5IOPB

Cetuximab fab in complex with 4-bromophenylalanine meditope variant
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
215
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Cetuximab Fab, light chain
publication title Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 46
structure length 215
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iopB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iopB01
2V9RA 3RUGA 3B2VL 2CLVB 1U3JA 2BVPB 3QAZB 1YEIH 4N90E 5E2WH 5EU3B 2G9HB 4OLWH 5D7LB 4DUVA 5FDWB 1QSVA 5JPNB 4O2FB 1LQSR 3UBXG 3ARDB 3FAXA 1T03L 1GHFH 2A6DB 3FN0H 2DQJL 3HB3C 3HHRB 1BFTA 1VGKA 4FNLH 1RJYA 4RDQG 4EN3D 4OGZA 3ECBA 1V3KA 1RUKH 2PTVA 4WO4C 2OJEB 1MCQA 3QQNA 2I60L 2BMKA 5ILTL 3B6SB 1QQDA 1MREH 2DJSA 2QHRH 1P7KA 3WFDL 1EFXA 2EDBA 4ZMAT 3L3OB 4LSVL 2WWKO 3VWJC 5CZXD 1BZQK 1QSFE 1MCIA 1OAQL 3CSPA 1I75A 2IMNA 3MV01 5GGSB 5JOPE 1IEBB 3QNYA 1CE1H 1JCKA 4U1KA 1R3LB 2ORBL 5BMFH 1WZKA 2EKSB 4DEPB 3VXMB 1IGML 3RBGA 3UBXB 2HT4C 3C9NB 1GL4B 1GXEA 1T5XB 4NZUL 3PV7A 2EIZB 1CXIA 1T7WA 3FTGA 1G9NH 2YPLE 3HB3D 4U1GB 2X9WA 1BEYH 4LEOB 4WO4D 2FZ3A 1FGNH 3KS0H 3U4EB 5LWYL 3E6HA 3FFCA 4FXGB 1X5KA 2HJLB 4L9DA 2J2ZA 2ADJB 1ZA3A 3W2DH 1YN6A 1UENA 4LLDB 2DS4A 4TUKL 4M9OA 4Z76A 2UZIL 3WEXA 43CAB 1GRWA 3VWJD 3ARQA 4OLEA 2VLKD 5JW3H 3LS4L 2VXVL 3X3FH 4GRMA 2V5TA 4NC0B 5IFHL 2XWBB 1BIIB 1RVFH 4UQ2B 4XHQA 5CP7B 1CFTB 1SEQH 1KYOJ 3IKKA 1FNGA 1XCQA 3NABH 5I30H 3KDMB 4OD3L 4GKZB 3L5HA 1UWEL 4WCYH 3HI5H 1BVZA 2H32B 1WICA 2HT4D 4HKZB 2HMIC 3VFSA 3MV11 2OSLA 3QUYA 1QFWI 1DBBH 3I6LD 2HRPL 2FIKA 1HKLL 5F7DA 4LVNC 2A1WL 1SMOA 2Y36L 4AENA 2P44B 4W70A 2XQBL 3L7FA 3O3EA 1CXFA 1VFAB 1YYLL 3QEQB 4N90D 5DEFB 1HSBB 3SKOA 1MFNA 5J9PB 1QFHA 3MLPA 4OQTA 1OSPL 1UFUA 3UPRB 1KB9K 4LP4A 1S9YA 4JPWL 3M17A 2HFFA 4Y4FC 3MRDB 3BZFA 5IR1A 3L3GA 2HJFA 1Q38A 1GVIA 3JV6A 1HOCB 4R26H 4HK3J 4GLRH 5FCUH 1G1YA 1AQKL 1X6LA 1TJHH 1CLYL 2FJGA 4U4BA 4PIRF 3SQOL 1R3JB 5JDSA 1H8SA 1WIUA 2V5MA 3LRSB 2HMID 1MHEB 4DKAA 4TSAH 1T04A 3MRMA 2KQMA 3GMOA 1A22B 3HMWL 3OKLA 3OAUL 1CXLA 2V5SA 4UT9H 5JOPD 4GRWF 3LSOB 3GSRB 4HDIA 1RJLA 1CE6B 5JW4Q 1AO7B 2YHGA 4V1DE 3NN8A 3RVWC 3DGCR 5MEPB 4Y4FD 2IFFL 4HWBA 2R2HA 5C0DB 1DR9A 4F15B 2XACC 2YPLD 5I2IA 2AJYH 3V6BR 3JWDC 1CTOA 3QO0A 4JHWL 4EOWH 3CSYB 3B3IB 2DIBA 2RCSH 4XI5C 1IJ9A 3OXSB 1I9IL 3GI8H 3WFHB 3NIDE 5KZCB 3U7WL 3CX2A 3FO0H 3BUTA 5EUKA 3MJ7B 3SDXE 3WIHH 3B9DA 2KDGA 2FGWH 3RWDB 5I9QC 1NGYB 3SE9H 3BDYH 4Q6IB 3FQNA 5MERB 5BW7A 4LF3A 2YS4A 4Z0BH 3BPOC 3BEVB 3DO7A 3U2SA 1EX0A 1KEMH 3RVWD 1NEUA 2J8UB 1AGDA 1QACA 2OXGA 5ACZA 3LMJL 5DJDA 1RZJC 5KS9E 3HE6C 1T2QH 3V4PH 4FFYH 4RRPG 1NBZA 4RZCA 5DZOA 3TH4T 3TIDA 2HKFL 1MHPL 1A1OB 4KPHH 5FV1L 1U2HA 5CSZA 3SKMA 4F2MB 4XI5D 5L8KB 1SM3H 4Z5RB 2IH1A 3FQTB 3I6KB 4LIQH 4YWGL 2IAND 4QRRA 3QI9B 2R29L 35C8L 5KVDL 5JPMA 4JFHE 3CFBA 1X5YA 4QRTA 2FEDD 3NCEB 1YEFL 2JK5B 4RFOH 3H3PL 3PWUB 2DM7A 2APTA 1MWAH 5E1HB 2JCCB 3QHFH 2IEPA 2F5BH 1JN6A 3AS2A 5B3JF 3RX8A 4PBVC 1SQ2N 2HFGL 1KN4L 4WU7B 2CQVA 2DMBA 2EYSB 5AYUH 1RUPL 2I24N 5D7JA 2D0GA 2ITDA 3TYGH 4LNRB 5E4EC 3HE6D 3OZ9H 4N8VB 5D96B 2ZNXA 5C6TH 5C0AE 4XPFH 5B22A 2VDOH 3IXTB 5IEKB 2YKLL 1MIEL 1QBLH 4AIZA 1NLDL 3EGSA 4RISH 3VRIB 4LHQB 1A7OH 3MACL 3QFDA 3RKDC 2NR6C 3MUJA 4V1DD 5T1LB 2YZ8A 2WBJB 4NQCB 4PPTA 5FYKU 1ITCA 5ALBL 5K9JH 1GZPA 4X0KA 4R4BB 1AIFA 2PN5A 5IJKA 5T5NF 2X5PA 4K3EH 3TT3L 4HGWA 2EO9A 5EU7E 1XIWC 5HI5C 4JFEB 3GRWA 15C8H 5MHSE 3ARFB 5EZIH 4HZLB 5FGSA 3VD4A 2QEJA 1YJDC 1OY3B 2R1XA 3T1FA 1N5AB 1Q94B 5HHMB 4HCRH 3PV6A 3HNVH 4JREB 5TF1H 1JPFA 4Z7UF 1CT8A 2XT1B 4NYLB 1DDHA 3DO3A 4R0LB 2BNRA 2F15A 3BT2L 1IGJB 3FAWA 3D87B 3K3QA 3MR9B 5EOCL 3TO4A 1P7QB 1AE6L 1IM3A 5GS0C 3DECA 1X5LA 3LKPA 3BPNC 3ESUF 1T1ZA 3EIFA 5IF0A 1D6VH 5I8CA 1RV6X 3F7QA 3QH3B 2ZSWA 4OZIB 1PX3A 3OKEB 5CIPH 4OKVA 2MSPA 1BHGA 1NDMB 2WP3O 2NR6D 4ZOBA 5DFVC 3RKDD 4XBEL 4N0UE 1ZHBB 1A7NL 1MCCA 2B4CC 4KK8C 4GKNA 5GGTL 5KOMC 3UTQA 3IFNL 1XIWD 5HI5D 4MNQB 4OZGA 2KQNA 4ZUWA 4JDTL 4X6CE 2H3NB 2W0PA 5T3XL 4JCLA 3RY4A 4L3CB 2ADFL 1WITA 3MV8B 2BVUA 4XXDB 5TDOB 2E7MA 3HZMA 4LCCC 4H20H 2F5AH 2MFNA 5I1JH 2G5BB 3IDYB 3NFNA 5FIEA 1HN1A 5GS0D 2UVFA 3H0TB 1HHJA 2CLRB 1KCKA 3RTQA 3NACH 5EU7C 1RUML 1DUYB 3ZYOA 4E0RB 1TENA 4OTXH 3SGKA 1WK0A 2AQ1A 1CLOH 2VSDA 3ZTNL 1AC0A 5FGBA 2W65B 1EEZB 5DFVD 3DRQA 1IGYB 4LQFH 4OSUH 5I16B 4NKDB 1V5JA 3RPIA 3VGGA 5CJQL 2UUDH 4PGEA 4XBGB 1RIVH 4KK8D 4X7SL 2E27H 1Q9LB 4DVBA 1UM4L 2D3VA 3CSBA 3RWEA 2C26A 4MQXC 5EFIA 4Y4HB 3QEGL 4HS6A 2X4SA 1VB9A 4PRPE 5C0AD 2RR3A 4HPOH 1V3MA 3PQYA 1TFHA 2KZ1B 2R56L 3QULB 3SBWC 3RWJB 1SEBA 1I8LC 2HH0H 1L7TH 4ZTPL 2B0SL 3CDGB 5F8QC 4XVSL 4P9HH 3WIFB 3X12A 1FRGH 4NRZB 3MJ9A 2BSSB 5J1AA 3LV3A 3C09C 3O41B 5F93C 2EYTB 32C2B 4G6JH 4UT6H 3GZKA 3DSFH 2YRLA 7CGTA 3T0BA 5IB4A 1UWXK 3VWKA 4WTXA 2EZ0C 1MWAB 3ORJA 4ETQB 5FO7A 3G5VB 1CFQB 5KSUB 4LCWE 5E6IA 4ZTOL 1SBSL 4NRXA 2WLYA 4OGAC 1ZA6B 4HFWA 2Q76A 4Y2DC 3IF1B 3DV4A 5CD3B 4TVSa 2FEEL 2WSKA 1TZHA 1WZLA 1ZLSL 3W81A 1PSKL 1I1AB 2FEEI 2X89A 4PJ7E 2Y07H 3VFMB 4MQXD 2VISB 3O3AB 5DK2B 2GSIB 