4WHTA

Structure of the hepatitis c virus envelope glycoprotein e2 antigenic region 412-423 bound to the broadly neutralizing antibody 3/11, p1 crystal form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
207
Chain Sequence
b'VKLQESGGGLVQPGRSLKLSCAASGFTFSDSYLAWVRQAPTKGLEWVASITNSGGRFYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTRMDYWGQGTTVTVSSAETTAPSVYPLAPGTNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of the Fab fragment derived from neutralizing an
publication title Structural flexibility of a conserved antigenic region in hepatitis C virus glycoprotein e2 recognized by broadly neutralizing antibodies.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Viral protein
total genus 47
structure length 207
sequence length 211
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, X
ec nomenclature
pdb deposition date 2014-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4whtA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4whtA01
1KB5L 4RFOL 1INQA 1MHEA 2VLLA 4JKWA 5HHXH 4YO0B 3VGAB 2WUBH 3GIVA 2IPUG 1GC1C 3G5ZA 3LN5B 5E5MA 5HI4D 1SEBB 1D5MA 4Z7OF 4Z0XA 4YO0A 4LAQH 1B9ZA 1GZPA 3BDYH 4OGYH 3GSOA 4M5ZL 4W4OA 5FA3A 3ECBA 5TE4H 3PGFH 4LQ1A 2UY6A 3QQNA 1UM4L 4N1EA 4N0UA 2AEPL 3WNOA 1B6UA 1WWCA 5I1CL 2CGRH 4HCRA 3UTPE 5EU3A 2FJFB 3UMTA 4JO1H 2CLRB 2UVFA 4HS6B 1F3DH 2DQGL 2DIBA 3ULVH 4LMQI 2F5AL 2FJFA 4X5XB 3VWKA 4NFBA 4JANA 4FMKA 4HS6A 5I71C 2GSIB 3CFEB 5I8KL 1MHCA 1G7QB 3SEPA 4OTXH 3MA9L 1ZOXA 3CFEA 2YUZA 4BFIB 1XGYH 4A6YH 3O9WC 4YBQC 1U8KA 2P46B 4YUEL 1AC6A 1AI1H 3HAEB 5JHDA 4NQEE 5D7KE 1QRKA 3DUUA 2Y6SD 3IU4H 2DTML 4WI5A 4M02A 5IQ9A 1DBKL 3TT3H 1AGFB 2ZUUA 1X9QA 3WD5H 3CMOH 1LEKB 2NY6C 5DA4A 1IARB 3ZE2F 5JDSA 5GZOC 4U1LA 4IEFB 1X5HA 3U30C 5C0AA 3WFDL 3T1WA 5IGXL 1CCZA 1BLNB 2HKHL 3OKDB 3KYMA 3HTLX 4FQQB 3TV3L 4RAVA 2I5YL 3LN9A 3OKMB 5C0IA 4H88L 4Q7DA 1S7RB 4NFCA 3GSQA 5DJ2B 1J8KA 1NKOA 1RMFH 3BX7C 2NQCA 2D7MA 3TNMB 2X70A 3JUZA 2EDXA 5DJ2A 4I18C 4RIRA 4DKFL 2VE6B 1UM5L 5IG7A 3V4VL 3NCYP 4KTEL 3SDDB 3DUHA 4OF6A 1B88A 1C5BH 1JPST 3KGRA 3P40A 4WW2C 1AD9A 4WUUD 3MYJA 1S7QB 1UCBH 1MI5B 3GUTA 3W39B 4JFFE 2VDRH 2J8HA 1KLUA 3BMWA 2G2RB 3IXTB 5K9OA 5GS1B 1UH3A 1CFVH 5SWSB 1BZ7B 3HFML 3IXTA 1FCCA 5GS1A 3O6MH 3ESUF 3HC0A 3CFCH 5E24E 1NAMH 4GG6A 1IM9A 2AK1H 4PREA 4XAKD 3FB8A 4NUGL 1SJVA 1AQKL 5F6IB 3O9WD 5IFAL 3FRUB 4S1QH 3P0GB 5EZOH 4YXKH 1MQKL 2NCMA 5B4MD 1TQCC 4ZPVA 1R3HA 4HIJB 2A83A 1MJJA 2EDRA 4MNQA 1RJCA 4APQA 4XH2A 5HGHA 4XMLH 4TOYH 3HUJB 5IVXF 4HIJA 5LBSL 4YH6A 4EUPB 5I75C 1XFPA 2Z31C 3O2DH 3EOTL 4Y5VB 5GZOD 3ZMRA 3MBEB 4KI5D 2FSEB 3NZ8A 1ZV5A 5K9JL 2VITA 5GGSA 4XVUC 4Y5VA 5IIEA 2QQKH 2VZTA 1S7WB 3A67L 1CG9B 1B0RA 3JBG7 5CEZH 4P5MB 4ELKA 3GMPB 4IMLB 3I75A 4YGVA 5LQBL 1N4XH 2Q8AH 5KAQF 5ALBH 2XXMB 5C0CB 1BIIA 4PLNC 3RX8A 2YRZA 1D5IL 4XHJD 4IMLA 5T1MA 3F8UB 4JO4L 5DJDA 4WU7A 3L5IA 1HEZB 4GXUM 3DXAA 1TVBB 3SDXE 4BSJA 1GC1L 1HEZA 1AGBA 3BFOA 3KPRA 4D0DA 4JPIA 4ZFFA 1ZVSB 1BJ1J 1TVBA 5CZXC 4LPCA 4YEEA 4X5LA 5C0JA 4PJIE 4OQTH 1ZVSA 3ARBB 2HLFC 3QAZB 4D8PA 3V6FA 2FD6L 4LIQE 1XGQA 5BVJB 3EDDA 3H3KA 1Q1JL 4WV1C 4Y4KB 3D9AH 5DD0L 1J1PH 2ADGB 4GRWH 1OAQH 1P7KB 3U4BH 2XQBL 3ARBA 4HS8L 5TGBA 3B2UC 3MLWH 3ARDD 2JTDA 4Z5RA 2O93L 3WDJA 1KCRH 4N8CL 3HPLB 3NH7H 4NJ9L 3FT3B 3FMGL 1FZMA 5CILH 3VMNA 5I1JH 4JPWL 2OK0H 3HPLA 1R3KB 5E4EB 2EYRA 4NZTH 4RX4A 4K9EL 4OUOA 2NY0C 3HAEH 1I8LC 3QUML 3ROOB 3H42H 4QRTA 2IPTH 2QQQA 5IK3B 3O6FA 4NQXB 2Y36H 5KSAD 2Y5EA 2Z31D 2R0WH 3H9SB 3QEQE 4QXTA 1CU4H 4K07A 1SJHB 4PLKC 5IK3A 3TEUA 1IGFH 3G6AB 1YMMA 3N85L 4R96B 4CU8A 4PIRF 1O0VA 3CPLA 3WCYA 2BHYA 5GJTH 2YRPA 1AIFA 4R96A 4ZNEA 4N0RA 4K3EH 4X0KB 5KVMC 4S2SB 4S11A 1HHGA 4R0LA 4LPVA 1FO0H 4AT6B 3CFBB 1TJIH 3WFZA 3MLVL 5BS0B 3ARQA 3G08A 3H6JA 5DRNB 4KHXH 4AT6A 1CLZH 2NXYD 3S4SG 5GGVH 4W70A 5DRNA 2F58L 2IBZY 2I60H 3HCVA 1QTYT 5CZXD 1RU9H 3E6HB 4XNUH 4TNVK 3MJ7B 3TC9A 3E2HC 1G7JA 1S7XA 1MVUA 4NZDA 2HLFD 1A6TB 3IDMB 5D7LB 5E1HB 3E6HA 2UVEA 5I16A 3D39A 1BZ9A 4GMSH 1KB9J 1KELH 3ESVF 5ACZA 4ZSOE 3O0RH 3QFJE 4QRRE 1JHTB 4UILL 4Y16B 3SGJC 5JLZB 2ENYA 4KHTH 5IMKA 4PD4K 2XTJB 1OD9A 2Q8BH 1DEEB 1JHTA 5I15L 1YNLH 1NFDF 5DQDL 2C1PB 5IFHL 5FYLD 1JGVH 4LPTA 2PW2B 2FIKA 3W5MA 3GJFA 4ETQB 2NY0D 5DEFA 2JJTC 3QXWA 3BUTA 4G6MH 1YQ2A 1P4BH 4XNMA 4DTGL 4R26L 3QCVL 2CUHA 3PQYD 3L1OL 2J5LC 1QHPA 3QHTC 4X80H 4OLEA 3HB3D 2GJZB 3U2SA 5DFTA 1L9MA 1NFKA 4EUPH 3WXVL 5EB9A 4PJXB 5CINH 1PLGL 5E5UB 5HYJE 6FABL 4JHBA 3WUZA 3MLUL 3MLRH 5D93C 3NTCL 5E6ID 3ZYJA 4JDTL 1J18A 5J11B 1QBLH 4Y4HC 4O58L 4R97C 4QOKD 4N1HB 4U1SA 3MGAA 1K8DB 3KDMA 2OL3B 1IZKA 1T0NB 3BPCB 1FC2D 1YMHB 5GRYA 3HI5L 3HMXL 2XWTB 3JV4B 4JHWH 1A8JH 1MRDL 1RZFL 3QH3B 1EK3A 1T0NA 1WIOA 2NY4B 2QKIB 4HT1H 5J13B 3SE9H 1IAKA 1JNHB 1UQSA 1WC7A 3U46A 2UWEA 1QFUL 1JV5B 4HFUL 4QY8B 1TZGL 4IJ3C 4JQIL 4PRID 1A6WH 1WAAA 5HHMD 4XX1G 3G9AB 2GITA 5E00B 4WHTB 3MRNA 1FE8H 5L2JA 4Y88A 1ZVHA 2ERJB 4PP1C 3VWJA 5DD3H 5JPNA 1GGIL 1R5IB 4PS4L 3JTSA 3MROB 3IDNA 3TBWA 1R5IA 1X6LA 1MFEL 1QO3B 4DK6A 1JPGA 1ZANH 3MROA 4YHPB 1JGDA 3C5JA 5L6YH 5EIIA 1R24B 5IEHA 4HC1H 3MRHB 3GHBH 2DI8A 5TE6H 4M7LL 