5IOPB

Cetuximab fab in complex with 4-bromophenylalanine meditope variant
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
215
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cetuximab Fab, light chain
publication title Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 46
structure length 215
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iopB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iopB01
1PFCA 4WY7H 1OP3H 4L9DA 5AZEH 3TBWB 5FO8B 5I75C 1OOAA 2P49B 3VFGL 4YXKH 1BF2A 1NCCH 5TE4L 4RFEA 3MLRL 3CDCA 2Z8WC 3UTQB 3S35H 3QDGA 5DD1L 5MENB 1DBJL 3PHQA 2HP4A 2ITDA 1OAQH 2KQMA 4DWHA 1MAMH 4IMKA 5A40E 5J1AB 3PHOA 4YHZH 2LTQC 4TUKL 4LEXH 3T0DA 3QQ4A 2MQ0A 2J1KA 3JV4B 5BV7B 2Y5TA 1A47A 1ZT4B 4WENB 3A6BL 4ZO7A 2DI9A 2OJEB 3VXSE 4JY6B 2HKHL 4K3DL 1HHHB 2ZJSL 3H9SA 5FCUL 4N0YL 3HE7B 2P5EB 3HPLB 4KI5D 1A7BA 2XPGB 5DUBB 4X6DA 1YEKL 1KT2B 2WSKA 3X12A 1CXEA 3ARGD 4RQQA 5CLWA 5JR1L 2L7UA 1SBSH 1P7QB 4GQPH 4R3SB 1I8LC 4U3XA 2HAZA 2ERJC 2JF1A 1EA9C 1V5JA 5EUOA 4HK0A 5DHVA 5E8PB 4JM2B 1KYOJ 2ITCB 4FQCH 1CLZL 1KB5H 3W0WE 2JCCE 3RI5F 1G6VK 2A77H 3MR9B 4XVTH 4I3GA 4L9LC 3I50H 5EFIA 3RY6A 2FX8H 2F58H 3CFJA 4RBPH 1J1PH 4OZGB 4ONGH 3GMNA 4UTBL 5FB8A 1L7IH 1SJHA 3VRLF 1MWAB 4J8RA 1TJIL 1XGQB 2KKQA 5FHBL 4XZUA 1RY7B 4C59B 5HPMB 4MHHG 2XQBH 4YPGB 4JO1L 1AHWA 5DD3H 2VDQH 4JG1H 3P0VH 1BECA 5C0FB 1CDBA 4HMEA 4F7MA 5EU5A 4GRWE 5TDNA 4K7PY 1EEQA 3MCKB 4Y4KB 1U3YA 1MFEH 4XPGL 3E6FB 5ISZE 4P49A 4WO4D 5FA3A 3U9UB 5F70A 3S96B 3CIQA 1OAXL 3GRWL 5FO9B 4TSCL 3HNVL 5C0ND 3D9AL 3DYMA 4OD2B 5GSRA 3FB5B 3K8LA 4PGZA 3ZTJH 5GGQL 4NQED 1NC4A 3T2QA 4D0BA 2B0SH 5JZ7D 3HLAA 2I26N 2DF3A 4J23A 3V4UH 2GT9A 3V8OA 1TZIA 1LVEA 2FHCA 1DBAH 1TMCB 1ZHBA 3E3QC 3ARRA 3RUGF 4DGYH 2BJML 1MEXL 4JPIA 3WN5A 5F3HB 1OB1A 2R1XB 5JW5B 1MCOH 1N7ML 1Q0XH 1H3PH 2VXSH 4NZUH 4Z7UA 1OVZA 4HSQA 4HIHA 1QO3A 4U1HA 3OKDA 3H7BB 2LV4A 4TQEH 1JUFB 4EJ1C 3WEXA 1FBIL 3MV7E 2MPAL 1JGLL 5KBNC 3STLB 1YNLL 6CGTA 2WLZA 1G1CA 3QJFB 5DC4B 2X4RB 4G6AC 1NGZA 4LSUL 4KI5F 4X0KB 1OGTA 5DRZB 2NY3B 1RZ7H 3RVWC 4CJ1A 2V5YA 1MFAL 3RY4A 3WUZA 4GRLC 2EDXA 5IIEA 3SGJA 1Q72L 1WZ1L 4M6OL 4G6JL 1CF8L 2VRAA 2XN9A 3GSNB 3S34L 4PYGA 2AV1A 4M5YH 1CGVA 5FAAA 4LDEB 2NX5B 4NZJA 4PPTA 3SGEH 4LLUA 3PL6C 1CE1H 4JQVA 2HMIC 3AY4C 3P9WB 3PV6A 2BC4B 1MHCA 4QHNA 2GFBA 5GHWH 4POUB 3SOBL 3C09C 3U79A 1QLEL 1FVEA 4HJGA 4XH2B 4PRHA 5FOBB 3JUYA 1EGJH 4Z78A 4GQ9L 2X2YA 3NABH 3EOBA 3G5XA 3QXUA 3GB7B 2ZSWB 4Y5YA 4ZTPH 3HZMA 1L0QA 2HG5B 5CEXB 5C7XH 1NGPL 5ALBH 1PKQE 3IJSA 1FO0H 3NCBB 2H26A 4TNVF 4PJ5A 3IFPB 5CWSA 2APBA 4YO0A 3T65B 1P4BH 1HIML 2NX5E 1XF3B 2R2EA 5IWLA 3HZKA 3MRHB 4JLRB 1KACB 2Y5EA 4WUUA 5E2JA 1AQDB 2FEEL 1E4XL 2XKUA 5DD5H 3BPLB 4KRPC 1ZV5A 5JNYB 4P0DA 5DJYB 2CD0A 3MLPA 2AK1L 2V7NA 5EU6D 1BM3L 1ETZB 1JYWA 4F9PC 1KEMH 1NANH 1CFVL 3QFJE 1AGCA 2NY2B 3ALPA 1R3HA 4LCUA 4UIKH 3G04A 1BQLL 1MFBH 4PY7A 4XXCA 1A7RH 2MTPA 5JHDB 5DJXA 3DGGB 4Y0GA 4UTAH 2A9MH 5CP3A 1LO4L 3O41B 1S7SA 3T3MF 4YBLC 3LKPB 4GG6F 4HC1L 1RUPL 3ME0A 4GW5B 4HUWB 5ADPL 1F90H 2GHWB 2BSTA 3EDDA 5F9DC 4M5ZL 3TH2T 4PJEF 1D5ZA 3KPMB 4PGDB 1FNEB 3LDBB 5C70A 1C8PA 5EORL 3VFTB 5AG9A 4PTUB 2J88H 4P57A 1TVBA 5F89A 1U42A 3VFRA 1G7HB 4DKEL 5GS1C 3QULB 4ERSH 3D18B 3BD4A 4AEIH 1NMCC 2EKSB 2BRQA 4KUCD 4KKCC 4Z77B 4QNPF 2XA8H 4YHML 1I85A 2H8PA 3H3PL 3OB0H 4NWUL 3O3DB 3C6SA 1JZ7A 5ID1B 3DSFH 1VKXB 4W4NA 5CSZA 3H2WA 4FQPA 2BVPA 1QYGH 4G8FB 4HFWB 1I7TB 2F54A 1LO5B 3MBEA 4G6AD 3QUYB 3RWIA 2BNRB 3RVWD 3DXAA 1YA5A 3UTOA 2IALB 1QFWH 5FA4B 3CSYB 2I07B 4LHUD 5IK3A 4J3TA 4HG4K 4RMTA 5ESVA 4ISVB 4AEFA 3BVNA 1UZ8B 2F5BL 2GAZA 1ZLWK 4Z7VE 1KNOA 4RGNC 4G43A 4AJ0A 1L7TH 4Q6IA 3VXNB 4C4KT 4K7FA 2NLJA 3CSPA 3PL6D 4JRXA 4P3CH 1I3GH 2HMID 3KXFB 3CFCL 3B8YA 3JWOL 3MLYL 4ZFGL 2P8LA 4M1CC 4X4MA 2E7BA 2YPKB 2VDPH 4JDZA 1CLCA 3PP3K 5GS0C 4DEPC 1FVDB 2BNRE 2OMBA 4NHCL 2AXHA 5I1KL 4KHXH 4BKLB 4XRCB 1MJUL 5GGUA 1JZ2A 3ROOA 2EDJA 1TCRA 2X4NA 4O2EA 1RZJH 3WV0A 3VRJA 1NC2B 3TLRA 4PLOB 1NFDA 1U8IA 1GGBL 3BZFB 3PWJA 1CFSB 1KLGB 1OAKL 2VXQH 3QWRA 3V5DA 4BM7A 3U46B 4XP1H 1NCDL 3RUGB 1EUUA 3PWNB 3P9MA 1A2YB 1A14L 3STBA 3U6RA 3KYOA 4DGIL 3OL2A 1YN6B 5I1LA 3HMWL 2LE9A 4P2QD 5FYJL 4JZOB 1PQZB 3TBWA 2OXHA 4KRPD 4RZCA 5FO8A 5MERA 2DJSA 2I25N 4BH8B 1SBBA 2XICA 3LRSB 4M8QB 1WWBX 4LL9A 3HZYB 1OTUC 4WFEE 1EAJA 4XMLL 1B9ZA 1EO7A 5HYJE 5CAYB 5DUML 2WINA 2BK8A 5J1AA 2NTFB 3CFBB 3J8F7 1MCKA 1RZ8B 5JQ6H 1J87A 1ZT4A 1UZ6E 1D6VH 4KDTC 3QAZB 4JY6A 1ZLUK 3DTXA 1ZA6B 3ARGB 1KJVB 3HE7A 1N3NA 4Z6AT 2P5EA 3HPLA 4BZ1L 2HH0H 2X1QA 1KJ3H 2WBWB 3FHAA 3IKKA 4F8QA 2AJXH 4LEOB 5IVXE 4AT6B 1Q0YH 2JJWA 4R3SA 1KCUH 2JJTA 2R8SH 1FCCA 4KUCF 2Z93B 5C0CD 1MCNA 2GW5A 4NBZB 3U0WL 2NYYC 8CGTA 1X5ZA 4HT1L 1CR9L 1JPGB 2FJHA 4YE4L 3TBTB 3GSVB 1ZT1B 1K9TA 4OCWH 3JV0A 4Z7NE 1MRFH 2Q3ZA 2AJYH 1ZWIB 1I8IA 5IMKA 1RUKH 3BIKB 4WVRA 2Z0BA 1EFXD 4OZGA 1K3ZA 3HMXH 4JKKA 1N5AB 4Y2DD 5FGRA 3DVNA 4JO4H 1DBBH 1MELA 1MWAA 3UPCA 3LRHA 1XGQA 3TIDB 4TSAH 3MREA 3U82B 4YPGA 3CVHL 4WEUD 3BP5B 1AP2B 3VCLA 3VU2A 4HS3B 2BVEA 1U6AL 4K8RL 4WO4B 5D2LE 2W9LA 