3MLRH

Crystal structure of anti-hiv-1 v3 fab 2557 in complex with a ny5 v3 peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
226
Chain Sequence
EVQLVESGGEVKQPGQSLKISCKSSGYNFLDSWIGWVRQIPGKGLEWIGIIYPDDSDAHYSPSFEGQVTMSVDKSISTAYLQWTTLQASDTGKYFCTRLYLFEGAQSSNAFDLWGQGTMILVSSGTTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlrH01
3WNMA 5L6YL 1SEQL 2RQ8A 3LRHA 1LDPH 3QUMH 2YMXH 5H94B 4QRSB 3GDBA 3HE7A 1EFXD 3UBXB 3D2UD 2LVEA 1IKFL 2ATKB 4P2OB 1K4CA 3M1BB 5CGMA 2HFEB 3KYKL 1JZ3A 3QCTL 3F7QA 5IMMA 4J3TA 3VFNA 1ZLUH 4PGZA 4PJEF 1UG9A 1MRFH 2NTFA 3N50A 4FN0A 3O4LD 4O2FB 1SY6H 5EU6E 4Q9QL 2J3SA 1Q0XL 2WUCL 1QRKA 2YZ8A 2OQJB 4ZXBB 1A0QH 4NP4H 2E6PA 3TO4C 1G7LA 3QWOB 4LEXL 3HC3L 4OCXL 3GBNL 3HUJB 3ME0A 1R5WA 3KLAB 2KQNA 3VFUA 4XNQB 4I9WD 3PHOA 4PJCE 1XR9B 1F13A 4K55A 1WLHA 2ZOLA 2VZVA 2N7BA 1DTUA 1JTPA 2BRQA 4MJID 5F7EH 3BP4A 5I30L 5EC2B 2CJUH 4DGYH 3KGRA 3HPJA 3KPOA 1H5BC 1U8KA 4NQDA 4KV5E 2DQJL 2HN7B 5F9DC 3GSQB 4PJHF 5K9QG 4FTVD 5DJXA 4RWHA 2OBGA 2CKBL 5IQ7H 2CDEB 3GSXB 1WQVT 3KNBA 3DRTB 2AJYH 3UZVB 4ZUSA 4PJDA 1F4XH 2HVKB 1UH4A 5C92A 3DIFB 2L7UA 5C2BH 2BOBA 1ZT4B 3D0VB 2VZOA 2MSPA 3GIVA 3O4LE 2YKLL 4LKXA 4NO0B 4TRPL 3DYMA 3UBXI 1S9VA 2R2HA 4JDTL 3NA9L 3FONA 4WGWB 2DJUA 1T7WA 5E9DA 1FVCB 1ZT7B 4QRPB 1OWWA 4JO4H 1IAIL 1KPRA 3O9WB 3EOBA 1AGDB 1WBXB 3MBED 3MV9A 1KJ2H 2XOTA 3QO1A 4JREB 5JORB 3AUVA 3FZUD 3QWRD 3WFEL 3ARDB 2VYRE 3K7UA 1GGTA 5C08B 4MJIE 5DJCB 4XCCL 2Y25A 5KTEL 5FCUL 4HCRA 2YD6A 5L2KA 1I8LC 5DA0B 2LV4A 3MV7B 1CVRA 5AWNH 1XGQB 5T1KB 3DGCR 3BZFB 5KW9L 2X4TA 1YMHB 1NDGA 4FTVE 4LSRL 2FX9L 3CDFA 4RDQG 5IJKC 3QXVA 4PP1C 3O2DL 3SKJL 3O11A 2XWTA 1P84K 4HKBA 3TIEB 2DM3A 2PCPA 4F9PA 2OR7A 4G43B 4WTZG 2IPKA 5IF0A 2I60L 3IU4L 5CD3A 3BISA 3BSZL 1GAFL 3K3QA 4OD2A 5MENB 4Z7UB 2BSTA 2C4XA 4ZFGH 2P48B 4IRSB 3GUTA 1NGXB 5FOJA 4UBDC 3KPPB 2QV2A 5DD5H 4ZFZB 4M9PA 3KPNA 2G5BB 3P73A 3BP7B 1WISA 1HKLL 4F7PA 5K59E 1HHHA 2Y72A 4X5WB 1DANU 1HCVA 2ITDA 2PTTB 5LWYH 3ZYOA 1RD6A 1CGSL 5JLZB 1I7UB 2JK5A 3AB0B 1U8JB 3GJFK 1FGNH 1DLHA 1UC6A 3QNYA 4HIEB 4YFEA 3OJ2C 5TDOA 1L7IH 4KKCC 5D1QB 3V7MA 5C0DA 3V5HB 4X98B 5C0BB 2JB6A 4UDUB 3VMPA 3MLPA 4DGIH 2HT4D 1M7XA 2DQTH 2Y23A 4PLOB 3DX7B 1ORSA 3HRZA 5KG9B 4PD4J 5T1DH 1PYWB 3R4DA 3AREB 5DVNA 5I0ZA 3VW3L 5F3BB 4UTAH 5JZ7C 5GRJH 3SDAA 3ILQC 4M5YL 4R7NB 5C7XH 4JEGB 3PQYB 1SM3L 3RL1B 1KIRB 1DJSA 1P9MC 1RURH 1G6RB 2ITCB 4YHOH 5HHOD 3AY4A 5BZDB 3SGDI 5JHLH 3V0VA 3L3HB 4BKLB 4R96B 5DJ6A 1YYMH 1QFWL 2D2OA 3DUUA 1JF1A 4KRLB 5T1MB 3LRSA 4S1QH 1C5BH 4ZPTA 3DVNA 3VXOA 2UV3A 3VRJB 3DI3B 5TE6L 2CR3A 1HN1A 4HFUL 1T1XB 5C1MB 1OGTA 2FEEL 3CDCA 2HRPH 3OGCB 1NGZB 4UT7L 4NN6B 3OQ3B 5J4MA 1QSEB 1NFDE 3QUML 2YMXL 5EUOA 1F2QA 3VD7A 5I1AA 4GAGH 3SKNB 5ESVA 3QG6A 1IMHC 4AZ8A 3K8LA 1A6ZA 3QH3A 5BRZB 4CDGC 3QIBB 1RIVH 4PRID 2Q3AA 3T0XA 1NCTA 4GRWF 2GSIA 3VRLE 4OLWL 4J6RH 2NY0B 1F02I 1ND0A 3HMXA 1S7XA 2EYTA 5JHDB 3IRPX 2UUDH 4OM1H 4F33A 4I18C 5HHNA 1BD2B 5CEZL 3DARA 1A0QL 1CLOL 2ESVA 2QQKL 5HHOE 3UJIL 5A2FA 2E9IA 3TPUB 3SKOA 2MCPH 4MB4A 3T4YA 1FZJA 3EYSH 4PLKC 3P11H 3DXAD 4UU9A 2H2SC 4UIMA 5D1ZA 5CZVH 1NCNA 5BZWA 1FL6A 1ZHBB 4UV4H 3CGTA 3TN0D 5IVXF 1QG3A 4JG0H 1FH5H 7FABL 1VFUA 4GKZB 4PJIE 5E8OB 4EDWH 1N2RA 3LKSB 1RZ8A 3FQUA 4PRHD 2ICWB 4OQ1A 1A14H 5FO9A 3KPMB 2CJUL 3BMVA 1UEYA 4OLYL 4XPAH 2YPVH 1ZANH 2JJSA 3MRQA 1T0MB 1SBBA 3OXSA 1VADA 4BZ2H 1FYTB 5IQ7L 2VLJB 5IM7A 4KKLD 3FAXA 2AJYL 2PO6A 1R3HA 2D4FA 4FQJH 2AK4D 1EX0A 5EWIH 1C7TA 2WQ8A 3QPXH 1V8HA 4XZUA 4Y5YC 3D3VD 4KDTC 1Z3GH 3FT3A 4PRIE 1MWAA 1P6AB 3RRQA 4ISVA 3ZE2E 4OJFH 5C2BL 4DKFL 4NKDA 3RNQA 2YPKA 3JTTA 4KRPD 3H0TB 4MMZC 4RCAA 2BY2A 1B6DA 1KUMA 3RY6C 1INEH 3SGJA 1FFQA 3ALWA 4S11A 4JQVC 1SYSA 5JIIA 4JO4L 4PS4L 3REVA 1DN0A 5GGTH 3C5ZB 3DXAE 3C60C 4OZFH 4PRAB 1I1CA 4FHBD 4K94C 5D4QA 3PGCB 4Z78B 3MRDB 1OTUD 4DCQA 4HK3J 2WINB 1CGUA 1VHPA 3I9GH 4HWBL 1NAMH 5AD0B 1SJEB 2A77L 5FKPA 3VWJB 2YSSB 2BHZA 4QLRA 4MQ7A 3B5TA 3BN9D 3V52H 2JE8A 5EO9A 1DBKH 2FZ3A 3OB0H 3F5WA 2Z35A 3QO0A 5DMGD 5CEZE 2I27N 2BRRL 1OOAA 2DICA 2V9RA 1KN4L 4JFXB 3VD4A 3IYLW 3WJJC 4HWZB 4QOKA 4MJ5A 2IAND 4W70A 5D9SB 3H42H 1JGVL 1PG7L 3ZE0E 2AK4E 1NCCH 4XMKL 5GPRA 1VA9A 1OAUL 3VI3F 1CE6A 2BNQB 4I77H 3HCVB 4HKJB 3RWFB 1TPXB 3ZLQC 5HYQA 1FDLH 3KLHD 4F7TB 1JVKA 2HYMA 1AO7D 2BX5A 5ID0B 1G7IB 3QDHA 4R2GB 1DBMH 3P0VH 1KLUA 1VGKA 4NIKB 2MWCA 4N0UB 5EU6A 4XBGB 4ELMB 4WO4B 4X4YB 5KSBB 4UQ2B 5F6IC 4GG6A 3C9NA 5DS8A 4YGAB 1CBVH 2OTUB 1BJMA 2X89A 2AJZA 5DUPH 3QNZB 5EH1A 1VENA 5LGJA 2YUVA 5T3XH 3FO1B 1PFCA 4JO1H 3TBTB 4ZS6D 4PJCA 3OHXB 3CDGB 1DQDH 1VGEL 5T1LB 4PGDA 5DJ2A 4DGIL 4DFIA 1WWBX 2DQTL 5DQ9B 3LS5H 3S4SA 3KPRA 3VXRB 1Z9SA 5TH2A 2K3TA 3H7BB 1EMTL 1J05A 4OCWL 3QSKB 4K2UL 1MFBH 3MRMB 4KJYB 3QXDA 5C7XL 2YPLB 1HHIB 1IT9H 3AAZB 3VE0A 1FL5A 2B0SH 4P2CG 5JXAH 4OLUL 4YHOL 1HXMB 2IANE 3BH8A 4OQTA 3VWKC 1QSFB 1KB5H 4FNLH 4XH2A 4CMHC 3QUZB 4MNGB 3HR5A 5KZCB 4I2XB 3EOAA 1WFUA 4XVTH 1AO7E 2EDHA 2ED9A 4XHQA 1JN6A 1U8QB 4Y4KC 1MCKA 2CXGA 2OZ4H 3O4LA 1C5BL 1HILB 3EOTH 3T0WA 1RMFL 3UBXG 4NRYA 4QRRD 5FUCE 1IZKA 4O9HH 