1MLCB 5LCVL 5HTSA 2DL9A 3VD3A 5C8JA 3M17B 1LEIB 5FYLL 3QNZB 1TNNA 5EBMA 5GZND 3M17A 1LEIA 5EC1B 5DUML 2DQCL 4D9LL 4JM2F 3QNZA 3GM8A 3NBNA 2BNRA 4FFWC 3TLRA 5C0EA 4FG6D 5DEZA 3HG1D 4GQ9H 2V9TA 1SM3H 2PYEA 4EIGB 3ARFB 4WO4D 3B9KA 3BKJL 2X4RA 3O3UN 5KVGL 1JRHL 3CU7A 2DD8L 1GGYA 4M8QB 4XPTL 3O3AA 2UYLA 4M7KL 5KOMC 3KR3L 1K2DA 1BVKA 6CGTA 3A0OA 1KSRA 4LL9A 2VDNL 3KPQB 1JBJA 1P7QD 4CU7A 1ADQH 3VGGA 5CJXA 1U93A 5CZVH 2EDJA 3C6LA 35C8H 1Y6KR 5DQ9B 3QJFB 3GSNA 2PO6C 5T33H 3EYFA 3NZHH 4LDEB 4YLQT 4F57H 3R06B 4XWGH 1QBML 2OSLB 4F8QA 1KXVC 4OM1L 4AEHL 1MI5E 4GKZA 2EEDA 3VXRD 2FZ3B 1OAZL 4D0CA 4CVZB 1ODAA 1BVLB 2P5WB 3QI9A 5SWSE 4UT6H 4HX1B 3QRFM 4OM0L 2I9LA 4R4FL 5KSUB 1JUFB 2EKJA 5INCA 4HK0B 1DLHB 4HX1A 5T3XH 2OR9H 1TNMA 5KSUA 5EA0H 5DVKA 1IZJA 3SKOA 1DLHA 3X11A 3RFZC 3VH8G 5BZWB 4TVPH 1Q9KB 1ZLVH 2EDYA 3HNSH 4KQ4L 1C08A 2V2WB 4PJGA 4OLUL 2XOTA 2CDGA 5EU7E 5BZWA 1XCTA 4UI2A 2VDOH 4OZGF 5DK0A 4EKXA 3HUJE 4X6CF 5FYJD 4WY7L 1F5WA 3QQ4B 2D7NA 2C9AA 4WTZA 4Z0BL 2W1NA 3UZVB 1OGAA 2GK0B 3RGVC 1CR9H 1NBVL 4YNYA 5EUOA 2H26B 3FO9A 5A2FA 2NZIA 1I9IL 2YEZB 1KENH 3N0PB 4OD1L 2O5XH 1Y18B 3HI6L 5B38B 4G8IA 5C0CE 1AGCB 1A1OB 2Q20A 2X4SA 4G9FA 4OZHF 3FOMB 3BN9C 1Y18A 5F6HJ 4OZIA 1SMAA 3SCMB 2YMXL 2OL3H 5IMLB 1U8PA 4KGJA 3NPSB 4HGKC 5TDNB 3S97C 1GOHA 1K9TA 3ARRA 5EZIL 4ORGB 3UTTE 5DI8A 3UTSA 2PO6D 4S0SD 4JKMA 4QHKI 4IDJH 4ORGA 4JZJB 5IOPB 4X6FA 2O5YH 1MWAH 5SWZD 4HWBL 4YGAB 4GKOA 4Z8FH 3C5ZB 4CMMB 2JJSA 4NT6A 1QUNA 5F7EH 2YPKA 4R3SA 1A1NB 2O5ZH 4F7PA 4JN2B 3C5ZA 1JNLH 3ZDXF 5FGSA 3A6CL 3CVHA 3S37H 2WBJC 2VZOA 3OAYK 4RRPG 2CXKA 4JN2A 4M9PA 4MHHI 5MP6H 5C70A 3C09B 3OHXB 3BQUD 3T04D 1ZT7B 1YJDC 2JIXB 3LKOB 3I6GA 3WIHA 3P77A 2HTKD 3U83A 1X5ZA 2GW5A 3B3IA 1SYVA 4AH2B 1NC2A 4FFZH 3WUWB 5FM8A 4PJAF 1VHPA 5IHZB 2JIXA 4OCLC 3LKOA 4KK6D 4MD4B 4BSVA 2Y9RT 1IVLA 5JR1H 1YQVH 1TIUA 2IPKA 4I0CC 4HH9B 5TJWK 5IHZA 4UTBH 5IHBA 4RMWA 3GHEL 3H9SE 3W0WD 4HH9A 1C7SA 1EUUA 1S3KH 2GCYA 4UV4L 1CTOA 3K8LA 3PHOA 2XN9B 2AEQL 4JFED 5FYJL 1DBJL 4ISVA 4XPBL 2XZCH 2VQ1B 4H0HB 1HIML 3V0WH 3IDJA 2EDDA 3A6BL 4M9OA 4U3CA 1VGEL 3K1DA 4JRWA 4ONFL 4R7DB 4AY0A 4MLSA 5BS0E 3S88H 4MAYD 4IRJD 4WHYH 5FECB 2VLKA 4KKBD 1HSBB 2VAJA 1NGWB 3KPOB 4M43L 2EDBA 4DVRL 4NBZB 1HSBA 1K5NA 5LKNA 3QFDB 5DJYB 4XVSL 4P5KA 4OZFB 1XF1A 3JV6B 2DWDB 5D7LE 2WZPD 3VXSB 3N1GC 4QYOA 3WL9A 3Q1SH 4OZFA 4KVNL 4L8SC 3BPNB 2DL2A 5HVGB 4ZUWB 1GZQA 3HHRB 1DQQB 2XTJE 4LASH 2XA8L 3PP3K 4BQ9A 4JGUA 4O2FB 3O3EB 2ED8A 3MRLB 1DQQA 4NGHL 5DSCA 1MCNA 5B3JE 1J0JA 3UROR 3BH8B 4TVPE 1B90A 3RZCC 5IB2B 3O3EA 2EE2A 3WJLC 4XB7A 4RNRB 1SY6A 1PDKA 2BZDA 4DEPC 1E4XL 1FV1B 1KCSH 4M5YL 2X4QA 3S3PA 4P5TB 1QG3A 5TE7L 2NYYC 5INDB 5JOFB 1ZTXL 3TN0C 1MUJA 4Z95L 4GBXC 4Z7UA 4PJXE 1NEZA 1Z6JT 3S5LA 4N9GB 5JOFA 3FO0L 4M03A 4PJDB 4L8CB 2P42B 4NO2B 2RJMA 3NIGE 1SMOA 1N0XL 1KIUA 3TJEH 1X6NA 3CSYB 2KPNA 3STZA 1I75A 4WDIB 4PJDA 3GSXB 3H0TA 2BJMH 3WIIL 4GAYB 1F00I 3MLTB 1EO5A 3THML 1FORH 1F13A 3GSXA 2BSTB 5B39G 4NM4L 1OP5K 1MCEA 2P8LA 3VFOB 4U3XA 1C5DA 3MLTA 3PWUA 3QDJB 3QUZD 4MCYB 4K3JL 2BC4B 5C0GA 5FV2A 2R9HC 1HHKB 3PP4L 4CBPA 2W65B 5F7MC 2VC2L 4ELMA 4MCYA 1U2CA 4K94C 2UV3A 1ZHLA 1FRGH 3P4NB 4GAFB 1J1XL 4LCUB 3BSZL 4CADB 3BPLC 4FQ1L 3BRGC 3E1F1 1KN2H 1B2WL 1QSFB 3P4NA 2A2QT 4L4TD 4LSSH 4Y4FC 4OLXH 4AJ0A 1MEXH 2R2BB 5FCSH 1WQVT 3PJSB 5EPMB 4ZFOA 1MNUH 4DVBB 5EOQH 1X5AA 1R5VB 1CE1L 8FABA 4JFQA 4G6KL 1OY3B 1INEL 1J7VR 3DGGB 5DF0A 3RZCD 3QXAA 3GKWH 4J3SA 3DV6A 3MRFA 5C2BL 4HBCL 3MO1B 4PJ7B 1FZOA 3DBXA 1NCUA 3V4PL 2V2TA 4YHOH 2ZSWA 1A6UH 4NO3A 1FAIL 4K7PH 3VXUD 4EZMA 1NEUA 1X3DA 1YJDL 2JCCB 1DQJA 1PX3A 2X7LB 1T7WA 5I18H 2YK1H 3KNBA 3HMWL 5FUZH 4GBXD 4RFNC 1JPTH 3K3QA 4WGWB 2X7LA 4QCIB 3OGCB 2IAMA 3MV8B 2ZUTA 3CNKA 1YECL 1XR9B 4XPAH 5HHOA 1D7FA 5A2JH 3LEVL 2R8SL 3LAFA 3P4OB 3IF1A 4P0DA 2EDHA 3MV8A 3V6OC 4S1SH 5FDWA 1XR9A 4UBDD 3DARA 3LS4H 5A16B 4O02L 4TSCL 2FO4B 1UJ3B 1YEHH 4JRXB 2A1WH 4O2EA 3BGFB 1EHLL 1K3IA 4QRPB 2ED7A 1JMXA 3AREB 5A16A 4YDLB 2FO4A 4KAQL 1RUAL 1UJ3A 1AXTL 4JRXA 3GGWA 1H3UA 3IDXL 3HPJA 4QRPA 5CIPB 2R9HD 2ZUVA 3QEUB 3ULUF 2YSSB 3O8XA 3D3VB 5L0QC 2QR0B 4KKAC 4CJ0A 7FABH 3U36A 1E6JH 3VRIB 4G8FA 2YSSA 1IBGL 1PG7X 5BO1H 4POZD 1JPSL 2BX5A 3VRIA 3S3SA 2X4OA 3G6JB 3K8KA 3IS0X 5IQ7H 5J1TC 2P5WE 1NCAL 1KJMA 4HAFA 4Y4FD 3VXMB 5JQ6H 4FQ2L 3WLWC 1NCWL 5E1AA 2NNAB 3VXMA 5JIHA 4LSQL 4Y7MA 3U7WL 4P2QD 4FQCL 1KIRB 5D2NB 3EO1B 4P57A 2G75A 5T3ZD 4HIIB 3ZDZE 4NP4H 3FQTA 5DGRA 5H35B 3NGBB 4P3DB 4V1DD 3EO1A 2VXVL 3D25B 3B5HA 2Z4QA 15C8L 4QXWA 3QO1A 2DQIH 2F54D 4X8XA 3EFDH 3U0WL 4G80B 5K59E 4L9LB 2CMRL 5EUKA 3ZTNH 5D71L 4NJAL 3MRGA 4J4PD 3NOIA 4LSUH 5T5FH 1IGTA 1RK0B 5EOCJ 5ID0A 1WK0A 1ZGLA 2OI9B 2GT9A 2HLAA 2P44B 5D2LA 4PJHA 4YHLH 2ADIA 1RK0A 2BXYA 4YXHL 2ICWI 3LD8B 5I0DA 1RUKL 1ZT1B 1CIDA 3KPNA 2G5RA 1QQDB 1ZEAH 2HFGL 1UWEL 1PG7L 5D9SB 1A9EB 4FQXA 5A3ID 5D70H 5JXED 1RPQA 1HHHB 2R0KH 4KKAD 4B7IA 5JMRA 4LEOA 2X4UB 3TVMA 5C07D 1KJ2B 2DWEB 4ZO9A 5ALCL 1HHHA 1KFAH 3GRWH 4P4KA 5E8EA 3PGDB 5GGTL 3DROB 1U8QB 5IHUL 1KJ2A 3K4AA 3MV9A 4HGWA 4XPFL 1CDCA 2X1WL 3WFEL 4Y19A 4K94L 5F44A 3ARZA 3WLWD 3ABZA 1X7QA 3DMMA 5DJ0B 4FTVA 4GQPH 