4RISL 1U8LA 5DJAB 1JF6A 4IOIA 1J9CT 1Y18B 4JKPH 2ESVE 1NGYB 1P7KB 3WD5L 4OQ1A 1MCEA 3E6FA 3TN0A 1A7OL 2NY7H 4M1CD 3EO1A 1WBXA 2R0LL 4DVRL 3NIFF 2AGJL 2Z31C 3FB7A 1H8SA 2IFFH 1LO0H 4DKFH 5GS0D 4MLSA 4A6YB 5JW3H 3LN5B 4Z9KB 1RIVH 2OL3L 5F44A 2RGSA 4IIQA 4F15B 4NQEB 3O9WC 4OCNC 1YEFL 4OD2A 1CYGA 3RPIB 3W2DH 4GG6B 1HEZB 1FFOB 5IT2L 4LAJH 2VDRH 1HCFX 2AJVL 5DJZB 5HYEA 4OLEA 1D5XB 4PJEB 4LSVL 4LP4A 3UZQA 3UTTD 1AKJA 5I75B 2HT3C 3EOTH 5EO0B 2GQHA 2HKFL 5BZDB 2ED7A 5ESQA 3WE6B 5MHSE 3QEUB 4D9QD 3S36L 3ELAT 2R1XA 4QYOA 4YDIL 5JW5A 5IW1A 4HLZH 3MA7B 3M8OL 5JW4R 4PRBA 5DT1H 4PJGE 2BXZA 3H7BA 5BZWA 2R15A 3PIQB 3MV9E 4N0FB 5D7KD 3STLA 1BQHB 3GIZH 1T80A 2EDEA 3QJFA 3L7FB 4TYUA 1FHGA 1ZVYA 4MJ5A 3X3GL 1JRHL 5C3TA 4X0KA 1U8JA 5DRZA 2BRRH 4P3DA 4OF0A 3ORJA 4HQQH 4OD1H 2HTKD 2O5XL 3SBWA 2ERJB 3FB6A 3JWDH 3HCVB 4QXTB 1CDUA 1HN1A 3G08B 4U6TA 1ITCA 1E4WL 3BO8A 2F53E 3CFEB 3DUSA 3P2TA 3U7WL 1GAFH 2HN7A 2X05A 2BC4A 1BJ1J 5JXEA 3HZVB 4ZPVB 1CLOH 4L9LB 4HK3N 5FOBA 4X83A 3ARTA 4FXGB 5EO1A 4FHBD 4V1DD 3EYSL 2ZSWA 3D87B 1P84J 1C5CL 1FG2A 3ARFD 3CK0L 2HG5A 2ADIA 3GK8L 5ECJE 4L3EA 4KVCL 1HKFA 5E6YA 4Z95L 5FECA 1UQSB 3QG6B 1T89C 1URLA 3MJ9L 1OSZA 4X6EA 4GSDH 5HGDA 5T3ZL 2QQKH 3OXSB 3UPRA 2OM5A 5DGQA 4LQ1A 4QHUB 3MZGB 3UMTA 1W2KT 3RL1B 4OSUH 5EU6B 3V7AE 1HILA 4O02L 5JNYA 1Z9MA 3BYTA 2Y72A 4K7PH 4C56D 1ETZA 1IC4L 4E5XA 1P9MC 2FZ3B 3C8KA 2FB4L 2DLTA 4QT5A 1B0GA 2Z31D 3IU4H 4O5LL 5JHDA 2YRLA 3W9EA 5DF0A 4Z0BH 3DGGA 4AG4H 4Z7QE 1K2DB 2EZ0C 4MXWH 3QWQB 4WEBL 1SM3L 3TT3L 2YRZA 4U33A 4OD3L 1CDJA 3FMGH 3W39A 1KCRL 2PO6C 3MA9L 4NQXB 1KB5B 4GW5A 4HUWA 2YKLL 2BMKB 4XPFH 3UBXB 3TCLB 5D7JC 2K1MA 2MMXA 2ZNWA 2HT3D 4PGDA 4Q2ZB 1FNEA 2EH8L 3BQUC 1DL7H 5HVWA 4UOW0 4G7VL 5LCVL 4NCC1 3ZTNH 5HVHB 1B0RA 2VMFA 3RVVC 1J7VR 2DQJH 5DK3A 1A4JB 4B5EA 3R1GH 5I1JL 1G7HA 3MGOA 4OLVH 3QULA 1AXTH 3CZJA 4PY8J 3RL2B 1N8ZB 4OT1L 4UNVA 3EYFA 3JV6B 4TNWF 2H2SC 4HMDA 4URTB 3RKDC 5F71A 1TNMA 4D9RD 1TZGL 2IBBA 1QHPA 2FATL 2AV7A 3CVIH 4X6DE 4PJFA 1I7TA 1YEDB 3FZUD 3H9ZA 3CSBA 1K5NB 3HAEB 4LHUB 4Q9CA 3QUYA 4PGCA 1CXIA 2YPVL 4F80A 4M43H 2BSSA 4LSPH 2IALA 4L4VE 5FA4A 2DJUA 2YD3A 4L8SB 1F4XH 4ISVA 4JAMA 4G6FD 2OXGA 3PL6B 1M7IA 3UPAA 3UO1L 3T08A 3NZHL 1I7RA 3FO2B 5E4EB 1L4IA 1YQ2A 4YFEA 2HJKA 2ZG2A 5D7LA 1JHLL 1IGJA 1S3KL 1K8DA 3LPGA 4XT1C 2A38A 3KXFA 2DLGA 5A1AA 4UOW1 5I1EL 1GIGL 3KR3L 2NZ9D 3T0AA 2FRGP 2V17L 3SE4C 4NKQB 3SDXF 2W91A 4FZ8H 5D8JH 4BKLA 4XRCA 1A3QA 5EC2B 1LEIA 1UCBL 1MPAL 1C1EH 3MRIB 1NC2A 1E27A 4R0LA 4S10A 5GZOC 2J6EH 1BQHG 4HKBB 3BZFA 2WUCH 3MLZL 3FO0L 5SV3A 4P2QB 2J8UE 4KRPB 3H9HB 3VFVB 2JB6B 3BPCA 1TENA 1A2YA 3FFDB 4PP2B 1YN6A 5MEQA 4LLYB 4HAFA 3N0PB 2OK0H 4JZOA 5T33H 1WC7B 4FABL 2NTSP 2V9QA 2P1YA 4X8JA 4FFVD 1J8HA 4M8QA 4XPBL 5GGTH 4HXAH 4KJYA 1KN2H 3WBDA 2R4SL 3BOVA 3ARWA 3NZ8B 3TBSA 4CDHA 4U1JA 3CFBA 3V7AG 4Y16C 1RZ8A 1B88A 4YBLB 3D25A 4NQDE 4PRNB 4AMKL 2X4QB 2ZPKL 3FFCE 2P8PB 2WLYA 4PBXA 3DBXB 3FQNA 1FLTX 1U3JA 2VR9A 4LBEB 1WT5A 3WDIA 4Q9RL 5HGBB 4QRRD 4PJIA 2V2XB 4HX1B 3Q5OA 3L5XH 3O3UN 5C0CB 2WBKA 5GS1B 4LEOA 3BQUD 1NMCB 2Q7YB 2DQUL 4KHTH 4Z7UE 4AT6A 5ACZB 3V0WH 1FIEA 3WNLA 5FEBA 3RVVD 2E7LA 3MOAH 5GRJL 3H8NA 5FUOH 3GI8H 4FFZL 5ICXB 4X80H 2B4CL 1PEZA 2IAMC 5SWQA 4CKVX 2PCPA 5B22A 2L4OA 1EFXB 2YUWA 1PBYA 3RKDD 3V5HA 4DKDC 1ZWIA 1OSPL 5CINH 5CEZE 1W8OA 4Y2DB 5GISH 1T1YB 4YNYB 4LCCC 5AYQA 4I77L 2F9BT 1S9WB 3U9PL 1ONQA 4HD9A 4ZAKC 1CICA 1R3JB 4HWBH 1IBGH 5KVDH 1CGTA 3LVEA 4YX2L 3QUMA 1FNSL 1TQCB 3ARPA 3DYOA 1RZKL 3D2UA 4E41D 1VESA 3BP5A 1AP2A 1WWAX 4PRHE 3RNKB 3UBXG 4MSWA 4OI7A 2RIKA 2VLKA 5L2KD 4ODUA 3LIZL 4Z8FH 4EN3C 4DEPB 1FE8H 1JCKA 3KPOB 4MA7L 1R5VA 4NSKB 3IETA 4MXQC 5EOQH 4PJ5E 1T03L 2ZOLB 2ILLA 3LN5A 1C7TA 4TNWK 3PWPD 4WHTB 4RGNE 1NAKL 2UZYB 5C09E 4NQCE 4TN9A 3N9GL 1EAPB 5GRXG 5C2BH 3T77A 1FZKB 3UTTB 4BSJA 1HEZA 1FFOA 1UYWH 3OB8A 4GXVH 1TIUA 3LMJL 5DJZA 3HAEG 4UMGA 1J18A 2AW2A 4PJEA 3ZDZE 5HHOA 5DEFB 5EZJA 4V2CB 4JGMA 4XBEH 3TPUB 4NM4L 3VXRD 1U58B 1K8IA 5EO0A 1IAIH 3QIUA 2X70B 3D0LA 4WU5A 3DYPA 5BZDA 2CQVA 5J9PB 1YQVH 3QEUA 4H25B 1ZHNB 1FDLL 2DM4A 2GK0B 3HI5H 2FLRT 3GMPB 3MA7A 4I9WD 1FN4A 3JTSB 1AE6H 3PGCB 3ZTJG 3FOMB 1JPFA 2ZOKB 4NC1C 4U1KB 4HF5L 3MROB 5F88B 5EZIH 4G3YL 1I9IL 4QO1A 1IFHL 4JO3H 4X4XB 5E9DA 3PIQA 3QI9C 4N0FA 4XNMB 4NN5C 3BAEL 4ZDHB 3L7FA 1UGNA 3QCTH 5CJQH 4XAWL 1M05B 25C8L 4Y5XB 4YXLH 4WW2C 2YUVA 1H3UA 2VLLA 1S9YA 4M9OA 4LOUD 2W9DL 1ZANL 2D03H 5D1ZC 3QBTB 4S1DC 3VFPB 5JW4M 5TQ0H 1QNZL 2YOCA 3GEWB 1U41A 1UWEH 1NCAH 5GRYA 2Y06H 2HWZL 4HPOL 3WHE0 2XT1B 4QXTA 5TE7L 1G6RH 3F12B 3IKCB 1OPGL 1K4DA 5J11C 4LQFH 1SHMA 4XNUH 3U30C 5C9JB 1FC2D 1RPQA 2DKSA 3ZHDA 4V1DB 2R4RL 2F54E 4ZPVA 3ARFB 4WFFE 3JWNC 3WFHB 5EC1B 3VI3E 4FXGA 3SDXB 2Y6SD 1E6JL 3DXAE 3HUJF 4C4KO 3OKMB 4JFED 1SMOA 1F3JA 43CAB 1H5BA 3ARDC 4FQLL 4XBPB 2VTFA 2E27H 4LPCA 4U1MA 3RGVC 4HW6A 1TXKA 2EECA 3QG6A 5DRNB 2HTLC 1S7RB 4KVNH 2PKDA 4NO2B 3O0RL 1YNKH 3OKOB 3THMH 3IJYB 1KENH 3C5SB 4I5BB 4QHUA 1RU9L 5J6HB 3ULUH 3RL1A 4FOMA 4C56B 5EU6A 2G5RA 4EQ3A 4NWTL 3PGDA 1XF4B 5I15H 4OCSL 4HWNA 5BMFH 3SDXE 