2UYLA

Crystal structure of a monoclonal antibody directed against an antigenic determinant common to ogawa and inaba serotypes of vibrio cholerae o1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
218
structure length
218
Chain Sequence
ELVMTQTPPSLPVSLGDQASISCRSSQSIVHSNGDTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLEISRVEAEDLGVYYCFQGSHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY F-22-30
publication title Crystal Structure of a Monoclonal Antibody Directed Against an Antigenic Determinant Common to Ogawa and Inaba Serotypes of Vibrio Cholerae O1.
pubmed doi rcsb
molecule tags Immune system
total genus 53
structure length 218
sequence length 218
chains with identical sequence M, V, X
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylA01
2I27N 1VDGA 5HVHC 1QBLL 4RISH 1A6AB 5FYJL 1ZHLB 5JW3H 4P5TB 2XQBH 3RWEA 1CL7H 5L2KB 2APFA 4FMKA 1DVFC 5IW1A 4X4ME 3V5HA 4XVSH 2HMID 3ZDYE 1NCNA 1QLFB 2J3SA 4XP6H 4NUGL 3BKMH 5DMKA 5TDNA 1U41A 1HKFA 1IL1B 5K93A 4DN4L 2FD6H 3K2UH 5DC9B 2P5EA 1MCRA 5BO1H 4WW2F 3NABH 2PTVA 5ISZD 3NIFF 4HV8A 4Q0XL 4X5WB 3U2SB 2HG5A 5L88L 2J1KA 5FO9B 2XZQH 1OD9A 5J9PB 1NKRA 1YN6A 1DL7H 1J9CT 2AGJH 2L7JA 4JPVH 1KXQE 2UZIL 2E9BA 4EN3C 1DLFH 1BBDL 3OKDB 4ZXBC 1A6VH 1UWEH 3SDXB 4R7DB 1ZE3C 5E99L 3PWJB 3LKPB 5FYJE 3DLQR 4L3AA 1L0QA 3H9ZA 3ZE2E 1GOGA 4HJ0C 3ZTJG 3JWOH 4PG2A 1MNUL 1CQKA 2VLRE 1A9BA 1MLBA 3L95B 2FLRT 1BOYA 4NQVB 3BHBA 3BZFA 2OJEB 3QWQB 1RZJH 4LLUA 4O02H 1I3GH 4FOMA 1B4JH 3UJIL 3S35H 1C08B 1A3RL 4M7KH 1LEKA 1F45A 3H0TA 3C5SA 5JMRA 1PX4A 3CC5A 1MUJB 5I1EH 3VI4E 5GS2D 5JIPA 5ALBL 5HYSG 5DUBA 5E2UH 2CKBH 3A6CH 3ETBF 5EU6A 1H3PH 3HHRB 3CFJA 3L3DB 1S5IL 3O3BB 1VFAA 3U7AA 4RA3A 4JCLA 2DQJH 5BRZB 1HYSC 4NNYA 5JHLL 1PEZA 3HR6A 2IPUG 4RRPG 4L8CB 4LCUA 5T1DH 5JW4M 1OAKL 2ZSWB 1OP3K 5HBBA 1K3IA 1QFWM 1OARL 5ICXA 1CLOL 1LQSR 1NUNB 4NFDA 4HWEH 3RA7H 4OIBA 2AS5M 3CH1B 3P9LA 4P5KA 1QFPA 4HK3N 1F00I 1OM3L 3WO3B 4Q9RL 3IS0X 3CFEB 4JFOA 1OP5H 3I6KA 4LU5L 4HS6A 4JDZB 1NBZB 4JRYB 1IC5H 5IT2H 2VDLH 3BW9A 3OBAA 4P2RB 5CINL 2X70A 1U8OA 4MD5B 1QSFB 2N56A 4RSVA 3UROR 1L9NA 4PJHA 4PRHD 5E4IA 3BXNB 1VFMA 5IB1B 3LQMA 3BP5B 4CADA 4OSUH 2G75A 2Y9RT 1EUUA 3VWJD 1YYLH 4RQQA 2QLVB 1U91A 5I73B 4RISL 3SPVB 5FGBA 3QQ3A 2Z92A 1G7QB 2I9TB 3D9AH 3FL7A 1ZHBA 4N0FA 5JW3L 3MREA 5CEZD 1CL7L 1JGDA 4J1UA 1HK6A 3DV6B 3DYMA 4IS6B 2E6PA 5IEHB 2O61A 1EUTA 4XVSL 3ZT7A 4NJ9H 4KDTC 3REWA 4XP6L 1MHCA 3T0EC 3BKML 4Y4HD 3V9FA 2VWEE 2Y7QA 1NGXA 4H25A 3K2UL 3IJHB 4BM7A 2VDMH 5BO1L 2C4FU 3NABL 3OR6B 4HWBH 3NA9L 4WFEE 5IFAH 4OQTA 1WCBA 3SKJH 2BNQD 2XZQL 5EBMA 1XFPA 5F6HJ 1AHWA 4RDQG 4F9LA 3QIBD 5A1AA 1DL7L 4U6VH 2AGJL 4JPVL 5BJTB 1T83A 5EO9B 1UWEL 5CJXA 1P2CA 4YDJA 2WWMD 3MLXH 1XAUA 2H9GB 3DUHA 3MBEA 3ZE0F 2HVKA 3S96B 3TBYB 1IM9B 1UKTA 3D85D 5H37H 4MA8L 1N6UA 3WFEH 3GMLB 5F7UA 1OW0A 3T1FA 3FO1A 5K9QI 3JWOL 3ZLQC 2B1HH 3EYUH 3QP3A 5DR5H 1T0NA 2BOBA 1DQJA 5I76A 4HDIB 4O02L 1I3GL 1MCBA 1B4JL 4A6YA 2J4WL 5JORA 3P11H 1U0QA 1GGIH 5JTWA 3MJ7A 1SEBB 1YPZB 3U4BH 5I1EL 3QCVH 5E8DL 3VD7A 5KG9B 5KSUA 3I6GA 1R5VA 1NKOA 2P5ED 3HUJF 4HIXH 3FOMB 4JFDB 1U3JA 4P23B 1AO7A 3QAZC 3QWOB 2CKBL 3A6CL 1H3PL 4NKQB 5F6IC 1MWAH 4MLIA 1MCNA 1I8MB 3UTZB 2DQJL 4P9ML 2FIRT 1WUNT 4QRRE 3BKJH 4OLUL 4RNRB 4KJPC 2XY1A 3GSRB 3O6KH 4KJYA 4XH2A 5T1DL 2FX9H 4LVNB 3SDDA 5DD6A 1WTGT 1F11A 5D2NC 1HQRB 5SWZE 3VXSB 5DGRA 4X6CE 1HH9A 2VDQH 5ESQA 3RA7L 3RWHA 1WFUA 1MFAH 2X4RA 4ZG1A 4YHIB 1WZKA 5IR1B 4TQEH 1I1RA 4GRWB 2VN7A 3MUGB 5DDHB 3RDTC 1ZXQA 1IC5L 5AAMA 5IT2L 2VDLL 1MCWM 1T1YB 3N1MC 4DQOL 3S36X 3I3BA 1LHZA 4YR6A 3D0VA 4OSUL 4OI7A 4W81A 4HUMB 5D6DC 1N8ZB 3QULA 4XNQA 3FO9A 1JPFA 4QRSA 2IG2H 5EU6D 1YYLL 3VRIB 2UV3A 1GIGL 5DRWA 3ZHKA 4U6XB 5E6ZA 1BD2A 1G7IB 4GRMB 4UTBH 3FT2B 5DZOA 2GUOA 1PKOA 4ZO9A 1I1AB 2X6MA 2EEBA 2DYPA 1KN4H 4QRRA 4GG6E 5IMOA 2NX5A 5GRVK 3ZHDA 3TJHD 5JHDB 3I6LD 3G6JB 3I02B 3REVB 1N64H 4HEPG 3DX7B 1J88A 1R24A 1KTDA 4AY0A 3E6HA 3TCXA 4MQTB 5DMIL 4XX1G 4G9FB 1J8HB 4U1MB 2OR7A 5IMLA 1U6AH 4HWBL 5LGJA 3KVQA 3TH4T 3EOBA 5ETUB 3SKJL 1MSPA 3WMSA 1HXYA 5BV7H 4CMHC 2P5WB 4U6VL 4Q6YA 4ONOA 4XCEA 1IAOA 1ZGLM 2R2HA 4X4XA 3EZ8A 5AZ2H 1GAFH 2CKBA 4ZO8A 5GS1B 4UDUB 2NY7H 1S3KH 2ZP0T 2R15A 4MCZB 3HMXA 4J8RB 1X5GA 5C0DA 5DQJA 1KJ3H 3TJEH 3ALPA 1SHMA 3WFEL 2ZSVA 2EYRB 1DFBH 2PCPB 2B1HL 1MLCB 3EYUL 3OKNA 5DR5L 2KZWA 4PV8A 5I66A 4YE4H 1X5YA 3GKWL 2R2EB 1LE9B 2GKIA 2ZPKH 3P11L 3TIEA 3G04A 2NW3A 4CKVX 1V05A 1JCKA 4LFHD 5ID0A 2VLJA 4PJ7B 3V95A 5BW7A 3WHXB 1GGIL 5M94B 3DHMA 1SJVA 4CUCA 2XN9A 3U4BL 3QCVL 2XTLA 3JV0A 3KPOB 4HIXL 3MV8B 5DJZA 3ALXA 1VA9A 2QBWA 3QT2A 1BVKB 4WFHE 3U6RA 1IAIM 1MWAL 1DLHA 1S7QB 2YPLA 3WUWB 4NKOA 1P4IL 2C3VB 1A6TA 2VDOH 4KJQD 2EH8L 3DWTA 4OBRA 2ICCA 3BKJL 4HGKC 1IM3A 1DANT 1NCUA 5JA9A 3QEHB 2FX9L 1NFKA 4OD2A 1C5DB 1JNJA 3MBED 3UX9B 1S78D 2ADGB 2DM3A 3RGVB 2J88H 2VDQL 4M9OA 4O51A 2JJVA 1MFAL 2R2BB 1OQOA 4TQEL 3OSKA 1KN2H 4KY1L 4Z0XA 1TVBA 4ZD3H 3CCHB 2PW1B 4X9FA 4OFPA 4X6FA 2VUYA 5GIRA 4XCYB 1MHPH 2Z8SA 3ESVF 4LRIC 4XXCC 3SKUD 4HC1A 2CR6A 1JN6A 4GOSA 3HZVA 4HWBA 2FJFB 4PGBA 1GGTA 3NPSC 4JM2F 