2UYLA

Crystal structure of a monoclonal antibody directed against an antigenic determinant common to ogawa and inaba serotypes of vibrio cholerae o1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
218
structure length
218
Chain Sequence
ELVMTQTPPSLPVSLGDQASISCRSSQSIVHSNGDTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLEISRVEAEDLGVYYCFQGSHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MONOCLONAL ANTIBODY F-22-30
publication title Crystal Structure of a Monoclonal Antibody Directed Against an Antigenic Determinant Common to Ogawa and Inaba Serotypes of Vibrio Cholerae O1.
pubmed doi rcsb
total genus 53
structure length 218
sequence length 218
chains with identical sequence M, V, X
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylA01
2PYED 4K8RL 3HE6C 4YWGL 2Z0BA 3RTQC 4QNPE 7FABH 2IPTL 2XOTA 3VD5A 3D48R 4QXTA 4ZDHB 2XY2A 3EYVA 4ZUSA 1KFAL 2O5YL 2C1OA 4NP4L 5JMRA 3WJLA 4I13B 4U1MA 5GSVA 1MLCA 1FL6B 2C1PA 2PXYB 3VI3E 3RKDD 2RFXA 2RQ8A 1RK0B 2BCKA 1MIEH 4OZFG 4M7LL 5IHZB 5F7KC 1CS6A 4I3RH 1UYWH 3H42L 1RAMA 4Y5VC 3T1WA 3U0WH 3ULUF 5D1QD 3D0LA 2P8MA 1KIPA 4PGEA 3MBEC 1HEZB 3MRRB 4Q7DA 4M7JL 3I02B 1HXMA 3VFRA 4AEIL 1ND0A 2J4WH 2IADA 2BNUB 3VGAC 4L4TD 3WIIH 2UWEA 1I7ZB 1CFNA 5DK2B 3NABH 4GG8A 3G5ZB 4MA1B 3WUZA 3W82A 3V6ZA 4G8EB 2JE8A 3HRZB 4LDOB 2VLRA 4P5TB 5ALCL 2W0KA 4MDJA 1QSED 4LSSL 1NFDF 5SWSA 5I17A 3ZDYF 1CBVL 5HHNB 3PV6A 3LS5L 3MV8D 5HVHC 5KG9A 4PR5B 3UAJC 5KOVC 2H2SD 1X9QA 1AQDA 3HTLX 1RQ5A 1ZOXA 4APQB 1MIML 1QPPA 4LAQL 4AT6B 2J3SA 3P9MB 1E4XL 4X4ZA 5J1TC 3F5WB 2DQIL 3PJSB 1UM4H 4ODTL 4PJDB 4I18B 1YPZE 1Q9OB 4H26B 1JPGA 4NQDA 4Z0BL 5KSUB 3HAEB 4QYOB 3ZZ1A 1T3FB 4OM1H 3EOAB 3CK0H 2FECI 2NR6C 4NO2B 4GAGL 4JRYD 5JXEC 4WO4C 4MA3A 4PJ8C 4OFIA 2EYSB 5CHNA 4YHOL 4KKBC 3RWIA 4AIZA 1Z9MA 5HYEA 3BEVB 4PJXA 1QFPA 1FO0A 3FN9A 1RZJC 2R0LH 4HX1A 4RZCA 1G6RB 4P2OC 4X5LA 5ISZB 3V2AR 1MCLA 3ES6B 1YYLL 1ZA3B 2F5BH 1KACB 2FJFA 3VRIB 1V3MA 5IJVA 4K9EC 4XAWH 3B6SB 4KKAC 3SDCB 2G75A 3S35L 3EZ8A 4QY8A 3CC5A 4HKXA 2H6PA 5IJKA 5E6IB 4K7PY 1P7KB 1RJLB 3X11A 4PB0L 5DZLA 4XBGA 4EVNB 5I8EA 5AUMB 4LAJH 2NY3D 4JE4B 1FZJA 4LHJB 1JTPA 1Z0NA 4BZ1L 4U1IA 1FAIL 1CIDA 3IFPA 3HMWH 3QP3A 1N4XL 3T8XA 4FABH 5TE4L 5IFAH 3JUYA 4S1SH 1UJ3C 1JPFB 3RVVD 5AYUH 3S36H 2J8HA 1O5DT 1MUJB 1PW3A 3C60B 3RWJB 3RBSA 4NWTL 4PJ5B 4OAWB 4CDHA 2Z93B 1IAMA 4PJ7A 3FT4A 5E8NB 1HHGA 1JZ2A 2R0KH 3DMMC 5FDYA 3UZVB 4PJEA 2CDGA 5I1LB 1B88A 1DEEB 1DBBL 2VXUL 5GXBB 4K3JL 3KLSA 3MLPA 2Z92A 2DI7A 1UEMA 2VR9A 1MH5A 4R8WH 1G7JB 1S7QA 4ONFH 4LFHG 2D31A 3HPJB 3QJHB 3IDIA 1D5BB 1QD0A 1H3PL 3GBNH 4R4NC 4Z7OF 4M8VA 3V0AC 3QDGD 1NCWL 5DD0H 3SJVB 4PRAA 2DQJL 1S9VB 2HKHH 4AIXA 4HUVB 2CKNA 4I0KA 4KKCD 5K9JL 3VXRD 4AMKH 1IFHH 5FO7B 1ZA6A 4IOIB 3G6AA 1I3RA 1LEIA 2OCFD 3JTSB 3HE7A 5E9DB 1G0XA 1XGQA 1XGUA 4DUWA 1W8OA 4O02H 2DICA 3MACL 3CD4A 4HWBL 3LB6C 3MUHL 1FDLH 2QQKH 2W9DL 1RUKH 4N9GB 4MWFB 5C0RL 1HWHB 2F54D 4Y1AE 4N8VA 3MLVL 3C5SB 3WS3B 1RZ7L 4KJWD 4RISL 4OCSL 1KG0A 4DN4L 2IBZX 5JPMB 4OZGF 4JFXA 4OZIB 3SE4C 5LGJB 1DLHB 4EI6B 3AXLA 4I48B 5MI0C 1B0RA 1T1XB 1BECA 5H2BB 1A6UH 4PJ5E 1QSVA 4GSDL 3HUJF 4RNRB 1X5HA 1QR1B 2CKBB 5JW3H 2ARJA 5I1KL 1U8MA 3O4LA 4KJQD 4MQ7B 2AJSL 3ARFD 1QO3B 1WZ1L 2DBLL 5D1XB 5ACZB 2BC4B 3DVFA 4XCFH 5J9PA 1CDUA 4DGIH 5JDJA 3OQ3B 1TJHH 5E1AB 4QXGH 5I74C 2EECA 3K81A 4F7EB 3VXMD 1ZHLB 1WICA 4PIRF 4LNRB 5HGHA 1GZPA 3G04A 3SJVE 3LHPH 2F15A 3QEGH 4LK4A 4R4BA 4E41D 2VNCA 2DQEH 2BVQA 3ZE0E 4H20L 4LLYB 2H8PB 1T22A 4ZXBC 4BQCA 1EAPA 1MRFH 2VQ1B 3ZHLA 4B0MM 4OT1H 5GS0H 4KUCF 1I85A 1EVTC 3CLEL 3H3KA 1W72H 4YK4C 5E9DE 2CLZA 3MRLB 1QPXA 4NCC2 3MLTB 3NTCH 1WC7A 2MWCA 1BJMA 1HHHA 3VRJA 1G7QA 1N59A 2Y25A 1FG9C 1R6VA 5DURB 3BOVA 5DJDA 3D69B 3CFBB 4WUKH 4HWUA 4HG4J 1RZFH 35C8L 4X7FC 2DQGH 4JHAL 5IBLD 3OWEA 4YH6A 3DIFB 2X4RB 1TJIH 1CI5A 2MQ3A 3EUUA 4X8JB 4LCCB 4OQTA 2NX5A 4ZFGH 3TVMC 2GY7B 1QRKA 5FHAL 2XPGB 3U7YL 3W5MA 3OJMB 1EERB 2YWZA 5IIEA 4ERSL 3BQUB 1R3IL 5BJTA 2YA2A 4ETQB 1WIUA 2X9WA 3IU4L 2FX9H 3T0EB 1BLNA 4KQ4H 1S5HA 3R0MA 3MC0A 3Q1SH 1H15B 4MJ6B 1SBBA 5GZNC 2YRPA 3BE1L 1R5VB 4XHJC 4C57C 2DBJA 3VMOA 4ACPA 1XGYL 2CIIB 1BD2B 4RMRA 5EIIA 3BRGC 2GK2A 4WI4A 4GMTH 5GGSB 3RZWA 4D0DB 2XZQH 1UB6A 3TZVB 3H9SA 1PVHA 3KJ6H 2ITCB 3KPTA 2F19L 2EDLA 3AU1A 4H0IA 4AJ0A 4JN2A 1MREL 1YJDL 4I3SL 4Y4FB 3W11D 3VFSB 4PJGF 4A6YA 2HG5B 3C6SB 3ETBF 1R5IB 2FGZA 5FGCB 5EU6B 4L8CB 4ENEC 4TUJA 2XKNB 4Z7VA 5EU7E 2VDRH 5A2LH 2DLGA 5F7WC 2CUHA 2VDKL 4HEPG 4Z5RA 2UWEF 3V4PH 4G43A 1S9XB 2R4SH 1U6AL 3VG0L 3EFDL 2NLJA 3B2VH 2XN9A 4HUWB 1LEKA 4HPYH 4ESKA 2V7HA 1TQCB 5MEQB 1P6AB 3IFNL 1QBMH 4JFDA 3WDHA 1WUNT 1N7ML 4RA0C 2NZ9C 3RIFK 4MJID 25C8H 5L2JB 1YMMD 1F5WA 2HYMA 3B9KC 5HJ3B 3K3QA 4PV8A 5A2KH 1F4YH 1T83C 5D7SH 4K9EL 4X7EC 4PRHB 4O9HH 1IT9H 3GO1L 4RMVA 1LDPH 2IAMD 4NDMB 4YBLB 3MV7D 4LDEB 1LO3L 4C56A 1KLGA 2X4QB 1XGPB 1JPTL 4L3EE 4YHPA 4HJJL 3E3QE 4J8RB 3W9EB 1D5IH 4LOUC 1GVIA 2X42A 1TTUA 2X4OA 3GMNB 1I8IB 1EX0A 4G6AC 3V5DB 1PBYA 5M95B 3GFUA 1LK3H 3KPMB 4JG1L 5F6IB 4F58L 4L3CA 4X6CE 1FYTD 5T1KA 4G9FD 1BD2E 4I9WD 1VEOA 4PJXF 3EFFA 3EDKA 