4WHTA

Structure of the hepatitis c virus envelope glycoprotein e2 antigenic region 412-423 bound to the broadly neutralizing antibody 3/11, p1 crystal form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
207
Chain Sequence
VKLQESGGGLVQPGRSLKLSCAASGFTFSDSYLAWVRQAPTKGLEWVASITNSGGRFYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTRMDYWGQGTTVTVSSAETTAPSVYPLAPGTNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural flexibility of a conserved antigenic region in hepatitis C virus glycoprotein e2 recognized by broadly neutralizing antibodies.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Viral protein
molecule keywords Heavy chain of the Fab fragment derived from neutralizing an
total genus 47
structure length 207
sequence length 211
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, X
ec nomenclature
pdb deposition date 2014-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4whtA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4whtA01
1RZJC 4UDTB 2W9DL 3PF2A 4N0CD 1FO0A 2AXGA 3BPLB 2MTPA 3SCMC 1A9EA 2ZUVA 3CSGA 1A1MA 3VG0L 2J4WL 5HHME 4DK3A 3V2AR 2HN7A 3AS1A 3EOAA 1FFPB 4O9HL 5DHVB 3EDJA 5I2IB 4XMLH 4M5YH 3C6LB 3LS4L 4RGNB 1QEWA 4KY1L 4LLUB 5D6CA 3IFNL 4RMQA 5E70A 4N0RA 3QSKB 5AEAA 1G7IB 3QA3B 2NY3C 4M1CD 2QQLL 3ARBD 3O4LD 4AH2A 4KKCD 4MCZB 2OL3B 3FT3B 5CEXB 1AQKH 3WIHH 4M8QB 4HGKC 2EO1A 3WYRA 5T1DL 4OCSH 4OQ1A 5D5MB 4YHIA 2BNQA 2OK0L 2VNCA 5KSAA 3QXVA 1M71A 1Q8MA 5AAMA 3WUZA 4K7PL 1DSFH 1YNLL 2RQ8A 4I3SH 5CEZL 3B3IB 2ESVB 2I24N 2IMMA 1IC7H 3GMOA 1K5NA 3U9UB 4NM8L 2NY1B 1H3XA 1CFSA 2OXGA 4OZGA 5FV2A 2H9GA 3DETC 4PV9B 3CXHJ 3RWEA 1YEHH 3GIZH 1L7TL 1MCOH 1DQMH 3I6LE 4WWKD 2Q76B 1UB5A 4GSDL 3D18A 4RFOL 2YWYA 4QRSA 4KJYA 5MENE 2VLKD 3VI4F 1U2CA 2H26B 3QWQB 3RAJL 1JHTA 4JFED 1YC7A 3NABL 3MRIA 1PX3A 1C5BH 3V6BR 1OSZB 3VFVB 4YQXH 5F96L 2VH5H 3V7AG 3MRCA 4Y4KA 3PDDA 2CIIA 4GKSA 3G5VA 1DUZA 2FSEA 2HMIC 3REWB 4NDMB 3HNTH 5IVXE 4S1DD 1K4CB 2LTQC 3IDGA 2NY5C 2EXYC 3U9UA 1J8HB 1K8DB 3E2HB 1NDMA 2AJ3A 4YC2B 5CINH 4S11A 1KELH 4Y4HC 5EIQA 4NKDA 1KN2L 3T4AA 4WENB 2JK5A 5F1NB 3AAZB 4P46A 3QR2A 4AEFA 5EZOH 3QHFL 4HLZG 2ICES 2YKLL 5KSBA 1EFXB 4MCZA 3WXWH 4NQED 1BF8A 3RWGA 3O0RL 1D7FA 5JXAL 1A9BA 3KPSE 1FVCB 4QRPD 3E6FA 3FB7B 4YDVB 4NNYA 1DBMH 1NGQH 1X5FA 2HFTA 3JUYA 2FHBA 1R5WA 4QT5A 4LSQH 1BQHG 1F5WA 2Y9RT 5FXCH 5E2UL 4OV5B 4F7TA 1P53A 1PG7W 1U91B 5DVMA 4BQBA 5K33A 1MRDH 3KPMB 3QUYC 4HLJA 5MERB 1OQOA 3HKFA 1AGFB 2F53A 3CPLA 1UCBH 4CMHB 3VW3L 1HZHH 2BOCA 1RZ7L 1F3DH 5I8OL 4R0LA 4P2OC 1HQ4A 4JJ5A 2WK2A 3O2DA 1T0NA 1NMCC 2W59A 3O3DA 3WN5B 2EE9A 1SJEA 4N8VB 5FYLD 5CGYD 5JW5A 3AXLA 5DJ0B 1P9MA 4NHUB 3QIBB 5ANMB 3QDGE 4FFZH 4MSWB 1NAML 1DQLL 3IVKB 2Z31A 1J1PH 4PRNB 3VXTB 3BEWB 4QXTA 2BP3A 5EFIB 4PTTB 4G6ML 3ES6A 1TZGL 2DICA 1LEIA 5C0CD 3MX0A 3EFDL 5F6HJ 4BM7A 5GIRB 1R5VA 5L2JB 1KYOK 2WWMC 5KVEL 2ZOKA 4HK3J 4OD2B 4BQCA 1QYGH 3P4MA 1VFBA 5D2LA 1BGXH 2Y07L 1JL8A 1BFSA 5FOBB 4G9FD 3UTZA 4QRPA 3SGDH 4K71C 3PDOA 3GJEB 4WO4D 5EUOB 4QOKB 4APQD 4HUUA 4Y8AA 3WJLC 1BZQK 3FB5B 3DSFL 3VFTB 2HLFD 4IRSC 3S34H 2AXFA 2SEBA 2AJ3B 4K8RH 5L6YL 3RWIB 5BRZE 3SO3C 4MJIB 3NCBB 2DQCH 2V5SA 4Y16B 2A74B 4NQXA 2X4SA 4QTHA 2DKMA 4HWZA 3M45A 4JEGB 1I3GL 4GRLD 3EYSH 2VE6A 3DVFA 1LO2H 3DBXA 4F7MA 3CK0H 3T0AA 3MGOB 4LCCC 3VXRD 5B8CC 3O2VL 1Z9OA 4OLVL 1RD6A 1MJ8H 4HQQH 3CVIL 3VXUD 3MRBB 1I1AA 1ZXQA 1TFHA 1LO4L 1JF6A 4OGYL 1MIEL 4BKLA 2Z8WC 3ZE1F 3DVNA 3AFLA 5HGBA 3DO7B 5JW4R 2P44B 2DYPB 3C6SA 3RU8L 1I1AC 4L4VD 2WANA 5IIEA 3TH4T 2R56L 5T1LD 1F2QA 3HPLA 3NCYP 2F8OA 3GMMB 3GSRB 3V0VB 1MCEA 2WWMD 2VLLB 4WGWB 1MEXH 2HKHH 1RUQH 2BOBA 2DBLL 2ZCLH 3H42L 3LKQB 5E56A 3HC3H 4JQXA 1MI5E 1CGWA 4O2CB 5D9SA 2XZCH 2W60B 4LPVA 2C7UB 3DRTA 5F8RC 5FFLA 3DX6A 4U7SA 2JCCE 3HI5H 3K0WA 4ZXBD 2YRPA 2Y5TA 1YPZF 3T8XA 1IEBA 3LV3A 3UJIL 5JMRA 5TPWL 5HVGB 4U4BA 4XC3L 5JQHC 7CGTA 1I7TA 1QHOA 3EJYC 4X4ME 3BKYL 4FQHA 1ZS8A 5IHZB 1G6RB 3N9GH 3QDMD 3AAZA 1UA6L 1HXMB 2EKJA 3BD4A 4HFUH 5CILL 1PYWB 3LD8B 1XF1A 2A83B 3ZHDA 5HDQL 3AY4C 4POZC 5KG9A 2P1YA 3KYMA 4ORGB 5CBEA 3BX7C 4XGZA 3HLAB 4PJDF 4EN3B 3MLSL 3S3SA 4XC1L 4GKOA 4WFHD 4JHBA 4JY5L 1BJ1J 2OR7A 4NN5B 5IFHL 4ZFOL 5LG1A 4ONGH 5TJWK 3HRZA 4Q6IA 1JZ5A 4I5BA 4EZMA 1RJCA 3W0WE 3VRLE 3DVNB 3GFUA 4GMTH 2A9NL 3Q3GA 3BAEH 4HIJA 2O5XL 5IJKA 2IBBA 2XKNB 5FGRA 5F7NC 3P4OB 5TPWH 3MRBA 1E4WL 4QO1A 4G7VH 2P5WD 5EULV 5AAWA 1SEBA 3ILPA 2R4RH 4Q6IB 4QWWC 4UNVA 3Q1SH 1GVIA 3VD3A 3K8KA 4OZ4B 2AJZA 4NGHL 1E4XI 2D31A 5ILTH 1NCAH 2P8LA 1OD9A 2JCCA 2KZ1B 2MOVA 5C92A 1T1XB 1D6VL 3FOMB 1OAKL 1CIDA 2G75A 2XQYG 4LSDA 3HC3L 3MSPA 4K3DL 1OTSD 3H42H 1IKNA 2J6EH 4W6YB 3AB0B 4ODTH 3WIHA 4HUUB 4R4BA 1CFVH 4M1GH 2NLJA 4WU7A 1MEXL 1KJVB 4X6DF 1XR8A 3OKLB 4X6CA 2GTZA 4X4XB 4MX7B 5D1ZB 1OTTC 5DFVD 3BZEA 4UI2A 2OS7A 4LCCA 1UADC 4M43L 3V5HB 1NCDH 2FX8H 5C08A 5GS1B 3NFNA 4LEXL 5L0QC 1I8IA 4N1EA 4U49A 1GCFA 4KQ3H 4LKCB 4EJ1C 1C7TA 4HX1A 1ZWIA 2PKDA 4NN6B 1T83C 1QQDB 1UH2A 1CICD 5EO1A 3BGMB 5MENB 5IGXH 3PGFL 3QXAB 4XP5H 1Z3GH 4HK3N 4Y5XB 3LKNB 1A9EB 1WGOA 3TESA 3PJSB 1WIOA 4K2UL 3BQUD 4G6JL 5H35A 5HD8D 2AV7B 3LN5A 4PJXB 1RIUL 