4L4TD 4FMFA 4H26A 1ZWIA 5E6IC 4YHPB 4FA8A 1IC5L 4U6HB 2WBWB 3JSSA 8FABB 3OWEA 1EFXB 2Z31A 2FLRT 3D2UB 3V4VH 4JRYB 2HRPL 4YWGH 2DJ4A 1I7ZA 5I76A 5JW3H 3ABZA 1EXUB 4MA8L 4GAGL 3QUXC 2ADGA 4RGNC 4U2YA 1NGPL 1CLYL 1UZ6E 5C0NC 5IHZB 4L8SC 1IGMH 5EG6C 4LCYA 4EQ3A 2BZDA 4OZGF 4U3HA 1A6TA 4LSDA 4FZEL 1RIVL 2J8UF 3RDTD 5SV4A 3WFZA 2X9XA 2B2XH 4J6RL 4I0CC 2YD4A 4HH9B 2OP4H 3MACH 1CVSC 4WDIB 4GAYB 3VXTB 3HFML 1EO8H 5GRWA 1P1ZB 4Q2ZB 2AJUL 1FFOB 3AS2A 1F4HA 1PG7W 3GBMH 1VEOA 1UVQA 4KZDH 1JGEB 4P59H 4LVNC 3T3PF 1KLGA 4AEHL 5JR1H 3L5IA 3MCLH 3TO2B 4RGMB 1I4FB 2W9EL 4D9QD 4K9EH 4Y89A 5CZVL 3CXDH 2DQEH 4J8RA 4XCEA 3V8CA 1LNUB 3AU1B 2XZQH 1NCUA 4GW1B 3LS4H 4TUJA 1H9VA 4EDWL 2F53D 2BFVH 4QRRE 1MEXH 1KJ3L 4L4TE 3MMEB 3PNWA 2BSSB 3TVMB 5L2JB 3HE6D 3O45B 4TVSa 1FG2A 2YPVL 4LLUB 2AKRA 1ZANL 5D71H 4KXZH 4QNPE 3CK0H 5MHSD 3O3DA 2CKBA 3BO8A 2P5EB 2R1XB 1KOAA 3F62A 4X7TA 4BZ2L 4W6WB 3UXFA 5B39B 2XG4A 1HHGB 4Z7OE 4ODXB 2G75A 4ODBD 3SO3C 1RUQL 3VFMB 3QIWD 5EBGA 1WWAX 2P46B 5CWSB 4TSCL 5EWIL 2RFXB 1T22A 4S0SD 1Z3GL 2NY4C 3P77A 4ZUTA 4Q6IB 5E8NB 4OJFL 3RIAF 5GRYA 3PWVB 4UV7H 2M2DA 5IVZA 1TQCB 4RMQA 1KIPA 5CLWA 1Z2KA 5E5RB 3SDDD 2ZOKB 3MBEB 3LCYA 1RJYA 1K5NB 4ORGA 2DQUH 5GGTL 4YUEL 4NQVB 2PYEA 4M5ZL 4D9QE 3A67L 4G8EB 4S1SH 4M43H 4MCZA 1A9BB 3LMJH 3T1FB 5J1SC 2VAJA 4CKVX 4PJ7B 1YECH 3MOBH 5F3HB 3U2SB 3VRIB 3P0GB 5FYLH 2F53E 4FQCL 1ZHLA 3QG7H 4M7ZB 3HAEB 4R8WH 3CLEH 1DP0A 4UOJA 1S5HA 3U0WL 4OI8A 1ZHNB 5E5MB 5JO5A 5MHSE 1N59B 2E8YA 3MRRB 3KPLB 2A73A 3L7FA 3LKQA 4NQXB 3O2DA 4S1DC 3UDWC 3T0EB 1MJUH 3O2VL 1MHHA 1NFDA 1YYLH 3DVIA 4G6KH 3DO7A 3I75B 4KK8C 1TZHB 1KCSH 3HLAA 3H42L 1I7RB 3CVIH 2VITB 4D0DA 1NCCL 2R1WB 4POZD 1A7NL 5E08L 4U4BA 3BGMA 5J6HB 4LRNH 1CXFA 2FJFA 3P0VL 3WS3A 3QXAA 3LN9A 3VFPA 1E4XL 4OGXL 4OIIL 1GIGH 1IEBB 5EULV 4U1MA 4NWTL 2DJSA 2J8HA 5I19H 2GTZA 3DUHA 3RI5F 4NJ9H 4LPWA 2DLEA 1SJVA 3IB4A 3ZE1F 5MEPA 2XTJC 3GO1H 5T3XL 4JO1L 1X7QA 4NNYB 4Y1AD 4Z95L 5IR1B 2Y06L 4YGVB 1NCDL 3RPKA 3DGGB 3WEXA 4KI1A 3LS5L 3FOMA 1TIUA 3BKCH 3FO0L 3H8NA 1XR8A 3CX5J 4LPTA 5E00A 3MOQA 2NY6C 2FSEA 1M05B 5EFIA 3RVWD 1JPFA 3O3EA 1HDMB 4GRLD 3E3QE 5LBSH 3CPLA 2DIBA 4YBQC 1IT9L 3CUPB 3RWDA 4OBSA 4OZ4A 4HBQA 1ZA3A 2XY1A 5ICZA 1UB6B 4PY7A 2OR8A 4RMUA 5T3XD 3C2AH 4MXWH 1FFRA 1LK2B 4NKOA 4LHJB 1HHJA 4F80A 1QRNA 5E94A 2YR3A 3ZSSA 5I18H 1KB5L 2Q76B 4FNLL 5I2IA 4OF3A 4JM2A 4PJ9A 5GZOD 1FO0A 4PRIA 1CFTA 2OCFD 2A0LD 2E9JA 2EH7H 3BPLB 3MROB 1RV6X 2OZ4L 3O6LH 3EOTL 4MDJA 5SWZB 4QRTA 4Y8AA 1CXIA 1IC7H 4O51A 3JWNC 1U95A 4L5FL 3GSRA 4O9HL 1Q94A 5HHQA 1FC1A 2HMID 4JAMA 4NUGL 3MRHB 1D5MB 5JOPD 2UVFA 4YHLL 5I16A 3V4VL 3QUMA 5A3IC 1HQ4B 2VMFA 4FQXD 4TTDD 2DMBA 3EO0A 4L3ED 2C3WA 3STLB 2MQ3A 4B53A 2BCKB 1SJHB 3MXWL 1TLKA 4NT6B 5HI4C 1JYNA 3TBSB 3BHBA 5AAMA 1B4RA 3ZDYF 3KAAA 1OP5K 3IGAA 3D39E 1KC5L 3C6LD 4R6UA 5BOPA 3JXAA 2Q86A 3KWWB 4PTTA 5DTFA 2YS4A 4JFFA 4H25B 2D0GA 4GBXC 1EO8L 1XT5A 2CDGB 2GW5A 5DZLA 2EXYC 1A2YB 5D6DA 3BEVB 4P59L 5GXBB 1HINH 1YQ2A 4P2QA 2UYLA 3W81A 5IFHH 2YD3A 2KL6A 3Q6GL 2BC4B 4R26H 3EAKA 4YE4H 2O5YL 5T3XE 3FFDA 2HH0H 5CKGA 3MCLL 4PJGE 3NCJL 5DI8B 4C58B 3UC0H 3VFOB 4PB0H 2AK4A 2UY6A 3OKNA 3TN0B 2VL5A 1OT2A 1U3HC 5B21A 2VXQH 5CJQH 4MNHB 1T5WB 4JFOA 1NBYA 2XG5A 4K8RH 4PRHB 2RB8A 4RFNC 3EJJX 2XZQL 1KCVH 3WCYA 1RUAL 4X7SL 5TGBB 2LAAA 5I9QC 1MEXL 4I1NB 1TTGA 3AY4C 1D6EB 4XNUL 4I0PA 4IOFD 4OGAC 1HCFX 1M4KA 5SX5K 1QFUH 5JW4N 1CG9B 2QQQA 5I17B 2J12B 2EDJA 4R97B 4I5BA 1U58B 5IWLA 4L3EE 4NO2B 2Y36H 4CVWA 1YN6A 2C7UA 4N0CC 4UT9H 3T8XA 2IF7A 3D3VB 2DKUA 3RTQB 2JCCB 4LOUD 1T4KB 2IH1B 3BP5B 3TT3L 1CD9B 3MO1B 5ANME 3HUJF 4Z0XB 3INUH 2YUZA 3EGSA 5F7MC 2WBJA 2A83B 1RI8A 3RVVC 2IPUK 1OY3B 4LVEA 1RJZA 4UV7L 4YPGA 2VE6B 3UAJD 3FT4B 4HF5L 5HI5D 2L0DA 3O4OB 2P4AB 5DJAA 4FQPA 2ARJA 3IDXL 5DA4A 4MAYB 1N6UA 1IQDB 4ELKB 2GUOA 2UVEA 3RZWA 3E2HB 1D5BB 3WLBA 1MF2H 2JB5L 1OAQH 2FD6H 1H8NA 1IAOA 1RK0A 8CGTA 4GOSA 4S1SL 4HIIB 1HK6A 5IFAL 5IMOB 4OF0A 2DQCH 1TVBA 3NFSH 1T1WA 4HWBA 5E8EA 5GS3A 5KSAD 3G6JB 1YECL 4P2RD 4P48A 1VPOH 1YNKL 4IRJB 4GKSA 1I3GH 5ALCL 1A4KB 3V5KA 3N0PB 3QG7L 3MRCB 4N8VA 5EBMA 4LP4A 4XBPA 2VXSH 2B1HL 4HJJL 4TN9A 1KEGH 1KJ2B 3U4BH 2VRAA 5D1ZC 4PGEA 5CS7A 2P8MA 1P2CB 3RWIA 1J0JA 4D0CA 3ZHKA 2CGRL 4X6BA 4R4BA 4G7YH 1KJMB 1AO7B 3QZWB 5EOCH 43C9A 3MLVH 3CVIL 5DJZB 1NLBL 4MD0B 2NY5C 3RVUC 1S7SB 2JJSC 12E8H 1EGJH 1N4XH 4YFLI 5FYLD 3EYFA 2HTLC 3ZO0A 4RAHA 5EUKA 3G5YB 1MELA 5D5MA 4E42B 1FVEA 4KJQD 4ACPA 3NPSC 3ROLA 4RQQB 5GSRA 1A7OH 4N0YL 2GITA 4HAGA 5BOZG 5I19L 4NFCA 4NJ9L 4JY4B 1TITA 4G8FB 3HTLX 5DMIH 3ARYA 1MY7A 4PRPA 4GSDL 1N6VA 2A74B 1OP3H 4M6AA 3H9HA 5DEFA 5F1IB 1EHNA 3IDIA 3R1GH 2LTQC 3NABL 1UB5B 3QUYD 4B7IA 4P2RE 2YN5A 4HIJB 1BVKB 5DJYB 3SGJC 3NTCH 4E5XA 4ZNEE 2EIBA 3O8XD 5L8JB 1MJ7H 3OBAA 4F7MA 5IP4A 4L4TA 5D8JH 3NN8B 5A1AA 4ZNCD 4NHUA 3QAZB 3OR6B 5EIQA 4RAVA 3W11D 1GL4B 3IFLL 1PKOA 4P5MB 5DHYB 5LBSL 4PG9B 4LP5A 1ZGLM 1OSZA 3C2AL 4QRSA 1Q38A 1S7RB 4TYUA 1ORQB 4N9OB 4P2OA 1X44A 3C5SB 1CYGA 3ULSB 1LO4L 3JWDL 2HFEA 4KWUA 5LAXB 1XEDA 2X4UB 3EDJA 4HD9A 4ZTOH 5I15H 1GOHA 