1BM3L

Immunoglobulin opg2 fab-peptide complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
DELLTQSPATLSVTPGDSVSLSCRASQSISNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPLTFGGGSKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN OPG2 FAB, CONSTANT DOMAIN
publication title Conformational change in an anti-integrin antibody: structure of OPG2 Fab bound to a beta 3 peptide.
pubmed doi rcsb
total genus 49
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bm3L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bm3L01
4QTIL 2NTFA 5EO0B 4Z5RB 4QRPA 1AQKH 4G42B 1K2DA 5B3JE 4G8IA 3EFDL 4N8CH 4LQ1A 5CEZD 4NKIL 3SKMA 4GXVL 1S7TA 3MNZA 3MUGA 3MOAL 1FNAA 3ARBD 2ZWLT 3EZJB 1NMAH 4GUPB 4PRPD 5DURD 1NC2A 5ELIA 3I6KA 3GGWA 4N0YH 4OIAA 4XAKD 3QT2A 3F5WA 3VFVB 5HYQB 3CK0H 3WFBL 4NJ9H 1TZIB 4JFEB 5J6HB 4PJ5A 1TZHA 2AS5M 3HPLB 4GMTH 4ZYKB 3PG2A 5E8NA 2QBWA 5CMAA 3OL2A 3RP1A 4Y19B 3QWRD 5JQHC 3LN9A 1QQDB 5FDWB 3ZTJG 2K7PA 3G6AA 2RJMA 1HHGA 2E9JA 4WTZA 4JO1H 4EUPH 2MCPH 1C1EL 1CDBA 1Q72H 4WFFD 4WW1A 3Q0HA 5D1XB 5L7XH 3D18B 2VWEC 4GAGL 3VXUB 4Y4HD 1UKSA 3NIFE 4LLUA 5I73B 1ZA6B 1KEGL 4YPJA 1KB5A 1OTTC 3X3FL 4NQXA 3L3IB 1JI2A 3B5GA 3UDWC 4HJGA 1Y6NR 4OF5A 1DZBA 4M93C 4PGEA 4YHIB 4PJFA 1LNUA 4ONHB 1I7ZB 3V5DB 1DBBH 5F6HJ 4BQCA 3MLZL 3KYAA 1XGTB 5KS9F 4WY7H 2X05A 3CLFL 1A7RL 2FIKA 3MGAA 4FXLA 1FVDB 1CVRA 3GMMB 5EIIB 4ZG1A 1CGXA 3KJ4C 4CADA 4Y4FD 1T1YA 5JMOC 2DI9A 1FPTH 1JHLL 3CX5K 5H94A 5FA4A 2Q7YB 2FNBA 4BSJA 4M6ML 3PWVB 3HAEH 4ELKA 4HWBL 3O2DL 4GO6B 2GKIA 2VDLH 4DKFL 3EYUL 1YY8A 5FOBA 2XI9A 4TUOA 4Z7QE 3N9GH 1GC1C 4L5FH 2VNCA 1SBBA 2X1WL 5C08E 1JPGA 4Q2ZB 4YEEA 2F53A 3AMLA 2HFGL 3C5SA 3P11H 3OKOB 2VQ1B 4RGMC 3KXFE 5GGSY 1CLCA 1CGSL 2VDMH 1A6TB 4NM8L 5K9OA 2JJWA 4U1MA 2BOBB 5D1ZC 4IRJD 2FECL 4TVPH 3BUYB 4U1SA 1RFDL 1YDPB 3CSBA 3V4PL 1U58B 5LXGL 4IS6B 1SJEB 4IRSD 5KG9B 2R8SH 1NEZB 1OGAB 3HC0B 3QFJA 1K5NA 1MH5B 5TE6H 1MIEL 5F7NC 4YQXH 1WICA 2F15A 3DUHA 3O4OB 4WNQA 3VFOB 3BMWA 2CUHA 5ANMA 1AIFB 2VDKL 3W11D 5I71C 1BX2B 3QHTC 4IRZL 1OTSC 2FX9H 2VKXA 4EN3A 4YBLC 2R69H 2XRAH 1KG0A 3RKDD 1T20B 1NBZB 3G04A 3DVFA 1P6AB 3KNBA 3L3HA 4MDIA 4XBPA 