4P5MB 5IKCB 4GAGL 3GHBL 3HG1A 3VXUB 4YH6A 3HNSL 4HSQA 3ZT7A 4ODXB 1PJ9A 3BKMH 1J1XH 1BZ7B 2BOCA 4YHLL 3RWCA 3NCJL 4PJBA 4CAGA 2QL1A 1KTDA 2X4UA 1KB5H 1UQSB 3FQXB 5DF0A 5D70L 3V5DB 1A14H 2GUOA 2EZ0D 3GM8A 4KHXL 1JF6A 4LEXH 5AZEL 5HHQA 4OGAD 4NRYA 5IW6A 4Y2DD 4ZO8A 3P9MA 5C07D 4ZOAA 1JPSH 5ESAB 3RNKB 3G04A 4IS6A 4OIBA 1CI5A 2HRLA 4ZO6A 4MZ2A 5JIKA 5J1SC 1RURH 2VDQL 3QDMB 2CR6A 3S34H 3IGAA 4WI5A 4WY7H 3WD5L 1D5BA 2AEPL 3FQWB 4J4PC 3DVNB 3EOTH 1HHIB 1SVZA 4UB0L 3RNQB 43C9B 2ARJA 1OCWH 4C58B 3KHOA 1MJ8L 2AEWA 1MCHA 1EV2E 1AGEB 1HI6B 3QNZB 1ZLWH 3UTSB 5CIPB 3EFDH 5E2UL 2JJTC 1MCDA 2BFVH 1M7IA 4HJJL 1B3JA 3C60C 1ADQA 5DXWA 4NN5C 2BRQA 4JEGB 3RP1A 5JIPA 4CVXA 1QSEA 5DJAA 4I2XB 1GGIL 3QEHB 4XPHL 2JJUA 4JZOB 4PRPD 8FABB 1UJ3C 3C5JB 4PY7A 2CKBA 3EYSL 4MNGE 1ACZA 1XGTB 2D7NA 1P1ZA 1YEJL 3TPUA 1OT1A 3K2UH 5ALCL 1LDPL 3W5NA 1T21B 1J0KA 4J4PD 4OCYL 3EYUH 1K8DA 5IG7B 1RHFA 2OQJB 1LDSA 1Q9KB 4O02H 3UXFA 3BIAX 5DEZA 1IGFL 4F37F 4PJAE 1VGEL 1IILE 1K5NA 1RJCA 5J11B 1OM3H 3HC3L 1OL0A 4K94L 4LCWD 5LAXB 2AXGB 1MJJA 2ZG3A 5FOBA 5DLMH 5C9JB 5ID1B 3AY4A 4M9PA 4NZUH 4XC3L 4YZFE 3TZVB 3BZEA 3C60D 3ZKNC 3DXAD 4HKJB 4ELKB 2VLJA 2Y25A 3T0XA 4QT5B 1FN4B 3EOAA 4MA7H 4JE4B 4Y5VB 1T89A 1PG7H 3BP7B 4MHHG 4ZS6C 2XZQH 3VMOA 1RIUH 3T3PE 3FB6A 4F33B 3FFDB 1CDJA 4ELMF 5F96L 4ETYA 4JFDB 3G08A 1BBJB 3U1SL 3ME0A 4LLMB 1I9EA 5IHUL 2DMCA 2ZCKH 5IFAL 3O2DL 1FZOA 4BKLA 5BS0D 3OPZH 1XR8B 5HGAB 4QTHB 2H2PC 2JB6B 1ND0A 3HR5B 1FH5H 4X99A 1C5BL 3QZWA 3W9EA 2X1XR 5L2KB 5JDJA 4WW2F 3QUML 1FORH 2FYYA 4LSRL 1QFWH 5FYKL 4GW5B 5CINL 1T6WA 1BJMA 3SJVB 4JKPH 3ARPA 3U30C 3QUZA 5SV3A 3ZKND 3ILPB 4OCRL 5DJCB 4RDQF 3O3DA 4MVBC 4TUOB 5C0JB 4XBPA 1HKLH 4YX2L 1V7MH 2EXWC 3VFTA 5GGRY 3CMOL 5EU6D 4XXCA 2EC9T 4ZS6D 3DMMB 1Z6JT 4JM2C 2FX9L 3FFCE 1NMAL 2AI0L 1EVUA 1QSFB 3KPPA 4M6NL 4U0RB 1RHHA 5F89A 2EC8A 5BOZG 1R24B 2MQ3A 2H9GA 1T6VN 1YY9C 2A83A 5D1QB 3ZKXB 2DJUA 4S0TD 2OR9L 5KANG 1ZHKB 3QRGH 1KB5B 2H2PD 4KRLB 1GYAA 4TYUA 1J11A 3BD5A 4NUGL 4PG9A 3W39A 4GAYB 1D3CA 2D9CA 1DUZA 2O5ZH 1UACH 1JVKA 5TFSH 1MCWM 3GSWB 4RA0C 1BOGA 4WTZA 3ARGA 3GMLB 4ZO7A 3IAGC 3EAKA 2WLZA 1A2YA 1CBVL 2LE9A 3LY6A 2L0DA 1ORSA 1UCTA 2EDLA 4GW4B 4MVBD 4HJGB 2APWA 4LPYA 2EXWD 5AD0A 3UDWC 2H1PH 2KH2B 5DC9B 3BH8A 5GHWL 5DK3A 1FSKC 3U0TB 4JM2D 5I8OL 4XRCA 3ZDZF 5AUMB 1Y0LA 3PP3H 2JIXD 2ID5A 1Q1JH 2P7TA 4O4YL 3OGCA 4P2OB 5JO5B 3LEYL 3OQ3B 1XAUA 2M1KA 5H37H 3MLVH 1YY9D 4MD5A 4H5SB 5D71L 1T22A 1JNNH 4FFZL 4S1QH 1J05A 4WENB 5L2JA 2OZ4A 4IRZL 5IMMA 2F19L 1II4E 2FX7H 4CNIA 5I8EB 3WN5B 2GW5A 3I3BA 4X9HA 1BQHG 4HXBH 4YK4C 1SJHA 1U6AL 4ODUB 1IT9H 2OL3H 1YZZA 4M1DH 4QY8A 4ALAL 1FL3B 5D1ZA 1QOKA 2WBKA 5DQJB 3QFJD 3HC4L 3ZDXE 3DI3B 2OTUA 3OV6A 3TC9A 1JWSA 5GRWA 1CWVA 2EDWA 4DN3L 4YAQA 3KYKH 4AK1A 5IVZA 1QRNB 2NX5B 5JXAL 1J1OH 4TVPE 2NW2B 2PTUA 3T2PA 1ERNA 4N1CA 2HLFC 2Q7YB 4BQ9A 2Q6WA 3NCFB 4K7FA 3W9DA 3LD8C 4TOYL 2V2TA 3MLUL 4NO3B 4KRNA 4NKQB 3OSKA 5CWSB 3BUYA 3SO5A 4OBSA 2NNAA 2BOBB 3C8HA 5ISZA 2FNBA 4NQXA 1T7ZA 1VHPA 4LBEA 4K71B 5C0CA 2HKFH 1MHPH 2QQLH 5EZLA 3QUYC 3L3IA 1PQZA 2VIRB 3IAPA 2ATPB 2F8OA 3OKNB 3FRPG 2VR4A 1B88A 2CUHA 4P5TB 4WUKL 3FFCD 4YWGH 5H8DA 1E27A 1OAZL 1IL1B 5EB9A 3VXRA 3PHQB 2J6EA 5KVDH 5KVEL 3MGOB 4P5KA 3T4YB 3UYRL 5MENA 4QOKA 5LBSL 3VFOB 2Z8RA 1PW3A 1OLZA 2X4NA 4GW1B 5DHVA 3KYAA 3BGAA 3P73B 4JFOA 4PY8J 5E2TL 3MNVB 5GRVK 3NAAL 2X09A 4G80B 4XGZB 4DKDC 1CDHA 3DWTA 3F58H 2HLFD 2FHCA 4UIKH 2GJ6A 4F8QA 4YDLB 4M61B 1FL5B 4DKEH 4PP2B 1OAYL 3N50A 4WHYH 3T0EB 1N4XH 3OHXA 2FJHA 5IQ9B 3QUYD 2XRAL 1FL6A 3ZE0F 4HFUH 5CJXA 3N85L 3MLWL 1DANU 5IB3B 4HWUA 4YXLH 5SWZA 5E94B 1L6ZA 1CLZL 1F90L 3AREA 5H37G 5FO8B 2ZG2A 1FVCA 2VWEE 3HCVA 2IGFL 1HHHB 5KSAA 4QRRE 4U31A 4XVJL 2VKWA 4LDOB 2VNCA 1G7LB 1IE5A 3QCVL 2ITCB 3MRQA 2APBA 2VABB 3K8MA 4KHTH 5CSGA 4YNYB 5CEXB 3HUJB 2ZOKB 5I76A 4N0RA 2VDPL 1RIHH 5EA0H 4AL8H 4B7LA 2Z91A 3ZT5A 2YRZA 3JTTB 4RFNB 1HYSC 5IB1B 3AS3A 2GITB 3MV7A 5T1DL 3FO1B 2MQCA 2ZNWA 4HHAA 4K3JL 3OMZA 1DQJB 5DMKB 2GTZA 3MRPB 3O6KH 4Z7NF 1VPOL 1LE9B 2CMRL 1GAFH 4TQEL 2P8PA 4U6TA 2H8PB 2DLFL 5BW7C 3O4LA 4EVNA 2HN7A 3FOMA 4TVPD 4G8FB 2F74A 1OGAB 2GTWA 4F57H 1UZ6E 5IMKA 3ARBB 4R90H 3MMEB 1C5CL 1ZOXA 2DQTL 1A9BB 1KN2L 1QLRA 3GSUB 4JDTH 4NM4H 1T0MB 3HLAA 4HWZB 5ABDE 1G7MB 1S3KL 1KIRB 1FYTB 4KI5E 4PRIA 4YHZL 1T1WA 3I2CH 1PAMA 5D2LF 2X40A 3TCLB 3KYNA 2IBZY 4ZPTB 1QNZL 3LZFL 3CXHJ 4XB8A 1BX2B 2YWZA 4XNXH 2Z8SA 2OL3B 5D8JL 1KCVH 4EBQL 4LRIC 5E5MB 2WUCL 5IW1A 1HYSD 2BNRE 4XP9H 2O93L 1I85A 2Y5TA 1NC4A 2B5IB 3DYPA 1JPGA 1ZLVH 2AERT 1ZTXH 3ZTNH 1KCUH 4MWFA 2IBZX 2AK4D 2ZKHL 3WNNA 2MKLC 5B8CA 2PW2B 2PR4H 1U8MB 4R7NA 5I6XC 1F3JB 2BC4B 4P49A 5DRXA 4XNZC 4N8CH 3BE1L 2E3VA 1KCLA 3NA9L 5HHPB 4UILH 1CDUA 3QEGH 1BMGA 4YDIH 2NMSA 4WHYG 4MLSA 5HGHA 4Y8DC 5D7JC 2R56H 3AAZB 4OZGE 5I73C 4ZFOL 4YUEH 3LHPL 4HMEA 2GAZB 3WUWB 1AGFB 2YD2A 1PZUB 2V9QA 3BZ4A 1MHCB 4S1SH 4WHDA 2VR9A 4MJIA 1U8OB 5IOPA 1E6OH 5F72S 1MI5A 4BSVB 5AG9A 1MRFL 3QJFB 4U6XB 5KSBA 4OD1H 5DMGC 1MRCL 1EUUA 3CFEB 5EULV 3QWOB 4QHUB 1BVLB 1IEAB 3MROB 4F9PA 5IJKC 4KI5C 2P8LA 4ZTOH 