TB 3GMLA 4PREA 1MFDL 3MZTA 1QLFB 3IVKA 3EZJB 1BQLH 4ZNEA 4G6JH 2DD8H 1QKZH 3ZZ1A 4KJWD 1DQDL 4PB0H 5ID0A 2JJVA 4L4TB 5DGRA 2ADFL 4NCC1 4WV1C 5JO5B 2G5RA 5ESVB 3BEWB 1CFTA 2HLAA 4OT1L 3O2VH 4LNRA 2JF1A 4QEGA 3MR9A 2Z0BA 4KGLA 5C6PB 4FMFA 4C56A 1FO0H 3EDEA 4XNUH 4GRLC 4LLUA 1T0MB 3CU1A 2X4QB 5DMGC 5IP4A 3EYFA 2OZ4L 1CFBA 4ORGA 2DDQL 4LLUB 4QHMB 4TQEH 4XBEH 1PZ5B 3M17A 5CJQH 3FFDB 1WEJH 1I8KB 1R0AL 1KULA 1OW0A 1FNGB 2Y1VA 1UEYA 1JGLL 1I3UA 1T6VN 4IMKC 5GGUA 4P5KA 5EN2B 2AQ1A 3PQYE 2BNQE 4MD4B 4U1IB 4UAOC 3PNWB 5DK0A 1LK3L 3QNXA 1E4WL 3BEWA 3HPJB 4WUUB 4JM4L 4R0LB 4IMKA 2D7NA 1S5IH 1LP9E 1KIUA 2CLZA 4S1QH 2G5BB 1L7TH 3ZKNC 1NFDF 1XR9A 2K7PA 1IZJA 3RNKB 5BJTB 3EJYD 3TGXA 2IANA 5IK3B 3ROLA 1TENA 3H2WA 1QFWI 5E2UH 3OX8B 4WFFD 2BY0A 3LKQB 1K5NA 1WC7A 5F9DC 1K2DA 4JFQB 2APWA 4M1DH 3QUXA 5HHVH 4MNQA 1BLNA 2EIBA 4S11A 5GSVB 3IJHB 1D5IH 4CVXA 3P9LB 3TM6A 3WNPA 5HPOA 2D3VA 3NIGE 3FT2B 1CQYA 1KELH 1UZ8A 3GHEH 5E95B 1UT9A 1EDQA 4FFVD 5IBUB 1CTOA 4LLVA 1PJ9A 4RIRB 4Z7UF 3WL9A 2AV1B 3WIFB 2YUVA 1HYSC 4IRJD 1LEIB 2IC2A 4QXUL 5HDQL 1AJ7L 1N7MH 1PX3A 4BK4A 5BMFH 3PGDA 5J3HC 3SDCD 2YBRA 1UB5B 3QDMA 5I17B 3H3PH 5I1GH 4JO3H 3QRGL 2ITDA 1SJHB 4TYUA 5H37G 3JV4A 3OXRB 3THMH 2MFNA 3VFOB 1CICA 5C0GA 3HE6B 5L2KB 4JM2A 4PLNC 4F58H 3A6CH 4FXGA 1R3LB 5D8JH 1YQVH 4JE4B 5B38A 4G9DA 3G6JE 5C6TH 3IGAB 4FN0A 1A6TB 5EC2B 5E8DL 3MV7B 1G9NL 1D6VL 1P1ZA 1P69B 5GRUL 4R6UA 3IYLW 2H2PC 1MVUB 1IEAA 1M1SA 4NWUL 3DMMB 4YQXL 1ULVA 2PYFA 3VFGH 2MQCA 3V5DA 4HIJA 1FJ1B 1Z9OA 1UB6A 3BVNB 1G7QA 4CRPA 1S9WA 5DVOA 4AEHL 5C07E 4QLRA 4OCSL 1G7MA 5MENB 4NP4H 1AGEA 4M61A 3VA2C 4RFNC 3UJIL 1KIPB 3WKML 3GMOB 3DNKA 4OF7A 4XPAL 1G6RH 2BNRA 1AO7E 1MUJB 1C5CL 5DD5L 5B8CA 3BAEH 4HXBH 4PV9A 4HKJB 1YEFL 2ZPKL 3ARDA 1UKTA 3G6JB 2VQTA 4N0UB 3VGGA 1I8LC 4Z78B 5CIPH 2XKUA 1OP9A 4HKJA 3NIDF 5H94A 3C87A 2AXFA 5F7FA 4U33A 3QIWD 3BN3B 2C3WA 4W4OC 1MJJA 2JELH 4QXTB 1MCQA 4XC3H 5IV2B 5DXWA 5DJ0A 4PTUA 4FA8A 3DGCR 5IHBA 5E6ZA 3QDGD 4ENED 1QFWL 1WZ1L 4HUWA 1QA9A 1O7SA 4TOYL 1S9WB 5I6XB 1MIML 4IDLA 4JJHA 4JZOB 1C7SA 