3MRJA 3VGDA 1U2HA 2PO6D 2LV4A 3MRGB 4U0RC 2OJZL 3AMKA 4QHMB 4JVPA 5FF6A 4XWGH 4HJGA 4JZNA 1T3FB 1T1WB 5JW5B 5HHNA 3QDMB 1JNLL 1RY7B 2XWTB 3DSFH 4M9PA 1HQRB 2BVPA 5L8LB 3GRWA 2R0WH 1R3JB 5EWIH 1VHPA 1I9IH 1S8DA 1EEQA 2EDOA 3GNML 4AENA 2PXYB 2QKIA 2KPNA 3FTGA 1FE8H 2A6KB 2VAAB 1QYGL 4JQVA 5BMFL 3UZVB 1MF2H 3IJYA 3LKSA 1FFQA 3QI9B 4IRSD 5GGTH 5F1IA 4LBEA 2R4SH 2YC1A 1MAMH 4WO4C 4JY6A 4P2RB 2EIZB 4HFWA 4RNRA 5KSBE 5TDOA 4K3JL 5KAQG 2KH2B 1XIWD 4AL8L 2ZCHL 1UGNA 4QGTA 1S7UA 1ITCA 5JZ7C 1NGZB 5EUKB 5J12C 4Q58C 4WCYH 4F7PB 2V2TB 1BOYA 4CKVX 4Z76B 2EYRB 3ARQA 4LHUB 4HAFA 3TNNA 3WFZA 4ZPVB 3PDOB 2FYYB 1DBJH 4G8EB 1XR8B 4JCLA 1ACYH 1MUJA 2ICEB 3QDGA 1JYWA 4HS6B 4NRXB 3VXRA 4CDHA 2CKBA 1RZIB 5BW7C 1NMAL 4IM8A 3CX5K 3ZDXE 2OJEA 1YN7B 3QEQA 4P57A 5FK9B 4N0CC 4TSBL 1GGIH 5TE7L 2BJMH 3B8YA 4PJIF 5BO1H 1U6AL 3S36L 5IVZB 4JDVB 4X6FA 2PO6A 3UYOD 3N50A 3BGFC 4HKJA 1MCLA 4CVZB 1MI5B 3VH8G 1CR9H 4F8TA 4YHOH 4MLIA 5J13B 2P7TA 3U4AA 3GBNH 1CBVH 3KR3L 1W0WB 4AYFA 3VFVA 5GGSY 4UV7L 1N5AA 4M5ZL 1QLEL 4RSVA 2E7BA 1ITBB 3P9MA 5EN2B 2X89A 3TO4A 1S7VB 3D85B 3RWJA 4XMKH 1BJ8A 4FFWD 3UAJC 1F4AA 1QBML 3KPPA 4KKLD 3ZKQD 1RURL 2MPAL 3KPLB 3RWFA 3S37L 3BIBX 3IFPA 3V6ZA 5FECA 1D6EA 4C4KO 3DX6B 4FQLL 2FIKB 1YECL 4JFZL 1JK8B 3CFDB 4Q9RH 2NTFA 3F7VA 3MLYL 3GSOB 3E1F1 4U3CA 3I6GA 1ZGLP 4Y2OA 1IAIH 4X9HA 2IQ9L 3B3IA 3BIAX 2EO9A 2P5ED 1YY9C 3L3OB 2Q7YB 2BC4A 1KELL 5D2NB 3MR9A 4OCLC 5E8NA 2IMNA 3WBDA 5JIHA 1LNUA 3O6FB 5GGUA 4QHUA 3NA4A 1IGFL 5DJZB 4U6HB 2R2CA 4Y2DD 1VKXA 4GRWF 1VGEL 3ZE0F 2FECL 4ORZC 2BVOB 1BF2A 5ADPH 1Q72L 1G9MH 3SY0A 3WD5H 4H1LH 3PWPE 3GZKA 3VFMA 3VRIA 5A2JH 2FHCA 2H6PA 4IIQA 3TIDB 5AYQA 4XNZB 3C87A 2AJUH 4PY8J 1YYLH 3BD5A 3DYOA 5ISZA 3RWCB 4XNMA 5DJZA 4GSDH 5DC4B 4KAQL 3O6LH 4U7MA 3SDXF 5FKPA 1RIHL 1BD2B 3SCMA 2L0DA 5CEZE 1L7TH 2Z31C 3OMZA 3QFJD 5I30H 3FZUD 3TV3H 2H2SC 2PO6B 3AREB 3OAYK 2V2XB 4XPAL 1INQA 3RRQA 2VQTA 3AGVA 4XNQB 4MD5A 1AY1L 3MREB 3B2UC 1XGYL 1QSEB 3BQUC 2P5WA 1KCVL 1JTOA 3EKCA 1PD6A 4XPAH 1YNLH 5F44A 4F33A 2EE2A 2GQHA 1SYVB 2DQIH 5FV1L 3ULVE 1B0RA 4WFGE 1P5UA 2VLJA 1E28B 4DUXA 1YY9D 4KAQH 2BY3A 4JRXB 4OCSL 5C0AE 2IPUK 1KJ2L 4FOMA 1RU9L 1XAUA 4R8WH 5I0ZA 5INDB 4XI5D 4JFOA 4CUCA 4LPTA 2VXSH 1KOAA 2V7HA 4S10A 1BIIA 4NO5B 5T5NG 4BZ2L 4CNIB 4ELMF 3ZTNH 4H8WH 4O2EB 2GITB 5A1AA 4GXVH 3WD5L 2O26U 4NNPH 4Y1AB 2P24B 4D8PA 2LAAA 3B9KA 3LKPB 1NFDA 2R69H 4P9MH 5FO9A 1JE6A 1FN4B 3T0EB 4LGPB 1J8HD 1J0YA 3NCCB 3I75B 2W9DH 2Z31B 4GBXD 5IBTL 2AXFB 2SEBB 4LRIC 4KJWC 3FN0H 3MOQA 1XF5A 3N1PC 3PQYD 5E8DH 4DEPC 3ULSA 3OJVC 1ZHNB 3TPKA 3C08L 4CMHC 3T2OA 1ROWA 4XHQA 4FXLA 4UQ3B 1OY3B 4N5ED 2DTMH 3FMGL 3NPZB 4FQLH 5GGRB 5FB8B 4YBLB 3W2DL 3QHZH 4H20L 3GK8H 4KK8D 1XCQA 5CZVH 4LNRB 3BRDA 3LPGA 1E4KC 1U42A 4Z0XB 1MQ8A 4XH2B 2N4IA 1I4FA 1FFPA 1U8MA 3TBYB 3QRGH 3RDTA 3D3VA 2M1KA 1Q0YL 5HHPB 4GRWB 4DJMA 2VUYA 3MV11 4WTZA 2PTVA 3SGKC 1ZEAL 3D25B 4P46C 1P1ZB 4LDLB 1T04B 2X4OA 4YHOL 3RVTD 4JG0H 3DXAE 3WV0A 4YEEA 3KGRA 5GS3A 4RFNB 4L8BB 5I74B 3S36H 5DVLA 4DEPB 4P99A 4UTAH 3BH9B 3MV8D 2FLBT 1N2RB 5GZND 1OPGL 1JIBA 1X7QA 5FHAH 3EJYD 5EIIA 3MOAL 4JKLA 3FFDB 1ACYL 3FN9A 1VDGA 4NBZB 3ZMRA 3F65A 1I7ZA 1BIHA 3LOWA 1EXUB 2NY0B 1NDMB 2CLRB 4S2SB 1J8HA 1K8DA 2OTWB 3L5JA 1JNJA 1K4CA 4JPIA 1PG7H 4HS8H 4X6CE 3RVXD 5FO9B 3SE4A 3RVUD 1SJHA 4IRSB 2L7UA 4QGYA 5JO5B 3BH8B 3E8UH 3V6FA 5SWSA 4X99B 1HILA 1FDLH 1ZTXL 3O2WH 5T3XE 4CMMA 2R4SL 3MPCA 5CP7A 2EC9T 1U8LB 2BCKB 3QQNA 1EH9A 1FYTD 3O4LB 1MF2L 2KQMA 3O2WL 1FDLL 4UAOC 3BP5B 1BVKB 5GJTL 1FV1B 1K3ZA 1HXYA 5KSAC 1BLNB 3QUYB 4LLVA 1IZKA 1RHHA 1CFQB 2F15A 5HHQB 4DOHB 2Y06L 5FYJD 2GK0A 3MV7D 5HY9A 1OF2A 1WBXA 1A6PA 1E4XL 2YOCA 4NM4L 5H2BA 4HKJB 2AV1B 1OWWA 4ZFOB 4PJ9A 2Z31D 1FRGH 5C3LD 3WFDH 4J7RA 5JW4M 1JNLH 3C2SA 4AG4H 1N4XL 4MD5B 2C3XA 5CGYC 4LQFL 3UO1H 2OJZH 4NZDA 1QP1A 2A6IB 3R06A 1RIUH 4ZXBC 2V9TA 4PY7A 1QRNB 4S1RL 5HHOA 4LQ1A 1FNAA 2EDKA 2W1NA 1RUMH 1NBVH 5CWSB 3H6JA 5TF0A 1A4KB 1S9YB 4PRPE 5KSUA 3FT3A 5C0IA 1KN4H 4OZFA 2MJWA 2EIBA 4EXPX 4XB7A 5CJBA 2QADC 4R2GD 3B9KD 4P9HH 2FEDC 2FX8L 3U2SB 5BZWB 2FR4A 4Y2DA 1W0VB 4L3ED 5F89B 3HE6B 2BFVH 1WBZA 4QCIB 2D4FA 2HJFB 3TFKD 1JV5B 3G04A 4BFIB 1MQKL 5DRWB 4JPVH 4MCYA 3DOSA 3KYMB 4NKMB 4ORGA 1KJMA 3BP6B 3EJJX 1NBZB 1EO8H 2IPKB 1JYVA 2IALB 3G6DL 2NW2A 5A2FA 1WFNA 1OAKH 4D0DB 2YS4A 3NCJH 4Y4KC 2NY5H 1EFQA 4DUWA 3C08H 1HQRA 2BVPB 4ZUVA 5ILTL 1ZA6A 3BYTA 4FQHB 1U8KA 3N1QC 4KZDH 2WW8A 5KOVC 1RJLB 1T2QL 3Q1SL 4WEBH 1UWXH 4M4PA 3MNVB 2R4RL 3LMJH 5C0AB 5BOZG 4JN1H 3JWDH 1T80A 2DMKA 1WQVT 3LY6A 1OCWL 2AEWA 2HTLD 3W82A 5IMOA 3GMNA 2P8MA 2EZ0D 5I8EA 4YHPB 1FYTE 3RL2B 5HGHB 3DROA 5FAAA 4FQ2H 2JLLA 4WUKH 3TBSA 1CD1A 3HMXH 3HCVA 1IILE 4K71B 2Q3ZA 1O5DT 2Z8SA 3BKJH 1FFOB 1S7WA 4DCQA 1A6TB 2DIAA 2G2RB 3G5XA 5IFHH 3ZTNL 2ENYA 3NN8A 3L3HA 5B39G 2VABB 3FO2A 3QFJB 2Y1VA 4J1UB 4EN3D 2AK1L 1ND0A 3O11A 4HIEB 3U7YH 4MD0A 5ANME 5J9PA 3MLSH 3TNMB 3WLWC 4P3CH 3I6KA 1U3YA 3MLRH 2A2QT 2E7HA 3QEHB 9CGTA 5HDQH 4FXKB 3O6KL 4HCRA 1HWGB 1VFOA 3TF7C 3KWWB 3D39E 4OF7A 1NKRA 3WN5C 5BVPL 1WCBB 2A6JB 1FNGB 3BPCB 1RZGA 1U8IB 3N9GL 3LKRB 1U58A 2APFA 2MMXA 2XXCB 5BRZA 4GQ9H 2CUHA 5FGCB 