4WUKH 4BH8A 2GI7A 4U1JB 3OR6A 3QQ3B 5DZLA 3CFDB 4AEIL 4DGVH 3HRZB 1Q8MA 1BFVH 2GTWA 3HS0B 4BKLB 1IGMH 3PDDA 2HT2D 2RBLA 1MFNA 1X5JA 2RCSL 3CFDA 4ZTOL 3VCLA 3C5SA 5J12B 2D03H 2WP3O 5HVWA 4EI5A 5AYQA 3HC3L 2R1WB 5DTFB 1W72L 3ORJA 2YD3A 4WCYH 3WLBA 2DLGA 2ZP0T 4U6VL 4ZOBA 2D0GA 4MQSB 5CKAA 5DTFA 1S9XB 5A1AA 2B1HH 1UYWL 3DV4B 4PJ5B 1WLHA 4XVTL 2AABL 4LLMB 1YNKH 1UJTA 3DX7B 4YHYB 4I3SH 4HIXH 2A6IB 4NM8L 1O5DT 4OSUH 4TUKL 2XN9E 3QXDA 3WXWL 3DX7A 3VRLE 1MRCH 4KU1A 3EYOA 2X10A 4OB5H 5C2UB 3NFSH 5T5NG 1H3WM 4HJJH 3V95A 4L9DA 4XBEL 2AXFB 5EBGA 1C5CH 3MGTB 5BV7H 1LQSR 2V17L 3SO3B 5ECJE 3KPTA 3UJJL 1BQHG 4PJ9D 1N7MH 2GFBB 1M7XA 5CIPH 2RQ8A 4XCNA 3KLSA 2NY7L 3NIDE 1FGNL 5IJVB 5E2VL 4UU9A 3ULSA 4YHKL 2EE9A 3VDAA 1Z3GH 3VXSE 3OAUL 4NQED 1U36A 1WEJH 4ZS6C 5CGTA 5D7KD 3LSOA 1UZ6E 2G9HB 1RJYB 4P9HL 1KYOJ 2KQMA 1GAFH 2X4NA 3RVVD 2XFXB 3UCRA 1RJYA 2DQEH 2J12B 2EDFA 4A2LA 3KPSB 4Q6IC 1OPGL 1D9KA 3TBVB 4TTDC 2J7LA 2CRYA 4KDVA 3M45A 3OXSB 1EGJA 2YA2A 3MYZA 1JK8B 4DUWA 5HY9A 3L3JA 4ALAH 3RTQC 1JK8A 2XWJB 1JF6A 5IBUB 5I1KH 3O4LB 3MNVB 1CFQB 5AWNH 3QIUB 1UA6L 1QLEH 3MNVA 1MCKA 3JWDL 1ZWIB 1AE6H 1XF2B 1UC6A 1IC5H 4E0RB 5GGVY 1KTRL 1XGUA 4FQLL 3VXNB 4JFFD 4EN3A 2PXYD 3FOLB 5KVFH 2HFFB 2YBRA 2R4RH 1XF2A 5HI3C 3SDAD 3LRGA 3X12B 4F9LA 3ULVC 1S5HB 2WK2A 3QEHB 5FHAL 3FOLA 1VFOA 1OT1A 4GG6F 4JQVA 3HI1B 2CDEA 3QDJE 1F6LL 4JFPB 3X12A 2BXZA 5HHQA 3PWPA 2VDKL 1F3JA 4DGYH 4OD2A 1ZHBB 5KJRH 2E7HA 4L4VA 2APTA 3VXQA 4WNQA 1OCWH 3H7BB 3EJZC 1KTKE 3BKYL 3LEXA 5F8QC 3TBTA 1NDMB 1L9NA 1AH1A 3MNZA 1QSFE 2FECI 1T1ZA 3QUYD 3H7BA 4HQQH 1DE4A 3PDOB 2A73A 1NDMA 3RWFA 3F6IA 1I7UA 1XCQB 4MXWH 5E9DA 4YQXL 1A7RL 5ESVA 3T0ED 3VFRB 3IDGB 3D2UA 4NZJA 3T77A 4LPUA 3KLHC 2E7MA 1WFOA 3PDOA 4X7EC 3G5XB 1FL5B 3PL6B 1WCQA 3ARGB 5LWYL 4ZO7A 3VFRA 2EYSB 1YDPB 2BNUB 1VEMA 3G5XA 3ARGA 2ARWA 2Y06H 3LHPH 1RAMA 2EYSA 4PJ7E 1YDPA 2NXZB 1KB5B 3RAJL 1X5IA 1DCLA 4TUOA 3TBSA 1V05A 3OF6D 1NMCB 2JCCE 1EJ6A 4S0TD 3WDHA 1KB5A 3RTQD 4R9HA 1W0YT 5ISZA 3FB7A 5DZNA 4PJFB 1HDMB 4HJ0C 4KKLC 4MDJA 3V5KB 5DRXB 1K3ZA 2C5DC 4E41B 2BNQA 2WWMC 5K9KB 3V5KA 2XPGB 1T7ZA 3BMVA 3UJTL 1UWXH 4PTTA 2YWYA 4KTDL 4D3CL 4HUVB 3ILPA 3QDMA 3WFCL 5IR1B 5CJOH 2DIJA 4JRXE 1RZ7H 3HE6C 4OZ4B 4QRPE 1YY8A 4AM0A 3OZ9H 4Y2DB 5HDBE 4X9FA 4MAUL 1P2CA 2EC9T 4BQBA 1S7VA 2V7HA 2DAVA 4OZ4A 3ULUD 4ZS7H 4N5EC 3D3VE 1TJGL 3RDTA 2OTUA 4L8BB 2VAAB 2UZYB 1CXEA 1DBAL 4OV6F 4M6MH 5D7JB 3SE3C 4L8BA 4M6NL 1YEGL 4OCSH 4RWYH 2W0KA 5FM4A 3T2NH 1MCLA 3G6JE 1LEGB 1T22A 4P23C 5E99L 4UB0L 1FFPB 5D7JA 4MNGB 3VXME 2ZNWA 3KPMA 4XMKH 1NUDA 5C0BA 2X05A 2FCBA 3P30L 4F2MB 2QV2A 1P9MC 4JG0H 2BOBB 4O5LH 5DVNA 4U0QB 3QEQD 4ZUTB 1FLRL 5IW6B 3P0VL 4PJEB 1A3LH 5D2NE 4H0GA 2VABA 3GJEB 5TQ2H 4ZMAT 1CXKA 1EXUA 4P3WA 4DKAA 4MHHG 4YBLB 1U3HB 3EYSL 2GJ6D 4P46C 2HJFB 3IKCB 1KULA 1CDJA 3VGAC 4X7DC 1MFDL 3KYKL 3RIFF 4OCXL 3WFBL 1U3HA 1MFCH 3NPZB 1OTUC 5CLTA 3TP4A 1FVEB 1YZZA 2ZOKA 3CK0L 4KKLD 5BZDB 2BHUA 5HHXL 2WUBL 2NLJA 5T1LD 4G42B 2EC9U 5D1XA 1HINH 5KVEH 5F89A 5HHVH 1TVHB 3PIQB 3MBXH 4LAQL 1HNFA 4XCYB 3BDYL 4OGYL 2VWEE 1T1XB 3PNWB 5JW4R 4I13B 4BZYA 4XWOD 3CC5A 4X7TB 5EZJB 4LAJH 4QHLA 1UT9A 5CD5C 1Q9OB 3SO5A 2D3VA 2CGRL 4JO1L 4J6RL 4ZOAA 1EAPB 3S8WA 1Q9OA 4LIQL 1NJ9B 3T3ME 1KXTB 5C08A 3RA7H 1BREA 5EOCH 3TGXA 1JYXA 1X5GA 4MD5B 4AEEA 3JWOH 4MA3B 2DMKA 2XRAH 3PWLA 5IV2B 2Z8SA 2R69H 4MD5A 3OKYA 2X5PA 1KTLB 4I2XA 3I6LE 4MA3A 2MQ0A 4HBQA 1XGYL 4EIZC 4A6YL 4Z7VA 1HXMB 1IAMA 4JDZB 4IBLT 3FL7A 5SX4H 4PUBH 3UPRB 2HN7B 1HXMA 4RA0C 3GMLB 3IU4L 4J3WA 2H8PB 5HYJD 4KROB 3UPRA 2HN7A 3TT3L 2W38A 1J8HB 3NIGF 1QEWA 5JW4M 4X7CC 4IMKC 5T1KB 4LLYB 1XMWA 2AQ3A 4OLVH 1J8HA 1C7TA 1TDQA 3MREB 4OD3H 1CD0A 4M8VA 4JZNA 5CMAA 1YYLH 4Z78B 3S36X 1II4E 5MEPA 4CKVX 1WTGT 4PV8A 3MREA 4PJ5E 3V5HB 1MJUL 4TPRH 3QCTL 1RMFL 4C57C 4WHDA 3SDDC 2UWEF 1ZGLM 3L9RB 2YZ1A 4UQ2A 1KG0B 2JKXA 3GSWA 4ODSL 4BM7A 1WAAF 5I1GH 5F21B 1W0WA 1JF1A 4JG1L 3UTZB 5AYUL 1KG0A 3ZHKA 3KS0H 4RBPK 1ORQA 1C5BL 4R4BB 5C3LD 5K9QG 5JDJA 3MR9B 3PV6A 4ZFZB 3QIWC 2F53B 4PRNB 2OYPA 4D8PB 3ES6B 4U3HA 4MJ5A 5DD5H 2VDRL 5I1LA 1NCDL 2DQFA 3HZKB 4RISH 3QIBB 3S4SA 5DFWH 3Q6GL 4PRNA 1URLA 4XB8A 4F3FB 5JHDD 2IFFL 2HJKB 5I71B 3O6ML 3CFCL 1NAML 2PR4H 4G8GB 4F3FA 3U0PB 1KT2A 4HXAH 3RWEA 5CSZA 4UDUB 1UADC 2F8XC 1IL1B 5GHWH 2VXTH 4S1QL 3NVQA 5I1HH 4YXKL 3E8UH 4K2UH 1H15A 3QUMA 3QZWG 3BKCH 2R2EB 3L95B 4NQVB 3MBEC 3O9WA 3KXFB 3V52H 3HLAA 4NQSB 4XMLL 4TOYL 4XCFH 3LDBB 2V2XB 5F9OH 3KPSE 4ODBD 3HZVB 4ZAKB 3O2DL 2Z93B 1J1OH 2NY6B 2OJEB 2VLJB 4YHNB 1LD9B 1LK3H 4B0MM 3HZVA 2OJZH 3O2WH 5GQBA 2QQKL 43CAB 1JZ8A 2VLJA 2ZG2A 3LV3A 4YHNA 4WVRA 4CN4A 1N4XL 2Q8AL 2XWBB 43CAA 1KV3A 3O4LE 4U1IA 4UT9H 3WKMH 5GRUL 2RFXB 2IQAB 1T83C 3Q3GA 3CX5K 4HFWA 1FZKB 4P2OB 1PX4A 2HJLB 2Z9TA 1MI5D 4F33B 4FNLH 4PB0H 2V9QA 1FZKA 2XV6B 4Y4KC 3Q0HA 4I18A 4WW2B 1Z5LB 3K2MC 1H0DB 5SWSD 43C9A 3QULB 4OQTL 5D1QC 3MPCA 1OVZA 1P4LA 5INDA 1T66C 4WW2A 2EIEA 3RNKB 1Z5LA 1H0DA 2AV1A 2VXSL 2OXHA 3D9AL 2XZQH 3PWVB 3GK8H 4ZYKB 2R15A 3JVGC 3MLWL 1OOAA 2X9YA 2BVYA 3ZDZF 5E4EC 2HTLC 3S9DB 4MNQD 2XICA 1KCRL 3DX6B 3NH7L 3SHSA 3MJ9L 4UT7H 1F58H 3JTTB 1M71B 4NQDB 5I1JL 1FZJB 