3CVHA 1BVLB 5CP7B 5MI0B 1T89C 2HT4C 2J2ZA 4U4BA 4OM1H 2X7LA 4Z0XA 3C5ZD 5E6IA 3N1FC 3DWTA 3K0WA 1FBIL 1MJ8L 1YPZB 2NY5L 2EEBA 4PRBB 3WXVH 5IHZB 1F58L 4PJEB 1ZHNA 1YEIH 4MWFB 1AD9A 3PHSA 1VESA 4FTVB 3I50H 2XFXB 2L4OA 2B39A 5GGTL 5ESAB 4DAGL 3QPXL 3TT1H 2B1HL 3IXTA 4YGVA 2CUMA 3ARBC 1S7XB 5FUCE 4LQ1A 5EBMA 1JUFB 3HZKA 4NJ9L 3VWKA 1F2XK 4GRLB 4P57B 2OYPA 5CJXC 5GRJL 2OZ4A 1SJEA 3FB7B 5KSBE 2VE6A 4OCXH 1TJGL 4HHAB 3VRIB 1BM3L 1REIA 1AC6A 4YHZL 5CJBA 3ULUH 1OSZA 1ZA6B 4MAYA 1FVEA 2NY4D 4OUUB 4CMHB 2QSCL 3GSRB 4QRRD 3HG1B 1SM3L 2NY7H 5DRXA 1A47A 4OCXL 4PJ9D 3UPRA 5CFHA 4X7TB 4DN4H 5BQ7B 2Z31B 4JKMA 3W9DB 5B39B 2W38A 2WUBH 3MJ9H 3TPUB 3R8BB 2M8XA 1QP1A 3BZFA 4U6YA 4M00A 2Q8BL 4R97B 2DI8A 3LKQA 5EWIL 5H35A 2P5EA 1U8IB 1KIQA 1U91A 1A7QL 5DK2A 3TT1L 3QPXH 5IVNA 4OJFH 5DDHB 4GBXA 2YD9A 1N8ZB 1FZMB 2BNQA 4YE4L 4PBWD 3AS3A 1F58H 4M3KB 4LAJH 1BJ1J 2NY5H 3MUGA 4G8IA 1I7RA 1MJ8H 1P6AB 4L4VD 1FBIH 2VDML 2FEDD 2F9BT 2PXYC 2R2HB 2VO5A 3L3HB 3CFEB 5HGDB 4RZCA 4OF3A 3KPSA 4F37F 3A6OA 1F11B 1IT9L 1B88A 3RWIA 2C3GA 1JTOA 3BIKA 3UXFA 4TOYH 1A7OL 5B3JF 2IALA 3U30B 4ODBD 5C0FB 4ZFFA 4E42B 1HOCB 2VAAA 5ITFB 3UTZA 3G5ZA 1DEEA 3FQUB 3QXDB 4Z77A 5E8EA 4I0PA 1FAKT 2KZ1B 3AREC 1FFPB 1LDSA 1VEMA 3JWOC 3C5ZA 4I18C 4Y5VB 2DN7A 4NQCE 1GOHA 1YEFH 4ZUVB 4OF8A 4CW1B 1AGDA 3MACH 3BJ91 1FNSL 1C5CH 3JVGA 4UU9A 3QEQD 1G6RL 3CFBB 4N9OB 1XR8A 4WUUD 1EZVX 4AEHH 2Y7QB 1ZT1B 3DYMA 3VWJD 1DLHB 4KJQC 1CL7H 4YH6A 3DMMC 3RQ3A 1X5GA 1F5WA 4MAUL 3B9KC 3QYCA 43CAB 1MCEA 4LPCA 1NCWH 1N59A 1BEYH 3PWLB 4M7JL 3FZUD 5LGHL 4HJGA 4MQTB 1IMHC 4NWUH 5IBLD 1HQRB 1D6VH 5GRUH 4B7IA 1BWMA 5EU4A 4JZJC 1PEWA 3TA3D 2XA8L 5DEFA 3RPIB 4X9FA 4XTRD 5C6TL 5L2JA 3V6OC 4PJCB 1YQVL 5D8JL 3BMVA 1QQDB 1CBVH 4F58L 4PGCB 2AQ3A 1PY9A 4GUPB 2WBJD 4OZFH 2BSRB 3WS3A 1A3RL 2NY6B 3T0EA 1ACYH 1ADQA 2EDHA 4UDUA 4U6VL 2MMXA 2XV6B 3TVMB 3VXNA 2IFFL 1HXYB 3H9SA 1V5JA 3QRGH 5ICYA 4JO3L 4L3EB 5I1GL 4NRZA 3H3PL 5T5NG 3ZDXE 2FJHB 1K3ZA 3BN9C 3QH3B 1M7DB 3B3IA 5C09E 4IRJB 5MEPB 3UTZB 1AJ7H 1QFPA 4QXUH 3GJFK 5SWZA 3S4SB 5C0FA 2FCBA 