2EH7L 4PREB 4TUJA 5A3IC 4PJDE 1A0QL 4OLXL 3C5ZB 1VGKA 5L8KB 3TV3L 3H9SA 1ZHKB 3PQYA 4FN0A 5I75B 3H3KA 4XPHL 2BNQD 3BP7A 5IQ7H 3VFPA 4KI1A 5AWNH 5F7EH 1RIHH 3EAKA 4LIQH 4F57H 5JLZA 1FAIL 3O6LL 1JPTL 3V8OA 1HCFX 4PJ8D 2EDEA 4D0BB 3V7MA 3WNKA 5IHUL 3QG7H 4G8GD 4GG8B 3O41B 2X4SB 4MMXC 1NDGB 3LKSB 1D5BB 2NY0D 2ZCLL 4Z6AT 4MWFB 3UTTB 3ZDYF 1ZE3C 2ADIA 4KDWA 1L7IL 4HBCL 1R3HA 3RVTC 3RTQA 4M1DL 1MCBA 1QACA 1GAFH 3KJ4C 2R2BA 4WWKA 1IGFH 2CR3A 1EEYA 2KL6A 5FGCE 4XCNA 3L95A 3U7AA 1KUMA 3DX8A 5DR5L 3U4EA 5IBLD 1QBLL 3RI5K 4MNHB 2EDXA 4M1CC 4PTUB 1G6RL 1YEIH 5B3NA 3RU8H 1NLBH 2R9HD 3KLSA 2R1YA 3D0LB 5EOQL 2IQ9H 4JFFE 2DQTL 2HJLB 3QIUC 4ZFFA 4XNZC 1YJDL 2A83A 2NX5A 3GEWB 1KIRB 2PETA 3SDCB 2DQEL 1J18A 12E8H 3ARGB 1L6ZA 2WUCH 1DL7H 5DJDA 1T1ZA 3P9WB 3ARFC 4EI5A 4ELKA 5E6IC 1A5FL 3PP4H 1I1YA 1QBBA 2MPAH 3W81A 3HHRB 1QBMH 1UFUA 3IVKA 1Y0LB 5IVOA 3ZTJG 1VERA 3L7FB 1TZHB 4AZ8A 1AFVH 5CZXC 1K4DA 1WWAX 5IVXB 1B4JH 3RGHA 3JXAA 5DK0B 4DOHE 3L3GB 2C7UA 3DRTB 1T0NB 3MV8B 1WT5A 1LNUB 4EI5B 4ELKB 5SWSD 5IW6B 2QADD 3S5LG 2Y07H 4X5WB 3CJJA 1RUAH 2VXQL 4KMTH 3CDFA 5JPMA 3F5WA 3GJFK 3I2CH 4ODVL 4TUOA 4U6VH 3CPLB 5IG7B 1WAAF 3RUGE 1YQVL 3WO3B 3DO3A 1BQHB 4L29B 2MKLC 3M17A 3VA2C 1G7PB 2AEPH 2HTKC 4XX1G 3WFBL 3DURA 5E9DD 3DX7A 3SGJA 2XZQH 3QJFB 1LP9E 1UC6A 4Q9BA 5ID1A 1QSFB 4LCWA 4UT9H 4MNQA 3THMH 5TDPB 1U3HD 3MLVH 3F7QA 3OAZH 5I8KL 4WCYL 5C6TL 4LU5L 4GG8A 5DEFA 1KC5H 1J1PL 1XZ0A 3QFDA 4HT1L 4X0KB 4KVCH 4MWFA 1VADA 2KBGA 3WS6C 2H2SD 4NT6A 2ZCHH 4UB0L 1HE7A 4GW5B 4K3JH 4R0LC 2I07B 4ZPTB 1YC8A 3WFBH 3O41A 1MAML 3RVVC 3NTCH 5GGTL 5CUSH 4ZTOH 2CRMA 4NO0D 3BPLC 5SV4A 2ZUTA 3CIQA 4Z7VF 5I18L 4H0GA 1WBYB 3X13A 2VXQH 1DANT 1MPAL 1CD8A 2VDKH 5FUZH 4WV1A 4FZEH 4RGNC 3MJ7B 3TM6A 5EWIL 2R1WA 4KROD 5E6IB 1R3IL 1RHHB 4LAJH 4DQOL 4JFDD 1I8LA 3JTTB 5IVNA 5T1MA 4G42A 1B4JL 2MNUA 3AU1B 3QO0B 5E2JA 3L3HB 1FIEA 4N0YH 5JDSB 2UWEF 4P2YA 2DI9A 2NY2C 4LLUA 1A5FH 3PP4L 3C60D 1CLCA 1KB5A 1F4YH 1LDPL 3O11B 4G6JH 4U1NA 5D71L 5DC0A 3O9WD 4DW2L 2FL5B 3KPSB 1Z3GL 5I16B 3PGFH 3D5OF 4Z7WA 4GXUN 4FQJL 2DQEH 3QHFH 2RR3A 4IBLT 5T3XD 5L2KD 5JORB 3KPNA 3SPVB 2EKSA 2ZCKL 5F1IB 3GSUA 3VXSE 3W11C 1YJDH 5F6IC 1MRCL 5FUOL 2DQTH 1UZ6F 4G6AD 1MELA 2FDBP 1UWEH 2CUMA 4H88H 1WAAE 4TUOB 3IFOA 5D7KD 2EEDA 3RL2A 4I0CC 5CINL 3B5HA 4X5WA 4LK4A 1LK2B 4L9LB 5DR5H 1TCRA 2RFXA 5J3HD 1U0QA 1QO3A 4NBYB 1EO5A 4L3AA 2OMNA 1QPPA 3QCVL 4KJQC 3GSNH 5C09D 3DIFB 4K94L 4XBPA 4M1DH 2P4AB 4ENED 4MB3A 4BQ8A 2Q7YA 1G84A 1AD0A 2ED8A 3BGFB 2DN7A 4HF5H 2J6EL 2XN9E 3MA9L 3NPSB 1MJJB 1T5XB 4BH8A 3RKDC 4U05A 1CXHA 1DN0B 1YPZB 1CXKA 4F7EB 4NUJA 4EBQH 2Y5EA 5CJ5A 1NCAL 4KFZC 3U2SA 4TSCL 1FAIH 3DXAB 1W0WA 4G9FA 4LIQL 5D6DC 3QB7C 4FXGA 3HC0A 5EO0A 3BDXA 5KANG 4PBVC 4G7VL 2V2WA 4RMTA 5BZDA 2A74A 2IAMD 2GHWB 2HT4C 4PGBA 3CFKA 4NM8H 4P4RA 1BZ7B 3AS2A 5DJ6B 4EDXB 2ITDB 3SDCD 1SM3H 4N0UA 5BVPH 2GUOB 5HYJD 2P46B 3IDNB 1CDIA 4MXQC 5L88L 4JRXD 1U3ZA 3U7YL 1FAKT 3W39B 3KYNA 1JP5A 3WJJC 2QQLH 1CCZA 4BZYA 3MCLL 3BKJL 4G8EA 4HFUL 5IB2B 1C1EL 3UTTE 4YBLC 2AJXL 4G6FB 3UTSB 3UTTA 3LIZL 3DARA 3P0GB 1BREA 1T1YA 2YUVA 4L3CB 2DM4A 1QD0A 4MNQD 2A9MH 5IB1A 3BMVA 4PJ7E 5EOCH 4IDJL 4QEGA 2DTSA 1RAMA 1F6AB 4G8GB 1SYSB 4A2MA 2PCPA 3UJIH 1FYTA 4JO1L 4O4YL 32C2B 2X4PA 3JWDL 3BPNB 1KXTB 1MNUH 2JB6B 1ETZA 1T0MA 2B4CH 1F11A 2VN4A 5ESVA 3QDME 5JO5A 2DM3A 6CGTA 3MV7E 3TC9A 3ZZ1A 2X5PA 4LVNB 4JFHD 4WUUD 15C8H 1HILB 1YJDC 3NCJL 4YUEL 3QXDB 4EI5D 2IF7A 1AKJB 1PGRB 2AEIT 3NACH 4N9GA 4HXBH 3K4ZA 5FO7A 3GHBH 2F58L 2AXHA 5F9OH 5JNYB 1NAKH 4P3DA 3WIIL 1NEUA 4M4RA 1DLHA 4MD4A 1HDMA 3ALWA 2BFVL 5INCA 3MRDB 1NUFA 3PABA 1D5XA 3BRGC 4JREB 5IW6A 3LN4A 4PRPD 4TTGA 1YEFL 4LSSL 2Z4QA 1R24B 1TPXB 1WTLA 5KVDL 3GKZA 1I3RA 2ESVD 5EBLB 4M7JH 1X7QB 5KAQF 1MH5A 1BVZA 3TIDA 1HHIB 1T21A 4GRLA 1Y0LA 1CT8A 3T1WA 3G5YB 2UWEB 2BSRA 3JV5A 4APQC 4EDXA 1KN4L 4YFLI 1Z0NA 4OQTH 3RY5A 1MWAL 1DBAL 3C60B 3QNYB 4IMKA 2GW5A 3WMSA 3DLQR 3O2VH 4GBXC 4HUNB 5DTFA 1QFWH 5BQ7A 5HGHA 1ZLSH 3INUL 4DVRL 5L2KA 5LQBH 1JGLH 4MLSA 4WW2A 3V5DB 3X11B 3UO1L 4NC1E 4YIQB 5EZIH 1AE6H 2YBRA 4OAWA 3EOTH 4WI4A 5CEYB 1ZLWK 4MNHA 2NX5B 5C0NC 1UXWB 2LU4A 2R2EA 4K8RL 3MC0A 1Q9WA 2FBJL 5E7FA 1G9NC 3BZEB 1E4XH 1NC2D 4NM4H 3T0BA 3HE6A 2VLME 5SWZB 3T4YB 2HTLC 5E8PB 3S96A 1QO3B 4A6YL 2QJDA 4RAUB 5TDNA 1WC7A 2R1XA 4GXUM 5J06A 2X6MA 3DIFA 2FH8A 3VE0B 4KI5C 3GBLA 5DMIH 5E5MA 4K55A 3CFIC 4MCYB 3BN3B 4JFFD 2UUDH 2GTWA 1FGNH 3CCHA 3EYOA 3GO1L 4EKXA 1S7VA 4LLAA 4RGNE 3ULVF 1OTTD 5DFVC 3TBVA 3O6FD 2D3VA 3NA9H 2L7JA 3LRGA 1ZLUK 4U3HA 4X6CF 3CVHH 1JZ2A 4MJ6B 1OAUL 5KZCB 3VD7A 4G6MH 4HS8L 1FH5L 5H8DA 2XTLA 2IAMA 5FYJH 1B90A 1AJ7H 3O2DL 3K81A 4KTEH 3RL1B 4EN3A 1SVCP 5BRZB 2ESVA 4U33A 4LCIH 5FA4B 4R7DB 1JMXA 4TUJB 4MNGA 1CFTB 2ITDA 2MKWA 5EBMA 4JM4L 1MHCA 3A6CL 2IBZY 2X4TB 1MCQA 1MREH 5DO2C 4G42B 2GCYA 5E94B 3F7RA 2MCPL 5JPNB 1UWXK 1QSFE 1WAAA 3RL1A 2FX7L 1XF3B 3UBXI 3VFRA 2VABA 3FO2B 2V2WB 1FFRA 3I9GL 1U8LA 1RZ7H 4Q6YA 5IW1B 1XR9A 2RCSH 4RIRB 2EE6A 4P4RB 5BJTB 5K9JL 4YBQC 4PGBB 2I07A 4ZPTA 3JWOL 5IB4A 5DHVA 1CGYA 3B6SA 1LP9A 5TDOB 1K85A 3WE6A 1TCMA 2XKUA 4EDWL 1KULA 5F7DA 3QRGL 2X9YA 3BESR 2IH1B 3OXSA 1EHNA 