3MLRH

Crystal structure of anti-hiv-1 v3 fab 2557 in complex with a ny5 v3 peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
226
Chain Sequence
b'EVQLVESGGEVKQPGQSLKISCKSSGYNFLDSWIGWVRQIPGKGLEWIGIIYPDDSDAHYSPSFEGQVTMSVDKSISTAYLQWTTLQASDTGKYFCTRLYLFEGAQSSNAFDLWGQGTMILVSSGTTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
molecule tags Immune system
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
total genus 40
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlrH01
3FTGB 3AU1B 3EYVB 4ZAKC 4NYLA 1KJVA 5DRXA 3L95A 1DUZB 4AY0A 5EBWA 3OZ9H 4NZJA 1F4XL 4Q9RH 1KELH 3NCEB 2EYTA 4X4MA 4YHIB 3GBNL 3DXAB 3S36X 2YK1H 3MV8E 5H2BA 1J0YA 3AFLA 4HUXB 5DHXB 3MRFB 3KJ4C 3MREB 5AYUH 1HXMB 3DX9B 2FD6H 5GJSH 4NHUB 4GKSB 4YDJB 3FB7A 4OZIA 5KSAD 2VL5B 5IF0A 2R0ZL 2XRAL 3EOAB 1RIVH 1EFQA 3MLSL 3AGVA 2AK4D 1MOEA 2GK0A 3QISA 1NMBL 4J3WA 5C2BH 5I1AA 5DQJB 5JOPD 4HKZA 4ZYKA 3X14B 4XNUL 2W38A 4M5YL 2D7TL 3T2PA 2XKNA 2W9LA 3MBEC 3MRDA 1K2DA 3TVMB 5IG7A 2HKHH 4GG6B 3WLBB 4CADA 5LWYH 3MUZ1 4QXUL 4LCYB 1NCBL 4JG0L 4TVSa 1J0IA 3DSFH 4IDLA 5E4IA 4P4KC 1UB6B 2QHRL 4IRSA 3MLRL 2DLEA 1FCGA 4Y4FC 1FGVL 4TTDD 4X6FB 1AHWB 2JJWA 1DBAH 4G7VH 5KANG 2AXJA 4Z77A 4A2MA 5IKCB 4XBEH 4J3UA 4HUWA 1D5ZA 3KPQB 4Y5VC 3Q2CA 2M2DA 2Z31D 5AD0B 4MD4A 1RHHB 1SVZA 2OTUA 5DS8A 2J1KA 4GG8B 1NMCB 1BFSA 5E70A 1F58L 2VB5A 1AO7A 2VXVH 1DQQA 4QHKI 2CLZB 5I1DB 4E0RB 3IDGA 4GRLA 5EU4B 5MERB 5MEND 1BFOA 4JY5H 3C6SA 1CFVL 4NCC1 1T0NB 4XNUH 1QSED 2PXYC 3AY4A 4PB0L 1ZHBA 3EFFA 2OBGA 3WV0A 4KDTC 1BPVA 2FH8A 3EAKA 3UZQA 2FJHA 1WUNT 5IW1A 5ICZB 1MCPL 3W9DA 3D85B 4LASL 1R5IB 4GAGH 3D0LA 4F3FB 1F3JA 5IW3A 1LNUA 3LKNB 4HEPG 3VXME 3EYFA 3JWDL 3RWFB 2RGSA 3BKML 3MV8B 2VXQH 1DBMH 3VI3F 4QHUB 2FSEB 2Q7NA 4RGNE 4FQ1H 4UT9L 4ZSOA 1G9MC 3RBGA 5GZOC 1DUYB 2CKNA 2IMMA 1BD2B 3V6OE 5I0DA 2B4CL 2R4RL 1MHHB 4ZFFA 4KROB 1J8HA 3FQWA 3LSOB 4NKIL 5L2JB 4S2SA 3IFNL 4U6XB 2NW3B 3HC3L 3BP7A 3MNZA 1E28B 1R24A 4OLXH 1QOKA 2DQTH 4LIQE 1PSKL 2JKXA 4OLWH 5EN2A 5T5FL 4OBSA 1ADQH 4KKCD 4N5UA 2VABA 3C2SA 1RUMH 1ZGLA 4LASH 2AEPH 1SEQL 3ZKQD 4XNYH 3ILQC 1UXSA 5IVXB 4MX7B 3VI4F 4LBEB 3U0WH 1PZ5B 4M61A 4F80A 5JUEL 1SMOA 4Y5VB 1IJ9A 2OI9C 4I3RL 2BOCB 1D5BB 4J3SA 2XPGB 5D1ZC 2DLFH 4JN2A 1MELA 1D5XB 4BZ2L 1I9RH 4YIQA 5D7JA 5KTEH 1P6AB 1OTTD 2H26B 3F58L 4ZSOE 3EYUH 4OLYH 4FZEL 4GRLD 5MENA 1U6AH 3ARDC 4NO3A 3QIBA 5FA4B 4ZTPH 3P73A 3IFLH 2XZAL 4KTEL 3MRBB 1ZK9A 5DRNA 1WJ3A 1MCNA 3MA9H 2GJJA 1QR4A 2O5XL 2VIRA 3BZ4A 4LSVL 1A64A 1PG7X 3RGVC 4RX4D 1EHLH 1GH7A 2HT2D 5BOZG 5CD5C 5H2BB 4NKOB 1GGYA 2G9HB 2DQHL 2AEPL 3MREA 3FAXA 2NY0C 1S9YA 4HGWB 3FB7B 5L88L 5LGKA 1Z9SA 2YA1A 4EIZC 2HH0H 4UILL 4QF1B 2CO6B 2AQ2A 5E2WH 1AXSA 4L4VA 1QRND 4IRJD 4TVPE 2H45A 4MNQE 3K2UL 3W11D 1HQRB 2H32B 8FABA 1FC1A 4X83A 3LS5L 5IB5A 1WEJH 4XVSL 3KPLA 2ADGA 2AJZB 1JPST 1WICA 4GRMA 3GSUB 2BY2A 4FFZL 3MRDB 2KQNA 4G8GD 4YHKL 4P5MB 1YEGL 3V6OA 4YDVA 4YO0B 1NFIA 3NCJL 5AAMA 4FTVA 4XVJH 2DMKA 5J56B 3GSXA 5DEFB 1AIFB 4YX2L 1IAOA 3S37H 3OXRA 4W70A 4R6UA 4IRSB 2Z4QB 3HPJB 2VQ1A 4X6FA 2EICA 4ZAKA 4Z77B 3N1PC 5DR5H 1CD1A 2HT4D 2OI9B 3BQUC 5DA0B 5EIIA 4L8CA 2ED7A 2LTQC 4L1DA 3TA3D 1RHHA 2W60A 4ELMB 1A3QA 1CFBA 3VI4E 2R2HA 3FQXB 3O3EB 1FRGL 1ZHLB 1BQUA 1W2KT 3HAEH 3UTPE 4JFQB 4PJ9B 1BFOB 4XP5L 3B9EA 3OF6A 4HKBB 3TWCL 4OD2A 5INDB 3FCTA 4O2FA 2E7BA 3CLEH 5D70H 1MQKH 1NBZB 5GS0H 4MDJA 3DX7B 1BEYH 2UUDH 3ZSTA 3UMTA 4RFNC 4XVJL 3RPKA 3HA0A 2AK1H 3OJMB 1E6JH 4M00A 3T0EB 4BH8B 3KR3H 4ZUTB 2NY6D 3V2AR 3K0WA 3QUYB 5L2KB 3RWHB 3QQNA 1IGTB 3MNVA 5HHQB 1YNTB 3U9PL 2IBBA 3WS3A 4X4ME 1BQLL 2ZSVB 5J4MA 2QR0A 3HZMB 5HYSB 1DUYA 2EC9T 2HKHL 4E42B 2YHGA 4M7JL 4OCWL 5E2UL 2ICWI 5DZNA 2AJ3B 3ZKSD 3UTSB 5CEZE 1D9KA 4XX1G 2A9ML 3DI3B 4YK4C 1P6FA 5D2NB 4PJCA 5ACMA 3PP3H 4XPGH 3BP7B 3QHTC 5I0ZA 3NN8B 7CGTA 2IAND 4R0LB 3SQBA 3ZE2F 4UTBH 4GW4A 4HUVB 4HIXL 1CGSH 1G6RL 1NGYB 1A7QL 4IRZH 3WUWB 1SY6A 1UKSA 4PGCA 5C09A 2UV3A 1S9WA 3A0OA 4KJWD 4LBEA 5T3ZD 2ZUYA 5LGHH 4M61B 4P2OA 4Y5XC 5DJ2A 1CDCA 1D5BA 1H8SA 3E0GA 5FDYA 5IVOA 3PWPD 1E4XL 4LF3A 1CBVL 1Y0LA 5D7JB 5EU7C 3RUGB 1Q9OB 1MHEB 3V52H 4NN7B 4UV4H 5DJ0B 3ZT6A 5C71A 1HH6A 4EBQH 3DMMD 3H9HB 2VE6A 2X4QA 5F9OH 2X1PA 3HG1D 5CJQH 4OZGA 1T5XB 3TYFA 3AUVA 1J1OH 2EE3A 5EOCL 1I1YA 4UTBL 2R69L 5E0QA 4UMGA 1FIGL 1KEGH 1X5AA 4OCSL 1A7QH 3RIFF 3UJIH 3KPSB 2E7LA 3HMWH 1S9YB 4K71B 2R4RH 4PRAB 3BPOB 4WWKB 3RI5F 3H9SE 3LH2L 3AAZB 4YAQB 3ARBA 1BX2A 2O5YH 2H3NB 1JNNL 6FABL 1HQRA 3RVWC 4Y19B 2J4WH 1G7MB 1G9ML 2ADGB 2AJZA 3IFOB 4GLRI 4PJDA 4ELKA 3MUGB 5EORH 2P43B 1K85A 4UB0L 3BGMB 4JZNA 4JCLA 4MJ5A 3JWDC 4JFZL 32C2A 1NLDL 3O8XA 4J1UB 3KPNB 3GK8H 4WHYG 1J12A 1N7MH 4PRIB 3KYAA 1FPTH 2FEDC 3UDWC 1AGCB 3BEWA 2OSLB 4U31A 4KKLC 4Y4HC 4A6YA 5IHUL 2OTPA 2Q1EA 2GCYB 4FXLA 4X7DC 4JKMA 5MEQA 1HSAB 2OR7A 1BJMA 3L3IB 2IH3B 4P2OD 4PD4J 3QG7H 1FAIL 4PBXA 4HS3B 3I6LD 5C0AD 1FP5A 4LLMB 1D5MA 1G7PB 4PG2C 3OGOE 3QWOB 5HGAB 5I8EB 3W2DH 3KYMB 2OK0H 2UYLB 2IFGA 1ND0B 4M7JH 2CIKA 3QUML 2YWZA 2VDOL 4E5XB 2DLGA 5ADPL 4OFKA 1EEQA 2IG2L 5CSZA 1MFCL 4MB3A 3T77A 1MLCB 4NZTL 5DD0H 5DRWB 