3EGSA 4P2RB 1JK8A 4KROD 4M48L 3TBWB 2J8UA 3DETD 3EW3B 3GHEL 1KELL 1D5IL 1KPUA 3SDDB 2EDKA 1KPVB 1T5WA 2XQBL 5A16A 3MRCB 4Y4FB 3REWA 5HHVL 2Y06H 2M1KA 1AXSA 4M1DL 1DE4A 1RY7B 1ITCA 3FTGB 1RQ5A 1TXKA 1J8HD 5DJDA 2RJMA 4LCIL 4KRLB 2OJEA 5DDHA 5CKGA 2DQUL 5MERB 3KHQA 4EI5D 5FKPA 1NEZB 3FT3A 2Z31D 3V6ZA 2VLRD 1I7TB 1ZTXH 1UM6H 3BP4B 4P2YA 5BXFA 5JQ6H 3CZFA 4PJBE 1W8OA 4OLYL 2OM5A 3U36A 2Q86B 1LK3H 3UTSA 3CAFA 2J8HA 1MI5E 4PYGA 3RL2A 4NOFA 4X8JB 3GSRA 3C5SB 2D4DA 1JZ3A 1JGLH 4K2UH 2ZP0T 1PG7X 4ODVH 5EUKB 2X4UA 1WEJL 1R0AH 2X4SB 3QSKB 5CJQL 4QGTA 4JRYD 2E27L 4TQEL 1F4AA 2OZ4H 3L1OL 4LMQE 4JFZH 4X4ZA 4JFFE 3HC0B 1AKJA 3E8UL 3VFTA 4MA1C 3QUZD 3GSWA 5F6IB 4M4PA 3C6LA 2G2RA 1A7NH 5LAXB 3HZKB 1FO0L 2EYSB 4XX1E 4JFPA 1HH9B 3S88L 4TVPD 3V0VA 5JW4N 2JKXA 4Y4HA 4RAHA 3BGAA 2VDOL 3N1PC 4X4XB 3O2VL 1C12B 4OT1H 1G7LB 3HCVA 2EECA 3MJ9A 4H5SB 3FB8B 2ADFH 3NCYP 1P9MA 1LDPL 1PYWB 4PB0L 1DQDH 1QKZL 5TDNA 3C9NA 2XWJB 2DD8L 3H7BB 1BQLL 1ZHNB 3T0WA 3BKCH 1MFDH 4KKLD 5EU5B 1I7ZB 4PRBA 4A2MA 2NTSP 4Y1AE 4MDIA 1R5IA 2DTSA 4JY5L 4QF1A 3BPNB 4HF5H 2HRPL 2QR0A 2WAHA 4NQTA 3VMNA 1P6FA 1FZOB 3H9SE 2P5EE 2OLDA 1HWHB 1OD7A 2AERT 4Z7QE 5IFAL 4X7DC 4BFIA 2XZCH 4G5ZL 3ORJA 2HJFA 3HI1B 2EEAA 3EO9L 2NPLX 4NQEB 4ERSL 4HK0B 3FOMB 4XCCH 4XGZB 3RIFF 4V1DE 3OAUL 2HRLA 2UZYB 1EH9A 4LIQH 5H94B 4FFWC 5D2NA 2PXYA 1AIFA 5E2WH 1KFAL 3SGJA 2ZZUT 1UA6H 1R3HA 1XCQB 2JK5A 1ZAGA 3HE7A 1J1PH 3UBXG 4OCRL 1UJTA 3L5HA 4TSBL 3I02B 2NCMA 3SEPA 2MOVA 4P4KC 3MRNA 1RULL 2B7DT 1SMOA 4XNMA 4GBXC 5J6HA 4YDVB 3G6DH 1T66D 1QBMH 4IRZH 1KTLB 4PPTA 3H42H 1UB6B 3E2HB 3FT4B 5CGMA 3ZLQC 5ISZA 2IG2H 3WS6A 3MROB 2ZG2A 5MHSE 3IDIA 4D2NA 3B83A 3CVHL 1NAKH 4NKMA 4MXVE 1A5FL 1P1ZB 1TJIH 5ANMA 4J8RB 1NGPL 5I30H 4IOSD 2OR9H 2ESVB 5ALBH 4KQ3H 3LRGA 3QWOB 4BFBD 4PRDB 4XRCB 5MHSD 3V6FA 3KDMB 1MCIA 4LCCC 1OARL 4EDWL 5JQHC 3MV9A 1EEYA 3UDWC 2XWTB 3DI3B 3MNVB 3QB7C 5C7XH 4PRHB 4J3VA 4TNWK 3PWJA 1RZ7H 1YDPB 4FFZL 5B39G 4TSCL 2KUTA 3EUUA 4FABL 1N5AA 3JWDH 2C1OA 1P7KA 4XCNA 3ARFA 4LCYB 1CG9B 1EEZB 4WHTB 1GRWA 3T1FB 2QQKL 4WFGD 2FECI 