1A3RL 2RHEA 4RQQA 4XC3L 3MRKA 5K59F 4NZTL 4KGLA 1F2QA 1CZ8L 1IGJB 1WF5A 4MQTB 3C6SB 5DHYB 2IPTL 5BRZB 5IT2H 1P1ZA 5IWLC 1V3KA 2FIRT 4LPYA 2Y36L 1E28A 3BJLA 3F7VA 2R0WL 2EXYD 5F7KC 1KGCE 1QACA 4HHAB 3WO4B 2WP3T 4UUJB 1IGFL 4HAGA 2P8MB 3MRPB 1G7PB 2Z31A 2OR8A 1CD8A 4HHAA 3QT2A 4LNRA 4UUJA 5GJTL 5I1AB 1Z9LA 5F88B 5IROC 1RHHA 1DN0A 3MRPA 4K3EL 4PJFE 4U05A 4E41E 3CDYA 1LNUB 4R2GD 3MCLH 3H9HB 2DQTH 5I1AA 1MHPL 5DMYA 3HMXA 1KC5H 5FCUL 2D7TH 2DYPA 1PBYA 1FO0L 1TJIL 4B41A 1LNUA 4BFBD 3H9HA 5IB3B 1JP5A 3DIFA 2CIIB 1DUYB 4KHXL 3VXOB 5AAWA 3FONB 1CLZL 3ARBD 3OGOE 4TSAH 4Z7WB 1WBZA 3LRHA 5AUMB 1NFIA 1I7ZA 1DUYA 2CIIA 1PEWA 1NPUA 1RU9L 3D6GA 1AXSA 3FN0L 5GRZA 1OAUH 3DX9B 4Y16C 3FZUD 5DD1H 4ZUVA 4TRPH 2XTJC 4OT1L 2FJGA 1ZSDB 1EH9A 4X9BA 5HDOA 4GMSL 2PKDA 5LGHH 3OXRB 4O51A 1KELL 3INUH 2OM5A 4RX4D 4OV5A 5DFVC 4H8WL 1WCBA 4KHTL 2AJUH 4QTIH 2FYYA 4WV1A 3HAEG 1RVFH 3OXRA 4XP4H 4BUHA 3SGKC 4HWEH 3C9NA 4MNGE 3ETBF 1Q38A 5E94A 4NWUH 2FEDC 4K3GA 2ITDB 1INDH 4K7PY 4ONHA 1S7SB 2EDQA 4G6ML 1P4BL 4PJEE 1CXHA 1MCIA 2A0LD 4XBGA 3VH8A 4HG4J 3VD9A 2J4WH 1D5XA 3P3YA 1I8LA 2NZ9C 2EDTA 1YY9C 4HWZA 5ACLA 5J11C 2EDEA 3PQYA 2VH5H 3QEGH 5D6CB 2O61B 4XP6L 2VZ1A 3FCTA 4G9DA 1GH7A 1OM3H 2F8OA 1H9VA 5D72L 5BS0D 1RUML 1TJHH 3GSRB 1L6ZA 4GAGH 4C58B 4GKNB 1YN6A 3RUGA 3BAEH 2NY4C 5J13C 1WV7T 1DQDH 3GSRA 5F9WC 3KVQA 4F37F 1F97A 4QOKA 1FNGA 3D39D 5I1IL 3UC0L 5GSVB 5D7LD 3SE9L 3TH2T 2Q76B 4MB4A 4X6DA 4UOW0 4ZDHB 3TJHC 2VR4A 3L3DB 1UZ6F 3BEWA 1EAJA 3MRQB 2ERJC 5HPMB 5I0ZA 1A6WL 2XTJD 5JQHC 1CGUA 3LRSA 4FFVD 4J8RB 2ZG1A 3V79C 1FE8L 4JRYB 4K23H 4PJBA 4PRIA 4X4YA 4QXUH 3D85B 5DLML 1G0XA 5AG9A 5ESQB 5BQ7A 1CDBA 1CBVH 3D85A 2YPLA 4N1CA 4GT7A 4M1GH 4OJFH 3SGJA 1V7ML 1J0HA 1ZANL 3Q6FB 4HKXA 3PGCA 4XI5C 1AR1C 4Z7UF 3STLB 4EUPG 4HC1L 4RRPA 5C0ND 4QRSA 5F7DB 3GHBL 5TE6L 2A38A 2Q7YA 2FL5B 1FN4A 3NFPA 5TFSH 1IFHL 2ATPB 3OG6B 2EO9A 2YN5A 4PJDF 2J5LB 2NZ9D 1G7LB 1RY7B 2JJTA 3TZVC 3ARFC 4LOUD 4YHZH 1M05A 2FHFA 2M2DA 3GMRA 2L0DA 3BP5A 4U1KB 3QNYB 1JCKA 2XKNB 2JB6B 4QHUB 1YEJL 1FFQA 1KJVB 3ZKMC 4ELMF 3HG1A 2JB6A 3WNMA 4YPGA 5TH2B 4R4NC 3QWQB 3BESR 1NGYA 1J10A 1CLCA 3JUYA 2ZUQB 3V0AC 5E4IA 1MCCA 4JQXC 4Y4HA 3GIZL 1JVKA 2J88H 5T1DL 1ADQL 2OTWB 2W0LA 3F7RA 4RMTA 5ESAB 4CVUA 5CZVL 4QRUB 4FQJH 35C8L 4KQ3H 2A9MH 3VFPB 5T33L 1P7QA 4F57L 5SWQB 3TJHD 2QHLA 3BDXA 2F53E 4HWBA 3PHSA 3LQAL 3VFPA 1GVIA 2MTPA 1SEQH 1G7HB 5F96L 1XGRB 1HCVA 3N06B 5SWQA 1EPFA 2R1YB 4IJ3B 5JORB 4MA7H 4J7RA 1ZLUK 3SKUD 1G7HA 5L8KB 2X9WA 1KLGB 1S9YA 4UT6L 2R1YA 1Q0YH 3ZE0F 3VXRA 3DSFH 3IFNH 5HHPB 4JHZA 4PG9B 4BK5A 2EE3A 3BVNA 4G8GE 3HR6A 4PJ7F 5T3XL 2OR9L 4XP9L 1OP3H 4IDLA 1IAIH 1K8IB 5EA0L 5DHXB 4JB9H 4XI5D 1AR1D 2JCCF 3HE7C 4HJGB 4DCQA 4TVPL 5E08H 4HULB 3IGAB 3HNSL 1K8IA 5CWSA 1H3XA 1FNEB 1TZHA 3ZLQC 4EQ2A 3C8KB 3KXFE 4XP1H 2VDOL 4UIMA 3FFCA 2H32A 1EEZB 5E2JA 4BUGA 4KTYA 4KZEL 2V5SA 3ARFD 3CVHH 1TFHA 1D5BA 4PY7A 4KK9D 1BBJB 1D6EA 1EEZA 4NRZB 1IM3B 1AO7A 4G7VL 2YUWA 1I4FA 1CR9L 4CDGC 5IVXA 5LG1A 2V7NA 5J3HC 1PZ5B 4HV8A 1KENL 3SCMC 4F58L 3EGSA 3IRZA 3UDWC 2ICEA 3OSKA 4WEBL 3NPSC 4MWFB 5IMMA 3N1PC 3O41B 5HBBA 1T5WA 5BXFA 1KEMH 3FQNB 3PUCA 4AIZB 5J89A 4F15C 4R4ND 3Q5OA 3W11C 3O11B 5FUCE 4LSVL 3EW3B 3O41A 2EZ0C 2OL3L 4NC0B 4IIQB 1MCFA 4JZJC 2VDLH 5B39B 4PRDB 4JN1H 4XCCH 1J0ZA 3MV7B 4IRZH 1U8LA 3G6JF 3F6LA 5B39A 3QHZH 2P5WD 4PRDA 2CKBB 1JTPA 2O5YL 2VNCA 1EO7A 4KDTC 4XXDA 1FL3B 2PO6A 1VFMA 3KJ6H 1BJ8A 3NN8B 4PGJA 3ZL4L 3C09C 5F7EL 3V8CA 1W0VB 1U8NA 1FL3A 5SWZA 1JNLL 3AAZB 3CLFH 4U6HB 4O4YH 5FKPB 1MLBB 4NCDA 3V7AE 3IRPX 4U6HA 3SGDH 2C4XA 4ZD3H 5FKPA 1PQZA 3D18A 3RJDA 1MLBA 1NH6A 4NQDE 1QFOA 4OI9A 3S96A 4PGZA 1OAXL 3U9PH 4GRLB 4XCEA 4H20L 1CDYA 2YD7A 4J1UB 1MJ7L 3GJFK 2EYTB 4YDVA 4MX7B 1TQBB 5JR1L 1EEYA 2A74A 1YQVL 5BRZE 1Z9SA 3DNKA 4PJHF 4CW1B 1XR8A 4X5WA 1WFTA 1XF5B 4QRQA 2X44D 4M48H 1T04A 5TQ0L 1MIMH 5CP7B 1YEKH 4CW1A 3FO2B 1S3KL 1HHJA 4FZEL 1I3GH 1XGTA 4YXLH 4GMTL 3D69A 3LKNB 1EFQA 3OAZH 3RGVB 3U4EA 4PJ8B 5IP4A 5J3HD 1B0GA 4GLRI 5CP7A 4ETYA 1R3LB 3FO2A 5ICXB 4GG8A 3W0WA 1SJEA 2XXCB 5GIRA 3UTSD 2XZCL 3AMLA 2PETA 3QO0A 3RGVA 2DM7A 3V0WL 2UY7A 1FFNB 1R3LA 3PXHA 2V5TA 4JFEA 5TPWH 2EZ0D 5KSBB 1FFNA 3IAQA 3VFSB 2ESVA 3P4LA 3S88L 1Q72H 4MJ6A 3UJIH 1NL0H 2XZAH 3I6KB 3TYFA 1T89C 3K4DA 2KKQA 2PNDA 2I24N 1MAJA 3C5ZD 4Z7WE 5JO5B 1WZMA 1E27A 4L4JA 5CCKH 3ROLA 3O3BA 3SOBH 5L2KB 1GSMA 3BPNC 1QBAA 3OX8B 5DJ8A 3CVIL 1BF2A 4NHCH 4JKLA 4MJIB 1K6QH 5DS8B 4MVBC 5L2KA 3TIDB 3VXTA 4AMKH 3Q1SL 1T5XA 1FFOB 5IF0B 4MB5A 5DS8A 2JIXD 2WINA 3SDYH 2AVGA 2IANB 3KYNB 4LASL 5IF0A 3W5NA 2WBJB 2AKRB 2C7UB 3DLQR 1MPAL 4Y5XB 3GNMH 1NAKH 1K85A 5CD3A 1WZLA 5FO7A 2VXUH 4NC1E 1GOGA 3CFKA 4P5TC 4G3YH 3ZZ1A 3SDCB 1FLTX 5FAAA 2BMKA 3EYUH 4N8PA 1Q9WB 3GI8H 1IRAY 2XN9D 32C2A 5C7XH 4NBYB 1DQML 5DHVB 3CDGB 1Q9WA 2WANA 4KY1H 3IU3A 3CCHB 4TUJB 2DQUL 3BZ4B 3GZKA 4JZOB 5GISH 3BP7B 1TPXC 4IOFD 1VKXA 2SEBA 1RURL 3CDGA 3KLDA 1VGKB 3TJEL 5BVPH 3EDKA 4WHYG 4ZPTB 1JZ3A 1AC0A 3CCHA 4MSWB 4PRHB 3BP7A 1S7UA 5D1ZC 1I7RB 4GO6B 3MRMB 3VI3E 1LO5B 1OF2A 1UZ8A 4HDIA 4MCZA 4LSTL 4K55A 4MSWA 5C09B 1T3FA 1FORL 1CQKA 2IH3A 1I3RA 3F58H 3EYVB 1BFSA 3DI2B 