4UT6H 4HUWB 4NQEA 4QRRB 4MX7A 2EH7L 4PD4K 5FYLE 4TTGA 5J0BA 3K1DA 4UUJB 2X10A 1L0XA 1IL1A 1AHWB 3O6LL 5CSBA 4HPOL 4R3SA 5GS0H 1I8IB 4JY6A 4OLVL 1OQXA 2VZ3A 3W9EB 4P9MH 1FL3B 3EYOB 4XNZC 4WTWA 3S37H 4OM0H 4TSAH 3QPQC 1IEAB 1S3KL 3LEVH 5SWSB 2IAMB 1A6VL 3RDTB 3RUGE 1ITBB 3PL6C 4OCRL 4UAOB 4YHYC 3DTXA 1WF5A 1BWWA 3NIGE 5DSCB 1CT8B 3X3FH 3HB3D 3VFSB 4X4XA 2JTDA 1FZKB 3BVNB 2ENSA 1WV7T 3HE6A 3SJVD 1RUPL 1TNNA 4QF1B 2HLAA 5H2BA 3X13A 2IEPA 3D0LA 2HLFD 5FK9B 2EDBA 1G9EA 3P4OA 2HT2C 5FA4B 1J8HA 4P4RA 1SEBA 3GSQA 3K8KA 4NRZB 1TQBC 4PREB 3ARXA 1X5IA 1X4XA 4YE4L 3WXVL 1Q1JH 3MLXH 4DN3H 2VQ1B 1CICD 1A7RH 1NEUA 4ZODA 1CGVA 2XIDA 1IM9D 3GRWH 3LD8B 1WEJL 5D1XC 2HVKA 4RX4A 3PV6B 1MCQA 5CJQL 2FB4H 2PR4L 4MMXC 4JFPB 3DIFA 1SYVB 1BQLH 4I0KA 4MZ2A 4K8RL 4QHUB 1ZT4A 3D0VA 4HPYL 4JZJB 4RA3A 1CGTA 4NO0A 1GPOL 4PJFB 3DETD 3RIFK 1DUZB 1J1PH 2AVGA 2EDYA 4ENEC 3QXWA 3SDDA 4P23B 2X41A 1INQB 2N56A 4O2CB 4ZDHB 1FVCA 1QFUL 4QRPA 1MJ8L 3IDNA 1SQ2N 3ZYIA 1AGDA 1KB9J 1WBXA 5DYOB 3QIWB 3LQZA 4OFVA 2Y36L 3ULUH 3STZA 5SX4H 4QXUH 4OLXH 4QYOB 2OL3H 2V5SA 3A0OA 4DAGL 4Q97A 1CFSB 1RUMH 4XNYH 5I71C 3CFKA 4LLYA 1JL8A 4K8RD 1CGXA 3S34L 2R2BB 4PJBB 3INUL 2OR9H 4R4ND 5HD8D 4BFGA 4HIXL 5A16A 3SJVE 4NSKA 1FNEA 2E7LC 4YXHL 2NZ9D 1KFAH 5DUML 3RY4A 1XGQA 4U33A 3RX5A 4LNVA 1JJUA 3QRGH 1D9KD 2DQGL 3V7AE 4GXUN 1CIUA 5GGTA 1YPZB 4LVHB 3CSBA 1FZMA 4KPHH 4ONHB 4ZD3H 2H8PA 3NACL 3TIEA 5DDHA 2YUXA 5SWQB 1MF2L 1OAQL 3PJSA 1IM3B 5DK0A 4QT5B 4N5ED 4XX1E 3U1SL 5FGSA 2Y4SA 1R3LB 4O4YH 2DQCL 5MENA 4LLDB 4Z7UA 4XAKD 3MTRA 4M48H 4IRSA 1T89C 2UY7A 2EO9A 1NGXA 5FHAH 2DS4A 3KPPA 4M62H 1I3GL 4ZFZA 1UJTA 2G5BA 3JVGC 5T3ZH 2VZTA 5FXCH 1U8LB 3BP7A 3WFCH 2ED8A 3ARGD 5ETUA 1MIEH 3AS1A 4F15B 5D2LE 2A6KB 3UTQA 1I7UA 3O6FD 4L8CB 1TJGH 3AMLA 3BDXA 4HIEA 1EZVY 3DX6B 3OG6B 3U0TB 3L5JA 4X98A 3GHBL 4UDUA 5EOCL 3MLVL 4OCNC 2ZNWA 1GRWA 3D39A 3DX7A 1JPGB 2X5PA 5KG9A 5CSZB 1EGJL 1N4XL 2GFBA 2Z8VC 1RSFA 3JV4A 4DZ8B 3OR7A 1KXTB 3U46A 5D6CB 5EZOH 2MFNA 2H3NA 4QGYA 2FCBA 2I07A 1DBBH 1ZVHA 3PQYA 3BUYB 3FZUC 3V4UL 3RL1A 1KIRA 4WTXA 5D7IE 2PW1B 5FO7A 4D0BB 2ITCA 1KENH 1C1EH 3F58L 3MUZ1 5IB3B 2XICA 2NX5B 4Y1AB 2WANA 3BGAA 4FQHA 3FQTA 3WNNA 2HKHH 4HGMA 3RX8A 3I84A 4EEEA 1I9RH 1AXIB 2ZUYA 1IGJB 3ESVF 4NCC1 4Y5VA 3T2QA 3P2TA 5T1MA 5I1JL 3BRFA 1CE1H 1AJ7H 5B8CB 4L4VD 1OAXH 4XGZB 5HDLA 3QDAA 4GRLB 1G1YA 1KTDA 3DX8A 1LVEA 1ETZA 1T1XA 4AEFA 3WFHB 5IMLA 1T1ZA 3C5JB 3RZCB 3WD5L 4PJGB 3TNNB 4FQXA 5KVMC 4J3UA 1QYGL 3OGCA 4BH7A 4ELMF 4N0FA 1AY1H 1DVFA 5KSBF 3WL9B 1MHPH 3C08H 3RHWK 4GRWH 1KB5A 4WU7B 3QWQB 1S9YA 4NWUL 3VD5A 2LU3A 1I1AB 2PXYD 1Q9LB 3GI9H 4RA0C 1I3RA 2QKIB 3G6DL 2OZ4A 4CNIB 4WW2B 4GKNB 2GHWB 4R90H 2Y5TB 4H0HB 4IHOB 4LSQL 1I85A 5TF1L 5F9JB 2AABL 3IFNH 2R0LL 5JHDA 1P7KA 4CN6A 3EFDH 4O2EB 5LJYH 5IB1A 1C08A 1A5FL 1U92A 2X1QA 1U93B 3GMNB 5EBLB 3ZDXE 1YEKH 4X0KB 4L3EB 5GGQL 4LCUB 4P9ML 1IGFL 3S37L 3TPUA 1NLDH 3CZFB 4KGLA 3BOVA 2GK0B 5DHXB 1MJJB 3LEVL 4IM8A 4BM7A 5DHVH 2P44B 1NCBL 3ARFD 3AXLB 1CDHA 5KS9B 2FLBT 1ZSDB 5E7FA 1S9XB 4L4VE 5E8OA 2R8SH 1FGVH 1YZZA 3LKSA 3Q5OA 2Z4QB 2ICWA 5EU7E 3KR3L 5CHNA 2ZJSH 1RK1B 4ZOEA 1JV5B 4Y8DC 5GS0D 3ECBA 4G8GE 1ZEAH 1T0MA 5GGSB 4XVSH 3I3EA 5C0AB 5ITBH 1FYTA 3BX7C 4KV5F 1B4JL 5HGAB 3K2UH 3IFOB 4YQXL 2VLJA 4DN3L 1F8TH 3O3UN 1K6QL 1EEZB 5HDQL 3HA0A 2AJSH 5MERA 2BY1A 5F8RC 4IJ3C 2AV1A 4QRQB 2FB4L 3SGKA 3UJTH 1Z6JT 3SOBH 3VXSB 4OFPA 4DTGL 3GSUB 2EKSB 4QHKI 4EDXB 4F7EB 3MLRH 4HEME 2FWOA 3MLTB 4L3AA 1J1PL 3H0TA 3FO9B 3RBGA 5HGBB 1CD1A 3OKLB 2D0FA 1X5KA 1E6JH 4MQXD 1DQJB 1MSPA 4JM2C 3QUKA 4PJ9C 4DZBA 1U8PB 2V5YA 2OSLB 5FYJU 4H20L 1FN4A 4HDIA 3IAPA 3OF6A 1Z9LA 3KPSD 2O61B 3ZSTA 3SDXB 4OLXL 2OL3L 3PGCA 3OTTA 1MLBB 4H1LB 4U1JB 5IEKA 2W9DL 1U6AH 2WINA 3Q5YA 2LABA 5E2VL 3WFBH 3CMGA 3GSOB 2OR9L 5F88B 1INDL 5HYEA 3KXFD 4WUKH 2C1OB 2NLJB 2P5WB 1JNJA 4L9LB 3QRGL 3QEGL 2J4WH 4UQ3B 2GAZB 4HK3N 4HWUA 2YA2A 4H5SB 4NNPH 4MA3A 5EN2B 2JELL 4ZD3L 1MH5A 4U1HB 4JPIB 1HWHB 5EDXA 3DRQA 3ULUD 5FAAA 1F6AA 5E2UH 4LRIC 5D9SA 4PJXB 1S8DA 3FFCD 4KJWD 4P2RB 1RJLA 2XZCH 3HCVA 4KQ4H 3RWFA 2H26B 4OF8A 2QLVB 4O4YL 3ZKXB 4UILH 5ID0A 5LGKA 5F8QC 3QJHB 5CIPH 3QEUB 5D6DC 4UIKH 5J11C 4LDLB 3B2UD 2AGJL 3BEWB 1GZQB 4WO4A 3BPOB 4JRXD 4UQ2A 3SPVA 5EU5B 4JO3H 2X4QB 1IGTB 3ARUA 3WFCL 4I13B 1MIEL 2EDLA 1U8HB 5E4EB 1BIIB 2VIRB 3HZMA 3PWUA 3D25B 3CIQA 3OKEA 5K59F 5F1OB 4ZFOB 4CMMA 3FO1A 1TJGL 4LARL 3KPSE 4TOYH 3TBTA 2ZCHL 1KTRL 5IG7B 1YMMD 4KRPC 3RUGA 3LDBB 5IGXH 3CDGA 1KYOJ 4ZSOE 1B90A 3LN4B 4WFGE 5HYSA 1YNLL 3MCKA 4TUKH 1UJ3B 3H7BA 5T3ZD 4N0RA 3KXFE 4Y5XC 5C0GB 2VDNH 4M6NH 4KJYA 1IQWH 5DD6B 4X6FB 2WWKT 4J4PD 1DBBL 1G0YR 3WE6B 3V6ZA 3AAZA 1NSNL 1S9WB 3EDFA 1T3FB 1HOCB 3CNKA 3VGBA 1KPUB 4NM8H 3FO2B 3ULUE 3UROR 5EORH 3E6HB 3C6SA 2HJLB 2HKHL 4KXZI 2WBJC 3FFCE 1J0KA 2APVA 2RJMA 5D7JB 5B38G 1I9RL 4I2XA 2M1KA 2X05A 3BQUD 5ACZA 1T83A 5HHMB 3O8XB 1JE6A 3FB5A 1CE1L 1U8QA 1KACB 2WWKO 2C26A 4OKVB 1T04A 1OAXL 5ICYB 3LV3B 4JRXE 1R0AL 1GZPA 3Q6FB 4ZUUB 4P3WA 1H15A 3GKWH 2I26N 4YHPA 1HI6B 4U6HA 1I1FA 8FABA 1U8IA 3O3BB 5EPMA 4HXAH 3KLHC 