5JNYA 3UAJC 1EFXB 1XZ0A 4BH8A 1RK1A 1KIPB 4ZUTA 3WE6A 5ACZB 2OJZH 4Q0XL 2ENSA 2F54E 5L2KA 3CH1A 5A3ID 1JHKH 1KOAA 1WT5A 2YZ8A 3U0PA 3S35H 1H0DB 2EDWA 3ALWA 3C5ZA 2B0SH 2M8XA 1A22B 5FYLL 5JQ6H 4LNRA 4MHHI 5D7LA 5HD8D 3X13A 2PXYD 2X42A 3VXSE 1KJ2H 3D48R 1KG0B 4UDUB 5HYJB 3RNKB 3QNXB 2QTEA 1DSFH 5C0CA 1IQDA 1R3KB 4ZFZA 1FL5A 2NPLX 4R96B 2QADD 4U6VH 5E4EC 5EULV 1DL7L 3I85A 5CJ5A 1OTUD 1X6LA 3AS2A 5EUOB 1BM3L 5DD0L 1MFBH 4IJ3B 5BS0E 3V5KA 2O61A 4NKIH 1KTRL 1EJ6A 4JY6A 4U1MA 5DJ2B 5JZ7D 4RFOL 1CT8A 1H5BB 4KQ3H 4XPTH 5L6YH 1UWEH 2VLRD 3U2SB 3T2OA 1Y0LB 4EXKA 4WFHD 2W0FB 3MBEA 2D03H 3SGJC 1BEYL 1MHEA 1SEQH 2JB5H 4RGOH 2DQJH 3VXRA 4M8QA 4MVBC 3EJYD 8CGTA 3I6KB 1QSEA 4IDJH 2X4QB 1ETZB 1MAMH 5FO7B 3VMPA 3LN4B 2Z0BA 4JY4A 1VACA 3TYFB 1SJVA 4KKCC 1M7IA 2J88L 3SDDB 4AT6B 1KB5A 2OR9H 1FDLL 5C0CE 3T4YA 4M1GH 3P9LB 1SJEB 2X6MA 3O3UN 2FJGB 2HVJB 3TA3B 3LEVH 4I18A 3DOSA 1EEZB 3BKJL 1QFUH 2A74B 4TPRL 3KPSA 3SCMD 3HB3D 4UT7L 3MLUL 4Z7UA 5DZLA 4PRAA 4H0IA 4FQIL 3VDAA 1Z3GL 2YR3A 4PFEA 3LIZL 2MCPH 3ILPA 5CIPA 3K1DA 1BX2B 3IJYB 2XZCH 5JOEA 2H3NA 4Y19A 2VLKE 3BIKB 5I8CA 1G7MA 1LEIA 1U8KB 3OTTA 4GAYA 2BRRH 1GHFH 1FJ1B 1IEAB 1MCLA 2VN4A 1JPFB 2GT9A 4FN0A 1UCTA 3CMOH 3QNYB 1GOGA 4OQTA 4UIKH 2BVTA 3C8HA 5F96L 1BVKA 3KWWA 5D1ZA 3T4AB 4NN5C 4CDGC 3QCTH 4RGND 2EDBA 2HLAB 3JV5A 1ZS8A 4HEME 1RZGB 4L9LB 3BFOA 1FVCB 2WINB 2F74B 4MD0A 5J11B 4DGVH 1CIDA 4PV8B 5DRZB 4DWHA 3DUUA 4M6MH 5MEQB 3H0TA 2IH3A 2L0DA 4IRJC 5FDWA 4LLMA 4DCQB 4G6MH 3ROLA 2CK0H 4WRLA 3QWOA 1HQ4A 1TQCC 5HGAA 4YQXL 5C6TH 1ITBB 5FYKU 3VXNA 3KLSA 4NNYA 5A2JH 5HHOA 4ODSH 4W6XB 2Y7QB 2CJUL 2IH1A 1CE1L 3DGGA 2V17H 3M8OH 5I6XC 1H3VA 4Y7MA 3VWJC 2JIXB 4PB9L 3Q5YA 2UY6A 1NQBA 1S5HB 2AI0H 2JELH 1RULL 4WO4B 5D5MF 3TF7C 3MO1A 1EFXA 2UVFA 4XCFL 1T4KA 5KVEH 4ZXBC 4QRUA 3TA3C 4P23B 1F00I 2BFVH 3QEHA 4FXKB 4PD4K 2BXZA 1NCDH 3P77B 5J7CC 4ODHL 1UADC 5B39A 3RZWA 3C5ZB 2VR9A 1ZANH 5JW5B 3ZDZE 2NXZB 5GJTH 4JRYA 4OAWA 1RJCA 3KPSE 1TVHB 3AC0A 2OCFD 4JPKL 1D5IL 3GO1H 3OKLB 3HN3A 4Y5YB 1MUJA 3LPGA 5E24E 3T2NL 1HHKB 1U9KA 1FFNA 1OCWH 4UDUA 4RNRA 3RNKA 3T04D 3QJHB 4M8VA 1CXFA 1UENA 4Q74A 5IHUH 3C5JB 4FMKA 4JFEE 4M7KH 3V0VA 1G7HB 1CI5A 3IS1X 4EI5D 1K4CA 5GHWL 1DBKL 1OPGL 3K81A 3MV7E 4LPXA 4F2MB 4K8RH 5GISL 1T21B 2Z93A 3FZUD 5AZEH 3SKOB 1HWHB 3LD8C 5TF1H 3CNKA 2BSTA 1TITA 3QR2A 1GGUA 2PTVA 2ED9A 3S96B 3KPMB 4ONGH 5JW4Q 3MLUH 2XWJA 2ZOKB 1A0QH 3U2SA 1JYVA 4HPOH 2VDQH 2R4SH 1ZANL 3C6LD 2YUXA 1FZOB 1FNEA 1OARL 4APQA 1N3NA 3C5ZC 4NO0A 4POZD 1CL7H 3K8KA 3VXRD 1X4YA 1QSEB 5D7LE 1MJJB 5DD3H 4RA3A 2DTMH 3BUYB 4FFZH 1YEDA 4JY4B 2X89D 5E9DE 4XAWL 2X4NA 1OAKH 4GAFB 1GGIH 3NPSB 3U0TB 3ZHDA 3HNVH 3ELAT 4RCAA 4B7IA 4X6BA 3HR5B 3U4BH 1JUFB 5ISZA 1NKRA 1EEZA 1JZ7A 1YMHB 5F9AC 3VD9A 3RPIB 3P4NA 3TP4A 1KLGA 4NNXA 5HJ3A 3TZVB 1NMCC 4UOW1 5DUPL 4YHPB 3RWDB 1ZA3B 3H3BC 4MXQC 4MAYA 1JYNA 2AJVH 4WGVB 5FGSA 4K3EH 1DBJH 1WGOA 3REVB 1LMKA 1MCWW 3CJJA 1J18A 4LDOB 2GT9B 3MRRA 2V5RA 4KDTA 5HGHA 5BZWB 3BMWA 4WI4A 3HMXH 5DD3L 2EDYA 1CE1H 2ZKHL 5T3ZE 2ZCLH 4P9MH 5CKGA 3IJSB 4P9HL 5E8EB 1CF8H 5DVKA 3WJJC 2AK4B 1ZS8B 2VZOA 2V2WA 2AJSH 2QQLH 4NJ9L 3VFRB 2WINA 4PGDB 3W82A 2NY0D 3PWPE 4UNVA 4HMDA 1W0WB 2MWCA 5DQ9B 5KSAB 5DRZA 5SWQA 2E27L 3DUUB 4HIIB 4K23H 4P5TA 1S5IL 3PHSA 4OCRL 2QKIB 4NNPH 2B2XL 3VXSB 1I7RB 2NY1B 5EOTB 2VDNH 4HT1L 3VXUD 3QH3B 2CLRA 2WIIA 4NN6B 1AGBA 1QNZL 4XWGL 3JSSA 5HHOB 5JA8B 4PS4L 1TENA 1FV1B 4X6CE 4MS8C 5HI3D 4B0MM 4DQOH 2GTWB 4F58H 2AGJH 4DKDC 3U82B 3HLAA 1TTUA 3D69A 4LLWA 3TO4B 5HYJE 3U7AA 4MNGE 3QXDA 5E5MB 2YA2A 1L7IL 3K80A 2H9GA 2P24B 5GJSL 1WTGT 1UWGH 4WENB 5AWNH 5C0FB 2CLVA 1WC7A 3HZYA 5GISH 4C59B 2BZDA 5LGHL 2DQCH 5I8KL 2IWGA 4CMMB 1U8IB 3RNQA 4JHBA 4YHOH 3NCYP 2AEWA 3NA9H 3GZKA 2DIJA 2PXYA 4I3RH 3AB0B 4Y4HA 4HUMB 1H5BC 5D7SH 3GKWH 3VFVB 3ARRA 1RZKH 2C3WA 5FHAL 3TH4T 3C5JA 5F1IA 4X5XB 4EDXB 4LLVA 4UUJB 3NA4A 1FLRH 3FRPG 4GMSL 3GJFK 1Q9WB 2C3HA 5IJVA 4GW1B 3LZFL 1GGCL 2VAJA 3GRWH 1DLFH 3MLXH 4J2XA 2X4TA 1T22B 1PYWA 4UNUA 3PWVB 4RMTA 4F37K 4ZXBA 5DJAA 1FH5L 3KYKH 4XX1E 3LH2H 4WU7B 5HGBB 1AXTL 1G7QA 1P1ZA 1XGPB 1ONQB 2A73A 5J8OA 1FNEB 1X5GA 3AXLA 5DLMH 5FUCE 4PLJD 1GCFA 4WFFD 1N3NB 4NO0B 1T04A 1MFBL 1JI1A 4LCUA 3WKMH 4JN1H 5D6CB 4QLRA 2BVOB 2NY3C 4U1SB 1OP9A 3OHXA 3FRUB 2APBA 2I9TA 4KQ3L 1A5FH 1G7LB 3MLPA 3FKUS 5ID1B 3ARXA 4H5SB 2IGFH 2Y6SC 1YC8A 1WWCA 3IFNH 2GJ6E 4UU9B 1QLEL 3QWQB 2W65B 3KPRA 5IMKA 1C7TA 3I2CH 4Y2DB 1P4LA 5FM5O 5I8OL 3NCBB 5FA3B 1ZT4A 5HTSA 2AV1B 4XBPB 1PEZA 1ZA3A 4LAJH 4KU1A 1MH5B 4MGXA 3JTSB 3BP5B 4OM0H 4QTIL 4QRQB 4KJPD 3REVA 4MSWA 4NN7C 1CQKA 1I1FA 3QQ4A 1MF2H 4J6RH 4WVRA 5ECJE 3MJ8B 4M9PA 5C07A 3NAAL 4L3ED 4H1LH 4LQFH 2C1PA 3VFWB 4D0BB 2B5IB 4DTGH 5IQ9B 3ZYJA 1JHLL 3HNTL 3VFMB 1N6QL 5ICYB 4NQVA 3QDAA 1BJ1H 3IJSA 2NY1C 1A5FL 1U42A 1TVBA 1JNHA 3HS0B 5DJXB 3SCMC 2FO4A 1I75A 5ALBH 2OJZL 1U93B 1UB5B 3QEQE 2HJKB 4P5TB 2A6IA 5IQ7H 3LQAC 1HHIB 4F7EB 1J0KA 1EO7A 1K8DA 5CJXA 4ODXA 3QDJD 1YYMH 1I7RA 4XP9L 4K3DL 5ANMB 3HG1A 3RY4A 3TBSB 2ZCKL 2CLRB 3F7VB 5JPNB 3EOBA 3IETA 4JY5L 5F6HI 5L9DL 3FB6B 4I18C 3BE1H 2ZJSL 3W39A 