4UV7H 3MNWA 5SX4I 1G7MA 5GGUA 1FBIH 5GS0H 3OMZA 3RY6C 4LCYA 4RGOH 3VXSD 2YD8A 3V6ZB 1HI6B 2XTLA 1KNOA 4PRBA 1FYTA 1QR1A 2CKBH 5H94B 5ANMA 1G6RB 4WI6A 3TIEB 1BQUA 1CGWA 4KVCH 4GKSB 4JPVH 1KN2L 3HC4H 5H94A 1J0YA 2FJHA 4JRYE 4LSSL 4D94A 4POYA 1DFBH 4L8SB 4YWGL 2DM3A 4OLXL 4NQUA 1AP2B 5HDLA 2H3NA 3LQZA 2Z92B 3X13A 3PABA 5AD0B 3TCXA 4F7TB 3P9LB 1AP2A 1MCOH 5HGBB 1MCSA 5GGRA 2HG5B 4HKBA 2JJUA 2AXJA 3QDGB 3FFDA 5AD0A 4P5TD 3GKWL 5I6XB 4I5BA 2HAZA 1L0YA 3REWB 2AEWA 4YHOL 1U8JB 3CUPA 3RZCA 4YHIB 3V8OA 2DLFL 3WJLA 4G8EB 2F8VA 3PHQB 5I18L 2YK1L 5D7IA 5FUZL 2EECA 4HMEA 5B38G 4UQ3A 3TN0B 3WNLA 1XIWB 1JPTL 3GSVB 5J1SC 4J23A 4KMTH 3ALXA 4WFGE 2AJXH 3G5VA 4G6FB 5EU6B 1DSFL 2GSGB 5BV7C 4U0RC 4KC3B 4XPAL 4XVJH 3TN0A 5J6GB 3LZFH 3BGFC 4GBXA 4M6OL 2Y7QA 2HFTA 5HXMA 1P5UA 5EBLA 4LCIL 4KJWC 5EU6A 5HYSA 2GSGA 3AREC 1Z0NA 2F19H 3IDIA 3QDJD 3LS4L 5ID1A 1HQRA 3AC0A 5E6ZA 1YEHL 4J12A 2JJWA 1QVOB 1F90H 4CN6A 1KOAA 4LLWB 3QG6A 1OP3K 1RIHL 1BQHB 3DVGA 3LH2H 3PE9A 5HGAB 1N5AB 7FABL 1E6JL 4LPWA 1YUHA 1CQYA 5DMJB 1R3JB 5EU4A 4DUXA 1A4JA 3C60B 1LO3H 1BQHA 5GGTA 3HR5B 3ISWA 4Q9CA 3CAFA 5BO1L 4WTWA 4BYHA 2IGFL 1U58A 3BPLB 2NR6C 2XNAA 5IQ7L 2APFA 5JQ6L 4HIHB 1BFOB 2E9JA 5D2NC 4XAWH 2A6JA 4H1LB 1F4AA 2R23B 1OWRM 2G60H 3W82A 2E7LC 3T0AA 4JFDA 4HIHA 3BN3B 1KJ3H 3DSNA 4WI3A 4Y4FA 1VFUA 3MJ8A 3FB5A 4GW4A 2Q3AA 4K7FB 1GXEA 1S78C 1HILA 1WUNT 4NP4L 3H2WA 3DETC 4L9LC 5KANG 4P2QA 2BVQB 3RL2A 3BHBB 1W72A 4YR6A 3EOYG 5GRJH 4B5EA 3DYMA 1R6VA 3MV8D 4V1DA 1RI8A 2P8PA 3ZTNL 2JF1A 1YPZB 1LE9A 3FRPG 4U6YB 3OBAA 4LRIC 2VWEC 2F54A 5DHVH 1AD0B 2BSRA 3LD8C 2PW1A 4OZGA 3T1FB 2X09A 1YPZA 3EYQC 4RAHA 1T2XA 2X42A 4JRXD 4QRPD 4HLJA 4KJWD 4JFYA 3ARED 3MRDB 3NCFB 1D6VH 4PTUB 5C92A 3U7YL 1MCBA 3GM0A 3KYAA 4IS6A 1EEQA 4JO2H 3MRDA 3V6OA 3OTTA 1ZEAL 1QFWH 4Z7QF 3M8OH 4OZHA 5CHNB 4BH7B 4PD4J 2BRQA 4MB3A 4FQHA 1A5FH 2E8ZA 4NHUB 4NO0B 2YHGA 4RMQA 5A2KH 4I4WB 3MV7E 3DJ9A 4NWTH 5CHNA 5C71A 1GRWA 3SKNB 3VXMD 3AVEA 1VFAA 1KFAL 5KS9B 1F6AB 4F37K 2PYFA 1WWBX 2G5BB 1G6RH 5EO9B 1FVCB 2HH0H 4XT1C 4ZTPH 2FX9H 1JN6B 2CUMA 2EH7H 4QWWD 5EBWB 2AI0H 3N1MC 2G5BA 2W0FA 1H8OA 1FVCA 1L4IA 1QRNB 3C8DA 4LLVA 5EO9A 3SBWC 4KJQC 3SKJH 5J12C 1WGOA 4DGVL 5C9KA 1FIEA 2IJ0C 4AIOA 1QRNA 1EERB 1JZ6A 1BFVL 1IGML 3N9GH 1ERNA 4OGXH 2X9XA 1O7SA 5IBTH 1CN4A 4BQCA 2GY5A 3B5GA 3VU2A 4WCYL 1U95A 1F3DJ 1YEFL 1YNTA 4H26A 2B1HL 3L7EB 1X5FA 3KWWB 2UZXB 2D7OA 4GAJH 1YNKL 3VMPA 5MHSE 4B50A 4I3SL 4LK4A 4TSBL 4W6YB 4CMHB 4RMRA 3EYQD 5CUSH 1JTTA 1KIQB 1IKNC 4N9OB 4UNUA 4FQXD 4OSUL 3UXFA 1MRCL 4TVSa 3EDEA 1WICA 3SO3C 1KIQA 1UKQA 3QXVA 4OB5L 4RMVA 3D48R 2H9GA 3TVMD 2N1KA 3NFSL 5CP3A 4HJJL 1S7TA 1QZ1A 4PYHA 1C5CL 5BV7L 2IF7A 5KSBE 3MGOB 4C56B 2J8UB 2QQLL 5JZ7D 5ERWA 3UX9B 2WIMA 2HVJA 1N7ML 1G7IA 4NOBA 4XNXL 2GUOB 2VQTA 3DMMD 4OIAA 4FTVD 1ZT4B 1NUFA 3K81A 1RZ8A 4J2XA 3I6LD 3KLAB 5AZ2L 4RGND 4XMPH 4MJIE 5FYKH 3QA3A 3WV0A 3QHFH 1Z3GL 1T2QL 2MMXA 2VISA 1WEJL 3BZFB 1FVDA 3I85A 3L3OA 4LQFL 1IEBB 3MX0A 3U0TB 3QPXH 1CIUA 1GAFL 2IANE 2X1XR 2DDQH 2DQEL 5DJXB 3U0TA 1VENA 4JFZH 1XH3B 1X4YA 4O2CB 3ARVA 1P7HL 5D6DC 3TNNB 3IXAA 3DVNB 3PWNA 2AJZA 2CH8A 3D87B 1XH3A 5J1AB 1RJZB 1IEHA 3MRIB 1KPUB 4PJ5D 4LSDA 2VL4A 3LPGA 1OARH 2D31B 5J1AA 2ZCKH 5CSBA 1N8ZB 5H8DA 3T65A 4ALAL 3QIUC 4OLWH 3OKEA 2EKSA 3MUY1 2D31A 1KCUH 1XF3B 5ITBH 1I85C 5I1KL 4LVOB 1KPRB 2V9RA 5AWNL 1NGXA 4OGAD 4PV9B 3B9VA 1WITA 1I9RH 2EDLA 1AXIB 1FG2B 1QLEL 1JZ4A 1AE6L 2DI9A 1IC5L 4PRHE 3GMQB 5DJAB 2QHRH 5CEYB 4FXLA 1OAKH 4NKOB 5KVFL 5C09E 4X98B 1CGTA 2BDNH 4ACPA 5DJAA 2DJ4A 2MPAL 1AFVH 2DMBA 1SBBA 3IJSB 4RFOH 4JFFA 4X98A 1BQLL 1WBYB 4DN3H 1H3GA 1OGTB 3SE4C 3ZO0A 4OUUB 4L3EB 3VGDA 3L3KB 5AAMA 4JFHD 1KLFA 1T20B 3D0VA 5J6HB 3EFFA 1WBYA 5KJRL 1I1AC 3CZFB 3L3KA 3GKZA 3VFWB 2YOCA 5J6HA 4YAQA 3CZFA 2NY5C 4NPYA 5BCAA 1UM4H 3H3BC 3VFWA 5JOPE 2BY1A 2AEPH 3D1MC 3VRJA 1J11A 1U0QA 2DKUA 5I8CB 3KPSD 3ZKSD 3G5YB 2VIRB 2BVPA 2IALB 3OKKB 3P0YL 1GGBL 4ZFGH 3QUYA 2DQGH 5DJ6A 4WUUB 2BSSB 3OKOB 2CKNA 1WTLA 2C3HA 2VIRA 1FQ9C 3OJDB 3QDGE 1QHOA 2BSSA 3GFUA 2BP3A 3ZTJH 2IADA 3LKPB 1FJ1B 3TO4B 2WIIA 3O4LD 5MENB 4Q6IA 3WEXB 1FAKT 3QIUD 1KTDA 4YUEH 4ZQKA 4JY6B 3FO1B 5MENA 4EDWH 3WEXA 3IETB 4C83B 4GUPB 3OF6A 5IB1B 1MCQA 2VMFA 1HXYB 2FR4B 4NRYA 5EU6E 1CXIA 1DBKH 3RTQA 3SDXB 5IB5B 3UBXA 3C2AH 4DN4H 4NRXB 4WW2F 1HXYA 2HVKB 2FR4A 4NN6B 2LV4A 2W07A 4Y2DC 3SDXA 3BZEB 4F80A 3FQXB 5ITFB 3WFDH 1S5IH 4L4VD 1IAII 5CEXB 1CXFA 4GFTB 4XTRC 2EXWC 2CR3A 3TV3H 2R1XB 2IBGA 3FQXA 5HJ3B 5ITFA 4C59B 4PJIA 3OZ9L 5FO9B 3RNQB 1UKSA 1EZVX 2R1XA 4ZS7L 1PD6A 4P4RB 2R2HB 4KPHH 3R4DA 3MUJA 1A21A 3RNQA 4LSPL 3CXDL 3D2UD 3VXPA 4QXGL 2ARJA 4PGCA 3FQUA 2R2HA 1A1MA 3SQOL 3V4VH 4Q2ZA 3VFTB 3UEZA 1JL8A 4OCSL 4RWYL 3T2NL 1ETZA 3CU1A 2AGJH 3PL6D 3RWHB 1DN2A 3ARGD 4A6YA 3ZSTA 4Q0XH 4AL8H 4XMKL 5HD8C 1GJIA 3QUXB 3GB7A 4WEMB 3MXVH 4JG0L 3VFUB 2CO7B 2FH6A 4FQIL 1N6QH 2NXZD 2C3VB 1A3LL 2P43B 4P2CG 3LN4B 2C3VA 3QEQA 5I76B 3QZWA 2QJDA 4YDIH 5DD6A 3P9WB 3QDAA 4E41D 3LN4A 4YJZL 1JWMA 1RHFA 5DMIL 1MQKH 1A6ZA 3NFNB 4E5XA 2QADC 1YPZE 5F7FA 2X4PB 1A6AB 2VR5A 1DQLL 2D0FA 2BY0A 5KVEL 1HINL 4MA8L 4XRCA 5HHVL 5LBSH 3MBXL 2A6DB 2X4TA 