4XNUL 5DD6B 1RIHH 1EJ6A 3RL2B 3TA3B 5EO9B 1UQSA 2PXYA 1KCUH 1TQBB 4X4MA 3T0BA 5LGHL 1I8IB 2WP3O 2CRIA 5CJQH 1MFAL 2A83A 1TCRB 5GIRB 1DFBH 1MJ7H 1BGXH 2A6IA 4L1HA 1HOCB 2W1NA 1GOHA 4HUMB 4PREB 5EULV 5F72S 1S9VB 2NY2C 3C5ZD 4JFDE 3X13B 1Z9OA 4L8DA 1MCDA 1P9MC 2EYRB 5C09A 1KIUA 1AGDA 2VXTL 3AXLB 1KN4L 1G9MH 1CD8A 1JJUA 3TO4D 1F8TL 3I75B 2XNAA 3CFJA 3HC3H 3FT4A 1ND0B 2BERA 5E6IA 1P7QA 5T3ZD 5DUPL 3O6FD 4XCEB 3BPLB 2IGFL 3MJ7A 2JE8A 1BOGB 4HPOH 3AVEA 1FGVH 1U95A 4Y5VB 5D6DA 3CXDL 1G7QA 4JQVC 1Z6JT 3CDGB 3ZYIA 5IMLA 3VFPB 1AE6H 3QIUA 1U8HB 4MNHA 5IHUH 4D9QE 4GG6E 4JPIB 1C5BH 3RJQB 5IGXL 3T3MF 4KK8D 3W9EB 1KLFA 4J3XA 5J0BA 5IQ7L 1S5HB 4QXWA 3U9UA 1VEMA 3ZHLA 2C4FT 4F58L 3C2AH 4ZNEA 3CPLA 3RUGE 3LMJL 5L88L 3MV9B 1FNHA 2OL3A 3OXRA 1FFRA 2JKXA 4S1RL 1D5XA 1UB5A 2OL3H 4PJGF 5JDJA 1BQLL 1F02I 4DVBA 2XZAH 4AEHL 4RSVA 3T0WA 3LKPB 4ELMA 5D7JB 4BA8A 2VQTA 2V7HA 3GSNA 4OBSA 3GMLB 4RRPA 4CGTA 1LK3L 1RJYA 1UA6L 4R2GD 3ZT6A 2CKNA 2FEEL 3GSNH 1HIML 4HUKB 5BS0E 4WFGE 4PRIE 4HIEB 1EFXB 1I7RB 2CUMA 4X5WB 1BAFL 2W0LA 3L3KA 4J1UB 4OLUH 4GMSL 5DEGA 1GGBH 3MRIA 3BYTA 4PRAA 3MJ8B 1KF9B 2IBGA 3IU3A 4JRYB 3X14A 3QDMA 5K9KB 4WTXA 3LKNB 3RNKB 5FHBH 5FYLH 2RFXB 4ZUTB 4Z8FL 5CD3A 2R23B 4MX7B 4WUKH 5DJAB 4EI6B 1YNKL 3OBAA 2EIZA 5HI4D 5SWSA 2DMBA 5DRWB 4JANB 1F3DJ 1T7WA 4Y16A 4YPGA 2W59A 1I1CA 2MQ3A 3O3DA 5JW5B 4NKMA 3RTQA 1MF2H 1VFBA 1R3HB 5I1LA 3K1DA 3M17B 4R4BA 2D7TL 2D9QB 1T5WB 5LWYL 3EYQD 2VXVL 2WBJA 3GMPA 4MA1C 4DCQB 4KZDL 3P0VL 3ZE1E 1TETH 4NQCA 4NYLA 5DRZA 4F9PA 4LCCC 5JPNA 4K8RL 4R9HA 4KHXH 3GK8L 4ZPTA 5IMKA 2A6DB 2ITCB 5C0DA 4L3ED 1QFWL 1B6DA 2G5BA 1S8DA 2Z93A 5DJDA 3ESUF 5IOPB 4XP6L 1YY9D 1KULA 3FJTA 4S1QH 4DKDC 1Y18B 1T1WB 4HMDA 4LMQE 1G7PB 5I66A 1ZE3C 3ARZA 4L29A 4BQ9A 3S34L 5IB4A 1QFWM 1HNFA 4RGNB 3HG1A 3UBXB 4PLOB 4DVRL 4OQTA 4NWUH 2A6JA 3LRSB 1ITBB 4MJ6B 3QPXL 3BDYL 2B4CH 5I8EA 4R90H 2HFEA 3IFOB 1UWXH 1KJVA 5GRUL 3N85H 1HYRC 4YFEA 3C6LA 5K59E 4JZJB 4XCCL 5EOCL 4QNPF 5TQ2H 2M26A 4LLMA 1A6ZB 3FB5B 1G0DA 1G9NC 2PYEA 1A4KA 4RAHA 1P4BL 4FQXA 4GQ9L 2W65B 5C3TA 4LRNL 2IANA 4BM7A 4PP1C 3W0WE 1F4YL 5HHQB 3K46A 4YHKH 3G5YA 1W0WA 4JFED 1JGLH 3EOTL 2C5DC 