4KROC 5EBLB 3SDCA 4XP4L 3IFLL 2P49B 4YZFF 4M6ML 1F90H 2WSKA 4Z7WA 3FQTA 1GSMA 4NUGL 3FO2B 2YBRB 5IHZA 4TSAH 4MXWH 3QJFA 1JHLH 3HNTH 3D39D 3RHWF 2X1WL 4PJBA 1JHTA 1GAFH 2VDKL 3OPZH 4G5ZL 4G6KH 5FV1L 1RIUL 3TM6A 3L7EA 1QRNA 1FO0L 3MZGB 1KIUA 1R0AL 1WC7B 3HZYB 1VFBB 1G0YR 1C5DB 1KCRH 1CIUA 4OZFB 4WWKD 1CWVA 3H42H 5JO5B 3EFDL 5SWZB 3RWIA 2QQKH 1CDBA 4KRNA 3THMH 1R5WB 3LKPA 4GO6B 5DC4B 4M4PA 3VWJD 1LWRA 3BWUC 4LFHG 2UWEB 5A2LH 3ZL4L 5KANI 4I3GA 3RDTC 4GRLC 3TBVA 1XF3A 5FAAA 4X9BA 3DVNB 4G42A 5DQDL 4P5KB 1JTOA 2RR3A 4IRJA 2OTWA 2XNAB 2ZUVA 3HZVB 4GKOA 4LHUD 3VFTA 4H8WC 4M1DL 2OXGA 5CS7A 5D5MB 3BW9A 1DVFC 1NMAH 1K5NA 4XMKL 5D7JD 4LQ1A 2X4TB 3DX6B 3NZ8B 2CDGA 4XRCA 3SDXE 3ET9F 2K1MA 3M07A 5C0EB 5ESQA 4AJ0A 4G6FD 3VWJA 1IQWL 4JHZA 4ZXBB 5J9PB 3TYGH 5HGBA 3P0VL 1H3WM 1JF5A 2W0LA 3D3VE 1P1ZB 1B4JH 1C1EH 3W11C 5K9JH 1IZJA 1MCQA 4LARH 2ZCHL 2P1YA 4J6RL 1R5VB 3MBED 1GHFL 4MWFB 2JK5A 1G7LA 4N5EC 1KTLB 1XGQA 4X7EC 3GJFH 3EZ8A 4H5SA 3OV6A 1VENA 3AS3A 2F54B 2QL1A 2R15A 2HT3C 3O3BB 4Q9BA 3LV3A 3UTSD 3GJFA 2EO9A 5DT1H 4U1NA 2IMNA 1RURH 4BZ2H 4F9LA 3SY0B 4LKXB 4ZO8A 3CFJA 2H1PL 3SDCD 4EN3C 2V7NA 1IGCL 2FX8H 3EGSB 5BRZB 4P3DA 3VXPB 5GGUB 5D6DC 1UACL 4FTVD 3S9DB 4HS6B 3C6LC 3CX2A 4FFVC 2Q3AA 1A1OA 5DVOA 4PJXE 2WUBL 1CICA 4L4TE 2ZSWA 4LSTL 4JO4H 1EX0A 3X12B 1S7UA 3G04A 3QPXH 1RUAH 4DEPC 2C1PB 1AO7E 4AIXA 3L3GB 3QRGH 3LDBB 2BXYA 4ORGA 5IBUG 5ICYA 3LN5B 3RIAK 3TJEH 1EUUA 4HC1L 4PJ9D 5E6IC 1QBLL 1BQHG 2VITB 3MRGB 4ODBD 4WEUD 3S5LG 2MQCA 3KYKL 4I2XA 1FFPA 5HI5C 5KVEL 3K4AA 3X3GL 3A6BL 4ZTOL 1RZKC 5EO9B 4OLUL 3RGVB 2GAZA 3ARFB 5I74C 2M26A 4AEIH 4AIZA 1B6UA 4PRNB 4LVNB 3ARBC 4ZPTB 3EZJB 3PHOA 2O26U 2ZUSA 3E3QE 3BI9X 1JIBA 1YQVL 1KEGL 4JB9L 4HF5L 1QTYT 3QEGH 5TDPA 1IC1A 2NY4B 3EOBB 3MJ9L 1DQJB 5D8JL 3WIHL 1KPRB 1J11A 2P4AB 3UBXI 3V5HB 3P30L 5IFAH 4PBWD 3MJGX 3CCHA 2YWYA 6FABH 4F57H 2NX5D 1TZGL 2LQRA 4KK9C 1YN7A 1RUQL 5FECB 2NLJB 4YGAB 3GGWB 5IR1A 2VH5H 3UX9B 2AJXH 3BWAB 1VB9A 4LDEB 1QRNB 3DRQB 4JR9L 4Z7OF 3WNLA 4Z7QF 3BKCL 3ESVF 3SDXA 1NBQA 2EIDA 4DGYH 1C5DA 1U8QB 1G7IB 1MFDL 1OGTB 1A8JH 1AY1L 3SCMA 3S3JA 3PE9A 2FR4B 2P42B 3PF2A 4FZ8H 3G6DH 4NKMA 4OCXL 4NRXB 4WW2F 3VXUE 3LKSA 4PJFF 5B4MD 1F8TL 4XTRD 1NCAH 1VHPA 1YPZB 3WMSA 2D0FA 3MZTA 4KZDH 2VLJD 1MJ8L 2RHEA 2X70A 4E41B 5DMKA 4KUCD 1NJ9A 3VH8B 3FO9A 4NC2B 4P5KA 2UUDK 1OSPL 2J8HA 3DUSB 2VXVL 1WBZA 4KAQL 1MI5B 5ALBL 3WFHA 3HI6H 1FZMB 5CINH 5C0RH 2EE6A 4GBXA 4PRDB 4TQEL 2HWZH 3MCKA 2EH7L 3OBAA 7FABH 3RA7H 4K7FA 4XBGB 3ETBF 4M7LL 3H9YA 3NZ8A 4XRCB 4K94L 4UT6L 4YPGA 3V7MA 4JVWA 5ESQB 1KB9K 3O11B 1BIIB 1KBGL 4PREB 3RX8A 4KZEH 4BSVA 2DMCA 3O9WD 3JWNC 5FYKL 3PGDB 3TO2B 1JHKL 1KTDB 3S35L 1DFBH 1TXKA 4LSUH 3MGOB 1WQVT 3Q1SH 4FQJL 1WBYB 1CGYA 1RFDL 3VG0H 3QPXL 3PHQB 3LKRB 1KTLA 3CVHH 4EI5C 4FTVE 1R0AH 3VWKD 3DXAE 1NFKA 5KSBB 1ZHKB 1NUFA 3O3DA 3DVGA 4QT5B 1IARB 1RIHH 3BH8B 1N59B 1XGTB 1AHWC 2YPLD 1BD2D 1C08A 5E9DD 2XG4A 2J6EH 4WHCA 2OX5A 1KGCE 3VFUB 1DL7H 1TDQA 1VESA 3EGSA 4Y4KA 5BRZA 4HHAA 4RZCA 1DBBH 3T0EC 4RMVA 3ARVA 4P2OC 4Y5XA 2JJSA 4KFZC 4LEXL 4JG0H 4OCRH 3HPLB 1TETH 5CLWA 5BXFA 1R3IH 4RGMC 2FATH 1M7DB 5C1MB 4BSJA 3VRLF 2AVGA 4ZUSA 1S7UB 1FYTE 1IGJB 3CFDA 4XPTL 5GGSB 5HDBF 3VWKA 4N8PA 3PUCA 2R2EA 4ZDHA 1FZKA 4AQOA 1LE5B 4L3CB 2IPUK 4QYOB 4YZFE 3C87A 1CDJA 2EDDA 1JVKA 1ZVSA 2PYEB 4PJ5A 1U8JB 4JM2F 2IAMB 5DURD 4R3SA 4QXWA 1KACB 4F7CB 2Q76A 3KPRE 1GC1C 4IDJL 2VDMH 5EZIH 2FCBA 3OAUH 3GI9H 5EBGA 3I02A 3SE8L 5HPMB 1D3CA 4AIZB 3GB7B 1VFMA 3TNNB 4ZPTA 2Z31B 1AFVL 5TE6L 3NIDE 3NIFE 2EKSA 4O9HH 1N2RA 5HHOE 1L0YA 1CDIA 1QBBA 5DVMA 4EVNA 1UA6H 4OZFG 1QD0A 5DJCB 3G6DL 1JZ4A 5K9KB 5KG9B 2HRLA 2CMRH 1BMGA 2GJZA 4JQXC 1HDMB 1X5HA 4WV1B 3GKZA 3K2UH 1UEYA 1NSNH 2EDNA 1YN7B 2E7CA 2EDJA 4ONHA 1S7RB 1MEXH 4Q0XH 4WHYH 4YXKL 4MCZA 5KSAC 5C6PB 4Z0XA 3MTRA 4QTHB 2P5WD 4OIIL 3JWOH 3MLWL 1CXIA 1FL3B 2X4OA 1JYWA 2DDQH 1FHGA 3DTXB 3G5XA 2C7UA 4QRPE 5FYLH 3KNBB 4M93B 4E9LA 1UZ8B 2VDPH 3K7UA 4HSQA 1SM3L 4XCCH 5D1QD 1PG7W 1BZQK 5J57B 2F8VA 2FIKB 3DXAD 3MRJA 2G75B 2BY1A 1J7VR 3AREB 1F02I 1FNAA 1TLKA 5GS1B 2P5EB 3S4SA 2OXHA 3HE6B 5FYJU 1CD9B 4RRPA 5CMAA 3S4SG 1NJ9B 4MDIB 3VH8A 3OKKB 1OQXA 2EE9A 3MACH 2D0HA 4R7DA 1WBZB 4KJQD 4KJYB 4ZS7H 1MI5A 4BQ9A 1CFNB 3DYOA 5EUOF 4ETYA 5EOQL 5IIEB 3LMJL 1XGUA 4LIQH 3MCKB 5BV7B 1EBAA 5FUOL 3IDMB 1PKQB 3CAFA 1H3GA 2FX7L 3N0PB 2LU7A 1RVFL 3RY6A 4WI5A 4R2GB 1B6DA 1TQBC 5C08A 3GUTA 3LPWA 3TC9A 4BKLB 2I27N 1WT5C 1MCFA 1A7PH 4X5WB 1QR1B 3WFBH 4ZPVA 4RMRA 1W0VB 5A43C 3PGDA 9CGTA 2DM3A 4RDQG 4IMKA 1BQLH 4HBCL 5DYOB 5C7XH 1A7RL 3TBWB 3NIFF 4P4RA 5FYLE 5T1KD 1V7NL 4YK4B 1UFUA 3AMLA 4MNHA 5GGTA 1OAZH 4F7PB 3PHQA 2C3VB 3JV6A 3K2MC 3DRTA 2F19L 3TN0A 2DICA 3MOBH 3MACL 3N1MC 1CZ8H 3W0WA 3HE7A 4MB5A 3MRHB 3VRJB 1C12A 3S37X 5HBBA 3LKQA 4NQED 4YEEA 5FO9A 4XB8A 2ZOLA 4PTUA 1Q38A 2KZWA 4M7KL 4JFFD 1QACA 3QUYC 2Y1VA 3RVTD 3RVVC 5E1AB 4HHAB 5JW3H 5GIRA 3I6GB 4NRYA 3FT3B 1XGYL 1K9TA 1EIBA 3LS4H 3EUUA 3HPLA 3TPKA 2DL9A 4K7PX 4PP2B 4Z5RB 3E8UL 4N9OB 3TT3L 3EO1B 3MXWH 3QUXD 4JQVA 1MRFH 1M05B 1CL7I 4NKDA 1RMFH 1Y6MR 4JHWH 3VXQB 