4OLXH 2AABH 1YEEL 1ZS8A 4YHPA 1NAMA 4N0FA 1KFAL 3MRRB 4N0YL 5D7SH 1O5DT 1DEEB 1AQDA 2NY7H 1G7JA 2NXZC 5DFTA 2AAVA 4Y7MA 1RK0A 2XZAL 3VXSB 1MCPH 1IAIL 3Q5YA 1A9EB 5HJ3A 4X6CB 2X1PA 2F53A 2CIKB 2ZCHL 3MV9B 5D7JD 3S3SA 4PJDA 4PJIB 2CKNA 3TN0A 2GT9A 1NAKH 3BKYL 3P30L 4NM8H 1UXSB 4OLZL 4YBLB 3UJIH 1TTGA 2OI9C 5HYSA 4XCEA 3LB6C 3H3BC 5JLZB 3D3VD 1WIOA 3JUYA 3PQYE 4YHLH 4XMPL 1K6QL 3DVIA 3WO4B 1VENA 1DQLH 3LDBC 2GEEA 4AQ1B 5FHAL 4M1CC 5DMGD 3LQAH 2N56A 3DIFA 3FMGL 1XF4A 2YC1A 4P57A 4W68A 2DKMA 2CDEB 2R0LH 2AKRA 1JHTA 2Z93B 1LO3L 3L5IA 2X70A 4HPYH 4KI5D 1MCEA 4PRBA 3UPCA 4UDTB 3KPMB 1LO5A 1R5WA 4ZUTA 1T3FA 1I3RA 1C08A 2NXZD 3VFRB 4XC1L 1H3TA 1MLBB 3OWEA 3MCG1 2E7HA 4BZ1L 3MNZB 1JF1B 3V8CA 2EDXA 3BI9X 5C0EA 3SPVB 2V6HA 3T04D 5M94B 1BVKB 5ECJE 4YPGB 1B2WL 1MH5B 1G7PB 4JPVH 4Q9RL 1IAKB 3RTQC 3L5JA 2WV3A 2BSRA 5E2UH 2XZZA 3BDBA 3LB6D 5CFHA 3SGKC 2CDFB 4KMQA 4MDJA 2AV1A 5K9QG 3HG1E 4O00A 2EDRA 2OCFD 3UZQA 1U8JB 4HAGA 3CFCH 2OTPA 3PWVA 5FGBC 3O45A 4M1CD 1OOAA 4HS3B 2PUQT 1QO3B 4U1JB 3V4UL 1A3QA 3L1OL 3P0GB 4PJBE 3PHOA 4MXVF 4AEEA 5FA3A 2F54D 3RZCC 1U41A 5L8JB 3ULVE 3KLHC 1W8NA 4JN1H 4PD4J 1U93B 5DRZA 1XF1A 2B1AL 2BVOB 2DQFB 4RWYH 2I07A 3UTTB 3SOBL 1JV5A 2WM0A 2IPTL 4KH2A 5JR1L 3ZO0A 1WBYA 4OLUL 3HPLB 3RU8L 3JWDL 5E8PA 1B4JH 3QG7L 3VRLE 2ZUQC 2FBJH 3HC3H 1RY7B 3PGCB 4S2SB 2N4IA 4UIMB 3RTQD 3LRHA 5BZWA 4HH9A 1NLBL 1C1EL 1DVFB 5D1XB 3MXVL 1RJZA 3NGBC 1WGOA 4R2GB 3VWKC 1JI2A 1HDMB 3TBSB 1BWWA 4FQ2H 3L6FA 5JHDA 5E6IC 1AP2B 1UB6A 3UTPE 3FB7B 1OSZA 2JJSC 1BP3B 1ZWIA 1TPXC 4E41D 1P4LB 2PO6A 4IHOB 3QXUA 2IH3A 3VG9B 1VFOA 2DYPB 1UB5A 4ODSH 2VUOA 5ESQB 1MQ8A 1CICA 1QSEE 4X4ZA 3RZCD 4WRLA 4XPGL 3KLHD 5IW3A 2IBGA 3EYOB 5B39G 2OJZL 4YHYC 1H3UA 2VLRB 3LQZA 4PJFF 4QF1B 5I1AA 5IV2A 4MYWB 1U92B 3O2DH 4PLJC 5L88H 1MLCB 4ZD3L 3TESA 1G84A 1RZJL 4DUWA 3O11B 2IPKB 4JRYD 5GRXG 1F58H 5H35B 3CVHA 2DQHL 1RUAH 3SO3B 4YR6B 3IDGA 4JQIL 5I1LB 3QIUA 1J0IA 3VWKD 2ADGB 3L3DB 4JDVA 1X5HA 5E6ID 5CJ5A 1B4RA 4YX2H 2GCYA 1NFIA 4L8CB 1M05B 1JJUA 4W4NA 2LTQB 1CF8H 2GK0A 1HQRB 1Z0MA 4Q74A 5I1GL 3KPLB 1EUTA 2QADB 3GSXA 1CG9B 1Q0XH 1H5BB 4MNGB 1M7XA 1FDLL 5JW4N 2NQCA 4IRJA 1MCOH 3HKFA 2YD1A 5B39B 5IVOA 2HWZL 3WBDA 3TCXA 1FNHA 5EO1A 1CQKA 3G6AB 4PLJD 5EDXA 4GOSA 4MSWB 5SWSB 5CJBA 3VW3L 1OP3K 2DD8L 1UYWL 4ZDHB 2V2XB 4JN2B 4OD2A 1I3GH 4MJ5A 5F1OB 1MJ7L 2Z31B 4HX1A 3RUGB 4BZ2L 3FONA 4QEGA 1H3PH 1WAAA 2R23A 1HINH 4KV5E 4G8GA 5HVHC 3RY5A 2EH7L 1JP5A 3MOBH 4JANA 2I9LA 1RJYB 1LO4H 4XH2A 3F12A 4NQED 4ODWB 1A4KA 1YJDL 1IGCH 1C16A 2ED7A 2YD9A 3CPLA 5TDPA 5D2NE 4EI6A 2BMKB 4NOBA 4O4YH 2CIIA 1GGYA 1YECH 1G7HA 1X5ZA 3LKRB 1JUFA 1P7KB 3FOLA 4U05A 1UH3A 1EFXB 3V9FA 5C0FB 5JIHA 2XPGA 3MCLL 3W82A 4PJCA 5GS0L 3UTPD 4MDIB 5FUOL 4ZXBA 4IRZH 1KJ2A 4GMSL 3AY4C 4JGUA 5MEQA 2Q7NA 3LCYA 2FSEB 3QNYB 2AEIT 4JQXA 4ODHL 1RPQA 3IJHB 3CLEH 2VXUH 4PJXA 1T89C 3KNBA 2DDQH 5DURD 1DTUA 2DBJA 3PWLA 5FKPA 2B4CL 2A9MH 5HYQA 3D18B 2GHWB 5HDQH 1CZ8L 3DUUB 1U8IB 3IYLW 3O3BB 5CJOL 2VR5A 1PYWA 4KJPC 3GSVA 4JKWA 5DS8A 3E6HB 3CDYA 1G6RL 3BGFC 4PRHB 1UH2A 1QA9B 3DOSA 3U0PB 1ZA3B 3MLUH 2PYEB 4G7YL 2MPAL 1HILB 2W38A 4O2CA 2FATL 4KTEL 5F1NB 3SDAA 2CDGA 3R4DA 1KENH 5CEYA 4HKXA 3S5LA 4ODVH 1FV1A 3OXRA 3OG4B 3G9AB 3QUZC 4GRMB 2D7TH 4JFFA 5J6GB 1KSRA 3QEUA 4Y1AA 1PY4A 3HNTH 1D5ZB 5D2NC 1NGXB 1JHLH 3HC0A 4OFVA 1DP0A 2KPNA 2LU7A 4N9GA 3ROLB 4M7ZB 4GSDH 5F3BB 2NTFA 5FUZL 5T5FH 1KNOA 3MRNA 4NKMB 4M43H 1OVZA 4GQ9H 1CTNA 3VFSB 1AHWA 2NPLX 5J12B 5E2TH 3KPOB 5EOQL 1A6VH 3MLSL 3N06B 5F7UA 2FDBP 4KJPD 3RFZC 5DR5H 4MAUH 4XPTL 1U8QA 1J12A 3KXFB 1OF2A 4NPYA 4AENB 1F42A 1XGPA 1NBYA 4RNRA 1DN0B 5F9JA 1UEMA 3SKOB 1QBMH 1YEDA 5GRVL 4Z7OE 4NJAH 1ODAA 4XP1H 2XG5A 5IK3A 4AM0A 3M17B 2HFFB 3ARGC 1JZ8A 5TE6L 1EIBA 3IJSA 1BAFL 3BZFB 4CUCA 1XGRB 3I6GA 3QUZD 3LQMA 1CXKA 4LKCA 3GRWH 4WI9A 5E56A 5ISZE 4EEEA 4YXHL 4FQ1H 3N85H 3S4SB 5C0CE 1H0DA 3WKMH 1LP9A 1R3HB 4W4OC 1I1RA 2VXQL 3MLWH 4OZHB 1WLHA 4M4RA 1DFBH 4NGHL 4KK6C 4OM0H 5GGVH 5JDSB 3QDHA 5DVLA 1E28B 4HG4J 3GSNA 4K3DL 4GAFB 4NCDA 4OI8A 4TUJB 3VXRE 2VLME 4FZ8L 3MRMB 4H88H 2M8XA 1KPRB 5ITFB 3ARZA 4QOKE 4K23L 2XN9A 2SEBB 2BDNH 3GO1L 1PG7X 5BRZB 5A2IH 5D9SA 3IDXH 1K8IA 4GXVH 4IRSC 3WHXA 1XR9B 2IQ9H 1TVHB 3HZKB 5GRUL 1O0VA 1F4WL 1YNLH 2R0WH 2GJ6E 3O2WL 4WIQA 3ARGD 5D1ZC 2CMRH 2BCKB 4U6HA 2R2HB 4TQEH 5I75B 3BKJH 5I2IB 1KBGL 5IFJA 5DD3L 4X8JA 4XP4H 4N0CC 4MX7B 1HH6B 2OS7A 5ICZB 5L9DL 3NIDF 4I18A 4PJHA 5DJYB 1NCBH 2NY5C 4KK6D 1WBZA 1IC5H 3SDXF 2GSGA 2QQNH 4XP5H 3BPCA 5EUKB 5SWZE 4QHNB 1R5VA 1A3RH 5F9AC 3M8OL 3U83A 4D0DA 1LK3H 4WW1A 2YR3A 2ZUYA 3D48R 5E99H 4KKLC 3DO7B 2ENYA 4IRSD 3FHQA 3U2SB 2V9TA 4F80A 2ENSA 3G6JB 4L3EB 1J8HA 3QT2A 1NDGB 4G5ZH 5KS9F 1A5FL 5CLWA 1OW0C 4F7TB 4KK5C 5D1ZD 5DJDB 4L9LA 4LHUB 1NCAH 2LVEA 4D9QE 4GRLC 5JW5A 2HTLC 4PRAB 1NBZB 1SJVA 4I3SH 1F3DJ 3TIDB 1Z0NA 4JKKA 5CSZB 4PGBB 1DBJH 4JFZL 3O4LE 2IH1B 2NW3B 3MFGB 2CLVA 5FGRA 4CGTA 3D2UA 1UXWB 5BJTA 1EO8L 4FQXA 1N64L 5EU3A 2G9HA 4QRRB 3B4NA 3QR2A 3MA7A 5DUML 5JPNA 5JPMB 5BV7C 4O2FA 4ZAKC 3VDAA 4S0SD 3LEXA 3DX9B 3V6FB 4NBZB 4QRTB 