4WHTA 4FG6C 3QEQA 5JQHC 4BSWA 2MCPH 3MGAA 3DRTB 2EDYA 2YUVA 1AO7D 1INQA 3VG9B 2IG2L 5CBEB 1JNLH 3W39A 3HB3C 1DEDA 3BEWB 3PWPE 4Z7UE 4GAYB 3AXLA 3AS1A 3CDCA 4UTBL 3IETB 1CWVA 1RJCA 2WK2A 1MCSA 4PJCE 3BFOA 4Z7VA 3SDDD 4RFNB 5FA3B 1NMAH 1JE6A 1N64L 1PKQB 2D3VA 1CF8H 3UAJD 3HG1E 3GMMB 1CICC 1MI5E 1P5UA 5IVXB 2IMNA 1HH6B 4IIQC 1U6AL 1S8DB 5D1XC 9CGTA 5BV7L 1RHHA 2HFFA 1ZWIB 4ONHA 5HSFA 2D4FA 4KI5C 3DX6B 5AZ2L 3O81A 1NSNH 2NY2B 4H0GA 1TJHH 2NY7L 1S3KL 2PR4H 4G80A 4JVPA 5C0GB 2H32H 1MWAA 2B39A 1KJ3L 3WNOA 2WBJD 5GGUA 1DFBL 4U6HA 1AIFB 1BD2D 3QNZB 1PSKH 2VZOA 5HGHA 4NJAH 5LGHH 4WI6A 1OVZA 4YIQA 4E41E 1RVFH 3HLAA 5C0BE 2DI7A 1NMCB 2VLKE 4QXUH 4YE4L 5F7LB 1Z3GH 1PFCA 4MYWB 1FORH 2NX5D 2VXVH 2ZPKL 4OCYH 1J0ZA 5C0EB 5HPMB 1EEYB 4PGEA 2A38A 1BJ1H 1O5DT 2X40A 3LQAH 4G6ML 3UJJL 3N1PC 4AL8H 4ZTPH 1UQSA 1RULH 1G7LA 2X4UB 3ES6B 1T2JA 4NRXA 5TE4H 3KNBA 1ADQA 5DJYB 2MNUA 3HRZB 1AGFA 3WLBB 1UKSA 1HHKA 1JTTA 3RNKA 4KKAD 2DTSA 4G7YH 2VDOL 1AI1H 4KTEH 1L9MA 1P5VA 2UYLA 1M7DB 1C16A 4HUXB 1ITBB 2DKMA 2IQAB 4P46A 5DURD 3B9KA 4KKBD 5JOFB 3BRFA 5LQBL 4BH8A 2IAMB 3P4NB 2WW8A 1MJ7H 3FAXA 2J88L 3QZWG 4ZAKC 2J7LA 2W9DH 5CIPH 5EIVA 3NGBC 3IGAB 1L6ZA 1KN2L 1F4XH 3T8XB 5FO8B 4NRYA 2VLKA 5IB5A 4D9QD 3MLZH 3ULUH 2HJFB 4GKNA 2G9HB 4IOSD 3KDMA 4V1DE 1MHPL 1WWBX 3RY6C 2EYSA 3GSNA 2VLJD 3VXPB 2XN9D 5LAXB 3LRGA 3ROOB 3S9DB 1GL4B 1K6QL 2GTWA 1S7RA 2VSDA 3LKRB 2MCPL 5KVEH 3UZQA 4L9LC 1DANU 3CZFA 4MD4A 4PTUA 4GW5B 1JNLL 4LEOB 4OT1H 4GKSA 1JF1A 2YPLD 4EI6B 1HDMB 1YN7B 5IV2A 2W0FB 1ZVYA 3VH8A 1I3RB 1IGYA 1ACYH 1JFQH 5FO7A 1ZOXA 5TDPA 4P5TC 3HPJB 4HUUA 5HYQB 3VWKB 2YZ8A 5DHVA 4DZBB 3MCKA 1NMAL 3QUML 2NW2B 1OF2B 3IVKA 5IBTH 4GAGH 4OF3A 1EVTC 1HCFX 4YWGL 5D2LA 1CFBA 4X6BB 5HGDA 2X4SA 4M7LT 4JE4B 5C0NC 4QRQB 3ET9F 3IDJB 5GGSA 1FL3A 1F3DH 1MCIA 3HCVB 1CN4A 3RBGA 5C6WH 2XI9A 4LIQH 1WITA 1M7XA 4OJFH 1NSNL 1X6NA 4Y5XA 3VFSB 1TJHL 3CK0H 3QHFH 2AV1A 4JFXA 3QEQD 4PJ7F 2PR4L 3QDME 3X12B 3L5WA 4L9DA 2Z35B 3NPZB 4I2XB 5EO1B 5HHOE 2KQMA 4PV9B 2AVGA 1Z0NA 2SEBA 3NOIA 4QTIH 1PSKL 2VQ1B 4NJAL 5LGHL 4PRBB 5GJSL 1RVFL 4JCMA 1UM5H 1U8NA 3DUUB 1Z3GL 2DLTA 4WO4C 3TN0B 5LKNA 1FORL 2VXVL 4OCYL 1VADA 3FAWA 1UM6H 4MSWB 1IAIH 1A7NH 1A9EA 1XT5A 5IB4B 4U3XA 2X4PA 4LSTH 1JYNA 4YPGA 5D7LE 3U4AA 3LQAL 3T77B 3C6LD 4AL8L 3CPLA 4ZTPL 3FN0H 5DLMH 1RULL 2LQRA 3IDNB 2OBGA 4M61B 3QUXA 5TE4L 3D2UB 3U7YH 1IGTA 4F3FB 5DTFB 5H94A 4XBGA 5EOTB 4Z7WF 3MJ8B 4LCCC 3GSOA 4G7YL 4ELKA 3WSQH 1AI1L 1BVLB 4KTEL 5EIIA 4U49A 4MD0B 3K2MC 3L9RB 4I18B 4M03A 1I8LA 1N4XH 4K3GA 1MRDH 1T5XB 3RWFB 1I1FB 3S5LG 2NY3B 4PLNC 4ODBD 4W6WB 3W5NA 5E00B 1D6EA 1AJ7L 1MJ7L 4D8PB 5IB2A 3D25A 1T80A 2G2RB 2IWGA 2J8UE 2W9DL 2GJZA 2CUMA 4JFQA 5DJ0B 3MLPA 3AGVA 4JEGB 1F4XL 1OT1A 5IMMA 2F9BT 3MLZL 2EIDA 3ULUL 3PGDB 1OAYH 1M71B 5FCUL 3G5XB 4JRWA 4RWYH 5HDBE 5KBNC 5SWSE 4IOIB 1ZEAH 4G6FD 1NCTA 2FYYA 3SGEH 4NBXB 3CMGA 3MRPB 5KVEL 3VXMA 3CLEH 3FJTA 4HK3J 5FYKH 4OT1L 5F1KC 4QYOB 1XGPA 5ICZA 4JJ5B 4YFEA 3Q5OA 4LSUH 3EDFA 3Q6FA 5D5MB 5I73C 2R23A 3CMOH 1FSKC 1BZ7A 4GBXA 2H32A 2V9TA 3PWVA 3V52H 1ACYL 1JFQL 4YGVA 3I3EA 3H9SE 4P46D 3B9KD 1SYVB 1G9MC 4U1KA 3HE7B 5MEQB 1FCGA 4TUKH 4GAGL 5IBTL 4PGDA 3QQ9C 2NY1D 1U92B 1GC1C 3KPLA 2J8UA 1LK2A 3GSWB 3ULUE 1H5BB 2WBWB 5IFJB 1PQZA 4Y4FA 4KZEH 4PGCA 1BZ9A 4RMWA 5JA8B 1B88A 3S8WA 2VLKD 2EIZA 1QSEA 3GGWA 3O3DB 3SDAA 5LJYH 1CG9A 1MAKA 4M7JH 4PRNB 1Z2KA 3DIFA 4LIQL 4ZUVB 4OJFL 3MRRA 2QR0A 5SWSA 3CVIH 4CJ0A 4X6DE 2W60A 5CJOH 2HT4D 2CJUH 4QNPE 1HXMA 4FFVD 3VD4A 1A7BA 4PJGE 3P4MB 4WI8A 2QTEA 1BEYH 3EKCA 4OZFG 1FDLH 2BP3A 4QTIL 1EXUA 3BZ4A 4IJ3C 1Q72L 3TNNB 5A3IC 4NO5A 3PABA 5CHNA 3C87A 1OOAA 1UM5L 1HSAB 3GMNA 3IFOB 5H8DA 5CWSA 4PJ5E 5TQ2H 1FO0B 5B4MC 2H8PA 2HKFH 3PIQA 3FT4A 2NYYC 1I4FB 1UM6L 5CIPA 4EI5B 1A7NL 2I60H 4LSTL 3OG4B 5T3XH 4ETYA 1F4HA 1ZT7B 3QXTA 3FN0L 1II4E 5DLML 3C5ZB 3V0WH 1B0GB 3BAEH 3U7YL 3VDCA 1Q9OA 1LD9B 4N9GA 1U8JB 1WBXB 4LIQE 4P23C 32C2A 1HHGB 2XG4A 4WEMB 1CFVL 1MVFA 5I30H 1CIDA 3GO1H 4MQXD 4FTVE 1ORSA 3WHE1 3WSQL 4OTXL 5I8OH 5I8CB 2WAHA 4UMGA 2BHZA 3OXRB 4X6DA 1N4XL 5HD8D 1MRDL 1ZHKA 4I9WE 5I1LA 1G7PA 5GISH 1WEJH 3MV7B 4N0UB 1XGYH 2OYPA 3OPZL 4LLAA 1F6AB 2WSKA 4JZNA 4GG8A 5MI0B 5CJBA 2D7OA 5DJXB 4URTB 1QZ1A 4JVWA 5TPWH 1J05B 4DCQA 1V3MA 3MRNA 4PJ5A 2NY4D 2GSGA 2Q8AH 1ZGLA 3RKDD 1OAYL 5GRJH 1RJZA 4JFPB 4ONGH 1KEGH 3Q1SH 4RWYL 1ZEAL 1BFSA 3BEVB 1UH3A 4QF1B 3KYOA 4M62H 4U1SB 5DRNB 4ODUA 4FQXB 3ZTJH 1WT5C 3QUXD 1Z0MA 3CLEL 4PRDA 2AJZB 1NGYB 1LK3L 3JVGC 3EOAB 4CJ1A 1YA5A 5T3ZH 5E6IC 1IGCH 2E6QA 4LSUL 2Q7YA 4CW1A 1S9XA 3CMOL 2OMNA 3BD5A 3HI1B 5GRXG 4TNVK 4F7PB 3RKPA 1MCQA 1FE8H 4NQXA 3DSNA 1YY8B 3NAAH 4CVXA 4X99B 5EZOH 4OZGE 4TUKL 4Q7DA 2OJZL 3V6OC 4NZUH 4LK4A 2VR4A 2BMKB 3FCTA 1WWCA 3VXUB 3AB0B 4H0IA 1XGUA 3MRDB 4KZEL 1L6XA 1U8IA 3RAJH 1Z5LA 2QSVA 3WO4B 1NCWH 1KTKE 2R1YB 4K7FA 4M7JL 1EGJL 5I18L 5CSZB 4HIEA 3CVIL 5ANMB 1KCSH 1EEQA 5CJOL 4OFYA 3WHE0 3GMOA 2CJUL 1KIPA 3VXMD 1QFUH 1S7UB 5GS1C 4MCYB 5HI5D 4ZYKB 3BX7C 4D9RE 4LBEA 3Q6GH 2EEDA 3IF1A 4QY8B 3LN5A 4PJ9A 2BK8A 3U83A 4GBXD 2LU7A 3EO0A 2XZAH 4L3CA 1DSFH 5TQ2L 2OQJB 3UP1A 2HKFL 3EHBD 3LZFH 