4WHTA

Structure of the hepatitis c virus envelope glycoprotein e2 antigenic region 412-423 bound to the broadly neutralizing antibody 3/11, p1 crystal form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
207
Chain Sequence
b'VKLQESGGGLVQPGRSLKLSCAASGFTFSDSYLAWVRQAPTKGLEWVASITNSGGRFYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTRMDYWGQGTTVTVSSAETTAPSVYPLAPGTNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of the Fab fragment derived from neutralizing an
publication title Structural flexibility of a conserved antigenic region in hepatitis C virus glycoprotein e2 recognized by broadly neutralizing antibodies.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Viral protein
total genus 47
structure length 207
sequence length 211
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, X
ec nomenclature
pdb deposition date 2014-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4whtA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4whtA01
5DJXB 3TBTA 1S7RA 4D0DA 3D3VD 1M6OA 2EDKA 5DDHB 1UZ6F 1VA9A 3VXSB 2CJUL 3QNYB 5LAXA 5D7IA 1WISA 4OFDA 5I18H 3EYSL 1N5AA 1UFUA 1MCNA 3WUZA 5BMFL 4HIXL 2JCCB 3FONA 4R4FL 3BZ4A 2NX5D 1D6VH 1QEWB 2EDEA 2C4FT 1GCFA 1MI5D 3U4EB 1W72H 2IFFH 4G8IA 2JB6A 4CBPA 2VISB 1AR2A 3ZKXC 3DVNA 3DXAB 1HYSD 1VGKB 1FPTH 3BWAA 2PW1A 3VGFA 1JF1B 2E6QA 4LIQL 5B38A 1W72B 1CGWA 3TJEH 5JHDD 5TQ0L 5EU6E 4XNXH 2CO7B 4HDIB 1RK1A 3FT4A 3PGDB 3WFHA 1I3GH 2CLVB 3ULUH 2VL4A 1S7UA 3PGCB 2BOCA 1E4KC 1R3HA 5DLMH 1OSZB 1NJ9B 4PJBB 1ZWIB 1SJVA 5J57B 5L2KB 1OAYH 1SVCP 3B2UD 4X6DF 1P7KB 5HD8C 2AXGB 3CPLA 2ITDA 4AEIH 2ED8A 1LEKB 4HKZB 3MLXH 2FZ3B 4OSUH 5CIPH 4OB5L 2X89A 2W60A 4U1HA 3ZDYE 2C1PA 3RUGA 1GZPA 1PQZA 3CNKA 4ZFFA 3PL6C 1B88A 3JSSA 4O2CA 1F6AB 5I1EH 4I4WB 3PP3K 4PRHE 2DF3A 2HTKD 1N3NA 3I9GH 3O2DL 1FP5A 4JFYA 5FOBA 1LO3H 3NMEA 1LK3H 4MSWB 3RWGA 1FCGA 1X6LA 1FNGA 4P2OB 3MUHL 2EDDA 3DV4A 5I30L 5CGYD 4YDIL 4HGWB 2Y25A 2VAAB 5TJWK 1CU4L 5C08E 4PLNC 1JGEA 1UVQA 5GS0D 3FOMA 2FEEL 3TCLA 4WO4C 4QHNA 5FO7B 4GAGH 1N0LA 4ZXBC 5ACMA 5JO5B 5SV4A 3CSYB 5HY9A 3QCTH 3RTQB 3ALPA 2IH3A 4WIQA 3KPMB 5ICZB 3V0AC 3ARBA 1SVZA 4WTWA 3RZWA 5D7JD 1TQCC 1OB1B 2ICEB 1FZJA 4WUUE 4S10A 4BH8B 5DVKA 4PJCF 2P4AB 4X6CA 5F8RC 4NHCL 3W5MA 4XRCB 3UTSE 1SYVA 3WDHA 2VE6A 3BYTA 3BD3A 4HZLB 4HF5H 2D7PA 1ZHKA 3KYNB 4XPTH 2QR0A 4JVUA 4PJDB 4DGYH 1T1ZA 4YHPB 4IOIB 4CN1A 2GUOA 5FGBC 2F19L 2X4OA 2FGZA 4OUUA 2W91A 4JPVL 1D5IH 5FUZH 4YPJA 3ZO0A 5D4QA 3WNPA 1T7YA 2J88H 3TH3T 4MDJA 3VW3L 1BBJB 3EJJX 3LN5A 3UAJC 2IAMB 1OD7A 4AQ1B 1EFXB 4JREC 3RIFF 4WEBH 3ULSB 1H3WM 3P73B 1CLZL 5H37G 3BP5B 2YC1A 5C0AD 1AD0B 3GMRA 2VDQH 3NN8A 1G7QA 1U3HA 1B4JH 2WIIB 4LLMB 1KCRH 2VLKB 3JVGC 5GS0C 3QFJE 1DDHA 1SMOA 5C3LD 2PXYB 1I1CA 3B6SA 3TGXA 5C09D 3WD5L 2YUXA 4OCRL 3VGAC 3QUYB 4PG9A 5IEKA 1X44A 4L9DA 4E41D 4GS7C 2A6IB 3NFPA 3HRPA 4R6UA 4FQXC 5E6YA 1DQDH 4MNHB 3I3DA 5D7LA 3U0PB 4U1KB 4M1DH 3V7MA 4DVRH 5EIIA 5ANME 4XX1G 2WZPD 5I8EB 3WLBA 4LSPH 1BZQK 1C08A 3HLAB 3I6GA 3LEYL 4DKFL 5TE7L 4XNUL 5JW4R 4LEXH 2EYRA 4OFIA 3SDCA 2ZUTA 2MKLC 5IG7A 1GC1L 3TT1L 3ZHDA 4KKCD 2B4CC 3REVA 4XVSH 2P8PA 3VWJC 5D1XD 3V4PL 4NWTL 3BO8B 5ENWA 1NAML 2AJ3A 5AUMB 2FR4B 2XQBL 1DFBL 3WMSA 5F1IA 4PUBH 4GG6A 4NIKB 4OLUH 1P7QD 2DQUL 1KT2B 3ARDA 4JZJC 1A9BA 1B2WL 3G9AB 1PX3A 4JO4L 1MRFL 1HCVA 5BRZE 5E9DE 1RJCA 4KROB 4XP4L 1K2DA 1DCLA 1NLDH 1FNHA 3AB0C 4IEFB 4PJ9A 3LKOB 1XGRA 1MRCL 1QFWM 3QUMB 5SX4I 3NCFB 4ENED 1N5AB 2E7LA 4ODXB 1HHHA 5CZVH 2EDJA 4Q2ZA 5GGVH 1JNNL 1BAFH 4XWOC 5GS2H 1MVUB 3OB8A 4PJ8D 1CZ8H 5CHNA 4MB5A 5E8EB 5TF0A 1JJUA 1FAIL 3LV3B 4OUOA 2C4FU 1HQRB 3OBAA 3MOAH 1A6TA 3T0EC 2ZCHL 4C59B 3QJFB 5CP7B 2YZ1A 2JKXA 4Y4HC 5B38B 4UUJB 4KWUA 2QV2A 3FL7A 3ULVF 4R8WH 2VDML 3FRPA 4HSQA 1ED3A 2AV1A 2Q8BL 1FZKA 3SE9H 3X11A 3MNZB 3WFHB 4EKXA 1BWWA 4R7NA 4K8RC 1OTSD 1S7VA 3KPNA 3ZKND 1JWUB 1R3HB 3IFPB 5ABDE 1J05A 2CDGA 4PLKD 3C5ZA 1RZIB 4G9FA 4WFHD 4MXQD 5IVXF 5T1LB 3MMEA 5D1QA 1AGBB 1J5OL 5E5UB 4L8SC 2UUDH 1V3KA 3DTXA 1NKOA 5B4MC 1PG7W 4N8CL 3T4YA 2KUTA 3EO9L 4KKBD 3RUGB 1MJ8L 4QTIH 3T1FB 4KJQD 3V6BR 5C07D 3HC0B 5CSBA 2PKDA 1GSMA 3QDJA 4ZUSB 1AJ7H 4OF8A 3GJFB 1JRHI 4NM8H 3FT3B 1DLHB 3KLAB 1MNUH 1QOKA 4UQ3A 3JTSB 4HFWA 4DW2L 3IRZA 5E0QA 4JFYB 1HIMH 4DJMA 4GW1B 4OLWL 3BN9D 3OAYK 2EKSA 1FNGB 1DN0A 3BUTA 5EUOA 5DMGD 4YC2C 1CFBA 1JYVA 4DKDC 4YBQC 4RNRA 4LLQB 4PRNA 1JGEB 2P49B 5JORA 2ZUVA 5KSVB 5EOTA 3TCLB 3VXTA 2GJ6D 4OCWH 3SE4C 2XKUA 5GGQH 4IRZH 1U8PB 2DLFH 2WAHA 3ARBB 5T3XH 3BZEB 1I8IB 2XZCH 3VXUD 3UBXB 2NYYC 3BJ91 1XF5A 2GITA 4BSWB 1RIHL 4OLYH 2NNAA 1SYVB 4I13B 2VE6B 5D7SL 3DX9A 3WFDL 4P5TC 2BNQD 3D85D 3GMLA 1C7TA 1Y6MR 4EIZC 2WNGA 4XHQA 3MRDA 1ZLVK 2QR0B 1YNTA 1EDQA 3PWNA 4GBXA 3ZTJG 1DQMH 4HIJA 1FHGA 3VGBA 2I9LB 3FO9B 4U6TA 5EU6A 3G6JE 3ZYZA 1HH6B 2R2EA 1T89C 5F9WC 1PZ5A 5GGRA 4MDJB 3IJHA 3VRJA 5BV7B 4Y16D 5I1IL 4LFHG 4NJAH 3QAZB 4KTEL 1OAUH 4AM0B 1N5YL 1T2QH 3SBWC 1JYXA 3IVKB 4NQDE 3C6SA 2AJZA 2ORBH 2C3WA 4H1LG 1U3HB 2VZ1A 4ZFOB 4G8FA 4WJ5B 1SY6L 4NGHL 4YXHL 3M8OH 4JFEE 5DURB 2AJSH 5L2JA 3U36A 2X4SB 4J7RA 2R9HD 1VEOA 1FPTL 3EYUH 5LBSL 4PB9H 1IC5L 4JFDD 4X9FA 