4I9WE 4X7SH 4Y2DD 1RK1A 2VL5B 3SGDI 3EOBA 1BIHA 5T1LA 4DFIA 3PWJB 2EXWD 2QLVB 2VL5A 1YEDB 5DMGD 3P11H 3HE6B 4LHQB 2ZWLT 3KPPA 5IVZA 2A6KB 4P59L 2YD9A 5D7JD 3EJYC 2Y4SA 1YEDA 1DBML 1I7TB 5I1EH 3ARUA 4JO4H 3RA7L 4ZSOA 3IJYA 3QFJA 5EOCL 4QRRA 1ZA3A 3V2AR 1LE5B 2FX7L 1NAMA 4HLZH 5KS9E 2XRAL 1GC1H 2BVOB 2R69L 3DRQA 1B0WA 2XKSA 3BP4A 4X9GA 1LE5A 4PRAB 4P23B 4EDXA 1EJOL 1JGUH 4MD0A 5HD8D 4YBHA 3SE3A 5SV4A 2ZPKH 1QRNE 1GPOH 2FD6H 2OQJA 1LK2B 2C3GA 3QQ9C 4P23A 5DEGA 1Q1JH 2LTQB 4PB9L 4XNQB 2NY5L 1U3HD 3QG7L 3CFJB 4WFHE 3OKLB 2OZ4L 4JCMA 1PFCA 3SY0A 1P9MA 3O2DA 2F74A 5HGDB 2CIKB 3N1QC 2FO1A 3OKNB 4QGYA 3ARYA 5D1XD 3FMGH 4P46B 3B2VL 5TDOA 4RA3A 4OLVL 2AW2A 4ODUA 5I1DB 4U6XA 4OD3L 1DDHA 1V3LA 4P46A 3MJGX 4G7YH 4K9EH 1DQTA 1MFAL 3QUMH 3LN5A 3NIFE 2IH1B 4X6DF 1SEBA 1DBBH 4YFLI 4HPOH 5I66B 4CDHA 4BFGA 3U82B 2HT3D 5I1GL 3MOAH 3WE6B 1HYRC 5I66A 5J9PB 5C08D 3N85H 2JB5L 2IPUK 3WHE1 1YN7B 4HZLB 4PJBF 3QIBC 2NY3B 2C4FT 4OQTA 4GRWB 1R0AH 4C56E 2J8UE 4WRLA 1JFQH 1YN7A 5FUOH 3ZKND 2CLRA 5L9DL 1G9NC 1KPVB 4OKDA 2ICWB 2BCKB 1B6DA 1OW0C 3RVTC 1R5WB 3GMNB 4LLAA 4X5XA 5IJKC 5C0RL 3B4NA 4NDMB 2GSIA 4LVNB 1KPVA 2ICWA 1G7QA 1N6VA 4DJMA 2H6PB 4PRPB 5FFLA 4JM4H 3MJ9A 4F9PC 4XC1H 2IMNA 4X99B 2PR4L 5DRWB 5E8PB 2F58H 5F1NB 3UP1A 1FCGA 4G6JH 4BFIA 2DQJH 2H6PA 4FP8H 4TN9A 4KROD 5E8PA 5I1HL 1K4CB 5F1NA 3LDBC 3E8UL 3HAEA 3RKDD 5I17B 1J8HD 2QEJA 4ZAKC 1JHLH 4ODHH 4XPHH 5T1KD 2C1OB 4PG2C 3T4YB 3OL2A 4XCFL 2HFEB 1AGFA 5F9JB 5HHMB 1LEKA 1P4IH 2VDML 2ILLA 2W60B 2C1OA 1J1OL 5F7HA 1F4WH 5F7YC 3RWGB 3EIFA 2HFEA 5DQDH 1M6OB 3OB0K 2WUCL 1BLNA 2W60A 3OKDA 4FQQA 1HQ4B 3OKMA 2COQA 2DQDL 5FK9B 4IMKA 5FUCC 1FO0B 2C4FU 3MRRB 4P99A 1S7RA 4X4XB 1OSZB 1C1EL 1T21B 3C08L 4P2OC 4UT9L 1FO0A 3TNMA 3L1OH 2DLIA 1MAMH 2DBLH 1FSKB 4NKIH 5FM5O 2VE6A 5D8JH 1EMTL 2FATL 2F53D 3WXVH 3B43A 4DKEL 3SDDA 1IC4H 4EVNB 3QIBD 4PB0L 4KMLB 3MLUH 4OKVB 1MAKA 3NTCH 5TDPB 2FX8L 1S7QA 1MI5A 3QIWB 2B2XL 3W39A 4ZODA 2AXHA 2Q6WB 4OKVA 1DUZB 4I3RH 2G2RA 4L3EE 4Y1AB 3HN3A 3QIWA 4G8GD 5D5MB 4YDKL 1WT5C 1TCRB 3GK8L 5SWSA 5SX5K 2Q6WA 3KLHD 1BZ7A 1DUZA 3HMXH 5JNYB 5I30L 4FXGB 1RZFH 4YBQD 3TYGH 1XGPB 3BDBA 2GAZB 1NLDH 3NCEB 4FXGA 4UT7L 1F58L 3KXFD 3KYOB 1BOGB 1QFUH 1XGPA 2HRPH 3FRUA 1E4JA 3CSBA 1NCTA 1TZGH 4JQIH 3J8F7 1MREH 4ZAKD 4HUMB 5EZLB 3MRCB 2NY6D 4WUUE 3MOBL 2VLJD 3WO4C 2OXGA 2X89D 5IT2L 5IBLC 2H2PC 3HUJA 3RWDB 3OB8A 4EUPA 1S8DB 2WBWB 4PS4H 3V6BR 3MBEA 1FIGH 5SV3A 2FSEA 4OIBA 4BZ2H 1ZHKB 2WLYA 2ZSVB 1WSST 4MZ3A 1S8DA 1MFEH 5MENE 4HUNB 3AS0A 4R90H 1S7WA 2FLRT 1CG9A 2K9UA 2ZSVA 4P5MA 3GMPA 2DOCA 5C0CA 5CBAB 1J05B 3IJHB 4XAKE 1EO8L 3MCLL 5H37H 1KC5L 1UG9A 5FYLH 2D7TL 3UTTB 5TF1H 4D0BB 2DQCH 3UTTA 4F7CB 1UFUA 1HH6B 4TSAL 1T83A 2KQNA 2KDGA 5KVGH 3ULVE 4HWNA 1JRHH 4WHCA 1A7BA 2DD8H 2GEEA 4D9RE 2FB4H 4XPTH 5DD1L 4MMXC 4X4MA 5D1QB 5BVJA 3S35X 1UH4A 4TRPL 2CRIA 4Y4KA 1XF4B 2ADGA 1ONQB 1P7KA 3DHJA 5D1QA 1I3VA 4X8JB 4L29B 3L6FB 4JCLA 4NQDD 3Q48A 5IMOB 2EH8H 4LVHB 2FLBT 2AJUL 2D4FA 1UB6B 2DKMA 4HKZB 2L7UA 4NC1C 1RVFL 4NFDA 1F4XH 4XP4L 5E2UH 5EO1B 1KF9B 2V5MA 3FT3A 1H5BB 1HE7A 2EEBA 4HWEL 3JVGA 1G9NL 1T4KB 4NUJB 5IMOA 2JJSC 3W81A 1QBMH 4HC1A 5BRZD 1R3KA 4OM1H 5EO1A 3FQWB 4NUJA 4JEGB 1A6PA 1INDL 3ROOA 2BVTA 3OAYH 2DJSA 5FGBC 2YS4A 4NQXA 1LHZA 4R4FH 5IKCB 1QFWI 4QNPE 4PFEA 3EO0B 1HKFA 2J4WL 3H9SA 1QSZA 4XVUD 3WS6C 4DQOL 4Y89A 1CL7H 1SJHA 1U2HA 4MMZC 1S9VB 5HGGS 2DYPD 3G6AA 5IWLA 2VH5L 3ARTA 3QEGL 3WSQH 5GSRB 1S9VA 1RJLB 2N4IA 3L3IB 1CICB 5KSBF 1T7YA 4KQ4H 3BQUB 5FYKU 2FEEI 4X0KA 3T4AB 4S2SA 3DHMA 2VUYA 5DYOB 4GAGL 4C55A 4L5FH 1N59B 4WFFE 3BAEL 5IROA 3CFBA 4LCCC 4LPXA 1ADQA 5BS0A 2NPLX 1OT2A 2EC8A 1GGUA 4Z0BH 3S35L 3MUZ1 5ICYB 1I9IH 4HUWB 1ES0B 3MJ7A 2P4AB 1ZMYA 3HI6H 1I1RA 1A6TA 1P84K 3IDMA 5D7LA 4LCWB 3B2UD 2E6PA 4HUWA 4YHMH 8CGTA 2YMXH 1HOCB 5KSVB 3RWCB 4Y16A 5HYFA 5JLZA 4QXUL 2BHZA 2WM0A 5EZIH 1QNZH 3BPOB 5E2WH 5KSVA 1JGLH 2A77H 1DEEA 1AJ7L 2Y1VA 5F72S 3VG9B 3L5XL 1T1WB 1CBVL 2C1PA 2ZUXA 3T3PE 4OJFL 4PGBB 2AJSH 4IRJB 2BY3A 3SGKA 2PW2A 4HWBH 3BE1H 4ETQA 3RP1A 1DVFB 2OR7A 5IUSA 4PLKD 3PP3H 4UNTA 2ZKHL 1W8NA 1MH5B 5ETUB 5E8OB 2GJZA 5FO8B 3H9YA 4WWKB 5CEZE 4F7MB 2F5BL 4PJXA 4YHZL 4OLYH 1MH5A 4LLQB 5KTEH 2MCPL 4JJ5B 5J0BA 1MHHB 4EXPX 3L5WB 3BUYB 4WJ5B 2Y07H 2ZUQC 4JJ5A 5KBNC 1NFDB 4XBPB 3AB0C 1L7TH 1K8DA 3BUYA 1AGEB 4WJ5A 3ZYZA 3O6KH 4NYLB 2OL3A 3H8NA 4Q9QH 4L1HA 3BPCA 2J6EH 4XBPA 1YMHA 3GHEH 3I3BA 1OHQA 2H32H 2XWTA 4JR9L 3JV4A 1AGEA 5F9WB 1NGPH 2OS7A 2AV7B 4NYLA 1LDPH 3QH3A 1MWAB 2J3SA 1ED3B 1GHFL 2MJWA 2DRUA 4FQJL 2QKIA 5BMFL 2VERN 4KQ3L 2A9ML 2AV7A 1JNHA 2XG5A 5L88L 5C0DB 1UWGL 4YDJB 5FYJH 4GRWE 1JV5A 4JRYD 4QY8A 5DC4B 4M7JH 2CDFB 3EO9H 4WFEE 4KUCF 3D85D 2YPLD 2XI9A 1OP5H 3V7AG 1L6XA 4YDJA 5E00A 4WHTA 3EZJB 3NCCB 2FGZA 1NUNB 5E7BA 3CZJA 1TCMA 4DGIH 4ONFH 4JAMB 3QCUH 2VZSA 1Q0YL 3GMMB 2R56H 3FTGB 4PRPE 4JAMA 5FM5M 4Y8DC 2LU7A 3LB6C 3GMMA 3L5HA 4M43H 2DI7A 5CZKA 1O7VA 1QO3A 4FZ8H 4YHPA 5D7IF 3NACH 1R24A 4JY4B 3MRHA 3MRJB 3ZDYE 3LKSB 4KV5E 1MLCA 1IQDB 5EO0B 4JY4A 2DN7A 4KVNH 4WFGD 1IQDA 2IFGA 5EO0A 4MQXC 3LQMA 5HHME 2OP4H 4EOWH 3MSPA 3UPAA 2XA8H 4MQ7B 5EC1A 3Q5TA 3TZVB 3MACL 3QBTB 