3KHOA 1DUYB 1MLCB 2Z31B 4AEEA 5HDBF 3S88L 1RIUL 4YXHH 2KBGA 2NY5L 1F6FB 4H20H 5L9DL 1R5WA 3LHPH 2VO5A 4MXQD 4P48A 3H0TB 2EH7L 3VFGH 2BOBA 5TE4H 3MLRH 1N59B 2X09A 3VXUD 3UAJD 2AKRB 2V5SA 3QEHA 4M1DL 1J0JA 1MHHB 3BGFC 3OR7A 5DD1H 1HH6A 2YK1L 1DBJH 3RWCB 3SO5A 4XAKD 5M7QA 3V0VB 3OPZL 1UB5B 5E1AB 3CSGA 1U2HA 5EDXA 4NQXA 4TUKH 1KB5A 1MHEB 5E8OB 4CGTA 4G9FE 3UBXA 3A6BH 4JKLA 4MMXC 1EV2E 3IDJA 1FNAA 1WICA 3I6KB 4JFDD 3Q48A 4K3DH 4YHNB 1EBAA 4YQXL 5FCUH 3EW3B 4AY0A 1A4JA 4L8BA 5DDHA 5IB5A 4Y8AA 3QPXL 4HG4J 4KPHH 1KIPB 3RL2A 2EYTB 4ZD3L 5JR1H 1YYLH 1XCTB 2F19L 1JL8A 5EB9A 4BH7B 4LIQE 4CVWA 4K3EL 3AM8C 1NEZB 3TO4D 3GGWB 5I1IL 1CFTB 1QPXA 3FT4B 2R29L 1HNFA 2NCMA 4IRSC 5LKNA 5EIQA 4YIQA 1I1AD 1IGYA 3QI9D 3RWGB 3DHJA 5KSVB 3HR6A 2BHYA 1YEDA 1RSFA 1GOHA 4LHUA 2Q20A 3ULVH 4Y88A 1T83C 4G6FB 4NRZA 1FSKB 4O58L 4FZEH 3QUZC 1JI2A 5D1QD 4ELKB 4L8SA 4P5TC 3VWKC 4ZS7L 3NPSC 3IAPA 4PJAF 5EU3B 4U7MA 4D9RE 3TF7C 4UTBH 1OGAA 2ICWI 3AY4A 1CN4A 5EUKB 4UBDD 2XY1A 1IEBA 1TJIH 1Y6NR 2XWTA 3GI9L 4I0CC 5FHBH 4CN1A 4OM1L 2YD6A 4YHPA 1U0QA 2NR6C 3MLXL 4YWGL 1QLRB 3IU3B 2X40A 3QCUH 4M6NL 5ITBL 3RVXC 1EBPA 3NVQA 4MQTB 3SKNB 3SN6N 4QOKD 3L6FA 3QRGL 2Z9TA 2CDGB 4HGMA 3P4NA 3DMMC 4RWHA 1EMTL 2A1WH 2ZUQC 3ARDD 1D5MB 4XPGH 4F37F 5EC2A 3RVUD 3AREA 3DX6A 1CL7L 2ICES 2E9WA 4JFPB 4AEHL 1MVFA 3CDFA 1OAXH 4PLJD 4YUEH 4GAGL 2P44B 3GRWH 1HI6B 1S7XB 3QXTA 1T04A 1Z6JT 2OSLB 1HHKB 1IAII 4TSCH 4P2QA 3HNVH 1OM3H 3MRPB 3D9AH 4CAGA 3H9HA 3VFVA 2JB6A 3IFNL 4IRJD 3KYKL 3RVTC 3FFDA 4NOFA 4PP2A 4JFFA 4LLYA 2R56L 3TT1H 5GGQH 4MA1C 1ORSB 5HDQH 3S8WA 3KPSD 3R0MA 4HFUL 4LRIC 4C58B 3TCXA 5DVNA 2AP2A 3TNNA 1SEBB 3BUTA 1FRGH 1T2XA 5T1MA 2BJMH 1MEXH 1HQRB 3T8XB 5BQ7B 4R4FL 3GMRA 1KLUA 4IJ3C 2J12B 5FM5M 3L3KB 4H8WC 4PJDA 5JOPE 5L88L 3QDMA 4XPHL 4O9HL 3DV4A 5TPWH 2X4QA 1EEUA 4QRRB 4H88L 4Z5RB 4N90E 3VFNB 3UCRA 3DBXA 2FWOB 1WAAF 4I48A 4HKXB 2VUOA 1A22B 4LBEA 1R3KB 2DLIA 1EGJA 1DFBH 4HWUA 1UKSA 3BQUB 4KK6D 1FBIH 2PXYA 3GNML 1JGLH 3VWJC 2V2XA 1YNLH 4PRPD 4OCLC 1B6UA 3TA3A 4LSUH 5ID0B 4X5LA 1FO0A 3GSWA 5ACZA 1MFAH 4OLUL 1AD9B 5T1DH 3KLAB 4ENED 1JPTL 1Q72H 4N0CD 4G6ML 4WTZG 1JHKH 1WZ1H 4M6OH 4G6JH 1MI5D 3FRPG 1ZGLB 1CF8H 32C2B 2VLRE 3O6KL 1YUHB 3RTQD 3S34H 1RMFL 4CN6A 2P45B 4HWZB 3SCMC 1TJHH 3P3YA 3HUJB 4WI4A 1I1YA 1F4HA 4UU9B 2EDDA 2O61A 2X1OA 5IQ9B 1YJDC 3ULUD 4Y2DA 2VDML 3Q0HA 2MKLC 3SOBH 1T1YA 1QLEH 4WW2F 3KPRD 3TVMC 2AEWA 5C1MB 4GQ9H 1YN7A 2A6JB 4UV4L 4E41B 1KTDB 5I17A 3QHFL 5BS0D 1NGPH 3DETC 4L4TD 2PNDA 4KXZI 2JJSC 4S2SB 1JZ3A 1X4ZA 2VXUH 3RNKA 3BHBB 5DFVD 4F8TA 1FFNB 4HJ0C 4X9GA 5CJBA 2DQEL 1SEQH 2ATKA 2EDQA 4JJ5B 1HIMH 3WNKA 5DTFB 1ZVHA 4ODHH 3UJTL 1KV3A 1A7PL 3FONB 2NR6D 5HYSB 1P2CB 3PWPB 5D9SB 3GSXA 1CI5A 4L3EE 4M6AA 1KTRL 1L9MA 4ESKA 5IMLB 4XB8A 4X5WA 4DQOL 1E4XH 4RIRB 1GXEA 1D9KC 3RVXD 2ZKHL 3BPNC 2AK1H 4JQXA 4JFQA 1BM3H 3OAYK 3DMMD 1NEZG 1EAPA 5IQ7L 4R9HA 3MJ7B 1XGYL 1FZKA 1NUDA 3UTTA 5F8RC 1BQLH 3WFEL 2NW3B 3HI1B 5C0AD 4P46D 5C0DB 2DIJA 2FECI 4R8WL 1A6PA 4L8CA 5DEFA 5CP7B 3TPUA 1U58A 4ZUTA 2YSSA 4TVPH 3LEXA 3O6FA 5DQJA 4HC1H 4WI9A 5J9PA 1RUPH 4OJFL 2OZ4L 5ADPH 4H25A 4JN2A 4ZFZB 1ZHNA 2GK0A 3S7GA 4HIXL 4M5ZH 4PTTB 2D7QA 1BQSA 1MUJB 1KBGL 4LLAA 4EI5D 5EORH 2X41A 1WFNA 4GAJL 1FZMA 2MWCA 5JIKA 3MROA 5F88A 2F5AL 4I0PD 5B3NA 4NKOB 3LQZB 1NL0L 4X4XA 2QHRL 3AGVA 3IVKB 4NO5A 1MLBA 1X5GA 4CVUA 3FO1A 4H1LH 4YHMH 5IFJB 3H3PH 1M05A 4Y5XA 4AK1A 1HHGB 1QSED 5J12C 1QR1B 3VWJD 4PJAB 2UY6A 3VFPA 2GJ6D 4NOBA 2B1HH 2XNAA 3ZYZA 2YR3A 1JGEB 1VGEL 4I4WB 2C7UB 1J0KA 3ZSSA 4FQXC 4RAUB 4X98A 4OF7A 4JFEB 4PJFE 1J1OH 4AH2A 4R2GC 4OFDA 1OARL 4J6RL 1HCVA 3ARFA 3SDDC 3ISWA 4YZFF 3SCMD 3WFHA 3ULUF 2CLVB 5EC1A 4FQIL 1CDHA 1QBLL 4UNTA 4DKAA 4EBQL 4NO3B 4PV9B 2FO4A 1UACL 2RR3A 3O4LA 5HI5C 2AJ3B 3CFCH 4PJ7F 3JWOH 3MLYH 3OR6B 3TVMD 1I3RB 4KKBD 5C0RH 1LK3H 3HRZB 3V6BR 4NHCH 4M1GL 1JF1A 4JR9L 2FYYB 1S7RA 4KKAC 5I1KH 5D7LE 1EK3A 4NO2A 1ND0A 3MOBL 4RGMB 3OKOA 1MJUH 1JMZA 3C5SA 1MJ8L 2GSIB 4JY4B 1XF4A 3PDOA 3PHSA 4DVBA 3FRPA 5F9OL 4JGUA 5CJ8A 2FD6H 3EOAB 3ARBC 5D1XD 1OAKH 1IAOA 5LJYH 4QWWD 5HXMA 1G9MC 3QJHB 4I3SL 1RZIB 2Z4QB 3Q6FB 1NCDH 2D7MA 1EVUA 4F9LA 4DGIH 1A14H 4IOSD 4GMTL 3VXUB 2DQTL 1JGUL 4EI6B 5CLTA 4WTXA 3H0TA 1WGOA 4Y7MA 4LSTL 1EO8L 5LGJB 1D5IH 1D9KD 3BKYL 3LN9A 1U8OA 1NGQL 4M7KH 1N59A 5SWSE 4BFEA 4IS6B 3BUYB 4GBXC 4MX7A 3RWCA 1QRNB 3T2NL 1UB5A 4JFDB 4GLRH 1UH4A 3TBYB 2GJZB 4NKIL 1U3ZA 1T22B 4P9HC 3MYJB 2CK0H 4CDGC 1J8HE 2EDBA 3QCVH 3WDHA 4XVUD 1DBML 4MD4A 4YHNA 3HMXA 1LDPH 3K74B 4L3AA 3GMMB 4O2CA 1I8MB 4FTVD 4PG2A 3TO4B 3OAZH 5J7CC 1KB9K 1T1WA 4HZLB 2EYTA 4QXUH 1T21B 4HH9B 1ODAA 4QF1B 1I1AB 3QI9B 1QRNE 4GKZB 5EZLB 5HYSG 1NAML 4NKMB 1MFNA 5DZOA 5C07D 1CDIA 3F8UB 1CQYA 1T5WA 4PJIE 1FZOA 1P6FA 1KCVH 2XTJC 4WW2B 4HT1H 3H6JA 4M6ML 5D1QB 4YE4H 1D6EB 1EJ6A 3GFUA 2EIZA 2OTPA 4LARL 4I3RL 2NW2A 2LFGA 3UYRL 4MAYA 2DKUA 2BY1A 2YD1A 4IDJL 3RDTC 1U8MB 4BZ2L 3RZCA 4RAHA 5EU3A 1INEH 3U30B 5BVPL 3EIFA 4ZQKA 4QRTB 2H3NA 2XTLA 1A1OB 5HYIA 4BQ6A 3NTCL 1MNUL 2E9BA 1WBYB 3UJJL 2FEEI 2AERT 3B6SA 4QOKB 3CVHH 2I9TB 4R2GD 