1MHEA 1HKFA 3L3HB 3NIGF 5JZ7D 4EOWL 1XCQA 4YHZL 3WHE0 2R2BA 5FDYA 2YEZB 4PP1C 2AGJH 4LSSH 1KNOB 4PRHA 3R06B 2P5EE 2NXYB 2QSCH 5D96C 3RGVD 3GGWB 1OAYL 2AJVH 5D8JL 3HZYA 2N56A 4NUJA 3NCEB 1BBDH 5CJOH 3PWPB 4AEIL 3I6GB 5CKAA 3W0WE 4EI5B 2NTSP 3I50H 3B8SA 3V5DB 5J9PA 5C08A 1I7TA 1NFIA 4XT1C 1U3JA 4DN3H 3D0VB 4KQ4H 5E8OB 4IMKA 1CK0H 3X14A 4Z7VE 2XWBA 3REVB 4AIOA 3M17A 4N8VG 5J1SC 4AK1A 1RZFL 1YUHA 5FCSH 2OTWA 5INDB 4ZPTA 2CLRA 1CICC 4M8VA 4WUUA 5GZNC 3NFSH 4UBDC 1J1PH 3ARDB 2H6PB 3DVIA 3F7PC 1FGVL 3UTSA 4XWGL 1WIPA 2O61A 1J12A 1S7TB 2KH2B 3NFNA 3QUXD 4HKJA 1K2DB 5ID1B 4JQXA 4U1NA 1IGTB 4QRSA 3LIZL 5DJ0A 2YPLD 3VE0B 1SM3H 3MRHB 5T5NF 4YHNA 3S88L 1F4AA 3BH8A 1I8KA 2Z9TA 2OJEA 3H0TA 4HHAA 4KRPD 4Q2ZB 4D8PA 3ARUA 1BQUA 5FV1L 4P2QB 2XYCA 4Q7DA 3SDAA 5EOQH 1JHTB 5C0CE 3CLEH 4KK9D 4ODUA 1QZ1A 2DN7A 3PIQB 5JPMB 1SQ2N 1XF3A 2X4PA 2ZNXA 2RB8A 3EOTH 5B22A 4OGZA 2YD1A 3MV9E 5JW4M 3QFJA 3GIVB 2O5XL 5IBUB 3ARFA 3SCMA 4EDXA 4Y5VB 3V5HA 1T83A 3MCKB 1N4XH 2HAZA 3FCTA 1Q72L 1D5IL 2CDGB 4MD4B 5HHPA 5FKAA 1LK2B 1KPUA 2XA3A 4XGZB 5JMOC 3AY4A 2ATPB 3BE1H 1F11A 3MREB 3K8MA 2Z0BA 2QL1A 2A6DA 1ZSDA 4P23C 5ANMA 2EZ0C 1FG2B 1WZMA 3ZMRA 3ARWA 1NMAH 1R3KB 3QNXA 2FECI 2D2OA 3T4YB 4QRPD 1FV1B 3HPLA 4S11A 1F4XL 1KCRL 4PJIB 2YA2A 3D3VE 2YN3A 3VWKC 2NY4D 4UU9A 4O2FA 3I6LE 4PD4J 4CW1B 4PLJC 4JFQA 4PGDB 4EVNB 2FO4B 2HFGH 3S5LG 2F5AL 3MGTB 2WWMC 1EMTH 1S7QA 3NTCL 4MD0B 4XXCA 2YPVH 5I15H 3LKPA 2OZ4L 1EPFA 1IAOB 2EKSB 4NQVA 2XNAA 4DVRL 1MI5E 5HVWA 3T2QA 3K7UA 5T3ZL 3MC0A 5MI0B 2OX5A 2PYED 2BXYA 3X13A 4TSAH 3TBSA 4PRNB 1JZ8A 3PHQA 4C57C 3OKDA 5BRZA 5E9DA 4ODTH 5KAQF 5GJTH 4P2OC 2ICWA 1UM4L 3H7BB 4U7KA 1CFVH 2UY6A 3OJDA 4QRQB 3PWVB 3TZVD 3VDBA 4ELKB 3O8XC 4WHYH 4CU8A 1RUAL 3KLDA 1C5DB 4Z5RA 3TO2A 1GYAA 3TO4B 5C7XL 4PYHA 1XF5B 2YD2A 4NRYA 4Y2DB 5F9JA 4Z8FL 4FXGA 3U1SL 1NBQA 2AQ2A 5M94B 4F7MA 3OGOE 3MJ7B 5E1AB 2GSGA 1DL7L 5J0BA 2AEPL 2PO6D 3AXLA 2CMRL 3B9AA 3QIUD 4U0RB 4HWEH 3CXHK 4GBXB 5MEOA 1D5MA 2CH8A 3CJJA 1RSFA 5DEGA 5AEAA 3JWOL 4UQ2A 3ROLA 3OKOA 5GZOC 4LPWA 2R2EB 3L3JB 2VLLB 1FNEA 4XAWL 1PZ5B 1IEBB 4BA8A 1HDMB 4YBHA 4OLXH 5E6IC 3MO1B 4M02A 3FFDB 3L7FA 4XP1H 1K85A 2YD8A 5CZVL 3T4AB 1RFDL 3MV01 4F7CA 3SO3C 5TDOA 1BAFL 5JXED 4K3DH 4O4YL 1QLRA 3O4LB 1XIWB 1GIGH 3KPOB 4JM2B 3MA9H 4LVHC 3EJZC 1CI5A 1OARH 1QVOB 3T0BA 3ARGD 4PJFB 4NZUH 2FBOJ 3MOAL 1KJMA 3UX9B 4Y1AB 4YDJA 4GRWE 5I66B 1YJDH 1EGJA 3CUPA 2VSCA 3K2MC 4BQCA 3N85H 1LP9B 4W4OC 3TZVC 3SKNA 5GRYA 1MUJA 2R2BB 3MLVL 1YZZA 3RWCB 3SE9L 1J1OL 3N1PC 3PWUA 4LLUA 5KSBF 4TVSa 2HFEA 4PJEF 5A2LH 4LPYA 2CKNA 3OKEB 4MA8H 1EAJA 4L3ED 3L3IB 2XKNB 1DLFL 4K07A 1E6JL 2GAZA 1V5JA 1RZKC 1TVDA 2R0LL 4KAQL 4K23L 4XPFL 1T6VN 3UJIL 3FMGH 1T04B 3TJHD 1FGNL 2ED9A 5J9PB 2Z31D 1I7TB 4MB4A 1GHFL 2Q6WA 1YPZB 4NBYB 3ARYA 3DSFH 2ZCKH 3RZCA 1ZTXH 3QFDB 5F70A 2ZPKH 4M7ZC 5DJCA 1VFUA 1YYLH 2W38A 3GHBH 1F6FB 1ADQL 1QPXA 3SY0B 1PY4A 1NGPL 2XKSA 5KN5A 1CS6A 1MNUL 1VCAA 2CLRB 3V95A 4WUUB 2VL5A 1HIML 4XI5C 2HWZH 5C0AE 5GRZA 4XVUD 1IM3A 4QTHB 2BK8A 5ESQA 4X0KB 1U2HA 2X4QB 5DJ6B 1A7NH 5JA9A 3CIQA 2BVOA 4PV8A 4NO0B 2H3NA 4QXTB 3SOBL 5I1KH 3P0VH 3ARVA 4QRSB 2B0SL 2DYPD 1QBAA 4PPTA 3G6JA 3GUTB 2NMSA 2P7TA 5C8JB 4UMGA 1ZLSL 1V05A 1S9XA 3TNNA 1S5IH 2L7UA 1BQHA 4D8PB 2CK0H 1A6WH 5D93C 5CEYA 4YDLB 1KB5L 3BHBA 1REIA 3IXAA 3O6MH 3MBEB 1U8LA 5I8KH 5HI3D 4L4TD 4M9OA 4NQDA 4NP4L 3QO0A 4OZHF 1NCAL 3MJGX 1HOCA 4JFEA 4Y4KA 2D31B 1JNHB 1LE5B 1P6AB 4HC1L 2F53B 2XZAL 4EDXB 1DVFA 4M6OH 1NBZB 2NXZD 3BZFB 4LKCA 2SEBB 5HHPB 5L9DH 2BJMH 3WO4B 3RWFA 4P46D 4K7PH 2P5EA 1G9MH 2XFXB 2EYSA 3BX7C 4U1SA 4NJAL 1VKXB 4X4YA 4PRPB 1WTGT 4KZDH 5DD5L 2E9WA 4EN3C 4MA1C 2R23A 4PTTB 1I1AA 3V0VA 5EO1A 2QKIB 3PP4H 3IGAB 3IDYB 4X6DB 4LDOB 1XGTA 3CFIC 3DRTA 5F6IC 2B2XH 4GUPA 3M8OL 2AJSL 2IAND 1T22A 3MV7D 2RBLA 4PB9L 3C2AH 4NZTH 1BVZA 3OKNB 2Q76B 3CFDB 2LABA 2PTUA 1HHKB 3QDMA 1MFAH 3GMPB 4NQED 1JNLL 3MLPA 1GVIA 1EV2E 1JMXA 3DUSA 4X7TA 1JV5B 2IFGA 3LKPB 2V5YA 2JK5B 4HLJA 1T80A 4PJEE 4D9QD 4YHIA 4L8CA 1MFCL 3HE6C 4L8DB 4HUVA 5CJOL 4JFHD 4C4KT 3S4SB 5IVNA 5JHLL 2GFBA 4NN6B 3OKDB 1RZJH 2X70A 3BQUD 4PG2A 4FQIL 3BP4B 1MQKH 5KANG 2EKJA 1AR1D 1ZAGA 3OJDB 1KIPB 5ACZB 5I19H 1UB5B 2GHWB 4RRPA 4NFBA 4NZDA 3DYMA 1ZHLA 3TCXA 1FFNB 5HHXL 3TO2B 2OXGA 4Z5RB 2OI9B 2DQHL 1OP3H 2H8PB 2EEDA 2JIXA 3ARQA 5EU7E 3EJYD 4WFHE 5HI4C 1WCBA 5DJ8A 4F9LA 5F9OH 1CE1H 1MFBL 4TVPL 1FNLA 1AXTH 1GGBH 4D3CL 1J1PL 3WS6A 5C0CA 1Y0LA 5JOFA 8FABA 4PJCB 2AEQL 2EXYC 3NIDE 1M7DA 1Z5LA 5DEGB 4UTAL 1NAMB 3B9EA 3MV9A 2DTMH 4AENB 5FB8A 1B0RB 4Q6YA 2Q1EA 5TQ2L 1S7WA 1CWVA 4P5MA 1CD1B 5ALBH 4K9EH 3F7RA 5FGSA 5D1ZC 5TE6H 5IHBA 2B5IB 1SJEB 4P2YA 3EDDA 5TDOB 3VRIA 2NZIA 4XZUB 1NCBL 3RHWK 1TJGH 1X5ZA 1L6ZA 1KJVA 3QHZL 4FTVB 2W9LA 1WT5A 2I07A 1EGJH 1WC7B 2PYFA 1JZ6A 4EXKA 1JZ7A 5EA0H 3E2HB 3RGHA 4D9RD 5DQDL 5DYOA 5C2UB 1L9NA 3CUPB 1DE4B 1DP0A 6CGTA 3D3VA 1I1FB 3F58H 3FQTB 5AWNL 2GJ6E 1CD0A 4OZHE 1MUJB 1KXVC 3T3PF 4UIMA 4FA8A 3UZEA 3VXNB 4PJXE 5T1KA 2P8LA 4X6EB 5DJAB 4LVEA 1L7IL 4LSRH 2Y4SA 3EJYC 3VXUE 3EOYG 4EEEA 2DQJL 1ZT4B 2GTWB 4PFEA 1NANH 4GQ9L 5L6YL 2NY0C 1RJLB 2GAZB 3K4AA 1PAMA 3OAUH 1T4KA 5IQ7H 4JKLA 