5EC1B 2VDNH 3JTTB 4Y19D 4H20H 5DXWA 1L4IA 5MI0B 1FL6A 5DFTA 4EBQH 5EN2A 1BZ9B 1J8HB 1ACYH 3PUCA 4X6CE 4PJIF 5D1XD 3MGOB 2EH8L 1ZLWH 1NEZG 4NO5B 2ZSVA 3VXUD 3B2UD 4UTAH 1Z9MA 3WJJC 1JF1A 5I8CB 1EJOH 1XIWB 4CU8A 3UTZB 1WBXA 3IJHA 4JR9H 3MO1A 4RFNC 2VLRB 1XGPB 3DPBA 4WO4C 1BBJA 1XF4B 5BMFL 5I16B 1UH3A 3PP4L 4XH2B 1HXMB 2W9DL 2GTZA 4GRMA 5KS9B 1N64H 5F1IB 1CGUA 3QCVL 3TP4A 3T2NL 5K9JH 1NGYB 4P5KB 4TUKH 3GHEH 2HMID 3OJDB 2XZCH 4KY1H 1AXTL 3BIAX 4X0KB 4F8QA 3BW9A 4NHUB 4ALAL 3LPFA 4KMQA 1KTLB 3S96A 1IGML 1X3DA 4ZD3H 4MS8C 1KCRL 5F7WC 3NA4A 1HE7A 4DZ8B 2X4RA 4XC1H 1UEYA 3CNKA 5DHXB 1IGFL 2FDBP 3V8CA 3ZSSA 4KKAD 4TVSa 5LBSH 2VIRB 3DROA 4P9HH 3QRGH 3MCLH 2XV6B 5SX5H 1U8LA 1A3QA 5GQBA 3G5VB 3HE6B 5HHPB 3ZTNH 4NOFA 5DVKA 3ARQA 5JW4N 1KPVA 3QO0A 3E2HC 1N4XH 3R06B 1CLYH 4S1DD 2ZNWA 3PDOB 3HUJF 4PPTA 1AR1D 4Z7WF 1HQ4B 3VU2A 3QIWC 1ES0B 5DZOA 2BNQB 4J3UA 4MD0B 4JY6A 3T0AA 2YA1A 2FB4H 1DUZB 2DM4A 2HFTA 1FFNA 2LAGB 3L7FA 2FGWH 4PJAE 1BPVA 5B4MD 1N0LA 2IWGA 1NGZB 4XRCA 4WFEE 1RU9L 5T1MB 1CFVL 3V7AG 1FDLH 3MLRL 4P59H 5C08A 1OSZB 3PP3K 1J0YA 2OJEA 3RBSA 4AJ0A 3DSFH 3CFEA 5DLMH 4JFYA 1X5HA 4DGIL 3QUZC 3KXFA 4NUJA 2HTLD 2ICES 2IMMA 4ZFOL 3BSZL 4ZTPH 4TQEH 1S3KH 3LKOB 5CS7A 3OX8B 4X7TB 4XVJL 3I2CH 3C5JB 3G6JF 3MLUH 3MRNB 1QFHA 4LVHC 3R8QA 3V0WL 3KDMA 4PTUB 4WVRA 3IRPX 4DGVH 4O02H 1A7NL 2IG2L 4X9FA 5H35B 4CNIA 2BVQB 2NY0C 5AD0A 3U9PH 3VXTB 3FO9A 4AIZB 2FD6H 5CBEA 2IH3B 1S78D 5GS2D 2H8PB 3VMOA 1KJ3H 3KPLA 1H5BA 4P4RB 5C6WH 5J13C 3MCG1 4BFIB 4EIZC 4LCWB 4HIXL 3P4OA 3K8MA 1NH6A 4LSRL 5CJ5A 4LKCB 4AT6A 3UC0H 1UFUA 2QHRL 3SY0A 1DL7L 1IEHA 1CR9L 5D93C 1BFSA 2WIIB 4KK5D 4WHTA 3UYRH 4M00A 1G7JA 3F7VB 3GSVA 3SBWC 4J6RL 2X9YA 4YHZL 4D8PA 1FC2D 1U8QB 1FJ1B 1NMAL 1WQVT 3U0PB 3VFSB 3VWKD 1D6VL 3PHQA 4JFDA 2Y06L 3DRTB 2J88H 3O6MH 4JPWH 3U46B 5IQ9A 4ZO6A 3GB7B 1NFIA 3VMNA 1JHTB 4OAWB 1NGQH 5GGTL 5IVOA 4MLIA 1CTNA 3RU8L 3MV9D 3FB6B 1TCMA 4J3WA 1BD2B 3RWIB 2I9LA 5L9DL 4PJGB 5DUMH 4QT5A 5I1KL 3C8KA 5C0JB 3MA7A 2UY6A 5EU5B 4KMLB 1H8SA 4NBYB 4LP4A 5D7JD 3MPCA 5JNYB 3ARDB 3SE4C 1MLBA 5GS3A 4ZTOL 3VG9C 1WCBB 4ONFH 3UBXG 2VLLB 4MVBC 4XB8A 4FQCH 3OGCB 1DSFH 4HIHB 2QADC 2GJZA 