1LP9A 3EYFA 2ZUWA 4FXKB 2FBJH 1A4KA 1XR8A 4J23A 3LKSA 2K3TA 5T3XL 4RBPK 3RUGE 1CLYL 1RI8A 3PL6C 5CZKA 1ZMYA 3V0WL 1JV5B 4RMUA 3BAEL 2VQUA 5E6YA 4Y4FD 3OGOE 3MGOB 5F3HA 2ZNWA 4NPYB 3ZKSD 1QSED 1EAPB 3MLTB 4X7SH 3S4SG 3RWIA 1CXLA 3FB7A 2VXQH 5I30L 3GO1L 3KPPB 3O8XC 1UVQA 1YDPB 4HKJA 1Q0XH 3IB4A 4LMQE 3QHZH 3VXNA 1JF6A 2VB5A 4JO4H 1I1YB 1S7VB 5K59F 5D1ZC 5GISL 1WEJL 1YEEL 2OTUB 1XGYL 3VWJB 1UZ8A 4HLZH 4EN3A 5C0RH 4PG9B 4CMMB 4LSDA 4ZXBA 1LWRA 4G8IA 5TPWL 4QEGA 1GZPA 3MXWH 2Q8AL 4BH7A 5GRJL 5JIHA 3QDJE 4ONGL 5C0AE 1KEGL 4PRAB 4XP1H 4LLDA 1T1XB 2GY7B 3Q1SL 5E5RB 4L8BB 4DN3H 1KPRA 3MR9B 4GFTB 5DJ2A 1KLGA 1AQKH 3DV4B 3EBAA 4M62L 4H8WH 5F7NC 1EFQA 1I7RB 3C9NA 3B9AA 3OV6A 4RAHA 4X80H 5DA4A 5DD0H 5ESAB 3K80A 2BFVH 3V5KA 3VG9C 3RIAK 5T3ZL 5C0JB 3O6LL 3E1F1 1IGCL 4KUZH 4WUKL 1T4KA 3FRPG 4MWFA 5DQ9B 3BGMB 1FIGH 3L3GB 4GUPB 5GS0D 1CXEA 3FT3A 2DQFB 2IBZX 1FE8L 2HA1A 2YD1A 1QBMH 1YMME 1QEWA 3NAAL 1JGLL 5LCVH 4UIMA 2ATPA 4NZUL 5BZWA 2AJ3B 5C92A 3MNZA 2JKXA 5IQ9B 2DQEH 3BUYB 1DP0A 1AGDA 4ONFH 2YWYA 5EBWB 3RWEB 3RAJL 1YY9C 4PJ5D 5CS7A 3V5HB 5JIKA 1NCWL 2KL6A 4I48A 3MRGA 4LGRB 4J7RA 5TDNB 2M8XA 4NO2A 2H2SC 5HGBA 5FV1L 3UTPE 1KCSL 5T3ZE 2D0GA 3X17A 1U95B 3BN9D 1QFUL 1NCBH 2GK0A 3L3IA 1GOFA 2IH1A 3O9WA 3MJ9H 5CLWA 1T0MA 3CFBB 2A73A 2XWBB 3Q6GL 4UQ3A 2CGRH 1U36A 2VZ1A 3NZ8B 1BIHA 3MX0A 1CD8A 2N7AA 3PV7A 3UTSB 1PY4A 3C2SA 2YKLH 2XZAL 7FABH 3RWCA 3LZFL 1CGVA 4I9WD 1CFQA 5DS8A 1A14H 4XNYH 3HZKA 3LEXA 4JB9H 3MMEA 2LU3A 5C09E 3VCLA 1I85C 1YC7A 2HYMA 3M45A 4KDTA 2DB8A 5HI4D 1UJ3B 2NZ9C 4DK3A 3T0EA 3BZFB 4C54A 4YC2B 1PAMA 2XKNA 1H3GA 4MAUH 4X7SL 3BPLC 2RCSH 1LEKB 4N90E 1H3UA 1Q9WA 2VXQL 2QADD 3VGEA 4TNVF 3C5SB 1Q0XL 3KWWB 3QJHB 5FECA 4JQIH 3QHZL 2C7UA 4QTHB 3MRMB 4JO4L 4OFYD 5C0FA 1VENA 2HJLA 2FWOB 5IBLD 1NDMB 3KLHC 1MFCH 5EU6B 1LDSA 1ZTXH 3DXAE 3CFJB 4KRPB 5C0RL 1TZGH 5I74B 1SJXA 2HTKD 3RVXC 3VXOB 4K94C 1TETH 5F7MC 1CU4H 1CGYA 3R0MA 4PJ9D 2FEEL 2B4CC 1HKLH 2UVFA 1G9NL 3MXWL 5E03A 3FB8A 1FNHA 1ZT1B 4LCUB 2V2WB 5JXAH 5CILH 1CD9B 3V6ZA 3QFJE 4XP1L 3F65A 4DN3L 1KLFA 5BS0E 4FXGB 5DYOA 1DVFD 2NR6C 1AQKL 3C08H 5J89A 4H8WL 2AABL 3OKOA 4K7PY 1Y0LA 4AEEA 3DO3A 4X80L 5DD0L 1HHIB 3I6KB 2MFNA 4HS6B 4ZFGH 3C8KA 1QYGH 3BJLA 4KUZL 1INDL 3LKOA 2V2TA 1X5KA 4RGOH 1FIGL 5FYKD 2BNRA 4JY4A 3P9MB 4LCYB 4LHUA 4DGIH 1QBML 1AGBA 2X7LB 4J3VA 5GSRA 5LCVL 4EKXA 5J06A 4EN3D 2HN7A 4ZXBD 3ARDB 4ONFL 5D2NA 1ZHBB 4O2FB 4Q9QL 3RY5A 3DPBA 2F53A 2AEQL 1LO5A 4L4VA 4ZDHA 4HJ0D 4ELME 3WXVH 5FB8A 1S9KC 4QGTA 4YX2H 4NC2B 1T21A 3MLWH 2W59A 3P77A 2Y7QB 4HKXA 3HS0B 4H25B 5IROC 2K1MA 4N5EC 2ICEA 3RDTA 2YEZA 1NCBL 5KN5A 4K71C 3MJ9L 1D5MA 5TF0A 3KLAA 3ZE1F 1V3KA 2DAVA 4OGZA 2DJ4A 4Q9BA 4MNQE 5D6DA 3DURA 1KUMA 2BNUB 4LKCA 5ITFA 3VW3H 2OXHA 2YKLL 1IC1A 5CGMA 4YHNA 4R2GB 7FABL 2WV3A 4FMFA 5GQBA 2NTFA 4AK1A 3TN0C 1A14L 4XNYL 5MP6H 3MBEB 4GRLC 1S9WB 3T4AA 1HYSD 1QPPA 1FFNB 4L8SB 3D39E 3HNTH 4NQDE 4AYFA 3MOQA 3FO1B 3T1FB 5C08E 1Z9MA 2RFXA 3UBXG 4Y7MA 1DQJB 4KFZC 3RIAF 5T3XD 1HILB 2VLMD 4MAUL 4NKMA 2RCSL 5HHME 2EC9T 5ACMA 3ILPA 5C07A 3SDYH 1MHEB 1PZUB 4HMCA 4MDIA 4JQIL 4IDLA 2DIJA 4JHWL 3AM8C 5IFHH 3I6GB 5KSUB 1R5VB 2QEJA 4I18C 5FDWA 3CVHL 1MFCL 1AO7B 2ZUVA 2NY3C 1NL0H 1OD7A 1ZTXL 1QR1A 1KULA 1LDPH 1D6VH 4NOFA 1TETL 4R96A 3LKNA 1CU4L 4LSQH 1WJ3A 1WV7T 3IAQA 4MNQA 1HKLL 3QO0B 2ESVA 2D31A 1RD6A 4KJYB 2CRZA 5JXAL 5CILL 5FGCE 1F11B 4KTYA 3QEGH 4MA7H 4PTTB 1HH9B 1X5IA 3RWHB 1NLBL 3GEWB 4NQDA 5IESL 5C6TH 4DVBB 1V5JA 2AXGA 3ZKXB 5B8CB 3WL9A 3T0ED 5IIEA 3FB6B 5D93C 1U93B 3W9EB 4ZFGL 1W72H 1QYGL 2VZSA 2C9AA 2V7HA 4XX1E 3F5WA 2QQKL 1C7TA 4XBPA 4RGOL 3HN3A 1A3LH 5FHBL 3TO2B 2P8LB 1LE5A 3S97C 2BC4A 5ESVA 3OMZA 1SJHA 4DGIL 1R3HB 4P2YA 1BQHB 4QHLB 4U1NA 4PJFA 2A83B 4HPYH 1FYHB 1JPFB 3MRJA 4LSSH 3HE7C 4RMRA 2F74A 5DRWB 5FYLH 3GUTA 1MELA 1S7TA 3VFRA 5SX5K 4S1QH 2D4DA 2DYPB 3SEPA 4BA8A 5C9KA 1MCWW 4QRRB 2F8VA 4NZDA 5IMOB 2OR9H 3BPOC 2QQNL 3WXVL 2X9XA 2C26A 1BIIA 3WXWH 4YX2L 3PE9A 3OB8A 5D6CB 4HS8H 4Y2OA 4K3EH 2ZUTA 3E6HB 4X6CB 5E8NA 5F8RC 1BZQK 2AW2A 3MCLH 5EU5A 4Z7NF 2VISB 3PHSA 4KXZH 1IQDB 1T03H 5C0CE 5IMLB 4XXCA 4F7MB 3AS0A 2BXYA 3HAEA 1HXYB 2J8HA 2YUZA 4AT6A 3WJLA 5I8EA 4ODXB 4XCEB 2R2HB 2H3NA 2BNRD 2CKBB 1CXKA 4NFCA 5MP6L 1CVRA 5DQJB 3S35X 1H8OA 1T66C 1ZVSA 4IHOA 5IKCA 1TZHA 4KJPD 5I1JL 1WC7A 4MJ6A 3AMLA 3RPIB 5E2WH 2F53D 4MQ7B 1BGXH 4GG6B 2YWZA 1CICA 4L4VD 4G9DA 3G04B 4JG1H 4Q97A 4I5BA 3CUPA 3SDYL 1JWMB 4ORGB 1DQMH 2MOVA 4M8QB 3U36A 2C3XA 1BFOA 4IIQA 1FG2A 2FO1A 1FGNH 3R1GH 5D1XA 5IFHL 4ERSH 1QUNA 3RDTD 2E7CA 3CDYA 2FBOJ 4KC3B 2JJSC 4GW1A 3HPLA 1KJVB 5JLZA 1NL0L 3KXFA 4LDLB 5E2JA 3RX5A 4GH7B 4M6MH 1LDPL 3OAYH 4NBYB 1D6VL 5B3JF 1DLHB 5MI0C 5EPMA 4NKOB 5F1NB 1A6TB 4TSCH 1B3JA 1RU9H 4FN0A 3U7WH 3MV01 4NT6A 1G9MH 2X1PA 2K9UA 4PJHF 5B39B 3CZJA 4Y5VB 1CFTA 4UUJA 3QEGL 4JLRB 2VL5B 4MA7L 1HZHH 2E27H 1OP5K 1GC1H 4O51B 4Z7OE 1JYVA 4EUPH 5C6TL 1KACB 3IKCA 1KOAA 3MYZA 3VXTB 4U7MA 1T7XA 1U8PA 4FQXC 1Z6JT 1TVBB 4MAYA 4RWHA 4X6FB 1W72L 1Q1JH 4AIZA 4TUJB 4HGWA 4LCIH 5C07D 4U1JB 5IJVA 3LRSB 3HZVB 3O0RH 3MLRH 4PGBB 1CDGA 4I0PA 1QA9A 4HPYL 3CFCH 4HAFA 2BHYA 1INQB 