4OM1H 2M8XA 1SBSH 5FYJL 3T0AA 5F89B 1K3IA 1A1NA 4P5KA 1WFUA 5BJTB 2Q6WB 4MAYC 1OGAD 4U31A 3S3PA 3WXVH 2QSTA 1HQ4B 4G8EA 3PV6A 1T03H 4N9GB 4EI5C 4AEHH 5DJCB 2Q8AL 2DM4A 4PREA 4WTXA 1T20B 3LS4H 5HYEA 1FFQA 3QG6B 4ZNEE 3EZ8A 4TN9A 1C5CH 4F57H 2BNUB 4OIBA 1DR9A 2VXTH 3GSQA 5IFAH 2W1NA 5H94A 4DTGL 1SEBA 1IM3B 5B39A 4Z7WF 2G60H 3U30B 4JN2B 3OR7A 2PTVA 4FQ1L 4JRXE 1UWXK 2XACC 2VJXA 4PRBB 3MR9A 4MYWB 4QGTA 2VDRL 1I4FA 4MD5B 4MJIB 2AEIT 4ODTL 1CGYA 3HG1D 3ZSTA 4OD2A 1I9IL 3GJEA 3PDDA 1A0QH 1FVCB 3PG2A 1Q9WA 3BMVA 4RWHA 3TNNB 3U9PL 2Z91A 1A14L 1KLUA 1BQHB 2YWYA 3QIWB 4CUCA 4U0QB 4OKVA 5IBTH 3BHBB 3EFDL 1CFQA 1T1XA 2F58H 1AD9A 3D39B 4I3SH 4UNUA 1BVLA 3GZKA 3MUJA 3OPZL 4M5YH 3GSOA 3INUL 3IDJB 1Z0NA 5AAWA 1FZMA 5IVZB 1CVRA 1F90L 5DVMA 2VXQH 1QFWH 3GMOA 2ZKHH 2ZCLL 4LKCB 5JW4N 3PWJA 3L3GA 5DI8B 1J0ZA 4UB0H 3FO0L 1YNKL 1LO5B 2ESVB 2UZIL 4GSDL 1T0NB 4L8BA 5D7JA 5F7EH 1EERB 2BDNL 4LCUA 4ODBD 4Y5VC 4ZODA 2MSPA 5DQJA 1RJYA 3T2NH 4DKAA 4XBEH 5DUBB 4JFXA 4QCIB 3SKJL 2DL9A 3VGEA 1GIGL 5DMIH 2FLRT 3UTPE 4BSJA 5IVXB 1OARL 2YD5A 5JNYA 1PKQE 4O02L 1WWAX 1UWEL 2XTJE 3SGKC 5GGSY 3DGGA 1R5WB 4P3CL 5GS1C 4HJJH 4PJGF 5L8JB 1FVDA 5HHNB 1CXLA 1AGEA 4MCYB 3H42L 3QDMB 5CBEB 2NY5L 4F33A 1EAPA 3T3PE 1J0YA 3K4ZA 4MA8L 2HT3C 1N8ZB 5IQ9A 1KYOJ 4JB9H 4JKWA 1Y6KR 3HMXL 1FDLL 4TOYL 5C0AA 3KPSD 4L8CB 3CFJA 4H25B 2Y6SC 5IIEA 2D03L 2IALA 4JZOB 1R5VA 3SHSA 3MNVB 3EOAA 2VITA 5LGKA 3MZGB 3UYPA 1SBBA 2ZCKL 4IRJA 1ZS8B 3EGSA 1S8DB 3SDYH 4YGVB 2CK2A 1YYLL 4P49A 3S35H 1NAKH 4NQXA 1BOYA 5I74B 1FYTA 2E27L 2DWDA 3DIFA 5HGAB 5F8QC 3BN3B 5D5MF 4RX4A 3V0WL 4YDVA 3SKOA 1H5BB 2HJLA 1QSZA 4IDJH 4NQSA 4NO5A 2VO5A 3W2DH 3QR2A 3I85A 1AHWA 1NCDH 1YEDB 3QPXL 4DQOL 3WN5C 4LAJH 2Z92B 4UNTA 1K8DA 1B6UA 1OTUD 4I1NB 3SDXF 4GRLA 4P5MB 3O3UN 5CJ8A 4R4BA 1PX4A 1ZEAL 4ZTOL 5D1XA 1IC7H 1TVBB 4BQBA 1TTUA 3OZ9H 3GIZH 2CK0L 1INQA 2CXGA 4LLWA 5C70A 2YSSA 1A4JB 3VXMB 1YEHH 4FS0A 4M8QB 2X40A 4HXBL 5DRXB 1MJ7H 4KKNA 1A6AA 2PYEE 4QOKD 5HHOE 2ZUQB 3DMMD 2Y5TA 5DC4B 5DYOB 3DO3A 2F74B 1CYGA 1G0XA 3MROB 2IMMA 1CL7L 4I77L 4HX1B 1FVEA 3FAXA 4RMQA 3EBAA 3Q6FA 1OAXH 3H9SB 3BXNA 5J06A 3H3KA 4YZFF 4FZEH 5K9OA 4KZEL 2BJML 2FX9H 2VR5A 5EZIH 2AV7A 3RKDD 4PGBA 1G9ML 1PDKA 9CGTA 4GQPH 5JPNB 2V5SA 4PJ8A 5IFHH 1GL4B 4YR6B 4PJEA 5JOEA 3FO2A 3QQ4B 1YMMA 4OJFL 1A1NB 2GIYA 3KJ6H 3SDDB 4ODVH 4HLZG 3PP4L 3E8UH 1BECA 4OZIB 2OJZL 3TFKD 2B2XL 4XCYA 3UJJH 3VXRD 3RVTD 1YEJH 2N1KA 1A3LL 4CAGA 4LARL 4HWZA 1QLEL 1W0VB 1NH6A 1BEYH 1NUGA 3GMMB 4ZYKB 1RUKL 4PREB 2WBJA 4YGAB 4FXKA 1NGXA 3WS3A 5FM5O 4PY7B 1IQDB 5HHMB 1CE6B 4ZO9A 3MFFA 5J3HD 1I9JH 1I7ZB 3BKML 4NQUA 5CUSL 3K4DA 4J4PD 4XMKH 4HG4J 5EG6C 5FHBH 3KYKL 4H88L 3MA7A 5EU4A 2GY7B 5TDNB 3K46A 5IHZB 1HYRC 1P2CA 2D4FA 5HYSG 3OR7B 1UQSB 5KTEL 1KSRA 4FQHB 1P4LA 2WV3A 5C0JB 4Z7QE 1TTFA 1BFOB 5B3NA 3V7AG 3FTGA 4U1LB 3HE7C 1OM3L 1P5VA 5EC2A 5IMMA 5D2LF 3KLSA 1TCRB 2DLTA 5FV2A 4OKVB 3O81A 1KG0A 4NPYA 1QFOA 2IEPA 5TDPA 4MS8D 3K2UH 4M62H 4L3EE 4X6BA 4Z0XA 1EBPA 3FO1A 2YWZA 5A16A 1AD9B 5HDBE 1UKTA 5C0DA 1AXTL 5TFSH 4Y2OA 4GRWH 5TE4H 1HXYB 1I8LC 4CVXB 2JE8A 1Q0XL 4HS8H 3T65A 5D5ME 3FQRB 3JXAA 4YEEA 3DX7B 1FO0A 3PGFH 1FZMB 5F97E 1W0WB 2E7HA 4POZC 4C56D 5HGBB 1KENH 3HPJB 2FGWL 3N1FC 4QLRA 3GMOB 1FL3B 4F9PA 5SWZD 4OZHA 4LCCB 4YK4B 1MFDL 1NC4D 4FFYL 5DRWB 3RP1A 3IDIB 1FJ1A 4PJXA 5ALBL 3CDGB 1V8HA 4LCUB 5TE6L 5FECA 2E6JA 1RJYB 3VXUA 5K59F 4HGKC 4O2EA 2G2RB 4L4VD 2DQEL 4UIKH 4JEGB 3JV4A 2V9QA 1U8MA 3HZMA 4KKAC 4L9LC 4OD3H 2BY0A 4KVCH 3VMPA 2C1OA 2BMKB 3R8BB 5E08H 1NUNB 2DMKA 2IMNA 4KI5F 1M7IA 5C0GA 4LASL 3FQWB 1BX2A 3DSNA 4TUKL 4TYUA 3VFGH 2ZUXA 3B3IA 5SX4H 4HPOH 3D2UB 4F33B 5J12B 1YEGL 4EXPX 3T77A 1U36A 4ZNEA 1MIEH 3RI5K 3W9EB 3NH7L 4I0PD 5KS9E 3B5GA 3G5VB 3IFNL 4LLDB 3C08L 3EAKA 4L4TE 4J3VA 5IQ7L 3RWHA 3RVWC 1F00I 4JDZA 5IIEB 3KPRD 5DQ9B 4JRXA 1BQLH 1D9KB 2O93L 3MZTA 2PTTB 3WXVL 5IVOA 2OTPA 4N5EC 4KU1A 4W6WB 3LQZA 4IRJB 5K9QG 4OLVH 5HGDA 4HMCA 3L9RB 1JPFB 3WFEH 4ZAKD 3MRPB 3DRQB 2A6KB 2EDRA 1MLCA 4ORGB 1B6DA 1FYTB 1EEQA 2BNRB 4KHTH 4MXWH 3MLZH 3DIFB 4H0IA 1C5CL 3RA7H 3G08B 3RGVA 2HJLB 5I8CA 4F58H 5JLZB 1EXUA 2XN9E 5J11B 2G60L 2YD7A 1N7ML 1Q9OA 4DOHB 3TP4A 2IANE 3VD5A 5GGSA 3MV7E 3D87B 4LHUB 1K8DB 2VZSA 2FATL 3NGBB 5D2NC 5AD0A 1HKLL 1JRHH 3WFCL 4R4BB 4XNMA 4NQEE 4NO2B 2NW3B 3P3YA 1C16A 4G8GD 4M93B 1SJHA 3VH8B 4CVZA 2BSRB 5C0ND 4TQEH 3S3JA 4AIZA 2PW2B 2OM5A 4O5LH 1NSNH 4X80L 1JWSB 4D9QE 3ARED 3QEQE 5D7KD 2KQMA 3VXPA 1CQYA 4LLVB 3STBA 2B5IC 5C2BH 4JFHE 4UT6H 4U3CA 4U4BA 4YNYB 2Y5TB 4KKLC 1PKQA 2CDFA 1VFAB 4U1IA 5F9DC 3ALXA 4P57A 1X4XA 1KB5B 1XGPA 2YN5A 4IMLA 1AE6L 2CRMA 1NBVL 4FZ8L 3ZKSD 4ERSH 2VXQL 1QFWL 4RGOL 1ZLWK 2GJZB 3PQYD 1AXSA 3F62A 5IKCA 1IAIM 4R96A 2DTSA 1B0GB 4B53A 5FGCB 4J1UB 3LS5L 3MNWA 1C1EH 2AJUH 4JR9H 4LK4A 3VD9A 3T2NL 1QSFD 4XBEL 5KSBB 5B8CA 2IGFH 1YMMB 4J23A 3B5HA 4JPKL 5K59E 1JGLH 3BGFC 3V2AR 2FDBP 3VFWA 3HI1A 3GBMH 3I6KA 1W2KT 3B83A 1JIBA 3QCUH 5EZJB 3TA3B 1QBML 5J7CC 2VSDA 3L3OB 1RJZA 2F54B 2MKWA 4FXKB 1YDPA 2Q7YB 2QEJA 5KSAD 1AGCA 3OGCB 1MSPA 3CX5K 3TPUB 1TZGH 4NCC1 4Z0BH 5FKPB 2E9BA 4X99A 4YX2L 1INDH 1UA6H 4L1HA 3VFPB 4D2NA 4LVNB 2HT2C 