3DWTA 4QXTB 1MHHA 3PG2A 3VRIB 2IADB 4WHCA 2CRZA 5IV2B 2DJUA 3MNVA 4JFYB 1MCPH 5E4IA 3QHZL 5GGQL 3RTQD 3QFJE 1UB6A 4KXZI 2HFFA 2VMFA 1KEGL 3D9AL 2NW3B 2AQ2A 2AK4B 3WFHB 1FLRH 4XP6L 1XF2B 1ZLWH 3B8SA 7FABL 4L8BA 4Y4FA 4P5KB 5D7IB 2LVEA 4AT6A 5ISZE 1UWGH 3G6AB 3P9LA 4R90L 1XMWA 3TYFA 4OZHA 5T3XL 2A1WH 2J2ZA 4XP9L 3HNTL 1YY8B 2LTQB 2X1PA 4FTVB 4YFDB 5BV7L 4NNPL 3G6JB 4GXVL 3QUXD 1T20B 5F96H 4E41D 1WBZB 4YQXL 1QR1B 4JE4B 5ESQA 2YXMA 1MWAA 3OB0H 4OIIH 4Z7WB 2LU3A 5DTFB 5C0IB 4DGIH 5D7JD 1H8OA 1MH5B 2Y6SC 4PJ5E 1UZ8A 3V6ZB 5FECB 3IFLH 2NCMA 3L3KB 4OIIL 4OLYH 4Y4KD 4S1SH 1YEHL 4RGOH 4LCWE 1I1YB 4X6CB 4ZOEA 4HLZH 2JE8A 4PGCB 1T1ZB 1Z5LB 3RBGA 3GRWH 1P4BH 1MHCB 2FHFA 4R90H 2F54B 1T6VN 2FEEI 1IC7L 1CGTA 4KKCC 2A6IA 4LSPH 4I3SL 5CEZH 4UT7H 4LHJB 4Q0XH 1EA9C 3UBXA 3ALPA 2ZJSL 4ZDHB 2BVQA 3N06B 2FSEB 4LLVB 3QUKB 5EC2A 3BDBA 1OAQL 3RIFK 1K3IA 5GSVA 1DZBA 2DI8A 5GJSL 2QR0A 4UILL 3U30B 4JB9H 1V3JA 4MGXA 5GGQH 5SWZD 4OCWH 1R6VA 4KMLB 2R0ZL 3MRFA 1NCCH 1X5YA 1WISA 3WLBA 1B2WL 3DUSA 1JMZA 1OSPL 1T7ZA 2EYRA 3CLFH 3TNNB 4AQ1B 5MEPA 2NNAB 5EZJA 2Z92B 1Q72H 3KNBB 3DX7B 3LKOA 3QUKA 5ELIA 5C07E 3QUYD 3S4SB 5C0CA 1NDGA 3STLB 1SJXA 3TO2A 1IGJA 5A16A 1UM4L 1FZKA 3VD5A 4S2SA 4JFQB 4QYOA 2XQYK 1U8QB 1A3QA 4KV5F 3TA3D 4LVOB 1LILA 4EQ3A 1Q0XL 3W39A 3B43A 4G3YH 4JQIL 2DLFL 4Q9RL 4HUWA 3QEHA 3IETA 1YECH 3EHBD 1A22B 1UM6H 5C0DB 2X4RA 4WW2B 3L3DB 3V5DA 3X11A 5JQ6H 5KSBF 2JKXA 3TNMA 2HA1A 3PL6C 4E42A 4CU7A 1CLYL 3O6MH 4HPOH 4JO4L 5DXWA 5KS9F 1RURH 4E41E 5KVMC 2BOCB 4KHTH 5ETUB 1REIA 3OKKB 5F7LB 3O4OB 1SBSH 5ESQB 5D6CB 5JR1L 4YPJA 3T0EE 1AJ7L 1TQBC 3R8QA 1B88A 1BQSA 4GW4B 5HYQA 3RDTB 3OB0K 2CKBL 5BW7A 3LN4B 5E8OA 1TJHH 5JIKA 1ADQL 3QG6B 4HKZB 1DVFB 3MJ8B 4KJQD 4R7NB 1B0GB 4HX1B 4HJ0C 2VJXA 3ARTA 4UMGA 1MJJA 3H9HB 3MGTA 3UAJD 1WWBX 4ELMA 1ZHNA 1G7LA 4NCC2 4L1HA 2HT4D 3OKNA 4WU5B 4C56B 1XFPA 5HVHB 4E42B 1A14H 4PJBF 2HT3D 2VDPH 4XCNB 5EBWA 2KKQA 3ARWA 2VKXA 1EEYB 3ARBB 3OF6A 2PXYD 1T1XA 3O3AB 5DZNA 3OXRB 4GBXA 5F6IB 3LZFH 1FPTL 4R4BB 1TQBB 1X4XA 4Y2DB 2F19H 3GHEL 3DTXB 4U1IB 5J13C 1J1OH 4AL8H 3ARFB 3PL6D 3WS6A 3ZYIA 1URLA 4JO3H 5DJ2B 5A40E 1OSZA 2W9LA 1JV5A 2X1QA 2DWEB 3D0VB 3INUH 2XI9A 2XWBB 5ITFB 4WW1A 4OUOA 2Q86A 3D39B 1I1AD 2NY2B 5DD3H 1JGUL 5JOFB 4LVOC 3TO4B 4L8SB 5MEPB 1MWAH 3D18B 1T5WA 4PJEB 3C5SB 3JWOC 2ICCA 3H9SB 5HTSA 4L4VE 3C5ZA 5J3HC 2OR8A 2XTJD 4B50A 4P4KC 5L8JB 1RUPL 3QJHA 2PW2A 2ICEA 3D3VD 4JN2A 5D7JB 3QQ4B 3U46B 3VXMA 2DQJH 1YEFH 2WSKA 5DEZA 1QOKA 2VL5A 4NRYA 4Z7UA 3S98A 3IKKA 4JFEB 4D9QD 4GAJL 2E5EA 2I27N 1I7RA 1FG9C 4PRHB 2OZ4H 3OSKA 4PY7B 1FC1A 4OCRL 3CFEA 2XZZA 4Z95L 5J11B 3NZ8B 3PGCA 3D2UB 3EO0B 1JNNH 5DURD 5E24E 2FJHA 3RJQB 3QZWB 3HCVB 4QHLA 2D7TL 4LCUB 2NR6C 3AREC 3RWCA 4NBXB 3HPJB 5IGXL 5DK3A 2PXYC 3D39A 2Q86B 4Y4HD 4FXGB 3STBA 2ZSVA 3BDYL 1KCKA 2X70A 2V7NA 2Q6WB 4O2FA 1J8HE 4OZIF 4YHML 4XNMB 1FV1A 3WO4C 5E08L 4J23A 2PXYA 2QKIB 2ZKHL 3WNMA 4MA7L 4LEXH 5A2IH 3HRPA 4IDJH 4ODSH 5DEFB 2HN7B 1FO0H 1LE9A 3V0WH 4M43H 1SJHB 1I7UB 5LVEA 1F00I 1RIVH 5A2LH 2HVJB 1IKNC 1Z9SA 1QR1A 4Y5VA 1NC4D 5CBAA 4F9LA 5SWSB 3K1DA 5CCKL 3PWNB 3DX9A 4I0PB 4WTZG 5ESAB 5DJ8A 3X3GH 1CDUA 4P3WA 1MVUB 2R0KL 4PJCB 2GSIA 4ZOBA 4BFIA 5GGVH 1IC5H 1OTUC 3LQMA 3CFBB 2C4FU 4OCNC 1F42A 5DK0A 3FFCB 5IJVB 1ZT1B 3GMPB 4BA8A 5EBWB 2NW3A 4EI6B 3HMWH 3SDXA 3QH3A 1FZMA 2D7OA 1I9RH 4FA8A 2BHUA 5L2KB 1HEZB 4M7ZB 3IJSA 4GW4A 1E4WH 4OGXH 4OF5A 5HJ3B 5HYQB 4RFEA 3BT2H 1OGTB 1QZ1A 2OTUA 4PJHA 3BAEL 3VXME 1IE5A 4UNUA 5CD3B 3VI3F 1I9RL 1UM5H 2EICA 4K9EL 2YD9A 3HMWL 2EDDA 2EE3A 2WLYA 4GRWH 1W0YT 5HHOD 3S4SG 4JY5H 4TSCH 5I16A 1ZAGA 5AD0B 1VEOA 4LFHG 2XQBL 4JFDB 2XN9A 5TQ0H 1JNHA 4GRMB 3FQWA 5IMKA 3MA9H 3QDAA 5ETUA 2C4XA 3BXNA 4HF5L 1MAJA 4NQXB 5D1ZA 2YN5A 5C3TA 4N8PA 4YBHA 1FJ1B 1UA6H 3KPRE 5D2LB 1F11B 4K94H 5ESVB 5I0DA 5C0GB 1A3LH 3G6JE 5D2LF 4GAGL 3O4LA 4JKWA 4PLKC 5EBMB 3QQ3A 2WUBH 4AK1A 5EZLB 4AIZB 3WO4B 3IAPA 3FOMA 1NGZA 5EUKA 2J6EA 2ZKHH 3L5WA 4M6OH 2XT1B 2DMCA 5EU7C 1CICC 3TA3A 5SX4I 4MQ7B 4X6DE 5E2WH 2MCG1 4RAVA 2BNUA 4JQXC 5DS8A 1HHKA 3MA7B 1L4IA 3MRLA 4FQJH 1T22A 2IFGA 3TO2B 1IM3B 2XFXB 3CU1A 2D7TH 1F4YL 1LDPH 1MLCB 2DBLH 3T2NL 4UIMA 4HKBB 4JR9H 5IVXF 4YE4L 3B83A 1JPSH 3KPQA 4J3SA 3LEYH 1KEMH 2HT2C 3MRFB 4X83A 4AEHL 1NEZB 4QXWA 1LWRA 3T65B 3HG1E 1P7QB 4DKFH 4K3EL 2CSPA 3VWJC 1U36A 2PUQT 4DQOH 2DQJL 1QLFA 3QIWA 5EC2B 5EIIB 3MLPA 4PBWD 5MI0C 1MCWM 1L6XA 2VDKL 5FUZL 2V2XA 1MPAH 5H94B 2WMPA 5E9DE 4NSKA 1SEQL 3I6KB 3O9WC 1TETL 5DEGB 1QSEA 5CEYA 4NKOB 5H37G 4G9FB 4OLVH 3UBXG 5SWQB 1UG9A 5IT2H 1FSKC 1P4IH 3EOAB 5D7IE 2QQQA 1S9VA 5CSBA 1F97A 2E27L 3CK0L 3P2TA 4JZJB 5D9SB 3X3FL 2APXA 3WHE0 5D7LD 2NQCA 4Z78B 4UB0H 1X5LA 2JJSC 4LNRA 4P23D 4FQ1L 4NQSA 4KVCL 2DQCL 1C7SA 1M1SA 4BYHA 1U8OB 1YPZA 1DQDL 4HS3B 3AS3A 1FQ9C 3MBEB 3FJTA 1VENA 2BDNL 5F9WB 5EU4A 1YMME 4XNXH 1BOGA 4YR6A 5JTWA 3QDHA 1QLFB 5FCUL 4NNXB 4X80L 4GUPA 3L95B 2F53E 4FTVA 4HUWB 4Y16C 4Y4HB 5IJVA 2DD8H 5JIPA 5HHVL 3BO8B 5KVEH 3QIBD 1I9EA 2X2YA 2H32A 1KLGB 4XRCA 3SBWA 2GAZB 1FORH 2C4FT 1AD9B 4OLUL 4O02H 2G5RA 3EFDH 1OAZL 1DUZB 1NCNA 3B9KB 3LKPA 4LLYB 5FA3B 3WSQL 4YXHH 1TPXC 4U1NB 4X4ZA 3WFHA 