3GJEB 5C07B 5E8PA 4XPGH 4P2RD 2XZCL 3VXNB 5GGUB 3L5WB 3MLUH 4HKBB 3PG2A 3WFHB 2W59A 5CIPH 5F1NB 3AREC 3X13A 4OCWL 4N90E 4LSRH 2LAGB 4PRBA 5I15L 4M5YL 2R9HD 2DLEA 4JFQB 2W0LA 4FG6D 2EIZA 5GIRB 4NNYA 4MMXC 2XZAL 5IVOA 2HFEB 4L8BA 3BEWB 5DJZB 3P40A 3VCLB 2YEZA 1MJUL 2HFTA 3P30L 5ITBH 4WHTB 3V52H 4S1DC 3HC4H 3QRGL 2VN4A 1NGXB 3MXVL 5DTFB 3T2NL 3SGKC 3GSVA 3LN4A 3OXRB 2EDXA 4XP9L 4KK9C 4KHXH 4KTEL 4PRHE 2HKFH 4ORGA 4PJ7F 1TJGL 3LY6A 4L29A 1A1OB 1V7ML 4JLRA 4ORZC 4PJEF 5SWSD 3EYQC 1TPXC 4ZNCD 4MGXA 1QNZL 5CBEB 3RIAK 4UQ3A 4JPVL 1W0WA 3UTZB 4LQFL 2ATKA 4XPAH 3NCYP 3GMMA 1CFQA 3F7RA 3TV3L 3WFBH 2W92A 4U1NB 2APVA 2CD0A 2HN7B 1FLRH 5F70A 3BD4A 5I18H 5C07E 3QNYB 3DX8A 1RURH 4KDTC 5ESAA 1M05B 4L4VA 3VH8B 1FE8H 2XQBH 3KGRA 4OD1L 4F80A 4JFOA 1EFXD 1D5ZB 5CWSB 4XWOD 1Q94A 3OB8A 1C16B 5F72S 2FH6A 3U6RB 1GZQA 4U3XA 3UBXG 3V7AG 1DBKH 1KPRB 4JG0L 3EJYC 1CGYA 4JQVA 4RX4D 4WEBL 2MHAB 3FO1B 5C2UB 5CP7B 1U8QB 3LQAC 5T1LA 4P23C 4DEPC 3N0PB 4TUOA 1YNKL 3TT3L 3D39D 2X5PA 1EHLL 4HUMB 2SEBA 3SDDA 4YR6A 2A9NL 1U9KA 1GC1C 4HJ0C 1I75A 5T5NF 3HZVB 4UB0L 5IEKA 1EHXA 4GLRH 1H5BB 4P4KC 1D6EA 5TQ2L 2Y4SA 1OTTC 1KPUB 4RBPH 3PHOB 1FCCA 1DR9A 3KYOB 3MOBL 4P2QA 4LVNC 5FM4A 2AXFA 4HCRL 2OBGA 5ESQB 4ZOCA 1EBAA 1ONQA 4Z18A 4DCQB 3QQNA 3NH7H 5A16B 3BD5A 4WTZA 5KVDL 1JBJA 4JO1L 2WSKA 4XC1L 1G7LB 5KVFL 3C8KA 3UX9B 5EBWA 3AM8C 4OTXL 3H2WA 2ZSVB 1X44A 4U0RB 3F62A 1BZ9B 4QHMA 3P0GB 3EYSH 4HHAB 1J7VR 3MV9A 1NC2B 1A6PA 1XFPA 3I6KB 2ZOLB 3VXPB 3FOMB 2CDEA 3IFLH 1RUML 4KFZC 3WUWB 1IAIH 3ORJA 3PGCA 1T04A 3U30C 4YPGA 5LBSH 5E7BA 4PV9A 1NEZA 5I2IB 3MNZA 2LV4A 4X4XA 2NY1D 5KAQG 4KUZL 2DM3A 2VC2H 1ED3B 1U8IA 3V6FA 3CXHJ 5HHVL 2QHRH 1YA5A 3MRMA 2AABL 5C9KA 2GUOA 2UUDH 3O2VL 3O41B 1Q1JH 1CXKA 3CH8A 2VAAA 5C0IB 5MEOB 4FQJH 4RIRA 4YWGH 3AY4C 1EMTL 2IPTH 3A6BL 2CPCA 5IFJA 2VXTL 4PG9B 1PY4A 1ZVSA 4HGWA 4PGDA 5C0DA 1KFAH 3OAZK 3CX5J 2DI9A 4CRPA 5DI8B 3QIUB 4GRLC 3K2UL 2GTZA 1IC4L 3LRSA 1HQRA 1CG9A 5TDPA 3EYFB 3BJLA 1M4KA 3V5KB 5BRZE 3TPUB 4M7LH 1D5MA 1T80A 3H42H 1A7RL 4QF1A 3TEUA 3V5HB 3RL2B 3CCHA 3HE7D 5ESVA 2G5BB 4I2XB 1EK3A 3B9AA 4LP4A 1KIRA 1MHPL 3W0WE 1U92A 3L5XL 4Y8AA 1QZ1A 3KPRB 4NQEA 1NFIB 3RWEB 3S35X 3B9VA 4QHLA 4M7JH 4WI8A 4Z0XA 5K9QI 5JDSB 5KJRH 1UVQA 2PN5A 4Y5XC 1OGAA 2W60B 5DJXA 5AD0A 1H8NA 4X0KA 1C5DA 1EEQA 1VEPA 3IVKB 1D7FA 1UC6A 3BW9B 3DRTA 4W68A 5BS0A 4DTGL 4F9LC 5ALCH 4D0CA 2DYPD 3BXNB 1UXSB 4LKXB 4UOJA 4LSSH 3GDBA 2P5EB 2VITA 3LS5H 1FFPB 1JUFB 1NJ9A 3TH4T 4TULL 2BY3A 4XX1E 4CVXA 1OL0A 3NZHL 3MRCB 4LAQH 2WBJA 1E4XH 2NY5C 3BPOB 5KTEL 2FR4A 2EKJA 4FQXD 2DQIH 4HBCL 1MAMH 1SJHB 4GXVH 3NBNA 2R4RL 4AQOA 2CK0L 4Z0BH 4JJHA 4Z7VF 2ZCLH 1IGIL 2IMMA 3G08B 2DTML 2EEAA 1YEJL 4GAGH 4Z7UA 4PJFE 1L7IL 4QOKE 5F97E 4YHOH 2ED9A 3E6HB 5F9OH 1JMZA 3LEXA 2EC8A 3DX6A 5ALBL 5ERWB 2EO9A 4NOFA 4M62L 1IGTA 5SWZA 3VRLF 2G9HB 1NBYB 1CU4L 1ETZA 2PCPB 5KSBB 4E0RB 4OD3H 4H0HB 4OD2B 4L8DA 5HHQA 3HMXL 4ZD3L 1TZGL 2XY1A 3IDNB 1NEUA 3S35H 4LASL 1EZVY 4XNQB 1UJTA 1H3GA 1FNAA 1P7QA 3JTTB 4D9QE 1NCDL 4HW6A 4TPRL 1A1MA 5BMFL 5L8KB 5T3ZL 2AKRA 2VLKA 5JUEL 3V0WL 2BX5A 5FA3B 4BZ1H 2OL3A 5ETUB 2GAZA 1FAIH 1T5XA 3LKSB 3M45A 1QHPA 5TE4H 1AH1A 2KUTA 2XIDA 4HUNB 3UTQA 2JKXA 2W65B 5EZIH 1ZK9A 3F7QA 4MB4A 1M71A 2X89A 4XRCB 1FVCA 4HIIB 3MV01 3U0PA 4HS3B 4ZPVB 2FHCA 3PL6C 5K9KB 4NWTH 4EXKA 3WD5L 4Y5YB 1AR2A 3MRKA 1LK2B 2R2CA 4WHDA 1S7RA 4LIQH 1S7VB 1HHKA 5TE6L 2YUVA 2WWKO 1QYGL 5IW6B 3HNSH 3WFCH 4X6DB 5IB3A 1IILE 1HHIB 2YOCA 3QFJE 4ZFOA 1AE6L 1CICA 5EO0A 4RGND 3TN0C 4C55A 4XP5L 5DZNA 1H3PH 5DHXB 2D2OA 4YHNA 1YY8A 1UH2A 2ICEB 3REVB 2W0PA 1NCWH 1RK1B 3VXQA 3C6LA 5IM7A 1CDCA 3S8WA 5DJ8B 1OB1A 1DFBL 2P49B 3KPSE 2GHWB 4X6EB 5K9JH 1E27B 3C09C 1H8SA 1NCAH 1DVFC 3X3GL 4KHTL 2C5DC 5HY9B 3LQAL 4HLZH 5CKGA 4JFDD 5MEPB 3MACH 4HWBH 4R90L 4Y16A 3TBTB 5L2KA 5I1GL 4OIIL 1GC1L 2W9DH 3ARBC 4JM2D 3ZKND 1FL5B 4RGOL 5C0RH 3AS1A 3H7BB 5IK3A 5SV3A 1RZ7H 1C1EL 4RISH 5M7QA 2JJTC 4O2EB 4DN4H 3FQUA 1MQ8A 1BX2A 5DVNA 5L9DL 1F3JA 1UKQA 4RRPG 3WYRA 2BHYA 3SKJL 2OZ4A 1DQDL 3KDMB 1E4JA 5I1DA 3T3ME 2E7LA 5HDOA 3HE6B 3LKNA 3RTQB 5I1KH 1N26A 1WFTA 1TENA 2E9IA 5DGQA 3FQTA 1AGEB 5JPNA 2AJSH 5F1IB 4YX2H 5T1KD 5HDQH 4FQHB 4X6DE 1R3HA 1QA9B 3RZCA 3S98A 5CBAB 2HT4D 4FTVB 5B8CA 4KKLD 1OW0A 1DE4A 4RAVB 3I3DA 4JDVA 1YYML 1NANH 3F6LA 3NCMA 1A9EA 1CLZL 4Y5VB 2YK1L 5HBBA 1NDGB 1L7TH 2FJGA 3THML 4J4PC 4YEEA 1KPVB 3PDGA 4XAKE 1ORSB 4ZQKB 2CR3A 4QTIL 3MBEB 3FB6B 3VWKC 4H20H 4GRMA 5GS3A 3D0VA 1T7YA 2XQYK 1QFWM 3K4AA 2XTJC 2K3TA 3VGAB 5JW4N 4MXVF 4QHKI 1KIUA 3LZFL 4WNQB 4G9DA 3FONA 1DJSA 1I9JH 4JQXC 1T4KB 2DJUA 4QRUB 4QRQA 3U0TA 5BZWA 2I9LA 2VISA 3LN5A 4TSAL 5JQ6L 3SKNA 4HZAA 4UQ2A 4Z7NF 1ADQA 3QEUB 35C8H 1T20A 1QEWA 4JHAH 1KCVL 2AV1B 4UTAL 5HVHB 5LVEA 4S1QL 2BNRD 1IAKB 5HYSG 3JVGC 4LCWB 15C8L 1F97A 3PGDA 3GB7B 3I50L 1N8ZA 4YGVB 2FECL 1IZJA 3ESVF 1I3VA 5FHAH 3EYOA 2OSLB 2RAMA 3BISA 1HYRC 1J0KA 1K2DA 4MA7L 2UVEA 3OZ9L 2MFNA 1R3IH 2E6JA 1M7XA 3OXSA 2OR8A 2FLBT 3IU4H 2XFXA 3GI9L 4AM0A 4MXWL 4U3CA 2NW3A 4WO4B 4X83A 2UY7A 4PJ8B 3O0RL 5E2UL 1KB5A 3BPNC 1OTSD 4NSKA 5E95B 5EWIL 2ADIB 4L4VD 3ARPA 2VZVA 4D9RD 