5GGRA 4APQA 1EFXD 4ZNCD 3RUGA 3D3VB 3ZKSD 3FO0H 1FG2A 3P3YA 1KB5L 4OF0A 5B22A 3QI9C 4LDEB 4J2XA 1BQHA 1IGTB 4K3HA 1JRHL 3U7YL 1FBIH 3F12B 4GG8B 5EU4B 2XA8L 3GBMH 1E27B 4WY7L 3ZYOA 3T2QA 2NX5E 3RKPA 2C3VA 5DJXA 3VWJC 5JIIA 1CD0A 4LF3A 1XZ0A 3VRJA 3WE6A 4HLJA 2OSLA 2AABH 3TVMB 5F9OH 2QQNL 5DS8A 3MODL 4YH6A 4HK3J 5BS0A 1KNOA 3OG4B 2EDJA 3DSNA 3SO3B 1CXKA 4RMRA 3PQYE 4WV1C 5E4EC 4YDKL 1T7VA 1IQDB 5FECA 4HUUB 2JIXA 4LKXB 4WEMB 4RFEB 1UJ3C 3E8UH 3LKRA 4OM1L 3X11A 1I8LC 1CLZH 1OAUH 2KUTA 4MCZB 5F89B 1DBJH 1CZ8H 4ODVH 5HGBB 3MLXH 2IPTH 3EOBB 4UUJB 5DQJA 3WNPA 3STLA 2EC9T 3IXTB 3IETB 2NXZC 5DQDH 3AREA 4XVTH 5FKAB 4HUWA 2D3VA 1EEQA 1NCWH 3QEHA 1MRCH 4QCIB 1MHHB 3CMGA 1TJGL 5EBWA 1A7OH 4LEOA 4U33A 2CMRH 3T3PE 3O3AB 1S7SB 3QJFA 4FQIH 5TE6L 5LQBL 4P46B 3DX6B 2KH2B 4FTVD 2FX9L 1P9MA 3MJ9L 3IGAB 3VXPB 1EO8L 4Q0XH 1ERNA 2JELH 4GH7B 4R6UA 1BFTA 5DTFA 3BQUC 5CKAA 1I1YB 2QQLH 4NC2B 1DBML 5J1TC 1A2YA 2W0PA 3MV8D 3P30L 1U41A 2ZCKH 2C4FU 3ARPA 3CFCL 4TN9A 4ZO8A 4ZUVB 1QPPA 1WAAF 2VR9A 4GAJL 3A6CL 3MLTB 3NBNA 3IVKB 3MROB 2DLEA 2D03H 5E6YA 2IAMB 3MRGA 5HGAB 2OK0H 2APVA 1C5DB 4I18B 4JO2H 3R0MA 2R0WH 4HZLB 2P49B 2WBWB 4D2NA 4JJ5A 4X6FA 1VEPA 2FO4B 2CXGA 4HK3N 3T65A 5J11B 1HHJA 4G3YH 2H45A 2H2SC 4LFHG 4JFQA 2F74A 4Y2DA 5DJ0A 4JFOA 2EXYC 4JKWA 1QSFE 1PJ9A 5I17B 3CD4A 1ZHKA 4JLRB 4KTDL 4PJIB 2AJVH 1J8HD 1E4XI 3HZMB 2MKWA 3PWPB 4MDJA 3B5TA 4JRXE 4MGXA 4NP4H 1G9ML 3FZUC 1BVLB 4U1KA 3CMOL 5BV7C 1NLDH 1LP9E 3W0WA 3NCCB 3RVWC 1T0NB 4LNVA 3O0RL 2VLRD 5EWIL 4Y4KC 1IKFH 1EEYB 2LVEA 2D7PA 1M7IB 3S88H 2F5BL 4F8TA 5D7LB 3SCMC 4U0RB 4G8FA 1DEDA 4Y8DC 1MIMH 1WVZA 3SKNA 2YPLB 1JGUH 3GJEB 5DA0B 1BIHA 4XCYA 2LVCA 4LGSB 2J6EL 4N8VA 4ZDHB 3BIKB 3CVHA 4X6CA 2F8VA 5FHAH 4M1DH 2NXYC 3ZKXB 1VSCA 2YR3A 3DTXA 4UT9H 3DX9B 2B8OT 2OL3L 4Y5YC 2K7QA 1UXSA 1JYVA 2DF3A 5E00B 3WXWH 1S9KC 4TTDC 2V9RA 1FG9C 3F6LA 2VLMD 4POUB 1D6EA 1F6AB 5DMYA 3HE6D 3V79C 2RB8A 4U6VH 1AGBA 3HUJB 4H25A 4LBEB 4Z7WB 1AO7A 3I85A 3QNYB 4P4KB 4ZFOB 2CQVA 4O5LL 1SEQL 3CFBB 1INQB 1OTUD 5EPMB 4LFHD 2VL4A 1UCBL 4ZXBA 2VZSA 1R5VA 2BNQD 3ZDYF 5HHXH 5A3IC 3WKMH 1P5UA 1G7LA 3B9KB 2C7UA 4GRLB 3ULUC 4FFWD 3EW3B 1FZOB 