1S9VA 4LSSL 2F5BH 3VFNA 1RZGB 5FYLL 4HUVB 2YK1H 2I07A 2ZG2A 3AXLB 1PX3A 1KIRA 4S1QL 5L0QB 1QQDB 3NIDE 1U8KA 2ESVD 3AB0C 2QSTA 4DGYH 2X44D 4S2SA 1LMKA 4ZAKA 4BYHA 3TGXA 4JQXA 3MNWA 5D7IE 3WO4C 3WXWL 4NSKA 4HS8L 2ZCKH 2IH3B 4N8CH 3JWNC 3S37H 3S3PA 3KPRA 1QRNE 4NQDD 3QUKA 3KPQB 3MCLL 2EDQA 3GHBH 3QDGE 4MJ5B 5CEYA 5H35B 3TCLA 3RY6A 1T03L 2AEIT 3IDXH 4Z76A 5I1GL 4R0LB 4WJ5A 1NFDA 5DJAB 4IRSC 3HC0A 4JRXE 2BY0A 1RHHB 1I7ZA 4Y19E 4UT6H 3TBTA 2UZXB 3ROLA 3TO4C 3C8DA 3GNML 4L9LA 4RIRA 1DUZB 1BBJA 3QUYC 1A6ZB 4PBVC 5SV4A 4XMLL 1E0OB 5FYLE 3O6MH 4NDMB 5F72S 1MWAB 1A6AA 3GSXA 4P5TA 1P84J 5L2KA 3Q5TA 5HGHB 3EYQC 1QLFA 1EJ6A 5E2WL 3DGCR 1FCCA 2VERN 4PJCB 2V9QA 1BGXL 1IAMA 5DT1H 3JZ7A 4JG1L 3TBWA 1DQML 2I26N 2D03H 1K4DB 2XRAH 3GIZH 1FVEB 1FGNL 3R1GL 4JZOB 1JI2A 4ERSL 1UQSB 3DNKA 4NRXB 1G7LB 3CJJA 3AUVA 4X5WA 4QHUA 2MMXA 4TN9A 1CDCA 1A1NA 1Q0YL 2OK0H 4JFHE 4AQOA 4M6ML 3BVNB 3RNKB 3VWJC 4FG6D 4S10A 4Y19A 4L4TE 3OKDA 1RJYB 3SDXA 1NGQH 4TSCL 4CDGC 1RU9L 4R7DA 3STLA 1N6VA 3LN4B 2UYLB 3U7WL 1C16B 3CGTA 3K4DA 3HB3D 1G9ML 4LVOB 3O3AB 1R3LB 4GAJH 4PJBE 3SKNB 4AM0A 4PREB 2FATH 4M6NL 1WIPA 4BH8B 5T1KA 4RCAA 1HZHL 2E27L 5JQ6L 3FO2A 4OZFH 3T09A 3L95A 4WO4A 4XPBH 4NQVA 1NEZG 4E41B 5C0BB 1C08A 1OTTC 2VLKB 1Y18B 4M5ZH 3MLSH 5IB5B 1UENA 1UKQA 4LOUC 1Q1JL 1CICD 3KDMB 3MROB 1QHOA 2EYSB 3FN3A 1MUJA 3GI8H 3JTTB 5IVNA 3O0RL 3MLRL 2DLEA 2G60H 5D1XD 3QXVA 4U3CA 5BV7B 2BDNH 3BIKB 4LCCA 4YHPB 3ULVH 5HHVH 4KI5D 3KXFD 2FR4A 2F5BL 2YK1L 3MOBH 4S1RH 3KLDA 1UT9A 5F1IB 5DVLA 4L8CA 5IV2B 3GJFB 2VTFA 1MREH 3VH8B 1IGYB 2O26U 2ZSWA 4ZO6A 2BSSB 4HUUB 4KK8C 2H41A 3FQWB 5KJRH 5I16B 4JPKH 4YDIH 3VFTA 3VD5A 2ZCKL 5GGVH 4N8CL 3L3JA 2A6KB 2DWEB 3MRQA 5GRWA 3S37L 1D5IH 3IAPA 3CX2A 5HGDB 3GHBL 3CFEA 4WW1B 5C2UB 4AIXA 3UTTE 3BKYH 5GGQH 2CDEB 3BOVA 1A4JA 1NBZA 4YGAB 2WNGA 4OF5A 5IVZB 1XCTA 3QIWC 3PP3H 5GGSB 1FL3B 4MD5A 1QSFA 4UT6L 3K81A 4V1DB 1QFHA 5IB1A 3BP5A 5C3LD 4CU6A 1UEMA 4Z8FH 4Y5XB 1RY7B 2JB6B 4I0PD 3O6ML 5F7EH 3VGAB 4NQEE 3GDBA 1W2KT 1P7QD 4P48A 5TE7H 1G7QA 4UB0H 2SEBB 5DJ8A 2JF1A 4JKMA 4IS6A 2JCCE 4KKCC 5E7BA 2IBBA 1U8NB 5EN2A 4HIJB 1UJ3C 4ZAKD 4YC2C 5DT1L 4EUPA 1A9EB 5ACLA 1CTOA 1QSZA 2D03L 2DQHH 3PHOB 2XRAL 4KUCD 3GIZL 1KPVA 3KPRD 3OR6A 3CPLB 1RJLB 5HGGS 3E8UH 4DKDC 2OK0L 1TVHB 1V7NH 1IGTB 4U1IB 4YK4B 3L3KB 4KRPC 5BJTA 5I74C 2IFGA 1CE1H 1IGIH 2H9GA 2A0LC 5I19H 3S96A 3VA2C 4MZ3A 4EQ3A 4GAJL 4OZIE 3QDMB 3GMLA 2FATL 1GVIA 3D69B 5HHOB 4NIKB 2ADJA 3D25B 3CFKA 1Q38A 3P4OA 2GJZB 4P5TD 4XPBL 5L2KD 2FH6A 4HDIA 4JFQB 4ZFOL 3QUMB 5E9DE 1TTGA 1TJIH 3MLSL 4M5ZL 4Z6AT 5IMMB 1XR9B 3BDBA 4MA3A 5HY9B 1RUPH 1SEBA 1YPZA 3GI8L 4Z7VF 3IXAB 4E42B 5C0ND 3WEXB 3FOMA 2G60L 4JFDA 5D7LB 3MXVH 4P23A 4XCCH 4FQ1L 3VXMB 2BDNL 5T33H 3ZDXF 3ULVL 4U7SA 5HHVL 1I8MA 3HR5A 5ICZB 4S1RL 3Q6FB 2X42A 1ZANH 4O2EA 4RNRA 5KSVB 3GSRA 1MREL 3ARDC 1BZ7B 2H32B 4CDHA 3P73B 4FZEH 5HDQL 1HQRA 25C8H 2Z91A 3VXSA 5DEZA 5KJRL 1FP5A 4JPKL 4YDIL 3WIFB 5T1KD 4GJTB 4YHIA 5IR1A 5GGVL 3ZKQD 1D5IL 4KJWC 4NNPL 4QRTB 3KPLB 2J8UB 4WO4D 3WN5B 5GJTH 4U0RB 3MUGA 4X98B 4L29A 3BKYL 5GGQL 2V17L 2V5YA 3K4ZA 5E9DA 5DDHA 3FONB 1FBIH 1RUQL 1BZ9B 1T22A 3KLSA 4PGCB 1PGRB 4HK0B 3MV9E 35C8H 3HZYA 3SDAB 1A1OB 3BISA 1CG9B 1V7MH 5FCSH 1WT5A 3I50H 4Y5YB 4P9HC 4LSVH 3I75B 3ULVE 4JO1H 3JVGA 1N8ZA 4Z8FL 5SWSB 5E6IA 1T83C 5F7EL 3VRIA 4R2GC 4U6XA 1G7IA 4N8VB 5TE7L 4UB0L 4JFHD 3V6BR 4GRMA 3FT2A 5BRZD 3WDJA 2A6JB 5EZJB 4L8SC 4P0DA 3B43A 4NO5B 5CHNB 1X4XA 3VFWA 4D0CA 1ROWA 5JHDA 3V6OA 3G6JA 3I02A 3REVA 3H9SB 3DX7A 3ARZA 3PIQB 1CK0H 3OKMB 1K8DB 3QR2A 5CIPB 3KR3H 4U1HB 2DQHL 4DWHA 4G9FA 3LMJH 1J8HA 2MQCA 4UQ2B 2VWEC 4U1MA 2MKLC 2DRUA 5ETUA 3E8UL 1UH4A 1Q9OB 1J86A 4JRYD 4UAOB 3C8HA 2Y72A 3T2NL 4HWUA 4M93B 1FC2D 4P2RD 2AJVH 1A6WH 1UWXH 4XPHH 1QSFD 3L5XH 3HZMA 2OTWA 5GS1A 1IGIL 4MCZA 1QFWI 3V8OA 4J8RA 4X6DB 5I19L 5AYUH 3AC0A 3FHAA 5I1LB 1G7PB 2EYRA 4J6RH 2VH5H 4PJGB 3RPKA 3SJVE 4JZNB 1MLCA 2P8PB 4MZ2A 2P4AB 5INDA 2W92A 1OSZA 4G6AC 3X3FH 1NAMH 1YNKH 3L1OH 2R2EA 3OTTA 4JFFE 5IF0B 4DCQB 3ZKXC 3QQ9D 5B8CC 1TJIL 5MENE 3GMPB 2PTUA 4OF6A 4PJ5B 3PL6A 3WHXA 1JHKH 1RUPL 5A2JH 1RJZB 5DZLA 4ZODA 2X4TB 5DD1H 2E7HA 3JSSA 3KPOA 3MV8A 3MXVL 3MJ6A 4XCCL 5D2LF 3RJQB 4HKBA 1MCPH 3VXRE 5T33L 1BVKA 3UYOD 3NCYS 3O8XA 3WUWA 4M1GH 4UINL 3ARFB 2C3VA 1BMGA 2YD2A 4CW1B 5D1ZA 1ZANL 4J2XA 4LAJH 2AQ3A 1MCOH 3QEHA 4FTVB 2DLGA 1QRKA 4FZEL 2VJXA 1H15A 1C5DA 25C8L 4J12A 2ADGA 4GQ9H 5A3ID 3MRCA 4CVXB 4JY5H 4P4KC 3SJVA 3JWOC 2DQUH 1KCRH 2CO6B 4OFVA 1CD1A 5B4MD 5GJTL 2NYYD 2PW1A 1XGUB 2QHRH 1FBIL 1Z9OA 3TP4A 5B3NA 4CAGA 4I3GA 4XCYA 1Z5LB 5KS9E 1K9TA 5MENA 1A2YA 1LVEA 2F58H 1VFUA 1V7ML 1KENH 3KS0J 4PJAE 4LSVL 4JO1L 4TNWK 4JFDD 2FNBA 4P23D 3PDGA 5CBEA 1FAKT 1UCBH 5EZLA 4WEUD 4LAQH 4QRUA 3IF1B 3MC0A 3PUCA 3P2TA 1NFIA 3LN5B 3ZL4H 1N7ML 4PJ9B 5E08H 3HI5H 2XNAA 3S98A 5FA3A 5HYJE 2IQ9H 3EO0B 4L3CB 1PKQA 3PV6B 1FZJB 3VXSD 3EYFB 1C1EL 4NWTL 5TH2B 3KR3L 1XR8B 3NFPB 5IVXA 4Q9CA 1YEGH 1HH6A 3G6DH 5BW7C 4X5LA 3SE9H 1P7KB 1P69B 1S8DA 5E9DD 3WFHB 1E4WH 1ZWIA 4FFZH 2HRPH 1CGSH 2AJVL 1A6WL 3RWIB 1UEYA 4XPHL 3DX6A 3L5XL 5SX4H 1BF8A 2WMPA 3ZZ1A 1JIBA 4R4NC 