2CKBH 4R4FH 4E41A 1OTUD 1T22B 3VRJA 3OKMA 1NH6A 1QKZH 4M9OA 1JHTB 4IEFB 4HWZB 2H41A 4ZSOB 5FYKD 35C8L 3QUMA 4MQ7A 1DQLH 3WLBB 1SBSL 5FYKE 4FFZL 2P43B 2YPKB 3MRIB 2H1PL 3QEQE 5HDBF 3FT2B 5BXFA 2X1OA 4F33B 1T1YB 4C56E 2CDGA 3UTSA 1P4IL 4WGVB 2P42B 1KIPA 3D39D 1RZGB 4LCWD 4NQUA 4NQTA 5KANI 3HLAA 2ZSWB 1TETH 1A6WL 4MS8C 2VUOA 1SEQH 1R5VB 2DB8A 4OCYL 5GS2D 1KJ2B 1UCBL 2BRRL 3MREA 1MUJB 3QO1B 3DYPA 1DBBH 1G6RA 1GZQA 4OZFG 1KPUB 1L0QA 3HR5A 1K8IB 3BQUB 5GGRY 1JN6B 5AUMA 1GOFA 4MNQB 4JDTL 4AEHH 2JJWA 2CDFA 2ZUQB 1GSMA 3S8WA 3R0NA 1BZ7A 1JPSL 3KXFE 3MLZH 5FCSH 2Y5TB 1B2WH 4K7PY 1KBGL 1NCCL 4X0KA 1BBJA 1TVBB 5KTEL 3EYOB 1YEGL 2IQAA 1U8JA 5FYKU 5J7CC 4WDIA 5EZOL 2HMID 4LRIA 3K74B 1DLFL 4NOBA 3T8XB 5CHNB 5C0RH 1IT9L 4XMPL 4PRNA 4P2QD 1LEGA 2CLRA 3MV8E 4JJ5B 2EDHA 1Q94A 3LS5L 3FTGB 3QHTC 4Q0XL 3CFBA 4OFIA 4CW1B 2MQCA 4UT7L 2GAZA 4PJGB 5CP3H 1ZMYA 4LSRH 3O9WA 5IEKB 1JPGB 4GAGH 2DMBA 2HT2D 3K3QA 5DMKB 5H94A 4ISVB 1NBYA 1V3LA 4HUKB 4HAGA 2DQUL 3UTSE 4S1SL 1C5BL 4RGMC 3DUUB 4PRIB 3TEUA 3UTSD 2C1OA 3SHSA 4GKZB 5GGSA 5D4QA 3MLTA 3TO4C 3DVIA 1CGUA 4P3CL 3IFLL 1IAMA 2R2EB 4NQCA 5TQ0L 1A2YB 3NCEB 4FQCH 3QEGH 2B2XH 1JWUA 4R7NA 5HGBB 3QXAA 1FNEB 4Y0GA 3BGMA 3CDCA 1IBGH 4I1NB 4JCMA 5F7DB 3TBWA 4XAWH 5DD6B 3V5KB 2C26A 4JGUA 4Y16A 2EDRA 2VOTA 1IFHL 4U2YA 3OX8A 4WI2A 2W65B 3UPRA 4XVUD 1MCRA 3WDJA 4ZUTA 3CDGA 2CQVA 1YN7A 5FK9A 2ARJA 1A6AB 4XT1C 3HG1A 1DSFL 2X4QA 3LRSA 4IMKC 4NFBA 4WHTB 4AEIL 3CU7A 4P46B 3O4OC 2CIKA 2E3VA 4PJDA 4ZPVA 4HWEH 2X4RB 4WFFD 3QXDA 3CAFA 1D5XB 4QOKA 1IZJA 4JN2B 5D7JA 1ULVA 4X8XA 4X7EC 3S88L 4HS6A 3SE8H 5IMMB 4LEOB 5GGVL 5F3HB 1J8KA 2WINA 4KC3B 4JM2F 1EO8L 3TBTA 1DTUA 3MFGB 3X3GL 1XF5B 4L8SA 5D7SH 3DV6B 4M5YL 5TFSH 2EIZA 4HFWB 4CU6A 3ARVA 3V4PL 5I8CB 3WIFA 3W9DB 1J7VR 2J4WH 2NY0C 1EJ6A 1U3HA 4I0PC 4P4KD 5C0BA 2D9CA 5K9JH 3QUZC 4KZEH 1EBPA 3BPOC 4OTXL 3HE7C 4K7FA 3ES6B 1PX4A 3I9GH 4NCDA 4XTRD 3O45A 2FX7H 4JFOB 1KTDA 3QCTH 4NCC1 1C5DB 2DQDL 5HHOE 3U0TB 3OTTA 1NCTA 3GSQB 1CVSC 4NHUA 4QRRE 2VDOL 2X89D 3GIVA 1SBBA 4NN5C 1XGTB 3V4VL 1BQHA 1KCRH 3OF6D 3EDEA 4LCIL 4PJFE 4LQFH 2XWTA 1JPGA 2OZ4L 3JVGA 5EU7E 3IDXH 1Z2KA 1BX2B 4U1HA 3MJ8A 3ZT5A 1CD1B 2X41A 1EGJA 1OAUH 3ESVF 1SQ2N 1V7MH 2MHAA 2Y06H 4OUUA 5BQ7B 3BUYB 2NY1D 1X5XA 1BD2A 4UDTA 4EIGB 3T0WA 3QIUD 3Q6GH 1DN2A 4JGMA 1AGCB 4M7KL 3IXTA 4Y2DC 1ES0A 2DQHH 4U6XA 2QQKL 2OTUB 2XTJC 1I7TB 2EH8H 1MCNA 5AZ2L 1IVLA 5C08D 2B5IC 3V4UH 3M07A 3G6JA 3BUYA 4ZD3L 1J1OL 4YHNB 4X9GA 1BP3B 3VGBA 4A6YH 3L3OA 1I9JL 2EYSA 4BSVB 4BFGA 3KYKH 5DQDL 3JSSA 1PG7L 4NUJB 1BPVA 4PLJC 5JHDA 3MBXH 2E9WA 4EUPG 1QFUL 1NJ9A 2Z35B 3K80A 4JFQA 3U4EB 1S5IL 4NN7B 3MOAH 3PWNA 1BWWA 1NAMB 1WT5C 3DYMA 3ULVL 4KK5C 2AJVL 2X09A 5E0QA 2YA0A 5AZ2H 4OZFB 4Z77A 3IB4A 2B7DT 5HXMA 4L1DA 4LL9A 2IANE 5BVJA 5I1DA 3Q6GL 3ILPB 1TJHL 1X5ZA 4G8GE 3ARGC 3CD4A 4JG0L 1KLFA 1T7WA 4M7JL 2EDNA 3PXHA 2O5ZL 4ZUSA 2QLVB 3OKDB 4LSSH 5D7LE 5GSVB 4DK6A 4YAQA 5LCVH 4L8DA 4QRPE 4P5MB 4MAUL 4E41B 1BECA 3BP7B 3S7GA 5JR1H 4NHCL 2YD4A 3WIIH 1RV6X 1MI5A 4KHTL 1HKFA 2F58H 3GHBL 4N0FB 1FP5A 5I15H 1ZSDB 2VLMD 3HZMB 3PV6A 1WVZA 4V2BA 5JQ6L 3ETBF 2VYRE 4MJ2A 4MQXC 3JTTA 2VC2H 3ZKMC 4QRRA 2DLFH 1UEYA 2CLVA 3Q6FB 4PGEA 3GGWA 5EOCJ 5FYKH 2B4CL 2JCCF 2PTTB 1OP9A 3L6FB 2YPKA 4Q2ZB 5MP6H 1E27A 3C5SA 4O4YH 1PSKH 4U1GC 1A6AA 3KLAB 4CADB 5CLWA 4Z76A 1ZOXA 1MCCA 5IWLA 3X17A 4PJGE 4OI8A 4NJAH 3AUVA 3LIZH 4M3JA 3SKNB 3VFOA 2CJUH 2GKIA 4OJFH 2VLKB 4U1IA 1GHFH 2X42A 3I50L 1OSPH 1EPFA 4PJ9C 3ILQC 4OCWL 1D5ZB 3FCTA 3OAYH 4JB9L 5CP3A 2QQNH 4ELME 2DYPD 2OTWA 2E6QA 5GJSH 3REVB 2IAMC 5ID0B 1JWMB 4GUPB 2AJSH 5EORH 5LBSL 2BXYA 2ZJSH 3GSOA 1HH9B 1ADQA 2ARWA 1BOGB 1HQ4B 1SM3L 2GJ6D 1BFTA 4G9FE 4LSPL 3JV6B 2YUWA 2NW2B 2O5YH 1CDYA 4TTDD 2Q8BL 2ED9A 5HI3C 1N0LA 3BP6A 4X7TB 4K7FB 4Q7DA 5DVNA 4NFCA 4QLRA 4FFVC 5I1IH 3BRFA 4I13B 4H1LB 1IBGL 5K59E 4HDIA 1UKTA 4NN6C 3EOBA 3ARZA 5I9QC 3STLA 2GT9A 1H8NA 2EIEA 2B2XL 3QEGL 4KK8C 4XCEB 4EBQL 4GT7A 4X6BA 5EZJB 4F9PA 3EZJB 3FKUS 1RK0B 3GJEA 3L5WB 3ZKSD 3GI8L 4MX7A 3RWGB 4NYLA 2DQUH 5GRVL 3CZFA 2W92A 2XY2A 2HRPL 2A1WL 3QCVH 2CLVB 3Q6FA 4OLEA 5T3XH 1SY6A 5FOJA 1N0XH 4LSRL 1ACZA 2VITA 5I17A 4FQQA 3TYGH 1DDHB 3AROA 4ZODA 1BZ9B 3DGCR 1SY6L 5T1LB 4XP4L 4CN4A 3B5GA 1NFDB 1DVFC 1OWRM 5L2JA 1IAIL 4I0PD 2YHGA 4JHAL 1RZKC 3D9AH 4MZ2A 4DTGH 4LLDA 3P11H 1KLUB 2F74B 2LAGB 5KTEH 4JG1L 1ZVYA 4NO2B 1PBYA 5HVHC 3G9VA 1N7MH 1BEYL 4XNYH 3ZKXC 3IYLW 4HK0B 2NR6D 2YC1B 5DYOB 1JFQL 4RISL 4I5BB 4PREA 5T1KD 4XZUB 4EVNB 3C6LC 4J3TA 4PJXF 4EDWH 2XV6B 5D7JC 1U41A 2E6PA 1X44A 2IG2L 3L5XL 4UV7H 2I25N 1K6QL 1HKLL 3BH8A 5C0GA 1UXSB 3JWOH 3QDJB 1DCLA 2P5WB 2HVKA 1IM9D 4AY0A 1HHGA 3IDJB 5KJRL 2AABH 1EAPA 3B4NA 4I2XE 2D7NA 4XXDB 2GJ6E 5T3ZL 4X7TA 1I1RA 4OCYH 3NZHL 5HD8C 3LN9A 1U6AH 1IEAB 8FABA 1QTYT 5LGKA 4KK6D 1JNHB 4GRMA 4JZNB 5FKPB 1GGIL 3BP4B 5TE7H 2CK2A 4JANA 1MREL 1BWMA 4GG6F 1KF9B 4JM4H 5DJ8B 5EUOF 1NANH 4QRQB 3CX5J 3T1FB 1IGTB 4OT1L 2H1PH 4R3SA 3PJSA 2H6PB 3ORJA 1NMBH 1ZVSB 3ZE2E 3WHE1 2O93L 2FO4B 3BH9A 2GFBA 2BVTA 2GK2A 4LU5H 4YJZL 3LB6C 4U1JA 2ZG3A 2AW2A 2ZOLB 5FF6B 4NKQB 1HOCA 1BFOA 4FMFA 4KKAC 4P2RD 1HWHB 4PRAB 4UT9L 4DKDC 1G7MB 