4ALAL 3RVUC 3O3AA 3V4VH 4OF3A 2LV4A 1JK8A 2W65B 4JZNB 3VXSD 4D9RE 3TYGH 1FBIL 1FFPB 3LRSA 4I18C 3LN9A 4Z7WA 2UUDK 3O0RH 1MPAH 1G0YR 3KGRA 1JCKA 2HLFD 1KULA 3WSQL 1FORH 3HNSL 3C8DA 4L3CB 4LBEB 5IMOA 4YAQA 4X6BB 4HUXA 5I75C 2V5TA 5A16B 4Y8AA 5AYUH 1Q9LA 4CN4A 5F7UA 3DXAD 5KOMC 1QRNE 2YD6A 1FO0H 3QIWC 5DHXB 1CFSA 2OYPA 5E03A 5HHOA 2VN4A 3GO1L 1OGAE 3L3DB 1WFOA 2FEDD 2EC8A 5MEPA 1RMFL 3VXOB 1NC2B 5IP4A 2D7NA 2VMFA 3ULUD 4R0LC 4JCLA 5T5FL 1ZANL 1XFPA 1TENA 5FECB 2A0LC 3QIBB 4U6VH 3QI9A 5CJXC 5HVHB 4FFZH 5DJDB 2E8ZA 3GBNH 3MLUL 1MIML 1FIGH 4L1DA 2QSQA 5C0FB 2R29L 3S7GA 2PR4H 1U8MB 5H2BB 2OBGA 3CH1B 2PO6A 3O9WB 3FB5A 1K4DB 3QIUA 2P48B 5E4EB 1HSBA 5IW1B 4YWGH 4DCQA 3HG1E 5CZXD 4YFLI 2DJ4A 1DJSA 1MFEL 4LU5L 1UACL 3B3IB 4MX7B 2X4RB 4BSVB 3ZE2E 2I5YL 1MF2H 1NFDE 8CGTA 1UXSB 2OP4L 4RSVA 4NUGL 4PJGA 4L5FL 5JQ6H 3MXWL 3X3GH 2C4XA 5JXEA 2NQCA 1E27B 2A9NL 5IFHL 3RWHB 1WF5A 4JDZB 4MNGE 1OSPL 3O6FC 1TDQA 3MJ8A 4PRAB 3RTQD 4GW4B 4ODVL 2G75A 2MJWA 2C3XA 5SWSB 1IQWL 3PDOA 3LH2L 4MVBC 3LSOB 5I17B 2R0ZL 2NY3B 1YEJL 4RFOH 1WJ3A 5IF0B 5HGDB 1CBVH 4WNQB 1PLGL 1NGZA 5GRXG 1MVFA 1U8KA 2H41A 2HH0H 1SYSA 4HIHA 4NKDA 1IGYA 5CZKA 1BWMA 3F7VB 2VDKL 3ILPB 1IM9D 3MRFA 3LPWA 4L3EA 1PZUB 3ZE0F 1F3DJ 4JFPA 1A7OH 4Y5XB 1EXUB 2EE3A 3O3DA 4CMHC 3LKQB 1YC7A 3HNVL 2AXHA 3UDWC 1A2YB 4LSUH 4DN4L 1UM6L 5D5MA 2Z31A 4CKVX 1T1YA 4RGNB 1JHKH 4Y4FD 4WU5A 1HNFA 2BVQA 1ETZA 3EZJB 1MCDA 4XNMB 2CRIA 5CSZA 3QUZC 2IAMD 3O2VH 1EFXD 1WFNA 1EEYB 4HXAL 4OFYD 4MMZC 1EHLL 4JANA 2LAAA 3KPPB 3MRKA 2HKFL 1G9NH 2R1XA 4RAVA 1I75A 1TZIB 3RY6A 2VLKD 3VXPB 2N7AA 5CD3B 4UOW0 3KPSE 3V52L 1H0DB 1J1XH 2YPKA 3D9AH 5GS0L 3C5JA 3NACL 2EH7H 1QSEB 4R97C 1HK6A 4ZO6A 2CDFB 4M7LL 2Z4QA 3AC0A 5HHVL 1KGCD 3QUYD 3S36L 4P57B 1S9VA 2ITCB 4IRSD 3W39A 2FHFA 1XGQB 2DYPA 2ADJA 5IR1B 3MX0A 5EPMB 2V2WA 2A83B 3BKCL 5IKCB 3MYJA 3DURA 2JJSC 4CVUA 1RUQH 2R8SH 1MCPL 4E0RB 3Q1SH 2LQRA 3QA3A 1ONQA 4HWBA 2AI0H 3MNWB 1U3ZA 1G7MB 1X5XA 4OF7A 5B8CB 4JY6B 1R3IH 1NMCC 5IROA 2ZSVA 2EDLA 3R0MA 3HI1B 2BVPA 3TLRA 2HKHH 1I8MB 1J0IA 4KVCL 5TF1L 3IFOA 5BVPH 4PRDA 2X2YA 4I3RH 3B9KB 4NOFA 1TJIL 4G7YH 1MJUH 5J13B 3AU1B 4ZUVB 1RJZB 2NLJA 2DI8A 5EFIB 1RY7B 1KN2H 5FF6B 4D0BB 3QEUA 4K2UH 3LD8B 3BVNA 4ISVA 3MLRH 1NDMB 2C7UA 2GCYA 4P46A 3BGMA 5GRJH 2FJFA 3WIIH 3ZHKA 1QYGH 4UINH 5CEZD 1FL6B 4KROD 1YY9D 4OM0H 3ABZA 2XN9A 4HMDA 1BLNA 1E4WH 4QRUB 1S78C 1ZVSB 4I48B 3SO5A 4Z7WB 2VXVL 5EO0B 2HG5B 3EOBB 2IANA 1RULH 2P8MA 3SPVA 1IGCL 5SWQB 1A6VL 4FABL 1T5XB 2HRPL 2ATKB 1VACA 3TVMC 5EORL 2MCPH 4NC2B 4H20H 3U6RB 2W9DL 4NQEA 2NY6B 3N50A 2FYYA 4R4ND 4BFBD 4JKPL 1J11A 5CEXA 3DO7A 4R3SA 3IS1X 5F7DA 3D48R 4JRYB 5K9KA 3TIDB 4KI1A 4F58L 3M1BB 3QEQA 1T7WA 3REWA 3EYOA 1NKRA 1KJ2A 4HT1H 3VFNA 4EUPA 4PS4L 5BW7A 3QDGA 4M6ML 3BQUA 4K8RL 5MERA 5MEPB 3VXRE 3V6ZA 3ECBA 4XNZB 3RY5A 4HS6A 5T1LD 5IV2A 2EDWA 3EYQC 5ILTL 5A3ID 3GKZA 3GB7A 5IW6B 5HGHA 3SGJC 4TUJB 3OXSB 5CWSB 1GGYA 4MB3A 4WWKB 4YK4C 1PG7L 4JQVA 4NN7B 3MRIB 4P9HH 2X89D 1NSNL 5FDWA 3IAGC 1I7RA 2CIKB 4TUOB 3QBTB 5C2BL 4UT6L 5F96H 4BFGA 1FNAA 4PBXA 2HVKB 4OFKA 1EUUA 1A7BA 2Y7QA 3OAYH 4PJAE 3K1KC 4GMTL 4WY7H 4W68A 4ZS6D 4KMQA 3EDEA 1S7SB 4H0HB 3QWRA 4S2SB 35C8H 4PJGB 3C5SB 2HYMA 2VDPH 4OZGF 3CXDH 5DUML 4G9DA 2W0PA 4MWFA 2BSSB 5CJ5A 4OZ4B 4ZFZB 4ZPVB 4HCRL 1U8JA 4N0FB 3T0WA 1EHXA 3H3PH 2VQUA 1KEGH 3JV0A 3BPLB 3P11H 3MLSH 1JGLL 2G75B 4X98B 3D0LA 4QWWD 1XF1A 4Q0XH 4C56E 3MRLA 3ARBD 3CVHL 3GBML 1LDPL 5K9QI 3B43A 3EO0B 5SWZE 1P1ZA 3VJ6B 3N9GL 5JTWA 2LE9A 1U8KB 2Z8VC 3QXVA 2HVJA 4NKDB 4P4RA 5E2JA 5T3XD 4NZRH 2P1YA 2D7TL 4IJ3C 3TN0A 1A22B 4GOSA 4Z0BL 4W6XB 4BZ1L 3O3DB 3PHOA 4L4VE 1QRNA 5E8NA 2WINA 4PB0L 3CSGA 4GAJH 1T66D 5BQ7A 2VLRB 2IWGA 4NRZB 2VABB 4YFLF 2DQDL 1O7SA 1OGAA 4JHWL 2BVQB 1LE9A 4M7KL 5D9SA 5J11C 4GKNB 3RAJL 5I1LB 3P40A 2ZSWA 3U4AA 4ODWB 3S36X 1MPAL 1U8OB 4IHOA 4JPWL 5CSZB 3U0TA 4JY4A 1H3PH 4Z78B 1X5FA 1CTOA 3NGBC 3SDXB 1DBBH 4P2CG 1U3HD 5F88A 3MRGB 4TPRH 5I8OL 4WI9A 3GK8L 5DURD 2UWEF 3DV6A 4FQ2H 4V1DB 1FO0L 2YPKB 5HYQA 4NWUH 3KPRE 3KJ4C 2FX8L 4XP6L 2AK4E 5L88H 4XVTH 1S9VB 3W9DA 5C9JA 3PF2A 4S1DC 4WW2A 4N0RA 1AGDA 3HG1A 1R0AL 3UO1L 2D3VA 2IQ9H 5TH2A 2NXYD 4PV9B 4JKMA 4HWBH 2JLLA 1TCMA 1L6XA 4G6MH 5D7LD 1NFDA 3RQ3A 3QCVH 4APQB 3E0GA 1E4JA 3STZB 4JKKA 3HB3D 4FHBD 5FM4A 3T0XA 4MQ7B 3DBXA 2DS4A 4U6VL 3LZFL 3I02A 4FFZL 2C5DC 5FHAL 5DMKB 5IJVA 5KVEL 1I85A 3SE3A 5KVFH 1F97A 4HGMA 5FCUL 5IJKA 4LSVH 4M6NH 4TSBL 3P30H 5C3TA 4F37F 4WCYH 1AO7E 4Z7NE 2RCSL 5LWYL 2GTZB 3EYFB 2BVUA 3QQ9C 4MNGA 5ESVA 3ZTJH 4PRDB 2WBWB 1MEXH 4NQCE 4OLZL 2F8VA 1AQKL 2WUCH 3UBXI 5AAMA 5EO9A 4G6JH 2VLME 4H8WH 2NLJB 3UXFA 1KEMH 2FH6A 4X6FA 3WE6A 5EZLA 2NY1D 2ADFH 3BVNB 4XC3H 3QUKA 5T1MA 3ARDD 4TSCL 1QHPA 2L0DA 3MCG1 4G8GE 2GCYB 2NZ9D 2R56L 2R4RL 4ORZC 4HUNB 3DHMA 5JQ6L 3NAAH 5D7KE 3PL6A 5CD5D 1JTOA 5KW9H 1BLNB 3BISA 3MBXH 5EU3A 5GGUA 5ID0B 3HI6H 4LEOA 1MHHA 4H1LB 1YQVH 1KJ3L 2VDLL 2J4WL 4HWUA 5ITFB 1KCVL 4JFOB 2X6MA 1XGYL 1A6ZA 1ITCA 1T6WA 2H9GB 3B8YA 5GISH 3QXDB 1FE8H 4Y8DC 3TBWA 3PQYE 5CJBA 4PGEB 1X5AA 4G80A 1A1OB 1PEWA 4ZFGH 5CEXB 3BI9X 5D2LB 1KJ2H 2WQ8A 1J8HA 3I2CL 1QSFE 1DQQA 5FA3A 5BZWB 4EUPH 