3W11D 1QZ1A 3SDDD 4BSWB 3ARDB 5EU7E 1U6AH 1R5IA 4K8RH 5EOCL 1ITBB 3SKNA 3FJTA 3F6LA 5F8QC 1UM5H 1GGTA 3V2AR 5JLZA 3DX8B 4FXLA 2I9LA 1GGIH 5IROC 1QA9A 2ENSA 2R0LH 3WLBB 4JFPA 5I1GL 1E4JA 5IOPA 4IRJB 4UT9L 3L9RB 1S7XA 3S5LG 1F2QA 2CGRL 3LZFL 4KY1H 1I3UA 3WXVH 5E56A 1XAUA 1CXKA 2OCFD 3KPSB 1YEFH 2X44D 3BGMB 2QL1A 4BFGA 3REWB 5KVFL 4GAYA 1UKQA 5IT2H 4BJLA 2APTA 5D2NC 4EUPB 4EDXB 4E0RB 3I85A 4OLYH 3MRJB 3NA9H 4OZIF 1EERB 3OV6A 1Y6MR 1XIWA 2HKFH 5GSVB 1SEBA 3BIAX 3LKSB 1OQXA 3FT2B 2DDQL 3OHXA 4F7CA 3BGFB 4WV1A 3T8XA 1XR9A 3BEVA 3R0NA 4D8PB 4YDIH 5FGBC 5F7MC 4NQTA 4HGWA 2HT2C 4JO2L 4KMTL 3M8OH 3DV6B 3WIIL 4HV8A 5HHOE 3VFNA 4EDWL 2ZUUA 4GBXD 2FWOA 3ET9F 4PRPB 4P4KC 4HKXA 3O8XA 1W72L 1R3KA 5C08D 3VFMB 1LK2B 1YDPB 2A6IA 4M03A 4WDIA 4A2MA 1A0QL 2A74B 4KJWD 2QTEA 1T1ZB 3S97C 1CS6A 1A6ZB 1JP5A 1S7QB 1F02I 1DQML 3PG2A 3X3GH 3KPPB 1JRHH 3VRIB 5ID0A 1KELL 1MI5B 4YHIA 3CC5B 3PWLB 4NKDB 3RTQB 4U1LB 2FR4B 1AD9A 2UUDH 2YD7A 2VYRE 2O5XH 5JUEH 5E9DE 1RJYB 1U2CA 1ZGLA 1JV5A 4BQBA 4X6BB 5DLML 4HWZA 1PDKA 3VFOA 2VLJE 1JTTA 3MBXH 2H41A 4K23H 2V2WB 1E4WH 1JK8A 3KPRB 4WI2A 3A6OA 3EYUL 4PJ7B 1PGRB 3U7WH 1RULH 2YUXA 4XCNB 1E4KC 4NZRL 5CGYC 3T3PF 2Y36L 3AB0B 5BS0B 3QNZA 3ES6A 4L4TB 2A6JA 3NPSB 1IGTB 4TRPL 4YGVB 1BOYA 4JDVA 2MFNA 1KGCD 4L4JA 1U93B 3CK0H 1G7LB 3NCYP 2DWDB 3S37X 3GK8H 4GXUM 5DR5L 4KVCH 2ATPA 5FYJD 5L2KA 4S2SA 5C8JA 4Z95H 4UDUB 4P5KB 2FHBA 3BHBA 2EKJA 3MJ9H 3N1GC 1FFNA 5SV4A 1VFBA 5T3ZH 3V95A 2DTSA 5DTFA 5INDA 3FONA 15C8L 2IADB 3MPCA 4QHMB 3TP4A 2BVQB 3DMMB 3T4YA 4MVBC 1KC5L 3RFZC 3CCHB 3CFKB 4O02H 4MA3B 3G5ZA 5C0AB 1IC4H 1Q38A 5DO2C 1G7MB 2DM7A 5LGKA 1A6TA 4WFHE 2K7PA 2UZIL 4U3CA 3VXRA 1JWUB 1UWXK 4O5LH 1GC1C 3TZVD 1X5XA 4JFHD 5C0DA 3V6FB 5BRZD 1IC5H 3IDGB 4K3JL 4U3HA 1C12B 4WEBH 1G9NL 3N1MC 3WS6A 1BVKA 4OD3H 4LFHD 1C5DA 5KZCD 2Y1VA 1V3MA 1KCRH 3I02A 2VB5A 3MA9H 4GW4B 4FP8L 5E00B 3WUWB 5L0QC 3GJEB 4I0PB 1BF8A 4IJ3B 3RQ3A 4JREB 3V6OA 1MUJA 4N0UB 4NQSA 4G7VH 5LCVH 3NCCB 2QEJA 2VAAA 4EEEA 3CLEL 3O2WL 4RMQA 3RA7L 5FF6B 3UTSD 2AABL 4JN1L 2YPLD 4JRYA 2IGFL 3IT8D 5T5NF 1R3IH 2Q8AH 1BFOA 1EX0A 2DQDL 1QSEB 5M94B 1DEEA 3J7HA 5IFJA 3VWJB 1EDQA 4P4KD 4OV5B 4K9EC 2GJ6B 1TZGH 1HHGA 3G6AB 4WU7B 5EIIB 3C60A 3FCTB 3RIAF 5T3XE 1QR1A 3INUL 5SWZE 1IEHA 4PJAA 5B38A 1AO7E 2Y07L 3EHBC 4K8RD 2YPVH 4N0UE 5AD0B 2W60A 4LKXB 3O45B 2J6EA 3SCMB 2F74A 4I4WA 1DN0B 2C7UA 5E4IA 4O2FA 1T1XA 4BFBD 5I8OL 4G6KL 5DURD 3RWHB 4JFEA 4LPUA 3UO1H 5BW7A 1I7UB 4EUPG 1BREA 3DI2B 5CEZL 1JHLH 3U4EB 2R39A 1X5IA 3BZ4B 5D7SL 3TVMB 1FQ9C 4R26H 1AGEB 4G80B 1KEGH 2A6DA 2AJ3A 3MV8E 1X6LA 4OCMC 5I1EH 1AR1D 1GIGH 4HUUA 3MRMB 3OR6A 5GGTA 4DZBB 3HRZA 1OGAE 3QUKB 4KV5E 2FYYA 3VXMA 3HFMH 1V7ML 3QHTC 4QTIL 1UCBH 1MPAH 4NDMB 3SJVD 4JY4A 3LKQB 1K3IA 3BN9C 4FQJL 5ETUA 4MLIA 4XCEA 2PTTB 3MLZH 3QUXC 3FO0H 4OZIB 4PJ8C 4XP9L 1D9KB 3KWWB 4LPTA 3QJHA 4DK6A 1RZIA 3TH3T 3BPNB 3RY5A 1OCWL 1RUML 5F7YC 3LS4L 4ETQB 3MOQA 4EI6A 3VDAA 5CBAB 2KQNA 4MVBD 4HK3J 2B1AH 4FABH 3LPFA 1RUAL 4D0DA 2CRMA 1WTGT 4ELME 1OTSC 2WIIA 3DHMA 4IS6A 4LCWA 4P2RD 1WAAA 3BUYA 5DRXB 3S37L 1MVUB 3OF6D 4DAGL 4L3CA 1QOKA 2FX7L 2R4SH 4MNHB 1IL1A 3SPVA 3QEQE 4UUJB 1UEMA 1T6WA 4JFFE 3GO1L 5IM7B 4ZUWA 3TBYA 2GJZA 4PJBF 4FFYL 3QQ3B 1JRHI 1T22A 1GGUA 4HCRL 4WWID 3E0GA 3MYJA 4AMKH 2ZPKH 5HGAB 1QVOB 4NFCA 5FUZL 1A8JH 4FTVB 4PJXA 3PE9A 4WEMB 2R1YB 2QSTA 4Q9RH 3ULSB 1DBKH 1I4FB 5ACMA 3GMMA 1F3DH 5LBSL 1TTUA 1UJ3C 4XTRC 4HWBA 1U8QB 4OLWL 5D70L 3TO4A 1DLFL 3H42L 4PJDE 2DQFB 3QDME 4FG6C 4HH9A 5C07B 4JPKL 2VC2L 4QF1A 1I1AA 2DQUH 1PSKL 5DJ0A 5LXGH 2G5BA 1TVHB 5HGHB 3D1MC 5EZLA 2Q6WA 3WLWD 3BFOA 5TE6L 3FT3A 3BT2L 5F9WB 1I1FA 43C9B 2HA1A 5D1QA 5J12B 1MIEL 2WM0A 2KH2B 1BZ9A 5ERWA 5H35B 2QQNL 3FAWA 2OYPA 5T3ZD 2XKNB 1ZT7A 3T1FB 5HHNB 1WCBB 3ROLA 4YJZL 3QXVA 2VN7A 1D5BB 4OF6A 5A43C 1JNNL 2XFXB 3PQYE 1LD9A 3PXHA 4KJQC 2BCKB 3EDEA 3KVQA 1T0MB 1N5YL 2R69L 3U1SL 2CK2A 3EHBD 4F7PB 4I77H 2ADJB 2JTDA 3U9PH 1J0HA 4QRTA 4TTDC 4JFYB 4R2GB 4FFWC 3LEYL 3SDDB 2VN4A 4FQ1L 3RHWF 3GBNL 4YX2H 1WBYA 1FNSH 3V5KA 3VH8B 2WK2A 4R6UA 3WUWG 2BERA 3IRZA 2O5ZL 5EULV 4CU8A 4NRXB 4CNIB 3LIZH 1Q9LB 3LOWA 3DX8A 5L8KB 3SKMA 5B39B 5IB3B 1N6UA 4MA7H 2OJZL 2FGZA 2X4UB 4CADB 4IRJA 1II4E 1I9RL 1OL0A 4R4BA 2HRPL 1NAKH 2BNQD 3N9GH 4WCYH 1RHHA 4Z7WF 2YD8A 1YMMD 3BN9D 3REWA 4DGVL 4CU7A 1P53A 4Y4HD 4QRQA 4DW2L 3LMJH 4M4PA 1A1MA 3QUXD 5CZXC 2B4CC 4EDXA 4E0RA 4PJ8D 1A6VL 2G2RB 2AK4E 4NM4H 2OTWB 1CDGA 2J5LC 1CU4L 1KN4L 3ARQA 5CILL 1V3JA 4UT7L 3U48A 5L7XL 5CEYA 4LSRL 2X1PA 1DUZB 3T04D 1TITA 4GBXB 2B5IC 2SEBB 4K3GA 4WWKC 1G6RA 1FDLH 5HHPA 2EE3A 3WYRA 4M02A 5C08B 3SE3C 2BNUA 1OTSD 4KZEH 2CXGA 3BJ91 3ZYIA 3MO1B 5CSGA 3WJJC 4XCYA 4HF5H 1HHIB 3PNWB 3VFMA 1BVLB 1LK2A 1YDPA 4G3YH 1DANT 1IFHH 4XCCL 1RZKC 2DQCL 1T1ZA 1A6ZA 1S7QA 1T2JA 4QRPE 3QT2A 4KH2A 2O26U 3F7YB 3VGAC 3KPPA 4YK4C 3SY0B 3VRIA 3BP4B 3Q5TA 3W5MA 4RNRB 25C8H 1MCPL 2EIDA 3PWLA 4NKDA 4U1LA 3RTQA 1F3RB 2FEDC 4NPYA 5K59F 4XTRD 5AWNH 4ZUUB 1ZANH 1RJYA 4LIQL 1QNZH 5IKCA 3BSZH 4P23A 5H94A 4C55A 5FCSH 3E1F1 4HPOH 3OXRB 2IBGA 2IEPA 3EJZC 4XMPL 5TE7H 