4PJEF 4XHJD 2FWOB 1I3GH 5E08L 3IDUA 5EC2B 1T1WB 2DQFA 3GMRB 4GKZA 1WZKA 5DC9B 3LIZH 2G2RA 3VGGA 2IC2A 1GAFL 4EN3D 4TNWK 1FL6B 4GRWF 4RWYL 3O2DH 2NY5L 3L3JA 3QQ3A 2DM7A 4G7VL 4F15B 1CXLA 3GB7A 1UXWA 3H7BB 3DWTA 4DK3A 4JRXB 4ZQKA 5EZOL 2C9AA 4GG6E 1JE6A 2DM4A 2W1NA 4DN4H 1BBJA 3LQAH 3B83A 3MRPA 5TQ2H 2HFEB 4FQXD 1UWXH 1F58H 4YXHH 1S7XB 4MJ6A 5GRYA 2DYPB 5IWLA 3AM8A 2DQHH 4PJ9C 5E6ID 3K74B 3CSPA 1RJZB 3DURA 3KXFA 4LLYB 5HHVH 4QRPD 5GRJH 25C8L 3JTTB 1H15B 4DFIA 2F5AH 1B0RA 3N9GH 3O6FB 4WI9A 1DVFA 5BVJB 3QCUL 4AEFA 1NUDA 1J5OH 4PRIE 5JHDB 3L6FA 1OF2A 1FG2B 5EU3B 1JWSA 4DUWA 3VD4A 4PJAA 1BVZA 1FBIL 4V1DD 3ZDXE 1BOGB 2D9CA 3LS5H 1IAIH 1RJLA 2A9MH 1TETL 2XY1A 4NO5A 2X1QA 4JJ5A 5C8JB 1JP5A 2HJLA 2Z91B 2VLRE 4ZS6C 4N0UE 5FB8A 1UYWH 2C7UB 1V7MH 3KNBA 3Q0HA 2BSSA 4TTGA 5FGCE 4OCYH 5I1IL 5KVFL 1CGXA 4KDVA 1NBVH 4HIXH 2P44B 3MLXL 3ULVF 4JPVH 1KPVA 3S4SB 1YJDC 2K9UA 2PO6B 2WBKA 4J4PC 3B6SB 3VXMD 4U1LB 1DP0A 4TRPL 3QIBD 4I0PD 4ZD3H 4P2RA 4Y2OA 5FCUL 3WXVH 3ZE2E 4K8RL 1AR2A 3MV11 4Z7VA 2FECI 5TF1L 4IMLA 1AP2B 5JPMB 3KLHC 4LLQB 3EO9L 4HS8L 2YPKB 3U83A 3O2WH 3GHBL 2IFFH 5HYSG 4XC3H 3UC0L 3CDGA 3PGFL 4IS6B 3TZVC 3O4OC 3SO3B 1BQHA 4LGRB 4BFIA 4YFLI 3NPZB 2VLKD 3C08L 1YMMB 3WEXA 3EOYG 5AWNL 2Y72A 5JXEA 3O6LL 4WHTA 3T3PF 4DKEH 5C0BB 1R3LA 2V2TA 1VKXB 3ECBB 1GVIA 5C0CD 1S9VB 4IOIA 1SBSL 2BNRB 3L5XH 2ICEB 3U46B 3Q5OA 2B1AH 1DVFD 3KLAB 3HE7D 5D7SL 1SEBA 5HVFB 4LSVH 2W9EL 3T3ME 1SVCP 5LGJA 1G7JA 2NTFB 1I8IA 2BHZA 1SHMA 2YXFA 3SDAD 2CR3A 4WW2A 4Q7DA 2H8PB 4FQXA 2A77H 2OZ4H 1NCCL 3PXHA 3G9AB 3QIUC 1QSFD 3VXOB 4HV8B 2FGWL 1CGTA 4PP2A 4PRHB 1JTPA 4KGLA 1F2QA 4G9FA 4GBXC 1NFDA 3TV3L 1U3HA 4PRPD 1PBYA 4K9EH 3C08H 4HK3N 3H3PL 4ZUUB 3UBXB 4AIOA 5SX4I 3P9MA 1FH5H 5DF0A 5F8RC 4J8RA 3VXQA 5EU6A 1OGAE 1OP5H 3HUJA 4DAGH 1IKFL 3SPVB 1CF8L 3QB7C 5EC2A 2YC1B 4UDTB 1M6OA 4UINH 4L5FL 2CRYA 3PP3K 2IPUG 3H3KA 4LCWE 5L8KB 4HWBH 4NC1E 4KK8C 4KWUA 5E2TL 3QO1A 5EZLA 5DVLA 2W59A 4WFGE 4YR6A 1LP9F 2H2SD 2YPVL 4K3EL 4QRRD 3U4EB 1INEH 3VJ6A 1T1ZB 4U05A 5ITBL 5B8CA 3TCLA 4X7CC 2GIYA 4GW5A 3LEVL 1J1OL 4NT6A 2AK4E 3KYNA 5E8OB 2B4CH 5GRUL 1K3IA 3MRPB 4OF5A 15C8L 2BJML 1C16B 3UTOA 2WBJA 4QRTB 1V3MA 2ERJB 4Z95L 3FT2B 5GSVA 1DDHA 1KPUB 4YBLC 1XIWC 4NRZB 5T5FH 3O6FA 5F89A 1HHJB 1J8HD 2NNAA 2FBJL 1FG2A 5F7EH 3PQYD 2ITCB 2D7TH 3BZFB 4HDIA 4NDMB 3DMMA 3S34H 1HNGA 4LKCA 3B9VA 3OR7A 4D0DB 1DE4A 4YHLL 3ULSA 3PGFH 3GSOB 4P4KB 5E95B 1PQZA 1PLGL 3QEUA 4S1DD 1R3HB 3BKMH 4D3CH 1CG9A 2K7QA 4JJHA 2FL5A 3NACL 5GZND 3IAPA 1EGJA 2VTFA 5KS9A 1HH9B 2VZVA 3UZEA 1MAJA 4JM2D 1I85A 1FZJB 5GRVL 2GITB 1L7IH 4Y2DC 1QBML 3IVKA 3GSNL 3F5WA 3IKKA 4LARL 4EJ1C 3GJEB 3FTGA 3TFKC 1OB1B 4DZ8B 3AU1A 1T03H 4NYLB 4G7YL 4JKPH 1EGJH 1PEWA 5DD6A 5J6HB 3RU8L 4HJGA 1MCBA 1DUZA 4FQCH 1BECA 5K9QG 1RU9H 3LB6C 2EYTB 5C08D 1P69B 3MJ6A 3DXAA 5D1QC 4H20H 1FNFA 5SWSB 4XCFH 4R26L 2K3TA 2GW5A 3HAEG 1I1AC 3LKOB 4JFHE 1JRHL 1NC4D 1U8NB 4WI2A 1EMTL 1NBYA 3MR9A 1BJ8A 4Z7QE 5SX4H 4KTYA 3U0WL 4JFEB 1A9BB 2QBWA 1NGPL 4OSUH 4WHTB 2B39A 3SGEI 1VADA 5IB3A 5LBSH 4KJQC 4YHZH 5E9DA 3O41B 1IL1B 5ALCL 1CDYA 4YE4H 1I3UA 1A6AA 2B0SL 1XCTB 4M7ZB 4I5BB 5DO2C 5E2JA 5TE7L 3T2NH 4XXCA 4WHDA 4OT1H 4ERSL 4TUKL 5JW4R 4KRPC 1OAUL 4F7MA 1G7JB 1NC2B 1DQLL 4XAKD 3E2HB 4HWBL 2VR4A 3D3VD 1V7NH 4NPYB 2Y06H 4HAFA 1TJGH 4U1IA 3TCXA 1RU9L 1DSFL 3MLTA 5DK2B 5HHME 1PZUB 3EYQD 3VXTA 4AYFA 1F5WA 4YHNB 1OT2A 1AFVH 3BPLC 3IDIA 4NBYB 3QFDA 4NP4H 5EO0A 5F21B 1U3HB 4MD4B 5CZXD 5D2NC 2EO1A 3LEXA 1MREH 4XNYL 4ZUUA 1KF9B 5C0DB 3L1OH 1HNFA 2XQYK 3B9KC 2FYYB 5FYLD 3P9MB 2DMBA 3G5YA 3UJTL 3ZDZF 1XR8A 4G6JH 3ZMRA 4R0LC 3VW3H 1HHGB 3B9DA 4MAYD 3QG6B 4XC1L 3IDGB 5EU4A 2H6PB 3IDJB 2APXA 4IRSC 5CJOH 5MERA 1K4DA 1SY6H 3VCLB 3WFCH 2YC1A 1VGEL 4RISH 3PJSA 1ZHBB 3EFFB 1X5KA 4U3XA 5K59F 4H0GA 3RKPA 4BUGA 1EVTC 3QO1B 3BDBA 5IW1B 1E4JA 3C60B 4NQCD 1KT2A 4X7TB 4YR6B 5FGBC 3ABZA 4TVPD 4GG6F 2CIIB 3GHEH 2NY2B 2XTJE 3D0LB 4WUUE 4F3FA 4QTIH 1T1ZA 3RKDC 3DROA 5DK3A 1QPPA 3SOBH 4W4OA 2ESVE 2YMXL 3MA9L 4U6YB 3MYJA 5C3TA 3QUMB 3AY4C 4C56B 2FSEA 2PKDA 5D7IB 5GS0C 5DTFA 4TOYH 4K8RD 5FF6B 5EB9A 5J6GB 4XP1L 4FFYL 1MHPH 4FQLH 4KQ4H 2W9DH 2XY2A 3W9EB 1YY8B 2XFXA 1MY5A 3WN5B 5B3JF 2A1WH 3QFJD 5DT1L 5E5RB 4XPAH 1WBXB 3TIEA 4B50A 5C9JB 2GTZB 1T3FA 2E3VA 4MVBD 3EJYC 3ZTJG 5T33H 5I6XB 4X80L 1P7QB 3FFCD 1QKZH 4FQCL 3HRPA 1ZGLB 4Z8FL 1HCVA 4AL8L 3ULSB 3GSOA 3N9GL 4P4KA 5KVGH 3QUKA 5TE4L 5FOBB 4WI7A 3V52L 1R3HA 1F6LL 3TBYB 4TN9A 4AEEA 1NCBH 1HKLH 2XN9B 3EJJX 3PG2A 1EHNA 5BV7H 4D9RE 5C07E 1DEDA 2CDEA 4JRYD 2X4RB 3OL2A 4HT1H 3GIZL 5GS2D 5J11C 3IVKB 3OB0K 1OWWA 3PABB 4X6DE 5IROA 3GJEA 3SDYL 4LSUL 3P73B 1GIGL 5T1LA 1FIGH 3HC0A 4YH6A 3EKCA 5DRNB 3MRMA 3ILQD 4BYHA 1S7SA 2EDLA 4K8RC 2VIRB 1UT9A 3GIVB 1KXVC 1HWGB 3O6FC 4KI5D 4N8VB 3ARGD 1A6UH 1KJMB 4JANB 2B1HH 3SBWA 3RL1B 1NGZB 5FKPA 1CICD 5JDSB 2XV6B 3LKOA 1ZLVK 4WJ5B 1U8NA 2NTSP 3QXVA 2C4FT 4C55A 2PW1B 3WXVL 1FNGB 2XZZA 2YZ1A 4ZFGL 2N7AA 2X10A 4OKDA 4DGYL 3F7YA 4I0PA 5IFAL 2ZNXA 5EUKB 4AM0B 5J3HD 2VWEC 3TT3H 4PJ7E 1MREL 5H94A 1C7SA 2UVEA 3VGHA 5IB5B 2ORBH 4M02A 1MLBB 2D4FA 