1G7MA 5FGRA 3I9GH 3VXNB 4OCRH 1LO0H 3B9VA 4DZ8B 4XBEL 5AYUL 3G6AB 5E6ID 4J6RL 2VH5L 3QRGH 5A2KH 1WK0A 4Y5VC 1AR1C 1P9MC 1UZ8B 3QHTC 1RZFH 4BFBD 1CXHA 3O4LE 1BHGA 4ZXBB 5DXWA 3X3FL 1NAML 1YNKL 3L1OL 3NIGE 1HSBB 1X5HA 1JMZA 1BFVL 5JHDD 1GZPB 3L3OB 4F7EB 5C0EA 5HYJA 2FIKB 2CO7B 1CTNA 1I85A 4HXAH 4RX4A 2GW5A 4I8DA 5E4EB 1BLNB 4FFYH 2NNAA 2C5DC 1SBBA 5DD1L 3ES6A 2X4UA 4G9FD 1XMWA 1J8HD 5DJ2B 3PWUB 3EJZC 5DJYA 2VAAB 3HRZA 4NKIH 1MCPL 1IZJA 1MCDA 1AC0A 2J8UF 2Y07H 1UA6H 1NAKH 5D70H 3WIHL 4M1GL 3V5KB 2YD5A 1G7HA 4Y2DB 1KPUB 5HVWA 3P30H 4LPVA 1M7DA 4XWOC 4ODWA 3UZEA 1MCOL 2IQAA 2P24B 1FHGA 5JOFA 4QHKI 3T2QA 4HSQA 2KUTA 5L0QC 1QLEH 3BUTA 3P4NA 2ZOKB 5HDBF 3G08B 1VHPA 3PP4H 4LPXA 1QEWB 4JY5L 4M4PA 4ZOEA 2ATPB 4ZUUB 1GGYA 2A2QT 4ODSH 2PTTA 5BZWB 2DQUL 3LVEA 3T8XA 5FO8A 3DI2B 4G42A 5DMJB 2PYEE 3QQ4A 1RUKL 4B0MM 1RZ8B 2QHRL 2FX7H 4I48B 4JY6A 4R0LC 3PL6D 2Z31B 5GRUH 5IOPB 1KENL 4Y1AE 4O5LH 3VXPA 4NGHH 3MRGB 3QDJB 3NCEB 5LAXA 4Z5RA 4E9LA 2IADB 3ROOA 4HBQA 2NY6D 5HGBB 3LKRA 3MV8D 4U2YA 5EU7E 4GW5A 1UCBL 4LEOA 2GK0B 1J12A 5L7XH 3L3IB 3O8XD 2IH1B 3O9WB 4LAQL 4EI6A 1HDMA 1YN7A 2W0FA 4UQ3B 4JFYA 3E3QE 3MA9L 3ZL4L 5CJQH 2VXUH 5D1ZD 5E08L 3K8MA 3TLRA 3HPJA 1IE5A 3HI5L 4DZBA 2NW2A 2IQ9L 3WFCH 1OF2A 2ITDB 3RWCB 5GRYA 1CFQB 1P4LB 2E8ZA 5DS8B 5FEBA 3LEXB 1YMMB 4X6DF 1IAKA 1NAMA 1EPFA 5TE6H 3X14B 1YEGL 4UNTA 3SJVD 3OJ2C 3EDJA 3VCLB 3X3GH 3TH2T 3G6DL 2XXCB 1MFEH 4KAQH 3SE9L 4QRQA 2PYEA 3OKEA 3T0EB 1JK8A 4G5ZL 4KDVA 4FFZL 2YA1A 1TITA 2HRPL 2XKNB 3LKQA 5MEND 1GYAA 4AJ0A 1CGSL 3V0VB 5AZEL 4XPAH 3TPKA 1XF2A 1AKJB 5EOQH 5FECB 1MQ8A 5LG1A 5D8JH 3I9GL 4OCRL 1LO0L 1XGTA 2Z35A 4I2XA 5C0FB 1EFXB 2HJLB 3IKKA 1PG7X 4DVRH 3MLVH 5ACZB 3QRGL 4LVOC 4PJEA 5I9QB 1AGEA 5GGTA 2VQ1A 4OM1H 4PRBA 1RZFL 3B5HA 2VKWA 4XVTH 3DUUA 1FPTH 4PB0H 3TN0A 5HYSB 3B3IB 4GRLA 1CGTA 1K3ZA 3LPFA 4FQ2H 4HBCH 3FB8B 4HH9B 3WS3B 5IB4A 1F2QA 2D9CA 4FA8A 5BVPH 5EO0A 3CXHK 3T77A 3V6ZB 2B8OT 1YEKH 4TNWF 3IDNA 5DYOB 5FF6A 3KPNB 1YY9D 2CDGA 4JN2A 1UM4H 4XVUC 3IFPB 4XP9H 3OKOB 4F3FA 2Y07L 5DTFA 1NH6A 1NAKL 3MJ8A 5D70L 4AH2A 2H2SD 1L0XA 3NH7H 5L8LB 5KOMC 1J8KA 3OX8A 3AM8A 2CLRB 3L9RA 3P30L 3LKOB 4I18A 1K4CA 2V2TB 1TTFA 4P2CG 5DEFA 3WS6C 5FKAB 1Y6MR 3RP1A 4LHUB 1QLEL 5E00A 1QD0A 3QPXH 4CNIA 1TQCB 2FECL 3PP4L 4D8PA 1I8IB 2G2RA 2GSIB 4AIOA 5DFWH 5DJ0A 3HI6H 4ODSL 1JF5A 4TSAL 1TVDA 1F3RB 3LSOA 3OG6B 3HA0A 5C86A 2FX7L 4WTZG 1M71A 2F53B 2NXZB 5B38A 2A6DA 4RX4D 4ZDHB 5GRUL 5A16A 3QG7L 4EIGB 4O5LL 5FB8B 4IOIA 4NGHL 1YQVH 4H5SA 3QFJB 1LP9F 3P77B 2NZ9D 4JHBA 3MRPA 5BS0B 3ALWA 3N06B 2EDHA 2ICEB 2X4QA 4OIIL 2YEZB 2OR8A 3SGKC 4QYOA 5L7XL 2APXA 4XPTL 4ZUWB 3VGAC 5J12B 5D5MA 3KLAB 2X10A 3WNLA 3L5HA 4KZDH 1WBYB 2EDRA 2VXUL 4QRPE 4X4ZA 5CJQL 4LKXB 4JQVC 3K1DA 4M48H 3KLHD 5ITFB 3MOAL 4FQCH 2OS7A 2ED9A 3WFCL 5MEQA 4YHNB 1KEMH 2NTFB 3RNQA 3RVXD 4DKEH 3K7UA 1U92A 1KLUB 2WIIB 3GSWA 5TE6L 2OZ4H 5IFJA 3RVWC 1BWWA 3X3GL 3RVTC 4FQQA 4KAQL 4U05A 3O3DA 4H1LG 4WHCA 4PP2A 4PRNA 1DJSA 4NKMB 3T3PF 2NR6D 1E4JA 4D2NA 4ZUVA 1AP2B 4NC0B 5BOPA 4XPAL 5C07B 4OGYH 3M8OH 4NUJA 4YK4C 2XKSA 5EOQL 4MDIB 3UYRH 5D8JL 2XIDA 5T5FH 2R8SL 4XMPH 5K33A 3P4MA 4WTXA 3ARBB 3BSZH 4UDTA 3MLVL 2QV2A 2CUHA 3BD3A 4DVRL 3BDYH 4DFIA 1RUMH 1NDGB 2LE9A 4OM1L 1QR1B 3H9HA 2B7DT 1CXFA 4MB3A 1IC4L 4HT1H 1FPTL 3RWGB 4MNQB 4LLQA 1FO0A 4LCWE 1I4FA 2D31B 4FQ2L 4HBCL 3RJDA 1QFOA 2HFTA 1IT9L 5BVPL 2FX8H 1ORQB 4G8GE 1ZT7A 1YEKL 2JJUA 3W5MA 3LD8B 1NQBA 3M07A 3FFCA 1CCZA 4PJIE 3D39B 4NQDB 2R0LH 4BKLA 1U8JA 1UM4L 5C08B 2AXGB 4XP9L 2R0KH 4WHDA 1WIUA 4AEHL 2EXYC 1HHGA 2FJHA 2ZUYA 3PGFH 2FLBT 3NH7L 5F88A 4POZC 4N5ED 5HHMB 4XBPB 2J12B 2XQYK 2JJSA 1LE5B 2DDQH 4NM4H 3OAUH 5CCKH 4F2MA 3EIFA 5ESVB 1SJHB 3G5YA 1F6AA 1HYRC 4U1NB 5INCB 3UDWC 3MRLA 4XNZB 2YA0A 3PF2A 4X0KB 3OAZK 4JFEE 1BQUA 3HI6L 1H9VA 2F74B 3GUTB 4YHMH 1J05A 4PJ8C 4X4YA 5I1AA 1KCVL 3TN0D 3WN5C 4GRLD 4LCWA 4FABH 4OB5H 1OQXA 4X8JB 2ZUQC 3N0PB 4JFPA 4IOFC 3CFIC 5MERB 3JBG7 3L5IA 1MIMH 2ARWA 4ZOAA 5FGCB 2WBKA 1YQVL 3SDAC 3LQAC 4QF1A 4L5FH 4KGJA 5DRNA 4FQXA 3SGDI 3D2UD 4PJIA 3UPCA 2ICWJ 4Y5YC 5EU5B 2AJZA 3CNKA 4C4KO 3EOAA 1HNGA 1XEDA 1NC4A 4KZDL 4UT7H 1N3NB 3HI1A 1IARB 4UIKH 3FQXA 2V5RA 4M48L 1T04B 1CYGA 4FQCL 4P2QA 2NY3D 1YY8A 3ZE0E 5BVJA 4I4WB 1KEML 2J6EH 4IMLB 2YXFA 4DKEL 2JELH 4HFWB 4FS0A 1QBLH 2CK0H 2Q76A 1F6FB 1VEPA 3H7BB 2OZ4L 4MJ4A 5IKCB 2DWDB 1WC7B 4OI9A 3OB0K 4L3EE 2ZJSH 4RGNE 4MJ6B 4TVPH 3MO1B 5C8JB 1X9QA 3ULUC 3SO3B 4J4PC 4NUGH 5EG6C 1CICB 4G9DB 4UAOC 4E5XB 5T1LA 4M93C 3AU1B 4I5BB 4OGYL 4P5MA 4HUNB 3U36B 4IIQB 3HUJE 4NRZA 3UYRL 4G3YH 5T5FL 1S7UA 3W0WA 4XMPL 4MCYA 1SEQH 2CRIA 1JGUL 5D1XB 4IRSA 3BSZL 1J1PH 4GW1B 3BDYL 5C0CB 4NWUL 3HPLB 3TO4A 1RUML 3QUYA 3LPWA 5C71A 5F7FA 2YC1B 4OBSA 4X9BA 4C56E 4HT1L 2ICWI 2JK5B 4XNXH 3UEZA 4FXKA 2EDDA 4NT6B 4GLRI 4UUJB 2BVUA 2YRZA 2ED7A 1JV5A 4G7VH 5DF0A 4NPYA 2GY5A 1EAPA 3PGFL 4MAYB 3DI3B 5CD3B 3ZSTA 1YDPA 4AIZB 4POYA 3ARFC 5EOCJ 3EYVB 2IALA 4W6XB 4P9HH 5IJVB 4M5YH 1I1YA 1S7VA 4ZPTA 2DDQL 4NM4L 3OAUL 4M6OH 3U1SL 5CCKL 3ORJA 2OTUA 3O3EB 1MCKA 3KPSE 4I0PB 4WHYG 1S5IH 5CGYC 1NCCH 1WZMA 3K0WA 1S9VB 1JGEB 3KJ4B 5J4MA 