1MHEB 4YDIL 3MNWA 1KIQB 1XGYH 2ESVE 4P2OB 2E6QA 4LMQI 4NO0B 4TQEL 1J87A 5DA0B 3IKCA 1UGNA 3QUML 2ZG2A 4F3FA 1RUPH 1SM3L 1T0MB 2F19H 2NY5L 1MREH 1YEEH 1YJDH 2DN7A 4MNGA 1E4WL 1ITBB 4BFEA 4WJ5B 3RGHA 3VXUE 3B8SA 4WWKC 1XR8B 5GS2H 2VDKH 4NRYB 4P2QD 5CINL 2BMKA 4KRLB 5IROA 4HIHB 4LF3A 3EFDH 4ZS7H 3ULSA 1NH6A 5TH2A 4D8PA 1UJ3B 3IFNH 3C08L 3HG1B 1N7MH 3TLRA 3V0VA 4ZFFB 4LCWE 4UIKL 1SVCP 3OB0K 5D70L 4AIOA 5GGTA 4FXKB 3VFUB 2F58L 4QO1A 4WFHE 3UTSA 3I6GA 4YBQD 1YEKL 3DMMB 3IKKA 5INDA 5F9JB 3GO1H 2GT9B 1X4ZA 4X7SL 1VFMA 1LO3H 1PKOA 1JPTH 4LU5L 1QBBA 4NO5B 1Y6NR 4V1DB 2DDQL 2WBKA 1QVOA 1EO8L 3AAZB 4MJ4A 5CGYC 4DUVA 3SPVA 4KAQH 4JG1H 5JIKA 3SDYL 4F58H 2M1KA 1FNSL 4MA8H 3B8YA 2HFGH 3EDFA 1K8IA 1A6TA 2VLJB 5DMGD 1Q9KA 5CSZA 2XZCH 4OIAA 1G7HB 2P24B 4P3CL 5DJAB 3MLSL 1VPOL 2NY0C 5DRNA 4OCWH 4EN3C 3TBVA 5L7XL 5BZDA 3NIDE 5I15H 3S37L 4M5YH 1WGOA 4HV8A 5DZOA 1XGRA 2XZAH 3M17B 2EC9U 4QRRE 3TBYA 2MQCA 4M93C 5FUCE 4GXUN 1LE9A 4FQCL 1MJUH 3P30H 4F37F 3BP7A 5DJCB 4X7DC 2ARWA 1HSAB 1NCTA 2Q3AA 5T5FL 3MXVH 3OX8B 4JDZB 3RHWF 1W0VB 3IU3B 2WINA 3HG1E 3T2NH 3VFMA 2DMCA 5MI0B 1TMCB 4HT1H 2BVUA 3EZJB 5IESL 5I16A 3PGFL 3R4DA 4N5EC 5FECB 1FGVL 2Q6WA 5K59E 3PP4H 1D9KD 1ZV5A 4LVOB 3DX7A 3HC3L 1MHHA 1TJGH 3L3JB 3BRFA 4DVBB 1V7MH 5F71A 5C0FA 4QRTB 2I07B 3FFDA 4P9HC 1I1AC 4PLNC 1IQDB 6CGTA 5B38B 4YFLF 1NC4B 1QNZH 1N2RA 1GPOH 4V1DE 3EGSB 5B39A 5D2NC 3KVQA 3BAEL 4JPVH 4CADA 5I74B 1BQLH 2D0HA 1NGZB 1X5ZA 3L3IA 2HVJA 3GKWH 2BSTA 4LQFH 4P49A 3VGEA 5GGRB 4KRPC 4D94A 4PGJA 5FYJU 4JY4B 4CMMA 2JCCA 3TV3H 4PGZA 5C0AA 1EEZA 2HJKB 3VWJD 2OTWB 5AWNH 3RI5F 2VLJE 4KRNA 4LLWA 3GHEL 5FKPB 1L0XA 2FZ3A 2YUWA 4FQLL 4ZXBB 3EHBD 4OD1H 1A47A 3C87A 1JHTA 3D18B 3JUZA 5CJXC 3AC0A 5EOCL 3SDAD 2NY7L 4YK4B 3QCUH 5D7JA 4UDTA 1WBXA 4GOSA 4JG0H 4WEBH 5DDHA 1DUZB 1T0PB 3CPLB 2VWEC 3ARDD 3UBXA 1EHLH 4JRYE 1MRCL 2MOVA 4GKNB 3VMNA 2A9NH 3TBSB 2EYTA 1V3KA 3D3VD 1YPZA 4UB0H 4HUXB 2VR5A 5TQ2H 1L4IA 3EAKA 5KN5A 2P5WD 4UNVA 4ZDHA 5ENWB 4BUGA 3QDMB 3MOBH 5I75C 5DFVD 5FCUL 4HCRH 5DRZB 3TVMB 2PXYA 3FT2B 3QHFL 5DVOA 3I84A 3Q6FA 4YXKL 4JO1H 5ECJE 4XC1H 2VLKD 4EI5A 4BSJA 1XIWD 3D85B 5KVFH 3BKJL 5IHZA 4Y4HA 1RZIA 4OTXH 4TTDC 4XBEL 4X5WB 4P3DB 3O45B 1J9CT 4P57A 1U0QA 4NCDA 2CJUL 1TDQA 1RUMH 4WFED 5AG9A 3VXSB 4LLMB 1QP1A 2BNUA 3WFEL 5DMJB 2APWA 3ALWA 1ROWA 5EU5A 2X1PA 4U1LB 1MAJA 3G5ZA 4M6NL 4JVUA 4GRWF 3HRZA 1X5FA 1NCUA 1PQZA 4KVCL 3C5ZC 3ULVF 3O2VH 1G9NH 4E5XB 4FQ2H 4R7DB 2M8XA 3RNQA 2O5ZL 2YC1A 3K8KA 4PR5A 2Z31C 1FGNL 3A6BH 1F8TH 1PEWA 4Q6IA 2VXTH 1AD9A 2P7TA 5BO1L 1SVZA 4Q6YA 4OF0A 3QUZA 4QTHA 3BDXA 3K2UH 3TP4A 4DJMA 4GW5B 1IC4H 1XZ0B 1N0LA 4OLZL 3QIWC 3T04D 5KSUA 3SQOL 3WNPA 3GJFK 1VESA 4QYOA 3B9KB 1T3FA 3QDME 4U31A 1A7RH 3EOAA 3MYJB 3VXRE 2J12B 4CMHC 1WBYB 2Y07H 4IRSC 4NO2A 1GGUA 2FH8A 1MHPH 3S5LA 1AKJA 3L5XH 4KK5C 3DROB 3ULUC 2V5SA 2ICES 4NBYB 4N0CD 1H3UA 1CT8A 3MCG1 4DKEH 3DJ9A 4PY7A 1KYOJ 1PDKA 3P3YA 1NBZA 2BVPB 4LHUB 5H35B 3OR7A 3INUL 1FPTL 3QIBC 4QGTA 4CVZA 4DFHA 4NJ9L 3K80A 2ZSWA 3SDCA 1XT5A 5DWUH 1UZ8B 1OP9A 4W81A 4HIXH 4OGAD 4GQ9L 2IGFL 1FNEB 2VDOH 1NBVL 5GS1A 5J57B 4IRZL 2IWGA 3BP6B 1WVZA 4PRPD 1PZUB 4ZNEE 2XG5A 4EDXB 4Y1AA 3RUGF 1NFKA 2FX8L 1YN7A 3AREB 1VERA 3NZHH 4XNYL 2P1YA 3DO7B 4XMLL 2J6EL 1NL0L 5KTEH 4HBCH 4NRZB 3IRZA 2D7MA 1AFVL 1EEUA 1N6QL 5IVNA 2CK0H 3KS0J 4J1UA 5C6WH 4GFTB 3JXAA 2APFA 5DR5L 3QZWB 4WEUD 1CZ8L 4GO6B 1WT5C 5JIPA 1KT2B 5HHOB 1IGIH 3RWFA 2Z93A 3VXME 2DTMH 2GK0B 1YEJH 1HINH 4HLZG 5CEZD 2E8YA 1L7IH 4JFEB 1JYNA 1JWUB 1KBGL 4NN5C 3ULVD 2GY5A 5ALBH 1PFCA 5E5MB 4M62H 4X9IA 1P4BL 1S8DA 2BOBB 5EUKA 1CK0L 4MAUL 5K33A 4K55A 3OHXA 1CU4H 4OKVA 2MCPH 4OZ4B 2FIRT 1R3JB 2BRRL 4MJ5B 5FGSA 3SCMD 3HMXH 4HK0B 5I66B 3QYCA 2G5RA 1TZGH 5I1JL 1YEIH 4LASH 5CEYA 4AEEA 3VFPB 4DWHA 1TPXB 1NCDH 3SE3C 4HUVA 2UZYB 3BVNA 3RGVC 4W6WB 4Z76B 3L7EB 5BMFH 4F7PA 4UTBL 3HR6A 3QNZB 4MXQC 2C7UB 5JUEH 1LNUB 2F8XC 2HRLA 5EC2B 3D2UB 4IOIA 2YUXA 1NUDA 3BHBA 3JTSA 1U91B 4HXAL 3RWHA 1QSFB 3MLRL 2VN7A 5I1EH 4QT5A 4QXUL 4LVHC 1ERNA 2UVFA 4PJ9D 3GSRB 5EPMB 5HHMB 2D7NA 2R23A 4PJBB 1CXIA 2C4FU 4YXHH 3WIHL 1UWEL 3ARFC 4NUJA 3WD5H 4HBQA 1MI5B 2DKMA 1QOKA 2UZIL 1CDHA 2VTFA 4CU8A 5JPMA 1KGCE 5F7EL 2ATPB 3VW3L 3NAAH 5TE6H 4P23B 2RCSH 4DEPB 4P9HL 1QYGH 3O3DA 5H37H 2I60H 3P9LB 5LWYL 3U4EA 3G5YB 1T1XA 5I1IL 1AE6H 5C0GB 5EUOB 4WGWB 5T3ZE 1Q9LA 4P4KB 5IGXH 4XP5H 4FQ1L 3WHE1 1W72A 2B1HL 3CXDL 1KCLA 4QHNB 3GGWB 3PNWB 2Z35B 4LVNB 4DZBB 3RX5A 5D1ZC 3WV0A 3HLAA 2AK4B 3KWWB 2ZOKA 1F2XK 2V5TA 3VDCA 4J3VA 4U1JA 4NQCB 1F42A 2D9QB 5C8JB 3RVWC 5E1AA 1U3JA 3TFKD 3LSOA 1F02I 5BOZG 4OCXH 4UNTA 2V17H 3CUPB 5IB1A 3OAZH 2E9WA 3LQAH 1JYWA 3LKOA 3UZEA 4R90H 2R0ZL 5IP4A 4X98A 5I1GH 4OIIH 3SKUD 3U30B 3L95B 3VFWB 1GC1H 1VACA 3ZTJH 2H8PA 4RGOH 1TTGA 1FFOA 1I1FA 1CXFA 1RZ8A 3O9WA 4BYHA 2HMIC 3T65A 2A0LC 1AGBA 5E8EB 3WN5C 5D7LB 2Q7YB 1I1YA 3GSWA 4OZHE 3LDBC 4J23A 4PGCA 2HLAB 1FG2A 4M7LT 5L9DH 4NKOB 3MLTA 2VRAA 2JIXB 4U6YB 3SKJH 5BVPL 1DQDH 4R6UA 5LGHL 3CFBA 1MI5E 2Q8AL 3KR3H 3DIFA 4YHIA 3KPNB 4Z7WA 5JW4Q 4BQBA 1UB5B 1QRNA 5JO5A 2X4TA 5D7IB 2V5MA 5C08B 1DANT 4X4ME 4UINL 4DKFL 5BW7C 3PWJB 4GRLB 