4PJFA 3WLWD 1Q0YH 3QIWA 4V2CB 4DJMA 1LP9A 1N6UA 5HYIA 1ED3B 1EDQA 3ZE1E 4APQD 1E6OL 3GMPB 5EC1A 1KIRA 3FT4B 3HI6L 4Z0BH 5B38G 2KZ1B 2GY5A 1P4BH 3AVEA 1FORH 3MLTB 3NACH 3VXTB 5EZOH 1GGCH 3T0VA 4NM4H 3B5TA 1KYOJ 3HG1E 5IB4A 3KHOA 1ZLWK 4HUUA 2I9LB 5E99H 3VD5A 4MYWB 2W60B 4ELMA 3RRQA 4UT6H 1NFDF 1YYML 2UWEE 5CZKA 2JCCF 3FQNB 3FL7A 3F7PC 1EGJL 4OFYA 2R1XA 2V9TA 1NMBH 2H6PA 3IDJA 4PJXB 4G9DA 4IOSD 3P0YH 1WCBA 1P9MA 1JNNH 5LAXB 5HHVL 4N1CA 4PJ8A 4BQBA 2E8YA 1B2WH 4KY1H 4LCCB 5C0IB 3U79A 3CSYB 3O9WA 1WWBX 1EA9C 4NZUL 2A1WL 4KUZH 4ZOBA 3C60A 4X7TA 4YBQC 3P9WB 5E8NA 4CVXB 4M4RA 2QHLA 3GI8L 4JZOB 2AEQL 1U3HD 4N68A 4IOFD 4PJGB 1ITCA 4XXDB 4QHNA 4F9PA 5I1JH 2G5BB 4RMSA 3H9SD 4EN3A 1QLEH 4GBXD 4TSCH 1FSKC 3MYJB 3QDGA 4ETQB 2A9NH 3UPRB 4JO3L 5DTFB 3KJ4B 4LLUB 4XTRC 5TE7H 4FHBD 3R06B 2GUOA 3O45B 1NDGB 2E6QA 2PCPA 4TUKH 2VZUA 3UTSA 4J3OC 1HYRC 2GSGA 2Q7YA 2ESVA 5D2NA 4OLUH 4HH9A 3D2UD 3MCLH 4JDVB 3WHE1 4HIEA 2VH5L 1NL0L 1LO5B 4X8JA 5ENWB 5CEYB 1WBXA 1A3LH 4R0LA 4X98A 1YZZA 3D5OF 2PR4L 3IFPA 4KKNA 4G43A 4MA3A 4MXQD 3SKNB 4FFWC 3BZEB 3BQUB 4PGCB 1VFOA 5C09B 5D8JH 1HSBA 1NC4B 1S3KH 3UJTH 4JM4L 5KSBF 3WJLC 2P46B 1HI6A 3OR6B 1RVFH 1HXYB 2MJWA 4LF3B 3QXUA 4LOUD 4WCYL 2ZPKL 1J86A 3ZKMD 5KOVC 1Q9OA 1KEMH 4RFEA 4HBQA 1RAMA 3QDGD 3PDOA 4QCIB 3RHWK 4FG6D 5GRZA 5DWUL 1U2HA 1C5CL 3V4VL 4OZGB 1PY4A 2JJUA 4PJ5D 2BVQA 4PJBF 1A7NL 1L7TL 1V3LA 1I1YB 5F7LB 4LSRH 2APFA 4LMQE 4JN1L 4YHIA 1PSKH 4OLWL 3H7LA 4XMLL 4ZG1A 5IFJA 1ADQL 1CDUA 1G1CA 3MRFA 3BPNB 1ZT7A 1NGWA 5E6IA 1HE7A 3OB0H 2WWKO 4NHUA 4YDJA 3FQRB 4FFVD 1BZ9A 4XCEB 1T03L 1BAFH 4HXBL 3I9GL 4BUHA 4N1EA 3CH8A 3QO0B 4PTTB 3TESA 5E99L 2QSTA 5DQJA 1MRCH 3MLZL 2GKIA 1WVZA 1MLBA 2ADIB 1FNSH 4PJFB 5BS0D 4R90L 2VXSH 1HHHA 4N0UB 4JO1H 4LCYA 4OFIA 3T3PE 2WP3T 2DBJA 2EH8L 5E2TH 4I13B 5FHBL 5F44A 4PGEB 1RZKL 2L4OA 5JHDE 1CFQB 1MWAB 4FQHB 3U1SH 3WIIL 1JGUL 4L8BA 5IB4B 3IGAB 3T3MF 3E6FB 3QCVH 4HS3A 4N8VG 3GMQB 2EZ0D 1MRDH 4PJHA 2BMKA 1G7PA 1QYGL 2EXWD 3O8XC 1AO7B 4GKNB 5I9QC 1DQQB 2CLZA 3B8YA 3TN0C 4U7MA 3BO8A 5D1QA 2XZCL 4AK1A 4Z95H 3GSWB 3HE7C 2CIKB 1JPSL 4KRPD 5K33A 2NXYB 1MVUB 4YHKH 2BHYA 3D85A 1F3DH 4MAUL 4CVXA 4LSQH 4PJGA 4XXDA 5GGVH 4BJLA 1LNUB 4NUGH 3RWEB 1U8PA 3RWFA 1KIQA 3N85L 4WW1A 5T1KA 1U58B 4LCIL 3GM0A 3U0PB 1BREA 4U7KA 3NCYS 5FK9A 3BESR 2E7LC 4JPWH 3QCVL 2XXCB 3GHEL 3FQWB 3V6BR 1AGDA 3UTPD 5D2LF 5C08E 4S2SB 1A3RH 5MHSE 1OP3H 4HH9B 4JDVA 2RAMA 5T1DL 5C0CB 3IKCB 4FS0A 1QFWL 1R3KA 4ZFZB 3OXSA 4HGMA 1L9MA 3V9FA 4PLKC 4XPBH 1RY7B 1AO7D 3O4LD 2AW2A 1M71A 3V79C 1QFOA 2ADFH 1AKJB 2JJTA 5EU6D 4UV7L 1YN6B 4R97C 4L8SA 4KRLB 2NXZC 1KGCD 3G08A 1ODAA 4KXZI 5JW4M 2EKJA 3GMOB 2IFFL 3SE3A 5GRXG 1FVDA 1F4AA 2HP4A 4LSSL 4C83B 1JK8B 1R3JA 2H26A 4OI7A 1CYGA 2QADC 4FNLL 4MXVF 4Z8FH 4X6DB 3MJ9H 2B20A 3SGDI 3QIBB 1CTNA 4R8WL 1ETZA 2HKFL 2R1WA 3MRBA 2EEAA 4X8XA 3MGAA 4U7SA 2IANE 1C5BL 4OV5B 2PO6D 2NY5H 3S3PA 1M7IB 3SDDA 4AT6A 2LAGB 5L9DH 4YPJA 3QCUH 3P9LA 4IIQC 1LO2L 1Z2KA 3TA3A 1IFHL 4S1RL 2G9HA 1EEYB 4P2RE 4NCC2 2A74A 4KK6D 3BT2H 2ADFL 1VDGA 4Z7UB 3IJHA 5C0ND 3ILPB 3PNWA 4QF1A 3WDJA 1CVSC 4FXGB 4P0DA 2FB4L 1A0QL 8FABB 4PGBA 4L3EA 5D2LB 5E8PB 2XWTA 12E8H 5JHDD 2XI9A 4GAYB 2X1XR 5IB1B 1UACH 1IEAA 5IGXH 1BD2E 4M6NL 1A4KA 4YO0A 3GRWA 1E27B 4OZ4A 5I66B 3QA3A 3GSXB 5DEFA 3FQUA 3L5WB 3I50L 4Q2ZB 4ZD3L 1OCWL 1V7ML 4L9LA 4O00A 1XFPA 4PGEA 2B2XH 35C8L 3A67L 4MB4A 4HJ0D 2C3XA 1OLLA 2VDML 5T3ZH 4OLVL 1J1PL 3EO0A 5IMOA 5EORL 2D31A 3QI9D 4OGYL 3MV9B 1LHZA 5F9WC 1KJ3H 2ARJA 4K2UH 1V8HA 3BSZL 4D8PA 1LO0H 3BQUD 5LXGH 5TFSL 1MSPA 2A6KA 4F58L 3BO8B 1FGVH 1Z9OA 1DBJL 2YEZA 2IQ9H 4JFYB 3HB3C 5FCUH 4DTGL 1MPAL 4QXGH 2IANA 5EU6E 4X4XB 1UVQA 4MDJB 4NN6C 1CFSB 3D2UB 1AQKL 1UH4A 3O2VH 5GGQL 4KVNL 3RJDA 1YUHA 1ZLVH 4PUBL 1MCKA 3CPLA 3LS4L 4KMLB 4HIHA 4CU7A 1JWMA 1NANH 4P23A 1LQSR 3QUYA 3VGAC 2O5ZL 3P0YL 1EAJA 1KC5L 2HJFB 4FXKA 4QRPA 2D7QA 2GJ6B 5HHQA 4ZO6A 4PB0H 1EEUA 1EV2E 2X44D 1P84K 2ZSVA 2X05A 3B9KD 2P8LA 5CP7A 4LL9A 2QR0B 1EBPA 3HZMA 4MAYC 4E42A 5DVNA 2FRGP 4JR9H 2AJ3A 5MI0B 1SBSH 5DJZB 3C2AL 4FA8A 2WQ8A 3IF1B 4OZGF 3KLDA 1OTSD 1PLGH 2BY3A 4YBQD 4I77L 4FQIH 4CMHB 4EBQL 4GXVL 2LFGA 4N90D 3WIHA 4GW4B 4Z7NF 1EHXA 4K94C 3OPZL 3LVEA 1K4CB 1NGYA 1BGXL 3UTQB 3HRZB 1AKJA 1OW0C 1RIVL 2XA8L 2VWEE 5KVFH 3SKOA 1IEHA 4H1LG 2BSTB 2AKRA 1B0GB 2AXFB 3CD4A 3S96A 5D1XC 1VFAB 4R2GD 5IMLB 4GOSA 4Y8AA 1FVDB 4ZFGH 1VPOL 2X41A 3TNMA 3C8DA 2EDRA 1JK8A 3RUGA 1GRWA 1R3JB 5IEHB 4DAGL 1XIWA 3MV7A 1FBIH 5GGSY 4A6YL 4APQB 3WHXA 4HZLA 5EOCJ 3HI1B 4IEFB 4PJ8D 2VE6B 2CKBH 4HW6A 5E7BA 1YEDB 1WZ1H 1JGEA 5HGDB 5LQBL 5IHLB 1N5AB 3MJ7A 1RD6A 4S1SL 4H8WL 4OCYL 5I1IH 2WMPA 4U6VL 3O3AA 3I6LE 4MQ7A 5F7NC 1EZVY 3TEUA 1J05B 1UQSA 3KDMA 3L5HA 3CX5K 1TZGH 4NUJA 1ZEAH 4QOKB 1INDL 3V6FB 4NNXB 5D71L 4JGUA 3ZE0E 4XPFH 3O2DA 4ODTL 5DMIL 2RCSL 1XGYH 3DUHA 3PDDA 3NIDF 5I17A 1IILE 3CFKA 3RUGE 3FONB 4FQQB 1FNLA 2JB6A 4JDZA 1RZJH 5B3NA 2BSRB 4U1KB 1Z5LA 2BCKB 3IFOA 3NABL 5CP3H 3ZHKA 4Z76A 3GSVA 2NR6D 4W4NA 1MFDH 1UM4L 2RJMA 4PJDB 3MUGA 3OAZH 1PY9A 1EERB 4R2GC 4CAGA 3X3FH 2DWEB 5L88H 3B4NA 4S10A 2MCPL 