3N1MC 3BDBA 5EU3A 1U3JA 1Q9LB 3NACL 4LLYA 3MXWL 4MMZC 5C0CE 3LEYH 2R0KH 5D2NC 4YHYB 1FNFA 1I7TA 4MMXC 1WZ1H 3C09B 4IDLA 3NOIA 3WNKA 4G6KH 2UVFA 1YYMH 1MF2L 2VDPH 3BE1L 4YK4B 3H3BC 1I9IL 2NTFB 3GI8L 4KVCH 1KIPA 3KPRA 4IMKC 4QRPB 3JVGC 1PFCA 1K2DB 1LO3H 1MNUL 4G8IB 4PJAA 5I1AA 5JDSA 3WIIH 5EZOH 3ISWA 4NN7C 3SKMB 1A6VH 1S7TB 4E41E 3MNZB 4F7CA 3GI9H 5CZXD 3MUGB 5D2LE 5HYSG 4CVUA 4XP9L 1BECA 1JMZA 2AEQH 3O6KL 2LTQB 4DUVA 4S1QL 1G7MA 3I6KB 3DOSA 4OLYH 4K7FA 4PD4K 4RIRA 4N9OB 3LS5L 3I50L 2GFBB 4ODXA 3WHE0 1PW3A 1GCFA 3GIVA 4LCWD 3F5WB 4MAYC 4UT6L 4UT7H 4PJ5B 2ZSWA 4OQTL 1TZHB 2AK4E 5E8NB 3ARUA 3ZDXE 5CMAB 1CFNB 3RI5K 4R4NC 5B3JF 2O5YL 3B3IA 4LQFL 5EB9A 3SE8L 3QHZH 4D0DA 3ES6A 3UJJH 3G6AB 1HHGB 2RCSH 2GCYA 3WJJA 2AXGA 3IDXH 3C08L 4NRXA 4K9EL 2ZUUA 4PJDE 4LLUB 5I1GH 1KB5B 4NQXB 1RUML 3U82B 1HILA 4HJGB 1W0VA 5M95B 2Y9RT 2IFGA 3IDIA 1IGYA 1BD2D 5C71A 4PGEB 4PJFB 2DICA 1LNUB 3HHRB 1JE6A 4P3CL 3VFGL 3CCHA 4LLAA 3UZQA 1MJUL 1HK6A 5C1MB 2ZOLA 2Z8WC 2FIKB 1WEJL 1D5BA 2BNRB 1KOAA 4CADB 1JGVH 1T1YB 1TFHA 4ZSOA 2YWYA 2W9EH 1FFPA 5H94B 4UTAL 5FA4B 1TENA 4KTEL 3NIFF 1H3PH 3KLAA 5IFAH 1Q38A 3D3VD 4ELKB 4KI5C 3TIDA 5J4MA 1IFHH 1FL3B 3VFMA 1X9QA 2W07A 3WCYA 4XPFH 3SDXE 5FOBB 4TUOB 1J5OL 1F58L 4JHAH 4K8RD 5GRWA 3OAUH 1JPGB 3QDAA 4Z7UE 3GHEL 3O81A 4HK0B 4FNLH 5F7YC 5FFLA 3CX2A 2WNGA 3AAZA 3LPGA 3RGHA 2WUCL 4M6OH 2MMXA 2PF6A 5K9OB 4U1MB 2DDQL 5DGRA 4U1SB 1UM5L 3OXSB 7CGTA 1GHFL 5F6HI 5TF1L 5E8OA 43CAA 5HJ3A 4S1SH 1K5NB 2H2PD 4V2BA 2HT4D 3QUZA 4W6WB 1ZT1A 4Z7QF 3RVVD 4L9LB 3ZTNL 3TN0A 1K4CA 5F7LB 3UPRA 4PJCE 5C0FA 5DJ6B 2NX5A 1VGKA 1H3UA 1KG0B 4QOKE 3G04B 3KNBB 3L3HB 4MDIB 3K8KA 4XBPB 4WDIA 4XNMA 1FSKB 1V3MA 3A67L 4XHJD 4HS8L 3ABZA 1UQSB 5F96H 2PXYB 4M1GL 5JUEH 1UCTA 3PQYA 2ADIA 5IK3A 3PP3H 2CRZA 1TVDA 3ARBC 2A83B 2A6IB 3BKYH 1U3YA 4HSQA 4UOJA 1EGJA 4P46D 4H8WL 4EI5D 2J5LC 4O2EA 5C7XL 3QWQB 4N90D 1EGJH 4D0CA 3DSFL 5JW4M 2JB5H 4JG0L 3ZSTA 5BW7C 3BVNA 1A7QH 2X1XR 4W81A 2I5YL 3TZVC 5C09B 4WU7A 4JY5H 4TQEL 1RZKH 1AGDB 2F9BT 3BKCL 1OP9A 3P0YH 4FFZL 2IAMD 3GMQA 3JWDL 4YIQA 1ZT4A 1X4XA 3THMH 5TQ0L 2XNAB 4NZJA 3CFJB 2P5ED 3LQZB 2OBGA 3WFZA 5E6IB 1P7QB 3MJ7B 3ARVA 