5GJTH 5EUOE 3P4OB 2XPGA 4TSBL 4HH8A 4XXCC 3SO5A 1UXWB 2FATL 3MFFB 1Q72L 4GAYB 4L3EA 1YYMH 3BSZL 4IOFD 3L5HA 4M7KH 1YPZF 4P2RE 1CLZH 4ZODA 3VA6A 4WCYL 2YK1H 4ZO9A 4XNMB 4ETQA 2AK4E 5JZ7C 3JWOC 2J7LA 4IM8A 2QR0B 4NQCE 3IJYB 1JTOA 4QTIH 3QXUA 1FFRA 1DUYA 4ODUA 1DBAL 4X6CA 1GH7A 4Y5XB 2ICCA 4P9ML 4BK4A 1BD2A 1BP3B 4U1SB 5HI5C 1TTFA 4J3UA 5I8CB 4DN3H 2KKQA 4D0DA 5EULV 3LZFH 2WAHA 4HLJA 1DLFL 3JSSA 3TZVA 4BUHA 1GYAA 3DXAA 2ITCA 4GQPH 3DURB 3RDTA 5J6HA 1RUAL 5GRYA 1ZAGA 4HXBH 4AENB 3WLWD 1MEXL 3U4BL 5JQ6H 1IZKA 1OPGH 1WJ3A 3LD8C 3TGXA 1EGJH 5E0QA 4G8GD 1KCVH 3S9DB 1MHCB 4S1QH 12E8L 1CDGA 1P84J 15C8H 2OR9L 4Q2ZB 3R0NA 1R0AH 1MCIA 3QO1B 2ZUUA 1S9XA 5HYSA 4W4NA 3ARWA 5CSBA 4JPKL 4I8DA 1FL3B 4LSVH 4ZUWB 1H8OA 5GGVL 2Z91A 3L5IA 1A6WL 4WW2A 3HCVB 3OZ9H 3W39B 4HH9B 1SMAA 1I8KA 2VUYA 3C2SA 5HJ3A 5C08E 4JM4H 3SQBA 4DOHE 3GI9H 5D5ME 4O4YL 3EW3B 4MXWH 4IMLB 2GIYA 1ES0A 5CIPA 1H0DB 4PRHA 3O0RH 5E2UH 2R1YA 1IGYA 4NYLB 5FA4B 3LIZL 5EWIH 3QI9D 4AQ1B 1MLBB 4YDIH 1U8HA 4HWNA 4IRJA 3ARGA 3OKKB 4N8CH 3WJLC 3FO9B 3QUMH 4LPWA 4RMQA 1Z9SA 1SM3H 4JJ5A 5LAXB 5KSVB 4JO4L 2NY5H 2EZ0D 1HDMA 2IMNA 3A6OA 3HZYB 4LLAA 4ZYKB 1T2JA 1UH3A 3RL1B 4HF5L 5KSAD 4ZPTA 2UZXB 2G2RA 3BDYH 3D39E 4KPHL 5C07A 5FOBA 4YC2C 1J5OH 3L3HA 5AZ2L 2WANA 1ZEAL 3L5WA 5DHVH 3FJTA 5CINH 2YHGA 5ELIA 3BN9C 4MD5B 4Y19A 3T0WA 1IQWL 5F1NA 4JKPH 4QCIB 4JFFA 4PBVC 3RVUC 2E5EA 2PXYD 4IS6A 5FYKL 2VDML 5IWLA 1KXTB 1VADA 1YQVH 1MWAA 5KANG 4YZFF 1FZOB 4UIKH 3PL6B 3CX2A 4M6ML 2F58H 1IAOB 1BFTA 3TIEA 3GMOB 3BP4B 3VI4E 4WHTA 1YN6B 4P59H 2V2XA 1NGXA 5KS9A 3DI3B 3MRIA 1VKXA 4S0TD 3TCLA 4XH2B 3FQRB 3OAYH 4DW2L 2H2PC 4O58L 4LU5H 4OV5A 3CSYB 4PJIB 3ARRA 4OBRA 5E2TH 4M7ZC 4F9PA 3BIKB 2AXHA 3V7MA 1T6VN 1BQSA 3ILPA 3FCTB 3TN0B 1MPAL 2VDQH 4JY5L 3KPPB 1EO8H 4N0UA 4OLYL 2FSEB 4P5MA 5IFHL 3NCCB 5HDBF 1BVZA 4I0PC 4P5TD 3SDYH 2OXGA 3BX7C 3DVIA 5EZLB 1A1OA 1FNSH 3H0TB 1ZLVK 4KMQA 3O4OC 3U1SL 2D7TL 1ZT7A 4F15C 3MRFB 2DF3A 3ALPA 3T2OA 4RMSA 2WIIA 3C09B 3CH1B 3DGGA 5GZOD 1DVFB 4P3CH 1G7MB 4APQD 4GXUM 2BVOB 1VPOH 4KK6D 1JZ5A 3VXTB 5L7XH 4ODWA 2JB6B 2HN7A 3WJJC 1J05B 4GUPB 3S37H 3TYFB 5IQ7L 4S1RL 1I9EA 4HFWA 3QNYA 1Q0XL 2ENYA 3ARBB 3VH8A 5DFWH 1OLZA 1IAIM 3BZFA 3QQ4A 5HGAB 3R8BB 5EDXA 1WTLA 5IVXB 5IJKC 3FO1A 3BMWA 3NA9L 3QT2A 4M6AA 5J56B 5E00B 5EBMB 2IH1B 1YEFH 5IESH 5E8OA 3AB0B 3PGFH 3QNXA 3SGJA 3L3KA 1FGVH 3FHQA 4Y2DA 5E7FA 3W5NA 5DEZA 1KPUA 3HC3H 3MFGB 2LU7A 1SEBB 5BRZA 3SDCD 4XXDA 1EO7A 1XCTA 1CFSA 3OR6A 1C12B 4PJIE 5JW4R 1PEZA 2Q20A 1YZZA 5E6ID 1GHFH 3S97C 3W0WA 4O5LL 3MSPA 5DVKA 1RZKH 1OHQA 2WK2A 3BAEH 3RRQA 1ZGLP 2BK8A 3S7GA 3KPLA 1G7LA 2QKIB 3VFOA 3QEQB 5TE7L 1BZ9A 3EO1A 1CD0A 1S3KL 4EUPB 3EOYG 1XF1A 5ILTL 3X3FH 3VWKB 2GTWB 4R7NB 4U33A 4FQLH 3C60D 3V4UH 3IB4A 3PIQA 2XTJB 2X7LA 4PJ5D 3FB5A 4IHOB 1XF4A 1IEBB 3EYUL 1K4DB 4MDIB 5I2IA 1WTGT 4QRPA 3PQYA 1JYXA 3OMZA 4PRIB 1GGIL 2CUMA 4ZG1A 1ED3A 5IOPA 1X6NA 5BVJB 5SX5K 2IBGA 4I77L 3EDEA 1UM6H 2ED7A 3WEXB 2KZWA 5DQDL 1NLDL 4U6XA 1GGTA 5IVXE 2VYRE 1BFOB 1ZHNB 5MEOA 2B1AH 3BWAA 3JWOL 5E8DL 4MZ3A 2D03L 4XNXH 4U1KB 1YUHB 3SJVD 5FCUH 1S7SB 3LQZA 4OJFL 1O7VA 3TO2B 4PJFA 3CZJA 4QOKA 3QHFH 2Y72A 5D7KE 1F11B 1MFBL 2A6DB 2C9AA 1OAKL 3P73B 2DLFL 3BKJH 3MRGA 3DO3A 4Y4KC 4BFBD 3V5HA 3IDJB 4XBEH 1ZS8A 5E9DD 4NZTL 3T77A 1FH5H 4ZAKA 5GGSY 2H9GA 3BPNB 1WFOA 4WUUB 2JJWA 3WIFB 4I4WB 4F7CB 2NXZC 3IDMB 2OJEA 4LARL 4N68A 2GSIA 2W60A 4NGHL 4PREB 1S7XA 1AGDB 1BPVA 2EDHA 3C9NB 5ANMB 2Q87A 2W9LA 3PDDA 1Z9LA 4G6KL 5EZJA 1RJYB 3OKYA 3O6FB 2NY6B 2JJVA 4D3CL 2WQRA 4KVCH 1AO7A 4KV5F 2XTJE 4H5SB 2VAJA 1RJCA 5JQHC 4Y2OA 2X10A 1KJVA 4X6CF 4WWKB 1JE6A 3QFDB 4ZOBA 4Z78B 3PXHA 5B4MC 1FGNH 1FFQA 4XCNA 2R2EB 2FIKB 4XPFH 2H32H 3UMTA 4TOYL 1BZQK 1HXYB 1AP2A 4YDJB 3MRCA 4Y7MA 5D1XD 5DQ9B 3Q5TA 5DJ2B 1I85C 4JAMB 5H94B 1JRHI 5T3XD 4KRMB 1SJHA 4KMLB 4MCZA 2HH0H 1F6AB 2IPKB 3MXWL 3HNVL 4OLZH 2OK0L 1AIFB 3SQOH 1FVEB 2WP3T 4PTUB 3IAPA 3QFJA 3UCRA 1B6DA 5EA0L 2D9CA 1CLOH 2AJVH 3D87B 3P11H 3E6HA 3F58H 2DIBA 3MLZL 3B83A 3RPKA 2AAVA 2DQTL 1KJ2L 2G9HA 3KPSA 3NIFE 3BZEB 2HJFB 1IM3B 3DVGA 4WUUE 5F7HA 3INUH 4U6HB 4H1LH 4NJ9H 5H37G 1L6XA 4NPYB 3S88L 5DURD 4GQ9H 1NBVH 4IBLT 1KEGH 4IRZH 1A14H 2ZZUT 4OCRH 1JHLL 5ANME 3RVTC 1K3IA 2FJHB 5JNYA 2FX8H 2NY0B 4U3HA 4XNYH 5ETUA 4EN3B 3O8XC 1DN0A 4GW1A 2J6EH 1NL0H 2QADC 2VR4A 5EO1B 4BH7B 1AFVH 1FLTX 1INDL 4DVRL 1QFWI 1N6QH 3P77B 2W65A 2ZUXA 5J06A 3SGDH 5T33L 4X9GA 4XMPH 4HIIA 1A7QL 3BQUD 4M93B 1J8HB 1LGVA 1WLHA 3HFMH 5GRVK 3OBAA 1LILA 43CAB 3T0ED 2WUBL 3HC0A 2CIKB 1A1NB 3GSXA 3FO2B 4NZRL 1PYWB 8FABA 3QDJB 4PJCE 5DO2D 3LQMA 3TH3T 3HB3C 3ZTJG 3WXWL 2EDBA 1VFUA 2R0WL 4HWBA 4LNVA 1BD2D 5IMKB 3DYOA 1HHIA 1P4BH 2DMKA 3JBG7 2EDRA 4U1GC 2ADJB 1RZGA 1CK0H 4MAUH 5DD5L 1O7SA 1GGYA 3TZVD 3VFNA 3FB7A 1T0NA 2XKUA 1QFOA 1JTTA 2BRRH 4Y4FD 2BVEA 2DWDB 3REVA 32C2B 4N90D 2YKLL 1IC7L 1V7NL 1KNOA 1MFCL 2Y36H 1I1AB 2YR3A 4JY6A 5KS9F 2H3NB 3GMQA 5EU6D 3TO4A 1RFDH 2X09A 1U58A 5D2NB 4UTBH 3T0BA 5F89A 3U36B 4B5EA 3CFDA 4KRPB 5FCSH 4RQQB 1EVUA 2BNRE 4N0RA 5HY9A 2NQCA 4UI2A 4HXAH 5E6ZA 3UJIL 3PHSA 3MLRH 4GBXC 3FRUA 1OT1A 1NGQL 4QXUH 5FYLL 2YPLB 