2GITB 3VFNB 4GMTH 4YHML 3T0DA 3HE6A 4XVJH 5F1OB 5JHLH 2I07B 3QRFM 4KQ3H 5CMAA 5CFHA 1I3UA 3SGJC 3MQIA 4HMEA 4OB5L 1OLZA 1T66D 4UI2A 1RPQA 1T1XA 4S2SB 2OZ4A 4L8BA 3T3MF 1MIML 3MR9A 3VI3E 3NGBB 4WVRA 4L5FL 4MXQC 4NSKB 1RIHH 5J56B 4KK9C 3MTRA 3WKNA 1I7RA 3FFCD 4NCDA 4R4FH 4Q9RH 3QUKB 1DUYA 3T04D 4NNXA 3S36H 5ESAA 5J57B 3VDAA 5CLTA 1VACB 5TFSH 2WINA 3IDIA 5FM8A 4WV1B 4Y4KB 5DQ9A 4UT7L 1TQBC 3B8SA 5FK9A 3BGMA 1T1ZB 4OFKA 4UIKL 3ROLB 12E8L 5J6GA 2DQFA 1BBJB 4I3RH 1IQWH 4M3KB 3GK8H 2CH8A 3V7AG 1IJ9A 4K23H 4ODHH 4QOKA 1NUFA 4PY7B 2JELL 3NA4A 3O2DH 2AV7A 1TDQA 3N85H 2AJ3A 2CK0L 4NYLB 1MVUA 3GSXB 5IQ9A 1ZA6B 3LCYA 3BUYA 4Q58C 3BT2H 5EBWA 1GCFA 2ZJSL 1I7TA 1WAAE 4TVPL 5B22A 5GGSY 5CD5C 5CP7B 4OF8A 5D7IB 4OFDA 3TBWB 3GSUB 4UZGA 4FQXD 1U95A 4G3YL 5EZIH 1SEQL 1QRNB 3VFUA 3NA9H 3QIWA 4Q2ZB 3QDGB 1UYWH 1W72B 1J1PL 2FSEA 3CFBA 4QHUB 2XWBA 2X1OA 1NC4D 1A1NB 3NZ8A 4FNLH 4RAVB 3BZEA 3UTSA 4JRXB 4NCC2 4Y19B 1MPAL 1CXIA 3STLB 4Z7QE 4XNXL 4P2QD 5IP4A 5KVMC 3DO7A 1W0WB 2EE9A 4GXUN 4NM8H 4OUUB 3DX9A 1IGFH 3SO5A 5ERWB 4AM0B 4MA8H 2ZOLB 5T1KB 1F8TH 1K2DA 2HLAB 2KH2B 4YXKH 4TVPE 4PJFF 1ZV5A 5E4EC 3FO2B 1RZKH 3VXUD 1S5HB 1UJ3A 4WO4B 5E70A 4ZFFB 4G7VL 2VZUA 2YS4A 1EHAA 4X4MA 2J4WH 1WAAA 2Z8VC 2NPLX 4OGAC 1NGWB 3C09C 3KWWA 5CSBA 3QJHA 5T1LD 1FN4B 1CGUA 3DTXB 4QTHA 4LQ1A 3MRMA 1T2XA 3ARWA 4M5YL 4P9HL 5E8DH 2XFXA 4Y2DC 1AE6H 2FWOA 4M6OL 2F8XC 5F44A 1NDMA 2X4NB 4XCNA 5J3HC 3W0WD 2YPKA 4Y88A 3K3QA 4QHNA 2BVYA 4IRSD 4WI7A 3ARTA 4LCCB 4AMKH 1NCCL 3TO4D 1B0RB 4G8FB 1EEUA 3VXOA 3QUYD 3RL2B 2FR4B 4P9MH 1A6PA 4GMTL 4XVJL 4G6KL 4KQ3L 4OLUH 2J6EA 4L4TB 1ZT1A 2PO6B 3CDGB 4KHXL 2V2WA 4XTRC 1ZLUK 4U1GC 2XA3A 4KK6C 4N0RA 5T5NF 3DRQB 2EDLA 4FXGA 4ISVA 3VFTB 4BQCA 2Z31C 3BH8B 5D72H 1RIHL 3KYNA 1MFDH 3EYQD 3MJGX 4R4FL 3L3JB 5I0DA 2ZCLL 3MRQB 4DEPB 1CDYA 3MSPA 3N9GH 4LFHG 2VLRA 5JDJA 3S36L 5D7JB 1HHIA 5F9AC 2QKIA 5TFSL 1A4JB 2MQ0A 5DC4B 4X8XA 1YECL 3IRPX 1AY1H 1XCTB 3KPMA 3O9WC 2FH8A 4FP8H 4JO2H 4DQOH 5JW4Q 3P9MA 4LCYA 5DJ6B 1TJGH 4I3RL 1IQWL 3GK8L 2BCKA 2X1QA 4PRPE 2X7LA 2HJKA 4E0RA 4K23L 3HC3H 4ODHL 3TNMB 1AXSB 3O2DL 1GIGH 3N85L 5MHSE 1FYTE 1FSKB 3ARDA 2ARJA 3WLWC 1U3ZA 3FQRA 5BZDB 1MCCA 4O2FA 3BT2L 4KI5F 1H3TA 5DJ8B 5DHYB 3S34H 5E24E 2IPKA 5EN2B 5IGXH 5MEPB 4P3CH 1S7SB 3FB5B 4EUPB 3HS0A 4JPIA 2NLJB 4M7LH 5DMIH 1DN0B 5A43C 1JWUB 1OTTD 3B5TA 2W9LA 3CX5K 1KPVB 3OAYK 5EZIL 4LOUD 1UYWL 4JGJA 2EO1A 4FNLL 4G6JL 4GMSL 2V5SA 2BNUA 5I9QC 2E3VA 4GSDH 4X83A 2R4RH 4KMTH 3TYGH 5HJ3A 3U46B 5CBAA 4NQSB 3C2AH 4BELD 4KRLB 2OSLB 4NM8L 3HNSH 3GHEH 1S9WA 3OGCA 1IGFL 3BH9B 4QOKD 1FFNA 4AQ1B 4IJ3B 4L8SA 1N2RA 1EZVY 5DJDA 1F8TL 4YXKL 1FYTA 1UXWA 1FNGB 1RZKL 2ADJB 2P46B 3CFKB 3P4OB 3QH3A 2EEAA 1UXSA 4KK8D 4F57H 2FO4B 1IILE 3I85A 3GKWH 4XNUH 2FRGP 1HILA 4MLSA 4YHOH 3S5LB 2ORBH 2CXGA 3LDBB 4N68A 2X89A 1MHEA 4MA3B 3NCCB 2YOCA 1MIEH 3TFKC 1AE6L 4P4RB 3GKZA 3WUZA 1BPVA 3QIWD 5I1IL 4KUCF 5HXMA 3RVUC 1MY5A 4AMKL 1TQCC 3F58H 1P4IH 3HR5B 3UTSD 4OLXH 2EH8H 2P5WE 2CDFA 3QO0A 1AGCB 4O2EB 1NFDF 5DHXB 4UU9A 1BOGA 3S37X 3ISWA 4WFFD 3O2DA 3V5DB 2HTLC 4X9IA 1G6RH 2Z91B 5F6HI 1V3JA 2E9WA 5DK0B 2NXZC 3CLFH 5F3BA 4PTTA 3TA3B 1ZT4B 4KKCD 5D72L 3WE6B 4K7PX 4DVBA 1MFDL 3N9GL 4KY1H 5B8CA 1HWHB 1N5YH 1TENA 1EHXA 3FB6A 1U93A 3W9EA 4L29B 5E9DB 1BAFH 1T22B 5GS3A 3CX5J 3RU8H 5D7KE 1AY1L 3HZYB 4BZ2H 5J12C 4FP8L 2CPCA 3QDAA 3TO2A 2P8LA 2VITB 3ARGC 4JO2L 2QL1A 3KPTA 5JR1H 1TJGL 1R3HA 2MJWA 1PW3A 1BQHA 1G1YA 1HCVA 4QHLA 5ID1A 2A83A 3HC3L 5E6IB 2HFGH 5IW6B 5CZVL 4KRPD 1HI6B 2A0LD 4C57C 3AREA 1G9NC 5L2JA 3S34L 4JM4L 3VFWB 4D0CB 4KV5F 5IGXL 4P4KA 2XTJE 3SDXF 1MCEA 4P3CL 5FYJD 5D6CA 5SWZA 1R6VA 4OM0L 4OZFB 1PJ9A 4X6CA 4M7LL 5I0ZA 4ZFOB 5TDOA 4KRNA 3EOTH 4HULB 4H8WC 2VISA 1IQDA 2VLRD 4F7MA 6CGTA 3GJEB 5C0IB 2Y36H 4Z7WE 3ARBC 4X7TA 2DOCA 4ODXA 3MUY1 1YEFH 4GSDL 2D9QB 1FAIH 2R4RL 1EHNA 4QT5B 3HZMB 4KMTL 2OTWB 3TYGL 4I0KA 1VGKA 3GJFH 3C2AL 1CFNA 5I6XB 3HNSL 3GHEL 2L0DA 3UPAA 2W0PA 3EJYC 2E8YA 3ARDD 5HHQA 5INDB 1OT2A 3LD8C 4ZPVA 5IHUH 1PBYA 3RPIA 1OSZB 5HVGB 4F57L 5AAWA 4JANB 4XNUL 1J0YA 4MQ7A 4YHOL 4GG6A 2ORBL 2YHGA 1VEMA 4ZTOH 1JWMA 4ORGA 4M8QA 4KJWD 3PL6B 4G6MH 3UJJH 3A6OA 5DRZB 1MIEL 3O6FC 3LEYH 2NY6B 2PXYB 4M9PA 2I9LA 3MUHL 2R0ZH 1KJVA 1VFBA 4HKBB 4JO3H 3PWNB 3BWAB 5CEXB 2IANE 3O8XB 4XNZC 4DUXA 3F58L 5F1NA 5C9JB 2XACC 1JTPA 4OLXL 4IRJC 3VFOB 4HG4K 4NHCL 5KVDL 3U0TB 5ADPH 3LB6C 5D1ZB 4LPWA 2EE3A 4R2GD 4F9PC 4J3XA 5E2VH 2O93L 1TFHA 1UB5B 5B39A 1G6RL 1H15B 4Y5VA 5LQBH 1KELL 1P9MA 1ODAA 1R3JB 2L7UA 4JLRA 3N1QC 2VL5A 3CLFL 3TF7C 1R5IB 3MRCB 4S1DC 3IS1X 4K9EH 4LEXH 1O7VA 2EICA 5H37G 3SJVB 1FYTD 3VXTA 2AK4E 3RZWA 4ALAH 3ZKNC 1CD1B 1N5YL 4JKPH 3O45B 1F5WA 1OGAE 4WUUE 1BAFL 5ILTH 4GT7A 3M1BA 4TUJA 3RU8L 5I1DB 5MENB 2HRLA 1A2YB 4U1JA 3SE8L 2X89D 1KJ2H 3AAZB 4BZ2L 3LRSA 4XAKE 4FQLH 4F15C 2P8MA 5JR1L 3WJLC 1K6QH 4N1CA 1F4WL 1XGQA 1RZIB 1E6OH 1AH1A 5IEKA 3EYSH 2HFGL 4WFED 5EZLB 1RZGA 4HUVA 3VXRB 3QWRA 5H2BB 4KVNH 2W65B 4UT9H 3GB7B 4QRUB 4BQBA 1QQDA 1NFIB 5E95B 4KMQA 1S9YA 3PHQA 1EEZA 2K7PA 2XNAB 3QUMH 4O4YH 4WY7H 3BP7A 5KSAA 4R4BA 5HGAA 3SO3C 2IH3A 2EDEA 4GAFB 4YWGH 2XOTA 