3BH9A 4XC3L 2UZIL 3EYSL 1U95B 1QHOA 1BEYH 4C55A 4AZ8A 4Y4HC 3MNVA 4L3CA 2Z31C 5IMLB 1QUNA 4L9DA 2VXUH 2FD6L 2FJGA 3QIUB 1QBLH 4LVEA 1DQLL 3EGSA 5HHOE 3PWPD 3J7HA 4NKDA 3U9UB 1X5GA 1MCPL 3X12A 3CPLB 2Y23A 4XPBH 3WNNA 3FRPG 2BX5A 3MOBH 2BHUA 2OL3B 1KCKA 2AQ1A 1D5XB 2V6HA 1J1XH 3KGRA 3SE4A 1UB5B 4OF7A 4XXCC 3MBEA 3MJ6A 4Y4FC 3VXMA 2RIKA 3UXFA 1G84A 3T0EC 3LZFH 1PG7W 3VMPA 2V7HB 3GSNB 4M6AA 5D7LD 4LVNB 4CMHB 3DI2B 4RNRA 1QSFA 4E0RA 2HH0L 4URTB 4GG6F 3IJYA 4JRXA 4WTWA 1Q1JL 5DD0H 3BPOB 1RD6A 1F6FB 2DJUA 4YFLF 1GAFL 3H3KA 1A14L 3RUGF 3ARGA 1IC1A 4GBXA 2AJUH 4LSUL 1WTLA 1MCNA 3MRIB 3SGJA 3RY6A 5L2KD 3X14B 3QDMB 2DYPB 3BKJL 4C57C 3P40A 2QR0A 5A40E 1QBML 2HRPH 1JUFA 2AXHA 2UZXB 2EC9U 3QUML 1MCLA 2AGJL 4PG2A 2L7JA 4IRSC 1MI5E 2EIZB 5SWSB 4P4KD 4HJ0C 5GGQH 4BSVA 1UJ3A 3I6LD 4Y16B 4YPGB 4LCUA 5E99H 3O3DB 3W11C 3FO0L 3RTQB 1OAKH 1X7QA 4HS3A 5I1LB 4HW6A 1HSAA 4R4BB 1I8LA 1UH4A 2A9NL 1FBIL 2WBJB 3GMPB 2FBJL 3B9KD 4GRLD 3HFML 4WTZG 5SX4H 4NYLB 5DRZB 25C8H 4TNWF 5JPNB 3OTTA 4YX2H 5IMKB 4ZPTB 4QRUA 2Y07L 32C2A 5C0DB 2OZ4A 5EIQA 3SE3A 4UZGA 1S8DB 4UQ2A 5DJDB 2NY7L 3IDYC 4OF8A 5DD5H 5K93A 1LMKA 2OZ4H 2VDQL 1R5WB 4CW1A 5I66B 5CUSH 4L29B 5IB4B 2Q3AA 2HWZL 4H88L 5E5UB 1FQ9C 5ADPL 1XEDA 3RZCA 3C5ZC 1FLTX 5I8EB 4M5ZL 2HFEB 4NWTL 1KJVB 2ARWA 3ZE1F 4MNGE 3C6LB 3NPSC 4NC1E 1MCCA 4LLMB 3TBVA 2PYEB 2ATPA 2XTJB 3TO4C 5D4QA 3LKSA 4FQXB 5C0CA 4R4FH 3UJIL 1J8KA 4OZHA 2IANB 4PV9A 3X17A 3O6FC 3CLEL 4C56E 4J8RA 3G5YB 1W0WB 3VE0A 1TIUA 2R29L 3DX8B 3L1OL 2I26N 4PJ5D 3QQ3B 2ZUQC 3DBXA 4KK8C 3L3OA 4U7KA 1FRGH 4XNXH 3RVTD 35C8H 2DQIH 1I8MB 1QFOA 3VD4A 2QQLL 4E41A 1FL6B 5K59F 5EN2B 2EIEA 4Q9RH 3NAAH 4YDLB 3HN3A 1MFCH 4I0KA 5C0IA 4IJ3B 1ZS8B 3S3SA 2ZSVB 1I7UA 4L4JA 5BV7H 3T4AA 1CE1H 1JF1B 1QVOB 4F7EA 2OK0L 4X7FC 4OD3L 1A1MA 4NJAH 4TNVF 4OCNC 3CSYA 3IJHB 3MO1B 3DYPA 1OWRM 2WWKO 1BBJB 1JV5A 1B3JA 1Y0LA 4R2GC 1I1AD 5FYJL 2AK4A 4JFFE 2GTZB 4GRMB 5TE7H 5T3XL 3FQXB 5E8DH 1IQWL 1JK8A 2YPVL 1DBKH 1JNNL 1CVSC 3UTTA 5IJKC 3BW9B 4M61B 2BNRD 4AL8H 3UZVB 1ZANL 5F71A 1NBYA 1HN1A 2L7UA 3S96B 1EHLL 1A3RH 1F97A 1N8ZA 4PJDA 4X6CF 3FMGL 3QFDA 3BEWA 2X4RB 3BHBA 2FLBT 5FUCC 2EXWD 3K74B 