4BQ6A 4HXAL 2VTFA 1U8HB 5ISZD 4PRIE 2XZCL 2DLTA 4HF5L 1QKZH 1YC8A 3JWOC 4KKLD 4ZS7H 3WNLA 3KPRB 4HZAA 4V2CB 1SHMA 1MNUL 4GG6A 1JGVH 1QP1A 3B6SA 3ZTJG 1KG0B 1TLKA 3NFSL 3TPKA 4M62L 4BJLA 4M5ZL 1JZ2A 3L3OA 1H9VA 1B9ZA 4KK5D 5C92A 3VXRD 3O6MH 4I77H 4Z7QE 1MJUH 2VLMD 2DQCL 2X6MA 3C5ZA 4P3DA 4GRLD 4QOKD 5HYEA 2HTLD 5LQBH 3RBSA 4W81A 1IEBA 4HLZG 4PJEB 5LGJA 4HUXA 3H42H 3BIKB 1R3LA 1U58B 3QFDB 3QDGD 4Q0XL 5GS3A 2EKSA 2R1YA 4LL9A 2BHYA 3VXMA 2IWGA 3WE6B 1T4KB 5JXEC 4ZAKD 4EKXA 3O6FC 3C9NA 1T5XA 2ESVA 3ISWA 3A6BL 2EIZA 5EU5B 3ULVH 2Z35B 1I8IB 3T1FB 5JW4M 3PV6B 4LEOA 5FHBH 4LPVA 1K6QH 1JPST 3U4EA 2VERN 4RGNE 3TH2T 2DLEA 3H9ZA 2HJLA 4F7EB 7FABL 1XMWA 2BNRB 2ADJA 5DD0L 2HT3C 2QJDA 3ZYJA 3U6RB 4LLDA 3TO4B 1FIGL 1KPUB 3UJJL 1CDGA 1S7UA 3U7YL 1N5YL 1MUJB 5I8CB 1W8OA 4KC3B 4JM4L 1ZGLP 4EZMA 2X44D 5E08L 2WQ8A 5HHOD 4EDWH 2A77H 1BIIA 1NGWB 5C3LD 4MA1C 1CFTA 4KGLA 5C6WH 5EU4B 1I1CA 4YBQC 1G9EA 3KDMA 3X11B 4X6DA 1T7VA 5JQ6H 4J3WA 4JPKL 3FQRB 2LU4A 3BAEL 2J88H 5FYJD 5JXED 3UTQB 2H32A 3RGHA 3O6FD 4OZGB 1I85C 4D9QD 2F53E 3TEUA 1IAMA 5DJ0B 4PJDE 2WANA 4Z95L 3RWIB 3C2AH 4NJ9H 4RFEB 5HHVL 1TCMA 3ZYIA 2HT3D 4KQ4H 1S7TB 1MCFA 1VFAA 3NFNB 5DEFA 3PGFL 4BQCA 2C9AA 1HHJB 1VEMA 2AEQH 5GRZA 4XMLH 4EUPA 1IQWH 4PRID 3SDYH 1U36A 1A6AA 4JG1L 4JFXA 4EJ1C 2VZSA 4YBQD 1BREA 3A6CL 1EBAA 1QVOA 1V05A 3RPIB 3RU8H 2JE8A 2E7LA 3RIAK 2CK0H 1R3JA 3WFBH 3LRSA 5EORL 3CDFA 4NNPH 3RWEB 2R69H 5CMAB 4P3WA 4QNPE 2X4SB 3SDCC 3BYYA 2CSPA 3EO1B 3U9PH 4M5YH 3PQYB 4F9PC 5I18H 2O26U 2XQYG 2VDKL 1NSNL 3LSOA 3GSRA 4G3YH 4CDGC 3SE3A 1CE6A 4HK0A 3F62A 1FHGA 3NPZB 1LEIB 4ZOCA 3NCMA 4DK3A 2YUVA 2DTML 4XAWL 4ZFOB 5MEPA 4KMLB 5C0DA 2IBBA 4WEBH 3TVMB 5DRNB 1MRDL 3B3IA 1MFCH 1YEGL 1MSPA 1RAMA 3OXSA 3C08L 4PJ7F 1TZHB 3S36L 2A38A 5IBTL 4O9HL 1A7RH 2FHBA 3IU4L 1VFMA 3NIGE 5IBLC 3MJ7A 2J5LB 3SDCD 2FB4H 5I17B 2EE9A 1LNUB 1NGYA 4J3VA 3RWDA 4Q6IA 5MERA 2Y6SC 3HG1B 4EXPX 4QXGL 1N26A 5I71C 4DGYL 3BEVA 3O8XC 4B41A 4OLYH 2BOCB 5JHDE 4OQTL 3RWCB 1Y6NR 3GK8L 1PFCA 4PJBB 2J8UA 1KTDB 4JY5H 3CFKA 2RAMA 2X1OA 2X4UB 1CIUA 2P5ED 4P23C 3NPSC 5F9OL 2F53D 4WI4A 2HT2C 2HWZH 4HBQA 4NRYB 2DL9A 3P9MB 2YMXL 3QHZL 1GIGL 1A1OA 4H8WC 4F2MA 2R2CA 4GS7B 2DD8H 4DAGL 2KUTA 4QO1A 3C8DA 4KK9C 3FQTA 2J8HA 2F58L 1NQBA 3ARTA 3I6KA 4X9BA 1D5BB 4XP6L 2EEBA 5IBLD 2OP4L 3QI9A 2ARJB 4G43A 4TVPL 2AXJA 1YMMA 2Y6SD 2JK5A 4HMCA 5AG8A 1M7IB 2JCCA 1D9KB 4NKIH 3MBXH 3O8XD 3I3EA 4L4TD 1GGCH 1CGSL 3CK0L 1EAPB 5DT1L 3TA3A 5I1HH 1NGQL 1QSEB 5DJAB 5T3ZH 2EYSA 2XV6B 5EG6C 4WUUB 4P23D 4YXKL 4LNRA 2HT2D 4N8VA 4PY7B 3TV3H 4K7PL 5T33L 1LO0L 1TZGL 3C6SB 4XCYB 5EIQA 1TJIH 2V7NA 4KK9D 3QCUH 2WBJA 4JM2F 4PJAF 1K8DB 5J89A 3VFUB 4B5EA 5DHXB 4KDTA 4RMQA 1MAKA 1IKNA 4WWKC 4LKXA 1K5NB 3ARFA 3QZWG 3WJLC 1WF5A 1CICC 4KDVA 4YZFF 1IRAY 1MJJB 1N5AA 1Q94A 1NC2B 2AP2A 1WAAE 3BZEB 4DZ8A 1KACB 4G8GE 4UZGA 3T65B 4NYLA 3V52H 2VLJB 1IGJA 4R9HA 2VXTH 3MR9A 1RZ7H 1P7QA 1NUNB 2AK1L 5JNYA 4HW6A 3LAFA 5EUOB 3O9WA 2IAMB 5GS2D 3FB5A 3UC0H 5GPRA 1DL7L 3BD3A 3THML 2Z0BA 1NDMA 4PJCE 5IQ7L 5JHDD 2BX5A 2QSVA 1FZOB 4MS8C 1TETH 1ZHBA 3BPOB 4Y5XC 1C5DA 2APFA 5DHVH 4XCFL 4JB9L 1ND0B 4BH8B 3QZWB 4WWKD 4MNQA 2J1KA 2H3NA 1CICD 1JHKL 3WFCL 2FYYB 4L1DA 4LSTH 1UM6H 2C3HA 3G6DH 4L3CA 4IRJC 3MV8A 4XXDA 3HE6B 4WTZG 4XWGH 5JHLH 3N1QC 4Q58C 1FFQA 2NXYB 2E9JA 3HA0A 3P2TA 2G5BA 4WV1C 5DUPH 2PNDA 4XPTH 3I50H 4M93B 4PG2C 3AC0A 3REWA 4QCIA 3WIHA 2DTSA 1AXIB 3H0TA 1G9MC 5MI0B 3VJ6B 3S37L 4E0RA 2ZOLA 3Q0HA 4DGIH 1U8PB 1RHHB 2HVKB 3BQUC 5CHNB 1JBJA 3SGEI 2PYFB 2Y06H 5CJ8A 2W65A 3QDJD 1EEZA 2A83B 4EI5B 1OGTB 1KC5L 5E9DD 4MS8D 5D5MA 4ZYKA 4NKDA 1OP5H 5GZNC 3GFUA 2KKQA 1GC1H 2RQ8A 1OTSC 3ALWA 5DJ6B 5D7IB 3LN9A 4JFFE 1ZE3C 4TNVK 1A6TA 4Y4HA 3JV0A 3W39B 1L0XA 4Y1AE 4OCSL 3QJHA 2CGRH 2BRRL 4IRJD 3ARRA 3QULA 1N2RA 1ORSB 3CDGA 5KSVB 5JA9A 4MA8H 1QHPA 1YEHH 4NRZA 3S96A 4ZXBC 5AD0B 3O41A 4RAHA 4CN6A 4HGKC 2EYTA 32C2A 2ED8A 3BH8B 3E1F1 4ORZC 5EBWB 4YQXH 2EIEA 3A0OA 3GJFA 1DBAH 4FQIL 1LE5B 1R5IB 4JQXC 5I1KH 4LMQE 5F6HJ 1MWAA 2P7TB 4ETQA 1XIWB 1CFQA 2K1MA 3F7PC 3G5VA 4ONGH 3BQUD 4PS4L 1YN7A 2B8OT 1Z3GH 3S36X 3MODH 5GISL 3IF1A 3S97C 4LCYA 1JGUH 5DGQA 5CD3A 1C12B 5GZND 4RGOL 2LAAA 5E2VH 4CNIB 4J3OC 1OTSD 3GJEB 1I1AA 3VFMA 2A2QT 1E4XI 25C8L 1OAKL 3O3AA 4HC1A 4J6RH 2W07A 1SJHB 3QSKB 5DK2A 5FK9A 3B9AA 3KYMB 1LP9E 5GQBA 2GSIA 3EJZC 3QCTL 4OB5H 3CSGA 2JELL 5CLTA 3ZDXF 1NFDB 2WWMC 3RX7A 2R0ZL 2ARJQ 3VXUA 1YQ2A 1P4BL 3K8LA 4UINH 2DICA 4M48H 1KEGH 2OTUB 3QDAA 2XTJB 2JJVA 3V7MA 4ZXBD 4HIIA 4DOHB 1VKXB 2FRGP 5EBMB 2XN9E 4Z77A 3TBYA 3GIZL 1UQSA 2VC2H 4M8QB 5DHYB 3FQXA 3V5DA 1P6FA 1EEUA 2DBLL 3ABZA 4Z8FL 3MZTA 3QG6B 2XI9A 4L5FL 1GOFA 3W9DB 1EPFA 3SKJL 1DSFL 4UV4L 5KTEH 1H8NA 2NNAB 3T2NL 4HV8B 4NQXB 4LBEB 3WSQL 3A67H 3QDMA 3MO1B 5C0CB 5K9KB 3L3IB 5F7LB 1PQZB 1KTRL 4HIXL 4P3CL 4JHAH 1HHIA 3RNQA 43C9A 4G6KH 5L6YL 1E27B 3EJZD 3ET9F 4U7SA 3QQ3A 3BVNB 1AGEA 1HI6A 2WWMD 5HGDB 1JGLH 4PJHE 3JVGC 5CIPA 1VEPA 1VADB 1YQVH 3E6FB 4NSKA 5C0BA 3VMNA 5MENB 4HXAH 1G7QB 3VRJA 4S11A 3EYQC 5DHVB 5FAAA 4J7RA 2XWTB 1RZKC 3D25B 1EK3A 2AJVH 4FQCH 