1XF5A 1OPGH 5C92A 3QWOA 3K0WA 5K9JL 2CH8A 2X4OB 5DUPL 5C0IB 4XCNA 3VFUA 3MRCA 2R4RH 3EYOA 4HIIB 5BS0A 5FYLH 3Q2CA 1E6JH 5E0QA 4YGVA 3BYYA 1U93A 2H1PL 2IG2L 4FQLH 5IVNA 4KJQD 4KRMB 5FIEA 1OT1A 1GCFA 2MHAA 2D4DA 2B39A 4UDUA 1YPZA 3TH4T 2XTJE 4FFWD 1DQTA 4XXDB 3WFZA 1S7UA 3K8MA 1F58L 4UQ2A 5E5MB 3O4LE 1WQVT 3MLUH 1RU9H 3IDMB 4OZHF 3TYFA 5TF1L 4OGXL 2NY1C 4NWTH 4QHMA 1DJSA 1UM6L 4NQUA 1CK0L 3CCHA 3CFKA 3VG9B 5C0JB 4ODSL 5DQ9B 2G75B 4NQVB 4BELD 3S88H 4GW1B 2UWEA 1NEUA 5DJ2B 1S7TA 3TZVB 1RIUH 4P46A 1H15B 4XWGL 2EYRB 5GGVL 5BXFB 3L95A 3FN9A 5L9DH 5BRZB 5ADOL 2LVEA 1R24A 2HFEA 1JWSA 3A67L 1JWUA 2XV6B 4PB0L 4PJBB 5KZCB 1QUNA 1K4CB 4N5ED 3IB4A 3IDGA 4Q0XL 1C12A 4LPYA 4M1DH 4UDTA 4QGYA 3ZT5A 2VL5B 5D2NB 4XNXL 4X9HA 2YK1H 4KMQA 2QLVB 4F57L 1ZK9A 2JJUA 3P4LA 3OPZH 1ZEAH 3N85H 5IEHA 4D9LL 4GW4A 4EI5A 4Q97A 5E00A 3IDIA 1AJ7L 3WUWA 3GJEA 3NPZB 4ZTOL 4O51A 2W0FB 1KG0B 4I0PA 4U6HB 3TJEH 2Q76B 3UTSB 4JFHE 2J8HA 3NIGE 2YPLB 5DMGC 3QIBA 5IB4B 3VH8G 4ZXBA 4WWKD 5FF6A 5JQHC 4P4KB 4ZSOA 4HAGA 5ESAB 3I6LD 3QPXH 3LV3B 1S8DA 4KROC 3IYLW 2IFGA 4MXVF 4P59L 1H8OA 2A6KB 1BD2D 4LGRB 2Q1EA 3CVHB 1KFAL 4Z7OF 4K3EH 1KOAA 1Z3GL 5I1IH 3QR2A 3RGHA 1VFOA 4WU7A 5IJVB 4DZ8B 2ZUSA 2FJGB 2R29H 4HEPG 4MNGE 4FQQA 5D6CB 2RFXB 2J7LA 4Y1AD 1IZJA 3RWDB 3FL7A 4X5XB 3K2UL 4KKLC 5IBTL 4O58H 5DURB 4CJ0A 4MQXC 2P4AB 1MJJB 2NY6D 1S9VB 3AVEA 2MJWA 3O45A 3GRWA 4U1NA 2NY5C 2OL3B 4NNXB 4NZDA 4ZS7H 3SQBA 3ETBF 5JHLL 5DFTA 4JFOA 4MJ6A 4KU1A 1Q1JL 4LLDB 3S3SA 5JMOC 1UH2A 5HHVH 3EJZD 3U4EA 1U8NB 4OM1H 4O4YL 3G6JF 5FOJA 3EJJX 2P5WA 3DIFA 4YWGH 3DX9B 4FMFA 5CD5C 1Q9WA 4YDJA 4KJPC 3MRMA 1P6AB 4M6NH 4X7TA 5ITBH 4DZBA 1HYSC 4WFGE 1QSZA 4XBGB 3PGFL 2X42A 3SJVB 3K4AA 3QUKA 3DX7B 5TJWK 3IS0X 2DWEB 4P2OC 1C7SA 2H6PB 1EMTH 2DLFL 4Z7WB 3HG1A 5D1XA 2FNBA 1CL7H 5B8CC 4PJ9C 1U8PA 4GAGH 2QSCH 5H2BA 3U0TA 3Q3GB 1JBJA 1PZ5A 3MUGB 3P77B 2FIRT 3KWWA 4J2XA 3PV7A 5HD8C 4X7EC 5FYKE 3KYKH 2NY1D 4HS8L 4IOFD 1KTKE 1Z5LA 5INCB 4P2RB 2ORBL 3VXSD 1YEHL 4HFUH 1UB6B 3JZ7A 1HSBB 1N6QH 3BKCH 3HC0B 1CXLA 5D72L 1A7QL 3Q1SL 1MVUA 2YEZB 3EJYC 3AROA 2LAGB 4XWOC 1FPTL 2V7HA 4UUJA 1I8KB 1S7VB 4R4FH 1B2WL 3V52H 3ZKMD 1XF1A 4W4OA 4AL8L 5L88H 5DFWH 4XPHH 3QQ3A 4O9HH 1HXYB 5DJ8B 2YD2A 1L6ZA 4H88H 2WNGA 5F93C 1FYTE 5L0QB 2ZCLL 1ORQB 5I1AB 3WIFB 3I3BA 1BIHA 1MSPA 2R1YA 4QHKI 4CVXB 1PJ9A 3FN3A 3ULSA 4LLWA 2CKBL 4GRMB 4L1DA 1BFSA 3GNMH 4J4PA 4J7RA 1T3FB 2E8YA 2DQFA 5I30L 3W0WD 2GITA 2YA1A 1WBZA 4LCYB 1FLRL 3VFWB 3EZJB 4PYHA 5C07A 3VMPA 5I66B 2BVOA 2V9TA 2Z8SA 3L7EA 1LQSR 1BLNA 5F7EL 1TVHA 5GRVL 5HGHA 5IW6B 2OI9C 3OJDB 3CMOL 1RUQH 4EVNB 4G6MH 3GBMH 2R0KH 4M8VA 1CWVA 3O6KH 4S1SL 4ZS6C 4R4ND 1G7JA 1WIOA 3LB6C 3GMLB 3T1FA 1WCBA 4LMQE 4I18C 4Y4FC 4YAQB 4H26B 5K59E 1IT9L 2R2CA 1IKNC 3LQAC 4XNZC 2BCKA 4LFHG 5DWUL 2OR9L 4NUGL 1KULA 2XWBB 3SDCA 4KKLD 3D3VA 4UV4H 5EPMA 4MQXD 5ISZD 4JFYA 4RGOL 1CG9B 3DROB 5I19L 5KSBE 1BFTA 4OZHB 2CIIA 4QEGA 2M1KA 3DVIA 3VH8A 2DQHL 1NLDH 5EIVA 5F7NC 4X6CF 4UT6L 4UNUA 1A21A 1NGXB 1JFQL 1KXTB 2AJUL 3QO1A 2VDLL 4NRXA 4XVSL 2DQEH 2H32H 4HC1A 2VDKH 1RJLA 5L6YL 1OAUL 2EDTA 1S7WB 3UJTH 4F3FA 5B39A 5IB3A 3MRGB 5CD5D 4NT6B 4KJPD 1DE4B 2BNQB 1WSST 1HYSD 4CADA 2ZKHH 1RZFH 3OSKA 1YMMB 2CRZA 4Y4HB 4P2OD 1BBJA 5C0BA 5IQ7H 3QUXB 3EO9H 4PJ8B 2FH6A 4H1LA 4PJ9D 3GUTB 3WFEH 1HHJB 3QH3B 2XOTA 1NUGA 1ZA3B 1QSFA 1CBVL 4R8WH 1X44A 3LN4A 1N4XH 2G2RA 3MV7D 3PABA 5HD8D 1J0YA 3K1DA 1WFOA 1DUZA 4OJFH 2OZ4H 1M71A 4HIXH 5C08A 3P4MA 3QZWB 1RJZB 3BRFA 3DRTB 5JO5A 4IBLT 3WHXB 3BMWA 4XWOD 4PLNC 1HHIA 3ZKXC 1ZLWH 2F5AH 1KLFA 3PNWA 4XGZB 4MS8C 4L5FL 4I2XB 5KANG 5E5RB 3DO7B 1NL0H 4X9FA 2DYPA 2QHRH 3QXWA 4JKWA 1E28B 3V6OE 3SY0A 4ZOEA 3BP4A 1HWHB 1VFAB 5DJDA 2JCCF 4MZ3A 4ZFFB 1BBDL 2W9EL 1IGIH 3PP3H 1VADA 5F7DB 1AY1L 4ZUUA 1I9EA 4JRYE 4RDQF 2FIKB 3ESVF 1Q94A 3WFDL 3RWJA 1IGCL 3GSOA 3OXRA 4PLKD 1WLHA 3A6CH 3AS3A 4N9GA 1VGEH 3G6JB 2QQLL 2F8OA 3B9KC 2AAVA 4QKXB 4NBYB 5C0IA 3O3EA 4J6RH 2NX5D 3C9NB 1VGKB 4HIIA 1T5XB 3LB6D 4J3VA 4EBQH 3RBSA 3IFLL 4GRWF 1UACH 2VE6B 3EKCA 1ZVSA 2COQA 1VACB 3IJHA 4OQTH 1NCWL 3HE6C 3QIWC 4U6XB 4POZC 1RZGB 4M1GH 2MSPA 4JR9H 4TSBL 3UXFA 3QFJD 4Y5VC 3GM0A 3MOBH 4ETYA 3LCYA 5CSBA 5LWYL 3JSSA 3QQ9C 1MJ8H 5E5MA 5JMRA 1UC6A 4DJMA 3NCEB 5CJXA 1R3LA 3GBLA 2HFFB 1JNJA 5DMIH 4H0GA 3VXPB 4H0IA 5F9OH 3BW9B 2GTWB 1F11B 2VLME 1YEGL 5ANMB 4IHOB 4NQVA 3X13B 1QBAA 3K1KC 4I3SH 4GW1A 2CO7B 5AYUH 5KW9L 3AS0A 3TZVA 3AMLA 5E7BA 3VXME 2EYRA 4PP1D 5BXFA 4GMTH 1JGUH 1P7HL 5ITFA 4LSTH 1EO8H 2E3VA 3BKYH 5FV2A 4DUVA 4P4RB 5EOTB 4XHJC 4OFYD 1NGQH 2EXYD 3BKJL 4JCLA 5D6DC 2BY3A 1MH5A 3VD7A 5KSAA 1NUNB 4XX1E 4YBQD 2BVUA 4HBQA 3T2NH 2QADC 2M26A 4M7JL 5JDSB 2CO6B 3GJFK 4NKIH 3U4BH 5A2IH 3CGTA 5B3JE 3ALWA 3OKEA 2BP3A 4K71C 4OB5L 2W0FA 2B5IB 3O11B 4U6HA 4WWKB 4AIOA 2Q76A 4LCWE 1DBMH 3UTSA 3KPQA 5IUSA 2YPLA 3WO4B 1UKTA 5DRWB 1BD2B 5IB4A 3UX9B 4F58H 3MRFB 1F42A 3LV3A 4P9ML 5GIRB 1NDGB 7FABL 1TNNA 1MFCL 3CVHA 3QP3A 3UYOD 4PJXE 1DQQA 5DK0B 1MCLA 4Y1AB 4UILL 1J11A 4YK4B 2D0HA 4X7SL 4NN7B 1T4KB 4KI1A 2FJGA 5IJVA 3HHRB 3GHEL 2NY6B 3O6ML 5FYKU 4M6MH 2RFXA 