1Z0MA 2VDOH 5E8PB 4I3SH 4Y2OA 1K3IA 5FUZH 3B9AA 4HAGA 3DROB 3EKCA 1U8LB 5HI4C 4DAGL 1KPVB 3KYKH 3QO0B 4OD1L 1KPUA 4DTGH 4QYOA 3MLPA 5D7KD 1NJ9A 2KKQA 2VISB 4UU9A 3CVHL 4XAWL 1MFEL 5H8DA 5E2WL 3RVUD 3QQ9D 3WS6C 3ULUH 1GZPA 3L7FB 1FE8L 3L5WB 3WXWL 3SDXA 4PYGA 4XRCB 5IEHA 2CKBA 4TPRH 4F3FA 1YY9C 2X4UB 1KPRA 3VGGA 5C08B 1RZJC 1T66D 4Z7UA 1HHHA 2CKBH 3OMZA 2OJEB 1WWAX 3CFEB 4JFYB 1UJTA 5ICZA 1F00I 3KXFB 4NUJB 3O4LD 1GZQA 3H0TA 2PXYD 4PV8A 5FGSA 2DWEB 4U1NA 1JZ2A 2HKFH 2BVYA 4FMFA 4X4YA 5KN5A 3KDMB 1R0AL 2G5RA 3JV0A 3CU1A 2YUVA 4PJAF 4YXKL 2PYFA 4CNIB 5T1KB 3PL6A 4PJCA 4KMTH 4KHTH 5AD0B 4Z9KB 3FO9B 4LGRB 4KPHL 4P2QE 5CBEB 3UCRA 4KH2A 1WZ1L 3INUH 1H5BB 5BVPL 5C09D 5I76A 1FHGA 1OF2A 3TESA 3P4OB 4WEBH 1EVTC 4AT6B 3TYGH 3LN4A 2A74A 1G6VK 5E7BA 1U8OB 5E6ZA 4WHTB 5EZOL 1MCFA 4LARL 1G7JB 4NRZA 4X4XB 5D1XC 3TGXA 3V6OA 1A0QH 3FB7A 2I9TA 5FM5M 1YPZE 5I73C 3QIUD 2Q3ZA 4JFDB 1H0DA 2CGRL 3GM8A 5IQ9B 1NFIB 1IAIH 3JWOL 2A9MH 2D31B 1RIUH 1GIGH 1BVKA 1XF1A 5HDBE 5E7FA 4UT7L 2OR9L 3BT2H 4JKPH 3O8XA 1XF5A 1YEHH 2I9LB 4FG6D 4CN6A 2MHAA 3JV4A 2HJFA 5ALBH 5K33A 3MA7B 4M48L 1MREH 4PJXE 3HE7A 4HUXA 2E7MA 1IZKA 5D9SA 3FT2A 1MLBB 3PNWA 1L9NA 4UILH 2IFFL 4EDWH 3V0VB 4WI9A 4G6JH 4GG6B 2XOTA 4OV5A 4HPYH 4KKAC 1XF3A 4EKXA 2Y36H 1F4AA 4NFDA 5HHOA 2VERN 4L3EE 5DJ8A 2GJZB 3HC4L 5GGRB 4APQB 2XQBH 3CC5B 3RUGB 1R3LA 3FQNA 3RZWA 3ZMRA 1JWMA 1SY6L 4QY8B 1FG2B 4XGZA 4OGZA 4ZPVA 1JYXA 1BQHB 3MUJA 3RVXD 3SE9L 1QYGH 4S1DC 5F7HA 1TJIH 4JQXC 3QDMD 2DYPD 3VDCA 4QGYA 3W5MA 2FEDD 2XKNA 4FXGB 4LLQA 2C3VB 2K1MA 5DJXB 1XZ0B 2BVPB 2GSGA 3CH8A 3WE6B 4PGZA 5JOEA 4FFYL 2OSLB 1Z2KA 5DS8B 1G6RH 5SWSD 5BS0B 1KNOB 5B4MC 4PRIB 4CDGC 4G8EA 1H3PL 2EKSA 3O4OC 2OJZL 4NUGH 5DA4A 5IF0A 1IEAA 5FECB 3RTQD 3WXVL 2JIXB 3KYOB 1MHPH 4XPFL 3D87B 2VABA 2OLDA 2WBJD 1OPGL 4IDJH 2YZ1A 5DVLA 1JI1A 1HCFX 2KZ1B 3BJ91 3LKRB 3X11B 2E8ZA 3TA3C 3SJVE 4NQVA 5JHDE 5IG7A 4G6AD 3I84A 5SWQA 1TQBC 3B8SA 1ZAGA 5E94B 4OF3A 3QEQE 1MI5A 3S98A 1BBDL 1PY4A 2E27L 3AREB 1MJJA 4HUWB 5BQ7A 5CEZH 3QEHB 1LO0L 4I8DA 4XMKL 2Q1EA 3GRWA 3OKDA 5F44A 5E5RB 3O3EA 1WZLA 3WHXB 3QJFB 3GRWH 5DK2A 2YRPA 3NVQA 1L0XA 1DN0A 4KJWD 1S78C 3W39A 1LE9A 