5ALCH 5ENWA 3D3VE 2E9JA 1A6VH 1WIUA 1YN7A 1A6WL 1MRDL 3FT2A 3DETC 4X8XA 5AWNH 1ERNA 2M2DA 4ZO8A 5TPWH 4AH2B 4Y4FC 3RWHA 2VDRL 2DQDL 4KGJA 3CDGA 4I18A 4UB0H 1Q72L 3EO1B 3QNZA 4XVSH 1PG7L 5FUCC 4ZFZB 2A38A 4ALAH 5IHLB 5MP6H 4QHLB 3V4UH 1RUAL 3HZVA 2IANB 5IK3A 3ROLB 5IJVB 1IKFL 3QIWB 3RTQA 3WHE1 5HHXH 1PBYA 3UP1A 4P48A 1BQHA 1YMHB 3HZYA 3VFWB 3K1KC 3WDIA 4J8RA 1N64L 4EIZC 1JL8A 5SWZD 2XKSA 2DBLH 2CLZB 3FN3A 1EVTC 2JB6A 4U6TA 4GS7C 1NGYB 4EUPB 5D2NE 4HS8L 3ZE1E 3PNWA 2XOTA 3KJ6L 3UJTH 1I4FA 2LABA 5EN2A 2G75A 3WIHH 2FJGB 1AQKH 4G9FE 4QWWC 1IM9D 3MLRL 4KQ4L 3S96B 4XWOD 5J6HB 4P3DA 5D96B 1AHWB 2NX5D 1OAXL 1X5XA 1OAZH 4ZUSB 1X5HA 3I02A 3OR7A 4U1NA 2X44D 5IB3A 1HIMH 3PDOA 1ETZB 1CLZL 3RHWF 2CLVB 3VFPA 1SY6L 3UTSE 4LHUB 1PZUB 3N1QC 5L2KE 1HSAB 1NANH 2PXYB 5E0QA 1A3QA 4NJAL 4NQDE 2FLBT 5KVEH 5BV7L 4YWGL 1MRCL 5I8KL 1RZFL 1JNLL 4J3TA 5EFIB 1CVRA 4KROB 5FV1L 1C5DA 3NOIA 5I75B 5DMKA 3C09C 3KYMB 4P23B 4UINL 3L5XH 1FSKB 3D9AH 5ANME 1KLUB 3KNBB 2A9NH 4NZJA 1XZ0A 2PKDA 3MNWA 4ACPA 5KSBF 2DLEA 1QLFA 5EU6D 3GMLB 2NY4B 5BW7C 4HCRA 2X1OA 4AT6B 4XI5C 1A7PL 3QDJD 4CDHA 1EFXA 2ENSA 2EYTB 4QRPA 4YDJA 4F7CA 1RJYB 1SJXA 1JPFB 5MEQB 3QIUD 3VRLE 2VKXA 4IDJH 4LPYA 4K9EC 3ZKQD 1AO7B 3T0XA 3MJ7B 1WCQA 3RX8A 2YPLE 3D9AL 1MHHB 4UINH 4JRWA 5D7IF 1BF2A 4F7MB 4MHHI 5FYKH 4FQLH 1RZFH 5BV7H 5KVEL 3RZCC 1QR4A 3KXFE 2V5RA 1SY6H 1HI6B 4AQOA 5JIPA 1CLZH 4X0KA 1HIML 5I1DB 4U1GC 2H32B 3X12A 5CSGA 2GJ6E 2GSGB 4GW4B 5I1HH 1FIGH 2VC2L 1JBJA 2H1PH 3UROR 4JKLA 4P46D 3MLRH 1LK2B 1JN6B 1JWUB 2W60B 1HYRC 1QHOA 4NQEE 1YEKH 4OV5B 3UPCA 1VGKB 5INDA 3SN6N 3K4ZA 4HS8H 5SX5H 3U36B 3UZVB 3D2UD 4YR6A 3AREA 4RBPH 4MQSB 4U1KA 3EYUL 4NKOA 4KRPC 5DGQA 1JPGB 3F7YA 4OZHE 5HHXL 4J3XA 1GC1C 4KK6C 3GMMB 2EXYD 4PJ5E 4GKZA 3V4UL 3CLFH 3MV7E 3ARSA 5MP6L 4UQ2A 2EH8H 1X5JA 1X4XA 4CKVX 4L1DA 1Q72H 4XVSL 4NIKB 3QUYA 1UYWH 3GMQA 5E8NB 3KPLB 5TPWL 2BRRH 3EO0A 2C4FT 3WLBA 3HMXA 1CICD 1JPSH 4PJAB 5JHLL 1A6WH 1MRDH 5EIQA 1EEUA 2VN7A 5FGSA 3TBVA 3EOAA 2W60A 4LSQL 5ALCL 2QQKH 1INQB 5A2JH 1TVHA 1Q8MA 5BRZB 1UJ3C 1MSPA 