3V8CA 3GJFB 5D93B 1YMHB 3RWDA 1GPOH 2B20A 2Z35A 4OV6F 3CX2A 4I3RH 4OF3A 2X9WA 2X7LA 1MJJA 1DVFD 4NNXA 2EYSA 1FL6A 2OQJB 4X6CB 4BZ2H 2BNRD 4JHAL 3D6GA 3CX5J 3BE1L 4OFKA 4FS0A 4APQD 5BVPH 3BP6A 3U0PB 1A5FL 4LPXA 3C6LC 3DECA 3RX5A 1MNUH 2GUOB 4LNRA 3B9KD 5DEGB 1U8NA 3HS0B 5F21B 3AUVA 5LGHL 3VD5A 1IGML 3REVB 3T0VA 3SE9L 1CFQB 1P4IL 3X3FH 4N9OB 2R23A 2DWEA 2FJFB 3MUHL 2H6PA 4F2MA 4Z7WA 3WFCL 1SVCP 5A16A 3EO0B 3QIWD 4XP5L 5I1GH 4WY7L 4HUXB 2NY1B 3KS0H 4JZJA 2AS5M 4WFED 5E8EB 1NCCL 2CGRH 3LZFH 5HYJD 6FABL 1AH1A 1EPFA 5IFHL 3VXSB 4Q7DA 4OF5A 3CXHJ 3S35L 3IGAB 1OAQL 5INCA 5KVFH 4P2RA 2CRIA 3U7YL 2Z8RA 1UJTA 4ODXA 1G7IB 4PRIE 1RD6A 5M95B 1AGBA 4G8IB 1DP0A 4G5ZL 3HC0A 1OP5K 1SJXA 5I71C 3B9AA 4YDLC 4MD5A 2JELL 9CGTA 1S5HB 3VMNA 4C54A 2LAAA 2GTZA 1MY7A 2YEZA 3KYNB 2DDQH 5K9OA 2VISB 1T7XA 3UZEA 4CVZB 2QKIB 2WBJA 5CUSH 3EYVB 4XHJD 1IVLA 4U49A 4XNYL 1HXYA 4KMTH 5DJ8A 1T7VA 1XH3B 1RK0A 3P73B 2V2TA 2FECL 2VKWA 1ORQA 3S4SB 5I1AA 4NBXB 4OUUA 4FQ2L 1J0IA 3F7QA 3X11A 4MJ4A 3W0WB 2QADD 2JCCB 3MCG1 1W72H 4PGEA 3RWFB 3W9DA 2E9JA 3OTTA 1TETL 3JV5A 3L3DB 2BSRA 1JNHA 1T3FA 3FQRB 1U3HC 4KC3B 4RX4D 1DQMH 2RB8A 3L3GB 4LCYA 1KJ2L 4OAWA 1KELH 3BXNA 3PP4L 3ZKNC 1MQKL 5LG1A 2EDFA 4FQCL 3UTPE 5IW6A 4PR5A 2JKXA 5BCAA 3MJ9A 3F5WB 3SDAC 3NFPA 4XVTL 5EZOL 4LVHB 4DCQB 5DLMH 4Z7VF 1NCBH 1J1PL 4OIAA 1U91B 2C5DC 4LLQA 1C5BH 5T3XL 2C3GA 3GMLA 4GRWB 4YAQA 3EYUH 4H26A 4KQ4H 4MJIA 5ISZB 4UOJA 3NCJL 5E5UB 4MAUL 4NZRH 4H8WL 2XQBL 2FO1A 3DRQA 2EO1A 3ESUF 2P24B 2YD5A 2ESVD 3CU1A 2HLAB 4JG1L 2QR0A 1UENA 5DVOA 4TRPH 1ZOXA 1FJ1A 4RFOL 1CG9A 3DROA 4L8DB 3T4AB 2VDOL 1PEWA 1BZ7B 5DR5H 1MFEL 1FV1B 1CXHA 3MLTB 4NJ9L 2BX5A 1A1NA 5ICZB 3CMGA 1H3XA 3BRDA 4DUWA 3C5ZC 1NBZA 1S7WA 1MAKA 3HAEH 1BGXH 4P2OB 1U95A 2BNQA 2AEIT 5B8CB 3P0YL 4PJ9B 1YPZE 1IM3A 1YMMA 1MIML 5KVGH 3HR5B 4Y4HA 5MHSD 4UZGA 2OLDA 4IMKC 3V4UL 5I16B 4LVEA 1YJDL 2XKSA 3MRKA 3HKFA 3E8UL 3R06B 3GUTA 2UZIH 3QNXB 3MV7B 5MEPB 2W0PA 1I9JL 3LSOB 3MLWH 4GKSA 3NFNB 4DOHE 1DLHA 3BWUC 1Q0XL 1HXMA 1UZ6F 2HJLB 1B0WA 2UWEE 3ARYA 2CKNA 4W70A 3MV9D 2OX5A 4PS4L 2AEQH 2VZVA 1EHXA 3CFDB 4FP8H 1ZHLA 2E7HA 3F7RA 5IF0A 3CXDL 3QZWA 1RJZA 3HB3C 4U0QB 4OLXH 4TUOB 4PJCE 5IVXF 1RZ7L 3WHXA 3QB7C 3ULVE 3O2WH 3RA7H 4XC3L 2AXJA 1LE9B 1VDGA 3DO7A 2AABH 2DQGL 4JN1H 2IGFH 5HHME 3X17A 1Y6KR 2DQDH 2F53D 5I2IB 1YEEH 3PF2A 3RY6C 3FB8B 3BPOC 4Z7NF 1VFAA 1KPUB 3KYAA 3INUH 5LQBH 5F7DA 1U3HD 4JVWA 1LNUA 1PKQB 4ZSOE 2OI9B 5GHWL 4OFVA 5IR1B 2Y07H 1FGNL 1LO2L 2FIKA 1PLGL 5T1LD 3L1OL 3U7AA 3ZKND 3T0BA 3ARVA 3SEPA 3NABL 3LKRB 3SDAD 3W5NA 1AHWC 2IANB 2HVJB 2I5YH 2WWMC 1YC7A 1CZ8L 3AAZA 5ALBL 1I1RA 5D96C 1JTPA 3C9NA 5JORA 1VGKA 4XNZB 3P11L 5CEZH 1LP9E 1T5XA 1T0NA 4LVNC 5D2LF 1QKZL 4QY8A 5D7SH 5D5ME 1G9NC 3VG0L 2VE6A 3QFJB 2E5EA 3BX7C 2I60L 5HHQB 4TUJA 1QQDB 5J89A 2FX9L 5IV2A 5DJ6B 4U1GC 3IDNA 4WI3A 1MFDL 3S4SG 4MQ7B 4GKNB 2VIRB 1T20B 3IRPX 1V7MH 4OM0L 2IANE 4QTIH 3QDJA 4EKXA 2P5WE 1UXSB 1MQ8A 3QA3A 3VXPA 4N8PA 4RDQG 5CZVH 3BH8A 4X4YB 4XP9H 1WV7T 1BZQK 4YHYC 4HUVB 2OMNA 2N7AA 1OCWH 1G7PA 3WN5C 3HG1E 5HI3C 4U1SB 5E99H 4JM4L 1BFVL 4DTGL 2PYEA 3C5JB 1RUAH 4P4RA 2PTVA 1F90L 3CUPB 5IJKA 4X9BA 2W59A 4BSVA 3OX8B 4PJHA 4NCDA 3S37H 1GOFA 4HIEB 2FX7H 4S11A 4PJGF 1T66C 2NMSA 1MCDA 3GO1H 5L8JB 2EC8A 1SYSB 5JDSA 4MNQE 3L3HB 4FFYH 5GS0H 2CIKB 4HCRH 1UH3A 4AEIL 3FHQA 3BJLA 1GZQB 5FUZH 1HINL 2XA8L 1WEJH 2EE6A 2XWJB 3SGJC 5I1DB 1YEJL 5LBSH 5F1IB 1XF2B 2OTUA 2X4TA 4OLWH 5D70H 1DLFH 3H42H 2GCYB 1QYGL 3BDBA 3ZKXB 4Z7VB 5GIRA 3QO0B 4J3WA 4L4VD 4YDKL 1G9ML 1KF9B 1NDGA 2VC2H 1NMAL 4GG8A 4JQVC 4MYWB 4JY5H 1UWGL 4Y1AA 5TE6H 1FZJA 3BT2H 3GIVA 2H32B 1QBMH 1T4KA 3B2UC 5C6PB 1J05A 3HN3A 3WJLA 4WJ5A 5TH2B 1DVFB 2CJUL 3W81A 1MIEH 1BOGB 1YMHA 4Y5YC 1EEYB 2QQNH 4NJAL 1L7TL 3D39E 3VXTA 4APQB 1MCIA 5I6XB 5TDPA 4GRLD 3JVGA 5DGRA 1XGRA 3BN3B 5IGXL 1N5YH 2R69H 3U1SH 3B9KB 4P9HL 4PRDA 4OZFB 4MCYB 4LSQH 5IWLC 1CIUA 3LEYH 2DI7A 2DLEA 4FQ1H 5DC0A 4KHXL 4S1RL 2VQ1B 2WWMD 2Z91A 5CS7A 5IHLB 2Z92B 4XC1L 3SGKA 2O5ZH 2C3HA 4J3XA 3T0EA 2YWZA 1CFQA 3S36X 3D3VE 3QIWB 2EC9T 5E2WL 4YFDB 3QNYB 2VXQL 1NGWB 1YECH 1EXUA 3L5WA 5EBLA 1JNLL 4G8GE 2HRLA 4XP1L 4XXCC 3MRQA 5HYJB 2OJZH 4HHAB 5JOFB 5E6IA 1S5IL 4HUXA 2VITB 4TVPE 1WZMA 2DLHA 1I9RH 4Z7QF 5E8EA 2HRPH 1ZLVK 5IEKA 4P5MB 1JZ6A 2X89D 1J8KA 4KGJA 4FNLL 3QSKB 2ZSVB 1IAKB 3IGAA 5I76B 4NQDD 3B5TA 1YC8A 1DQDH 2DS4A 5CBEB 5EWIL 3FFCD 3TIEB 4DW2H 4I1NB 5I18L 1GYAA 1G7IA 5JQ6L 3GSUB 5DMJB 5C0BE 1CU4H 1KN4H 2C1PB 2IPKB 4GJTB 5IVXB 1D6VL 1S5HA 2ZUWA 5HI3D 5CILH 3UTQA 5MENA 3WDJA 3KYNA 5L7XH 4LSRH 1HDMB 2AJZB 2VISA 4ZYKB 2QKIA 4QXGL 2YA0A 1HSAB 4K3HA 2QADB 4J1UB 1QSFE 1I85C 3JV4A 2HH0L 1JF5A 3DNKA 1XH3A 4L1HA 1NDMB 2CRYA 3WIHH 3P73A 2OJEA 3S4SA 4KTDL 1HHHA 3GKWH 3W0WA 1T66D 3OZ9H 1R6VA 3BP7B 1F00I 4XCCH 1KJMB 3MBEC 1O7SA 2XPGA 3L3DA 2DQCH 5DUBA 2V6HA 4PV8B 1KT2A 4X6DF 5KG9B 2EEAA 5CEZD 3L3GA 1OQOA 4JFXB 1P7QA 3TJHC 5F7HA 1X7QB 1MCPH 2XG4A 2H9GB 4U0RC 5DD6B 1MRCL 1WFTA 2CLRB 4K07A 3V0AC 1G7QB 1A64A 4Q6IC 3NH7L 4KKCD 5KS9E 3K81A 4NNPL 3RP1A 3EDJA 3QFDB 3HMXL 5E8PA 1U91A 