4JFFD 2VUYA 4I2XA 3QEHA 5IEHA 3JV4A 4JZOA 2DI7A 4Y1AD 8FABA 4QLRA 2VO5A 4B0MM 2GJ6B 4JO2L 4OFDA 4BUHA 5GXBB 1XGTA 1J8HE 1A6WL 3SGDI 4LPTA 4NN6C 5DWUH 1UVQA 4PRDB 2EKJA 3IFOB 1EO7A 1N59B 4KY1L 2NY2C 1FL6B 5IG7A 2OQJA 4DGVL 1Q9KA 1XGUA 5F8RC 2JB5L 4X83A 4TSBL 1INEH 1K4CB 1Z2KA 5LAXA 2AJSL 4JRXD 3AREB 4Q9QH 2AXGA 3BJLA 5ID1A 1FVCB 3HCVB 2DKSA 5KSAB 3EYQD 3T4AA 5A2LH 1AGCB 4U1LA 4ELKA 2CUMA 1NCCL 3BO8A 1N6UA 4NWUH 4FQJL 4X7CC 5GJSH 1J1PH 4Z78B 1H3WM 4UT7L 1DQDH 3WFEL 3B9KC 7FABH 4Y5VA 3LS5L 2UWEB 3STZB 4MQTB 1EH9A 3BP7A 5AAMA 4Z7WB 1FZJB 3SKUD 4M7LL 5I76B 4F33A 4HBCH 1K3ZA 4OFPA 5T1KB 1QRKA 2Z91B 1ROWA 3RRQA 5IBUB 1WIPA 5J56B 4M7JL 3MV7B 1BBJA 3ETBF 4NZRL 4LLMA 5KJRL 2NY2D 1IC7L 1DBKH 4YJZL 4L8SC 2W0LA 4UTBL 2YEZA 1XR8A 4WU5A 1CS6A 1UZ6F 4XNUH 5IT2H 4RBPK 5DD6B 3O4LB 1GZQA 2HN7B 2YRPA 3FOMB 4CRPA 4EVNB 2F74B 3HR5A 4C4KO 1B90A 3ZYZA 5LCVH 5A3IC 3GBNH 4OCXH 3P0YH 5GSRA 2YK1L 4DN4H 1ZK9A 1WJ3A 1ADQL 4GW5A 4KI5F 1QLRB 4NQSB 4LU5L 4NWTH 1F13A 4Y19A 3E2HC 5FYJU 3L5XL 3SJVA 3I75A 3VXME 1Q0YL 3ILPA 5DJCA 2CPCA 1MVFA 1A1NB 5C0JA 1FNSH 2BY0A 3KYNB 1JRHI 3B9KD 3S37X 5F7WC 1FPTH 3DMMA 2CKBL 5EZJB 1QLEL 1UJTA 4P99A 3D85A 3WJJC 4CDHA 3MC0A 4PV9B 3O4OB 2MNUA 5AZ2L 1DBMH 5I15H 1XF2A 4Q9CA 3HR6A 4HWEH 3QAZC 3MUGA 1NC4B 1JYNA 1WEJL 1JPGB 5HXMA 4ZOEA 2GFBA 4ORGA 2CH8A 3ARDC 4MWFB 3V5HB 2D7PA 1ZHKA 3I9GH 1KCRH 3C60B 1KB5A 5B8CB 1KT2B 4R7NB 5A3ID 2HKHH 3UJTH 4AIXA 1NCWH 4PLNC 3GHEH 2VDLL 4ZFGL 4P0DA 4UAOB 5LGKA 2Y72A 4C83A 1CFBA 3ULUE 1J8HD 3GMLA 1CD0A 4Z0XB 4X6DE 1BQLH 4D0CA 3MLYH 3N9GH 3CUPA 5FV2A 5EBGA 4U6VH 4U1HB 4GW4A 4Q2ZB 2MCPL 4HJGA 3P3YA 1RMFH 5HYSG 3B8SA 1ES0A 3MRHA 4ERSH 4YHKL 4MJIB 2ERJB 3U0TA 1JZ5A 4KVCH 4XVTL 3QNXB 2DQEL 2ZJSL 1MI5B 4BFIA 2QSTA 2P42B 2MHAB 5KSBB 2DI9A 5HPOA 4P2OA 1WT5A 4B53A 1CL7L 2W9DH 3ZKQD 3UO1L 4DEPC 3RVVC 5JO5A 4AEHH 2J12B 1YUHB 4XPAH 4I4WA 1U0QA 4IIQB 4H5SA 5D7LD 4TSCH 3U9UA 3ARDD 3P0VL 3U4BH 1FCCA 1W0YT 5CEZE 3FCTB 5I8EA 1BM3H 3RA7H 1PKQB 3WN5A 1EHNA 4U1GC 2X41A 4KJYB 2QQKH 3BJ91 4KVNL 1L0YA 1G7JB 1VSCA 4ODUA 1RK0B 2X4TA 1FL3A 1NCDH 3WXWH 5DQJA 2ZUWA 3TN0B 1QZ1A 4MLIA 2A0LC 1MFDH 4DGYH 4LVOB 3QA3B 3ES6A 4KXZI 1QRNA 2AJ3A 2NX5A 5SX5H 2NW2A 1ACYH 5ADPL 1CU4H 2Q7YA 1A7QL 5F1KC 1T5WA 2YC1B 4P57B 4BA8A 3RVVD 4NO3A 2B20A 1B6UA 5TJWK 1JHTB 3VXMD 3GBLA 5CWSA 1OAXH 2EDHA 1NBVH 4PRBB 3U30B 3QHZH 1LO5B 1T3FB 2VIRA 2ATPA 4FTVA 2O61A 4GBXB 3D9AH 1C08B 3OKMB 4GT7A 3LKNB 3FZUC 1EERB 4MA3A 1MPAH 2YPVL 1KF9B 2XA3A 4LASH 2YD4A 3VFOA 4R7DA 2UY6A 5JIIA 2BSRB 2A0LD 4DZBB 3F65A 3MNVA 5GZOC 4MDJB 4KZEH 4G80A 4XGZA 4NT6B 4PJ5A 3WIIH 6FABL 3PWVB 4PV8A 3LEVL 2ZP0T 1FL5A 4FQLL 2E7LC 2OZ4L 2J8UE 5J3HC 4ONFH 5FA3B 2NY3B 4K7PH 3T0EA 3SQBA 1XEDA 2VAJA 5IQ9A 3BHBB 1BFVH 4R8WH 4PRNB 4CL7A 4K8RH 1JV5B 1X9QA 3FZUD 1FYHB 4QTIH 2BSED 1WBYB 3VRLF 4JZNB 5IB3A 1U95A 1F8TH 5E94A 1NMBH 1L7IL 3NZ8B 5E8PB 3QEQD 5FO8A 4CMMB 1HHHA 1XZ0A 4HH9B 5CP3H 4MB3A 2EDDA 2NY5L 5GZOD 4F15C 1G7LA 1UM5L 4FZEL 1YMME 2ITCA 1UB6B 2VABA 1OSZB 4YNYA 5CEXA 5C0RL 3HUJA 1ZWIB 2JCCE 2AW2A 5LGHL 1DEDA 2PO6B 5KVFH 2IH3B 1N7ML 3EOBB 5C2UB 1F11B 4R4FH 1UB5B 4J3SA 5IB1A 2GITA 5J3HD 1EJ6A 3PXHA 4Y89A 1DQJA 5DMKA 3R06A 4HS8H 3MRPA 1LE9A 1CQYA 1NH6A 4CADB 2YXMA 2H8PA 2D03H 2VQUA 4Q6IC 3LQZB 2XFXB 4G8FA 1OAUL 1OGAA 4F58H 1A3LL 4UV7L 1L4IA 1AO7D 1A9BA 4NQCE 3GSUA 1T0MA 1G7MA 2ARWA 1BD2B 1KIRA 2DQGH 1FYTA 3IDGB 1G9NC 2CD0A 3QIUB 5B4MC 4WWID 4JDVB 4ZPTA 1RZFH 1F4AA 2EE6A 5HHME 1BX2A 5IESH 2OL3A 2AQ2A 5BV7L 2GCYB 3L3JA 1NFIB 4L1HA 2HTKC 3K80A 2ZSVB 1I3UA 1QFWM 5E5MA 4P48A 4MJ2A 3BKCH 1EGJL 4G7VH 4OCWL 3GSXB 4IJ3B 3RIAF 3RL1B 1I9RH 5KZCD 1FE8L 3JWOL 3SGEH 1AJ7H 1S7RA 1UC6A 1IZKA 4YDVB 1QPPA 4KTYA 2ZUUA 4LPUA 1HZHH 4NZTL 2VDNL 5EO1B 2PW2A 2W60A 3NOIA 1F3JA 2BC4A 3P4MB 5HYFA 3GSNH 3ROOB 4JO3L 1MIMH 4IMKA 5F70A 5HHPA 3IDJB 1O7SA 2BJMH 4OD2B 3CJJA 3V7AE 1UKSA 4HX1B 5I1EL 5C6PB 3EO9L 1U3ZA 3K0WA 6CGTA 3SHSA 1ETZA 5B4MD 3PE9A 4MNQE 1I7ZA 2R23B 3NIFF 1J87A 5D96C 3WUWA 1AGFA 2X42A 4G8IB 1MHCA 3OAYH 3MV8E 5FYJL 1U8OA 2OX5A 2HTKD 2I9LB 4XH2B 2C7UB 1A4KB 4U6XA 1C16B 4X80L 4YEEA 3CPLB 2WBJC 3FT4B 4KKAC 4P9ML 5HY9B 5DD5L 4EI6B 1BVLA 1IEAA 3MROA 3MOQA 1T1XB 2CIIB 2I5YL 2EDYA 4PS4H 2PTTA 3ARFC 1X5IA 5IHZB 3G5XB 3CX5K 3IXAB 3REVB 2FLBT 3S5LG 4JREC 1E4XH 3S88H 1T7XA 4R0LC 5KOVC 5I8KH 5D5ME 5T1MA 1J0YA 1ZEAL 2A73A 1MVUA 2W1NA 2CIKA 4G8EB 4DJMA 2ZUVA 3MV9A 4KI1A 3VGAB 5ERWB 4PJXB 4YE4H 5DSCB 1H8OA 3KNBB 1J18A 4PJIA 4Y88A 1AY1L 1PZ5A 2BHUA 3H3KA 4S1DC 3LN5A 3V79C 4KQ3H 2IQAB 1AXSB 1TMCB 2AK4B 3NMEA 4H26B 3DV6A 2E9WA 3MLZH 5EZOH 1N3NB 3GSVB 5T1LD 4BFGA 2WBJD 3R1GH 1JZ4A 4NQCD 4KKAD 2CDEA 1S7WB 2ZPKL 5DGRA 3V0VB 4OCNC 5MP6L 2CR3A 4QKXB 4JFED 3CGTA 4RWHA 4UDTA 3ARFD 4CU6A 5L7XH 2QSCH 3KPMA 2DQIH 3SDAB 4QXUH 3T2NH 5HHMD 2EC9U 3I3DA 3S5LB 3UEZA 1INDL 2WK2A 5AEAA 3TH3T 3OXRB 1MCBA 1MLBA 5F1SA 2ZUSA 4H1LH 3MNZA 1JF1A 1YEKL 3SPVA 1BVKA 3IDYC 3QEUB 1M4KA 4GH7B 4YHIB 1N6QL 1P7QD 4YPGA 1MH5A 3PP4H 2QV2A 1BJ8A 4PYGA 1LD9B 3BP4B 3K1KC 3QPXL 2NTFB 1JWMB 4PJGB 4X6BB 1OARH 5CGTA 1KNOB 1NGPH 3MRNB 2AJXH 4S1DD 4LOUC 