3BAEL 3LH2L 1NCAH 2DIAA 4JRYA 5D2NB 1KCUH 1AY1L 4TVPL 1OPGL 1OAKL 1D5XB 3C08L 4YDKH 1QBMH 3I6GA 4F2MA 3FMGL 3P9MB 1QHPA 5AEAA 2IG2H 5EBWA 3ELAT 5FUCC 2OI9C 5DFWH 4G3YL 4OAWA 3MJGX 3BXNB 5IHZA 3GI9L 4HWNA 1NFDF 1PQZB 4YZFE 4X7CC 3F7YA 3IKCB 3WNKA 4NQSA 1GCFA 1TTUA 3VU2A 2XN9D 1KJVA 2XTLA 3CX5K 2V5TA 2NY1D 1I9IH 5T3ZE 4LHUD 2V2TB 2EECA 2XT1B 4Q2ZA 1AKJD 3VRLF 4ZS6C 3G9VA 2EDWA 1OGAD 2FX8H 1BJ1J 1YEKL 3PWPA 4YC2B 4OUUA 15C8L 3OKMB 4NBXB 2VLKD 4DUVA 1CICA 1KELH 3IF1B 1NLDL 3FQNA 4OV5A 1I4FA 1KULA 5DD1H 4R0LB 1J7VR 4JGJA 5BMFH 3GMOB 5IIEA 1A7BA 1MVUA 1LNUA 3ZDZE 2XPGA 1Z9MA 3DUSB 2X4SA 1ZAGA 5KVDH 1G0XA 4G9DA 4XPFH 2FR4B 1GOGA 3CH1A 4NZUH 2XWBA 5KN5B 4G9FB 3TJEH 1RAMA 1BF2A 3TVMA 4PJIF 1H3UA 3O45A 4LLUA 5FYJH 1AH1A 1UENA 3H9ZA 4FFVC 2P5EA 1I1RA 5B39A 5ITBL 3ESUF 1HHGA 4ODXA 3VGEA 5M95B 4PUBL 4OLZL 3U82B 5CWSA 3WJLC 1G9NL 2X40A 5IB4A 5BQ7B 4XC1L 4CW1A 5B22A 1AD0B 4KMQA 3VGAB 2GT9B 5C09D 3UJTL 3BYTA 4XWOD 3FB6A 4KUZL 2XN9E 1DUYA 1YEIH 3X3GH 4UINL 3HNVH 4WW1B 2W60B 3UPCA 4I4WA 2V5RA 3ZE2F 3EBAA 2N4IA 1OGAE 5CGYD 4J2XA 3W0WD 2ZOKA 4JZOB 1X5GA 2FX7L 1DLFL 2D31A 3SHSA 5EIIB 3IJSB 2VLKE 3D85D 4XMPH 1CDYA 2MHAB 4OZHE 3KJ6H 3VXUB 2A1WL 1W0WA 4NQVA 4I3SL 4Y4HD 1X5YA 2Q6WA 3UYRH 3D18A 2C1PA 1W0VA 3U2SA 1ZKAA 1U2HA 3MRKA 4HV8A 1HH9A 3MJ7A 4FXKB 3EFFB 2OX5A 5BS0B 4YIQA 5F97E 5AUMA 1R3KB 5MEOA 3HAEA 1QACA 3ARGA 4MJ6B 1U8MB 1D9KB 3M8OL 1ZHNA 3KYNB 4JDZA 3U7WH 2QHRL 3MRRA 1XF5B 3KPLA 3QDJD 5JW4M 3O6FA 2BVTA 3VFTB 1DBAH 5C07B 3T0EA 3DSFH 4LL9A 4NNPL 4LKCA 5DO2D 3GI8H 3IDGB 4GS7B 5DXWA 3GHEL 2A9NH 1L7TL 3I75A 3FQWB 3QQ3A 1TZHA 4PJAE 2EIEA 4JJHA 2B4CH 2VITA 4PP1D 3WLWD 3HE6C 2XZCL 4CJ0A 4KQ4L 4YFLF 1JMXA 4RWYL 5C09E 1HHKB 1HE7A 1DEEA 5ENWB 4UILL 1F11B 4OZFG 3ZE0F 5J6HA 3PF2A 2GSGB 4M6OH 3QFJB 3WSQH 2C9AA 4UIKL 1GH7A 3DHJA 2P45B 2FGZA 2R4RH 3ZT5A 1FNGA 25C8H 4YHIB 3IJYA 1J8KA 3W0WE 1KG0A 4UBDD 1FFNB 5E5UB 1S7TA 4NKQB 1Y0LB 1I8KB 1MCCA 3R06B 4LLWA 4PG2A 5TFSL 4QHMB 1YEJL 4X6DB 4NNYA 2YD7A 1K8DB 5GISH 3BD3A 1YQVH 3MRJA 5D72H 4L4VA 3DGGA 3SDDC 4KKCD 5JOFA 1EGJA 2H45A 4FQQB 3L5HA 3PGDA 5HGHA 4JRWA 5INCA 1M05A 5GRUH 4G80B 2WIIB 4NN5C 4G8GA 1Q9KB 5LCVH 1SBSL 2VDNL 5GZND 4NPYB 4U1LB 1BZQK 3QDJE 3CUPA 4JJ5A 5JZ7D 4G42B 2ZUUA 4XMLL 3V6OE 1IGYB 3RKPA 6CGTA 5JQ6H 2GJ6D 1F90L 3OAZK 5T33H 2Q76A 3B9KA 3U7AA 1F3DH 1WBYB 3N06B 1DR9A 5F9OL 1HQRB 4J23A 4MWFA 3GSNH 4TQEL 5DRXB 2ZUWA 3MROA 1JPST 3U7YL 1EAPA 5SWZA 2VO5A 1JZ2A 1QLEH 1S7UA 5DC9B 3MLZH 1IILE 5K9JH 3TJHD 1R5IA 3VG9B 1ZK9A 2VISB 3MRHA 1D5MA 1NDMB 1OSPL 5IUSA 3WIHL 4QXTB 4U1GC 1MFEL 3L95B 1SMAA 1B0RB 3ARRA 4YHKL 2ZKHH 3STLA 4IRSC 4K3DH 2KDGA 1QBML 3BI9X 3D48R 4HSQA 2IG2L 1B2WH 2DYPD 4NT6A 4C4KT 3DURB 3TYFB 4BSWB 1M71B 5I6XB 4PV8A 5DQJB 3WMSA 4ZYKB 4FRWA 4KKNA 4YO0B 1V7ML 3JV6A 1WFOA 5GGUB 3MLYL 3MXVH 2ZSWB 5F7DA 4DW2H 2L7JA 1U42A 4ODTH 2CDGA 3VGHA 2BJMH 2LFGA 2YA0A 1A2YA 1XF1A 4MA1B 5D93B 4EI6B 3BEVA 5D7SL 3ILPB 1VKXB 3HG1D 1N5AB 1NGWB 4ZAKB 5TDPA 2H1PH 4WJ5A 3SDYH 1ZHKB 2X1WL 2GJ6E 1KELL 1EJ6A 1GGYA 1RY7B 4MNQE 1AFVH 5DD1L 1N3NB 5FM8A 3PUCA 4PGBB 2YBRB 1AE6L 4TPRL 1W72B 3VJ6B 4GG8B 4G8IB 1TCRB 1K85A 2F5BL 4MHHI 2NW2B 4X4ZA 3BRGC 4KGJA 4GLRH 1MAKA 4GRMB 3O2WL 5CP3A 4NZUL 3KVQA 3ALXA 2XWJB 1D6EA 3WUWA 3BESR 2VR4A 3MRBA 3WXWL 4P46A 4X9FA 5GZOC 5I1DA 3G08A 2VAAB 5I17A 4XPHH 2BXYA 4Y5VC 4AM0B 4NO2A 5HVWA 5LQBH 5JIHA 4NKMB 2Z8SA 1WBZB 1DN2A 4P9HL 4ZO9A 2CLVB 5EU3A 3RTQA 3LKOA 1BHGA 2R2EB 4ZSOA 4P5TD 5TF0A 4Z7OF 2HMIC 4LSTL 1T4KA 3BP5A 5FGRA 3QI9A 2HKFH 2I9LB 3MO1A 5JPNA 1BQHB 3WNPA 1TENA 2VDQH 3O6KH 4E41B 4LGRB 2RGSA 4C56D 4FP8L 3I02A 4TTDC 1ODAA 2A83A 2VH5H 4FQXC 2X44D 1FVDB 4PLNC 3EYUH 3HNVL 3KXFA 5LGHH 1DVFC 3RGVD 4KKAC 1A6UH 1YN7B 3HG1E 3EZ8A 5HYJA 5FYJD 4X6EA 3KPSB 4MAYA 4KTDL 5F9AC 5FF6B 5HHVH 3C6LC 1SJXA 3U30B 2OL3A 5L9DH 1FNSH 1MQ8A 1EFQA 3I3BA 1I85C 2D03H 4HS6B 3V9FA 1CZ8L 4PJ8D 1G7HB 2V17H 4ZTPH 3QDMD 3FB8A 3R8QA 3WDIA 5K9KB 4ZS7H 1ZV5A 4M02A 1ES0A 5ERWB 4JRXA 1AI1H 2I5YL 3S88H 1DDHB 1RFDH 4N8CH 2NXYB 5BV7L 1RZKL 4JPKL 4NUJA 4TNWF 4XC3H 3T04D 2VDRL 4G6MH 2BOCA 4JO2H 3MA7A 3WO3B 4EUPA 4V2BA 1DBAL 5EU4A 1G0DA 4WU5A 1N7MH 3GI8L 2GCYA 1QD0A 3DBXB 1JYVA 3CFIC 1NGYB 4EN3A 1ZLWH 4NO5B 4HUVA 2DLFH 2B4CL 5DJZA 1CD0A 3WYRA 3X12B 2VLLB 3FN0H 3PP4L 2Y1VA 1CDGA 1BAFH 1WFTA 2V2WB 2CUHA 4AIZA 3DMMD 1XH3A 2C3VA 3RWEB 4C56E 1IAMA 5KVFL 3LKRA 1I7TA 3N1MC 4RGOL 4E42A 4JZNA 2A6JA 4PP2B 2ILLA 2AEPH 5CAYB 1CL7H 5LXGL 4X7FC 4NDMB 3GSWB 5DZOA 4LOUC 2D0HA 4U7SA 2EC9T 2FECI 1YMMB 3B2VL 3SGKC 2FL5B 2IMNA 1FPTL 1KN2H 3QISA 4ERSH 5F1IA 2BDNL 2E7CA 1CDCA 5I1CH 5J1AA 4EBQH 1UKQA 2V7NA 1LO5A 2IPTL 1WIUA 2ERJB 4P4KA 4XNMA 3UAJC 1BVLB 1F3JA 5HI5C 1YQVL 4QXWA 3QDME 1UB5A 3JWOH 1ZVSA 1RHHB 4HUXB 1BVKA 4HCRH 3HI1A 5JNYB 1ACYH 5CMAA 3IXAB 3U36A 2PYFB 2QADD 1KT2B 3BT2L 3O41A 3EO1B 3BPCA 3TPKA 1CK0H 1CLZH 3TEUA 4KZEL 5GRUL 3MJ8B 1KIQA 1IE5A 3OR6A 4WNQA 1MI5B 2EDQA 5LCVL 3MRPA 5F7FA 4F58H 1FLRH 5A2JH 3I6KA 5KSAC 1T5XA 2CQVA 1D6VL 1LD9A 4BQBA 5JQ6L 1S7RA 3BQUB 5HPMA 1SMOA 5IMKB 3C5SA 1PZ5B 4QHKJ 2H9GB 5M7QA 3NH7H 2CKNA 