4JM2A 5D2LB 4XMPH 2ITCA 1TPXC 5K9JH 2ESVB 3MMEB 3MR9A 3D69B 3B2UD 4PRHD 5DUPH 3OKYA 4TSAL 1BHGA 5F6IC 5ISZA 4PRAB 4M93C 1FVCB 4RMVA 4U1IB 2HLAA 4M61B 2OR8A 5F96L 3TWCL 3T1WA 3BEWB 3QPQC 5DJCB 5MI0C 4Q74A 4L8DA 5AG8A 2IG2H 5HPMA 2E7MA 4PJ5D 3BD3A 2C3VB 3SKUD 3Q6GL 1A7NH 4RGND 4GS7B 5C09D 4NQCD 2WV3A 5IMOB 5C0FA 4XP4L 4M3KB 1LO0L 5ICZA 4QCIB 1A6AB 4WUUD 2J8UF 3MCKA 4Y4KA 5TF1H 1TQBC 1UM6H 3KPLB 3U9UA 3C8DA 4P2OA 3FTGB 2JB5L 1LILA 1U92B 1XR8B 3ZL4H 4C57C 3S96A 2KUTA 2VDRL 4ODSH 2JK5B 3BWAB 2WANA 5FFLA 5FO9A 3GMQB 4XWGH 5I16A 5GGVH 3EOTL 4PJGB 1SQ2N 3NCFB 5ADOH 1QFWM 3FB5A 2C3WA 5BV7C 3A67H 3QNXA 3AFLA 3WKML 2W1NA 4PB0H 2BHUA 1CTOA 3MV9B 5DEZA 5FGSA 1NAMB 3NFNA 3A0OA 4Q0XH 1T6VN 5FYKL 1ED3B 2AXFB 4XNXH 1DQLH 3HE7C 4F57H 1JWMB 5AUMB 4D9LH 5I71B 4YDLB 5D4QA 1K6QL 1ZS8B 5F3HA 4AENB 1IC1A 1AJ7H 2V5MA 4HULB 4YGAB 4OZFG 4ZTOH 1TTGA 2UYLB 1RURL 2JJTC 2LTQB 3RBGA 1OTUD 2APFA 4XNQB 12E8L 4JB9H 4Z7UF 2DICA 1S78C 2F53B 3SKJL 1RV6X 3GSQB 1QSVA 1JUFA 4OD1L 1LE9A 4KGLA 3GM8A 4ALAL 1TDQA 1SJVA 4P59H 1R0AH 1CDYA 4Z76B 2X4RA 5I2IA 1KFAH 1U3HB 3BESR 3BH9B 5GQBA 4RAVB 1Z3GH 3UDWA 1F3DJ 1BX2B 1KPUA 2F54D 4WHYG 1M7DB 5T1LB 3MBED 4WFFD 3EGSB 3MRLB 5E2UL 1GC1L 2VQUA 1PKQA 1I7ZB 3DXAD 3SDAB 5IR1A 2R0WL 1CLOL 3GSNA 5GS3A 4JVPA 5D7IE 5IBTH 3TJHD 4OLZH 4PIRF 2NX5A 5I1HH 4DN3H 1PG7X 3LKRA 3WL9B 1KIQB 3B8SA 4D0CB 3QYCA 2X1WL 2DD8H 3EDKA 5HVFB 4YLQT 1AD0B 5JHLH 2NYYD 2HT4C 4Y19E 4XH2A 1Q1JH 1U8HB 5KN5B 2V9RA 1ULVA 4KQ3L 4WRLA 1J88A 1HYRC 3GB7A 3TN0C 1PKOA 4O4YH 5CEXA 1RI8A 5CJOH 1VENA 1SY6L 4OSUL 4IIQC 3PGFH 3S6CA 3IFPA 3T65A 4MQ7A 4P2YA 3F65A 4GKNA 2VIRA 2DLFH 4K9EL 1T20A 1XF3A 2W0KA 4Z18A 4ZO8A 3MRHA 4JLRA 5FO7B 5E24E 5J3HC 2R2BB 3RWEB 5EU4B 1AQDA 4PBWD 1W72B 4MZ2A 3VMOA 4Z0BL 4AG4L 4RFEB 5DJYA 2GYSA 5ABDE 4H5SB 3EAKA 3ZDZF 5J0BA 4JPVL 4OFYA 4U1SA 3PHQB 4G9FD 2YUZA 5HI4C 1YEHH 2N7BA 3C5JA 1DDHB 3QQ4B 4LCIL 4XPFL 4OTXL 1Z2KA 3O41A 1A7QH 3O9WD 5K93A 4U6YB 1IQDB 2Y25A 1FPTH 1LDSA 3LKPA 1B2WH 2E6JA 4KDWA 4BQ8A 4TOYH 4AL8H 1MCRA 4X6DB 2MNUA 5F7FA 2CIKA 1AXTL 3X12B 2IPUK 2NY3C 3UP1A 3KPMA 2ZCLH 1IEAB 3VFTA 2X6MA 3QDGE 2BDNL 4PTUA 3MJGX 1OAZL 4L4VB 3SBWC 2CKBH 2E9IA 1UFUA 5F1IA 1Z9OA 1XF2A 3D18A 2EDWA 5I30H 4HUNB 4HK0B 2EKSA 1CGXA 3QO0A 4ZO9A 5DHVB 4Z77A 3FN0H 4YHOL 5F7EH 1G9EA 3O3DA 1AGFB 1S78D 3H9SE 4M43L 5ID1A 3CMOH 1VKXA 1OW0A 5JXEC 2H32A 4YEFA 1KPVB 4G8FA 4HFWA 5TH2A 5T5FL 4S1SH 4GRLB 1DVFA 1LO5A 3GMNB 1BOGA 1UT9A 1FL3B 2BNRA 1EEYA 3VI3F 4QHKJ 4APQA 1SJHB 4KTEL 1ROWA 3CSYA 5DQDH 2I07A 4XZUB 1TLKA 2D7NA 1UZ8A 5EUOE 2OR9H 4NUGH 1SJEB 3OAYH 1AHWB 3EZ8A 3I9GH 3LRGA 1VA9A 3ZE1E 4MCYA 1HKLH 3C09B 3VXNA 4F7MB 1AIFB 3IDYC 5EU5B 3IF1B 3HI6H 4RGOH 2J8UB 5FK9B 4MJIE 4WHDA 3PWVB 5D8JL 4YH6A 4RFNC 2Z92A 5DS8B 5F72S 5FA3B 2HT4D 3SKOB 5CZKA 2YPKA 1JFQH 2AJUH 1VFUA 2APVA 1S9KC 4NUJB 4UI2A 1FVDA 2J6EL 2WUCL 4JPWL 5L6YH 3TN0D 2OZ4A 3V79C 1NGWA 2NY2C 2OS7A 4U1GB 3F6IA 5IBUB 4NP4L 3GSRB 5HYJA 3U83A 5FGCE 4HHAA 4HWEH 1BWMA 4NCC2 3QHZL 3OBAA 1NC4B 2VITA 5T33L 1CFSA 2PUQT 1KLGA 1HZHL 4NQDB 1PG7L 2Q8BH 3FFCB 4P5MA 4RMUA 3U46A 2GT9B 1TZIB 3RUGA 3PWNA 5JOPD 1ZHBB 3VI4E 1KN2L 5I76A 2EE9A 5CBEA 4JPIB 1AKJD 1PQZA 4N90D 3TIEA 3WN5B 1CBVH 3LDBC 1QG3A 4BH8A 2A2QT 3LRSA 2DB8A 5D71L 3IXAB 2FGWL 2IPKA 4Z7UB 3HZYA 4JJHA 3SGDH 1G84A 4HIHB 2M2DA 4LGPB 1HDMA 4U1HB 4CMHC 3NIDE 5HI4D 4ZFOL 3WEXB 2NTFA 1HSAA 2IQ9L 2EZ0D 2VSDA 5B4MC 5I74C 5IFAH 3NMEA 2HJFB 5IHZB 2IMMA 1OGTB 4RX4A 4KHTL 1ZA6A 2PO6D 3ARGA 1ZGLM 2VLRD 1KJVA 4L5FH 4XPAH 1ACZA 1KJMA 4WGWB 5IIEB 3QUYC 5KOVC 4FN0A 2ZCKH 2EDKA 2XACC 5D7JD 5KG9A 3TBVB 2BY0A 2P42B 4OQTA 3ZSTA 2AV1B 5F6HI 2WW8A 1X7QA 4NZTL 4OKVB 2VL4A 4WNQB 2H9GA 1BBDH 2W9EH 4LLUB 5DD6A 2Z93A 5F9JB 2CLRA 1AY1H 3PV6B 1G7QA 1MHCB 2D7PA 2GFBB 1FVEB 4PRHB 1JPGA 2P8MB 2XZCL 3TBTA 3GSVA 1IGCH 2K3TA 1ZT1A 4M9PA 5KAQG 1TFHA 2H2SD 2C26A 3EOBB 3G5XB 2QQLH 5KVDL 2RAMA 2ESVA 3MMEA 4Y5YB 3BIKA 35C8L 5EN2B 4PRAA 3IJSB 1TJGH 1QFPA 3CDGB 4UV7H 2XN9E 4TPRL 4U1IA 4PJ5B 1N5AA 3HC3L 5CWSB 2ENYA 7CGTA 1MY5A 1X5FA 4RGNB 3IFLH 3VA6A 3HC4L 4L3ED 5C09B 4LPVA 4NQCB 3TIDA 3K8KA 4R0LC 1FE8L 3KNBB 4NM8L 1NCWH 2F15A 1CTNA 1EVTC 4WUUB 5I8KL 4HJJH 4HS3A 5IMOA 1XGUB 4WO4A 5F3BB 3UC0L 1P84K 5T1KD 4CL7A 3D48R 2V7NB 5DJAA 5LWYH 1A6AA 1Y18A 1NGYA 1P7KA 4LHJB 2P48B 5C2BL 1AGCB 3KPLA 1R3HB 1J0ZA 2XXMB 1U92A 3F62A 4PY7B 1UYWL 4XI5C 1FC1A 4GXVL 2JK5A 4A6YA 5C3LD 1YEGH 3B9EA 1WFUA 2G9HB 1FNLA 4DFIA 5KW9H 4NQEA 2NPLX 1S7SB 4XBEL 4F7TB 5IHUL 4PJGA 3QDJE 3VE0B 3RPIA 4ACPA 4GG6A 3U4AA 3CDYA 4WUUE 3RIFK 2FLBT 5GZOD 2AI0L 3I75B 3MV9A 4PFEA 1KXQE 3QAZC 1D5XA 3BKJH 2WUBL 5FUCC 1ED3A 2IPUG 5E2VL 1D5ZB 1WT5C 2APXA 4JE4B 1AE6L 5JXAL 4M7JH 4ZG1A 3WE6A 5DVLA 3VFRB 5EZIL 4AENA 3OKNB 3ILQC 2PYEE 4OB5H 2UYLA 4PJHE 5J13C 4U4BA 3NN8B 2E7LC 2H8PB 3QCTL 5CJQL 4OI9A 3UZVB 2F53A 2JE8A 1MRDL 1KTLB 4Y16D 5B4MD 3ILPB 2EICA 4P9MH 5DA4A 1BQHA 2F54B 3MBEB 1MFCH 1UWEL 3DXAB 4RAVA 4GAFB 5IBUG 4UILH 1G6RL 4EUPH 4X7SH 5I73C 1M7DA 5IK3B 5T1LA 3ZT6A 4XNUL 5EU7C 3FQUB 3MRLA 3GHEH 1I8LA 3O6MH 5HTSA 3VXQB 1QFUH 1CICC 1KNOB 3LS5H 4G43B 2WQ8A 