4UILH 3O8XB 4J1UA 5CIPH 1TZIB 4G80A 3L5WA 5BV7C 4PJ7F 2EXYC 5LQBH 3PWUA 4U6HA 2DQGH 3RDTB 4POZC 5AG9A 1V05A 2BOBB 1W0WA 2AABH 2R23B 3P0GB 5JOFB 4M6OH 1I7TB 4NWUL 3E6HA 4U3HA 1TTGA 3CUPA 3TJHC 4UQ2B 3BH9B 4CKVX 4U1HA 5I75C 5I8EA 1MJ7L 1P7QD 2WIIB 1E4WH 1EPFA 4WY7H 1ND0A 4YBLB 2R1YA 5EO1B 3G5ZB 1UM5L 1A2YA 5AZEL 1N64L 4Z9KB 4ONFL 5GGRY 4APQC 1OAZL 1XR9B 2FNBA 2YKLL 3G5VA 3HLAB 2ZG2A 1NFDE 1YUHB 3T77B 1FFRA 1YEEL 5ITBH 3OKYA 1HOCA 4MCYA 5JNYB 1JWMB 3QXDB 3GSQA 5ACZA 1YY9D 2P24A 2HJFA 4BELD 4ODUA 2DTSA 1MCJA 3QIUA 4D9QE 2DWDA 3L5IA 4L9LC 1F11A 3B9KA 4S1DC 4LAQH 2WWKT 1Y18B 4OLZH 2X7LB 4LNRB 2D2OA 3WN5C 1U95A 2CQVA 3VA6A 4BFBD 3Q48A 4TULL 3JWOC 3IF1A 4N0CC 3RIFK 3ARSA 5D93C 1KG0A 3CIQA 2Y9RT 5HYJA 2X9XA 3QWRD 4N0YL 1AH1A 1J87A 1D9KD 2FZ3B 5IK3B 1IAKB 3S3SA 3GSRB 4XCNB 5F1IB 3QDJE 3DVIA 5CJOL 4YUEH 3VXRE 4PB9H 1D5IH 3UJJL 1U3ZA 1WLHA 1P4IL 3C9NA 2WUCH 5DRXB 4LVHB 3L95B 5A16B 5EBWB 3PL6D 2AKRB 3EO9H 1H5BA 4HS8H 3GBMH 43C9B 2IQ9L 3CDFA 5IMLA 3NH7H 4KI1A 4OCXH 5TPWL 5D71H 4PP1C 2HYMA 3TNMB 4NQCA 1NCAL 1TNNA 4XMPH 2APWA 4PJIF 1XIWB 4OZIB 3D3VB 3O2VL 3K3QA 2QQKL 2Y4SA 3EOAA 5TDOA 4HZLB 1JI2A 4LCUB 3DIFB 5IVZB 3HI1A 2ICCA 4U1SA 3OHXB 4CNIB 3LN4A 4R90H 1YEJL 3T0WA 4HIJB 2I9TB 3P4MA 2VJXA 2XKNB 4G6AD 4FP8H 4JQIH 5IG7B 3TVMA 5KAQG 3DBXA 1X7QA 3PL6B 1J05A 1UQSB 2W65A 5E8DL 2OMNA 3KPRB 5IMKB 4OQ1A 4QOKA 5FFLA 4QXUH 3WFDL 5JXED 2A6JB 1P4LB 1UB6A 4R8WH 4F7TA 1ZT4B 1H3PL 1F42A 4GS7B 2ITDB 4XZUB 1KYOK 3T0XA 5F3BA 3K8LA 4HUWB 1K6QH 5ICXB 1D5ZB 4HWUA 3C5SA 1I7UB 4M3JA 5DMGD 4G7YH 2BSED 2BSRA 1Z5LB 3QUZA 3QQ4B 3D39A 3MJ8A 2HTLC 5C07B 3H42L 2AERT 1FJ1A 1XF2B 5DMJB 3HAEA 3QP3A 4GG8A 3U30B 2DI8A 1BVKB 4NO2A 2J12B 4GAJL 1KN4H 3PWUB 2HLAA 3DO3A 4U6HB 2AQ1A 1KJ2B 3LRGA 4PJ7A 3ZKNC 3OKNB 3FB5A 5SV4A 3E6HB 5C0JA 2HJKA 5EOQH 3W0WD 1G6VK 3SE4C 3WFDH 4B53A 1OAQH 4KKLD 4HMEA 2A0LD 4N9GB 5ANMA 5HHXL 4XMKH 2FJFA 2GFBB 4OFPA 4RISL 4EUPA 3G5ZA 3ULVE 1SJXA 2VAAB 5F8QC 4HK0A 2Y7QA 4HWEH 4NC1C 2GY7B 2V5YA 3NFSH 4RBPK 4X6EB 3NZHH 5C0AA 1YPZE 1J8HB 4WEBH 3FRPA 4KPHL 2VLMD 3NPSC 1SJHB 5H35B 5L2JA 1N0XH 5FYJE 4NP4L 5TFSH 1CGWA 1KCVH 1F4XH 4D0CA 3QEHB 3EDJA 3UO1L 1QHPA 1ZLSL 4F9LC 2F5AL 1J9CT 4CRPA 1D6EB 1AXIB 1AGFA 3P77A 1S7VB 3T2QA 3ARUA 1SYVA 43CAA 4LPYA 5F72S 4JFDD 3BVNA 3O8XD 2AGJL 4CVZA 4P48A 1NCCH 4OZGE 2HLFD 2J7LA 4DUVA 3RUGF 2FGWH 2BNUA 2YD5A 3CDCA 4QRRB 1A6TB 3KPOB 4Y5YA 2BOCA 1WSST 3VMNA 1L0XA 1KUMA 4JN2B 1CDGA 2OM5A 3I2CL 1D5XA 4P2CG 1FVEB 2R0WL 2WV3A 3QJHA 2YD9A 3DHJA 5C2UB 6CGTA 4G42B 3UYRL 1FO0A 4I1NB 3QAZC 4DQOL 2EIEA 3VFTB 4YXKH 2W0PA 5EDXA 4NO3B 4KPHH 5A1AA 3QDMD 4LPCA 3RP1A 3VD7A 4OZHF 2NY3B 5FUZL 4PJDF 1S78C 1T20A 3BP6B 5A16A 4PRPB 3VRIA 5CJBA 4KV5E 5I19L 3KPMA 5IESH 2XWJB 4ZOEA 2DBLL 3MLYL 1PGRB 3BKCH 4QEGA 4Y1AB 1JPTL 1TJHL 2QSVA 2J8UB 3AS1A 2Q3ZA 4AEIL 4XC3L 3UC0H 4PJAF 2DI7A 4C4KO 2A9NL 4I48A 4OGXH 1N7ML 2PF6A 5JMRA 3ARFC 3OKEA 1UWXK 3ARZA 2H32A 2G60H 1JZ5A 4AL8H 3WFEH 1YA5A 3MLSH 4Z78B 1HEZB 3GSUA 2I07B 4YE4L 1Q0XL 1U36A 3KJ6L 3U36B 4YDVB 4X6BB 3GJFB 2A6DA 1FAIH 4P2QD 1AIFA 2FHFA 3Q3GA 4OI9A 3SY0A 5SWZD 4P46B 5CUSL 4Y4KD 1TQBB 2PR4H 3LEYL 5IBTH 1LP9E 3HPJA 1NUGA 5GGUA 1T66C 2ITDA 4LSPH 1Q94B 1OL0A 3VXUA 2XWBB 4K94H 1IBGL 5F3BB 2OR9L 2QQNL 3IRZA 2VRAA 3MRKB 1I7UA 3NGBC 3NVQA 1A7RH 2ZSWB 1P84J 2RBLA 4NGHL 4OM1L 3D39B 3VI3E 3SQOH 3B3IA 1WF5A 1XF2A 1EK3A 3V4UL 5M7QA 1U92A 1Z3GH 5BZWA 4CMHC 3FQXA 5HDQL 5HGHB 2IALB 3VW3L 2OR8A 4ZS6D 1T5WB 3WNMA 2RCSH 2G60L 4HKBA 5E8EA 3RBSA 4ZFOL 3VE0A 4KTDH 5INDA 3FCTB 4O2FB 3WFEL 3O6ML 4OV6F 2ZUQC 5DWUH 4MNGB 2GJ6D 4P3CL 3DX7A 5TE6H 3FB5B 1GPOH 3ZL4H 1G84A 1CFVH 1L6XA 2O5XH 2VSCA 5C0JB 4N5ED 3BPNC 4AEHL 3QUZD 4PRNA 2OL3H 2QKIA 4TQEH 5FYJH 3B9AA 4HXAL 2VLME 5EOTA 2JF1A 5HVWA 5F9JB 4D94A 2NR6C 4LEXH 3QZWG 2OL3B 4MNQB 1NGXB 3GNML 2NY7L 5KTEL 4JQIL 1YDPB 1V5JA 2F8XC 2GTWA 4CN4A 2EXYD 1OLZA 5EG6C 3MV9D 5HI3C 5HDBE 4NM4L 4G6ML 4LVOC 4M9OA 4ORZC 5C6WH 5J1AB 5TQ0L 3WD5H 3BXNB 3NN8A 4FFWD 3PWNB 3SKMA 1P2CA 2QEJA 4OTXL 1PX4A 1EHLL 5IROC 1CU4H 1K6QL 3DRQA 3BKYH 5I76B 2XA3A 3WUWA 4XPBL 1G7IA 1OGTA 1QLRB 1ORSA 1S9WB 4LCWB 1RIHL 3RNQB 3MRLA 3V6ZA 3QSKB 1HINH 1HZHL 4QRRA 3WSQL 1LEGB 4CU6A 1YPZA 2Z8SA 3KG5A 1RIUH 4A6YH 5EH1A 1S9XB 4ZO9A 3C8KB 1F4WH 3SDAC 2GSIB 3L3HB 3IXAB 2FATL 4XC1H 4LLVB 1Y6KR 2XTJC 1I9RL 1W0YT 4YX2H 5ANME 4S1SH 1FNHA 2VZ1A 4JO4L 4NC0B 4XGZB 3DX8A 4PRPA 1CQYA 4KKBD 5D9SA 1UJ3B 3PWLA 1AD9B 2F53B 4GQ9L 5C7XL 4XWOC 1NBVL 1OSZB 1BIIA 3EW3B 5IBTL 5JIKA 4WU7A 5MHSD 4XVTH 5CCKH 2J8UA 4XP6H 1M1SA 1OTSC 1D9KC 4MJIA 2XXMB 3I3DA 4RWHA 3AAZA 5DFVC 3QIUD 3ARBB 2BVOA 4LCCC 1RQ5A 4C58B 3FRUA 1MWAL 5F6IC 5F7FA 3CXDH 4LLDB 2DAVA 4MAUH 2JLLA 5GS0L 1HEZA 2J3SA 4A2LA 2NXYC 5BVPH 4RFOH 5CWSA 1AQDA 1S8DB 2H41A 1ZHKA 4H25A 3V95A 2EC9U 1N8ZB 4MJ5B 1UWEL 4O2EB 4ZFOB 3GHBH 1J88A 4OCNC 32C2B 3Q3GB 4P46A 3O9WC 1VGKA 4WTZG 3GK8L 4Y4KB 3WBDA 4P46D 4U0QB 4XBPA 4JPWL 3CSBA 4P2QB 3N1QC 3BHBB 2OSLA 3OKDA 1DCLA 2OL3L 1CLOL 3MRKA 2GCYA 1MAML 2MCG1 1I3RB 1HSAA 3L3IA 5K9OA 1L7TH 4Y16C 5E8DH 1IGIH 2Q87A 2Z92B 3GEWB 1D5MB 2X40A 2ZCHH 1KJ3L 4K2UL 