2E9BA 3VXUE 1AHWB 4OF5A 1LK2B 5CD5C 1MQKL 1U8JA 2EE3A 5DZLA 4L29B 4HS3A 1P2CA 1U8QB 2R4RH 5TE4L 3SGDH 1XGPB 4RNRB 4DW2L 2JJWA 1NAML 4R6UA 4MNQD 4NHCH 5F9JB 2R2EB 1MCRA 3FQUB 3QHTC 2DQFA 1NJ9B 4AM0B 3WFZA 4P4RB 3MV8D 4P2YA 3UTTA 3IDMB 5I73B 3IJSB 4NN7B 3I6GB 4LKCB 4LFHG 3HPLA 3QDME 3W5MA 3U0WL 4Z9KB 1CFVL 3PGCA 3NZHH 2Y4SA 4YHOH 5KN5B 5D1XA 3LH2L 4TRPL 5JUEL 3GSNB 4LOUD 1HDMA 3BRGC 1YPZB 4LGPB 4LSUL 1W72L 2AGJH 1QYGL 2NY6B 4FQJH 5CD5D 5GGRA 4Y4KA 3UX9B 1P4LA 3GKWL 3TT1L 4IHOA 4EIZC 2XN9B 3H9SA 2DYPA 4M7LH 5ESQA 2RGSA 3SE8L 5EC2B 1I1AC 3WHXB 4P2CG 4I2XE 3ZKMC 1F4XL 4JVWA 3OR6A 3ULUH 1DQQB 4P2QB 3EYOA 1E6JL 2VLRA 5HD8C 2APXA 4OT1L 1U92A 4BH7A 3VH8B 3KGRA 2YN3A 4HIJB 4PJ9B 3CH1B 4QHKJ 2IPKA 3RY6A 4ODTH 4I18B 4H8WL 4PJHB 3H9HA 1EHLL 4WJ5A 5CCKL 1F02I 3T8XB 4YR6A 1ZT4B 1WBZB 3V95A 2GSGB 3ZLQC 2ADGA 2ZCLL 4OJFL 2F54B 2GYSA 3L3DA 1JRHH 3K1DA 3PF2A 4OGYL 1A6UH 1KCSL 4DVRH 4L8CA 1M05A 5CZKA 2FJFB 4D0DB 5CEZH 4EUPH 4NFDA 4TN9A 1HQRA 3KPLA 3BEWA 1CG9A 1I1AD 3C2SA 2A9NL 4MXWL 1H5BA 12E8H 3PL6A 3ZKMD 4HUNB 4TNVF 1BWMA 5CILL 1WEJH 2KL6A 2XWJB 4LCIL 5E2JA 5HD8D 4U1SB 3FO2B 2MWCA 3T08A 3VXUD 4L9LB 3K81A 3S35H 4JFDE 4MSWA 3FO9A 5SWSA 3TNNB 5ANMB 5BVPL 5JW5B 2FO1A 4PB0H 5I19L 4ZDHA 3IJYB 4JN2A 4KROB 3MBEB 1MFEH 2R1WB 4RMSA 3EYVB 1NEZB 1TZIA 2AVGA 2VDLH 5FM5M 1J88A 3D2UB 4LLAA 3QUXA 5J06A 5BJTB 4M1GH 5L2KE 5TQ0H 4FQXB 4S1RH 5BOPA 3RZCB 3MA7B 5E03A 2MCPH 4H1LB 3LEXB 4Y19E 1WFTA 5IB5A 3KJ6L 5I66A 3SJVE 4X5XB 1GH7A 4ODWA 3QDMD 2DRUA 2EYRA 1N0XL 1CXHA 4GRWE 4LSSH 4KJWC 5I1IH 1KJ3H 4GG6B 4YO0B 3W0WB 5IUSA 1NL0H 3WDJA 3LKRA 4JRYB 3CXDH 5J11C 1Q9WB 5C0FA 3UTSD 4FABL 1FLRL 4H0GA 4MDIA 3C5ZB 4P3DB 4DTGL 1QPXA 1AKJB 3TZVC 1A6ZA 3IFLL 3CVHL 2FSEA 4KUZH 5LGJB 4HUXB 1RUQL 4UNUA 3TM6A 1E4JA 1EXUB 1TNNA 3D69A 3IJHA 3VGEA 3STBA 1BGXH 3EFFB 2R1YB 4BELD 4F8TA 4RIRA 3X3GL 1MY7A 3D18A 1HKFA 4KXZH 4HEME 3DUUA 4P9HC 4YHYB 1U8IA 2ESVB 3O3BA 2D9QB 3T0WA 4LSDA 4RX4A 4AMKL 1R0AH 1A0QL 5ADPH 3OJ2C 4NO0D 4KJWD 4LRNH 4PRHA 3HRPA 4QHLA 1QA9A 4UTAH 3U0PA 2DLGA 4Q9BA 2PYEA 4ZNEA 4X98B 5HI4C 4AT6B 1HILA 1S7UB 2OR8A 5F1NA 4PYHA 1SYVA 2VDMH 1ITBB 1G9ML 4IDJL 3TZVD 4EUPG 3MRGB 5J6GA 2RJMA 4JGJA 1KELL 4AJ0A 3U79A 1D5ZA 1NGXA 3W11C 4Y5YA 3D5OF 1MCWW 3P11L 4ZPVA 2FIRT 4YHNA 3DMMC 5TPWL 3ROLA 4X6DB 5F3BA 2EICA 4FP8L 3C6LA 3O2DA 5DQDH 4NKMA 4JFDD 4U0RC 4PJDF 1MAMH 3NVQA 4AEIL 3KPOA 3VG0L 4N5UA 4PTUA 3QUMA 3HZYA 5D1QC 3ZKXC 1F4YH 1MEXH 3Q6GH 4LARH 3KXFA 1TXKA 4P4KA 1QRNE 2NX5E 1H3GA 5HI4D 1DN0A 4ENEC 2W9EL 4GAJH 2X4RA 5B3JE 5L2KD 1IFHH 1ZHNA 1KJ2L 4PREB 1HXYA 4U0QB 1FCGA 1T66C 1DQMH 3SJVD 4EUPB 1XGRA 2PKDA 1TQBB 1TDQA 1WV7T 1A6AB 3S4SA 2Q8BL 3AB0B 1R3HA 3HFMH 4JFXB 2W0FA 3W11D 3UZVB 2DQUH 4YHML 4OZHA 1QVOB 3DMMD 2YN5A 1IGTB 4PJ8A 1E28A 3D39A 1FZKB 3K4DA 4QNPF 1ZANH 2MCG1 3MLRH 4ESKA 4TUJA 1P84J 3VFGH 3KR3L 1QSFD 4P2OC 1VFUA 1WT5C 1V7NH 2NY4B 4G6AC 5KW9L 1MF2L 3WNKA 1KPRA 1J7VR 5ITFA 4KTDH 1A64A 4X7TA 5D2LA 4HQQL 5D1QD 1PVHA 2SEBA 5BO1L 5C09B 5C0RH 5BRZA 2B39A 4O58L 4HK0B 3WN5C 1LILA 2JLLA 4P2RB 4ENED 4PJ5E 1XR9A 2D7QA 4AZ8A 1TVHA 3HZKA 5HHXH 1I9JL 4UQ3B 3VFVB 3PDOB 1BJ1H 3KS0J 1T66D 2BCKA 2X7LB 4XNQB 3T0EE 1P6AB 1A3LH 4MX7A 1NUFA 1HH6A 1AXTL 1WWBX 3ZL4L 5ICZA 3V4VL 1CLCA 2P46B 5DJYA 2DM3A 2DQDH 3NIGF 1IBGL 5IMLB 2B1HH 4QHNA 4P2OD 4G6AD 2FX8H 4YDKL 4K9EH 3ZSSA 4G6ML 2R4SH 4KAQH 3O2VL 3AMLA 4IBLT 2FEDC 4P59L 4Z7VB 4MGXA 2O5XH 2JTDA 4K71C 1A1MB 3TWCL 4PUBL 2R39A 1XGYH 2HJKA 2V17L 1OPGL 4BZYA 2Z8VC 5GJTL 2NY0B 3G6JA 4L3EA 2K9UA 2E6JA 3HUJE 1DLFH 3NCYP 1XT5A 3U46B 1RZKL 1NDGA 4P5TC 3CFKB 2GIYA 5DD1H 4F7TA 3KJ4B 3H6JA 1ZXQA 4LHUA 2P5WA 2XXCB 4YDJB 1EMTH 4N8VG 3LPWA 4PRAA 1UGNA 3NH7L 3DUHA 4JO3H 4PGBA 1QRND 4JY6B 2NX5D 4LAQL 2NW3A 4I0PB 3T1WA 1OGAE 4OIIH 5H94B 1UXWA 3O0RH 4OI9A 4MAYB 4CBPA 4CMHB 1JGEB 1UA6L 4YDLC 5D7KE 3FHAA 1SY6L 2R0KL 4G43B 5AWNH 3SE4A 2O5YL 4HULB 1FAIH 3DX9A 3GJFH 3V6FA 1YMMB 3MOAH 1U8HA 1FYTE 2LAGB 3T0EC 5C0IA 1TIUA 1M7DB 1H3VA 4OFYA 4NDMA 3KPRA 1J5OL 1TJGL 3EZJB 1L0QA 1R3IL 1RU9L 4XCNA 1KG0A 3TA3B 4JY4A 4P5TD 1WC7B 3INUH 4F7PB 4GMTL 1VERA 4C56B 4U6YA 2X10A 1WZ1H 4LSPH 1MFAL 4HC1H 4HIEB 5SX4I 4J3XA 5BZDA 5E8EB 3BP6B 1MFBL 1BJ1J 4PJEA 4M6ML 3BIKA 1U58A 1RZIB 2V7NB 3PHSA 3STLB 3IDIA 1U3HB 2EDQA 3VFPB 1IC4L 1QD0A 4M7KL 5DVOA 3V7AG 3WE6A 1T4KA 3VXQA 5F7FA 3OG6B 1FGVL 3HZVB 3EDEA 2CRYA 4RFNC 1DQTA 4LKXB 1RZGA 4ZUUA 1JTPA 1OTUC 2C3GA 1WAAF 2Z4QA 5EU5A 2Z35A 1I8IA 1YNKL 3T0ED 4O5LL 3F5WB 4DZ8B 5GRJH 5FDYA 4F7EA 3DVFA 1KXQE 1A7BA 2RFXB 3U6RA 5DC4B 3L3KB 1KPUA 2OTWB 3OB8A 4I8DA 2VQ1B 2BVQB 4PLKC 3ARBC 5JNYB 2AJUL 3WDHA 1EVTC 3UZEA 1CGYA 2V2WB 1KPVA 1MUJA 3O9WB 1HHKB 2CJUL 3HMXL 3KPNA 4ZODA 3L5WA 3TJEH 4CJ0A 3GI9L 2ED9A 4XCCH 5DO2C 4XHJC 3FB5B 2KBGA 1CGWA 4LSQH 1J10A 4PJCF 4QGTA 4NZDA 1NGWA 1Z9SA 1LO2L 3DSNA 3KG5A 5DMIH 5EU4A 2IG2H 5E8DH 5DEGB 3X11A 1N6QH 1C5DB 4I1NB 3FQRA 3VXSE 2QR0B 4WDIA 3DX6B 1OTUD 2B5IC 2WNGA 4PB9H 4UU9A 5CUSH 3MV9E 5DJ0A 4M6OH 1NUDA 3GBML 4TULL 4JR9L 4PJIE 3MXWL 3RWIA 2YD7A 4RFEA 3L9RB 1OGAD 1S7TA 1FLTX 3REWB 4PLKD 4QCIB 4IMKC 3ARBD 3LIZL 