5DUML 2PW1B 4JQIL 3WIHH 1UWEH 2D0FA 4KI5D 1KV3A 1NMBL 2UZIH 3ELAT 4PRHD 4QWWD 4XGZA 4M00A 5B3JE 1SJEB 2B7DT 2X4UB 5F7EH 4POYA 1YMHB 3VW3H 4H8WL 4XP4L 3VFVB 1AXIB 1EUTA 5LWYH 1J8HE 5AYQA 3GJFB 4B7LA 1BBDL 1BHGA 1Y0LA 3HE6A 4FQ1H 4MMZC 5C09B 3RVXC 3H7LA 5MENB 3QDJE 2B1HH 3CXDH 5I75B 4BELD 3QEHA 3LKRA 5IVZB 5FV1L 2GSGA 5C07D 1OSZA 5CBAA 3PHQB 5A3IC 2BOCA 4BH8B 2HT2D 4MCYB 3BIAX 1K5NB 2V9QA 3T4YA 1N3NB 2VDLL 5DEFA 2YPKA 3ZDXE 1VFAB 1ZHBB 2ESVA 4TVSa 4RAHA 5F9AC 1UWXK 5IQ9A 5I8OL 4UNUA 5DRXA 5DC0A 1A4KA 1KTLA 4FFZH 1P9MA 2BNQB 5HVWA 1CGSH 3MBEA 3GI8L 3MV8B 5D2NE 2NNAB 2VSCA 5TPWH 1G9EA 3L9RA 1U95B 4FQQB 1TVDA 1IC1A 4RDQG 5I76B 4GW4A 3PWUB 3VXUA 3CDGB 4LCYA 4KJPC 1NGYB 3NPSC 4OLVL 2NYYD 2HTLD 3RFZC 4YBHA 4XVJL 3NOIA 2YPLE 5BVPH 3C5ZB 1I7UA 3T0AA 3QWRA 5DSCB 3VDAA 4R3SB 3G5XB 4G42B 2Q8AH 1AY1H 3FFCB 1OTSC 2Z31B 3P4MA 4BZYA 4R4FL 5DLML 1MNUL 3U48A 2P8LA 4PFEA 3GB7A 3LS4L 5CILL 3QO0A 1AJ7H 5J13C 4K3DL 1N6UA 4HUUB 4KTDL 2BY1A 1NDMA 1INEL 2P44B 4JQVC 2YXMA 5JHDB 4TSBH 3O6ML 5C09E 3QIWB 2FATH 1Q72H 3BSZH 4N9OB 4H88L 1G6RL 3SDDC 1QLRB 3JWNC 4CMHB 3OKNB 4PRDA 3HNTL 4X99A 5HD8D 3PUCA 4IRSB 1BQHG 2V7NA 2F5AL 2XRAL 2W9EH 4PJ8A 1HILA 1UT9A 3KLHC 2RBLA 5MERB 4PJFF 5EBLB 1P6FA 1KIQA 4NRXB 4P2OA 1C5BH 1CLCA 1DLFH 1LD9A 1CE6A 2BNQE 4JRXB 1YDPB 1DCLA 3QIBB 5FUOL 5CJOL 3SHSA 1RUAH 3WNKA 2JK5A 2PYEA 4HK3N 1MEXH 3U4BH 4F2MA 5LJYH 2XACC 4LPYA 1S7UB 5GSRA 2DMBA 4HJGB 1QLFA 3EO9L 2AEPH 4QRRA 1PSKL 1NFDB 12E8H 2C4XA 2HT3C 3L3DA 1PKQE 2OR9H 1KLUB 4YLQT 1KJMA 3NFPB 5J6GA 4HIHA 1XF3A 4MNQB 3WL9B 4JPKH 3UBXI 1SY6L 4PLKD 1JZ8A 1HQ4A 5FGBA 3U79A 1UJ3A 3PWPB 1X5GA 2QBWA 4OQTL 1U8LB 5GGVH 2XTLA 3HG1A 4RFOH 2Y06L 3GM8A 4NO3B 5D1QA 5DHYB 2XWTB 5T5NG 4XCEB 3ZKQD 1G6VK 4K8RD 2EYRA 5D2LB 3VFUA 4OGZA 3LRHA 3M1BA 3CFJB 1NC2D 4O4YH 1ULVA 2X4PB 4MAYC 1OCWL 4NN5B 1K85A 3DMMA 3DYMA 2AJUL 3LIZH 1MSPA 1QBLL 1BOGB 2YA1A 5JHDE 5I73C 4EZMA 3VXOB 3EO0A 2CRMA 5CMAB 4OLUL 4CNIA 3E6FA 1X5LA 4BSWB 5JW5B 1QSEA 3ZLQC 4JCMA 5JXAL 1UEYA 2PTUA 4JO4H 4WRLA 2LU4A 5KW9L 3ULUE 2AEWA 1OD7A 1U93B 2GITB 4OUUA 1MFAL 3JV6B 4KPHH 1W8NA 2JELH 1ZWIA 2VLJA 3RGVB 5DS8B 3W2DL 1FNLA 3O3BB 5AZ2H 4HKZB 4A6YL 5DEGB 4DK6A 4K7PX 4WU7A 4LPXA 5E99L 3ZKXC 3D25A 3GM0A 1PG7W 1IQWH 5DC4B 4JANB 3FQXB 3QIUD 2P5WE 4QOKD 4TN9A 2AJ3B 5IG7B 5FYKH 3T0DA 1MCCA 3O3AA 2BHZA 3C5JA 4LVHB 1MJ7H 3BT2L 4JRYA 1G7PB 1U41A 4MZ2A 1NFDE 4O51A 4PRNA 5C0JA 4FFWC 4M6MH 3ARFB 5GRWA 5IW1B 4MNQE 4U7MA 2CKBL 4NQSB 3MRHA 1BF8A 3PWPE 1C7SA 1HSAA 3KPRD 5A1AA 3HRPA 4UUJA 5FF6B 2GJJA 4ZUVB 5E08H 1AXSB 4DW2H 4HS8L 2OTUA 4D9QD 5D2LE 4WFEE 5BV7C 2XXCB 2D3VA 2FHBA 2WBJC 1M7DA 4M48L 4X7TA 2HLFC 5T3XL 1MPAH 1A2YA 4JY5H 4U2YA 3LKPA 4OLYH 3L6FB 3L3GB 2Q76A 3T3MF 5IFHH 5L0QC 5D1ZB 3E1F1 5FYKE 3VFGL 2DS4A 2J88L 4DVBA 3U1SH 2D7TH 4LPCA 1BZ7B 5IBUG 2P5ED 2ZCHL 2AJZA 3HN3A 1QTYT 2DWEB 3QH3B 4X6DF 2KQMA 1C5CH 3B4NA 2BSRB 1C8PA 2H1PL 3B3IB 1J10A 5F7FA 1AGCB 1N6VA 1B0GA 3X14B 4X6FB 5E5RB 2EH7L 3BH9A 1K4CB 2F74B 3S96A 5IQ7H 4MVBC 4S1RH 2YMXL 4HCRA 4IDJH 1Q0XH 2L7UA 2W07A 4JN1L 1R3LA 5IKCB 2Y7QB 4ZXBA 2VMFA 2CLRB 1FV1B 1MCBA 3WN5B 2YSSA 4K7FA 1N5YL 3LDBB 4OI7A 3KYNB 2LABA 1DUZA 3QPXH 3GRWA 3FN0L 5I1AB 3NA9H 2OP4L 2A83A 5IB4B 4UT6L 4YDKL 2ENSA 4OZGB 3P4NA 4NKDA 5DUPL 1T1ZB 3BZDA 3TBSA 3QDGA 1DQJB 2ITDB 3MRQA 1KN2L 3G6JA 2VL5A 3G5VA 4N0FA 4X7CC 1J0JA 1DQQB 4KJYB 4BQ6A 1U8KA 5ENWA 1OARL 3WE6A 3PP3K 3VXRA 4Q9RL 3MGTB 5DYOB 3OKLA 3HI1A 5C0BB 1S7TA 3ROLA 2MSPA 4O5LH 4X8XA 1KTRL 2DQFB 2R15A 3JV4A 4ODHL 3G9AB 1K8DA 3BUYB 5TE7H 1S3KH 4P3DA 1A6ZA 1CICC 1T1WB 4E9LA 2VIRB 2EDEA 5ILTH 4URTB 5LCVL 4EQ2A 1IL1B 4YXLL 4G7YL 1S7WA 1XGTB 1OTUC 4LLMA 4ZUUA 3C6LC 1E0OB 3HS0A 3QA3A 2A6JA 1X5YA 1G1YA 1N5AB 5ITFB 5DJYA 2ED8A 1GGIH 4PB9L 3IT8D 4PJHA 5D4QA 2UYLB 4ZNEA 1A0QL 5CZVH 3QQ9C 2E9BA 4I77H 1JF5A 2IANB 4NKMB 1R5WB 3LD8B 5DQDH 1P4LA 4R7DA 3U9PL 4Y16C 4NKQB 5AG8A 1JGEB 3JWOH 3LV3B 4W4OC 3CGTA 5E8DH 4M3KB 3GSNL 3QXWA 4EKXA 2D03H 4S2SB 4TNWF 3S4SB 4LPUA 4DGYL 2A2QT 5EOTB 4OJFH 4XAKD 3VXMA 3HR5B 4AEHH 1CFVL 1CL7L 4GW5A 1G7IB 2QLVB 3WNMA 4PLJC 4POZC 4F37K 1JI1A 4TUKL 1DQLL 1MFBH 4E41A 3OJDA 5C0EB 3RHWK 2DLFH 1OAZL 3GMPA 5C6TL 1GJIA 1T83A 5ID1B 3MRDA 3DETD 3DV4A 4NZTH 3RY5A 1SJVA 1TZIA 2E7LC 1E6JL 5C0BE 2LQRA 4RSVA 2QJDA 1V05A 3IDGA 2MKWA 4QXTB 3U7AA 4XT1C 2AI0L 3EYVB 4TVPL 4LARH 2EO1A 1KF9B 2C1OB 3VD4A 4NGHH 1TXKA 4U1MB 5GSVB 1MLCB 3CVIL 3RZCC 1ZHKB 1A6AA 1A7PL 2C1PB 2F8OA 5LQBL 2BVPA 2RFXB 4G6KH 4YO0A 4MQTB 5B8CC 2EXWC 1OW0C 1ZLWH 2BCKB 5CJBA 4H25A 4D3CH 1A02N 3ARSA 1TCRB 4U4BA 2YA0A 2DQUL 5DUBA 4YC2B 3D0LB 2ICWA 2P8MB 3HE6D 1KIPB 3BP6A 3RTQD 1FBIL 1KJ2B 4PGEB 3RI5K 4LMQE 4NJAL 2J8UA 1HXMB 4RAUA 3VFRB 1ND0B 2IANE 2IADB 3HMXA 1DTUA 2UWEB 4U6VL 4GKSB 1IC5L 3MQIA 4FTVD 1YECH 4GG8B 3HNVH 3NIDF 1MJ8L 3D6GA 3V6ZB 2OK0H 3AVEA 2GCYB 2AVGA 4Z77B 4OF6A 5FO9B 3IXAA 2V2WA 2VLRB 2R56L 4MDJB 3HUJA 3DUUA 2CGRL 3MCKB 2R1WB 3GIZL 1RULL 3T3PE 3AS0A 5I17B 4OUOA 1X7QA 2IALA 3MBED 4YHML 5KG9B 3U4AA 3OPZL 5HPMA 3MLZH 2NTFB 1J12A 3ZYJA 3MJ9L 4M7ZB 4ELME 2I5YH 4JZJA 4P99A 1KJ2H 1NMAH 5CP3H 1JNJA 3MUGA 3VXUD 4OV6F 5IB2B 1J1XL 5E03A 4C54A 