5EU7E 5DUBA 2VDRH 4N0FB 3KYMA 5TH2A 2BFVL 2EDOA 4HKXB 1S7QA 1RZIB 4JAMA 1TVBB 4IIQA 5CILL 2Q76B 1RK0A 2YK1L 4Y1AD 1TZHB 3U48A 4DN4L 1AQKH 4NQDD 2CRZA 1N6VA 5J12B 4KVNH 4DVRH 5CEZL 1XCQA 1FN4A 5EOCH 5DRWA 1HHIA 1XZ0B 4TSBL 1MRDL 4ODXB 2FGZA 1N2RB 2NXYD 1H3UA 3MROB 1HYSD 3CH1B 1D6VL 4XNMA 3TBSA 5INCB 4KJWC 1W8NA 3H9ZA 1JWUB 2AJSL 3BPCA 5DJCA 3W39B 5EBLA 3RA7L 5KG9A 5C0GB 4Z7WB 1LGVA 5EWIH 4CW1B 1JYXA 1F2XK 1AC0A 1X5LA 5AUMB 4PJEB 4HUKB 5J1AA 2YS4A 3QQ9C 4JRXE 3UTTA 4MZ3A 4G8IA 4J3VA 3WDIA 4Z0XB 5DEGB 3B2VL 1A02N 1DTUA 5DI8B 5D96C 3X11A 1IGFL 3R0NA 3A6BH 4ZTOH 2LV4A 5HYQA 4XNQA 3PIQB 5JLZA 4OZIE 5JO5A 1QLRA 3O0RL 2YSSB 2LU4A 2IF7A 1Q9LA 4JY6B 4U1MB 3LKPB 4QHMA 1OM3L 3QEGL 3VDBA 5JORA 2JJSC 4JKKA 2Y36H 1OAKL 2AI0L 3N50A 4HJJL 5A2KH 3L3HA 5D7KE 4DN3L 2NX5E 2CGRH 2IAMD 4Q9CA 2XNAA 5C70A 3VXRB 2PO6C 4GT7A 2D7NA 4PJIB 5GRJL 3U9PH 4JG1H 3OWEA 3QBTB 4XH2B 4R4FH 1OVZA 5BQ7B 5L8LB 2Z31C 1MCIA 3VGDA 1WFTA 2XACC 2VXQL 5D9SB 3ZE1F 2NYYD 2X1OA 3MRNA 3F62A 1CD0A 1QFWI 3PWLB 2AEQH 2N4IA 4I18B 3K4ZA 1B90A 2YD3A 1SYSA 2VLLA 4HFUH 5JOPE 5GS3A 4ALAL 5CIPB 4DZBB 3TBWA 3IJYA 4AMKL 4CVUA 1BJ1J 5JQ6L 4QOKD 2JK5B 5I19H 3IAQA 3RY6C 2C3VA 1CR9H 3JV6B 4NQTA 4BFGA 5ESVB 5E4EB 4YXHL 4AZ8A 3RVXD 1U8LB 4YFLF 3VRJA 1IM3B 3ULUC 1AQDB 1S8DA 4NQDB 1FG9C 3LKQB 4Z7NE 4M5YH 1LO4H 3KWWB 1UJTA 1G9MH 5AG8A 4LKXA 3T4AA 4RIRA 2JJTC 3EYSH 2NQCA 4PRHE 2IAMC 3QRFM 3KPRD 3H3PH 1FVCA 4P2QA 5TDNB 1ZTXH 2PTTB 4DVBA 4KHTH 5GGTL 3SGEH 4TUOA 1U91B 3SGJA 1N4XL 4DKFH 4P23D 1A1OB 2QHRH 4WIQA 5ITFA 5K9OB 1K3ZA 3X12A 4WO4D 1M05A 1JBJA 1KCSH 4OFDA 3UYPA 4NKDB 4G8EB 1LE9B 3UPAA 3B5HA 2FX9L 2WZPD 4RBPH 3ESUF 3L3OB 1IFHH 4S1RH 5I30H 2HG5B 3SJVB 5IVXF 5IEKB 4HKXA 2E6JA 1MI5D 1RZIA 2BNRE 4JAMB 3A6OA 1BLNA 1T1WA 2QQNH 1L6ZA 5MENE 2AXGB 2E9BA 1OQOA 1FFPB 2VLJB 2V5SA 4I2XB 4QXTB 1UCBL 2G5RA 3HC4L 2X4UB 3MMEB 4X6CA 2GAZB 3NA9L 3ARFA 1XCQB 1T66D 3SKJL 4LVEA 1UXWB 2ID5A 1ORQA 3H7BA 1YYLH 4RAVA 5HI5D 1VPOH 4PJ5E 4Y5YC 3MROA 3FOMA 3E3QC 1YNLL 5FV2A 3IDYC 2IBZY 1KELL 3ARBD 5LVEA 1H3TA 4QY8A 5FO8A 1UH3A 1MJUH 5C0GA 4MJ6B 3RVVD 5BVPL 5ILTL 4OAWB 1NKOA 5IBUB 1YEGH 3KXFB 1RJZA 3DURB 5ISZD 4IMKC 4CW1A 1NEUA 4FQ1L 3BMVA 4PY8J 4KXZH 1HHKA 1FFNB 3L6FB 3WIFB 3FO0L 3UTTB 3GGWA 5IR1B 1NGQL 1FDLH 4O5LH 1QFWH 5E7FA 3HI5H 5DR5L 3PWJB 1CLOH 5C9KA 3V0VB 1G7HA 4OIBA 3OAUL 2Q8BL 4QO1A 2NY4D 2A0LC 4JRWA 1U8QA 5IMMB 3PIQA 5JLZB 2NZIA 3LCYA 2W9EH 4OLXL 3SCMB 2BSSB 1MPAH 4QXGL 5EA0L 3F6IA 4CL7A 3WS6C 3F6LA 3LKSB 3EDDA 4PJHF 5F9DC 1IRAY 4X99A 4XP5H 4P57A 2ZOKA 1DBAL 1Y6NR 3TPUB 4S1QH 1MHPL 5KZCD 4UAOB 5MEOB 1DFBL 1FYTB 4K55A 2Z8WC 4ELMF 3ZYZA 4W6WB 3BDXA 4FMFA 1FZMA 4M62L 3VGBA 1REIA 1MJJA 4Z7VB 1TCRB 5BQ7A 4K7FB 3KJ6H 3E8UH 4M6OL 4JFOB 5ETUB 1PVHA 2X4NB 3BRFA 5AZ2L 2VLRB 2YPKA 1T1YA 4DOHE 3TIDB 4X4YA 2VC2L 1B4RA 3R4DA 2NX5A 4WDIA 5KSBE 4BSVB 2R0KL 1AGEA 1DJSA 3RPIA 2YPVH 3TO2A 3P4NB 4HWBA 5FM8A 5SWSE 3IT8D 3MRIB 5B21A 4Q9QH 3ORJA 1WISA 2YUZA 3KYOB 4MA7H 4WFED 5E56A 4YC2B 5J89A 3ULVL 4DZBA 1QFUL 2V2TB 3SQOL 3OAZK 4YGVB 2AJVL 1BFVL 1CFTB 2YRPA 4X9IA 2XN9D 3S37L 5DJDB 2BNRA 2CJUH 2HH0L 4BZ1L 1U8LA 4IRZL 4HCRH 3GSNH 2FECL 3BH8A 3EJZD 4NOBA 4HJ0C 4GXUM 1L9NA 3S88L 2HFTA 5GRWA 4WW2B 3QIBC 2NY5C 3NIGE 5AZ2H 3SE4A 2Y36L 4U1JB 3S7GA 1DN2A 4AEHH 3FOLB 2B4CC 4ZXBD 4HV8A 2WUCL 2EEDA 1KN2L 4H20L 4LGPB 5SWQB 1OHQA 3T08A 5MI0C 1EFXD 4RRPG 5ITFB 1NANI 4OD3H 1IGJA 3UZVB 4G8EA 1LE9A 5EZJA 5LKNA 4C57C 5I1GH 4KC3B 2WWMD 5EU6B 4LHUB 5JW3L 4U33A 4G6KL 4G5ZH 1AGBB 3E1F1 5L2KE 3P11H 4H88H 1BLNB 3EOTL 4MZ2A 4R3SB 4URTB 4OGAD 2IPKB 3P40A 1Z0MA 3QDGE 1CZ8L 4PY7B 4QXTA 4M7ZC 1FQ9C 4NQSB 1GC1L 1OPGH 2X4UA 3MMEA 3DO7A 4WEBL 3U4EA 1W72B 1GGIL 2AV7A 2NY2D 1ORQB 5EFIA 5CHNA 4JKLA 5HY9B 1A6WL 2DDQL 4K7PH 3FOMB 3ZT7A 4OUUA 1A47A 1E4WL 4WY7L 5CBEA 4XP1H 4Q6IA 3UEZA 5EA0H 2HN7A 2VN7A 3ULUE 3KR3L 4QY8B 4CMMA 5FO8B 3SDAA 5DZOA 3GMMB 2GJZB 5E2VH 1PD6A 1YEJH 3U6RA 1A7OH 4Z7UF 1CXEA 4NZRL 4KK8D 3PP4L 4NRZA 3RL2B 4LEOA 1YQVH 3QFJA 4PLJC 4KMTL 1RJYB 2EDHA 4RQQB 1G6RA 5GGTH 4X5XA 3PWJA 4JGJA 4NQDE 4XB7A 5TE4H 1T1XB 2UZYB 1FL3A 4R97B 2X4OB 3OR7B 3JVGC 4GW1A 4OT1L 4H0HB 1MNUL 1L4IA 2EDEA 3S97C 2VLKA 2R0LL 3R1GH 4WTZA 1T22A 3BD3A 4OUOA 4P5TD 2R2CA 1ZOXA 2VXTL 4X99B 3MC0A 2G75A 1Q1JL 4ESKA 1CG9B 4K9EC 4NBZB 1G0DA 3TPUA 3E2HC 3HE6A 2FL5B 2N7BA 4NQEE 5CMAB 1XGRB 1A14L 1HH9A 2VDNL 1YEIL 4J23A 1XGPA 5JQHC 5JXAL 4CJ1A 5LXGL 3OF6D 2HFFB 2FEDD 1IT9L 1EO5A 1MFCH 3K8MA 4FFYH 1A6UL 5D6CA 4NQCE 5IIEA 4L1HA 1LEKB 1OB1A 1XAUA 3P2TA 1QA9A 1AI1H 4ODWA 3LQZA 1QLFB 1E0OB 2C1OA 1M7XA 3HMWL 2VKXA 2VLRA 1QUNA 4LRNL 2OMBA 5C0BE 5C08B 1IC5L 5BS0B 4MA1B 2EDFA 4OZHA 4R4BB 4X5WA 1QR1A 4WDIB 1U2CA 1CK0H 1BQSA 4F15C 1AGEB 4PGZA 4Y2DA 4W81A 2CDFB 2Z35A 3MR9B 1ZLSH 1YJDL 3VFPA 5FA3A 5DQDH 1FE8H 4QHLB 4Y2DD 2AV1A 4HG4J 1CXHA 2O93L 4P4RB 4HC1H 3OMZA 1MH5A 1VADB 5IB3B 3GMNB 3QDME 2ARWA 4MSWB 3DSFL 5DUPH 3JWDH 4IJ3C 4LLAA 4MA1C 3W0WB 4TRPH 5M94B 3VFWA 4D0BA 2FB4H 3G6AA 2CRIA 1A4JA 4X6CF 3DJ9A 1QEWA 5FO9B 2J4WL 3VFMA 5HDQH 1NC2A 3O6LH 2VNCA 4NO0D 4UQ3B 2OZ4A 4BK5A 5T3XL 4NPYA 3MUY1 1A1MB 1C1EL 4U1IB 