4NO3A 2W60A 1G7IA 2ITCA 3RVVD 3LN5B 4WTXA 1CYGA 1K8IA 3BQUA 1H9VA 5C08B 3MRMA 4R4ND 4PGEB 2MHAB 3B2UD 1TVHB 1J0IA 1U8HB 3GSWA 4KJPC 4NO0A 2HT3C 3DMMB 4OGAD 4QHNA 1FORL 2OX5A 4LF3B 1BHGA 1AXIB 4D0DA 3IS1X 1T4KB 2NLJB 4WU7B 1A7RL 4TULH 2VL4A 3L6FA 1JGVL 1FE8L 3PGCB 1T7YA 4I3RL 4HIIA 3PWVB 2CIIB 4GKSB 3VDCA 4XVTL 5HBBA 2DQFB 4IRJC 1JF5A 1I9IL 2B4CC 4IDLA 4ZO8A 5EOTB 3E2HC 5CGMA 5EU5A 5HPMB 2FBJH 1J0KA 4M02A 1I8KB 1D5MA 4CJ1A 1ZSDA 1MI5D 5DRNA 1RJYA 5EZIL 2Q76A 2YSSA 4H0HB 1KCSH 5IM7B 4OFPA 4JKKA 3HE6C 4HW6A 3IXAB 3QUXA 4W4OC 3QCUH 4PV9A 1TNNA 5GGVY 1S9YA 4U7KA 1DL7L 2WUCL 4X6FB 1FHGA 4TUKH 4U1MA 4Y8DC 12E8L 25C8L 3MJ6A 1DBAH 3WKNA 4RMVA 4ZFGL 3CMOH 3IAQA 5B3JE 4L4TE 5B38A 3FO1B 2EYTB 5BVJB 4MNGE 4LHUD 2FJGA 1TZIA 1NLBL 1T83A 2WINB 1UYWH 1G6RH 1I7RB 1SMAA 1QBLH 1U8IA 1NCDL 4WUUB 4CVWA 1R3LA 1MCWW 2C3VB 3RWDB 1VFAB 3HE7A 2JJTA 5IBUG 4NNXA 1QFHA 4MA3A 4U1SB 3QA3A 3OR7A 4ZOAA 3LEYL 5F9OL 4IMLA 3ZE0E 5KN5B 1HH6A 1DQQB 1KENL 3QWRA 2Y7QB 1XIWC 3KXFD 4JPWH 1UXWA 3D69A 5KG9B 1QVOB 4Z7NE 5HYEA 4TPRL 3QG7L 5A43C 4H5SB 4PBXA 1B9ZA 3D0VA 2HH0L 4NGHH 5E8EB 5DHYA 4P4KA 5C0BD 3JVGC 3TBSB 5AWNL 5CJXA 3VCLB 1G7QB 3L9RB 3TCXA 5C0EA 4XPHH 4PV8A 2ZOLA 1MCHA 3QZWG 2FGZA 2QTEA 2A9ML 3HZVB 4A6YA 4WI9A 1CU4L 3K46A 4GQ9L 3PV7A 1SVZA 1QSFA 4LCWB 2Y6SD 5TE6L 2HJKB 5HYSB 4PJ8C 1KPRB 3O4LE 3PIQA 4NQEA 5CZXD 2CK0H 3IJHB 4AMKH 1DUYA 4LLQA 2X9WA 3B5TA 3MV9D 1FVDB 3RKDD 1YMMD 2DI7A 4LKXA 1TTUA 5CLTA 4XC1H 3IU4L 1U8PB 3T1FA 5H35B 3VG9C 2VAJA 1HYSC 4OCMC 2H3NB 2AK1H 2Z91B 5J6HA 5L88H 4YIQA 3FB8B 1S5HB 3JTSA 2CLZA 3BP4A 1FL3B 1S7QA 2DRUA 3VD4A 2YR3A 1Y18A 4FZ8L 2C9AA 4NNYB 4NQEB 3RA7H 5CILH 4K9EH 4HUVB 2BSTA 3RFZC 5E99L 3H9YA 1QG3A 3F58H 4FQ2L 4ODBD 2WIIB 2A77L 3OZ9L 3BKYH 2DLTA 4B7LA 3U48A 5LJYH 2HLFC 3KNBA 1K4DB 5C86A 4CN1A 5EO9B 1T0MB 2VE6B 1BBJB 1TVBA 4PJHE 3DUSB 1OCWH 2BSRB 3CFCL 4K7PX 3RZCA 3M8OH 3GDBA 4IS6A 5DI8A 1XF4B 1NBQA 4RWHA 3MRHA 4WEBL 5E2VH 4U1SA 4G9DB 4KUZH 5GS0C 3HI5L 1X5GA 3EYUH 3IETB 3QXUA 3GBML 4DVBA 2MFNA 4X6EB 5HHXH 1JPFA 4U3XA 5IB5A 3G6DH 4WHTA 1RUQL 4LLDB 5KN5A 5I1LB 3NGBB 4OD2A 5AG8A 4YDIL 2BVUA 3SQBA 3U0WL 5CCKH 2QHRL 1RJZA 4FABH 3GSNL 1IL1B 2AK4D 2VB5A 4ONHA 2ADFL 1NFIA 1RZIA 3IRZA 2P8LB 4PRPA 1QSFD 4MXQD 2R56H 1FO0L 3KHOA 1MFDH 1QR4A 3ULSB 1HIML 4XPFH 5HHMD 2PR4L 5F7UA 3STZA 4CN6A 4H88L 3QIUA 4ALAL 4JHZA 1A2YA 2DLHA 3E3QC 2V5YA 3BDYH 4TVPE 3MLTB 3IF1A 3ZO0A 1RK0A 2VR5A 1RUML 4DW2H 3PP3K 3QJFA 4YDJB 1H8SA 1J5OH 4M03A 1OTSC 3U30C 1DEEB 3RNQB 5FDYA 1A47A 2F9BT 3EYSL 3H9SD 4LBEB 4NIKB 2G5BA 4PTTA 4Z95H 1I3GH 4OCRH 2XXMB 1U3JA 2F54D 4GAJH 1UACH 3LHPL 1U8NB 5L6YH 3S34L 4YHIB 4C4KT 1K2DA 2VLRD 2FNBA 4U1KA 1HYRC 4Q9QL 3AXLB 2Z93A 5DJ0A 1NCWH 1A6UH 1TVHA 3BJ91 2VIRA 1OHQA 4G43B 4S0SD 1W8NA 1AHWB 5FYLE 4HULB 5LWYL 1KXQE 4B53A 4R6UA 5I18H 4OD1L 1RULH 4X7DC 1JGDA 4OZIE 4DFIA 5JW4N 5HVWA 4YDVA 4L4VA 3WUWG 5DD3L 5DJAB 4ZTOL 1ZVHA 3C5ZC 4CJ0A 1ZHLB 5C0EB 4ODUA 4PJ7A 3LV3B 4R96B 5T3ZD 1Z0MA 3QI9C 3HS0B 4QRQA 2F19L 3GHEH 3T0ED 3H2WA 4RMUA 3WE6B 4HT1H 1YY8A 2VDQL 5GS0H 1JUFA 1PDKA 5KSVA 5LAXB 4PGDB 3FB7A 5FM5M 3P73B 4L4VB 1F45A 3THML 3S36X 4C83B 2R1YB 1ZT7A 1EBAA 1NAMH 1RPQA 2YD7A 2P5EE 1IGTA 4OD3H 1WK0A 4QRRB 2AEPL 3QIWB 5E9DB 4D9RE 3R1GL 2HFFB 1CQKA 4N0UE 5I1JL 5J8OA 5BS0B 1PQZB 4ODVH 3HZYA 4R7DA 5EU3B 3RUGF 1ADQH 4Q74A 1A4JB 5KBNC 1YDPA 4IRJD 1J87A 2EXWD 2F8VA 1P7KB 3OJMB 4CRPA 4F7MB 2D2OA 1GL4B 3CLEH 1MRFH 4OF8A 4D0BA 3CFDA 3ZDZF 3SGEI 3ARBC 3KPSA 3QWOA 5C71A 1KTLB 1AFVL 2VZOA 4L9LC 5IOPA 4M7LT 4RIRA 3MYJA 4PRHE 5JXAH 2V7HB 5E00B 2XIDA 4ODXA 3JV4B 3OL2A 3QUMB 2C3HA 5C2UB 4M7LL 3C2AL 3RDTC 3GK8L 3CCHB 1W72B 2AXJA 3W2DH 3SKOB 3H3BC 2DTML 3FMGH 2LU7A 5EU5B 3QYCA 5EZLA 4AIZA 1HNFA 5CMAB 4UQ2B 2IGFH 2OJEB 1CFBA 4X9FA 1CL7H 4K23H 3SKMA 4JAMA 4MJ4A 4DN4L 5GZOD 1D5MB 3FRPG 3P40A 4PRIE 1OQXA 3MV9B 5EOQH 5DFWH 5A3ID 4PRID 1JCKA 2VWEE 5HYJE 3FN0L 1WBYA 3X13B 4TVPH 2DAVA 5ICYA 2N7BA 5F1SA 1INQB 3TVMC 2F8XC 1S7XB 1EAJA 4BFBD 5IWLC 1OF2B 5E8OB 1GAFL 2R69L 3VGGA 3G5ZA 3BEWA 3ARXA 3C9NA 2EECA 4PG2C 3ZDXF 1T03H 1P69B 2VLJE 3LQAC 4J8RB 5C07B 5DURB 3CLFL 5DJAA 5CD3A 4BZ2H 5M95B 3QIBA 4EN3C 1CGXA 4X6BB 3NABH 1JWUB 4DGVL 4OKVA 3RAJH 1ZK9A 4O58L 4R8WL 5ITBH 5T1KA 4EUPB 1KJ2H 4NO3B 2EC9U 4RFOH 4ZYKB 3RUGA 3KYAA 4F57L 5F7EL 1DQML 2NYYD 3GIZL 4KK6C 1T20A 1YQ2A 3L3DA 1ES0B 1H0DB 2DQIL 4FFWC 1XGUB 4JPIB 5F71A 4R3SB 3PUCA 1DLHB 3EUUA 4WEUD 4JDZB 3WFCH 1AY1H 1CICA 1P4BL 2HG5A 2W91A 5J11C 4X9BA 3WCYA 5B39A 1CGVA 4QY8B 3KPRB 1U8NA 3QIWD 3V95A 5I30L 5D5ME 4KK9C 4QCIA 1I8MA 2HVKB 4RGOL 4Q9CA 3BEVB 2Q8AH 5IEHB 1KPRA 4JKMA 4QRUB 3O6KH 2OK0H 3MLRL 2WQRA 3LKNA 4WWKC 5DD0L 4LPWA 1EZVX 1YYLL 4L8CA 4WY7H 2V5RA 2AJUL 4X7CC 4BQ9A 1C8PA 2R39A 3IDUA 3VXRE 3BZ4B 4DGIL 3IGAB 5E95B 2CR6A 1FVCA 5ACMA 3RUGB 4Q2ZA 1FYTB 2E7CA 2XPGB 4KY1H 3PWLB 1FZOB 3TT3L 4YHLL 3WL9A 2V7NB 4PRPB 1OW0C 4XMLL 4L3CA 1N3NA 3AY4A 3RNKB 1VGEH 4KMQA 2IJ0C 2ICWJ 5HI5C 4DZ8A 3MGOA 1NGYA 1UWGL 3GM8A 1HHJB 1QLRA 4BFEA 1CF8H 4NQVB 3BIKA 4JFXB 5MEQB 3QZWA 1VFUA 3TZVC 4I48B 5EG6C 4Q97A 4YEFA 1KJ3L 4U2ZA 4DGYH 3TPUA 1FLRL 4XP6H 4Z7VB 5DDHA 5B3JF 1KEGH 1Y6MR 5CIPH 4HWBA 4J4PA 2NY5L 