4I0PB 5CD5C 4YGAB 4NQDB 1MCWM 2XWJA 3KNBA 3O4OB 3QAZC 4HGKC 1U3HC 4LCUA 4UBDC 1PX4A 4N8PA 4EEEA 3VFPA 4F15B 4G6JH 5JOFB 5F1KC 3IJHA 1JHLH 3UAJD 4AIZB 5CJQH 1VGKA 4LCWD 4PJXB 3SEPA 5DMKA 1HYSC 1FO0B 1LMKA 4P48A 1I7TA 3PWLB 1B6UA 4WFHD 3WHXA 3ZSSA 5INCB 1HH9A 4MJIA 4OZHA 1YMMA 2FX7L 1MQKL 1UG9A 4DVRH 3FHAA 1NSNL 4CKVX 5BV7L 2I9TB 5IJVB 5T33H 1YEDA 1A7QH 1GOGA 1A8JH 4UMGA 5E24E 4KGLA 2G75B 5GS2D 1JZ7A 2IAMA 2V5RA 2NR6D 2UV3A 2WUBH 1MI5A 4QY8B 1HNFA 1SYVA 3CU1A 4XPHL 5JXED 3CC5B 2H6PB 4PJ8D 4PP1C 1B4RA 4KKBD 1A4JA 3X11B 4MD0B 3TESA 5I8EB 3T1FB 5SWQB 5DD6A 3RPIA 1FZJB 2OQJB 5HSFA 3G5YA 4P2OD 2VLRE 4U1IB 5IROC 4U0QB 1XF5A 3IFPB 4NO0D 1JHKL 2R2HB 5DD5H 5EUOA 2FGWL 1FYTA 1BM3L 1KULA 4G9FA 1P1ZA 2LE9A 1TIUA 4KKAD 3REWB 4P2RA 1CD9B 2AK4A 5GGRY 2YKLH 4MSWA 3K0WA 1CGTA 2XA3A 4ODSH 2CLVB 5MP6L 5CSGA 1MVUA 1HHGB 4QRRD 1NGWA 5EOCJ 1ZANH 1RUQL 2CDGB 1S78D 4OB5L 4XNUL 3UROR 4G8GE 3WKNA 4NQDE 3AM8A 2Z92B 5IR1B 1MH5B 1S7QB 2D31B 5EG6C 1EUUA 3IDIB 4P46C 5IW3A 3HG1D 2YN3A 4G5ZL 5M94B 1NGQH 3FQWA 4PJGA 1F4AA 4PJXE 3FKUS 3KPQA 5DUMH 4JQIH 2AV7A 5TQ0H 3FAWA 4PRAB 1NMBH 4U2ZA 1B90A 3MLWL 1F13A 3BESR 2Q7YA 4DAGL 3DMMD 2P43B 2VLLA 4H8WH 9CGTA 4XP4H 2JIXA 1ZA6B 4U6YA 2ZG3A 3G6AB 1I3RB 2BVTA 2J1KA 5D9SA 3H6JA 4IDLA 1LEIB 1QFHA 4V1DD 3MGOB 1XGQB 1XGUB 4FFVC 4R4ND 3TM6A 3KPNA 4ZFOL 2IF7A 3GSUA 3RWGA 4S11A 2GYSA 4J3WA 4ALAH 2AXGA 4N8VB 1WCBA 1OM3L 5D5MA 5IF0B 1KG0B 5FYLE 3SY0A 3CU7A 2VLJD 3KYKL 4P4RB 3UO1L 3SKOB 3PABA 4FNLL 4JFXB 2X4SA 1EGJA 2YUZA 2DKSA 2VDLH 1IBGL 1KN4L 3AXLB 3G6JF 4Y4KB 3MTRA 5ID0A 2A6IA 1WWAX 2PF6A 3BPCA 3V6BR 1EFXA 3H9ZA 3LB6D 2QR0A 2ARJB 2O5XL 3O4LB 4XZUA 4G8IA 2NXZB 2EDYA 4RX4A 5EC1B 2A1WL 2X40A 3WKML 2VXQL 3D39A 5IHUH 4U1SA 5I8CA 4F7MB 5C9JB 4GLRI 4YE4L 4G6ML 2WZPD 3ECBA 4OLVH 5J89A 4LQ1A 4ZOEA 1XR9A 3DURA 5HI4C 4XVJH 5CKAA 5C7XL 5HGHB 1GZPB 3OSKA 1RPQA 4OSUH 2XYCA 4ZFZA 3MRNA 2FWOA 2BVQB 4Z6AT 5H8DA 4R4FH 5DLMH 3WO4C 3K1DA 1KXQE 3HAEH 4L4JA 3QUMA 3LS4H 5CILH 3H9HA 1OY3B 4PJHF 4K3DH 5D7JC 1NC4D 1INEH 4I3GA 1Q9WB 1IAII 2CLZB 3O6MH 4OKDA 2VZTA 1HHHB 1IGCL 2EZ0C 3L1OL 3VRJB 1G7QB 1N59B 5T1MB 1G6RH 1JF1B 3TIDB 3GHBL 1OAYL 1Z0MA 3HNTH 5DJDB 5DHVA 4KDWA 1L0YA 2DJ4A 2F5AH 2XRAH 1OP3H 3MROA 3NACL 4L3AA 3T08A 5HI3C 1BQHA 2L7JA 4PJDE 4ZXBD 2NX5B 2V5YA 3E8UL 4PPTA 2P8PA 3ZE2E 4Y88A 5IBUB 4LVEA 2GQHA 5IV2A 1Q38A 5FUOH 5LAXA 5IIEB 1AI1L 5CJOH 2CQVA 3O4LE 4MLSA 4EI5C 2XZZA 5BJTB 4Y4HC 1L9MA 2OLDA 5HGBA 4KQ3H 1S5HB 2ZWLT 4BFGA 2VOTA 2NY2C 3EO9H 1QFWL 1PSKH 5ISZE 4JFPB 4FQIL 1FZKB 3QDMD 4NNXA 3O8XB 5EIIB 4QCIA 1E6OL 3TVMD 1I4FB 3FMGH 1SY6H 2QADB 3HPLA 3OGOE 1UB6B 4Z9KB 5IUSA 1U3YA 3H9SB 3NCJL 4HAGA 4WIQA 4B50A 3AU1B 2Y06H 4JN2B 2FB4L 1FZOA 3DHMA 3D85D 4GMSL 1G9MC 2VABB 4A6YB 3QRFM 1AR1D 2VUOA 3BMVA 4TUJB 3BP4A 3ZMRA 1OCWH 1CVSC 2B5IC 2J8UF 4Z7VB 4HIEA 5GZND 1JNNL 3NZ8A 2AJUH 4XHJD 2OMNA 1DN2A 1I3GL 1GIGH 1LVEA 3P9WB 4YIQA 3VXSD 1GAFL 5GZOC 4Q6IC 2PO6C 4OLUH 3DUSA 3F8UB 3QCTL 4PJIA 5E2WL 4U1GB 2NLJB 4POUB 1LEKB 2XN9B 1TVHA 2PTTA 3QUZC 5FDWA 1XH3A 1T2QL 3FCTA 2DYPA 3MNVA 3DSFL 3A0OA 5JXAH 1A3QA 1U8JB 4BFIB 5KW9H 3H0TA 3Q5OA 1UQSA 2NX5E 4Y89A 4PV8B 4ENED 2NXYC 1MFAH 4NWUL 3IYLW 4OLWL 3RBGA 3HHRB 1A9BA 4FQXA 1MCQA 3IS0X 3E2HC 4C56B 3CFKA 1GRWA 3Q3GA 3WXVL 1NGPL 3PV7A 1R24B 4YHPB 4MJ2A 4X6BA 5IBTL 4GBXB 1A22B 1EXUB 2X4OB 3WFZA 4NC1C 1OT2A 1P2CB 2NZ9D 3FQNA 2EDDA 1EEYA 4LDLB 2XA8L 3B9KD 3KG5A 4L3CB 4KGJA 3ZT7A 4YEFA 1FP5A 1J88A 5F7NC 5TFSL 3GIVA 4LLQB 3BP5A 1XMWA 2RGSA 2CKBH 4JREC 3EFFB 4R0LA 5GS1C 5IVXA 3QPQC 1ZKAA 5E8PB 4HS6A 1E4KA 1JGVL 2NY4B 1KJ3H 3H9SE 4K71C 4OZHF 1YEHL 4NT6A 2HA1A 1JFQL 4M48H 4PRBB 5T3XH 3MMEA 1X3DA 1W2KT 2H41A 2EIZB 1UCBL 3QCVH 4LHUD 4NNYB 2FCBA 2AW2A 4G6AD 1CQKA 2NCMA 3TJHC 1SEBA 1INQA 1JWSA 4L8BB 5D8JL 2J88H 2AJYL 4OZIE 4PGBB 1A5FL 2ZCHH 2A6KA 5JIHA 4FZ8L 1AQKH 3ILQC 4X9FA 5EUOF 3GSVB 3LN4B 4G6FB 1OQXA 3EOBA 4K3EL 1KGCD 3MODL 5DC9B 5D72H 4TNVF 4ORGB 4KMTH 4R7NA 3KYMA 5T3XE 4L29B 3SOBL 4JR9L 1OP5H 5T3ZD 1IEBA 4MDIA 5HHOD 4JLRB 3ZHDA 5DF0A 1AHWC 1HH6B 4EOWL 1N5YH 4S1DD 4JFED 3NPSB 1A3LL 4UQ3B 3FN0H 1W0WB 2OP4H 1MY7A 4UT6H 4Q9BA 4IIQA 2ATKB 3EIFA 4W6YB 4NHUA 3GMMB 3ROOB 1CFQB 4GJTB 1J0IA 4KK9D 3WEXA 1VCAA 1KN2H 1BFOA 3DX8B 1URLA 5ESAB 2Z8VC 3KAAA 1P4IL 1FJ1A 2YPVH 4YFEA 1YUHA 4Q9RH 5GRJL 5F9WC 5J13B 4CU6A 1GGCL 2Y1VA 3TO2A 4GG6A 1GZQB 5HHXL 4LKCA 3WNLA 3H3PL 2PW2B 5HGDA 5T1LB 2EDOA 4JZOA 1RZJL 4ODHH 2SEBB 3D2UD 1N0XH 3SDDB 4HD9A 3PWVB 4YR6B 1CXLA 3RWDB 4JM2A 1TQBC 2H32A 1H3WM 3GSNB 2FRGP 5ICZB 1QSFD 5IEKB 3O6LL 3CDYA 4JPIA 5GS0C 2RHEA 4M1GH 3WIFA 7FABL 5LCVH 5D5MF 4AH2B 1IKFL 4XTRC 3K4DA 4G7YH 5HHMD 4P2QB 3AS2A 4XPTL 5ICXA 1MI5D 4YFDB 2VERN 4LSQL 4PREA 5IMMA 1ONQB 1C08A 1AGDA 1FNHA 3EJYD 3FT3A 4PB9H 3K7UA 5ANMA 2APBA 3T0EE 4P23D 3TBWA 1J0YA 1A0QH 3O6FA 1RJYA 1T89A 2YD3A 3HI5L 3QXAA 3UPCA 3C8KB 5EBWB 1UYWL 1RJZA 2IQAA 1QKZL 2HJLB 2VDPH 1JZ3A 5F7LB 4HJ0D 1DBMH 2X1XR 4QHMB 1J86A 3MV9B 3U9PH 1OTTD 2CDEB 5C6PB 4Z78A 3PGCB 2GW5A 4G3YL 1NANI 4YPGB 2R2EA 4P0DA 3GSNH 2AERT 1BREA 3ET9F 4DGYH 2AK4D 4RDQF 3OV6A 4LEXL 2MKLC 3N9GH 3O9WC 4PV9B 1NEZB 1G0YR 4H1LA 3MNZB 4U1HB 