4WI3A 3SKMA 2NY7L 3SDCC 3KPSA 5FYKD 1OL0A 4HBCL 4OZFG 4TRPL 4Y19E 3QDGB 5GQBA 4WFGE 3S37H 2CDEA 1TPXC 1J8KA 3IU3B 1CDCA 2X09A 2EO9A 4QEGA 3C5ZD 1TZHA 3BRDA 5IOPA 4HULB 4JO2H 3IS0X 4N8VB 2ADIA 5HGHB 3RDTB 4ZOAA 4PJHE 4LLYB 5GRVK 2OL3B 5DVLA 5FGBA 2HMIC 3DROB 1RVFL 2VTFA 1F4YH 3HR5B 1OP3K 3WJLA 5AZEL 2W07A 1LNUB 1JHLL 1R24B 3ZL4L 4GW5B 3C60B 2YXMA 4N0YH 3QIBC 3TIEB 1QNZH 3KS0J 3D9AL 3NCYP 2EH7L 3VXSE 3GRWL 4FQQB 3QDJD 1CDBA 1BOGB 4PJ9C 4DZ8A 1U91B 2UWEE 3WFZA 2HT4D 4MZ2A 3KYMB 4BH7A 4WTZG 2UYLA 2E7LC 1RIUL 2VWEE 3GSXB 1HILA 3ZYOA 3QG7H 3GKWH 2BCKA 5MP6H 1ZGLM 4R7DB 4WW1B 1LVEA 2FSEB 1FH5H 3NZ8B 2QLVB 3GI8H 4NKOB 5FUCC 5KZCB 1G7IA 1RUML 1R5IA 1RUQL 4UV7H 5KSUB 1G7LA 3IJYA 1N0XH 3DXAE 2NTFB 2G5BB 4CADA 5LVEA 3AROA 4OGYL 5E70A 1HSAB 2LVCA 2B1HL 2QQLH 3JTTA 5IMLB 3CSPA 1YEEH 5BOPA 5LKNA 4FQXA 4F3FA 3DMMA 5E2UH 4KJPC 3T8XB 5BCAA 3MRLB 3GSVB 2APXA 3V5KB 3JV6A 4I3RL 3TO4D 4BFIB 1WGOA 4P4KB 3C5ZC 4PJBE 2YMXL 5L2KE 4XXDB 5EBLB 4LDLB 4ODSH 4Y2DD 5D1QC 4HUWB 2GY5A 2XG5A 3BW9B 2DQCL 1MJJA 1U8IA 5EULV 3HZKB 3MLRL 1LEIA 4JM4L 1QUNA 3NABH 1EH9A 3TN0B 1NGYA 3KWWA 4HUUA 3PHOB 4BYHA 1RI8A 4GBXD 5DSCB 4KGJA 4D0CB 5IT2H 1A7RL 4JQIH 2W0KA 1KLGA 2J8HA 1LE9B 4NNYA 4NC1E 4C83B 1YC8A 1YMHA 4XAKE 3VXRA 2AK1L 2ZSWB 1NCCL 1DANT 4JZJA 4AG4L 3CMGA 2YK1H 5AG8A 3MV8B 1FSKB 2YUVA 4YHOL 5IB4A 3H9HB 4XH2A 4G6AC 1NGQH 5IB1A 4YXKH 4RGNC 2DL2A 2IADB 3O4LD 1XIWD 3AUVA 4IOFD 4LGRB 2CLZA 3RL2B 3S5LB 3QT2A 3SEPA 1KIQB 3FQUA 4PBVC 4Z77B 1KLFA 4LPXA 2F8OA 2HFTA 4IIQC 5JIIA 1F5WA 3U0WH 2QADC 5DEFA 4ELMB 4Y1AD 2GSIA 3DV6B 4DZBA 3L5WA 4X7CC 4OI7A 3HRZB 1GXEA 2JB5H 3P4NA 1X7QB 5C9JB 1S9KC 3RWEA 4Z7UF 4X5WB 1FNSL 4PRHD 4PJAA 3KLHD 4G3YL 4CRPA 3P9LA 1ZLUH 3HFML 3ZKXB 1RPQA 3FZUD 5TGBA 4AT6A 1IGIH 3SQBA 3RWDB 1EX0A 3BPCB 1DQLL 4K3JL 3CVIH 3DBXB 4PBWD 4PRIE 5EBWA 2ZOKA 1WV7T 4G6KH 4YO0B 5C08D 4FP8L 4PJDE 2VC2H 5FEBA 1IGFL 2CKBL 4MHHG 3U46A 3N1GC 2DM3A 4URTB 5JQHC 15C8L 1Z3GH 2Y36L 3SGDI 3ZKMD 4XPAH 3C09C 3WO3B 4LSQH 1CLOL 2R1YA 5LXGL 4WUUD 3AS2A 1NC4A 3G5XB 4PR5A 1KTLA 5C6TL 3B9KC 1U58B 2D0FA 1MLBA 3Q0HA 2V6HA 4LPTA 3FFCB 1U95A 4KVNL 35C8L 3NCJL 4JJ5A 4J3UA 5E6ZA 2V17L 1CR9H 2VLKE 4QHUA 5E2WL 4JFFA 1Z0MA 5HDOA 4NO0D 1DUYB 1AKJA 3AS1A 5D71L 5FYJU 5E2VH 4FXLA 3QULA 2LU4A 3DUUA 4PGCB 1GAFL 3P11L 1KGCE 3MLSL 3ROOB 1CG9A 5FA4B 2NX5B 5E7BA 5E2TH 4XCCH 1A5FH 1OVZA 4WGWB 3RJDA 3WIHA 7CGTA 5JDJA 4HIEA 3LHPH 2NY5C 4ONHA 4Z7OE 1N6QH 2AP2A 3I75A 4G80B 3CFEB 1UENA 3MBED 3T2OA 3QZWG 4A6YB 2QQQA 3EDKA 4WO4B 4WV1A 1KN4H 2E7MA 3GEWB 1G6RA 4ZXBB 5GSRA 1J8HB 5FA3B 4I0PA 4XP5L 3SE4A 1AI1H 2NY6C 2Y06L 3QFJD 4FFVC 1XF2A 3ARFD 1Y18A 4IMKC 1CT8B 1RHHB 2OR9H 5LJYH 1T7XA 5E94A 3PWLB 4GAJL 1VGEH 3VGGA 2X9YA 1KUMA 3OKYA 2AK4A 4MCZA 5DRZB 5BS0B 3LQAL 2Y07L 3VMNA 1TZHB 2QQNH 2YUZA 3QEGH 4KY1H 4P5TA 4GLRH 1JPGA 2X4UB 4TULH 1WBZA 2ADIB 4M48H 3VI4F 4PRPD 3OJ2C 4DWHA 4EDWH 1FRGL 4XNZC 4YUEL 4QNPE 3QH3A 2XQYK 5J8OA 2ZUSA 3GMNB 3MXVL 4NCDA 3QNZA 5CEZE 3RPIB 4RIRB 2ZOLB 5A40E 1AO7A 4WWKC 1BZ7A 1FFOA 5ELIA 3SBWA 1FAKT 4NQCA 1HHJA 3VGHA 2WW8A 3MOBL 4MXVE 3QPQC 2CIIA 5IB3A 2DQFA 3A6CL 3SDAC 5DWUL 4JHAH 4G6ML 4HD9A 4LOUD 1I9RH 2Y5EA 4G8GA 2KL6A 1YEIH 1UB6B 3KYOA 3VGAB 1ND0B 2AXFB 5LGHL 3B2VH 1FN4B 5BRZD 1LO4H 5E9DD 3DX8B 3IDNB 4P3DB 3ARFC 4LSVL 1BVKA 3SCMC 2DLHA 3C8KB 4FQXB 3BSZH 1T83C 2VXSL 1IFHL 3NA9L 2WUCL 5JW5B 1P6FA 3MOQA 4G6JL 2CXKA 3FN0H 4H8WL 3EDJA 2FEEI 4KJYA 1KEML 1WZ1H 2B4CH 1JZ4A 1C12B 1CIDA 3H3BC 1P84J 1NGWA 1P4BH 2XWJB 5IUSA 1G9MC 3H6JA 2FJHB 4EIGB 2BVYA 2HFFA 5DFVD 3VWJB 1QSFA 3E3QE 5C92A 3QDAA 3RUGE 3RIAK 3G6AA 5BZDB 1J18A 5KW9L 5I6XC 2O5YL 5DO2C 2FWOA 2IPKB 3MBXL 4Y19A 1KLGB 1YQVL 1CICA 3CZFA 3TWCH 1ZHBA 4JZJB 5HPMB 5JUEH 1JTPA 2CSPA 5IB4B 1FE8L 2BERA 4NNPH 4XH2B 4AIXA 4B0MM 5I1DA 4XXCC 1AP2A 2XV6B 4J3WA 5KSAA 3TH4T 4ZQKB 1HINH 4GAYA 2XWTA 3HAEA 2DD8L 3FQUB 5EU5A 4H26B 5MENB 4PJHA 1OF2B 5C09B 3AB0B 4KK5C 4UAOC 5I1HL 4NRXB 1R3LA 2GSIB 3L5WB 1T3FA 5C0IB 2XRAH 3OJVC 4LCYB 1IMHC 4E41B 5FUOH 5DDHA 4O51B 3RWJB 3MACL 4KJWC 1NL0H 3O6LH 4J6RL 4RWYL 1RZJC 3QNYA 1B0WA 2UWEA 4LPCA 1JN6B 3OX8B 3ILQC 1KCUH 1L7TL 5F9AC 3T0EB 4V2BA 2X1WL 1MHPH 3DUHA 4FMFA 4Y4HB 3UZQA 5T3XE 3G04B 4JO2L 1QEWA 3T08A 3ZTNH 4F2MB 5J1AB 2EDBA 2IPUK 1WICA 3U4EA 1K4CA 2EC9T 4JG0L 2VISA 4NYLB 5F3HB 3DXAA 1X4ZA 1KELL 1VGKA 1JF1A 3U9UB 4OCXH 5F7YC 5BVJA 1DBJL 4K94L 2AAVA 1CDJA 1MQ8A 1YY8B 1P7QB 5K9JH 2CLVA 2KQNA 4OGAC 3PGCA 4L8SB 4KTDH 2IG2H 5BOZG 5CP3A 1OSZA 1NJ9A 1TXKA 1ZWIA 3QG7L 3TEUA 5L2KA 4PR5B 5MP6L 4M03A 3QWOB 1N64L 4K9EC 1FH5L 2HLAB 1P7KA 2V7HB 3BT2L 4ZUTB 4NHUB 3VWKA 4K3HA 3P0GB 4JJ5B 1LEKA 1JPTH 1UXWB 4HKZA 3X3FH 1BD2E 5JXAL 1W8OA 4JFFB 1VADB 4KUCF 3VFSB 2JELH 1AKJB 3O11B 2RHEA 4NKQB 4XNQB 4FN0A 3WXWL 3WIHH 1YEEL 1BGXL 1CG9B 4RGMC 1DEEB 5E2UL 1ACZA 3TM6A 3OKLA 1F6AA 4DEPC 2A74B 1P9MC 1I1YA 1VPOH 5T33L 2XPGB 4YC2B 4MJ2A 2ZUYA 1G6RH 4S1QH 5C1MB 2IPTL 2O5ZH 5DK2A 3T0VA 4MSWA 2PCPB 3D39D 3PWPE 4P2OA 1XCTB 1G6RB 5ADPH 5J6GB 3NABL 3FOLB 4HGWA 2VAAA 3GSNA 4UT7L 5EZOL 4JFED 4Y4KD 3CVHB 3GDBA 3RZCC 3FB7B 3ALWA 2FX7L 5FO7A 5IT2L 4G42B 5JO5A 3CSYA 1AFVH 5JR1H 2AK4B 4JQIL 5JDSB 4MCZB 4XNYH 4EI6B 