4U0RC 5DJCA 4E9LA 3CH8A 4N9GA 3QA3B 3GGWA 5DUBB 4DCQA 4X0KB 3I6GA 1RZ7L 1JFQL 2YKLL 1WK0A 4OZGF 4PJFE 5D7KD 5K9KB 1OARH 3WS3B 1G7JA 3BD5A 1DTUA 4U3HA 4JY4A 1YMMD 3DUSB 4QRPE 1S78C 3QWRA 2DQFB 3CFKA 3GSXA 5IOPB 4KQ3L 5ALBL 4BKLB 4PFEA 3N0PB 2OR9L 2DLFH 1NGPH 1BFSA 1RJCA 2P46B 5EU4B 1AO7A 2HFFB 3PP3H 4K8RD 3OKEA 1NAKL 3CVHH 3BP6A 4P2RD 3UTQB 4JCMA 1LP9A 4G43A 1HE7A 2IPUK 4GRWB 5HHPA 2HH0L 2KQNA 4PJ8A 2IG2L 5BRZE 3S35X 43CAA 1MHPH 3P0GB 1WJ3A 3H42L 1Q38A 4Q6IB 3NABH 3G6DL 5L2KD 1KLGB 1CDBA 1UXWB 1QRNB 2Q76B 2NZ9C 2R56H 4JEGB 3SCMB 3SE9L 5D4QA 2UY7A 5CLWA 3L7EB 1PY4A 4OCRH 3VG9B 4DFIA 4Q6IC 3VGFA 1TZIA 3WFZA 4P0DA 1MCNA 4LQFH 4MJ5B 4LDLB 1N0LA 5E2WL 1T89A 4R3SA 1NLDH 3FFCB 3B5GA 3Q5YA 3QG6B 3OAUH 3ULSB 2F54E 4XCCL 4WFHD 4BZYA 2JE8A 5F71A 4EQ2A 4JANA 1NUGA 5DS8B 4X7EC 2LTQB 4PJGE 4JFOA 3ARRA 2WLZA 3KS0H 2DYPD 4M4RA 4NFCA 4CVUA 2XY1A 5GZOD 2QKIA 4F37K 1T4KA 5ECJE 3QDME 3BZDA 1Y0LB 3S96A 3KPSB 4H1LG 4WWKC 1EAPA 1IRAY 3FHQA 4NQDA 4HF5L 3MO1A 3OSKA 3BESR 3BKCL 3QAZC 3W39A 4G8FB 4HLZG 5J1TC 4C55A 4L4VB 4X5WA 1LDPH 2AJUH 4JFHE 1GC1L 2HLFC 2GSIA 4WGWB 2ATPA 3DGGB 1ORQB 3TNNB 4IJ3C 5D2LF 1DLFH 1CFSA 3GO1L 1Y0LA 1DVFD 2VDOH 1UEMA 3S88H 4B7LA 2MJWA 4G6KH 1A14H 2GHWB 4KV5E 1A7NL 4N68A 3MRQA 3LCYA 2A83B 1IGIH 1I9IL 4K71B 3E8UH 1INDH 1RUPH 3EFFA 4JFZL 4JGMA 4PJFA 3L1OH 4LP5A 5DFVD 1QSEA 2OCFD 1U3HC 1OSZB 2E27H 5HGHA 1QFUH 2F58L 2R23B 4ODVL 5F88B 1ZA3B 4K2UL 3MOAL 3UTTB 1SEBB 3DPBA 3CMGA 5SWQB 2PUQT 1UH2A 4ZNCD 5E56A 3ARFB 4WHCA 1I9RH 4TPRH 1D7FA 1RVFH 2EH7H 1R5WB 3SBWC 3FZUC 4OLYH 3S34L 5HGAB 3MUHL 1UM6L 1ZTXL 1NBZB 5JQ6L 4LIQE 1N4XL 3CNKA 1ZXQA 2V5TA 1ZGLM 1X7QB 2DQUH 2VLKD 4V2CB 1DUZA 1IEBB 5ICZA 3VI4E 1GIGL 3H7LA 1LP9B 4G43B 3V6FB 4E41D 4ELMB 2PYEA 2ED9A 1NAMB 1F13A 2L7JA 5HXMA 4LCIH 3MNZB 2GJJA 3AROA 3GSVA 3TA3B 1ZOXA 3MX0A 2V5YA 2DQGL 1U2CA 2Y06L 1HKFA 5JORA 2XQBH 2WP3T 4NOBA 2R1XB 4F80A 2HT2C 3QUXC 4IOIB 1IGTA 1GXEA 2X10A 3VGHA 3FQTA 3FT4A 4M48H 1RHHB 1H8OA 1DJSA 5T1KB 5GGRA 4X5XB 4MCYB 4CU7A 5DJ0B 3MLSL 2R39A 5HVHB 3JWOH 4OGZA 3VJ6B 5CJ5A 2DMKA 3ARGA 