4TTDC 4G6AD 1F6LL 3KPQA 5F9WB 2P7TA 1T2QH 4MJ5A 3EOTL 5I1HH 2DLFL 5H35A 2AK4A 4W70A 4CVZB 6FABH 4R0LA 4EXPX 5DJAA 2Y36L 3PXHA 4GS7B 5KS9B 1HHHA 1B4RA 1DUZA 1A6ZA 1YEFL 1FAIL 1JZ5A 1FC1A 4BFIB 4PJAB 4GKZB 1G7MB 3BQUB 1YPZF 4NDMA 4WEBH 4HG4J 1IGMH 3RTQC 3ECBA 3H3PH 1HE7A 3S4SB 1NANI 4LASH 3C5JB 4Z7UA 3PWPA 3B2UC 2G5RA 2RHEA 3F7YA 3G5ZA 5GJSH 1Y6NR 1G6RA 5IHUL 2DYPD 3CXDH 2GEEA 1E4XI 4QRRD 5JNYA 4PJCA 4HZLB 2VSCA 3GZKA 3LH2L 2M1KA 3G5VA 4I13B 4P4KD 4ZTOL 5HYJB 5SWZD 5AUMB 1BJMA 4MAYC 1K4DA 1FVEA 3HG1A 4JZOA 1J0KA 1MI5A 2X2YA 1FLTX 3LEYL 1N59B 2NNAB 2F19L 3ZT6A 5CUSH 1KCLA 2FCBA 2R0ZL 1X5LA 3BPLB 2ILLA 4JO3L 5LBSH 3ZDZE 1RK1A 2DQGH 4GRWF 3BVNA 4I0PC 4H1LH 3VGBA 3H9YA 1IBGH 2WUCH 1RJYA 1X5AA 3KJ4C 1D9KB 1G7HB 3LN4A 5ADPL 1CGWA 2B1AL 4ODWB 3TVMA 5E2VL 3O3AA 1J1XH 1R3LA 3SKNA 1GHFL 4BSJA 5E0QA 1YMHB 4PREA 2IEPA 4DKFH 3VH8G 1AJ7H 3H42H 2GFBA 3L6FB 4K9EL 4LEXL 1SYSB 3R8QA 1I7UA 4F8QA 4JQXC 4DUVA 4YNYB 1FZMB 2DS4A 4ZNEE 2MHAB 2PTTB 2IC2A 2GJ6E 2XPGA 4ALAL 2Y5TA 4E41A 3O4LB 5C0BA 3FFDB 4G42B 4JKPL 4X9GA 2YD7A 1Y18A 4M1CC 3QQ4B 2XKUA 1J7VR 1CD0A 2WM0A 4M1DH 5ILTL 3MROA 2ZG3A 5FCUH 3JTTA 1KJ2L 3NZHH 4JY6B 4WV1C 5J1SC 4Y4KC 3G6JF 4FQLL 5BMFH 4Z5RB 1ZLSH 1ONQB 2HKHH 2IF7A 3BIKA 1E6OL 2D0FA 3EYSL 4YHPA 3QXAA 4HIIB 1ZK9A 1ZKAA 1JPST 1E27A 2A9MH 1P53A 4Z77B 3EW3B 4R4ND 4KVNL 5F1IA 4UT9L 3WS6A 2YD8A 3GJFA 3PJSB 3BYYA 4JFYB 5CKGA 3V4VH 1FGVH 5FM5O 1T89C 1Q94B 1C5BL 2HWZH 2BSSA 3SDCC 3X11A 2M26A 3FQWA 4U0QB 4EJ1C 2BHUA 4O4YL 4WY7L 1AR1D 5I16A 1JZ8A 3QXUA 3ILQC 5L9DL 2QSCH 2A6KA 2DWEA 2VNCA 1IAKB 1NAMB 3MYJB 1T2QL 1X5JA 5I1HL 4WW1A 1KB5H 4ZNEA 4WCYH 3UJTH 2CDEA 4A2LA 4RFEA 6FABL 1FZKA 2PYEB 5A2IH 4LNRA 5IVZA 3OKEB 5ALCH 1JK8B 4V1DA 3LKQB 5D9SB 2YA2A 3L7FA 3EJZD 1TLKA 5KOVC 2KQNA 2VZVA 1XF2B 5K59E 3SGKA 1KBGH 2JB6A 4K71B 4WEBL 1IGML 1XGTB 1OAQH 3H3PL 4LASL 4PJEB 4XWOD 4JQVA 4WFHD 3QWRD 4OCWH 1Q72H 1AGEB 3RHWK 1FIEA 15C8H 3L5JA 4WNQA 3CXDL 2ZNXA 4HIJA 1EA9C 4GRLB 4YZFF 2YD6A 1M1SA 2CIKB 1CBVL 2YZ1A 1E28A 4P3DA 3AS3A 5FA4B 1X44A 2HT2C 2XXMB 3PHOA 5EO0B 2R29H 2O5ZH 1RJLA 5CUSL 2P43B 5FF6B 1ZLVH 3F12A 2CDGB 1TVHA 4JN2B 4TOYH 5KZCB 5E8EB 5LBSL 1N5AA 4F7TB 2DQGL 4U1IA 3BJ91 4OLEA 5HI3C 1IBGL 3L3KA 2WUCL 4AH2B 1CFVH 3OX8B 1LNUB 1Z9LA 4OTXH 1OWWA 1K4CB 1JHTB 5DEFB 3A67H 1J1XL 3DARA 2PO6C 3QDMA 3JWDC 3OPZH 4DKFL 3X13B 4CNIB 3D69A 3H42L 2E7LC 5HHOA 1U9KA 4PJDE 2AEPH 3PWPD 3EUUA 4R7NB 5F7HA 2Y25A 3V4UH 3U48A 3QUMA 1EMTH 4DEPC 4LP4A 3LSOB 1XR9A 2WWKT 5D7JC 4M1DL 5HY9A 1UADC 4OLWH 2D0HA 3FTGB 1FV1A 1K8IB 3GM8A 2ADIA 5B38B 1MJUH 1FZOB 3EOYG 3NZHL 2A6DB 3EFFB 5A16B 3IXAA 4E42A 3WEXA 5BMFL 5D7LA 3HG1D 4YHLL 2DTMH 1ZLSL 4H5SB 1MI5D 2HKHL 5D93B 5IVXF 1LK3H 2FGWL 1MFNA 2X4QB 1VKXA 2A9ML 4DGVH 1OGTB 5KSVA 3V4VL 4HIHA 1FGVL 3P73A 2UY7A 2HWZL 2W07A 3UDWA 4MHHI 4UV4H 3NCBB 3WIFA 4NQCE 4EZMA 5M7QA 3ZTNH 1WFTA 3RNQB 2OJZH 3MV7E 2QSCL 5F71A 1R0AH 4PJ8A 2Y23A 4QRTA 5HHNB 4L1HA 4PJDA 3WN5A 2R39A 4X98A 1KB5L 4ZQKA 2VIRA 4WCYL 3UJTL 3RX8A 3FONA 4FQQB 5C0BD 1N0XH 3RWJA 4E41D 3BPOB 4HK0A 1G9EA 1ZAGA 5DFVC 5ALCL 1A1OA 4OCMC 4PP2B 5DO2C 5ICYB 5GGRA 1EGJH 3RVVC 5I18H 3LHPH 4Y5YA 3I75A 2EKJA 2E7BA 4XVUD 1D5BB 4NUJB 1KBGL 3UBXB 3WKMH 1P1ZB 3CFDB 4LGSB 4WW2B 1U2CA 4NCC1 1OAQL 1B90A 2J5LB 4N8VA 1YEHH 4LPTA 4HUKB 5ISZE 4UDTB 2APBA 2A6JA 4O9HH 4OCWL 5EZJA 1UH2A 2NXYC 4Y8AA 3MZGB 3H9HB 15C8L 1AQDB 4YFLF 5AEAA 3ABZA 4XB8A 2DQDH 4QRPB 3H9SA 1JVKA 1DQDH 3HC4H 4LLQB 4NZRL 4ZOBA 3GBLA 3OKMA 1IC7H 1K8DA 2Q6WA 1XF1A 3E0GA 4XHJC 5DWUL 5J7CC 3QI9C 2HLFC 4U1HA 5EDXA 1FVDB 3LDBC 4BZ1L 3J7HA 4MDJA 4UQ2A 1CLYH 2LVEA 2R29L 2O5ZL 3FFCB 4BKLB 4J4PA 3LS5H 2CLZA 4TOYL 3HMWH 1AD9A 4TULH 5D1QC 2FL5A 2FJHB 2I25N 4V1DD 3LQZA 4JFZH 3NIGF 5F88B 1UWGH 4LSRH 3WIIH 1U3HB 3MGTB 1DDHB 1P6AB 2NZIA 5C6PB 3A67L 4F2MB 1MY7A 1YEEH 4PJGA 3G5YB 4KQ4H 2P8PA 3MRLB 4AG4H 3DUSB 2AEPL 4LVHB 3FQTA 1EO8H 4LQFL 4MA1B 3TA3C 3V4UL 1EMTL 5IF0A 2PW2B 3RGHA 3TT3L 4X4YB 5I1AB 5I1CH 1PLGH 3GMPA 4N1HB 4Q74A 5FAAA 4YQXL 4LCWB 4OLWL 1TNNA 4Y16B 4PBXA 3RVWD 1MJUL 2EYTB 5TGBB 3RVTD 1MHHB 2X4TA 2C1PA 4BZYA 5IQ7H 2DTML 4M8VA 3EGSB 4K2UL 4ZFZB 4G8EA 4IBLT 1JZ2A 5JMOC 4PJIB 4YHKH 3KJ6H 3ZE1E 5E1AB 3W11C 3ARFA 4ETQB 3O6LH 4DGVL 1NC4B 3RHWF 2BVOA 5FM5M 3OKYA 4WUKH 3RWDB 4FQHA 4FTVA 2EECA 1ES0A 3FQXB 4LNVA 4UV4L 2J8OA 4PRHE 5I75C 4P2QB 1SY6L 3U79A 3QDMD 5BVJB 3ARQA 1YEDA 1OSPH 1JGLH 3ZTNL 4NN5B 1I9IL 5HHOD 1R0AL 1EK3A 2Q76B 3SGJA 4JFEB 3DVGB 4NC1C 4MNHB 2OM5A 4PJEF 2RAMA 2DLHA 4YO0A 2BRQA 4U33A 1N0XL 2E5EA 4OUOA 4HHAA 1U8LB 2B0SH 3BGAA 4EOWH 3LHPL 4MGXA 1FFQA 5T1LB 1MRFL 4Z78A 3K8LA 4XZUB 5D7LD 4P5MB 2OTPA 3WKML 4NRZB 2EXYD 5IBUG 3W0WB 1BP3B 3Q48A 3P40A 3DSFH 3DYPA 4IRSB 4L8DB 3ULVC 2R1WB 1YEHL 4POZD 5I6XC 4OZHE 3MRKB 3TO4B 1W8NA 4HUWB 4O9HL 2BNQE 5JOEA 3QUYB 4RMSA 2Q3ZA 2BVPB 2DQDL 2BXZA 2CXKA 1ITCA 4LLWB 4OQTH 4PB9L 3HC4L 1DQDL 1M7IA 3P0VH 3ZT5A 3PV6A 1FZJA 3QBTB 1IC7L 5TH2A 4DUWA 2DF3A 1M05B 1AXTL 2DL9A 3NFPA 5DD3L 2C3HA 3CDFA 4OZGA 1WGOA 5IHZA 4PJ8D 2DL2A 1S7WB 1I9JH 1DBBH 1P7KA 1A22B 4IOFD 1W8OA 5DFTA 3LS5L 2NY6C 3RL1B 2PXYC 3WFHA 1G0YR 1L7TH 3HMWL 3FOLB 4L3EB 4RGNB 4TULL 3SDAD 