5D7KD 2C1PA 4DW2H 4JFHD 5TE7L 3QXAA 5FF6A 4AEFA 3IDNB 2EXYC 2ZOLB 5DO2D 1SVCP 3K4ZA 4XHJD 1AH1A 4NUJA 1FYTD 1OT2A 3GMMA 2UUDK 3VXNB 3C8KB 2EDKA 4PJFA 4C55A 3CLFL 4OGXH 3SGJC 3PXJA 5J6HA 4FMKA 5EC1B 5D5MB 4PR5A 4ZYKB 1FBIH 3X13A 4APQB 5ITBL 1FP5A 4JZJB 1GGBL 1JPTL 1YYMH 3UBXI 1A6TB 5CMAA 3PWJB 3NFPB 1UWGH 3EO1A 4ONOA 3QJHB 4LSUH 4J2XA 2M26A 1N2RB 1S7VB 1S5IH 3GKWH 4PTTB 1AI1L 3S96B 1U2CA 2XA8L 1LEIA 4NP4H 1P5VA 2EO1A 4ZFOA 3GJFB 5T3XE 5MHSD 1CK0L 3HE7B 1YC7A 4K3GA 2EXYD 1HIMH 1CIDA 3TVMA 3ZE1F 3NTCH 3MGAA 3OKOB 1YN7B 5DRNA 5GGQH 4YBLC 4PBXA 5CZVL 4LCYB 4WHTA 1IGIH 4QYOA 2QBWA 3QWQB 1O7VA 4JO4H 3UTTE 5FYLL 5GIRB 5IGXL 3WO4C 5IVXF 4XX1E 4OUUA 1WFNA 1LP9F 1EHLH 4U1NB 3GMNB 4GRWH 5FK9B 1JMZA 5I17A 1LNUA 3RZWA 4RBPH 5EWIL 4XPBH 3KWWB 4XMKH 1M6OB 2J3SA 3UYPA 2FD6L 4FXLA 4YC2C 4HIIB 4WNQA 4FRWA 3O6LL 1T2XA 5TQ2H 1CR9H 3VXSD 3H9SE 2IALA 4Z77B 3TBYB 3JTSA 1TCRB 2ICCA 3N1MC 2XIDA 3Q1SH 2C4FT 1A7PH 2MJWA 3MV9D 3N1PC 1G6VK 2OXHA 2YA1A 4JVUA 1UCBH 3HI1A 3DBXB 3GNML 3GSOB 3MA9H 1ZVHA 3MRIB 2VLRE 3TYFB 1IQDB 1ZLWK 4W6WB 5C2BL 2PCPA 3B2VH 2V7HA 5BVJA 1ZT7B 3QQ3B 5LKNA 1MY5A 4NSKB 4Y4FA 4X6FB 1YEIL 5C0BB 4D3CL 1T03H 5E2WL 1M71B 2HAZA 2YPLA 3IB4A 1D9KA 1BZ9B 4OLWL 5JA8B 2DQJH 4AG4L 2Z9TA 3VRJB 1EAPA 1GHFL 3FN0L 1WCBB 4FNLL 3MRKB 4WFHE 2I60H 5EH1A 5IEHB 1XH3B 5ILTH 4WUUA 3JV4B 3V6ZA 3FRUB 2X4QB 3NA4A 3WFDH 4U3CA 4LSVH 2I9TB 3UP1A 4K07A 2Z92A 1MREL 1FLRH 2QHRL 3SDCB 1OAQH 1DVFC 5D1XC 4N9OB 5EN2A 2DIAA 2XYCA 4R2GC 1UVQB 3C6SA 4XCYA 2BVTA 2E6PA 4K55A 2B2XL 3MCKB 3IS0X 5SWSE 5DFWH 2ORBH 3VFUA 3VG9C 1XGUB 1CE1L 1IGMH 5DK0B 5BMFL 3RI5K 3RUGE 1NC2A 1WFOA 4JQVA 1CGXA 3T65A 3T4AB 3DX8A 4U1LB 5IM7B 3BO8B 3UTTD 4WTWA 1ZGLA 1EEYB 1HQ4A 1G9NL 5LWYH 2BY2A 4CVZA 1BEYL 3EHBC 1AR2A 3RJDA 1FGNL 5EUOA 5FCSH 4Y16B 3RY6C 3OB0H 4RAUA 4TUKH 2IANA 2IAMA 2UZIH 3W2DL 1DVFD 5D1XD 3SO3C 3MZGB 3FJTA 3LS4H 4R2GD 2VXVH 5JW3L 5IFHH 4OM1L 1ONQA 2YEZB 2YZ1A 3X3FL 1KELH 4WU5B 5BCAA 1GZQB 4BH8A 2LTQC 3TF7C 2K3TA 2DYPD 1RVFL 4OD3H 2VZOA 1SEQL 5GGSY 2QADC 5GSRB 1QSZA 3NABL 4FP8H 4URTB 5I30L 1NKOA 1UWEH 1H5BC 4Y19B 3HE6A 5J13C 3I75B 2DWDA 3QIBB 4WCYL 3HI5L 2ICWA 2VLRD 5E8NA 2VAAA 4KFZC 2XKNB 2HRPH 4ZFFA 1BIHA 3DURB 2X9YA 3QO1A 3LQAC 3HAEA 4GRWB 2A1WH 2Y36H 1BLNA 3EHBD 2XQBH 2YSSA 1YYLH 1TTFA 4KRPB 3VJ6A 1IM9B 2R2BA 5C0NC 3MREB 3ARSA 3D85B 3KPSB 2Z31C 2BVEA 2OYPA 4PRHE 1OSPH 1XF2B 4JPWH 1IKFL 1U8PA 2PYEE 4G9DB 3MUGB 4ZNEE 2HVKA 5CHNA 2PYFA 2GFBB 4EI5A 1OGTA 4ORGB 4HUMB 4XVUC 3VI3F 4WFHD 1AQKH 3FT3A 5DJ6A 1CLYH 3PIQA 4WI3A 5D7IA 4R26L 4NO5A 2WIIA 5FCUL 2G75B 2QADD 3SQOH 1P7HL 1TJHL 4C83B 1S8DA 4GLRI 1AGBA 2EE2A 4D0CB 5KW9H 4KKBC 3HMWH 3CUPB 3OAUH 2BHZA 5KSVA 1JMXA 5JMRA 4TSAL 1PBYA 1ZGLM 3PP3K 5SWSD 4UT9L 4LCUB 1ES0B 5EBWA 3MRHB 5F1IB 5C0ND 1LE5A 2DL2A 3DHJA 1R5IA 5A2FA 2Z31D 4BFIB 2C3VA 4GJTB 3KXFE 1UADC 3D1MC 1XIWA 2ADIA 4OF3A 5GSVA 5KS9A 2IFFH 4I4WB 2QKIA 4JHWH 3UAJC 3U9UB 1C12A 3AGVA 4XVUD 2MKWA 4HJ0C 8CGTA 1CD8A 4Z7NE 2AJYL 3GJEA 4LHJB 5MEOA 3ARWA 1TVDA 3MLXL 1I9IH 4EOWL 2CUIA 3KYMA 2X4TB 2RCSL 3U7WH 1G0XA 2Q86A 2XKUA 3GI8L 1HH9B 1NFDA 4OZHE 3UMTA 4KKBD 1EFXD 3FO0L 2C1OA 4P59H 4EDXB 2GY7B 3WIHL 2A74A 2FGWL 3SE9L 3WKNA 3BDYL 1VKXA 2PXYB 4PUBH 3ES6B 5FEBA 2AJ3B 5D2LE 5EBMA 1RFDL 4Z0BL 5F9DC 4JHBA 4M8QA 5DHYA 1JNHB 4LLVA 2GK2A 5BRZE 5DZNA 3QG6A 4WFEE 1IAOA 1T5WB 1KEML 4U3HA 3LMJH 1KTLB 4LDLB 4M7ZC 2DMKA 4PGCA 1CDCA 2BXYA 3IS1X 4HV8A 2VYRE 3UAJD 3B9EA 2DI8A 4HJ0D 3MO1A 5J12C 1NGZA 1T2QL 4GUPB 3V4PL 4RX4D 5K9KA 4FFYL 4FTVB 3RKPA 4TNWK 4R3SA 2O61B 2DIJA 1D5XB 3CXHK 4KPHL 2QSQA 4XNYL 3RVXC 5AAWA 4PRHD 1SM3L 4H0IA 3BVNA 1RSFA 4JFQB 4MA3B 5HGDA 2R29H 35C8H 2PYED 1VADA 3E6FA 4LIQL 4ODBD 5JZ7C 1YEFH 1G7QA 2COQA 4R7DB 5KG9A 3H3PH 3HTLX 4PGZA 2XWTA 4U1MB 3D25A 3E0GA 4QRQA 2N7BA 3P9LB 4NC1E 4RFOL 1DLHB 4Z7UB 2VMFA 4PJ5B 1TJGH 2HFGH 3QHFL 1KN4H 3P4OA 4PV8B 1HXMA 2F5BL 1FQ9C 1U8NA 1RUPH 2J8UF 1JZ6A 5TGBB 3G6JE 4L3EE 2R8SL 1GSMA 1YDPB 1ZAGA 3MLTA 1CD9B 5AYUL 4PRDA 3IFOA 2YKLH 1MIEH 1N59A 1AD0B 3TYGL 1MFBH 3OZ9L 1EZVX 1NLDH 5C6TL 5HDBF 4F9LA 2VDOL 5DUBA 1QBLL 3MACH 5K59E 3Q3GA 4RISL 1AD9B 3RVXD 5M7QA 5ALBH 3KXFD 1A7OL 1U95B 1UZ8A 1K4CA 2ZWLT 3TT3H 3EDFA 3UROR 5K9JL 2IPUG 1XZ0B 2EIBA 5JZ7D 4K3EL 3MRBB 5EBLA 2W92A 1AGCA 15C8L 4Y2DA 5C07A 1MHHA 5EZIL 2K7PA 3EO0A 2VZ3A 3FB8B 5I75C 5IIEA 1JZ3A 4Z78A 3DHMA 4ZO9A 5C71A 2JCCF 4HCRL 3QBTB 2UWEA 3RDTB 2B7DT 3HNVL 3STZA 5TF1L 3BT2H 3DVGB 4Z7WA 5FUCE 1FZJA 5TF0A 5EOCH 2QHLA 1AE6H 5L8LB 2D31B 3KPRE 5T1KA 1K85A 3RWGB 4R97B 3HMXH 4NKOB 3R06B 4LP5A 3T77B 1D6VL 2FO4A 5DD6A 4WFGE 2LV4A 4XBEH 1A7NH 2H26B 3BPLB 5BRZD 3S3JA 1S9XA 1FNLA 4PJEE 3DARA 3SDDB 4WFED 1PDKA 5GGTH 3IFNH 5IP4A 4NQSA 3PWPB 5T3XH 3WNOA 2FWOB 3N1FC 4NBYB 3TP4A 4TULH 2ADFH 4CVWA 3F6IA 1A1NA 3PNWB 4V2BA 3VGBA 3WUWG 3GEWB 4H20L 5EZJA 1ZLVK 2F5AL 3L3JB 4PV9A 4R96B 5I1JL 1FO0L 1RUMH 3S7GA 2VWEC 5DJZA 1I7TA 3X17A 3NACL 1JWUB 1S7RB 2JJTA 4OZIF 3V5HA 5B38B 4OTXL 4ZUSA 3KYOA 1X5GA 3C60A 1CLOL 1JGDB 1KT2A 2W60B 3DXAA 3N1GC 5C3TA 3RHWK 3MRLA 5CJQH 2G2RA 3JWNC 4X7SH 1MCNA 1WTLA 1FAKT 1UM4H 2EDOA 