3UJIH 3L3JB 2VNCA 5GJSL 3HCVA 5SX4I 4Q6IB 1DQJB 4K7FB 2NLJB 3G08A 3CFEA 1FGVL 3P4OB 4POYA 1KIQA 1UA6L 1TPXB 4JHAH 5TFSH 5D7LD 4HUMB 2IAMD 2E27L 3HZVA 4L9LA 2AEPH 5F6IB 1A5FH 1P4LB 1AFVL 4M93B 4KVNL 1YNKL 2BFVL 4R90L 4CBPA 4UB0H 3ROOB 1IQWL 4O2EB 4KK9C 3VRJB 3BZDA 4S1QH 1Q8MA 1IGMH 1EZVX 1UQSA 1CD8A 1P4IH 3PWJB 4FXKB 4ZAKD 5HYQB 4GUPB 3JXAA 5BMFL 5JZ7C 3V5DB 3OXSA 2GK2A 5E95B 1B4RA 3WFCH 3O2DL 4JRXE 3PXJA 3U6RB 3P9MB 1INQB 4ONFH 5FO7A 4XP5H 3TYGH 3RWEA 2GEEA 4X4ME 5EU4A 5SWSD 1A3RL 4KXZH 4CN4A 3T0EE 1W72A 4RZCB 5MERB 1TQBB 3NFSL 3QIUC 1INDL 4G9FB 3RX7A 6FABH 4H5SA 5IFHH 1BEYL 3SGDI 4EN3D 5C71A 3ZT7A 1H9VA 2FZ3A 4PD4K 3VFSB 1RVFL 1YY8B 3WHE1 5GGSY 2VZOA 4JANB 2C1OB 3O9WB 2WINB 1NFDE 3U7YH 1J8HD 4XI5D 5HHXL 1K2DA 1DDHA 2YD9A 3D85D 4G5ZH 2JELH 4U6YA 3S9DB 1IQDA 4YBHA 3DTXB 3ZDXE 3ARXA 4ODVL 1N3NB 2VZUA 4U6VL 4LRNL 4XNYH 2BMKA 4N8CL 4TVSa 3LKNB 3TCLA 1QRND 3KLDA 4KPHL 2KZ1B 4Q2ZA 3CH1B 2HKHH 2I27N 1YYLL 2DL9A 4FQ2H 1IEAA 2ZJSH 5MENE 3MQIA 1TETH 4N0YH 2H45A 4L4VA 1IM9D 1YEKH 3ILQD 1LGVA 2DMCA 3S3JA 5KVMC 1N8ZA 1KJ2H 3PP4H 2FJHB 1MQKH 3ULVL 2XG5A 3JV6A 3FRUB 3TO2B 1AGFA 2CUMA 5I8CB 2WZPD 5J1TC 4FZEL 1GGYA 1I8IB 5FYLE 5IMKB 2P5EE 1KPVA 1C16B 1IKFL 5EZOH 2UVEA 3HAEA 3MUJA 1K5NA 2N1KA 4GRLA 4PJFF 4PUBL 2B2XL 4K2UL 1SMAA 4GOSA 5FV1L 1FL3A 5T3XH 1CLZH 3DVNB 1H5BC 5HDLA 4ONHB 2JLLA 1MCJA 1XT5A 1IAIM 3NCJH 4MAUH 4J3UA 4H8WH 3MREB 4PBVC 5D1ZD 4S1DD 1GL4B 1CICD 1SJEA 3C2AL 3PL6A 1CGSL 1LEKB 3QCUL 3VCLB 3FO2A 4OI8A 1AIFA 3IF1A 4RFOH 3D2UD 1U8LB 2J8UA 3ECBB 4IOIB 5FK9A 4JQIL 1DN2A 1UWXH 2VDOH 1D3CA 3PWVA 4JCMA 3VW3L 2A1WL 4HUKB 5DK2B 3TN0B 4JO1H 5DS8A 3SKOA 3EO1B 1WBXB 2VLKD 4NJ9H 3FB7B 4OZGE 2J3SA 4NUJA 1F4WL 2JIXD 4B53A 4YUEL 3VGFA 5F1OB 5A2JH 4IIQB 3MV11 2DBJA 1OM3L 1ADQL 1LWRA 3GSRA 4KK9D 3MRIA 3RGVD 1CCZA 2X4PB 2X89A 4RSVA 3TT1L 4IRZL 4B7LA 2HTLD 4HKBA 3P0YH 5HDQL 1MIMH 4NQDA 1FFPB 3FFCA 5L2JB 1AKJB 2YZ8A 5CMAB 5BOPA 1YJDH 1OF2B 3LQAL 3E8UH 1FRGL 1JZ8A 4F9PA 5ESQB 2Y7QB 5HHOD 1I9JH 1WC7A 4QYOB 4V2BA 3MJ8B 1X5KA 5IW1B 3QIUD 3FOLB 4HKJB 5TPWL 5HVHC 4PRBB 3IXAA 4MB3A 1KXVC 4PS4H 1RK1B 3NZ8A 2RJMA 2EDLA 1DFBL 5BZWB 3CXDH 2PO6B 1N7MH 4LP5A 1U9KA 2VLRB 4PRNA 3KJ4C 2HJFA 3ZLQC 2P8PA 4MJ5B 5IHZA 1T2QL 2CLZB 1U8JB 5D7JB 5E9DD 4P3DB 4KWUA 3K7UA 1XGPB 1NLBL 1J10A 4XC3H 5HGBA 5T1DL 2MPAH 1BJMA 1OT2A 2DQGH 2VLJD 3KAAA 4PJIF 3ZDYE 4HX1A 1JHKL 3HA0A 4PB9L 3FB6B 5C0CA 3TBVA 5GS1A 3NGBC 1H3WM 4PREB 2Q7YA 4L8SC 1TJHL 3MFGB 4OKVA 3BO8B 4WNQA 3DUSB 5F9JA 4N8VB 2ICEB 1FIGL 1XZ0B 5E4EC 2HN7B 5ICXA 3RJQB 1FGNH 1LO2H 2P8MA 1PLGH 4I0KA 3L1OH 5EO1B 2MKWA 1EFXA 3NA4A 3H3BC 3ZMRA 2WWKT 2V5RA 2R2HB 4M62L 1UCTA 1FG2B 4IRSD 2VWEC 5ALCL 2ADIB 1CZ8H 3F7PC 5EN2A 4L3EB 3V4VL 4YNYA 1NBVL 2KL6A 3CDGA 3P11H 5FECB 1WITA 4XHQA 2VXUL 4XPTL 1S9WA 1QKZH 1OSZB 4X6EB 5J6GB 1R3JA 4QRUB 1SEQL 3QUZD 5HGDB 3AREC 3ZE0E 3VG0H 5C09A 2E6QA 4NQCA 3UPRB 4ODHL 3IDYB 4P5TD 3VWKD 3KNBA 5T1KB 3WSQL 2I60H 5GRVK 2FX9H 1XCQB 3ARZA 1HILB 1XGUA 1O0VA 4RFNB 5F3BA 1MFDH 2IBZX 2UV3A 4WFHD 3NACL 3WFBL 4OM0H 4E5XB 4HCRA 1DSFL 3HNSL 3C8KB 3KPOA 4QT5B 1B0GB 3TESA 4NSKA 3EFDL 5EOCJ 1QBBA 3G6DL 1RFDL 3W9EB 2ZOLA 2CKBB 4HBCL 4WHTA 1GGCL 4LF3B 4QHLB 3RI5K 2G9HA 2BXYA 4F7TA 3HPJB 1CFVH 2Q3AA 3W39B 3VE0A 4TVPL 3QRFM 4JM4H 1BFVH 3KS0J 4DTGH 3I75A 1PYWB 2AJSL 1FYHB 4Y89A 1LO4H 5FDWB 3LD8C 2X70A 2PXYC 3RVTD 5F7UA 4FMKA 1B0RB 1O5DT 5C6TL 1QLFB 3TA3C 3MGOB 5HPOA 3OKNA 5JHDE 5ICYB 4CMHB 2W65B 3GMPA 3FKUS 4G42B 4KUZL 2CUIA 3ARSA 3JTSA 1HINH 3PGCA 3EYFB 5T3XD 5IG7B 2A83B 4Y16B 3FOMA 3NN8A 5SWZD 5I74B 2ZOKA 1FCGA 4U1KA 3UBXI 2ZP0T 1WIUA 5DYOB 1YEJH 4KDTA 1AO7D 4DKEH 1BIIB 1KTLA 2AV7B 5BO1L 1WWWX 4PJFB 3ILPA 4XNMA 4JFZL 4YDKH 1G9MH 4ZDHA 3S5LB 3STZB 1NMAH 1JJUA 2B1HL 4PGCB 4NWUH 4Y2DC 5F7WC 4OCRL 1UWGH 2BSSB 3FQUA 2DBLL 4JAMB 2CJUH 3VXQA 1J1OL 4OFIA 1M7IB 3BI9X 1I7RB 3WO3B 3L3JA 4FRWA 4NJAH 1L0XA 3MV8D 2HJKB 3CFIC 5D7LB 1IGJB 1DQJA 1TQCC 2IAMB 3F12A 3IKCA 5JIPA 1XGTB 1K8DB 3P4OA 5C9JA 1QP1A 1OGAD 4LVOC 5IGXH 4V1DA 2BVYA 2F5BH 4P9HH 3K4DA 2FHFA 3K46A 5C0RL 1LK3L 3SDXA 1P4LA 2AQ1A 3VRLE 4LCCB 3OKMA 3O2VL 4W6WB 1C08B 3QEGL 3FAXA 43CAA 4S1RH 4ZAKB 4XBPA 5ENWB 1LEIB 4ZFGH 3CZFB 4XC1H 1E27B 4JQXC 4R0LB 4WW1B 5DRNA 3QG7L 4FXKA 2FD6L 5HYQA 4GUPA 5E2WH 5SWSB 3ARED 1JGVL 1YYML 4JZNB 1JNLH 3IJYA 1I1CA 4I5BA 3DETD 3BPCB 4M3JA 1GRWA 5H37H 5J6HA 1INQA 3KXFE 1AR2A 4C56A 5MEQB 3WIHA 4WTZA 4EN3B 1S5IH 1GGBH 4KZDL 1D5IL 1DEDA 4HJ0D 4XP6L 1DUYA 3EDFA 1MLCA 3O6FC 4G9FA 2Z31A 4M7KL 3QEQD 4X8JB 1J8HB 2GY7B 4JFFD 4TULL 4FNLH 3VFSA 3D85B 1YY8A 4KJYB 3HMWH 4JANA 4N8VG 2C1OA 5FYJH 5EWIH 3WKNA 3O9WA 3TBSB 3NBNA 5I18H 2QSVA 4U1JB 2NXZC 4XMKL 2CDFB 1UM4L 3D25B 1X4YA 1CIDA 2AKRA 2CK0L 1MHHA 5J56B 3RJDA 3FQNB 3QCVL 4XMLH 3RUGE 5E6ZA 3V0VA 1RAMA 3QDMD 5DUMH 5E1AA 1LDPL 4QXGH 3MRRB 4TNVK 2HTKC 4PJIB 1MHEA 3QDAA 5E8OA 3LKNA 1IM9B 3LEVL 3PJSB 4Y5XC 3CPLB 3I6KA 5F1NB 3CH1A 4QXUL 4KTDH 3SGEI 2N4IA 2PXYD 4HKZB 1QFOA 2HFGL 1H3GA 2VR5A 5J13B 1HK6A 3TA3D 5IMMB 4MDJB 4BZ1H 1B6DA 1RZJC 3TNMB 3S98A 1KCVL 5DZLA 1KIPA 5SWQB 1XCTA 2PCPB 5E03A 4KI5E 3PQYD