1IGYA 3MRRA 4P2QA 1MCPL 4RFNC 3VI4E 1ETZB 3W5MA 4F37K 4JPVL 5FM4A 4XMKL 5HYFA 3DMMC 4HH9B 3PWLA 2D7QA 1BM3H 3MMEB 1C16B 4GKNB 1CE6A 4KI5D 5BZDB 3CXHK 2Y36H 1QLEH 2X1WL 3JV4A 1UJTA 5D72L 4P9HL 1A6TA 2CXKA 3KR3H 4IOSD 4XCEA 1NCUA 2RCSL 3OAZK 2GT9B 5FGSA 2YSSB 1VCAA 2FGWH 2GJ6B 1LDSA 2VZTA 1TLKA 5D7IA 4PIRF 4U0QB 1PQZA 3SKUD 2MCPH 5IP4A 3QT2A 4N8CH 4Y4FB 3SDAB 4PRBA 5DWUH 1DR9A 3HN3A 5B39B 1HH9A 3D85D 4S1RH 1FNGA 5IBUB 1GGYA 3PIQB 4E0RB 1R3JA 4L8SC 1YNTA 2VZ1A 3VRLF 1DBJL 1JJUA 1HXMA 3KJ6L 5SX5K 2QEJA 3ARDC 5B21A 1RHFA 1N4XH 4KTEL 3WFDL 4P48A 4E5XB 4D9RD 3CSPA 3TN0A 1FH5H 3N1GC 4KHXL 4N5EC 4P2CG 3CVHL 4POUB 2G2RA 3HS0A 3B9AA 3NA9L 4TOYH 1JHKH 4JRYE 4WFED 1AO7D 4UOW0 4CW1A 2IWGA 1KSRA 3RWHB 2EXWC 3HPJA 4LSVL 1II4E 2X1XR 4CGTA 1JUFB 5KSVB 1A6ZA 1I8LC 4LAQH 1EEUA 1BFOB 1FGNL 1S9KC 3MUGB 5I19H 2R0LL 4LVNC 4LP4A 3A6OA 4IIQB 1ZTXH 4H5SA 2DIJA 3F7PC 3ET9F 3OAUH 3P4LA 3P0YL 3E8UL 3V52L 3GNMH 4PJCF 3P4NA 5FB8A 4NJ9L 5F7KC 2E7LA 1IC4H 1UVQB 1R3LB 2C3VA 1PVHA 3BGAA 1UQSA 1YEDB 3FL7A 1IEHA 1KPVA 2H32H 1I1CA 1IGCL 3OR7B 5E1AA 3I84A 4X6DA 3S97C 5GS0D 4WI6A 3GGWB 1BX2A 1CD9B 1F90H 4ZS6D 3MV9E 4KKBC 4XWGL 3I85A 1QNZL 3FONA 3SE3C 5C6WH 5LQBL 1ZLSL 4DVRH 1NGPL 2EDBA 3ARGD 3BPNC 5E00A 5H2BB 4BUGA 1Q9LB 5A16B 1F2XK 2WP3T 3BW9A 1M7IA 3MCKA 2V9QA 3OJ2C 4HGWB 4UTAL 2ZPKL 4F9PC 1F4WH 1NMCB 1R0AL 4YGVB 4OQTL 1EV2E 4XPBH 5E6YA 4TNVK 1H15A 4KQ3L 3SDAC 4YAQB 2JB6A 2D0GA 4D9LL 4KJPD 2A0LD 5DF0A 5C0JA 1XEDA 3OKMB 5ITFA 3F62A 3QDJD 3QEUB 5FDWA 5ID1B 1QBAA 1T89C 5EOTA 3KPOA 4M6MH 5E6IA 2ZNWA 1OOAA 5TDNB 4ZSOA 3Q48A 3GMLA 2J7LA 2ZUSA 3GSNB 5SWZA 2KZWA 3OKOB 1U95B 2AVGA 4HXAH 4XBGA 5B22A 3TBTB 5CZVL 4HIHA 5IQ9A 4K3DH 1P7KA 4LF3A 3VH8A 3ABZA 5IMKB 3S5LB 4NO0B 2J88H 2CMRL 3TPUB 4APQB 1ZANL 2OI9B 4YHNA 4XXCA 4KRPC 3OPZH 2NTSP 4PJBA 3SO5A 5EU4B 1MNUL 1AO7E 2HP4A 4X6EA 4J4PC 4KKAD 3NIGE 4MXWL 3BP5A 4DZ8B 1F6FB 4J6RH 2Q3AA 5JA9A 5EO9A 5EOCL 3C60A 4G80B 1DVFA 4JVWA 4O51A 4LHQB 1GPOL 5DZLA 2O61A 4IS6B 2A9NH 4PJ7B 5DI8B 5J1TC 4LMQE 5DD6A 3V5KA 4P9ML 4HC1L 4Y19D 3RZCD 2FECI 2AJXH 2X44D 3TJHC 4HDIB 1C1EH 3DV4A 2YK1L 3SDXB 3IDYB 4QF1B 3KG5A 3O8XD 4OFYD 4ONFH 1L0XA 2NXYD 1BQLH 1ZVSA 3ARGA 5LGHL 4J3OC 2VXSL 3VFGH 4G43A 4U6TA 3M1BB 3TYFB 1RU9H 3R4DA 4KKNA 4PB9H 5IEHA 2BOBB 3KDMA 1GC1L 1H3WM 1P84J 2GJZA 3JV6A 3EOYG 4NFDA 4PB0H 5CKAA 2NXYC 2VKWA 2JIXD 1ZT4A 4ONOA 1DUYB 1P9MC 5CKGA 1AD0B 5CGTA 5K93A 5ADOH 4YWGH 1JWMA 2AK4A 4HV8A 1O0VA 4Y5VB 3BE1L 1YNTB 2WBJD 1DEEA 3RNQA 3FRPA 4ZOCA 2VXVH 4OFDA 5HHNB 1QSED 1R5WB 2J1KA 4JFDE 3MJ9L 1D9KB 2VDLH 2PYFB 3LEVH 2WV3A 1T7XA 1ZHBB 3O45B 5D2NC 4EEEA 1NC4B 3SKNA 3QISA 4OLWL 5DJXA 3SE4C 3T0EA 1YMHA 5I1CH 5C0CB 1A3RH 2FWOA 1G0XA 3KXFB 3NCMA 4IRZH 2NNAA 1A1NA 4HSQA 3IDYC 2P5EB 1S7RB 1WICA 4GKNA 3MACL 1G9ML 5DS8B 5ADPL 3EO9L 2VQ1A 2R8SH 1EHXA 2HKFL 1KPUA 2XYCA 4LSTL 5JW3H 3LKRA 4JRXA 5I1KH 1BZ9A 4ZUWA 2X4NA 3CZFB 2OL3H 4Y89A 1MOEA 3OKOA 4L5FH 4J2XA 3ILQD 3SKJH 5F1NA 4ZAKB 5J1AB 4FP8H 3WHXA 3DMMD 4YDLB 2AI0L 2J5LC 3LRSB 4NUGL 1IQWL 2EYTA 3TWCL 3FO1A 1T2XA 1AP2A 4WNQA 1FL5B 1MRCH 5FUOH 5TF1H 1QRKA 3CGTA 2VDNL 2B0SL 5GRJL 5GRYA 1PKOA 3CVIH 3CXDL 4PJ5B 1FN4A 3EDKA 2WBJC 3Q5OA 5F21B 2CDGB 2ZWLT 2XWBA 3KPSD 4TVSa 2AS5M 4I8DA 4Y1AA 1IJ9A 5C70A 4ZNCD 1M7XA 5DUBB 4LLWA 1M6OB 4P23A 4HGWA 5GRUH 1FNLA 1A4JA 2YA2A 5HI3D 3K8LA 3N85H 4N0YL 3HZYB 3ULUE 2WBJA 3RZCB 4NWUH 4HIJB 4M5ZH 3OKEB 3OB8A 4MVBC 4R26L 1SHMA 3ELAT 1QA9B 5B8CA 3GBNL 1JWSA 3T0VA 4Y4HA 1CR9L 2FATH 3O3DB 4I18C 4RQQB 3BW9B 4HV8B 4LHUG 1XH3B 5HPMA 3BISA 5BO1L 1FCCA 3OGCB 4P5KA 4UT6H 4FFYH 5JHDB 3PWUA 1LK2A 1A7BA 3HUJF 5CUSL 2IALA 5GRVK 3NTCL 5HGDB 4DZBA 1MLBB 3F12B 1NMAH 4IOIB 3RX7A 5DRWA 3I6GB 2BMKB 1TZGH 1OAYL 5DQ9A 1D5ZA 3FCTB 5E1AB 1EHLL 2COQA 3JWNC 1NFKA 1U8HA 5C6TH 4M6AA 1HI6A 4NC0B 3BZFB 1NFDF 2XA8L 1DVFD 2OP4L 5EPMA 4QRTB 5C0CE 2VLRA 1ORQA 4MQTB 4O51B 2VDMH 4MNQE 5C0AA 4ZXBB 2OSLB 3UTQB 2XZQL 4OUUB 4HKXA 5LXGH 1VEMA 2Z4QB 2DBJA 1MFEH 3MROA 5C07A 5FYJE 4F3FA 2J5LB 4PJBB 1AHWA 1EVTC 4Z7QE 2WQ8A 5BMFH 1F4XH 1IEAA 3VG9B 8FABB 3I2CL 4U6VL 1EERB 1NC2A 4IOIA 2YPLB 1H5BA 3UMTA 4KQ4H 3MRNA 4PP2B 2DJ4A 2R0WL 3GM0A 1WIPA 1FGVH 4X5LA 1UXSA 3QDJA 1EUTA 4P57B 3EYVA 5E2UH 1IM3A 1GOHA 4MA3B 4RZCA 3CFEB 4YZFE 3TZVA 4C59B 1MFAL 2GSGB 1IM9A 1JZ8A 2XN9D 4NQCD 2ZSWA 3SKMB 1NCBH 4YDKL 3QEUA 4XP1L 5FDWB 1VADB 1T66C 3H9ZA 3O0RH 4Y7MA 3QQ4A 3U0TA 2BCKA 4Y4FC 4K2UH 3WXWL 1N64H 3EDDA 5GRZA 2JIXB 3VRJB 5F88B 4CVXA 5KS9B 2YKLH 1MJUL 2BY1A 5C0ND 1M6OA 3MA7A 3BFOA 1VPOH 4P0DA 1AH1A 3U4BL 43CAA 4U1MB 2VO5A 2J8UF 3BKCL 2VZUA 3PL6A 1Q9WB 3SBWC 5CIPA 1YEIL 3TLRA 3K2UL 3TJHD 2GY5A 1KNOB 1YDPB 4X8JB 3RX5A 5D70H 2HRLA 1HSBB 2Q1EA 3ISWA 5T1LA 3UC0H 4J3XA 2R1XB 4MHHG 3OXRA 2D03L 3OJDB 5C0AD 3F7YA 1S9WA 4NQVA 2YEZB 4OZHE 4M1GL 4OM1L 1YYML 1CLZL 2FYYA 1CFVL 3C5ZD 4BSVA 4ODTL 4KRMB 2CRIA 2W0LA 3DJ9A 1T1WA 2NXZB 4LOUD 4UINL 4NN7C 3WJLA 2VLRB 3T2QA 4UV4H 1G0DA 2K9UA 4OZGF 2DLIA 1JPTH 3A67L 1W72H 4KGJA 1MCOL 3FZUC 1ZA3B 1R24A 4HJJL 4PGDA 1FFOA 1S7WB 5K9QG 1GGTA 3RWHA 3L1OH 4L4TD 3V79C 3PABB 3WDIA 4OLXH 3ME0A 3TZVD 5MEND 3PQYE 2EH7H 4WUUE 5JDJA 3G08B 1GH7A 4GMTL 1CT8B 4MDIA 3D0LA 1P7QD 