1OAZH 5MEQB 3ULVD 1A8JH 2ESVD 5ICZA 3U4BL 4IS6B 4P5TB 4Y5YC 5IBLD 1OB1A 4Q9RL 2A1WH 2ICEA 5I1JL 1MAMH 4M1GL 1A3RH 4XBPB 3U83A 4KV5F 3EO1B 2GEEA 2DQIH 5C07B 1I1AD 1CFNB 4PRIA 1GPOH 5DR5L 1NPUA 4HZLA 4WHTB 3RJQB 4ZO7A 5F9WB 3ZSSA 3KYNA 4PJDA 1JZ5A 3WFBH 4YHPA 1IL1B 4IOIA 2OLDA 1X5KA 4ZSOA 3IETB 2VDOH 3QDMD 2XZQL 5HI5D 1XR8B 3C60C 4ONFL 4KK6C 3U7WH 2P5WB 1BBJA 4R2GD 5IB3B 4P2QE 4N0CC 2IAMA 1MCBA 3UTTB 4ZTPL 1ERNA 3TT3L 5T1DL 3ULSA 4QY8B 1QKZH 4RMVA 1OQXA 1FZOB 2V7NB 3ARTA 3BP5A 3GSUB 2A77L 3CVIL 1AD0A 3LEXB 4OBRA 3THML 2AJXL 1XH3B 4G5ZL 4QKXB 2K7PA 4M9PA 5KBNC 2WIIA 4LLMA 3VA2C 2VLKA 1RHFA 4OZGB 5E99H 4EBQH 4QYOB 2VC2L 5FYKE 1HZHH 5I1CH 1DVFC 1OAQH 2PXYA 4GMSL 1R3JB 3K8LA 4XPAL 4XTRD 1J0KA 2ED7A 2A6IA 3S8WA 3RU8H 2BNQB 5A1AA 3D85B 3L5XH 1A1MB 2V2XB 4YHMH 3UJTH 3MRCB 2KZWA 1IAIL 4MNHA 1QR4A 4U1KA 3U0PA 2FBJL 3TBYB 5DD3L 3MV11 5I8EA 1AIFB 3VG0H 1F2QA 3HLAA 4E9LA 3IKCA 5KVGL 4PJIE 1MWAL 4WVRA 2R0WL 1RZ7L 3MV9D 1UYWL 2ICES 1XGUB 2DBLL 4Y16B 4OIIL 3ET9F 1TQBC 2HTLC 1CICB 3CZFB 4M6AA 1C7SA 2A2QT 3L5JA 1BHGA 3HAEH 3BO8A 3SQOH 4R2GC 1X9QA 5AUMA 4WDIB 1AP2B 3WKNA 2DIBA 1INEH 3CLFL 1CD8A 2V9TA 4KTYA 3VXMD 1KT2A 4QRRB 3O6KH 2AABL 4JFDB 5F1NA 5F71A 5IESH 1R3LB 1KTKE 1JPSL 1T3FB 5B3JE 4GXUM 4Z95L 5JW3H 3DNKA 5DJZB 1CLYH 3I6LD 4MAUH 1DBKL 2GYSA 1A3QA 3H9SD 2UWEB 1K5NB 5D70L 3LKOA 4MA7L 3QUMA 3O3EB 4L29B 5T1KD 3K8KA 5KVMC 3FRPG 1H15A 1GRWA 4ODXA 2JF1A 5ADOL 1P4IL 1PJ9A 4WUKL 5HDQH 2ERJC 1LQSR 2EIZB 5E8DL 4UILL 4Q74A 4FNLH 4G7VL 4OCSH 1MVUA 1E6OH 4Z7UA 3MLYH 5E8EA 1VHPA 2R4SH 1K4CB 3LV3A 3ZT5A 4QHLB 1HQRA 2A6JB 2EC9U 3SDDD 3QJFA 3KHOA 4YHYB 5CP7A 4KV5E 3U7YH 43C9B 4UUJA 4KK8D 5EBMB 4U6HB 5BVJB 1FL5B 3VU2A 4M7LT 5CP3H 4LMQE 4NSKB 4HPYH 5MHSD 1DN2A 3MNZA 2MHAB 2NY2C 1RURH 4BK4A 1JWUA 3IFPA 4P23B 5HHMD 1RZIA 4EN3A 2FD6L 2IF7A 3ZDXF 1WEJH 5T1LA 2Z35B 5DD6B 1EO8H 1AGBA 4DGVH 3L1OH 3O4LE 4JHAL 1WT5C 1YYMH 3KPQB 3VWKB 4A2LA 4IM8A 1GOHA 4CN6A 5HGGS 1IEAB 3TV3H 3C6LC 1YEFH 4OCYL 1YEIL 1WCQA 4PJFE 3L7EB 3H9ZA 4NKIH 2YPLB 4Y1AE 5DUPL 2EH8L 1QFPA 1LO2L 5EN2B 3T1FA 4RFEB 1LP9E 1U8HA 2XIDA 3HC0A 3A67H 3BSZL 5GGRY 4ZUSA 3GJFA 3OKLB 4O9HL 3FT3A 1DLHA 1ZE3C 1I1YB 3KLAA 3JTSA 5T3ZD 2FIKB 5C9KA 3O3BB 3HE6A 3KPLB 4R26H 5L7XL 5DK2B 3UC0L 4GW1A 4LIQE 3GSNH 1K9TA 1CF8H 3CD4A 2IBGA 5CLWA 1RUPH 3HNTL 4WHYG 3BPOC 2H1PH 3D1MC 1JGDA 3O8XB 2M2DA 4HKXB 1HYSC 3GSNB 4LLQA 1AY1L 1YPZE 5EOCH 3HS0B 3BJLA 3MYZA 3KDMB 2NR6D 5KSVA 3CK0L 3EKCA 2APTA 1MCOH 4Q6IC 1U8PA 4OBSA 4Q9CA 4RISH 3BZEA 4DGIL 2J6EL 1AC6A 4OQTA 1I8IA 5JUEL 3PV7A 5JIKA 4QRPB 3UBXA 5ISZA 3B2UC 4KUZL 5M95B 4BSWA 3BDYL 1UKSA 4KFZC 2NY4B 4KHXL 4G6FB 3S34H 4CDHA 4HK3N 4PRIB 3RFZC 5GJSH 1OCWH 1NUDA 4JO3H 2NW2B 3QRGH 5E6IB 1QLFB 4FFWD 4HQQL 5D1ZA 5HYSB 4QHMA 5FUOL 2I9LA 5I0DA 4ZSOB 3FO9A 3SO3B 3T2PA 1HH6A 1NL0L 3HI5H 1XF4B 3HMWH 4LKXA 4U7SA 4LQFL 1YNLH 2W9EH 1IAKB 5I71B 1RZGB 1UZ6E 4LVHB 3QQNA 1ZVYA 1Q0YH 5I73C 3QHFH 1DSFL 2HTKC 1TETL 3RL1A 4AM0A 4ONGL 3QXAB 3IVKA 2D0HA 3KXFB 4HK0A 1PFCA 5DA0B 3TZVB 5CGYC 4BUGA 1FLTX 3CU7A 4FQLH 2B7DT 1BD2A 4ZFOA 1D9KD 4WJ5A 3CMOH 4BJLA 3RVXD 3CFCH 2X4SA 1GGIL 4ZD3H 2F53E 1CDGA 1QBLH 3NZHH 4MDIB 2I26N 1RZKH 4F7PB 3L3HA 4IRJD 4H0GA 4XBGB 2DQGH 2YEZA 2ARJQ 3IT8D 5D7JC 1YEKH 1FYTD 4YQXL 2BNRD 1KNOA 3R06A 1VEMA 1G1YA 5BXFB 1H3VA 1IC4H 2X41A 4M1CD 4OT1H 4PGJA 4RX4D 4HUKB 4PRPE 2BHYA 3WYRA 3GGWA 4MAYA 2JJTA 4I0CC 1A7QH 2Q87A 3PWPA 3IKCB 3QHTC 1BF8A 4M7ZB 3S96A 3SGEI 4X6DE 4EI5A 3X3FL 2AJYH 1QFUH 3V5DA 3C8HA 3D0VA 3TYFA 4LHUD 2DWEB 5E8OA 4XHJD 4GRLD 2CGRL 2VR4A 4KDVA 3MODL 2BY1A 3FRUA 3F8UB 4OIAA 5INDA 5ESAB 3NVQA 3FB8B 1DBAH 3WDJA 1VPOL 2APBA 1IILE 4FOMA 5DK0B 5CEZH 1NDGB 4K7PY 2H6PA 5F1NB 4ZDHA 1M7XA 1NCTA 5GPRA 4NM4L 1S7TA 3BPNB 5DK3A 1IGMH 1ZLWH 3QUMH 5ID1A 5D93B 1IGTA 3B9DA 4X9IA 4XCFH 4HK3J 1AFVL 5JR1L 3VE0A 3MRHA 2RAMA 1H15B 2YR3A 2ZWLT 2BP3A 4LP4A 2H2PD 4RMSA 4P2QA 3BAEH 4ODHH 3LMJH 4Z7UB 1A3RL 4XCEB 1JHTA 4K71C 1YMMD 5LQBH 5CJQH 3PIQA 4YDKH 5JPMA 4PJCE 2DQTL 4X7SH 5J6HA 2XA8L 2A9ML 1AHWC 3ZE1F 3NCCB 5FK9B 3F65A 3GIVA 5F93C 5J56B 3TA3D 4KKCC 3JWDL 4YXLH 4Y5VA 4FQJH 1E4XL 4S1SH 2WBJD 5DD0L 5D1XC 3MCKA 4KGLA 1EJOL 1OAKH 4MD4A 3BGAA 4EN3B 4MA1B 3HC3L 1LK2A 4XGZA 4I5BB 2ATPA 3A6BL 3MREA 5F6IB 4FTVE 3SGKA 3SE8H 3X17A 1NLBL 3EYVB 5DC0A 1FG2A 3AAZA 4XPHH 1R3KA 1J87A 3MRJB 4P9MH 5ALCL 2C3VB 4GAFB 1FV1A 2BOBB 4PJIA 3GJFH 3W11D 1BFVL 2BFVH 2OK0L 1U8HB 1HZHL 3FN9A 3K81A 1KC5H 4ZS7H 3SN6N 4BZ2L 4CW1A 2CUHA 3HCVB 5IHUL 2EEBA 4PGDA 1I9EA 4LRNH 1J7VR 2FO4A 4EVNA 2Q3AA 4ENEC 4GG8B 3OL2A 4I8DA 3MGTA 3HE6B 4MD0A 2VQ1B 3AS0A 5FYLD 4YHML 4PJ8C 4TNWK 1IAOA 3IAQA 1MAJA 1G84A 1A4KB 4QXGL 1JGDB 2I60L 4CU6A 1M71B 2KKQA 2EICA 3CFBB 5CAYB 1L0YA 3R0NA 1H9VA 3H7BA 5ITBH 3LY6A 1NC2D 4QRQA 3PWVA 4OQTH 2R0KL 4ELKA 3VCLB 3DVGB 1U9KA 4LQ1A 1OTSC 1C5DA 1HEZA 2L4OA 3ZKNC 3TO4A 4PLKC 1FG9C 1OGTB 1OPGH 5EU7C 4P59H 4MXQC 5ISZB 4Y2DA 1OP5H 1LWRA 3LEVL 5GGTA 2FH8A 3BD4A 4RAUB 3MJ7A 5E1AA 1M1SA 1S7XB 3P77B 3O9WD 5IESL 2J8UF 1OT2A 2VH5H 4MJIE 4P2RA 4KKBC 1CGTA 4KJQC 5D1ZB 4QHMB 3TH2T 4Q9QH 4UT9H 1CLYL 5BV7H 2EDFA 1YN7B 2EDNA 3L3JA 2VLLA 3QQ3B 4LKXB 4MAUL 1D5BB 5F72S 1IEBA 4RMRA 