1BX2B 2IFFH 3C6SB 3O81A 3LOWA 3ARDB 5FOJA 4U6VH 1R3IL 4PJAA 1ACYL 5EA0H 1DSFH 3VD3A 1A3RH 3V4VH 2I9TB 4Y5YC 2VRAA 3KPLA 4XGZA 2X9WA 4H20L 4WGVB 2ESVE 1CBVL 1I1YA 4YFLI 1Y6MR 3WSQL 3BWUC 5D7IB 1B0GA 1JGEA 2DQTH 2XA8H 5CS7A 3EYSH 4DEPB 3VWJC 3QISA 1U8LA 3D18A 3QQ3A 4HZLA 1WWBX 4Y5YB 3RDTD 4D0BA 1A2YB 1KYOK 4GKZB 4QHUB 2PO6A 3P40A 5LGHH 1N26A 2FLRT 4M7JH 1BEYL 5K33A 1NCWL 3KYAA 3U4BH 4MAUH 3ME0A 1BVKB 1I1AA 3BIBX 4BUGA 2EDYA 1CL7L 4O2CA 3G5VA 1KCRL 1KYOJ 3JTTB 4YGAB 4ZUUB 2BVUA 5E5RB 2DQEH 3LKPA 2YC1B 4KDVA 1TPXC 4L9LB 4OLXH 2V7HA 1DR9A 4IHOA 1FNSH 3VE0B 4HFWB 3MACL 4WI4A 1J5OL 2BP3A 1T83C 4L4TE 4ONHB 1KOAA 4OFPA 1UENA 3NVQA 1VFOA 1T7VA 3QDMB 5I17A 1KB9J 1RZJH 4QRTA 3U82B 2FR4B 5BRZD 3OG6B 2NY3B 3E6FB 3PDGA 1A7OH 3KS0J 2XXMB 4QRSA 4P59L 3GSNH 3P30L 3UC0L 1WZMA 3BKJH 5JR1L 1IT9H 4M93C 4Y2OA 1UM4H 2D31B 2PR4L 3TNMA 4HUMB 2VDMH 3PE9A 4M5ZH 4U1MB 4MNQB 3UTSD 4QYOB 1RJYA 2X4OA 3CH1B 5E5UB 1EFXB 3FFCE 3OWEA 4YE4H 3OKKB 1I7TA 2XTJE 2GFBA 3U4EB 2BSTA 4K3DL 2ICES 2BVPB 1FVDB 5AAMA 4ENEC 4OJFL 3V7AG 3RNKA 3ZL4H 1A7QH 4LHUD 4HBQA 4PRHE 3G9AB 1NC2D 3BP5B 2YRLA 5EWIH 1RSFA 3DYPA 4JFFA 5HYJD 1S7UA 2Q8BH 4P23A 4XCFH 1O5DT 5EPMA 3MJ9L 4HX1A 2WUBL 3KWWA 2ZJSL 1N6VA 1YUHB 3DX8B 3FL7A 4DN4L 1Q9LB 2DQIH 4EUPG 4KKBD 2Y07H 2NY7L 1SM3H 5I71B 2QSCH 5GGUB 2XWBA 1C5BH 2AJZA 3T08A 2BC4A 5B22A 3ULUL 4YHZH 2B1AL 4CMMA 3HMWH 4NFBA 3MUJA 4AYFA 1BM3H 3L5IA 3D39D 1ZGLB 2YA1A 1TJGH 5DHVB 1KEML 4M1GL 4PRNB 5EBWA 4UV4H 1C08B 5GRJH 2WV3A 1KTDB 1NJ9B 4P3DB 3QH3A 1L7IL 3GIZH 5TQ0L 2GITB 4NJ9H 1PDKA 1CL7I 1BFVL 3OJMB 1WTGT 3BWAB 5E7FA 5ACMA 3VXNB 4IRSA 4LVOB 3GSUA 1I8MB 4HS3A 3KLAA 3W11C 4D9QE 2ZSVB 5IMLB 2B1HH 3Q0HA 3F12B 2E8YA 4Y0GA 5ESVA 4DAGH 1XIWB 4KJWC 1RK1B 5GGTH 4P46A 4R26L 3I50L 3B5HA 4X98A 3IDJA 2I26N 1MFCH 1YEIL 3DUHA 3LEVL 4JRYB 4LNVA 5DEFB 4JJ5A 3WXVL 4WTZG 3D69B 4NNXA 5GGVY 3PXHA 4HDIA 4JFDA 5DJ8A 2D7PA 4PY8J 4PLJD 1FG9C 2FBOJ 4OM1L 5SX5K 5SX4I 3B2VL 2A2QT 3J8F7 1T20A 3UCRA 4R9HA 2NQCA 1MIMH 2Y7QA 5DD1L 1S9XB 1U3HA 4R7DA 5FECB 1WZ1H 1QFWH 5E5MA 3NCMA 5I1AB 5F72S 