4ODTL 4Y4HD 1MCWW 4W6WB 3DRTB 5GRVL 1LMKA 3TZVA 1FL6B 3ARFA 3MLSH 4TULL 2RGSA 1F4YH 1JWUB 4IIQC 5T5NF 1HSAB 5GS0C 3DRTA 1CVRA 4M8QA 5B22A 1FL6A 1M7IB 1VACB 1SQ2N 1E4XH 4LFHG 5I74C 2E7BA 4W4NA 3KPQA 3VGFA 5M94B 4DW2H 1KCVL 2VDLL 1MCJA 5DQ9A 3QJFA 4JN1L 4XCCL 5C6WH 4JQXA 5IW3A 3E0GA 1N0XH 3R06A 1AY1L 3QHZL 2OSLA 3ZE2E 1F11B 1VB9A 3MTRA 4JM2B 3E3QC 4U1GB 2FZ3A 4PP1D 2V5YA 2VRAA 4CVZA 4Y1AE 3HZYB 4M3KB 1BVLA 2P5WA 5D5ME 2ED9A 2VJXA 4MXVE 4L3CB 3DO3A 4O4YL 3K74B 1JUFA 4K3JH 5FGCB 4HK0A 4GRLC 1DZBA 3FFCD 5E8NB 2VC2H 5CSGA 3BWAB 4LHUB 1TQBC 4FABL 1Q9LB 3K2UH 4YX2L 1HKLL 2CSPA 3VE0B 1Q9KA 5E8NA 3U9PL 5F3HB 3HE7B 1AO7D 2V2WA 3UTQB 1B2WH 1YPZF 4WIQA 3FAWA 4C4KT 2XYCA 2FNBA 2VN7A 3DUSB 3HE7A 4GW5B 4QGTA 3UTQA 4FFWD 4PJ8C 1BBDH 3QQ4A 4M48L 1IC1A 1CE1H 4WTXA 2GK0A 1MRFH 3MODH 3T0VA 3AXLB 2H26A 3J7HA 1UB5B 2YEZA 4WU5B 4GXUN 2FBJH 4HBCH 1ZS8B 4XP5H 1E6OH 5B38A 5GRVK 5CGYC 5GS0D 1AGCA 2MHAB 1A1OA 3QNXB 3VI4E 2P5EB 1VADB 3FOMA 3RRQA 1FAIH 5F7UA 1YJDH 1ZS8A 3SCMA 3MV7D 4F15B 3UDWA 3JSSA 5IMLA 3QNXA 2P5EA 4KKNA 4LLDB 4NNXB 4F8TA 5TDNA 2XZZA 5H2BB 4HPYH 1DJSA 1NL0L 2N56A 4I0KA 3UJIL 2XZAL 4MNHB 3DGCR 1AQDB 3VG0H 5KS9F 5EC2B 3F7YB 5CCKL 4X4ME 4JZJA 5IOPA 4MNHA 3MA7B 1U91B 4KJYB 2VLME 1NBZB 4NHCL 3F7YA 3BGMB 4CMMA 3RU8H 4E42B 3MA7A 1A1NA 4Y5XC 4AMKL 1NBZA 4KDTA 3RX5A 4JKKA 2MQ3A 4R7NB 5FOBB 5FF6B 4KAQH 1RUAH 1UH2A 3X14B 3IDXH 3ARSA 4GRLD 5F3BB 4JKPL 4GS7B 1NBYB 1HZHH 3OHXA 5FOBA 1ZT7A 5BJTB 1NAKL 3SDCC 4QO1A 1UXWB 1MSPA 2VXUL 3SN6N 4AH2A 3WUWA 5BJTA 4G3YL 4MD4A 3RJQB 1BEYH 4KKCC 1NCAH 3EYUL 5MHSD 4FQ2H 1NCWH 3RGVD 3U9UB 4N0YH 5C0FB 4LSQH 1XZ0B 3ILQC 4BZ1L 3AUVA 4KY1L 2QTEA 1UXSB 4R8WL 5L8JB 1MCPH 4YE4L 2ESVD 1LP9B 2XN9A 1OSPL 1XZ0A 3BN9D 4I48B 1CFNB 5IESL 1UXSA 2VQ1A 3UAJC 1J9CT 3IDYC 1LP9A 2J8UF 4RAUB 4EBQH 1HCFX 3EJJX 2E27H 25C8L 1YEEH 1P69B 1KCLA 3K80A 4LHJB 3U0WH 2CMRH 4R7DA 1V3MA 5K33A 5D71H 3F58L 5GS2D 1CFSB 4X9IA 4NJAH 5L2KD 5FECA 3TCLB 1QLRB 1MVFA 2XQYG 3P4MB 5GS0L 1NGWA 5D7SL 3KPOA 4MJID 1A7PL 3VFVB 5DJZB 4RGOL 1PGRB 4NQCB 4HK3N 4Z76B 1T89A 1YC7A 3QFDA 4PY8J 5DJYA 1RIUH 2CKBL 3JV6A 4L1DA 3VFVA 2DWDA 5J56B 4LCWE 2IAND 4LF3B 3L3HB 4KVCL 2IBZX 2WBJD 3VXSA 4JPVL 4L8DB 3IFLH 1NMBH 3HC4L 5T3XE 4ZUWA 3WHE0 3MRBB 4NKMB 1GGCH 1DFBL 2HFGH 1PG7H 5TF0A 4X9HA 5I6XC 2E9BA 4O2FA 5ENWB 4M62H 3MRLA 4JREC 3SDCD 1JYWA 3BH8A 5ALCH 5IB2A 3TF7C 4PJ9B 2I25N 1X5YA 1IGYB 3MLXH 4CRPA 3FT2B 5GGTH 4RNRA 4XPFH 5GRXG 4JHAH 4KKCD 4Q6YA 4HD9A 1NLBL 3WFEH 5I8OH 1F3RB 1FV1A 2YUXA 1XIWC 2VSCA 4P5TA 4ODXB 1U9KA 3K4ZA 4M7ZC 3ELAT 1D9KC 4NBXB 4PRHD 3CX5J 3U6RB 1OQOA 1RULH 3ILQD 4ODXA 4N9GA 2A9NL 4L8CA 1NCBL 4NO2A 3CSYA 1TPXB 4BJLA 2LFGA 3LKRB 1G9MC 4WDIA 4WI4A 5ELIA 2X41A 5I8EB 1NFDE 2VO5A 2F19L 4GAYA 5D1ZB 3QJHB 4LP4A 1FYTD 3WDIA 2LAAA 3LKRA 4U6VH 2BSTA 3VFOA 5T3ZH 5D1ZA 4NC2B 1JYVA 1FNHA 2VLRB 4XVTH 2AABH 3QDJA 3C60C 2BC4A 3IVKB 1HHKA 3UYPA 4NM8H 2W65A 2PTUA 3LH2L 5LXGH 2F9BT 5AZEH 4TUKH 5IVOA 5JOPD 4ODVH 2NX5B 4P9MH 5FKAB 5CJBA 3IVKA 4LCUA 4GXVL 4CADA 4KUCD 3RY6A 5BW7C 5KOVC 1TMCB 2NX5A 2AK4B 1QSFA 2FHBA 4XPGH 4WW1B 5A40E 3MXWH 4XAWL 4RGMB 3UJJH 2R2BA 3PJSA 5EPMA 3UYRL 4GH7B 3WS3B 4DVBA 2VOTA 1R5VA 2MFNA 3SDAB 5GGQL 1KJ3L 3TA3B 2NY7H 1D5ZB 3DGGA 2EICA 1FGNH 1VEPA 1N0LA 3MO1A 4PJ7A 3CD4A 5DUBB 2NYYD 1I1YB 3TN0D 5GRJL 1XIWD 2DJUA 2JCCA 4P9HH 4UTAH 4G6FD 5EU6D 3SDXF 4OLZH 3BEVB 1NMAL 4J3UA 4K71C 2WAHA 5FIEA 4OCWH 3I2CL 5DWUL 4QCIA 1X4XA 3SJVB 3OGCA 2HP4A 3KPLB 4PJIF 3ARXA 3T0EB 1TZIB 2ZUWA 1OPGH 5BV7B 4U0RB 3P4OA 3RWIB 3CJJA 3ULVF 2EDOA 5CLWA 1TZIA 1D6VL 5GJSL 3AU1B 3UPCA 1N64L 2Q86B 1OD7A 5EOTA 1H3VA 4JO2L 4IRSB 2CRMA 3AREA 3WN5C 4Y2OA 3M8OL 2P49B 5CIPA 3QEUA 3QRGH 2ATKB 1A5FL 1U8IB 3D3VA 2QR0A 3TESA 2CLZB 1LO2H 3JWDH 1EFXB 4JFDD 3T0BA 1P53A 3BKMH 3MUHL 2FEEL 1EFXA 3G6JA 1TLKA 1G6RL 1MJ8H 4PJCB 5IB4B 4ZTPL 5CP3H 3VFNB 2AI0L 5FHAH 4P3CL 2ZJSL 1CT8B 4PJCA 4I0PB 4ZXBB 5IB4A 2ICCA 2NNAA 4QNPF 1UENA 5FGCE 3VFMB 1FG9C 1ROWA 1KIRA 5D2NA 1QOKA 5FV1L 1C16B 3N9GL 4HIIA 3BIKB 3TPUB 4CL7A 1WZ1H 2E7LA 1QSEB 1E4WL 3BOVA 5H35A 4P3DA 3BKYH 2ZCHH 2YD5A 1C16A 5E2TH 3BIKA 3DOSA 2PTVA 3D25A 4AG4H 1QSEA 4YFDB 3TH3T 1RUQH 1AKJB 5E56A 1EHXA 2YD6A 4G80A 4L9LA 4CMHC 1JRHI 2VYRE 1EUTA 1FGVL 4ENEC 1WBXB 2YC1B 2UUDH 4JFOB 5B8CC 4I9WD 5LWYH 4ZNCD 3I9GL 4GAJL 2ZOLB 5C6PB 2YC1A 3HKFA 4JFOA 1EHNA 2CK0H 1ZLWK 4LRIA 1BHGA 5FDYA 4X6BB 5DVLA 2P5EE 1ZT1A 3WIFB 3LIZL 4K3HA 3RGHA 1LDSA 1JYNA 4Y8AA 4JO3L 3FQRB 4YC2B 5T3ZE 3ARWA 5CBEB 5KG9B 1PKQB 2WBKA 1A2YB 4X6BA 1JZ7A 4XZUB 1QQDA 4Z9KB 5CKGA 1G9ML 5D9SA 4A2MA 1A9EA 5C86A 5CAYB 5GXBB 3R0MA 1A2YA 4XZUA 1H3PL 4AQOA 4FA8A 2BFVL 2X4UA 2FHCA 2DWEA 3EHBC 3T3PF 1J5OH 1NBQA 3UZEA 1CL7I 4XMPL 1QRND 4D3CH 3PGDA 1B3JA 3F7PC 3DROA 1U8QA 5FYKL 1CGSL 3QHFL 4L3AA 4AYFA 1C12B 2QQNL 3T0DA 4AEFA 5DJ0A 1TETL 3QPXL 4K8RH 4U1JA 4MAUH 3QQ3A 3WNPA 1WZKA 1RZGB 4N5UA 2DDQL 3HRZA 4BKLA 1TJGH 3HS0A 4JFZL 1Z2KA 4OFVA 3H7LA 3FN9A 3KS0J 3SBWA 5DMKB 2CLVB 1TITA 1DBAH 2BRRH 5C3TA 2AERT 3RI5F 3HZMB 5DT1H 3I84A 4M61B 4UAOB 5DMKA 2R1WA 4B53A 4UB0H 1FDLH 4LVOC 4G43B 4CU6A 4M61A 2WLZA 4Z77B 4OLWL 1S9XA 2ADFL 3DV4A 4UOW1 4PJ5A 4LLMA 1IEAB 1KCUL 4M3JA 