4EDXB 3VFPB 4HXBL 5SWQA 4Y0GA 4CU8A 4JFZL 1UWGL 4LSRL 3WIIL 4Y4HA 5SWSD 4PLJC 2IALB 4DZ8A 3TC9A 4XC1H 4MVBC 4ZPTB 4A6YH 3G6AA 1QP1A 2XY2A 1BX2A 4KK5C 2P5EE 1YNLL 3WFZA 4KQ4L 3LN9A 5J6HA 4PBWD 4JGUA 4AG4L 1JBJA 3QFDA 2Z4QB 4OZHA 1XH3B 4JKWA 2HFEB 1EO8L 2WZPD 3HE6B 4C56B 3V7AE 1G9NH 1LO2L 1HSBA 1ZHNB 5D5MF 4MJIE 4QWWC 3L3OA 5CMAB 4F7EA 5I1CL 3H9SD 1PLGL 1DTUA 5IM7A 2FIKA 2YRPA 2H26B 1BLNA 3MBXH 2LTQC 3PWUA 5IQ7L 3RUGA 1UZ6F 2VAAA 4BFGA 2AABH 3QCTH 2P49B 3ULUD 4YHKL 2Q86B 1VFOA 4P2OB 1DUYB 4J4PD 4NNXB 3KJ6L 3K74B 4JZJB 1EGJA 1MJ8H 2P42B 2WINB 3IDIB 4Y2DA 1KPUA 1INDH 4CRPA 5FK9B 5CJ5A 1XCQB 1QPXA 2P24A 3RY4A 4MB5A 5F97E 1OCWH 3Q2CA 5CAYB 4Z0BH 1IGJB 4YFDB 5SX5H 5J6GB 4N5UA 2ZOKA 3D0LA 5EFIA 3G08A 1YEJL 4OV5A 1A7PH 1OSPL 4XGZA 3BO8A 4ZUUA 4QOKB 3KPSB 4ZUTA 4FFWC 2AV7B 5EU6E 3WJJC 1KTLA 1MVUB 3MRFA 2Q3AA 3HNVL 5F9WC 2GYSA 1RZ8A 3V7MA 4O2CB 3V4PH 4Q9QH 1RK0A 2AEQH 4MJIA 2B0SL 3EO1B 1I7TB 3AY4C 5F8QC 3BP6B 1MEXL 2Z31A 5IOPA 1FJ1A 5C0AA 3QDJA 4EOWL 4U3HA 3EDKA 3SKMA 2A77H 2IADA 2DI9A 4R26H 3I6LE 2APTA 1YNTA 2XICA 4GS7C 5E94A 5T1MA 1T7ZA 5ENWB 3O2WH 1BFTA 1HIMH 1QKZH 3DSFL 3VFUB 3BQUC 1MAMH 1AD0A 3QIWB 1A1MA 3R0NA 1CLZL 2FSEB 3ARFD 4YBQC 5TJWK 5B3JE 3OHXB 1DZBA 4HPOH 3RIFF 3AROA 2ZUXA 1XF5B 2H6PB 3BZEB 2VR5A 4FTVD 3WBDA 5JZ7C 2EDTA 4OQTL 4MS8C 3ZMRA 2ITDA 3P0VL 3CAFA 5CGYD 1U8HB 4PJHE 4XXDA 1FL6B 4YEFA 3DO7B 1P4LA 1YMMA 3DX9B 2AXHA 3X14A 3IDGB 4WDIA 2AJXH 5KAQF 3WYRA 2VUOA 4WU7B 3LPGA 1J0HA 1I9JL 1K2DB 1DBBL 1DQQA 3HMXH 1EHLH 4OAWB 1L7TL 4CN4A 1XGRA 3TYFB 5EUKA 4MXQD 4Y89A 3V0VA 5JO5A 4KK9D 4TYUA 4XAWH 1AKJA 4D9LL 1FNSH 2HT3C 1GRWA 2R0WL 1D9KC 4JHWH 3QNYA 2XFXB 4XC1L 1EFXA 1MFBH 4A6YL 1NEZB 2GHWB 4D94A 4IMKC 5ACZA 3CVHH 4XCNB 3BGFB 2YPKB 2FDBP 4QHNB 4PJIF 1XIWC 4XMKH 4CGTA 4LHUG 3CSPA 3NBNA 5GSVB 3ELAT 4F7CB 5HYSA 3B3IA 4B7LA 1S7XB 4NP4H 5EU4A 2UUDK 1OTUC 4HH9A 3WS3A 2MQ3A 4H20H 1KC5H 1WLHA 3MBXL 3ZYJA 4RZCA 5C09A 2EIEA 5IESH 3IT8D 4ISVB 1NLBH 1ZLWK 3KPNA 4RRPA 3KYNB 3QCTL 2UY6A 3IFPA 5JW4R 5E7FA 5CD5D 3U0PB 2VLRB 1TTUA 3B6SB 1MJ8L 4UNUA 2XQBL 1CE6B 2QKIB 2CLRA 2QQKH 3KPMB 1Z9SA 5FHBH 1OCWL 1R3IH 5FKAA 4Z0BL 4JM2B 5L8KB 2OX5A 3T65B 1GZQB 3BZDA 2BCKB 2FD6L 2V5MA 1I8IA 1X7QB 2HJKB 3NCFB 4E0RB 1A7PL 1ZS8B 2GSIA 3OXSB 1VEOA 4HC1H 2ENYA 1AO7E 3DXAA 5JW4N 4D9RD 3SE3C 2ARJB 4HLZG 2W91A 3QUZB 3FQRB 3P0GB 4WWKB 4KVCH 4P49A 3V4PL 1IFHH 2WQRA 2C3WA 5DK3A 1FFPB 1DLFL 1Q9KB 2IPKB 2QQNH 1A6VL 4MMXC 3JV4A 2A77L 3QFJA 4R26L 3LAFA 4JPIB 5BS0A 1J18A 5GRZA 5AD0B 1MCHA 5JPNA 1FVCA 3O2WL 1IEHA 4OGAD 1QKZL 1HIML 4ZUWA 1MAML 5DJCA 1O7SA 1VGEH 2Q20A 3ARGA 5EU7C 1WBYA 1RZJL 4HPOL 1GOHA 4Y2DD 4LKXA 3S35L 4OD3H 5J3HD 2JJWA 1KGCE 4M7KL 3E3QC 5EBLB 5HJ3B 4OLYH 5CBAB 4HKZB 3QB7C 1KLUA 2AXFA 4PRPB 5F1SA 2WIIA 3OGCB 2AJXL 4WI5A 1N2RB 2XQYG 4CL7A 5E2UL 1EBPA 2APWA 5I1JH 5DJDB 2LAGB 4LHJB 3UO1H 1FYTB 1UXWB 4XTRD 1BD2E 3HMXL 3QH3B 4KK6D 4X7CC 1EHLL 1C5CH 1UXSB 4P99A 1X5ZA 4MJID 4U4BA 3BMVA 1IMHC 4NKDB 4DW2H 2Z31D 3I3DA 1AP2A 2DM2A 2NX5E 5C0AD 3QDJD 4ELMA 3MNVA 4XAWL 4O58H 1FNSL 3T0XA 3JV6B 2GI7A 1DBKH 2VZTA 3U9UB 4F33A 1MFBL 4HWEL 5KSBE 3ARBA 3VA6A 1N26A 5A40E 4I3SH 3VFVA 3O9WD 1NDGA 4XMKL 1DBJH 2RBLA 5JDSB 4HQQH 3RWGA 2CDFB 1ADQH 2ZUSA 2W1NA 4NP4L 4F37K 1R5WB 2VXSH 4UU9B 1BOGB 5DRXA 5GGVY 3JV5A 4H20L 4OGXH 1KC5L 1ORQA 1ACZA 4YBHA 3WLWD 1YMMD 1I8KA 5F3BB 5ITBH 3MA7A 3D39A 4LSPH 1T7VA 2WBJA 5C08A 1C8PA 4JHZA 2YSSB 1R3KA 3D9AL 1XZ0B 4EQ2A 3O6FA 2CUIA 4D9QE 3EYOA 2AK1H 2ICES 4NJ9L 2ZWLT 1AKJD 1NCDH 1JRHI 1F3JA 1R3IL 2VLJE 1A47A 1RAMA 4RGMB 3MJ9A 3UTPD 3HAEG 1EFXD 2XN9E 2NTSP 5FM4A 5INCA 4JDVB 5T3ZD 4DOHE 3VI3F 5IMKA 3SBWA 5ID1B 5KSBA 1J5OH 2X9YA 4YDLB 3DGGA 4X0KA 5MEOB 3GSNH 5T5NG 4IRJA 3BYTA 4HC1L 1FG9C 2VDML 1HOCB 4LLMA 5IFAL 2VDNH 4F9PA 1K5NA 4IEFB 3IDMB 4PP1C 2AQ1A 4WTWA 2LABA 4P57B 2ID5A 2YPLE 4KVCL 4V2BA 2RR3A 3LIZH 4X8JA 3I84A 2BZDA 3AREB 5L2JB 5HHXH 1IFHL 3ULSA 5MERA 4HJGB 2LU4A 3EDEA 4XCFH 1L7IH 1JNNH 4P4KB 2W38A 5SWZB 5J1AB 2VQTA 3IJYA 3MLXL 1TZIA 5C09D 5FUCE 4WRLA 2XA8H 5TDOB 2D7NA 1DQLH 5DHVH 1F42A 3VXQB 5GZNC 5I1GH 4WW2C 3FKUS 1E4KC 2XWJA 1BREA 1VGEL 1KNOB 4J3OC 3VU2A 2J5LC 1HHJA 1N3NA 3TFKD 4X7TB 4AZ8A 2CRYA 3IJSA 4N90D 2DD8H 3KHOA 1QO3A 4OD3L 3GNMH 3GSVA 3OR7B 1WAAF 4UNVA 3ZDYF 5IWLC 1T04A 4EXKA 3CVHA 3OZ9H 3QCUH 1H0DB 4I4WA 4LHUD 3RVUD 3QIUB 4OLYL 4OCXH 1VGKB 4XMLH 4IMLA 3JWDH 1CFNB 4HFWA 3QEQE 2F54E 3NCMA 4JKLA 3H7BA 3DXAD 2DWDA 2JIXB 3UC0H 1QFWH 3UO1L 1FNAA 5HHQB 3T0VA 2HTLD 3O4OB 1MAJA 5D96C 2C3GA 4ZPVB 3MO1A 1DN2A 5C8JA 1C5CL 2NXZD 4KKLC 4C83A 4WIQA 4DW2L 3V2AR 4E5XA 3WDIA 3AU1A 4Z7VE 3O6KL 2XTJB 3QFJD 4O58L 4Z7QF 2V6HA 1H3XA 4BQ8A 1TPXB 5BS0D 1DBKL 1EBAA 1EIBA 4O00A 1U3HC 3QEUB 2Q1EA 2I9LB 5DK2B 3ZDXE 3PNWB 4I3SL 1AFVH 5C0CA 3ZE2F 1Q0YH 1VFBB 3E2HB 2E6JA 1EV2E 3ARGD 2YC1A 4NO0A 1DBJL 4Z7WB 4HQQL 3DMMB 1GPOH 2JK5A 4OF0A 1F4AA 4LVHC 2EZ0C 1ADQL 4MA1C 3RTQA 2VABB 4HX1B 2VXSL 3CH8A 5TQ0H 4OGXL 2RIKA 1FFRA 4M6NH 3VI4F 2F54A 2WANA 2CR3A 5JQ6H 1TCRB 2DKSA 4Y16C 5ITBL 1FH5H 4LSPL 2Q8BH 1NC2B 3MUZ1 4S1SH 2FGZA 3R4DA 4N8PA 5J1TC 5K9OB 2F5AH 4LP5A 3TIDB 2VLLA 5CD3A 2PYFA 1KN4L 4PYGA 3M1BB