5BO1H 5IWLC 4U6YA 1HDMA 3NBNA 5EIQA 5LGJB 3MO1A 4LGPB 5I18L 1CTNA 3FFDA 1BZ9B 1BFSA 1Z2KA 3RL1B 1UADC 5FIEA 3T4AA 4DAGH 1F58H 3BN9C 1IAMA 1J88A 1D6VL 3O4LA 1XIWA 3D39E 3KPOA 3Q6GH 4JM2A 4HK0B 4LCIH 5DMGC 3IKKA 1QVOA 1W72L 2IFFL 4JRXD 4PJFA 1BD2B 2AS5M 3DETD 4Y1AA 2DDQH 4HFUH 2LFGA 4PTUB 5I66A 3G5ZB 1JF5A 3TJEL 4F9PC 2NY3D 1LP9A 1G1CA 4XNXL 5F7LB 2ADGB 3RWCA 1F3JB 3BFOA 3ULVE 1I3GL 3OHXB 3ULUL 2NY0B 2ESVE 4WI7A 2WWKO 4XMPH 5DLML 2OXHA 3IDXH 3OKEA 1UH3A 3L3IA 2XKNA 3MRMB 4MAYB 4FQCH 3RI5F 4N8PA 1EO8L 4OZIF 4XMLH 3MLTB 4JAMB 3EDFA 5IVXE 2B1AH 1WIOA 1T04A 3MLXL 3TV3L 4BFEA 5DTFB 4OSUL 3VG9C 4NKIL 1YPZA 1T0MB 3TYFB 3UPCA 3QFDA 1MH5B 4ZOCA 1KFAH 3FRUB 3QDME 1UJ3B 4M7JH 3DLQR 5KJRH 3SY0A 5I1EL 1QP1A 3Q3GB 1WBXA 4Y16C 3I3BA 4YIQB 2NCMA 5DC9B 3I9GL 5FAAA 4ZDHB 1LO3L 1LK3L 4QTHA 1CF8L 4QRTA 3UTPD 4X0KA 4HIIB 2X4QA 1EFQA 4I2XB 4OGXH 2H1PL 5DJ6A 1JYWA 1VFBB 2XTJD 2R9HC 5EOCL 4NO0A 5D6DA 4QXTA 1SEQH 4X5XB 2C3HA 4GXUN 4GAGL 5JZ7C 2GJJA 3PHSA 1ZA3B 3QCTL 5C8JA 3GUTA 3VGDA 2R2HB 5CMAB 5CLTA 4M4PA 5GRUH 4WI2A 4RFNC 4CU7A 1ZA6B 1VFOA 3S96B 3RGVC 1ORQA 5CKGA 5INCB 3MBEA 4XP9H 4G43A 5FYKH 1QG3A 3HA0A 5J6HB 1RIVH 4HF5L 4CDGC 4PJ7F 4RDQG 3LKRB 1HHGB 4XPTL 2D31A 1JNHA 1R6VA 4DGYL 1LE5A 1BIIB 2F53A 4OQ1A 1KPRB 1NBZA 4YHYC 3HR6A 3BZFA 5D7IF 5FUZL 2SEBA 4Y7MA 2J88L 3BP7B 4NDMB 3AVEA 1WQVT 2APVA 3RBSA 2XFXA 4L9LA 4P99A 1VB9A 1D5ZB 1VKXA 5I2IB 1NCWH 4WEBL 3WV0A 4PRPA 3VXME 4KPHH 1MCQA 5GS1B 1BMGA 3AAZB 1F8TH 1G9NC 4MQXD 4PTTA 2VDQL 2QKIA 1B4JL 3IGAA 2MTPA 4X6DA 1L4IA 1T0PB 3QUXC 5IK3B 3CMOL 2AKRB 4E42B 1QBLL 3T3MF 4JDVB 3H9SE 3N1QC 3OKNA 2Q76A 3CFDA 3F12B 4JO1H 4K3GA 4ETQB 1HHKA 1K8IB 2UV3A 3GMPA 5EWIH 4KRPC 3FQNA 3H2WA 4GXVH 3NIGE 4O58H 4RRPG 2K3TA 3QJHB 1JV5A 1DQDL 1WBYB 4JRYD 1TLKA 2JK5A 4M1DL 3OXRB 3KS0H 4YE4H 4KK9C 3MTRA 1OHQA 1PBYA 4LSPL 2HA1A 4L8DA 3VD3A 2H2SD 2XQYG 5HHOD 5FM8A 3S4SA 1UT9A 3H7LA 4OZIE 5DHVB 4LEXL 2Z8SA 3BP4A 1NMBH 1UCBH 2RFXB 4MMXC 3SGDH 1KIPA 5ACZA 1UB5A 1IT9H 2WM0A 5MHSE 3HC4H 1U8NB 4XVSL 1HEZB 1FFNA 1KBGH 5HHME 2H8PA 5GGTH 3QI9D 2WIMA 5DZNA 4HH9B 4PUBL 3K74B 1MWAB 4OLUL 1HHIA 3WN5B 5DXWA 1H3UA 3UTZB 5HDLA 4PP2B 4PJCA 2E7BA 1T5WB 4P2RB 3VFTB 5A2IH 2NY4C 2C9AA 1IGML 1NAMA 1MCWW 1NLDL 4AENA 5FO8B 5HYJA 1B0RA 1DQJB 5ICXB 5ECJE 1CLCA 4XCFL 1MCRA 4U6YB 1QA9B 1CD1A 2P47B 5T3ZE 1QHOA 1VENA 1CN4A 1SJEA 5GGVL 1T2JA 32C2B 4XZUA 3LMJL 4FTVA 5I71C 5E5MA 1CZ8L 4V2CB 3EYSH 1WK0A 1MCFA 4X6CF 5C0BB 2BZDA 4LSDA 3WUWG 1WC7A 5BMFH 4U7MA 2H2SC 4HIXH 4LVOC 3QXTA 5CJQL 4YDKL 3WNNA 2I9TB 4R4FH 2XXCB 4J12A 1DE4A 1I1FA 3FQTA 4R8WL 3OG6B 4NOBA 4YXLL 3J7HA 3VXNA 4YEFA 4CJ1A 1BP3B 4LIQH 4X6EA 5DJAA 5TQ0H 1UC6A 2R69H 5EIVA 4GKZB 3OMZA 1EIBA 3IRPX 1ZT4A 2GTWA 1RJLA 3SE8L 1MCLA 5IGXH 1I7UB 1ZLUK 3BWUC 2PO6C 1JMZA 5F89A 2VLRD 3QIUC 5BJTA 4X8XA 5B39G 3HUJF 3MRBB 4UDTA 1HQ4A 5E8PB 4QTIL 4JVWA 5DRNB 3FN3A 4N9GA 5CILH 4OB5H 1AJ7L 1T20A 4NM8L 2Y23A 2FJGB 1WBXB 2ARJB 4QT5B 3QG6A 4H5SB 1X5HA 4OV5B 2BNUA 1U93A 5JXEC 4X7DC 3LB6D 3HE7B 4JN2A 4QRTB 2IPUG 1ZT7B 3IDMB 3ARGC 4PRBA 4OI8A 4OF6A 1XEDA 1SMAA 2QJDA 4MJIA 4MD5A 1S3KH 2WWKT 5I30H 1S5HB 1T21A 4YDIH 4NO3A 2B39A 4OCWL 4OQTL 1FVCA 3BPNC 4IRZL 5GGQL 2DLFL 4APQD 1FYTE 3QIWA 2BNRE 3HZVB 5T3XL 1FYHB 1CL7I 4M4RA 2XZCL 3BYYA 2YRLA 3QB7C 2OQJB 1VSCA 4P59L 1ORQB 1CDYA 1V7MH 4GG6F 4ZOEA 4G43B 5IB5B 4OLYL 2W0FA 3D39A 4HV8B 3TPKA 2D7MA 1AGFB 3LKNB 3TJHC 3C9NB 4R9HA 2YKLH 2Z31C 2VB5A 4R0LA 4DOHE 3IDJA 4NHCH 2VH5L 4UOJA 5IVZA 1UKQA 2WBKA 3OF6D 1DQML 3NA4A 4CL7A 1WAAF 5BV7L 2EDQA 3LQAC 5DI8A 3MJ9A 1IARB 5BO1L 4TNVF 1LO5A 2ESVA 1T0NA 2F19H 4L9LB 3NPSC 3V6FB 1OAUL 4LFHD 4JPVH 5IB2A 4DAGL 1T2QL 5DUBA 1F58L 3GHEH 4QCIA 4YPGB 4XVUC 2BHUA 2VZUA 2XN9D 3K1DA 4NNXB 3Q6GL 2ORBL 1F3RB 5IVXA 5A43C 4DUVA 3BEWB 2DDQL 1R5WA 4X9GA 3EYUL 3VFMB 1IKNC 1S9WB 3D18B 3L95B 5HHNA 4MCYA 4NC0B 5CBEA 3UTQB 3FQNB 1TNMA 2X9XA 2AGJL 5F3BB 4LSSL 2QSCL 3WD5H 5FGCE 1QO3A 4TTDD 4OCRH 1SY6A 5KSBE 1N8ZA 4HJ0D 4XCNB 2AJVL 1A9EA 3QEQD 5HI3C 1OTTD 1YMME 2X4TB 1BBDL 4XMLL 5IROC 1KCKA 5DJ2A 4H25A 2BRRH 3QDGD 3OV6A 3GSRB 3I50L 4JZOA 4LRIC 3MNVA 2D9QB 4DN3L 3STLB 2KPNA 4KQ4L 1JFQH 2OR8A 4LCWE 1CK0L 3LEYH 2F54E 4DKFH 5TE7H 2NXZC 4XNUH 5GSVB 1ZS8A 4QXWA 2BRQA 4JG1H 1S8DA 4K7FA 1F02I 4YGVA 3RDTD 1GC1H 4H8WC 3TT1H 12E8H 4P46C 2OMNA 2R15A 3RY4A 5HGAA 4MNQB 3NFSL 2ZG3A 1HHIB 1H5BA 1IGJB 4OAWB 3V4PH 4NWTH 3M07A 3VRLF 1NAMH 5D2NB 5EUOF 1WFTA 5I1AB 2P46B 3BRGC 2DQUH 3LRGA 2Q7NA 1YEDA 4LAQH 1B2WH 4HMEA 5HYJB 4JGJA 2KBGA 2Z92A 4JO4H 1MRFH 4FG6D 1SEQL 1J9CT 2J8UA 4HS3B 5DA4A 5AYQA 2CRZA 3RVVD 3CGTA 3DJ9A 1SM3L 3QWRD 3P4MB 4KI5D 4XP4H 5C0EA 2J5LC 5KZCD 1TVBA 1S9YB 3IAPA 5FYLE 3GM8A 1MRCH 5E5MB 1A4JA 5EOQL 3VXMA 4M8QA 1BPVA 3CLEL 1HXMA 3WHXB 4XP9L 5DRXA 1UCTA 1XR9B 5FYKL 2FL5B 1JNNH 4KMLB 5IFJA 4ZUUB 5BW7C 3L6FA 3BQUC 4ZAKB 2F74A 3EOTL 2EYTA 3MROA 1AR1C 1FAIH 4WWID 4P4KD 4HX1A 5LCVH 1EEUA 4OZFB 2ZCHH 3H9SA 1N4XL 1DUZA 1G7PA 3CU1A 1OT1A 2EXWD 3BGFB 3TN0D 3QDHA 4JQVC 3BE1L 5JPNA 1QRND 1NCWL 1O5DT 4HG4K 4YR6A 3QQ4A 1HH9B 1NMAL 1MCWM 3SDDA 5HYIA 1J5OH 4OZIA 4UDTB 3U79A 3S6CA 4K94C 1JZ2A 1Q94B 3MV8D 3ZDYF 1W0VA 4HAGA 3GMMA 4ZYKA 4N8CH 1T7ZA 