4LAQH 4XC3L 4I77H 2JELL 4LKXA 2E7LA 1C16B 2HN7B 3O4LE 2I07B 5D72L 1C8PA 4LSUH 1I1FB 4LCYA 1CI5A 3QUZC 4XCNB 4Y8AA 2ZPKH 4TTDD 3IS0X 3QIBC 3NFPB 5IB4A 3L9RB 1FFPA 3BN9D 5DUML 3BAEL 4HXBL 4F2MA 3HB3D 2QADD 1RZIB 5DD5H 4I0PB 4X4ME 5DHYA 5LXGL 4CADB 3V7MA 3H9HA 2VAAB 3D25A 1NGXA 4KMQA 4XPAH 3SO3B 4OZIB 3IDNA 4HIIA 4X99B 3WKMH 3UJIH 1J05A 2BVOA 4L8DB 3CXDH 3JWNC 4NP4L 1KLFA 4OCSH 4BSWA 2D0FA 2WNGA 4NDMB 3N1GC 3QPQD 2WW8A 4OAWA 3QWOA 2VIRA 5HYJA 1AQDA 2WWKO 5FIEA 3VFGL 3LKOB 4FNLH 4NC1C 4YQXH 4WWKA 4JPWL 2AV7B 1AKJD 1CR9H 3BQUD 1EAJA 1WAAE 3RWJA 5CEYB 2DF3A 1A4JB 3W9EA 1G9NH 1NBVH 2EDDA 5E8DH 3R1GH 3KPPB 3U30C 4GG8B 1I8LA 1KV3A 1FV1B 4QHNB 2NY0B 3A6CL 3ZYJA 3SDAD 2E7HA 1ND0A 1QSFB 2VWEC 1HXMA 2RAMA 1K9TA 3VFRB 2BRQA 2OMNA 5EUOB 3THML 1XGTB 3RNQB 4NCC2 1EV2E 1F6AB 3DVGA 4HIEA 1S7WB 2XPGA 4ZDHB 3L3KB 4JQVC 5KSUA 2Z31A 4RGNB 5BMFL 5IKCA 1N7ML 2VABB 4HEPG 5HDQH 1GVIA 4OFDA 4NQCB 1U6AL 4I2XB 2GTZB 4WU5B 2WINB 1IFHH 3Q3GB 2Y25A 2J5LB 2BVYA 5CJOL 3P3YA 4KKCD 6CGTA 4NPYB 3RKDC 3F62A 3OHXB 5DI8A 1CDYA 3NFNB 1ZV5A 2ICWA 2R2BA 3C60C 5DRNA 4Y4HC 3VFSA 3QULA 2APXA 3VFNB 4JFDE 2F5BL 4JM2C 1G0DA 4LPVA 4Y16A 4Y5XC 2QQLH 3A67H 5I66A 2HWZH 3R06B 5FO7A 2IAMC 5E2UL 1HHHA 1FHGA 4FQQA 5EC1B 1G7PA 5HD8D 1XGUA 4HAFA 5FYKU 4M6AA 3CFJB 3ARFC 1L7TL 2DLHA 4S1QL 4U49A 4Z7WF 1T83A 1S5IL 3WMSA 1OP3H 1G9EA 4JM4H 1E4WH 4TN9A 1OP5K 3SOBL 5D93B 5C0JB 2EO1A 4X6DF 1HHHB 2IBZY 4X6DA 3NZ8A 4ZXBB 4Z7WB 2CIIB 4WO4C 2DIBA 3AFLA 4BSVA 1FGNL 1F6FB 2IQAB 3VFNA 2V9RA 3O6FA 5C3LD 4NHUA 3UMTA 4JDTL 2DDQH 3IRZA 4XBEL 3VXSB 3MGOA 5I1LA 3BPLB 5FM4A 1WT5A 4PGBA 3L5WB 1JI2A 1JP5A 3O3EA 3I3BA 5J1AA 1NMCB 5C3TA 3N9GL 4MX7B 3T0AA 1U8NA 4NQVA 3L3GA 5CEXA 4AIZA 4XNUL 2CMRH 3IF1B 3RI5K 3U46A 1EHAA 3ZYZA 3WDJA 2UWEF 5D7LE 4OAWB 4YIQA 1WAAA 4HGWB 2VWEE 4D0DB 1VFAB 1J05B 1NBYB 1MUJA 3DVGB 3MFFA 5D6CA 5F9JA 3AAZA 4G6JL 5IFJB 5FFLA 5C0ND 2UYLB 5AUMB 1NUFA 3PIQA 4F2MB 2VMFA 5GRVK 2AJVH 4APQA 1YY8B 5D96C 1KBGL 5FB8A 4HW6A 3TT3L 3KLSA 4E5XB 5KW9L 4UOJA 5D7JC 2JB5H 3REVB 4U2ZA 1B6UA 1A6ZA 3HUJE 3OGCB 1ED3A 