5D7LB 5FYJU 1GGCH 1KACB 2AKRB 1FIGL 2B0SH 1XF2A 2XKSA 4XCFL 5J6GA 4PJAB 3QQ9D 4G8IB 4XPTH 1ZA6B 4KRNA 5ABDE 5T1DH 3C8KB 1F4HA 1JI1A 1YN6B 4PJGA 3MJGX 5DA4A 4XVSH 3NFPB 5DRXB 4I3GA 3VDBA 3KPRA 3H3PL 2W0KA 5JW3L 5F72S 1A6VL 1I1FA 4O2FB 2AV7A 4PJXA 4YPGA 1TJGH 4XPGH 3EO9H 3HMXL 1RVFH 2ESVE 4W81A 4O9HH 3UTPE 1HHKB 5D1QA 1TTFA 4GQPH 1QFOA 2NPLX 4XC3H 1BFVH 4NO2A 4GMSH 2NY4C 2YPVH 3SJVB 5I1CL 4U0RB 4OLWH 4BSJA 2HYMA 1T2QH 2I9TA 2NY7L 3BOVA 1OB1A 3TJEL 2BRQA 3VFTA 2ZSVB 2HFGH 4MJIE 1E28A 4ZAKA 3EFFB 3W11D 1TQCC 1WCBA 2A6JA 5DZOA 1MFCH 4GW1B 3UBXB 5I1GH 3BZDA 5DLML 2X4QB 4ONHB 3BE1H 2HKHL 3LEXB 2QSCL 3E6HB 3CH8A 3ROLA 4HIXL 4OQTA 1PJ9A 5KW9H 2YD5A 5FYLL 4M7ZC 4MA1B 3S35H 1LO0L 4ZFOA 3R8BB 4PB0L 3RBSA 2WWKT 1PYWA 4WHDA 2X4UB 4U31A 2VITB 4RWYH 4X98B 3SQOL 3SJVE 1JYNA 3ZKNC 5EA0L 5DJXB 3BI9X 2FB4H 1GIGL 1KYOJ 5LGHH 1MIEH 4OGYH 4G7YH 3RY6C 3NIDE 1LO4H 5I8EB 3MRPB 4MB5A 4F7CA 3ULUH 4XXCC 3FT2A 3DUUA 4HC1H 3IGAA 3QH3B 1YZZA 2YN3A 3GSXA 4UDUB 5E6ID 3FOLB 4ISVA 1CIUA 4RZCB 3TZVB 2BSSB 4PJBE 3CSYA 3C09C 1P7HL 5CD5C 2FEDD 2BMKA 4FMKA 4R4NC 1FRGL 1UZ6E 5F7YC 3FONB 1UJ3C 1NPUA 3IDIA 3ARED 1MLBA 3F12A 3RPIB 1JGEA 3PWVA 1ZANH 4HIIB 4NZTH 4Z7NF 2WZPD 2J88L 1HINH 2YD2A 2RAMA 3VFNA 4EQ2A 3MXVH 1MFBH 5GJTH 3SDDC 2I9LA 1OP5H 1TCRB 2RFXB 4RQQA 3DV4B 3ARUA 1B3JA 1A21A 1L9NA 3IFPB 3PWPD 5HYSA 1OL0A 3FQXA 1INEL 1NQBA 1B0GA 4QHKJ 5F93C 4JM2B 4M6ML 5C09A 1JHLL 1IKFL 5DGRA 2GEEA 3KLAA 1QFPA 4CADA 1H3VA 3VGAB 3SEPA 3MODL 1EJOH 5DD1H 1KB5L 4PJFB 1UT9A 1AGCA 1EGJL 3WUWB 1F4WL 1R0AH 4MJ5A 4NKDB 5D2NA 4NP4H 3MLXH 2R23A 3HI6L 4RA3A 2A6DA 4U1KB 1CE1H 5IR1A 1NGPH 4M61A 4MA8L 1DQQA 2V17H 5T1MB 3VGHA 3GSVB 4PJ9B 3KS0J 1IAKA 5CFHA 3HPLB 3Q5YA 3VXMB 2QSVA 2G60L 4WWKB 3BN9C 1F90L 5E4EC 1XGQB 4JFEA 3QQ9C 5DYOA 2HFEB 1EJOL 3MODH 1LK3H 3PV6B 5DD1L 5IF0B 3VFUA 1QSZA 2DQGH 4H0IA 4NJ9H 1KG0B 2IPTH 4HMEA 3LAFA 4M48H 3V52H 4MJ6A 3MYJB 5KVFH 3QXWA 3GMRB 4HWBL 1ZLVH 1DBML 1NGQL 2UZXB 4GW5A 5T33H 1CDJA 4N68A 4LCYA 1MLCA 2R0LH 5GGTA 3FHAA 3TO4D 4Z7QF 5GISL 3ZL4H 6FABH 4WI7A 2VR9A 4GBXB 3QI9A 1DDHA 1MFBL 4PJGF 1DANU 3MLUL 2APBA 5EU6D 3ARFA 2YUZA 2L4OA 4JRYA 4NZTL 1RI8A 3T3PE 5I74C 1FYHB 4KHXH 4JZOA 3HI1A 2CKBB 4UZGA 1G9MC 1BVLA 3PHOB 2ADGB 5BS0A 1G1CA 4YFEA 5E8DL 4LNVA 5FHBL 1KN2H 4L4TA 4UUJB 4L29A 3UX9B 5GQBA 5JXEC 3MRQA 5IBTH 4GG6B 2ARJB 1CK0L 2OL3A 2XRAL 5C6PB 2EDWA 1FJ1A 4YR6B 1CGSL 5E8PA 2EZ0C 4XB8A 8CGTA 1WZ1H 2OLDA 3MRJB 3L7EA 3G5XB 4N8CL 2YD8A 4HUXB 3VXQA 3T77B 2VH5L 4Y1AD 1AI1L 1U91A 1WEJH 5D5MF 3WFEH 4NQDB 4H8WL 4G7YL 1TMCB 2FB4L 1N5YH 1ERNA 3DROB 5KS9E 3SQOH 5I1EL 2CO7B 1JRHH 2QSTA 3MV7B 2GFBB 5KW9L 3UZEA 5IK3A 2GYSA 1IQDA 3WN5A 1RJLA 3MRDA 2J8UA 2BVYA 5JIIA 4DN3H 1KCVH 3RP1A 3CDYA 1DE4A 5I1GL 1XGYH 1RSFA 1NEZA 2PYEB 1N6QH 2WBWB 1MFCL 4PJCE 4RDQG 3EYFA 3MR9B 4I4WA 4KRLB 4ZTPH 3MTRA 4D9QE 2HJKA 1PZUB 2HFGL 3HB3C 2B8OT 3TJEH 4I0PA 1U3HC 3DX9B 4NRZA 3FRUB 2NY7H 2ZUQC 5D8JH 3RQ3A 1ZKAA 4DGYL 3EO1A 2CDEB 1H3TA 2VLJD 2CPCA 1AO7B 1UKSA 1I3VA 2KQNA 3T0EC 5DRZB 5J57B 1BFVL 2ADIB 3DSNA 1FL6A 2JF1A 1A9BB 4LFHD 32C2A 1AQDB 5CHNA 3WEXA 3IF1B 5BJTA 1SEBB 3U1SH 3IFNH 1FBIL 4EVNA 5I8CA 1KG0A 3VFSA 3LS4H 1RVFL 4XPGL 4NWTL 3FB6B 1A6VH 3QP3A 1CXFA 3P9MB 5HDOA 1A4KA 5FEBA 4YLQT 3RHWF 3VWJD 1UB5B 3VG0H 3D6GA 1E27B 2N7AA 5JW4Q 3MO1A 3H3PH 4JFFA 4IMLB 2C5DC 1CFTA 4F15C 1KT2A 4ZMAT 3BXNB 2FJHB 2E7MA 4B41A 1KJ2A 5DD0H 3RKPA 2YRZA 2CD0A 1QVOA 1W8OA 5D8JL 4MD0B 5J9PB 1OT2A 3IAGC 3VXUB 1S3KH 3MLYH 4WFHE 1FIGH 3GB7A 4KDVA 5EC1A 2VRAA 4Y5VC 4JFZH 1A02N 1HSAA 2VL5B 5D93B 3W0WB 3LH2L 1JPFB 3QJHB 3S37H 2BY0A 4PRHA 4XWOC 1NGWB 3O8XB 4PJHB 4PUBL 3L1OL 4N5UA 1PG7X 1XZ0B 2UYLB 5IMLB 1PEWA 4KK5D 4ZUSB 3UYRL 2FEEL 1OB1B 3BN9D 5KZCD 1W72L 4ETQB 5B4MC 1P6AB 1OD7A 5IM7A 5GSRA 2YD3A 3CDGB 1CBVL 2KDGA 5HYJB 4DGVH 3R0MA 3H8NA 2FBOJ 4OBRA 1R3KA 3Q5TA 3HAEH 4Z7VE 3WFEL 4PYGA 3ZT6A 4HUVA 3LDBC 3TCLB 1PLGL 4Z8FL 4FG6D 4LPXA 4U1LA 1AD9A 2BJML 3GMNB 4YHZL 5IMOB 3FQTA 2JJTC 4TSBH 3VI3E 5DJ2A 3LKQA 2D03H 1H5BB 4ESKA 2DQFA 3UC0L 1OGAB 5ENWA 3PNWA 5GXBB 5DMJB 3TN0B 3W9EA 2VLLA 1QRNE 2H45A 1NGXA 3VXNB 1CK0H 1R5IA 3MLWH 3SE9L 4RMSA 4GKZA 4YDLC 5GGSB 3E3QE 3SGJC 5L9DH 4PRIA 1FFNA 2NX5E 1JZ4A 1MCJA 3BMWA 2DDQH 2NX5D 3IRPX 4L9LA 2NY4B 3LB6D 4PP1C 5BCAA 5K9OB 2UWEE 4HZLB 3PHSA 1AGBB 4LMQI 3EHBC 1C08A 1MJUH 1G7LB 4ENEC 3JUZA 1PY9A 3D85A 3ULVD 4Z78A 2HJFA 3VD9A 1AGEA 1N64L 4F7CB 3C6LA 5EN2A 4PP1D 5EBLA 3C2AH 4M7LH 5CWSA 1J1XL 2VXTL 3MQIA 4TQEL 1HNGA 1N5AB 3DGGB 2VZ3A 5BS0E 5MEOA 1Q9KA 4DUVA 5GISH 4KU1A 4LLWB 4YDKH 2Y4SA 4NQDA 5DHYB 2YZ1A 5T33L 1EMTH 5M7QA 5L7XH 3MZGB 4OIBA 2HLAB 1E0OB 2DLGA 1G7MA 4PJ5D 4K94C 3LSOA 4Z18A 3U9PH 3BHBA 3C5JA 1FGVL 3I3EA 4U1JB 1LK3L 1RZ8A 4OF3A 4OKDA 3GMMA 2ATPB 4KQ4L 4FTVD 1I85C 3S3JA 3HE7D 4XCCH 1RZJL 1YMMA 3GKWL 2VSCA 5AYUH 5TQ2L 5JHLH 4JFPB 5LKNA 3EFFA 3ZTJH 1QA9A 1RZFH 4OCXL 4TNWK 3ZDZE 4HBQA 4YK4C 5DK2B 5LXGL 1YEKH 5D7IF 2XICA 2AV1A 1BJ1H 5GS2H 1L0YA 4CVUA 4XP5L 1AR1C 2JELL 1OLZA 3RI5F 4XNUH 4H26B 1RK1A 5HSFA 4OZHF 3V6FB 5DMYA 3RGVC 4TTDC 4ZQKB 3DHMA 1HHJA 4A2LA 1OVZA 4G5ZL 2P47B 1EGJH 1PZ5B 5DHXB 4LPCA 1U93A 4MVBD 3TA3B 4RMRA 4P5TA 4G6KH 1EHLH 1C5CL