3IDJB 4K71B 4QHLB 2VNCA 1VACB 4M8QB 2MKWA 2VR5A 3GMLB 3BDYH 2ZSVA 4KJPD 5SX4I 2BNRD 1GGBL 1M1SA 4Z7VA 2ZUQC 5DMKA 3BWAB 1WK0A 1CU4L 3LPGA 5KSVB 3W39A 1TVDA 1IBGH 1JFQH 4HH8A 1JGLL 2VQUA 4NNXB 1ZT1A 3DX9B 3W9EA 1MNUL 1X5ZA 3MV8D 1FL3A 3EYOA 1X5FA 1ONQA 3DROB 4ZQKB 1ZGLA 2OM5A 1IEAA 2ZKHL 5AZEH 4CL7A 2F54E 2IAMA 3QULB 4K3DL 4PR5B 1WAAA 2N7AA 5E8PB 4YDJB 1OARH 1UFUA 1B2WL 5ALBL 3QRFM 1JRHL 1ZTXL 1RPQA 32C2B 1CT8A 1NBZB 4LFHD 4C83A 2ZUXA 4LHUB 3VFSA 5C0ND 1AKJB 1UCBL 3BVNA 1OGAB 3MXVL 4RFEB 4QF1A 5J12C 5ITFB 3MGTB 5GJTH 1KPVB 5IV2B 1LP9E 5FK9A 3V0WH 5FUOH 4OZHB 3MUGB 2X4PB 3L9RB 4GRWB 5FIEA 4NRZA 3QUYC 4PREA 3TO4B 1JF5A 1V7NL 3ZTJH 3CU7A 2ZCKL 2QSVA 4MS8C 4JFDD 4MSWB 4PJAA 5DHVA 3FQRA 1AFVL 3V7AG 1V3KA 2WV3A 1VESA 4PJGF 3W11C 4Z7WE 1J18A 1BOGA 3F7PC 4JFPA 3MC0A 2BVQA 4OSUL 2YHGA 4X6CE 1ADQL 2BNRE 4M7JL 3BH9A 4L8DB 4GQ9H 4PJFA 3B6SB 3RU8L 4XX1G 4EI5B 1NH6A 1D5IL 3TC9A 4ODSH 2VN4A 4AL8L 4LBEA 3P3YA 1XF3A 1WZLA 5E8DH 4IIQA 4C54A 4Z77A 5JMOC 2CLZB 4ZDHA 1H5BB 1YEEH 4KROC 5IVXB 1J86A 3OZ9H 2MQCA 1T83C 5DYOA 4XP1H 1J1XH 4LNRB 2BNUB 4QYOA 4J3OC 1K3IA 4QWWD 3JTSA 1JGUH 1H3XA 3WFDH 4D3CL 1XMWA 1V3JA 3ZL4H 2J88H 2HKFL 2O5ZH 4DGVL 5D7LD 1NC4A 3O6KL 5SX5H 4PJBA 3HMXH 3TYGH 4M93C 5IJVB 2VH5L 3W0WB 4FQ1H 2NY4D 3EYUL 5LGHL 1N26A 3X17A 3D85B 5C8JB 3MYZA 3JWDC 4DWHA 3MQIA 1BREA 2IJ0C 2Q8AL 1HIMH 1ZE3C 1YPZA 3HE7D 4KY1L 3MLWL 2OTWB 4JFDE 5DC0A 5SWQA 4KK6C 3B9VA 3BZEB 2W65B 1IM3A 3H3PH 4QT5A 2AXFA 1EBAA 2FATH 4X80H 35C8L 4LLDA 2IBZX 2V17L 4MZ3A 1CIDA 5FDYA 2APTA 3A6BH 3PABB 5J06A 4ZS7L 5C0EA 3WS6A 2YD9A 1MCBA 1AI1L 4J12A 1BX2A 1JUFA 5ESQB 4WI3A 2NY5H 1CICC 2QSCH 1XIWA 1BBJB 2VUOA 2W0FB 1NFIA 2BHYA 4LIQH 1GSMA 1B0GB 3U4AA 2SEBB 3OKKB 4X99B 4Z5RA 5KAQF 3T4AB 3CSPA 1TTFA 4G6ML 1RZFH 1L6XA 3BE1H 4L8CA 3H3KA 1N7ML 2QSQA 5M94B 5F1NA 3DX6A 1WC7A 4LLVB 4AG4H 3SQOH 2J1KA 4AY0A 4GW4A 4KAQH 2WNGA 4R7DB 1F4WH 1LWRA 1MWAH 3QIUD 2EDKA 3UTOA 1MPAH 5D7LE 2XNAA 1P4IL 5CSZA 1Z5LB 2X1PA 5E56A 3DO3A 2D4DA 5MEQB 4DZ8A 3CJJA 2AQ2A 5C0CB 4NQDD 2AEPL 1CL7L 2HRLA 2IH3A 3L3JA 3BUYA 3TA3A 3RL2B 1A4JB 2PW1A 2DWDB 2RCSH 3HHRB 5IB3A 4K8RC 5KOVC 4DVBA 3O6MH 3FRPG 4R4NC 4MNQA 4WEMB 5C9JA 2EIDA 1CR9H 5TE4H 1FV1B 2NZ9C 4LCCC 5CIPB 1KNOB 1N8ZA 4Y19D 3M45A 1QNZH 3JWOL 4YR6B 4MHHG 2BSRB 4YLQT 2ENYA 1H3WM 2I9TB 5C0RH 2QR0B 5J6GA 1WIPA 5FGCE 1S5IL 3QEHA 2NY2D 3SCMA 4U31A 3GJFA 5GGRY 1CK0L 5DVLA 1G6VK 3I6LD 1P6FA 1IGCH 4N5EC 4OKDA 3WFHA 4YAQB 1ULVA 5HVFB 2NY6D 3LHPH 1C12A 1HEZA 3RZCA 2GJ6B 3S3JA 2C5DC 5FYKL 3MV9D 2Z91B 2P7TA 4ZPVA 4XRCA 2A6DA 1H3PH 4WU7A 3P4MA 1GGCL 1T7ZA 2BXZA 1LEKB 3B5HA 5CJ5A 1I1AA 1WZ1L 4HHAB 2GIYA 2QKIA 4BK4A 3RAJH 3ARGC 5JUEH 1EK3A 3OJDB 1JHTA 3O3AA 4CNIA 4GKNA 4PV9B 3GK8L 4WVRA 4QXGL 4M1GH 5L2KD 4IHOA 3O6FC 1UYWH 3CFDA 5KSUB 9CGTA 4MD4B 4AENA 5JPMB 4KU1A 4NQDE 4WUUB 4U6YB 1FE8H 2J7LA 1IBGL 4M7LL 3QFDB 3WIHA 4X0KA 5FB8A 1AIFA 4HGWA 3S5LA 3OJMB 4TNVF 3CZFA 3QEQA 4PJDE 5J57B 1WZMA 1LE9A 2GK0A 2VDKH 4LPYA 3H9SB 4RSVA 5A3ID 1EEYB 5IEHB 1I8MB 1OARL 2W92A 4IS6A 5D70L 4Y19E 5KS9A 5I1IH 2D7TH 5ACMA 4F37F 4JPVH 3RUGF 5HI4D 5FECA 5DT1H 3NIGF 2LE9A 4PG2C 4D8PA 3LZFL 1RK1A 1JV5A 5GJTL 1NCWH 4X8JA 4HIHA 4V1DE 4OT1L 2DAVA 4OZGB 3L3KB 2IQAB 1S7WB 4I18B 2J8UB 3RBSA 1DE4B 5GGSA 4O5LH 2WZPD 3MV9E 5IW6A 2C4FT 4L29B 5HGAA 4YXKH 5F89B 5IESH 3BP6B 1EJOL 2X4OB 4FS0A 1J0IA 5EU7C 2NW3B 3TV3H 2E8ZA 2P8LA 4QRQA 3K46A 3RWJA 2OMBA 1PG7X 3LSOA 5L2KE 3L3DA 4EDXA 5JDSB 3ZT7A 1FHGA 2DQFB 4J1UB 3SDAD 2X7LA 1YDPA 5EZLB 4IDJH 5HGBA 3NBNA 1CDJA 1BM3H 5E8DL 3OKLA 4NFDA 5L6YH 1YEEL 5HGDB 3VXMB 3B9KC 4N1CA 4U3CA 1IKFH 5SV3A 3L6FB 3OKDB 1HSAB 2DTML 1CXHA 3LB6C 1YEGL 2O61A 3SDXA 1JZ6A 1CFNB 3U4EB 4NO3A 1JGUL 4H1LA 3WFDL 3B3IA 4U1JA 4FMKA 4N0CD 2V9QA 1HH6B 4Y5YB 2J88L 4GUPA 4Q9QH 1Q0XH 1PVHA 2KPNA 3OV6A 3GSOA 3TYGL 1XF2B 1Y6NR 4RIRB 2B1AL 4FQ1L 5F88A 2C1OA 3HC3H 1E28B 2NLJA 4OCXH 2P5WA 3GBNH 3ARFC 3BN3B 1XGUB 5EZJB 4HKXB 4ZUVB 4H5SA 1HIML 2ZWLT 1G7QB 1MLCB 4JPIA 5ISZD 4HC1L 3C60B 3ES6B 4KDWA 4YH6A 3CFJA 1B6UA 3NPZB 5I75C 5GS0C 3REWA 3DMMA 5I8OL 5I30H 4NCC2 2E6JA 2BVOA 3IJHB 1UA6H 1J0HA 4AMKH 1JCKA 3LEYL 3R8BB 3V79C 3DOSA 6FABL 1UXSB 3NIDE 4OF5A 4XVUC 1T6VN 2QSCL 1IGTA 2VZUA 4MAUL 3OJVC 2CKBH 5HY9A 4F7CB 2ESVD 1U8HA 1GJIA 2O5XH 2X4NA 1BIIA 1RZFL 4PRNB 2F54A 5D2LF 5D1ZD 1AGEB 4O02L 3BKYL 1KCLA 4KAQL 1CLCA 4N1EA 2DBLL 2EE6A 1F4WL 1MWAL 1XAUA 5FOBA 2CIKB 2YKLH 4TRPH 4MQXC 4K23L 1HXYB 4A6YH 1BBDH 4P46C 2HTKC 4JN2B 1JYXA 1VFBA 4JDTH 3NA9H 1UJ3A 2P24B 5DJ0A 4LGSB 3V4PH 2XKUA 3HI6L 5F6IB 3RVXD 4QRUB 1IAIH 3G5VB 2WK2A 4X6FA 2HTLD 4CADB 2AJ3B 2YD5A 4PJ5B 4W81A 1XGYH 1RIHL 1T3FA 5EUOE 3VXPB 1KPUA 3FO2A 3QI9C 5ISZE 3IDYC 5D7IF 2PO6D 1BVZA 2HJLA 4N90D 3S35H 1AXSB 4XB8A 4YK4C 5DRWA 1CR9L 3U9UB 5MP6L 3WFEH 5EOCJ 2OTPA 5D7JA 3NIFE 1JYWA 5L0QC 5KTEH 4Q9CA 4M4PA 1P5UA 2BP3A 4RRPA 2BNRA 1QNZL 5C0JB 2VKXA 4LCWA 1J11A 3J8F7 3L3OB 5CSGA 3VFVB 2KBGA 5L8KB 3ULUC 4LSRH 2FX9H 5JW4Q 4IMLA 2Q7YA 2ESVE 4KJWC 3O2DH 4LSUL 3LHPL 1LO3L 2PW2B 3O3BA 5LKNA 3MRFB 1QSZA 2XACC 4GMSL 5IW1B 2Q8BL 1EVUA 1MCLA 2I60H 3IU4H 5E7BA 