1D5XB 3TBVA 2HFGL 5IM7B 3AREB 3EO9H 4RQQA 5HTSA 1MJ8H 1IQDA 4PY7A 1NQBA 1CE6A 2P45B 1EMTL 1I7ZA 2D9CA 1LHZA 1U93B 4DVBB 1UJ3C 2YPVL 5KG9B 5I15L 4I18B 1CDIA 5TDNA 5IHZA 1UQSA 4FQHA 3V6OE 2IC2A 5C0JA 2VUOA 2VLJA 4TSAL 4U1JB 4OLWH 2M1KA 1BFOA 5SWSE 1LMKA 5GJTL 2CUIA 5D72H 4U1LA 1NMBL 1T21B 5F1KC 4NO3B 1HCFX 1CFVL 4HW6A 5I75B 2C3GA 2OZ4A 1PEZA 1ZHNA 3HC4L 3TNMB 3JUYA 1TCRA 2X7LB 3F7YB 3OB0K 1WLHA 4MJ4A 2K1MA 5IEHB 3U2SB 1QFWI 2X1QA 4XC1H 2QBWA 2W0FB 2QHLA 1JPST 1PGRB 1FC1A 1HXYA 4CVXA 2YD9A 1UH4A 3FQRA 3V4UH 4HWEL 4R0LB 1EJ6A 3DX7A 1RIHH 4RGNE 5HD8D 3MJ9H 4OLEA 3ULVH 1W0WA 4LHQB 5HGBA 2PNDA 3HPJA 5D7SH 3WFDH 5HHQB 3V8CA 1RD6A 1FL3A 1IKFH 5I76B 3GSWB 4LCCA 4PJ7A 1N2RB 5DRWA 1HI6B 3IDIA 3IJSB 1CGXA 4OLXL 2XY1A 3CDGA 3FFCD 4XP1L 3MRRB 4D94A 5IB2B 4UV4H 3PL6D 4K3DL 3BRFA 2G2RA 1U6AH 3O2WH 3QO1B 3MA9L 2G9HB 5I1IH 1QSEE 4KTEH 1N5YH 4JLRB 4NZUL 5A2KH 2DLIA 3IDUA 2BMKA 4NBZB 3CDCA 2LTQC 1AQDB 4WW2C 1YJDL 1ZT1B 2K7QA 1IE5A 2BXZA 3N85L 3FQWA 2A73B 1SY6H 4NGHH 4YXHH 3D2UA 3OKKB 5LBSH 2V5RA 1IC5H 5HYFA 5F1OB 2VIRB 3PNWB 1CGVA 4WO4D 1QO3B 4QGYA 2R69L 4EOWH 4YHZH 4ZXBD 4C58B 3O6FB 1J8HD 1I85C 1NUFA 3W9EA 3SE3C 1A9EB 3G5VA 5IJKC 3G5YA 2XTLA 4LLDA 5DJ2B 1ZGLP 5IGXL 3FMGL 5DQ9A 3RX5A 1D9KA 1MCKA 2NPLX 3GMQB 3ZT6A 1JZ3A 2PTTA 5D8JH 5BS0D 3DSFL 5ETUB 5EBGA 3BEVB 1ZTXL 3JUZA 2R1WB 2ZPKL 2HP4A 5CILL 3L9RA 1JPFA 4K7FB 3MRPA 4CMHB 3VFVB 3DRQA 3GHBL 2A6KA 3OR6B 3G6DH 4ORGA 4U1GC 5D6CB 2BNRA 1F45A 3S9DB 5CIPB 3G08A 4RAHA 1RZFH 3GNMH 5JLZA 2HWZL 2Q86A 43CAB 1ODAA 4CJ0A 2UVFA 4I9WD 3MUZ1 3QUZB 4X8JA 3UAJD 1A7NL 4Z7WE 4XPGH 2XT1B 4WU7B 1ADQA 4NJ9H 1FGVH 4LHUA 5I1KL 3P0VL 5C6PB 1S3KL 2J8UB 4XWGH 5H35B 1JUFB 2BSED 2YBRA 5C0EB 4NO2A 1FQ9C 2NW3A 2OTUB 1S5IL 4I0KA 1A6WL 3VH8A 1JYNA 4R97B 2BSRA 3LIZH 1V3MA 4N0UA 4JRYE 3O6ML 4F7TB 1V7ML 2PW2A 2ZUWA 3S88H 4GO6B 1JWSA 1HXMB 5I8KL 2BVEA 3PABB 4LLVA 4XX1E 3QZWB 2LU3A 5IFJB 1WZLA 4RZCB 1H8SA 4YNYA 4FQXD 5F44A 2YKLL 3L6FB 1I3RB 4XPBH 2APWA 5AG9A 1X5YA 2EYTB 1VFAA 2HJFB 3BH9A 3ZZ1A 1IM9B 1KB5A 2H45A 5JOPD 4U2YA 1ULVA 4JGUA 3MRNA 4M6OL 1DUZB 1U3YA 2GJZA 3RX8A 1VDGA 1D7FA 1G7PB 1KTRL 2O5XH 5L8LB 5L9DL 1NMCB 1D6EB 1D3CA 1B0GA 4ZUWB 4K7PL 3ETBF 5EC1B 4J1UA 3WJLC 1GOFA 1Q72H 2VN7A 3VWJD 5KSBA 4HC1A 1BJ1J 4Y4FB 1TVHB 4X4XA 4KZDL 3GHEL 3WNKA 4UDUB 4PJ5B 2E5EA 3VFOB 2LAGB 1NEZG 1GGCH 5EZJA 3TA3A 1OTUC 3C2AL 4NZTL 4LCWA 3L3OA 2F54A 4JPIB 1GZQB 4L3AA 3TBVB 1F4XH 3HUJA 5DFTA 4F37K 2Q7YA 2FO1A 4RQQB 1Q1JH 1MFAL 4PJGE 1M4KA 3OGCA 4N1HB 3TPUA 5I9QC 4QHKJ 5MEND 4MJ6B 5C86A 1QQDB 5FKPA 4AEEA 2F5AH 3VFPA 4IRSB 3NTCH 3TVMB 2VLJB 5IMKB 2BRRL 3DMMC 1LGVA 2W65A 4JZNA 4XWOD 2OSLB 2OZ4H 1FFPA 1RZJL 1ZGLB 1MQKL 1YN6B 5T3ZH 5I19L 1JFQL 3RNKB 3RPKA 1ZHNB 3T0ED 4NN5C 5GRVL 1FCCA 4Y4HD 4JG1L 4L3CA 4JHZA 2MOVA 1UM4H 4LBEA 12E8L 3RKDC 2G5RA 5F9OL 1MHCB 1CE1L 1RUAH 1IBGH 4K8RD 2RQ8A 1H3TA 1GGBL 4KDWA 5C7XH 2R2CA 2VZTA 3SGEH 3AMLA 1UGNA 3FB6B 2VLRE 4YFDB 3GI9H 3LDBB 5ERWB 1TMCB 4Z8FH 3L3DA 3TFKC 3U1SH 2ARWA 3WL9B 3RVTC 4LAQL 2ZNWA 3VXOA 2DTML 1DL7H 3EIFA 2AEPH 1NC2A 4PJ7B 2CMRH 2N7BA 5B4MD 4WEUD 3TBTB 4M00A 1S7RB 2AVGA 3G6JF 4D0DB 4K9EL 3B9VA 3OG4B 1M6OB 5J3HC 3JWOH 3SDXE 1DTUA 3QIBA 1WAAA 2V5MA 4BK5A 4J4PC 3O4OC 5DJDA 4XAWH 5LAXB 5D7IB 1TJGL 4JFFD 4V1DE 5C0FA 1AKJD 3ZKQD 1EGJL 5H2BA 1JL8A 3CH1A 1ZKAA 1RFDH 1U2CA 3O9WA 5EA0L 2AQ3A 3FONB 1K4DA 1PY9A 3Q5TA 4WHCA 4O4YH 3BZ4B 3DECA 5IW1A 3F58L 4RBPH 4G8IB 2JB6B 5LCVL 4MX7A 3DVNB 2X4RA 4FMKA 4YBQD 4BSVA 1UXSA 3BWAB 2Z8RA 1DBMH 2PW1B 1L0QA 4MS8C 4LSRL 1WWWX 3MLVH 2VNCA 2UVEA 1RK1B 3FT4B 1J0HA 1J1OH 3G5YB 2VERN 1S7UB 4X5LA 1E27A 4YZFE 4RDQF 3OAUL 2BOCB 3SJVA 4OM1L 5HPOA 3LQMA 1SBSL 3V6OA 3CFKA 4PRAA 2AK4D 2NYYD 5KANI 1DLFH 4GW4A 1E6JH 3CPLB 2ITDB 2R0LH 2QQKH 5SWSA 4KAQH 3LSOA 4K23H 5I17A 4XPFH 3UJIH 4QHKI 4P5TD 1FGNH 4IJ3B 5IF0A 2ZUUA 1T03L 4WFFD 4WNQA 4AEHL 2DIAA 4Z7VF 3D5OF 1GHFH 2IQAA 3LS4L 2W60B 4U1HB 1CXFA 2BY3A 3F7VA 2C1PB 3ILPA 3ME0A 2EO1A 1GZPB 4MZ3A 1PQZB 3K3QA 4F57L 4ZFFB 2VXTL 5IFAL 4Y5XA 2EDYA 3NCBB 4O2CB 1ADQH 2X1OA 3LKQA 2Q86B 4B7LA 1NGPH 1UEMA 2WUBH 1AO7D 3KR3H 1LEGA 1A2YA 4X8JB 1OW0A 1N3NB 1QBBA 5FOBB 4NQCD 3RWGB 2P5WD 2VLMD 5D72L 3DV4B 1JVKA 4IIQA 2YBRB 3UTTD 1A0QL 1EEYA 4ELMF 1UVQB 3FOMB 3SOBH 4WV1C 4NFDA 4QHNB 5IBTL 2B0SH 3KPPA 5D2LE 5HY9B 3KJ4B 4N0UB 4I0PC 4GT7A 2F58L 1N26A 1TZIA 2IH3B 1ZLSH 5CD3A 4K7PX 1RV6X 3TESA 1KF9B 4PP1D 4XC1L 1H0DA 4I3SL 1KB5H 1YECH 1FZJB 1QSEA 3QDGE 3LRHA 3V4UL 4M5YL 5DFWH 5GHWH 4X6CB 3BH9B 2ITCA 3MJ9L 3ULVL 4NP4H 1XGQA 3MRNB 2ZKHL 1IKFL 4KRLB 1NCAH 1ZHKB 5IR1A 5EPMA 4ZAKC 1W0YT 2A83A 4UB0L 1T1ZB 1NBYA 4HC1H 4E0RA 3UP1A 2XZAH 2GUOB 5F7EL 3JV5A 2EECA 2X4OB 1G7MA 4OUUB 2VKXA 4X4XB 2N4IA 2DAVA 4UV4L 4JY6A 4NCC2 4ZNCD 1U6AL 3O2WL 5DMIL 3LN5B 4Y19D 1IZJA 4ZG1A 1CICD 4WFGD 3VI3F 3F7QA 1I8MA 5GZND 4DK3A 4NZJA 4UBDD 25C8H 3B9KA 4O00A 5DD5H 2YC1B 3JWDC 3LVEA 3AU1A 3GMRB 4HJJL 3NN8B 4ZUVA 1G7QB 4LCWB 5EFIA 2ZG1A 3HUJB 5FF6A 4D0BA 4KI5E 3P9MA 4MQSB 1N6VA 1NDMA 1MAKA 1DDHB 4QRRD 5A2FA 2EIDA 2YZ8A 3B6SB 5C0NC 4MQTB 4PG9B 5IEKB 4JB9L 3AREC 1JNLH 1FL6A 3NFPB 2P44B 2GQHA 4QRUA 2YS4A 3RIAF 1ZVSA 4I48A 4AEFA 1MREH 5D7LB 5EIIB 5EO0A