4LQFL 4OSUL 5HYJB 4L3ED 1XF3A 1RIVL 3HS0B 2E27L 4Z0XA 4M7LT 2EDJA 1B0RB 4NO2B 1ETZB 4U1HA 4Q2ZA 4LHUD 1I7ZB 1X44A 4PD4K 4HPOL 4OF6A 4ZTPH 2B0SH 1B0GA 4XVSH 4BSJA 5K9OA 1PD6A 4K3HA 5BS0A 5JMOC 3WCYA 1L7TL 2WW8A 3QNXA 3TBWB 4P9HL 2PF6A 5EIIA 1FRGL 2ICEA 4HGMA 3QB7C 2MHAA 1ZKAA 4JO1L 1I1YB 3QISA 3CFIC 1YUHA 4G6JL 4UT6L 1KJMB 4QRRD 4IIQA 5FO9B 5EOCJ 1FFOA 1SBSH 2PTTB 2X4PB 4KDWA 5E00B 3FCTA 4YEFA 1CVSC 1PKQA 5F7KC 3PUCA 4KJYA 1SJEA 4B7IA 5FYLH 3SCMB 1ZLSH 5FA4B 4OFYD 1LWRA 1PSKH 3B9KB 3KPRD 5EU6A 4IOSD 2X05A 2J4WL 5T1MB 1XGQA 2A73B 3RJQB 1MVUB 4WEMB 4I3RL 3TO4C 5DI8B 2CO6B 2Y07L 1EEQA 1IAII 1PGRB 4GAGH 3GHBH 2VXSL 3OJVC 3HNSH 1PZ5B 4FQQA 3LN5B 3QA3A 4MHHI 4Y2OA 3IETA 2FD6H 1N8ZB 5F6IB 3KLAB 3QRFM 3NCJH 3DV6B 3BKML 5HDOA 4HAFA 1KXVC 1J1XL 4D9LL 5D70H 5KVMC 1CCZA 1ED3A 4KHXH 1KB5L 3GIVA 5AZEH 2WUBL 1A14L 4YPJA 3FL7A 5HGBA 5CBEB 4RAVB 4GBXA 2VDQH 1JPSL 3OKMA 3LKNA 3WD5H 1W0VA 2AEPH 1C7SA 1RURL 4XX1G 2BNRD 3S34L 4UB0H 4X7FC 3GSQB 1PEWA 2E6QA 2P4AB 4WY7L 4A6YL 1FC2D 3TO4D 1MJ8H 2OK0L 2JIXA 3EOTL 1OCWL 5LXGL 5C08B 4D3CH 3OAZH 4DZBA 4JPIB 5GS1B 2C5DC 3RGVB 4HJJH 2YUZA 3EFDL 4AG4H 1GOHA 2FL5A 4EQ3A 1KIUA 4NT6A 1IMHC 2BFVL 3L95A 1GGIH 2AV7B 4XPHH 3U82B 1P2CB 4U2ZA 3EYSH 4DK6A 5KANI 5HVFB 4ELMB 5EO0A 3BHBA 3QFJA 5DJ8B 1YEJH 5INCA 4LVEA 4PRNA 3P9WB 5ALCH 1LDPH 3UDWA 3WDIA 1G1CA 2B2XH 1BECA 4OCYH 4JZNA 2GQHA 4MJ4A 3K2UL 5DRWB 1OTTC 3I02B 3NZ8A 1IGFH 5F71A 4CMMA 1VGEH 1S7XB 3EYUL 3HPJA 1FFPA 4O02L 4K94H 3CVIL 4WW2B 1NANI 4QRSA 1OM3L 4XC3H 1B6DA 4HWNA 1J86A 3JXAA 1S7SB 3TVMC 5DLML 2Q8AL 5C0GB 5GGRB 5FM4A 4Y4KB 3H9SB 1KLGB 3EOBA 1F11A 3ZKSD 1QHOA 1I1FA 4MA7L 4OV6F 1PG7L 5F96H 3EZ8A 4OFIA 2XZQL 1RIUL 4WUUE 4U49A 4X4MA 3OR6B 2J5LC 4CADA 4RQQA 3U1SH 3PGDB 1C8PA 2YOCA 5IHUH 3PQYD 4NQVA 4HT1L 2XFXA 4BH7B 3Q2CA 5IFAH 5ETUA 4OM1H 3OR7A 4ZUVB 4PP1C 4MD4B 2ZCKL 1OTTD 3CNKA 1SJXA 4JKLA 3D0VB 1C5BH 3OPZL 4UNTA 3QUMH 3CZJA 4LSRH 1BD2A 1FH5L 2ICWI 3H9HB 5FYKH 4WJ5B 3ULVC 1ZT1B 5CINH 4QRUB 4X9GA 4DFIA 1FORL 4JCMA 3TVMD 1QFWL 4ZSOA 4OCRH 3BISA 4QRPB 1D5MB 1QBAA 4JKPL 1F45A 2ZSVA 3WNMA 3CMOH 4GS7C 3AS1A 2VLJE 1V7ML 2FX9H 3BEWB 3VXOB 3RL1A 4DKFL 2X89D 1NMAH 1X5JA 2AI0H 3PL6B 1X7QB 5CBAA 1IKFH 4M6NH 5EUOE 4YDVA 4DWHA 4PLOB 2IANE 3HG1D 4WI8A 3P4MA 2OR9H 2Y23A 3FO9B 2H45A 3ROOA 4PP1D 1D9KC 3IDJA 1FNFA 4NUGH 3SKNB 5C8JA 3EJJX 3QRGL 3QYCA 1TZIB 3ULVD 3QUXB 2O5ZL 1CBVH 1UACL 4NNYB 5TFSL 3TFKC 1A47A 2ZG1A 4G8IA 1ZVYA 2BNQB 5IB5B 4PY8I 5I66B 1EBPA 5GHWH 3E3QE 2C7UA 4H25B 1V3LA 2EYRB 5I8OH 5EO9A 2H1PL 1VCAA 3FT4A 5HY9A 2XXMB 1T1XA 3QXTA 3LEYH 5IHZA 1Q1JL 3WUZA 3G5XA 5A16B 1FVEB 4HG4K 5D71H 3V0AC 4FFZH 4C59B 5E7BA 3IXAA 3G9VA 3REVA 2F19H 3MLVL 3D0LA 1D9KD 2CO7B 4JQVC 1S9WB 2F9BT 1JNNL 4S1QL 4GKSB 1A6ZB 3MLXH 5EOTB 5CS7A 1TVBB 3Q5TA 2FX7L 2EIDA 3AXLA 1U6AH 1QSED 3MUY1 2YBRB 4G8EA 4MMXC 3D69B 1P9MA 2EECA 2EDEA 2H6PA 3MNWA 5D7IE 2VOTA 3IT8D 4WUUD 4HXBL 5DSCA 5ERWA 4ALAH 1OWRM 4RMWA 5DVMA 4RIRB 3BXNB 1IT9L 3HC4H 2IAMC 2OL3L 4M1DL 4Q7DA 3TFKD 3WS3A 2IQAA 1AXSA 2AK4A 2Z8WC 4DN3H 4H26A 1X6NA 1BFOB 5JXAH 1N3NA 1RFDH 5D4QA 1BOYA 3KYKL 1S7WA 4Y0GA 5CP3A 2NLJA 1J1OL 4QHLB 4TOYH 3V0VA 5FB8A 5BQ7A 3MPCA 5DTFA 1SYVB 1NC2D 1QBBA 4X8XA 3ZHDA 5D93B 5KAQG 5J7CC 3E3QC 2VLJD 2NXYC 2QQLL 5T3ZE 4XNYH 4YHIA 4LRIA 4M93C 1WWAX 4WUKH 3S4SG 4FQHB 4Y5YB 1OAZH 2FR4A 4XXCC 4ZPVB 4F3FA 4YHNB 1LD9A 3BP4A 2M2DA 5KVEH 5MI0C 3ZT6A 3UYRH 3VGDA 1I8KA 1JWMA 4PJGA 1KB9J 2IAMD 4X6BA 3C6LB 5LBSH 5HVWA 3QIWB 1NFDE 3X14A 5FGCB 1LK2A 4NIKB 2NZ9C 3NAAH 4L29A 2XTJE 4PTUB 4EI5C 3QUMB 3HZYB 4MJ6B 4BK4A 4DOHE 1FC1A 4HUUB 4P4KB 5F7HA 2X4RB 3F58L 2R8SH 4G6FB 2NZIA 2R2EA 1ZHNB 1OAYH 4UIKL 3FQUA 3RI5F 1NJ9A 2IJ0C 4DKEL 4P4RA 1HXYB 3IDMA 3P77B 3GGWA 2XRAH 4G9FB 3C87A 3SN6N 3D3VA 1N4XL 2NXYD 4X9IA 1WBXA 2GJZB 3AS0A 4KUCD 2W0FB 1VA9A 1HK6A 1NMCB 1CLZH 2X1WL 3K7UA 4HFUL 4QXTB 1F90H 1FFRA 5KN5A 4PJ8B 3D39B 2IGFH 3O3UN 4YXLL 5DC0A 3B5TA 1YPZA 4XVJH 1KGCE 4I13B 4MNHA 4ZQKA 3FN3A 2NZ9D 5MENE 2QQQA 5F88A 2NY1B 3QCVH 4X7TB 5D2LB 4EI5D 1U8LB 3L3HB 5F9WB 4XWOC 5EC2A 2VDPH 4GXUN 4LVHC 4KHTL 1LEKB 3KPTA 1DQQA 4P2QA 5T1DH 4F7MB 1RIHL 5EA0L 4AL8L 2CLZB 4K3JH 3EYFA 1VPOH 3VA2C 3VH8A 4LHUG 4F7CB 1QG3A 2DLFH 2XTJC 4HIJA 3O6KL 4PJ9A 4AIOA 4NBXB 1GAFL 3CH1A 4O51A 4D9RE 1WWCA 1C5CH 4F57L 3CFDB 1LVEA 2DQTH 3T8XA 1KN2H 1ZT4A 4L4VB 3MSPA 4BFBD 4R90L 4OV5A 1S3KH 2DB8A 2FCBA 4I0CC 2F54A 4MCZB 4YHZH 3KVQA 4NM4L 2A6IB 5C7XL 3MRJA 5E8OA 3M1BA 3QXWA 1QNZH 2FJFA 3OKKA 1S9VA 3I2CL 3K74B 3LZFH 4QGYA 2L7JA 3RIFK 5C07E 5T3ZD 4XWOD 5D8JH 4E42B 1I7UB 2HJKB 3HUJF 4EBQH 1J0HA 1RK1A 2CXGA 2UWEE 2WUCH 1HNFA 3H7LA 1FO0H 4XNXL 3U4AA 4Z7WE 1KCVL 4EIGB 3DGGB 2DN7A 2X4OB 2XWJA 3R8QA 4U1SA 4XP9L 3FO2A 3DYMA 2P5WB 2D4FA 2ZKHH 3MV7E 3TNNA 5ANMA 2XTJD 1ZTXL 1KCUL 4BM7A 3IJYA 3BE1H 1DE4B 1KIQB 4L4JA 4NQDB 4E41A 3MBEA 2R1WA 3NA9H 3EYVA 1L9NA 2PR4L 1NEZA 3OX8B 2X2YA 2VZTA 4N8CL 5DMYA 4DQOL 3RZCA 3DJ9A 4UILL 3ZHLA 5K9QI 4RGMB 4G42B 4YDIL 3AROA 4H1LA 2V5YA 3H7BA 2AXFB 4D0BB 3GUTB 3LHPH 4X5XA 3BN9C 3CFJB 5C0IB 1I3VA 2HLAB 5C0CD 4YUEL 4JDZA 4NDMB 3LKQA 1ORQB 2WWKT