1IC7H 3P0VH 2A6IA 2EDKA 4JGMA 3MFFB 1LP9E 3UTPD 1I9RL 4J3TA 2D2OA 2J1KA 4GRWF 4ZUSB 3EYSH 3B8SA 3S34L 1N3NB 1AHWB 2QHRL 1IKNA 4MS8C 5K93A 1OAKL 1INQB 2AXFA 3MGTA 5C1MB 1MFDH 1GYAA 1MHEB 2VLLB 4OCXH 2X1PA 2YD1A 3WFBH 4ZUSA 2DKSA 2BDNL 3GIVB 3G5ZB 4UZGA 4PJAE 5E5MB 2P24B 1AFVL 4KK8C 1D5MB 3CK0H 4Z0XB 1OQXA 4DN3L 2GFBA 1GZPB 2P24A 3GSOB 4LSRL 5FA3B 3ECBB 4CGTA 1G1YA 3EHBD 5IJVA 4NQCE 4Y5YC 4H1LG 4RBPH 1PSKH 1ACYH 1BFTA 4N0UB 1RV6X 3ZDYF 4KV5F 4QF1B 1OLLA 5EU3B 2G9HA 1CDIA 2XFXA 4QF1A 4U7SA 3F62A 3VWKB 4J6RH 4JANB 4ZFGL 4LIQH 1F02I 1MHCB 3TO4C 1OL0A 3LS5L 3KPSA 2X40A 3TBVA 1J87A 1U8HB 1CGYA 3OXSA 3TT1H 4K9EC 3NAAH 3ULUH 1U8KB 2GQHA 3BP6B 4H25B 5D6DA 1FPTL 4XNYH 1U8HA 1XT5A 5JHDB 3LVEA 3DUUB 3BP6A 4H25A 1T03H 1NGQH 2JLLA 5IQ9B 2XWJA 5B4MC 4EDWL 3O4LA 1ZXQA 1CFQA 4NN6C 3QIUA 5JDSB 4U1LB 3RY4A 4LEXL 3SGEH 4M00A 5C0AB 1ZWIA 3C2AL 3VD7A 4DN4L 5ADOH 1I85A 2AJYH 4E0RA 3KYMB 4RAVB 3VXNA 5C0IB 4KI5C 5JMOC 4MS8D 1BZQK 2HFFA 1S5IL 5MERB 4OBSA 4L3ED 1WWWX 4Q97A 1S5HA 3GSQB 5D5MF 3QEHA 4KK8D 2HKFH 2VLRE 3HI1A 5MERA 2X70B 4JFPA 4MXVF 5MEOB 3VW3H 1MJUH 4MXQC 1CF8L 4P48A 3QCTH 2MCG1 4RIRB 4XHJC 5IG7B 3U79A 4KPHL 1GIGL 1ZHBA 4KH2A 4ODSH 5MEOA 2NX5E 4ZS6D 2YPVH 3VD4A 3SE4A 1PY9A 1I1AB 1AD9B 4JG1H 5AYUH 3MYJB 2F15A 3QUXC 2AK4E 2AGJL 3HUJF 3GUTB 1I1AA 3ZKQD 4S1RL 1R3IH 1KLUB 4Q0XL 4AL8L 1QKZH 3DYPA 3O6LL 1XCQA 3ZTJG 1SJXA 5K9OB 3IDGA 3MXVL 1NCDH 1CLYH 3PL6A 1FL5A 3Q6GH 1E4XI 2OZ4A 4TTDD 1N6QL 3TO4D 4AENB 3HC0B 2BNUA 4GG6B 1IM9B 5MEND 1JI2A 4PREB 5LAXB 2IFFH 3ARDC 3DVIA 3FB8B 4AENA 5M95B 4YDIL 1JJUA 4UIKH 5IHLB 5LAXA 3W9EB 3VI4F 2VKWA 4Q58C 2VTFA 4M93B 4ZPVB 1BAFH 1R3HB 2A83B 1MJJB 3W9EA 4MNQB 1SBSH 2E6JA 4PJFA 4APQB 12E8H 4XH2B 5HGHB 1PEZA 4U4BA 1HDMA 4E41A 5DRXA 2LABA 4PBXA 1U8OB 3SJVE 3NCYS 3RKPA 2QSCL 2APBA 5K9KA 3S36H 3T0EE 5KSAC 1U92B 2WV3A 3B9AA 3NZ8B 2XPGA 1U8OA 2QSQA 2VITB 4NN5C 5GGSB 5HI3D 2ZG3A 5C6TH 5CFHA 4OF0A 5ADPH 4M1DH 5IIEB 3ULVD 2Y5TB 4X7SL 4G5ZH 4D9RD 1B0RB 5J8OA 4HUVA 3GMOB 4P2RB 1U92A 1MCDA 4ELKB 3I75B 4YGVB 5IR1A 2Y5TA 1BIIB 2R0ZL 4LDLB 1S9KC 3EOAB 3GMOA 4P2RA 4Y2DA 3P11L 2W0PA 5T1MB 5JUEH 4NIKB 5DJDB 4WU7B 4MXQD 4GLRH 3EKCA 3EOAA 5GRUH 3DXAB 3EJZD 4AZ8A 2VAAA 5I1EL 1V7NL 1BVZA 1MF2H 1AGBB 1B4JH 3KPRB 4D0DB 4JPIB 4OF8A 4ZFFB 5BOPA 3QUXD 4R2GB 1WFNA 5F7LB 5C0JB 4JPKL 4ZO8A 1LEGA 3NCJH 1BM3L 2NXYC 3BD3A 4PJCE 5DK2B 3G04B 3MLPA 1FFPA 2H1PH 2LTQC 4MNGA 1RFDH 4OCYH 4HCRH 1QFPA 2DQHH 4H0IA 4XXCC 3V6FB 1XGQB 1JGUL 4LRNL 4F2MA 2JELH 2ZPKL 5DK2A 3G04A 2BOBA 3X3GH 1GPOL 2UUDK 1F8TL 5TGBB 5J7CC 4ZUTA 2VXSH 5IW6A 4Z5RB 4N8VG 4PJEA 3EBAA 1FNSL 3GJEA 1VFBB 1QSEE 1FZMB 4YFEA 3ULUE 3O2VL 5JW3H 2HJFA 3IKCA 2EYRB 1VFBA 3MJ9H 4HJ0D 1BX2B 3V9FA 4WFFD 1A3RH 1EVUA 4XC3H 4M6AA 2WWMD 4QRTB 1FVEA 4G7YL 3O6FB 5BZDA 1BX2A 2LAGB 1CZ8H 2QADB 2Y25A 4G42A 4QXTB 1DBBL 2EO1A 4HPOL 1TVHA 3PIQA 5DJCB 3UO1H 5TE4L 1RQ5A 1YMMB 2NY3C 1P6FA 3PGFL 3HB3C 4XCYA 1Q0XH 3MOAL 5DC9B 1T1XA 3HE6D 3PNWA 3CPLB 5DJCA 4OAWB 1AIFB 3QFJD 4QRRD 4OI7A 4X7TA 5EZJA 2N7AA 4OFDA 1PKQE 1HHGB 4R0LB 2IQ9H 4N5ED 5B21A 3I3EA 4OAWA 1R0AL 5E6IC 4HLZG 1JFQL 2GJ6E 3ULVL 2R2CA 4LVNC 5FUOL 3PXJA 5HVFB 1EAPA 3G08B 5B3JF 1MHPH 3VFGH 1NJ9A 3ZHDA 5FCUH 4OCRH 4OTXL 4P23D 3HCVB 5IV2A 3BI9X 4JM4L 4XC1L 4UNVA 1G7JB 1S7XB 1MVUB 1KTLA 1QPPA 1CD9B 1AI1L 4HW6A 4G6JL 2DQJL 1OB1B 4DK3A 4FP8L 5I16B 3D39B 1BZ9B 1ZLSH 3FN0H 4PJXF 4JDZA 1HN1A 3VGEA 5ACZB 4OCNC 3CSPA 1OB1A 4OT1H 5FHBH 1JHLL 5CEZD 2Z8RA 4ODHL 4XPHL 5IMKB 1A7QH 3WD5L 3CMOL 3GMLA 2H8PA 4P46D 4ZOEA 4H8WH 1A7NH 2W9EH 4KUZH 1P4IL 4HMDA 3Q2CA 5T1KA 1F4WL 4LLYA 1OTUD 5HYIA 1UGNA 1SVZA 2FIKB 5E0QA 3GJFB 4H5SB 5DEFB 4Z78A 3OG4B 5CGMA 4XNMB 1I1CA 1A02N 4H5SA 1FSKC 1EBPA 3V5HA 3U2SB 1I8IB 4MA1C 3L9RA 2GJJA 5FB8B 2NY3D 1MAML 2DBLL 5GZNC 1QR4A 2YRLA 2X2YA 1I8IA 4NKIL 5D8JL 3UTZA 3RY5A 4WFED 4DUVA 5FB8A 5CD5D 1IC4L 4YZFE 3GBNH 1UCBL 3BGAA 4FG6C 4R4BA 4XP6H 1KN4H 4U1SB 3MR9A 1A7OH 4ZFZA 5JHLH 2F53A 4WO4C 3K1KC 1RZIB 5D72H 3KDMB 1RUMH 3ES6A 4FRWA 1CFVL 2YXFA 3HZKA 4BA8A 3QIBA 4PRPD 4I3RL 1RZIA 1EEUA 4U6TA 4NN7C 3C2SA 1K4DB 2AK1L 1IAKB 3GO1H 3NCMA 5I1IH 1UQSB 2HJKA 3UC0H 5LGKA 1WC7B 4N0UE 3U46B 3TYGL 2UWEB 4G8GA 1OW0A 1K4DA 3U0PA 5EZOL 1NLDL 2ZCLH 1G1CA 1MELA 5I73C 5IJKA 4UDUA 2GITB 4JFXB 4F7EB 4NO5B 1IL1A 2HRPL 4F9PA 3MRNB 3N50A 1ZLUH 4RDQG 1IGIH 3I3DA 5DZOA 5L2JB 2P1YA 1MREL 4JFXA 3VWJB 5JPNB 4F7EA 4NO5A 2R2EA 3L95A 4NQVA 3BT2H 3JTSB 3KXFA 1N26A 1U6AH 4NQSA 4YK4B 3IDNB 2V2XA 2FGWH 3TBWB 4ZAKA 5DLMH 2Z93A 2XY1A 4FN0A 1JPGB 2OJEA 1JGDB 3C5JB 1PVHA 1FIGL 1IKFH 4BZ2L 5CEZL 5EIIB 1LD9A 5IEHB 4PG2A 2X89A 5GGRY 5ALBL 1V7MH 5JHDE 4R90L 1QBBA 4OFYD 1PY4A 5C8JB 3SDDD 4PR5B 2H45A 2XWBA 1DL7H 5EBMB 3PV7A 1IFHH 2RFXA 5E6YA 4PR5A 2IQAA 4QTHB 3GBLA 4MLIA 1NCCH 4U1NB 2BNRB 5C0AE 5TF1L 3HNTH 5C0EB 2B5IB 4QTHA 4P2OA 5LVEA 2HJLA 3QIWD 2PYEB 4BELD 4U1NA 3B9KB 2X4RB 4HIEB 4F33A 4KFZC 4Z18A 4Y1AD 3O3AB 2UYLB 4HIEA 1YEJH 3X3FH 5KZCB 1J1PL 2APVA 1BVKB 1K2DB 3QULA 4RZCB 1OAQL 3U4BL 2FB4L 4LVHC 3RNKA 4HF5H 3L7FB 3PWVA 4RZCA 3TBYB 1U93B 3G6DH 1YEIH 1H5BC 4ZYKA 3C6LB 3CLEH 2K3TA 3GIZH 3GSNB 2WW8A 5T1DH 3EYFB 3MQIA 2EH8L 3L7FA 4WI9A 5CILL 5EN2B