3GJFB 3RWDB 1NC4D 2AV7A 2GJZA 1NUDA 4XP1H 1MH5B 3MA7A 4KHTH 4DEPC 4E41E 5IMOB 4XCYB 4HKZB 2I60L 3HS0A 3QEQE 4QGYA 4XPFL 2W0FA 5TJWK 4R4FL 5I8EB 3C09B 2V2TB 3RTQD 4RGOL 1BREA 3RWCA 4HIIB 3H9HB 4CADA 3BT2H 4DGIL 4NNXB 3UBXA 4P2QD 3P0VH 1IAKA 3RGVA 4OFYA 2NXZB 4P2QB 3MLUL 3TVMA 3SGEI 1EMTH 1HEZA 1IBGL 1YY8A 4KVCL 4XP9L 3WD5H 5CEZL 2GKIA 2R1YB 3RJDA 3MRMA 4RWYL 2EDQA 3T2NH 2UV3A 4LKXB 4AJ0A 4WCYL 3U79A 4UTBL 5D6CB 1J8KA 2FSEB 4HLJA 4HWZB 1S7TB 3TO2A 3DV6B 3RPIA 2YUWA 4CVXB 3IFLH 4LPWA 4JO4L 1KB5H 4OCNC 2UVFA 4OV6F 2VZOA 1XGPB 1INEH 4JFQA 4K94L 5D1XB 5DQDH 4YHML 3CX2A 2NY5C 4PY7A 5CEXB 3HE6D 3MOBL 1H5BA 3GSNA 2C4XA 2R0KL 2VSDA 1QHPA 4WFED 3TJHD 2DRUA 1IGCL 2VITB 5CBAA 3QEGL 1KXVC 1FFNA 2KH2B 1IGJB 1OL0A 1YUHA 3DX8A 4NN6C 1BFOB 4QOKB 4H0IA 2AGJH 1ITBB 1FC2D 2AJXL 2EDFA 3K2UL 3ZTJH 3DBXB 1FZKB 3HC3L 4WNQA 1M71A 3RDTB 1GCFA 5D6DA 5I73C 5DK0B 4KDTC 2EDJA 4JCLA 4P4KB 2IWGA 5ICXA 5D7LA 4F9LC 2DTML 1RZGB 1KEGH 4P5KB 3S5LA 4Y4KB 3S35L 1YPZE 2HKHH 1FVDA 3G04B 5E4IA 5BS0A 3FFDA 3OKKA 1GGCL 2EEDA 1Z9SA 3KXFA 3MREB 4M1CC 5F7EL 4PLOB 3OF6A 1IM9A 5DMIH 1KJ2H 2X4QA 3OV6A 4QYOA 2VLLA 1IGMH 1FAIL 1IC5H 1P5VA 3MQIA 4F7PB 4LEXH 3O0RH 5T3XD 5JOPE 1CLYH 3GI9L 1OT1A 2VNCA 4Y16B 4FQHB 4C4KT 4JFEE 1DBML 4NM8H 3IKKA 4QCIA 4ODHL 4POUB 4GFTB 3AM8C 3KWWB 1OHQA 3RWEB 3DRTA 3STZB 1J9CT 4NPYA 3S97C 1HHIA 4MMXC 1BP3B 2C5DC 3SQOL 5J6GA 3NIFF 1XT5A 5FGCE 5CUSL 3Q3GA 5JUEL 4UTAL 5I18H 5DO2C 2ARWA 2YA0A 5GISL 3WXWH 3HAEH 4Y4FD 2NY3D 1AD0B 4UT7L 1M7IA 1NPUA 4IMLB 2ZUTA 4HJJH 4U6YB 3VXUE 4IHOB 2XPGB 4PJXF 1S7WA 4YUEH 5BZWB 3U4AA 1ZVSA 5L9DH 3TPUA 4EVNB 4WU7A 2NX5A 2OMBA 4LARL 1J88A 4ZODA 1XGTA 4PTTB 3GKWH 5I8CB 5KVGH 4LSVL 4TUKH 2VLRB 2X4PB 3O8XD 4KZEH 3S8WA 4LLMA 1N5YL 3HLAA 4MDJA 4N1HB 1IILE 3RKDD 3VXMD 5I1JL 2P45B 3WUZA 4R2GD 1NC2B 4X6CE 4HHAA 1A4JA 3W9EB 1JHTA 1SJEB 3FB7A 4WI8A 3L5JA 3DX6A 3T4YA 1H3PL 4QRTB 1E4JA 3OPZL 5E70A 1XMWA 3KJ4C 3TLRA 4PJ7E 3L3DA 2PCPA 3WN5A 1G7HB 3S3JA 1A6UL 4DGVL 4FFYH 4DTGH 4ONHA 4OLVL 3ZT5A 1WBXA 3SCMD 1UWXK 1J0YA 4GW5B 4LK4A 3TYFB 3KPQB 1QG3A 4JQIH