5A2JH 4JAMA 4NQCD 1CFVH 1CL7H 4X4XB 5DRWA 4LPVA 5CEXA 4NN6C 2A73B 2Q1EA 4XVUC 2CSPA 4PJCA 5IMLB 4P5KB 3I3EA 1U8PA 3NABL 4TUKH 5FGCE 2IPKA 2R69L 4NM4L 3IDYC 5EU6E 2ZKHL 1U8IB 3V6FB 5I30L 4JZNA 5HVFB 3IAGC 4QHUA 3MRMB 1LP9B 3DV6A 2GUOB 1OAZH 4IOSD 5C6TH 2E7MA 2OM5A 1SEQL 2DLIA 2R29L 1AD0A 4FRWA 2YS4A 1E6JH 4MAYB 2Q8BL 3BD3A 2WV3A 2X05A 2XG4A 3T4AA 2J6EA 5I73B 3VI4F 3CSBA 4PGDB 4HGWB 5C0DB 4BK5A 1REIA 5D7LD 4HC1H 3KS0H 3UP1A 2OTPA 5I71C 1A7PH 2GTZB 3LRSB 3VG9C 4ZS6C 1TLKA 4HUKB 5LQBH 1IM3A 2H26A 1DZBA 1CG9B 4GKOA 4KI5E 3V6OE 5TDPB 3TA3C 4C83B 3CFEA 4U6HA 2JIXD 1QHOA 4UZGA 1U42A 5TDNA 2BNRA 1BGXH 5I0ZA 4V2CB 1B3JA 3CCHB 2F8VA 5ESVB 2DQUH 4OZFB 1KIRB 5B39G 1G9ML 1FBIH 4NQEB 1ZLUH 3ZKXB 2FJHA 1NPUA 1RSFA 4MXVE 4NJAH 5C08D 3TNNA 1UVQB 1OGAB 4GRLD 5DJXB 2VE6B 3QG6A 5AD0B 4U6VH 4BH7A 2X1QA 3GEWB 3MV9E 4X0KB 1C5DB 4TVPE 1IC5H 1OGTA 3DRTB 5BS0B 1MJ8H 3RDTC 5A2FA 1G1CA 3UC0L 2BSSA 4Z7QE 1J8HA 2R56H 4D0CB 3I6LE 2MTPA 3GBML 3GIZH 1RULH 4LLDA 1WFUA 1HZHL 3IS1X 2VITB 5ACMA 3F12A 3WMSA 4J3XA 4JHWH 1PYWA 3B43A 1M7IB 1NJ9B 4BKLB 2CO7B 4JKWA 4XB7A 4CVXB 4OZFH 1AGFA 4DQOL 3MZGB 4U05A 5BXFA 3MJ9H 1WWBX 5K9OA 5BV7B 1LP9E 2WBJB 3HMWL 3I75A 2FR4B 3OKOA 4FABL 5F6HI 5EU4A 3WIHA 4G80B 5IB5A 3QJFB 1J1XH 3BIBX 5L0QB 2BY0A 5HYQA 2A77H 3ZKMC 3KXFB 1JNLL 1ZT1A 1Z5LA 2P46B 3S36L 4WW2C 2DWDA 32C2A 4FFYL 1BWWA 3N1GC 1N64L 1I1AA 3SE8L 4JB9L 5F21B 1LE5A 4Z7UB 4QWWC 5D2NA 4PJIF 3LEXB 4FZEL 3BKCH 1FN4A 5EH1A 4GKZA 4QLRA 3MZTA 2VKXA 1BFSA 1IGTB 4IRJC 5SWZB 3NGBC 3ARGC 5HHPA 1PX3A 1ETZB 2FX7H 2Y5TA 5HHQB 3IDXL 5EFIA 1NSNH 3EDDA 2DQCL 4NQEE 1RHHA 1H3XA 5DD0L 3GK8L 1P7QB 5CGMA 1HHJA 4ZO8A 2HP4A 1L9NA 1A1MB 2X4UA 1R3KB 2HT2C 4AMKL 1A6VL 1YY9D 2PYFB 3D9AL 2AKRB 3TC9A 3WO3B 1U8OA 1TVBA 1K9TA 4NC0B 1JHKH 4BM7A 3UTQB 3K4ZA 1Y18A 3T2PA 4O2CA 1FDLL 1WIPA 1M71B 1FVCB 5IVXF 4K8RH 2X70A 5F8QC 5HGGS 5EBGA 4K2UL 4QHKJ 1UA6L 5MP6H 1ZT4A 3MRKB 1FAKT 2FLRT 2O5YH 3CDCA 4NP4H 3QHTC 5DQJA 3CSPA 1RUQH 4OB5H 3A6CL 4XNUH 3SDXA 3DTXA 1ZVYA 3KXFE 3HAEG 5IB3B 4NQXB 1U2HA 4ZFOB 1A6UL 2X9XA 4F9PC 1CICB 2QSTA 4Z7UE 3S5LG 2HTKC 3ZYZA 4G5ZH 4YHNB 2B8OT 3NN8B 3VXQB 3BJ91 1NAKL 3C6LB 5IM7B 3STZA 4M5ZL 5SWZE 1OB1B 4DAGH 4AEIH 5L8JB 3CDGA 1FZMA 2QHLA 3NCFB 1PKQA 3MJ6A 2X2YA 1ZLSL 1D9KA 3N1MC 5KZCB 2ADFL 2PR4L 4HWZB 1MJJA 3C5ZA 2WIMA 4PUBL 3QEGL 1CDBA 1HI6B 5HD8C 5DSCA 4Y16B 5KANI 5L2KB 5C92A 1BVKA 4LSPL 1CBVH 3DOSA 4ODXA 3FRPA 4NBZB 4ONHA 5CZXC 4IJ3C 3DECA 1V5JA 4OT1L 1A7OL 1OM3H 5ADOL 5GS0L 1MIMH 4HUUA 4NBXB 1RIHL 3FQUB 3KYKH 1EJ6A 1BX2B 1I8MA 2ILLA 5JHDA 4FNLH 2R1XA 3NTCL 4ODTH 1D3CA 3EJZC 5I8KL 1DVFD 1IBGH 3VWJA 3CMGA 2O93L 4ODVL 1QLRA 5CLWA 2D7QA 2QQLL 3SGJC 4MX7A 2DRUA 3SDAA 2DQGL 3LKNB 2FL5B 3ARBD 1SYSB 2O5XH 1TJIL 4Y2DC 3FQTB 5EBLA 5JPNB 4GG6F 1K3ZA 2FD6L 2A1WH 2KH2B 4ZFGL 1R3HB 3ARDA 3WKMH 3RZCB 4CN6A 5L6YL 4G6MH 3RJQB 3KPOA 4RWYL 1NQBA 5EZOL 5JORA 5B8CB 4JM2F 4WFGE 1DE4B 5FYJL 4I2XE 3D3VA 3U9UB 4WI9A 3NIFF 1YYLH 4JDVB 2BHUA 4HIJB 3X12B 2YD9A 1A9EB 4K07A 1KTDA 3KPRE 2W38A 2COQA 2P5WA 2FJGB 4GRWB 5C0NC 1A21A 4F7TA 5D7KD 4HJGA 5D71L 5KVGL 1ZVHA 1YC8A 1JNHB 5JHLL 4PB0H 1KLUA 1RVFL 4RMWA 3TNMA 1WWWX 4MNQA 1XIWA 1ZGLA 4CJ1A 4G9DB 3FONB 2IG2L 1N4XH 1IEAB 3MRPA 2P5EE 5I1CL 1ORQA 2OR7A 1KEML 2XWTA 4RBPK 3U0TB 1IGCH 2I9LB 3L1OH 3MX0A 5BZWB 3WLBA 3QEQD 1WT5A 3LN5B 1S9YA 5D2LA 4XI5C 3EKCA 3GHBH 1CD8A 1OAYH 3SKNB 4J4PD 4UQ2B 2YBRA 3RQ3A 4Z8FL 1DBJL 1QEWB 1JIBA 4LSTL 3VWKD 2ORBL 2FEEI 5FHBL 1CTNA 4OF7A 5HPOA 1D5XA 3PGDB 3VXOA 2XTJD 3O11A 2CR6A 1J0ZA 1N8ZB 3E8UH 4PJCF 1DBBH 2VXUH 3B2VL 1CVRA 4K3JH 1EPFA 4PRID 3EYOB 3JZ7A 3S3JA 4GH7B 1QBML 4XP1L 1AI1H 1K2DB 3ZSTA 3QAZB 1CF8L 3OXSB 3HZKA 1U3HB 4UIMB 4L9LC 2XFXB 4RGMC 4HGMA 5FK9A 4AM0B 2NW3B 5J1AA 4ZAKC 3JWDC 1KB5B 2DQJH 1MCFA 5HVGB 4HKZA 1K6QL 5DEGA 4FQIH 5KSBE 3QUYC 3MNWB 2PKDA 4YDVA 5I19L 3GMRA 1E6OH 4HPOL 2UUDK 4GRWE 2AJ3A 3IKCB 3NCJH 5CD3A 2VH5L 4I5BA 2FB4H 4M4RA 1LK3L 2GJ6B 5ACLA 4MNGB 2C3GA 1A7NL 2QEJA 4CVWA 1F2QA 4HKJA 3MLVH 4LP5A 4CVUA 4WUUD 4XPGL 5CZKA 4F33A 4OCSH 1JMXA 2E7CA 2QSVA 4M1CC 4ELKB 5CLTA 3NFNA 3UJJL 2W0FA 4ZUVA 4NZJA 5D6DA 1CGWA 5B3JF 3V4VL 1GAFH 4LF3B 3QCTH 4UDUB 5E2WH 3ULSB 1X4YA 5TH2B 3BPLC 4D8PB 3BO8B 3CDFA 4GSDH 2QL1A 3O6FD 2NY6D 3QULB 1XEDA 4KK8C 5HYIA 3SKMB 2KQNA 5D1ZA 4PRPA 4LLVB 1TZHA 4R2GC 1BZ7A 2YD7A 2R2BA 1WZ1H 2DBLH 4NWUH 3BGMA 3I6GB 3UTSB 4WWKD 3V52L 2DWEA 3QH3A 4OLWH 5INDB 3P0VL 1I7RA 4MQXC 3GUTB 1QG3A 3U46A 5GPRA 5DK0B 3WXVH 1NGPH 2AK1L 5EIQA 1IKNA 3X14A 3QXDB 2X1OA 5IEHA 3STLB 4KHXL 1PAMA 5IBTH 3ZDXF 1CFTA 3GNML 4P46B 3QUXC 3OKDB 3DX9A 3R06A 3SPVB 4C59B 2LVCA 2ICWI 2AEQL 2XA8H 4ISVA 1I9RL 2QQNL 2CDFA 5TFSH 1FNFA 1MWAL 2JB5L 1K8IB 1CLYL 1A6TB 3MJ7A 4BSVA 1Q9KB 3CLEH 1JGVH 2XNAA 2XT1B 4OLEA 2DLTA 3WFDL 1EH9A 4HK3J 3SBWA 1RMFL 2GJ6E 3SCMA 4MNHA 3QDHA 1VA9A 3TBVB 1E28B 1J1PL 3B2UD 1JFQH 1FLRL 2YRZA 4QKXB 1DQJA 5CGYD 4RCAA 1RURL 1XGRB 4HMCA 3DHJA 4KJYA 3TBYB 2XQBL 3IJSA 5JLZA 2AJYH 2ZUQC 5DYOA 1MCHA 1A5FH 2NMSA 3BP7B 4FZ8H 4WENB 2IC2A 1VFOA 1NLBL 1KSRA 4BQ9A 3U7YH 2DQFA 3VFMB 2P47B 2NY0D 4EN3D 1XF2A 4ZOAA 3HZMA 4ERSH 4IMKA 4PJ9A 5I16B 4K3EH 3MODH 2Q6WB 