4FFZL 1H3PL 3B2UC 4Z7WB 2EH8H 1LILA 3VWKB 2H2PC 5EZIL 5BJTB 1A9EA 1M6OA 4NC1E 5JUEL 4TUOB 2J2ZA 5CINL 4KVCH 3AS3A 3MR9A 1NJ9A 4Y4KB 4N5UA 2NY3D 3G6AB 4OFKA 1NBVL 3VFRB 4MGXA 2V2TA 3MFFB 5JXEA 5ID1B 3MV8B 4LIQE 3U0PB 3CVHL 1CGSH 4EN3C 1EBPA 5E6IB 3M17B 2R15A 4LHUG 2R0ZL 3S36L 4QOKD 4WCYL 4BUHA 3ZDXF 3H3BC 5C2UB 3IF1A 5ADOL 2R1YA 2YC1B 4DOHB 1Q9WB 4R0LA 3QUXB 3MJ9H 3GSNB 4RGNB 3GMOA 3QPQD 4NFBA 3VH8A 1OF2A 4L8SB 3VW3H 3B43A 5I1IL 3JUYA 3ULVH 2VQTA 3DUSA 4AEIL 4M5YH 5DT1L 5E6ZA 2FR4A 3DHMA 4G9FA 4BELD 4CVUA 4UOW1 3KPQB 3WO4C 2X89D 3GB7B 3CFBB 4WWKA 1DZBA 4LSSL 2UWEE 5KVEL 2CLRA 4NBYB 4P4KC 5C6WH 4LVNB 4L4JA 5GSVB 1JWUB 3WIIH 5IT2H 1MCOH 3NGBB 3WKML 2FHCA 4ONGH 1UZ8B 4X7DC 4P2YA 1MCSA 3QNXA 1AD9A 2FHBA 5EC1A 1FO0H 1MQKL 2CXKA 1ADQA 1YY8A 3RWCA 2GT9A 5D7LA 3KPRD 3ZT6A 2CUIA 4LPVA 4RAUB 4OGYL 1YEDA 1KBGH 4OV6F 1BM3L 3OPZH 3AFLA 4Y16D 4UT7H 2F74B 4RMSA 3QA3B 2DQIL 1ZS8B 4CU6A 4QOKE 4ENED 2AEQL 3FOLB 2CRYA 3GBLA 2BY0A 5IBLC 1IAKB 1IC1A 1IJ9A 2NY1C 1FJ1B 1LMKA 1JWMB 4OLWH 1VFAA 3NVQA 2NY4B 4CU8A 3EFFA 3MNVA 5FO8A 1XCQA 4GG6E 1GC1H 3BDBA 4LAJH 2IALA 4MD5B 1R3KA 1FAKT 4P57B 4Y2DA 1AGFB 1XGTA 1YEHL 4AEEA 5CEZH 1VERA 4JM4H 5JDJA 3ETBF 1U8MA 1CLOH 3CLFL 2UUDK 4NGHL 2QQKH 3UJIH 3P40A 2Z31D 1KTLB 2ZPKL 1K4CB 3CXHK 2YWZA 2KKQA 5DZNA 5IMMB 3H6JA 4G6FB 3VFNB 4PRDB 4BSJA 2XRAL 4P3CL 1UADC 3QIUA 4LVOC 5B3JE 7FABH 3OB8A 3FN9A 3KPRE 5ENWA 1W8NA 3W5MA 1CF8H 3VDCA 4WEUD 3QFJA 4OLYH 1QQDA 1UA6L 2J5LC 4AMKL 4H8WL 2AV7A 4YHIA 3VFGL 1U8OA 5C0FA 1T0PB 1FFNA 1R5WB 3UJJH 4WY7H 3VFUB 2O5XL 3UYPA 1I8KA 4XCNB 1U3YA 3R06A 1A1MA 2LQRA 3C8HA 4XWOC 3LKNA 4QHMA 4QTHB 2R39A 1WT5C 4NOBA 1AGBA 4OGZA 1JHKL 2GY7B 4Y19A 1K8DA 4DKFH 3BP4B 2XFXB 1QA9B 4IIQC 2G2RB 5FA3A 5CGYC 3CC5A 4DVRL 3VD3A 3C2SA 3KPOB 4A6YL 1BBDL 1U8KB 4XNXH 4NQDB 3PWNA 4BJLA 1HSBA 2HWZH 4JFYA 2C3GA 3V4PL 4CVXA 4G80A 4V1DA 2WIIA 4KUCD 1N6QL 4Y4HC 4PS4H 4NPYA 5FKAB 2CRMA 3KNBB 1G9NC 1AXTL 3ET9F 1TZIB 3G5XA 5C3TA 4ZMAT 4PJDB 4GLRI 1XGYL 4MLSA 4S0TD 4IRZL 3UTSD 1AGCA 2GTWA 2XTJB 1TVHA 1PSKH 2BOBB 3RPIA 3S35L 3GIVB 4NYLB 4HWBH 3ULUF 3P4NA 3T2NH 4K3EL 2A77H 4M61A 2YRPA 3KLDA 1DQQB 3R0NA 5CZKA 5BXFB 2R2HB 5DRXA 1YC8A 3FONB 3MCG1 5E9DB 4HG4J 1QR1A 5DO2C 1RULH 2R0WL 2YXFA 3V6OC 4MLIA 2BRRH 1KPRB 2NY6B 4FQIL 2MOVA 3BJ91 2WAHA 1KN4H 5CCKH 4E0RA 3MNWA 3MV9B 4A2LA 3AC0A 4LCIL 3WLWC 2VISA 3QO1B 2DI8A 5IQ9B 2JIXA 4OIAA 5CBEB 4KRMB 5CKAA 1HYSC 4Q0XH 4NRXA 3L95A 1JGVH 1PG7H 2PYED 1LHZA 4XMKH 2FHFA 1OAUH 4QCIA 2IADA 2EH8L 3WS6C 2EDFA 5L2KB 4BSWA 4M7KL 1XIWC 1M71A 4ZO6A 1OP9A 2VXUL 1TETL 4KVCL 4YO0A 1IKNA 4F15C 4YZFF 2X4TB 2NCMA 5HVHC 3IVKA 3QQNA 4OTXL 3I85A 3TBYA 1EZVX 3O11B 3HMWL 4HKBB 2EXWD 3ILPA 2BK8A 4NC2B 2PCPB 1IVLA 2B8OT 1N5AA 4ZAKA 1OTSD 4PJEA 3ZTNH 3UTSE 2IPKB 2G60L 1FYHB 1VGEH 2BSTB 3LEXB 5EOTB 4KH2A 3GUTB 2VZ1A 3MJ9L 4BK5A 4JFHD 1BFVH 5GZNC 3CSYA 3EOYG 3KPNB 1W72A 2Z92B 5DRZA 3RKDC 3VJ6A 3P73B 3UO1H 1EMTH 3S9DB 3ULVL 4OCWH 2MPAH 3TA3C 3KDMA 4K2UH 4RMVA 4GRMA 1PKQB 2ITDB 3ZDZF 2XWJA 2JK5B 4GBXB 3S3PA 4NQCB 4OLUH 5TDOB 5C0DB 4BUGA 2JB6B 1XCTA 3EO9H 4AM0A 2PYEE 3FHAA 5IT2L 3WIIL 3NCFB 1MCOL 4J3SA 2IQ9L 4ONGL 3GIZH 4QTIH 1ORSB 2DMCA 3HRZB 4J3WA 1T03H 1MCNA 2FEDC 1CS6A 1FO0L 3SCMC 1U3HB 2CRZA 4XXCA 3TJHC 1RMFH 4PJHA 1QLFA 2XQBL 3KYMA 5HYFA 3G5ZA 4FG6C 3ULVD 1BQHA 1UGNA 4RFNB 1MCFA 1IC5H 4K7PL 5I9QB 1KBGL 4PY8I 3OPZL 2H32B 3EYQC 1YN7A 3LN5A 3V0VB 3WHXA 1FG9C 1ZGLP 5DJ6B 5IK3A 4MA8H 1II4E 5EIVA 4W68A 3SDCA 5ISZA 1HNFA 1NGPH 1CLYH 3DUUB 1JF1B 1QRND 3TBVB 3Q3GA 3LRSB 4NQUA 4JM2D 4PJ9D 3DVNB 4OZHF 5GIRA 3GM0A 4FZEH 3VXOB 4HS6A 4JFHE 4YFDB 5DQDL 5CGTA 4JGMA 3HFMH 3TIDA 4LMQE 1RZGB 2AJUH 1GC1L 5GJSL 4JM4L 4L8BB 4AEHH 5I1AB 4KVNH 2FIRT 5E95B 2D9QB 5ESVB 3QG6B 2W9EH 1A6ZB 3QR2A 5KVGL 3QH3B 4HC1A 3DBXA 2WQRA 5FUZH 2R4SL 5DWUL 3FTGB 1OD7A 3FN3A 2GYSA 3K8MA 4LPCA 1ND0B 4JHWL 2EYTB 1BWMA 3BIBX 3ULVE 2OXHA 4KI5D 4P49A 4PJAF 1KJ3H 1CF8L 3D5OF 4WHTB 4LU5L 4Z76A 2R29L 4F33B 4JFQA 4JFFD 5HHNB 3VA2C 2AQ3A 4PP2A 4S1RL 1P4LA 5CEZD 1EAJA 5ICXA 2HFFA 3SKOB 1U91A 1A1OB 4P2QD 2IMMA 3BPNC 3T4YB 1FZJB 4NDMA 3GSWA 3UJJL 3PDOA 4P5TC 4UU9B 4YNYB 4WY7L 2NY7L 1RUQH 4UIMB 3V2AR 5D1ZB 2FL5A 1GGIH 1QRNE 3L5WB 4TSCH 5BZWB 1FL6B 4ZOBA 4EKXA 3PWLB 5CJXA 1U41A 3MPCA 1QKZH 3WHE1 1N2RB 5CP7B 3RGVC 3FQUB 4O00A 5FO9B 2BVEA 3UTTA 3TZVA 1LEIA 1NC2A 4HZLA 4XNXL 3MRQB 1KCRL 1KT2A 1FIGL 2HWZL 1CN4A 3ZMRA 4I0PD 2F58L 4P3DA 3MJ8A 1NQBA 4P9HC 3OXSB 3IKKA 1VADB 3NPSB 2ZUSA 1MI5A 3IRZA 1YJDL 2UWEA 1RUKL 1O5DT 1X6NA 4WEBL 4WI2A 5GS1B 4YUEH 2PF6A 1NUDA 4PJ8C 1R3HB 4M5ZH 4OCSL 1NUFA 3A67H 5GRVL 3KG5A 5FEBA 4XZUB 3FT3B 2ORBH 3ARBD 4ISVB 1WITA 1PSKL 3QP3A 1LEGA 2B39A 2P8PA 4MCYA 4NKDB 2MJWA 2YPKB 3JTTB 1OW0A 2LTQB 5F96L 3RNQB 4FQCH 3T2NL 3TCXA 4M8QA 3GMLA 4KK9D 4KI5E 2WBJD 2DL9A 1NEZA 3U0WH 4JFFE 4F57H 4YDVB 5TQ0L 2D7OA 3BWAA 2VDLL 3UX9B 2A6IB 1FC2D 1RULL 1SYSB 4KQ3H 1BZ7A 5FDWB 3SEPA 3REVB 1DN0B 4DKDC 1F5WA 5CCKL 4P2QE 3RJQB 1MCIA 3O2VH 3X14A 4JFZH 3OAZH 2YD2A 2NNAB 2EE3A 2WUBL 4U05A 4ZQKA 1U2CA 4Q0XL 2ZCLL 3DMMC 4AIOA 4DCQB 1CFQA 1E4WL 1AP2B 