5HGGS 1EO8H 3HS0A 5DJXA 3FT3A 5MEPB 1EJOL 3ROOB 1JV5B 3DMMC 3FOLA 2FO4B 3UYOD 4O51A 3IDIB 2BVPB 3GRWL 3HTLX 5C0AE 2CXGA 4Z5RA 1UB5A 1CK0L 3T0ED 3EO1A 2DQJL 5IQ7L 3LEXB 5L0QC 5C0DA 2DQDH 4V1DE 3D9AL 4WWKC 4YDIL 3MBXH 1MIML 3QG6A 3F7VA 4NZUH 5JPNA 2VXUH 1MCOH 1K4DB 5C09D 1T6VN 3AS0A 3HKFA 25C8H 3RGHA 5DUML 1HKLL 4GKZB 4BQ6A 1N4XH 4OGXL 3PV6B 2G2RB 2ERJC 2VR5A 1Q0YL 2EYRA 3ES6B 4NQSA 1KT2B 5ABDE 1QNZH 4XWGH 4PR5B 4WFHE 2AV7B 3BGFC 2P45B 4ZO7A 2VZTA 1JHTB 4I3SH 4UT9H 5F6IB 4HWZA 2P8MA 3SBWC 4M48H 3VFNB 5CHNB 2YN5A 3D1MC 1AKJD 5DO2D 5HHPB 1UYWL 4FZEH 4U6YA 4OUUB 3VFGH 1DR9A 4JREB 5DK0B 2HN7B 5D7IA 4WNQA 1EZVX 4WU5B 3L3DB 3NBNA 3U6RB 4ODTH 5DMIH 2ZG3A 2P5WA 1ZGLM 4P3WA 3SGKA 2QQLL 4G8FA 3RVUD 1W72H 2KDGA 4LEOB 3WSQH 4DW2L 1YY8A 3ARGA 5IM7B 1Q9KA 5JA9A 4KK6C 5KN5A 1QQDB 4GH7B 1KSRA 1RJYA 4W68A 5EU3A 2E7MA 3TBVB 4RQQA 2Y25A 4IRJB 1PJ9A 5HHOD 1T3FB 12E8L 4W6YB 3D0VB 1S7TA 4XCYA 5I1CL 4KUZL 4KMQA 4M6NH 2Y6SD 2MFNA 3BW9B 2MMXA 2OQJB 4GUPA 4RAHA 3G6JE 5TGBB 1MI5E 2BNRD 2BNQA 2MTPA 4J3XA 1F6FB 1ZVYA 2JCCA 3UAJD 3PGCA 3HCVA 3MUJA 1MJ7H 3IDNA 2AJXL 3NMEA 1I1AA 4PBVC 5DMYA 3DSNA 3HC0B 1KJVB 1PKOA 3R8QA 5MP6H 4MWFA 3BYTA 1QLFA 3OZ9L 1ZVHA 1GPOL 4TPRH 1XGQB 3H6JA 2PNDA 4O2CA 3CDGB 1TIUA 1ZLUH 4Z7WF 5L7XH 4HXBH 3LV3B 1X5IA 1NGZA 5FKPB 1JGDB 4ZUVB 4U1NB 2OP4H 3QULA 3JV4B 2FD6L 5GGQH 1HXMA 1YMMA 3CFJB 5C09E 2I26N 3F7YB 2ICWB 4LSSH 4I0PB 1FC2D 2VXSL 3W5MA 2FX7H 4BSWB 2GK0B 3F7RA 4RAUB 4YHYB 2EE2A 4L4TA 1UKQA 1KTKE 1CICB 2JCCE 3ARDD 4X7SH 2ICEA 3U46A 5CBAA 1KEML 1DBKH 3G6JA 2Y07L 4M5ZL 4GG6A 1GOFA 5CD5D 3ZTNL 5CUSH 2KKQA 4WTWA 4ORGB 3U1SL 5D4QA 3CFCL 3F8UB 2VITA 1BFVH 3MRGA 4ONGL 1NDMB 3T0BA 2W07A 1E4KA 1YQ2A 2VQTA 1S7WA 4TUJB 4O51B 2BVPA 4M03A 3KPQA 2E8ZA 4YQXH 5AD0A 2I9LA 3IXTA 2IQAA 2FBOJ 3O6FD 3PHOB 15C8H 3MGTB 4GQ9H 3QYCA 4KDWA 4G9FE 5DHVH 4HGKC 3ZDYF 3EIFA 4EI5B 3EJZC 1B3JA 2W0KA 4XNZB 2B8OT 5HDLA 2JELL 3RX7A 1KPRA 3PV7A 1M6OB 1ZV5A 3OGCA 4K3DH 1MFEL 5I1EL 3BN9C 3HNSL 5CEZD 2GK2A 4X7FC 4QGTA 1FYTD 3GMLB 4JZOA 2HT4C 2EDTA 1RMFL 2DB8A 5BV7L 5FECA 1RUQH 3ARDA 4QHNB 4ZODA 2G5BA 5IVXE 3VFNA 3GIZH 3K4DA 4EN3B 4Y89A 3ULUF 3EHBD 3MCG1 2VQUA 2UZXB 3SDXB 4ETQA 4PJ8C 2QSQA 1NCTA 4WU5A 4ZSOB 2VDKH 1EHAA 1WZMA 5I1LA 4OF0A 5F97E 3UBXG 1B0WA 1MWAH 2GUOB 1BD2A 1ZSDB 3O45A 1OGAA 1NDGA 2FIRT 2LTQB 2PCPB 2WK2A 1EXUA 1MHHA 4OBRA 2OS7A 4G8FB 1KCUL 2WAHA 2EDKA 3LSOA 3SOBL 1G1YA 4OLEA 2EC8A 3HC3H 5F70A 4F9PC 3MJ9A 4U6XA 3DV4A 5TQ0H 2X70B 3MNZB 1R24B 2BVYA 1YEFL 3TWCH 3C60D 3GO1L 4OQTH 5D72L 4NCDA 2ADJA 4HXAH 2E27H 3KXFD 2BRRL 1LVEA 4PV9B 1S7TB 3RAJL 4ISVB 2VABB 3BZEA 5F7MC 1A9EA 1RURL 4GBXB 2YD7A 3HZKB 3CK0L 4K07A 1HSBB 1NC4A 4KHXL 4QNPE 2BVUA 4PG9A 5HHNA 3GNMH 5IVXA 3HUJF 2VC2H 4XBGA 5SWZE 2QLVB 3NGBB 4NSKB 2FH6A 3OR6A 3QEUB 3MOAH 4PIRF 5LWYL 2XPGA 2F8OA 3NFPB 2WUBH 5KS9B 1QG3A 4JB9H 3HCVB 1U8HB 1KTDA 5GZNC 5CILH 4RFEB 1FO0H 3QT2A 1INQA 3OKMA 4X7SL 1RFDH 3VG0L 2BVQB 3QEQA 4JE4B 3UJIL 2DKMA 3LKRA 5E1HB 1E6JL 4YHMH 4OQTL 5GSRA 3ZO0A 4I9WD 1BWWA 3FB8A 2WQRA 5KVDL 3A6CH 4X4ZA 3ISWA 5DC0A 1JGDA 1PX3A 4ZUVA 3CU1A 5FCSH 1ZT7B 4B5EA 3LB6D 4XP6L 1C08B 3UCRA 3CK0H 4KHXH 2BC4A 3RWJB 2ICES 5EIQA 3VFUA 4ZNEA 1UGNA 4RZCB 4JFED 3QO0A 3BGAA 4PTTA 3CZJA 3GKWL 4OD3L 4XNXH 1ZTXL 3GSNB 1BZ7A 3U9UB 2R8SH 4KI5F 4ODHH 4JRYE 2H1PH 5F71A 1WIPA 3FZUC 4NQEA 1M7DA 2P5ED 2HRPL 3LDBC 2ADIA 3AREC 5SWSD 3CFDB 1F6AA 1XCTA 2PN5A 1JFQL 3DARA 1KCSL 1NFIB 3FAWA 2MKWA 4L3CA 4QYOA 1QP1A 1U8JA 3HE6C 1ZKAA 1YMME 2Z4QA 4H26B 2NZ9C 2XYCA 2ZUUA 1CFQA 4Q6IC 4OZIF 1KB9J 2ZUWA 3INUH 1S7WB 4KK9D 4N0CD 4P3CH 4TUJA 4Y4FA 1I85C 1CD1B 5HPMA 1WWWX 4P9HH 1ZWIA 3W2DL 5EIIB 2DLTA 4L8CB 2GEEA 2IQAB 4YC2C 3DV6B 3UJJH 2YOCA 3LQMA 4PJHB 1QRNE 1XR8B 4YNYB 4R7NB 4GKNA 3O3EA 2PYFB 1ZHLA 3I75B 4Z0BL 1GZQA 4EI5A 1UA6L 2Q6WB 4JHAH 4PJ9A 3NCCB 3VCLA 4JG1L 3MRQA 3NH7L 3X3FL 4OD2B 3PJSB 1AE6L 1NBZA 5L7XL 1P53A 4OIAA 1MVUA 1CLZL 3CVHL 4ONHB 4HK3J 3O6KH 5FGCB 3T0EA 3ARDB 3VA2C 1MEXL 3X17A 4NHCH 1U3JA 1MCOL 5A40E 2EDXA 3RWHA 1U8PB 1UH2A 1KIQB 2ED8A 2Q20A 4WW1B 1CXKA 4OM0L 4QTHA 4DFHA 3WS3B 3WJJA 4ZOAA 4C56A 1C5CH 4IM8A 3V4VH 1T7XA 2O5YL 5F93C 3PQYA 5HYSA 4MMZC 1ZSDA 5FF6A 3VG9B 2DKUA 5J6GA 3M17A 1UM5H 1HINL 3MRJB 4DOHB 4J4PA 4PJCB 4BH7A 4N1HB 1YEHH 2P5EA 2Y23A 4MJIE 2H2PC 4HMCA 1HILA 3KPPB 3NFNB 3OXSB 1QRKA 2GI7A 1AD0B 2GTZA 3ZLQC 3LRHA 4CBPA 1U8MB 3IDXH 5AYUL 1J8KA 3FHQA 4RMUA 1XGUB 1M71B 1O5DT 5B39G 1XF1A 4YHML 4WI6A 5I16B 3HZKA 3IDMA 4PG9B 5HHNB 5DMGC 4G6AC 3QUKB 4DW2H 1JCKA 4P2OB 2F9BT 2Z9TA 1F45A 4NSKA 4Y88A 3GMOA 2BERA 4PRBA 3TBYA 4Y16B 1OD7A 5LG1A 5KW9H 3W5NA 2AJYL 3NFPA 2XN9A 5DD5L 1J5OL 4TULH 5JXEC 3BEVB 4OLVH 4I9WE 1W0VA 4J12A 2AJUL 2FHBA 3BD5A 5DYOA 4Q9QL 5IBLD 4JM4H 1KBGH 3UP1A 3OKMB 2R1WB 2XZQH 2HTKD 2MSPA 3HC4H 2EECA 4MQSB 3GIVA 3KGRA 3SKJH 5GSRB 3HE7B 1UEMA 1T2QH 4JLRA 1K8IA 2CK0L 1C12B 1OD9A 2JJVA 5CJXC 3RL1A 2CKBA 2ZOLB 3GBML 3ARGC 3MV9E 2LAAA 2L7JA 2BC4B 1XH3B 5KVMC 4ZTPL 3RTQD 4WWKA 3VDCA 3MRCB 5H8DA 1MJUL 1MF2L 2JE8A 3OX8A 4U6TA 5ADOL 1J1XH 2PETA 4OFYD 2P8PA 1YMMD 4JZJB 2QSCH 4PGBB 2W92A 5I8OH 1QVOB 1N6QH 1KJ2L