4M61A 3DX7B 1LEGB 1IL1A 2ZJSL 1J8HD 4JR9H 3BE1H 4FTVE 3WHE0 5C0FB 4Q0XL 3FFDB 1RD6A 4EOWH 1AXTL 3SDXF 4LLUA 3QWOA 3TO4C 1N2RB 3NH7L 1UZ6E 1A3LH 3QDJD 4MHHG 3GSOA 4O2FB 1I8LA 3MA9L 3WCYA 4CADB 3RUGA 4KROC 4M9PA 3L3IB 1WITA 5BOPA 4MS8C 2BSTB 2LVEA 2J2ZA 2IANA 4CMMB 4HMEA 4NKMA 5J3HC 2JCCB 1LO5A 2AQ3A 2FYYB 4I3SH 5C0AB 1EEZB 1FC2D 1ZMYA 4LLWB 5I9QC 3WO4B 1IAIL 3DGCR 1JWMB 1P4IH 4LRNL 1JHTB 5F7DA 1F4WL 1I1AD 5EOTA 5D7JB 1JV5A 1U6AH 3QUKA 3VG0H 4UDTB 1QQDA 1WBXB 5HHXH 1F3DJ 2X4NB 3OL2A 3H3PH 2IFFL 2ZUVA 1QUNA 5D6CB 3UBXB 1RZJH 5FM5O 4KRPD 4CN4A 4ELMA 1FFNA 2NW2B 5GGVY 2X1WL 3N1QC 5ID1A 4NC2B 1YPZB 3O6LH 4FQJL 5KN5B 4K9EH 1JL8A 1IKFH 3VD3A 1JGDB 1BVLA 2YPLD 3LRGA 1HKLL 2O61B 3D5OF 4XPTH 5AZEL 4CGTA 1X4XA 5DD3L 4LSQH 5C3TA 1ZHKA 4HJJH 4M6OL 3VD9A 4LCIL 1FNGA 3Q6FB 2OI9C 4EI5B 3HI5H 1QSZA 3UPRA 1FSKC 3FZUC 1XCQA 4Y4HB 1RZIB 1MOEA 1TCRA 1QKZH 2EDQA 4N5UA 5F3HA 4WWID 4PLOB 1P9MC 4P57B 4ZO6A 5C09D 2NY2B 1BMGA 1KJ2A 5MEND 3QB7C 5CP3A 2AEIT 4G3YH 3PDOA 5TGBA 4LEXH 5KJRL 2JCCE 1T66C 5C0AE 4KVNL 5EU5B 4GKSA 4D0BB 2R69H 4NM4H 3VH8G 2ZKHH 4LRIA 5I30H 2GCYA 4KU1A 4Z77A 5FO9A 1DDHA 2OJZL 1PQZB 4TTDD 2E6PA 3MCKA 2R1WA 4PTTA 1SEQH 5FB8A 2R29H 2BNQD 1HSBA 2B5IB 4W70A 2Q8BH 5E94B 3RNQB 5B22A 3S36X 2YC1B 2XWBA 4JVWA 5I0DA 2YD5A 1OF2A 2JF1A 3QRGH 4UOW0 2WWMC 3V7AE 2NTFA 4Q6IB 3JWDL 3MRBB 2PO6B 1AD9B 2P7TB 3FB8A 1YJDC 3QUZB 2L4OA 4QTHB 4L8SA 4PYHA 1MAML 1BBJA 1PZ5A 1X5JA 1YNTA 3PWNA 4GXVL 4LEOB 3U7WL 5IB2A 4XP9H 1KELL 3MJ8B 5D2LF 1XAUA 4KTEH 4AK1A 4I0PA 4G8GA 3OGCA 3W9DB 3C5ZD 3MRJB 2ZCLL 2DM7A 1CDYA 2NXYB 1Q0YL 2GJZA 1JCKA 5JOFA 3OKEA 4UU9B 3FFCD 3S5LB 1G9MH 2Z31D 1AKJB 5F9OL 3MOAL 3E2HB 3GMLA 2OS7A 3PWLA 1CT8B 5GRXG 3WJJA 1NUNB 3WS6A 5SX4I 4PY7B 5INCA 1NBZB 4YAQA 4GT7A 4OGXL 5JHDD 4OD3L 3WUWG 2AJXL 3OR7B 3QIWD 3U2SA 4WV1A 2I9TA 3VGHA 4CVZB 3UC0H 2ZSWB 4J2XA 1SQ2N 3QI9A 3BH8A 3GSQB 3NFSL 3GBMH 2I25N 1BIIA 4IRSD 3IXTA 4JREB 2VSDA 5GS1B 1HZHH 1JN6A 2B4CC 2V6HA 4KK5D 2DD8L 3F7VB 4MD0A 4K71B 4HZLB 4XX1G 3T1FA 1VFBB 3VFTA 3ULUD 5F88B 4E42B 3ARUA 5SWQA 1S78C 4Y1AB 2GFBA 2OQJA 5FUCC 4NQVA 4DQOH 1YN7B 2RIKA 3RKDC 4TNWK 1YNKH 3TT3H 4JKLA 4UAOC 1Z2KA 2R2HA 3V9FA 3MA7A 1M6OB 5KSAA 4JRXD 3LKQA 5FGBC 1U8NA 4JFYB 4J1UB 1T1YB 3QIBD 5EZIL 3OF6D 1KLFA 2ADGA 2DL9A 1T7VA 1JNLH 5D1QC 4OCNC 2EIDA 3REWA 4FFYH 4KZEL 3DUHA 2D4DA 1N64H 3RWFB 3Q48A 4OFVA 2EE6A 2CLVA 3SE8H 4JB9H 1QFUL 4OF3A 4U6TA 4LIQL 4OGYL 2QQQA 4D2NA 1FL6A 4FZEH 4I1NB 3HNSL 4KZDL 3WFCL 1OAUL 4KY1L 5KVDH 4FHBD 4MNQD 1S8DB 5IR1A 1RK0A 5FEBA 1IMHC 3TJEL 1CD1B 5EUKB 3OG4B 4PS4L 3OHXB 3PWPD 4OKVB 3IDXH 1MF2L 2DQCH 4B7IA 4WI2A 2MQ0A 1HEZA 3EJJX 2H2SC 3GK8H 4R96B 1AHWB 3MRRA 5CEYB 3I02A 1MFNA 3SGEH 3BVNB 3AGVA 4F7PB 1I7ZA 4NC1E 5FYKD 1A6VH 4KUZH 3D9AH 1NCAL 3J8F7 5DK2A 4Q58C 3BHBB 4G8EA 5HHVH 4P5TA 4YZFE 3RWHB 2AABH 3STBA 3MGOA 4WI3A 4QT5B 2JTDA 4NFCA 1WIOA 5HHNA 4TSCL 1BJ1H 3W81A 2R23B 1EMTH 4K2UH 5F9WB 4WI6A 4NUJB 1UA6H 4U7KA 4CAGA 5IF0A 4APQA 5HDLA 3RGVD 4AT6A 3P9MA 4P4RA 2HVKB 1BF2A 3F5WA 3SKOA 4OFKA 3PJSA 1F4XL 2E3VA 4MXQD 4PJDA 3A6CH 4HDIB 4I18A 3O3DB 1Q9OA 3U4EB 4Y4KA 4K23L 4H26A 1TQBB 3HAEA 1Q9LB 5HDBE 4C4KT 1WV7T 2QSCL 4M43L 1T03L 4N1HB 2Y9RT 3IDUA 1IGJB 2MJWA 4LVOC 1W72B 2EYSA 3DSNA 4CW1B 5EC1A 4YX2L 3CVHL 3HLAB 3BEVA 2ZOKB 5HDQL 1NAKH 2NY3C 4M5ZH 4F7MA 4U1JB 5C9JA 5KBNC 1G6RA 1EBPA 5ISZA 5GRUL 3LSOB 3ES6A 4LGRB 1ZA3A 4OF5A 1ZLSH 5CCKL 2ADFH 2PR4H 2VZ3A 1UKTA 3VRIA 5IB1B 4DTGH 3RVVC 3B6SA 1L7TL 4PUBH 2ZUTA 1LHZA 2H45A 3VXSE 3LKOB 2IQ9L 1OOAA 3QXVA 4X98B 1FYHB 3Q6GL 4LSPH 5E6IA 1VACB 1P7KA 1RJLA 5D1ZD 2HAZA 3ZHKA 1FFOB 4EVNA 2ZUYA 1I1FB 1RZ8B 5AUMA 4TULH 3O9WB 1A7OH 3CSGA 2BSED 1AGBB 3T65B 5ADOH 4Q9QL 1I1YB 3GSWB 1RIHH 4NN6B 3RVWD 4PGCB 3DVNB 1HKFA 1FG2B 1I9JL 1Q9WA 3T0XA 3IDYB 5DJ6B 5I8KH 1JPFA 2R4RH 4ODVH 5T1MA 4ZTPL 3UTPE 1JF1A 3TIDA 1MUJA 3C60A 2QQLH 2NPLX 3RWJA 4PJ5A 3ZL4L 4OAWA 2EKSB 1TETL 4YHIB 4PYGA 5A40E 1SY6A 4Z7WB 5E8NA 3T3PF 3C2AL 1NCNA 1QRNB 4KKNA 2X4TB 5JO5B 4YQXL 4KKCC 2FD6H 2HMID 3AMKA 2A0LD 5I1LA 1SBSL 1DEEA 4LL9A 2EH8L 3U83A 5I71B 5F1SA 3VG9B 5L6YH 3CZFB 3MYZA 1G7JA 3G9VA 4RWYH 4ELMF 3TA3B 5EZOH 3HPJA 3S3SA 3QJHA 5FYJH 1Y6KR 1G9NC 1G0DA 1D5BA 4L3EB 4PBWD 4ZD3H 1P53A 1AR1C 4Q74A 5D71H 3SJVA 5KVGH 1GCFA 1PJ9A 3VGGA 1S9VA 4F57L 4KJWC 3QQ3B 5JHLH 4JFPA 3AROA 1DUYB 1FZKA 4TPRH 4ODUB 1RVFH 4X6CB 4M02A 5T3ZH 1CIUA 3O8XA 2PTVA 5FO7A 2MCG1 1I4FA 3V0WH 2DB8A 5C0BD 8CGTA 2XKSA 1M1SA 3I9GL 2IG2H 5E9DA 3DXAB 1RUPL 3RDTB 1JI2A 5I1CH 5J6HB 1YEEL 1KEMH 5JZ7D 2VABA 4N9GA 4MWFA 2CMRL 4KJQC 5FYJE 1JGLL 4Z8FH 1QR4A 1DBJH 2FEDD 3C5SA 3WS3A 4LSTH 5J1SC 2BXYA 1IVLA 2ORBH 4PD4K 2WBWB 5FHBH 4OZIA 2C26A 5HYSB 5HI5D 4ZS7L 5LGJA 1DLHA 3E0GA 5DGRA 4EI6A 5ICYB 4I48A 4XVSL 5H2BA 2Q86B 4KUCD 5HHOE 4RNRA 2Z91B 4XP1H 1S9WB 1QR1A 2CKBA 4JFZL 1U8JA 4Z7WE 4WW2B 3DPBA 4JFEE 4G7VL 4BFIA 4A2MA 1QRNE 2IAND 1CF8H 1KOAA 1I8KB 3BKML 4MQ7A 1QO3A 4QNPF 1ES0B 4R97C 5CIPB 4M8QB 2R1YB 5D1XA 1IGYB 5ACZA 2BC4A 1DFBH 1K6QH 1BAFL 3K74B 1DP0A 1U8HB 2B4CL 1R24A 4IRJB 5I19H 2CO6B 3NGBB 3ARGB 5GQBA 4F7EA 4HPOH 3VI3F 1ZHLA 3X3GH 4KHTH 4LNRA 2ZNXA 4GBXA 2RJMA 4QXWA 1EXUA