3DV4A 1A7NH 3QULA 3LQAH 5E8PA 1FSKC 4YHMH 5BV7C 2VN7A 4F37K 2FJGA 2EDDA 2CMRL 3QHFL 5EO9B 2FZ3B 3F5WB 4OZIE 1E4XH 2Z35B 4OGXH 4OIIH 1K9TA 3E8UL 3QO0B 1GOFA 3ZHDA 5IVNA 3VMOA 4NWTH 4RFEA 3CVHA 5I8CB 5ITFA 1QPXA 3S96A 3ISWA 4LFHG 3RA7L 2B4CC 3MUGA 2X4PA 3TO4A 5A40E 4U1IA 1MHCA 3ZTNL 1CE6B 4LSPL 4XNZB 4Z95H 2D3VA 2Y06H 5HYQB 4D94A 1UWEL 4L3CA 4CU7A 1NCDH 1EA9C 2QADC 4MSWA 1NPUA 3ZZ1A 1KLUB 1VGKB 2VSCA 5EU6B 4GW5A 3FO0H 5JW5A 1BFVL 4KHTH 3PL6B 4YHYB 3C9NB 3UO1L 4Y2OA 5AYUH 3EZJB 2MPAL 5CBAA 3TWCL 5CD5D 3B6SA 2AJZB 4EI5A 1S7QB 2XKNB 4JR9L 1HWGB 4Y16A 1N0XL 2R23A 2WW8A 5A2IH 1H8OA 4PJCB 5CFHA 5D7JC 4PRPD 1TQBB 3EO9L 2R69L 1X4ZA 2NR6D 4IOIA 4KJPC 4PGDB 5DJ2B 1Q9OB 2DB8A 5EO1A 3CH8A 3MLUL 4OCYL 3GIZL 4QTIL 4FFVD 4XPBL 3S4SB 1VEPA 1T03L 1Z0MA 2RIKA 2IBBA 1UWXH 2V7HB 1FNHA 5D1XB 1J05B 3LY6A 5E1AA 4L5FH 1M7IB 1IFHL 4U1KA 3VE0B 5K9OB 1FL5B 4NUGH 5D96C 2J6EL 3GJEA 3TM6A 1J88A 4YHLH 2Q87A 3BH8B 3SE8H 4WV1A 3MGOA 4XH2B 1CGWA 1QVOA 3MODL 2DDQL 3OXRB 3H2WA 3MXWH 5JA9A 1BGXL 4P2OD 1J0ZA 3H7LA 2OTWA 1JN6B 3BZEA 2YUWA 2W65A 4NKIH 3O4LB 2X1OA 1KC5H 3ORJA 4NRYB 1FNFA 4NQED 4ZUWA 3TP4A 5JXEC 5I71B 4H26B 4JFEA 1ZWIB 5GS2H 3DI2B 5D5ME 2IBZY 2W38A 1CDIA 5IB5A 4ALAH 2FBJL 2VLRE 5ESQA 2W0PA 4JKLA 1I8LA 5I66B 1BBJA 3Q6GH 1I7ZB 3WN5C 2O5YH 4TSBH 2SEBA 4KVNL 2ADGB 3NCJH 4PRPE 3WIFA 1F4YL 4P99A 5TE7H 4LCYB 4PIRF 4GKOA 5ESAB 4M00A 1A6TB 5FUZL 4LLVA 4MJIB 4K7PY 4KMTL 4R7DA 1NMCC 2EKJA 2EZ0D 3IFPB 1RUAH 2EYSA 2DQHH 4X7SH 1E6OL 1A7QL 3OX8A 4WWKC 4CUCA 1UVQB 2ADFL 3QXUA 4ODHH 1MFAH 4XNUH 3W82A 4FTVB 5MEQA 3VCLA 4XXDB 5C0CA 4WFFD 1Z9OA 3TNMA 1J8HD 4QWWC 3RL2A 4BFIA 2DWDA 4P5KA 2NPLX 2IC2A 3UTSA 1FAIH 4HLZH 2Q20A 4J8RB 1GGIL 5DJDB 4XCEB 3FHQA 1QKZL 3TT3H 4RX4D 3S37X 1MREH 2BMKB 4YXLL 1T1YA 1FV1A 2E3VA 4U6XA 4NQEE 1KNOA 3PDGA 4A6YA 4Y4FA 3PNWB 3GSVA 4M1DL 2BSRA 4B7LA 4NO0D 2X42A 4HF5H 3O3DB 3HE7C 4ETQA 2CKBB 2AXHA 3IDXH 4X7TB 4QRPD 4YAQA 5I73C 2G75B 4HLJA 2JB5H 2WSKA 4PLJC 1T20B 2Z91A 1YNTB 1XFPA 4HUUB 1T22B 5IFAH 3P77B 4O58L 4ZUTB 2ORBL 4I3RH 3NCBB 3TBWB 3JBG7 4Y2DC 1TJIH 1YNKH 4U1SB 3NZHL 3ARDD 4I48A 5ALCH 3K1KC 3OKYA 4MB5A 5IVZB 3CFCL 1KIPB 3D9AL 1QO3B 4EJ1C 4F57L 2B1HH 4WTZA 2FYYB 1RJYB 3HS0A 1I1YB 4HJJH 3C8KA 1LK3L 1Y18B 4KQ3L 4WFFE 3KLSA 4WUUA 2PKDA 2MTPA 4LLMA 1J8HE 3GMPB 5IB2A 4HKZA 2CGRH 4JFZL 2FJHA 3QIUC 4Z0BL 4JLRA 4MCZB 4ONFL 1UCTA 1X4YA 3MFGB 1UM5H 4BQ6A 4AIXA 1NLBH 1K4DB 1GYAA 4X9IA 3IDMA 3OAYH 3LQAL 3H9SA 4XI5D 1D5ZB 4YHML 1EEYA 5IEHA 4ZFFA 1F3DJ 1ZHLB 5MEND 3TCLA 4IRSD 5IROA 43CAA 2YA1A 4N0YH 3VXQA 4BSVB 3JZ7A 2A73B 3L7FB 3ROOA 3LKQB 5CUSL 3ZKND 4WFHD 2ICCA 1MHHB 1NFDB 4PGCA 4QRPE 4WHDA 4ONOA 4OZGA 3TH3T 1P7QA 1G6RL 4GSDH 5AG8A 4NN7C 4POUB 4CBPA 2A9ML 2AEWA 1LE5A 3HLAB 1LP9F 4D0DB 2GJZA 4L29A 4QY8A 3NABH 2R0KL 5DLMH 3BGMB 5C0BD 5H35A 3MJ9A 2NY2C 3NZ8B 2NW3A 3GMQA 4R4FH 3JV0A 2FJFB 3D39D 3WS3B 2XXMB 4KHTL 5C08E 1J9CT 1E27A 2VDML 3ARED 3QDGA 5J89A 5AYUL 3VDBA 1A6AB 3MV7E 4Z7WF 2GTZB 3IFLH 2DQFA 4J1UA 2EIZB 1WUNT 4X6CF 3SKUD 5HHOB 2R56L 1MAMH 3HZYA 5EZLA 1P4BL 4HJGB 3PQYD 5MEPB 4JHZA 5HGDA 3VXMA 1X7QB 3BJLA 3JWOC 4FZ8H 2FBOJ 3OKDA 1LO4H 5F6HI 3JWDH 4FQLH 1IAII 3WEXB 4PJIB 4EZMA 3FOMB 3U4EA 5MENE 2MKLC 4Z7UE 4YHZH 5E00B 3LPWA 2ZUVA 1AR1C 1XF4B 4IJ3B 3E6FB 1HH6A 4HPOH 4KDTA 5C70A 1FRGL 5IW3A 4OLVH 5IBUG 3RWDB 4OZ4B 4WFHE 1ZA3B 3QHZL 5ICZB 4F9PC 4X8XA 4OD1L 1WSST 4NKOB 4HXBH 3SE8L 1AQDB 1OWRM 3RY6A 3TF7C 1AQKL 1S3KH 1DVFD 3ZKMD 1Q0YL 5EZJA 4HKXA 4KKAD 1QSED 1A6VH 4JM2B 4PJ9B 1G7QA 3VFWB 4CDHA 1EHAA 1GHFH 4PRIB 5C0BE 4OCRH 5ECJE 1IKNC 4UB0H 3FB7A 4U2ZA 3C60A 4NKIL 2D9CA 3ES6A 2VXVH 5BRZD 4MDJB 4QRTB 1U8NA 3ARVA 3KYAA 1U95B 2IGFH 2D7MA 5E2TL 1RUPH 1WTLA 3IJHA 1XZ0A 4HS8L 2AP2A 5JHDD 4FABH 3O0RL 3GMMA 4ALAL 1UXSA 3PQYE 3QUMB 4KRNA 3DXAB 3T08A 4F7CA 4TSBL 3WXVH 4WENB 3HNTH 4X5LA 2OXGA 1JMZA 5TE7L 1WEJH 3IGAB 5E99H 2PR4H 1AGEA 1T0NA 3SDAC 4X9BA 4HPYH 1VCAA 5E2WH 1JHLL 2CIKA 2Y7QA 4MJ2A 1GPOH 2DQHL 4HS3A 1HXYA 3ZHLA 4OZIA 2BVPA 5GS2D 4JN2A 4ODHL 1MFAL 2CSPA 3EJZC 2IPUG 4XHJD 3W2DH 5HYIA 5J11B 4LF3A 1MJ8H 2OMNA 4QRUA 1JNLH 3FFDB 3G5VA 4UOW0 1X6LA 3GZKA 1W0YT 2AJ3A 3K4AA 4PJ5A 3HC0B 5E1HB 2AK4B 3OKNB 1FYTD 2VL5B 1QSEE 1FAIL 4XXCC 3VXPA 2VLJD 3HN3A 5HHXL 2ZG2A 4DAGH 3ARBA 1NBYB 4F8TA 1HNGA 3T0VA 1AXSA 3QQ9D 5BRZE 1AC6A 1TFHA 3S34H 1MREL 4KRPB 2PTUA 2F15A 1F6LL 1UKTA 5I1KL 4HIXH 1QFWI 2C3XA 4YXHH 3B9EA 5JHDE 5DUMH 3HAEH 3L3OA 3BKMH 3VFVA 3SDCC 2DQGH 3F7VA 1R5VB 1BD2E 1JNNL 4Y5XB 1UQSB 1FZOB 2C7UB 1V3LA 3NACH 3T8XB 4XWGH 1K2DA 3F7RA 1EEUA 4K3JH 1RU9H 4LQ1A 1H3VA 3MRFA 1TJHH 3OF6D 1W8OA 2FEEI 4HQQL 2XXCB 3U1SH 5E6YA 4I3RL 3VWKA 5E2JA 3EGSB 1NBQA 2WBJB 4G6JH 4HBCH 2B5IC 1TJIL 3BIKB 2NXZC 1RJZB 4HFWA 4PY8J 4LSVH 4NC0B 3VWJD 5DK3A 1RQ5A 3FQXA 3NFNB 5DJAB 4Q7DA 1IC4L 2ARJB 5JA8B 3TH4T 5F21B 3KJ4C 4KTEL 5TDNB 1CXKA 5DUBB 3U0PA 3EYVA 2IANB 4WI4A 3WLBB 1R24A 2HVJB 1RZ7L 1OB1A 3JV5A 5E6IA 1IAOB 2VWEE 1FYTE 1RK0B 4NC1C 3SE3A 3U83A 3S8WA 2VLJE 1E4KA 2PTVA 5LVEA 2HJKA 3GHBH 4KFZC 2APBA 3P30L 1TVBB 1T1WB 1UM5L 2YC1A 2FH8A 3PHQB 3HZKB 4U1NA 3E1F1 4RFOL 5KOMC 3VXNB 4LASH 3L7EB 3WNLA 1C8PA 3U6RA 3RVXC 2OI9B 4PJDF 1DQLL 3V5KB 5CZXD 1DL7H 3SO5A 1I9JH 1L6ZA 3PIQA 3G04B 2M8XA 4XBPB 4WO4D 1EUUA 4OF6A 1EUTA 3IETA 4HG4K 4Y0GA 5J3HC 2VLRA 1JI2A 4R9HA 1U36A 3V4UH 4PGEB 3CAFA 2P8MB 5FHBH 2PO6C 3KPQA 2CPCA 3BZ4A 5CJXC 5BO1L 3F58H 2Z93A 4R4BB 1T7VA 43C9B 5GSVA 1JWUA 1WCBB 1OVZA 3TZVC 4YX2L 5DLML 4AJ0A 4WI8A 3V0AC 1N5YH 5I1JH 4APQA 2IFFL 4R4FL 2X9YA 5EUKB 4MS8D 3ROLB 3VXRD 5TQ2L 5EO0A 5IFJA 1OTTC 1BFOA 2GITB 2NTSP 4RAUA 2RBLA 5B38B 2ZNXA 3S4SG 1OHQA 1PBYA 1MAML 3WD5H 4GJTB 2XZAL 2BVUA 4PRPB 1QYGH 2V2XB 2F74A 3BGFC 1EIBA 2YRZA 5H94A 5F93C 4AK1A 3UBXA 3IDIB 3Q1SL 4NWUH 2ATKA 5I1GH 4FZ8L 4CN1A 1QSFD 3M1BA 1IAKA 4KROD 4FQLL 3LKPB 3QUZD 4BFEA 2NY3C 5KZCD 3G6DH 2BNQE 1BIHA 2EDNA 4PTUB 4XP9L 4E5XB 1JWMA 4URTB 4YHZL 4L4TB 4LSQH 3OAUH 5TF1H 2AABH 4O2FA 2AJVL 3KS0H 4N0UE 2R0LH 1A5FH 2DM4A 4NZRL 4LQFL 2J6EA 4MD5A 4P57A 3DECA 2OQJA 3BYYA 4ZXBA 5DGRA 5GGQH 5HTSA 3LIZH 4N68A 1UWGL 1OSZB 3VMNA 3QWOA 1IGFH 3CDYA 2ZG3A 1KTLA 4HXBL 3HUJA 4JRYD 2DKMA 3KLAA 4U0RC 3SKMB 3MSPA 4XNQA 1GHFL 1NCBH 1XR9A 4NQEB 3MUY1 1KF9B 4MX7B 4PRDA 4UB0L 2DI7A 2VXVL 1IL1B 2EYRB 1G7PB 4LAQL 1Y6KR 1IRAY 4R3SB 4KK6D 3VXRE 3H9YA 1MIMH 2IGFL 3KR3H 3MRNB 4G5ZL 5EC2A 4JY6B 5CP3H 2P49B 3UZEA 4FABL 4KK5C 4U49A 1PW3A 5E24E 2YPLE 1VEMA 2HN7A 4M6MH 3M07A 3PWPD 1MCPL 2CDEA 2QSTA 3GSXA 1B4JH 5CILL 4YQXH 1LO0H 3NIDF 3DRTA 3HNTL 4XCNA 1K6QH 1SVZA 5HDQH 1QSFE 3UDWA 3DTXB 4QTHA 3FT2B 4Q9BA 3KPTA 4MNGE 3T65B 3C09C 4I2XE 2OK0L 1BECA 5E99L 2F53B 1MFDL 4EI5C 1WWCA 4X4XB 5FV2A 4DTGH 2XFXA 1QA9A 3HE6B 2G2RA 4Y16C 2KUTA 5E2WL 2HLAB 5H2BB 3X13B 3D0LB 2F19L 1JTTA 5DD3H 3P4OB 3TVMD 1J8HB 4P4RB 5D7KE 1SEBB 3W2DL 1ZT7A 5E4IA 1OAYH 3LVEA 1JNLL 5FKAA 3O9WA 5E03A 2LU4A 1O7SA 2P5ED 4H20H 1TZIA 2E27L 4JRYE 5HSFA 5C3LD 1WZKA 1ROWA 3PXJA 5JORA 2VOTA 4Z9KB 5EUOF 4GO6B 2W9DH 4NYLA 3N1FC 3ARDA 4YBLC 5E2VH 3W9DB 5C08A 5DJCA 4MDIB 1DQQA 4JGUA 2Z31C 3T77B 1BJ8A 5BXFA 4OD3H 3SDDB 4GH7B 4X4MA 3MV7A 4WV1C 1INDH 3NIFF 4G7VL 5IOPB 1IZJA 5T1KA 3BZFA 3IDNB 5HDBE 2Q3ZA 3EJYC 3BKML 1YMHA 3QEGH 4EOWL 3PWPE 3LQZB 4NN5B 2JELH 3STZB 4EUPH 3W5NA 4XWGL 4J3XA 2VXTL 5IQ9A 4I9WE 4K3JL 5CBEA 1RU9L 1TJHL 3CFKB 4LLYB 4G43A 4LDEB 1MAJA 3MRLB 1C5CL 4XPTH 4IMKA 4JHAH 4C55A 4G6JL 4HBCL 1MCJA 5A16B 4NSKB 1FNEB 2Y07L 1PEZA 1RVFH 2AGJH 4CVZB 4LSVL 2RHEA 2VZSA 1H3TA 1PGRB 4DQOH 4NOFA 4X5WA 3F6LA 1FZMB 2PTTA 2H8PB 4OZFB 5JLZA 1EERB 5DDHB 3RVTD 2P5EE 1U8JA 3PJSB 4LARH 3T0ED 5DK0B 2VDPL 2ZCHH 2E5EA 1JWSB 5D1QA 5L88L 3V5HA 4U1GB 5C0BA 2XY2A 4FQ2L 4RISL 2QL1A 1QBLH 3LEXA 5EOTA 1NAMB 5B3NA 4H8WC 4LASL 1PYWA 1YNLH 4NM4H 3AREA 2Z92A 4NQTA 4NZJA 4FFYL 1DL7L 4V2CB 1I9JL 5F3BA 5ETUB 1ZXQA 4YDIH 4R7NA 1PKQA 3B4NA 2XI9A 3UTQB 1NGQH 1NSNH 5FHBL 4U6VL 4GBXA 1G6RA 5AYQA 4NQCA 4M9OA 4GQPH 5BZDA 5HHPB 4EQ2A 1DSFL 3L3HA 4NZTH 4BKLA 5ADPL 4R96A 4Y4FC 1CFBA 4JPWL 2UWEF 3D39B 3P9LB 1N5YL 3WHE0 2GFBB 1U3HA 4PJ7E 3JV4B 1RIUL 5DMYA 5EOQH 4H88H 3VRJA 1CD8A 3OR7B 4HUMB 1R0AH 3U46B 4RBPH 2H3NB 2I07B 5F9WC 5FO7B 4G8GD 4JANB 1BZ9B 3QCUL 5I8KL 1UH3A 3BAEH 3LH2H 2H32A 1NGZA 4TVPH 4FQHB 3FQTB 3QBTB 1OPGH 4JG1L 1OAKH 3T0EE 1QSEA 1UM6L 2V6HA 4ZO7A 3KYOB 3FMGH 5I1GL 4Y5VB 3SKNA 3TBVA 1DCLA 4G3YH 1A3RH 2FH6A 3B9KD 5BRZA 3QIBA 1VSCA 1KTDB 3MRIB 3DX8B 3LB6D 1ETZB 3OAUL 5GGVL 2EXWC 5SWZD 1OTSC 1RZGA 5IMLB 1T1ZB 3DVFA 4FQXB 3N1QC 3CCHB 1BD2A 4BH7B 15C8H 4N0FB 1DVFB 3LIZL 4GG6F 5DR5H 1A1NB 1LDPL 4L8BA 1ED3B 1KB5B 4WFED 5FV1L 1S9YB 5BVJB 5AAWA 4AQ1B 1I3RB 3C6LB 5ANMB 5IROC 3FTGA 1ZHBA 4AH2B 1CTOA 3PDDA 4U0QB 1BQUA 2KZ1B 1BLNB 1MRFL 4PJCF 4GKZA 1SY6L 1P7KB 2W0LA 5IB1B 1C08B 1U92B 1MIML 3VD9A 4WHTA 3KPMA 5B3JF 1DANT 3MBXH 1L0QA 4NP4L 2QTEA 1NFKA 4M6ML 3J7HA 1A1OA 3UYOD 1UACH 1E4XI 4YNYA 4PUBH 1LO0L 4XVUD 4OLZH 4MQTB 3F12B 3V5DB 3ULVC 1JZ7A 3L5WA 3T3ME 1G9NH 1T2JA 3PWLA 1A21A 1QBBA 4XC1H 5C86A 5HPOA 2DTSA 3RIAK 3BW9B 5CP7A 4KUZH 5F7EL 4GT7A 3LOWA 5CHNB 3BD5A 4UINH 4Z7QE 4DGYL 5SWZE 3ECBB 1T6WA 4FXGB 5DD3L 4HULB 4BA8A 1YUHB 2FX7H 2YD8A 1DLFH 1R6VA 4C57C 4B41A 4P46D 2HTKD 1OAYL 4WFEE 4OI7A 2A1WH 5F7KC 5GS1A 4BFBD 4I3SH 3C5ZA 1F4XL 4PRAA 4JE4B 5MERB 1S9KC 2AV1B 4Z78A 3FRUB 3MRDA 1PD6A 3RTQD 3NA4A 4WFGD 4HMDA 4M1CC 3HRPA 5DFTA 3QI9D 5AD0A 2FWOB 1SJEA 2R9HD 3VWJA 5MI0C 2WLZA 1LGVA 2YSSA 4UDTB 1CD1B 4OD3L 3NCEB 2LAGB 3RIFF 3QHTC 4YDVA 3M8OH 2A6IA 3QUKB 4DZBB 2H6PB 2QHRH 5FDWA 2I25N 5F6HJ 4LHQB 4JFXA 5HYJD 1FN4B 1QUNA 1KJ2L 4HDIB 5DK2B 4F9LA 4HWZA 3GHEH 4MAYD 2NNAA 3L1OH 4D9RD 1NMAH 1L7TH 1XGPB 4KI5C 2Z8RA 5KSAB 5IEKB 1AP2A 2CH8A 1GC1C 2BNQA 2VTFA 4HKJA 4RWYH 1F00I 4F7TA 4K7FB 1G7IA 4XPTL 3QJFB 4JHAL 5DVMA 4PRHE 5B4MC 4N0UA 4WI9A 4XBGA 1RVFL 4ELMA 4IRJD 4X4YA 4YDLB 5AWNL 4XBEH 5KSBA 2H2PD 1OQOA 1D7FA 3RI5K 4DQOL 2OTUA 4LLAA 1KXQE 5I74C 2ZUQB 2C3HA 5I8CA 4PBVC 3OKOB 4MA3B 3PWJB 1JNHB 1MH5B 3DRQB 3QNZA 5TFSH 1F6AB 2DL2A 2ICWI 4N8VG 4KUCF 4Z7NE 1S8DB 1YEJH 1RJLB 3OHXA 4EN3D 3D3VE 5DD0H 5GRVK 5T1LA 1FNLA 1QBLL 4ZFGL 1KGCD 2JCCE 2X2YA 4I0PC 4QGTA 5DQ9A 3SPVB 5DD5L 2WBKA 3VXRA 3PL6A 4NM4L 5J13C 2EE9A 5IWLC 2MCG1 1K3ZA 3EKCA 1SBSH 3GJFH </