2YBRA 5DTFB 1E4KA 4CL7A 2NNAB 4FMKA 3LOWA 1UYWH 2PYED 1A2YB 3ELAT 4FQXD 1ZT7A 1NQBA 3HLAA 3V4UL 1ADQA 5DWUL 4KK5C 3OKKA 5GJSL 3P9WB 4HZAA 3BPLC 4KJPD 3MRGB 3DHJA 1IC4L 2MFNA 4Y5VC 1EFQA 1MPAL 1ADQH 4NQEE 3V9FA 1OM3H 4MD5A 2X1PA 4Y4HA 4JJ5B 3DURA 2DLTA 2VSCA 3QUYD 1RVFH 3T3PF 3WUWA 3A6BH 3Q48A 3T65B 1HHJB 2FEEI 2XZQH 3CX5J 3GJFK 2F74B 1RV6X 4MNGA 4Y2DB 3HZKA 5DJ0B 4JFOB 2V2XA 4UBDC 3D69A 4GAYB 3MRKA 5EBMA 1HINH 3DARA 3QUXA 1ZHKB 2ESVE 1SVCP 4JGJA 1RZKL 3JSSA 3RWFA 5J12B 4MDJB 2JJTC 3U36A 5D7IE 4L3AA 1F13A 4XXCA 3VXNA 5I1EH 3REVA 3W0WB 4C56A 4JGMA 1F2XK 5D7JC 1DQJA 3NH7H 1X5YA 3O2VH 5JXEA 3ARSA 1S7RA 1PEZA 5C0RH 4JFPB 5MP6H 3NZHL 1QBLL 1I85C 4XCYB 1VDGA 1NCDH 4P48A 4ZQKB 2X89A 2XG5A 1PBYA 4N8VB 4YFDB 1IC5L 3PGDA 3CVHB 4X6CB 4UAOB 3STZA 1MCOH 1YQVL 5ECJE 4M6NL 4ODWB 3G08A 4IRJA 4O2CA 1LP9F 1F3JA 2XN9E 1UXSB 4LAJH 4PYHA 1N2RB 4IRSA 3ZTJH 4HKBA 1D6EB 2XYCA 3IJSA 3KPPA 5IMOA 1UM6H 5CBAA 5JZ7D 1AGBB 4H25B 2QSCL 1AO7B 4MXWH 3QIBB 5LJYH 5D72H 3L3DA 3UROR 3MNWA 4HT1L 4LNRA 4Z18A 4ZXBB 1R5VB 4QHMA 3I3BA 2JJSC 2PCPA 1AC6A 2AJUL 2HT3D 5HHVL 5CSZA 4A6YH 5EOTB 2C7UB 4I0PA 3NFSL 5DDHA 3QXDA 3IT8D 3O11A 2G60H 2Z8VC 5IWLA 4M7LT 3ALWA 4YNYA 4I2XE 3F7PC 4OGYH 2YMXH 1A64A 4RGNC 1YA5A 2AJZA 2RGSA 1LDPH 3GMRA 3SGDI 4LSPL 1P4IH 3KXFD 1LILA 4U6TA 4JB9L 2ATKB 2VITA 3C5ZA 2HYMA 3RBGA 4S10A 3BRFA 1BWMA 4RAVA 4XI5C 4ODSL 2HRLA 4GRWE 4DN4L 4KUCF 4M7JL 4NQSA 5AZ2H 5IVXE 3WLBA 1Q0XL 4JZJC 4LCYA 4F9LC 1KIPB 1DQML 1H3VA 2R1WA 4NGHH 4KAQH 2NPLX 3PWJA 3GMNA 4PJAB 5I1AB 4POZC 5JDSB 2AI0H 1EAJA 4NT6A 2QJDA 3GSRA 3CIQA 1GGIH 4F7CB 1NCCH 3GM0A 4KTYA 5T1KD 2O93L 1SYVA 2Z9TA 4YGVA 3NFNA 4KI1A 4OFIA 1QRNE 3MLYH 2W91A 2L0DA 3IAQA 1G7MB 1M1SA 4HKZB 5DFVD 3EAKA 4K7FB 4RIRB 1UGNA 4LSVL 4W68A 4ODXB 2P8MA 1J0JA 3TV3L 1IBGH 1ZVYA 4N5ED 4JDTH 4FZ8H 5F9WB 2A73B 3FN0H 1DLFH 5MI0C 4MNQE 2G2RB 3KYNA 3B3IB 4MB5A 4D0DB 3REWA 3ES6B 4LSSH 1NMBH 1EDQA 1ULVA 1W72A 2GCYB 5KJRL 4NDMA 4NN6B 5D2LF 5I1CL 3L3GA 1XIWC 3QSKB 4JFDD 4NRXB 3OPZL 2H9GA 2EDYA 4OV6F 3HA0A 4Q9BA 1H3WM 1EZVX 1UENA 4PGCA 4MAUL 1U92A 4NQUA 4XNYL 4YE4H 3I9GH 4QRQB 1HILB 1F90H 5KW9H 1EHAA 3WFCL 1U6AH 5EZIL 4QLRA 1GXEA 1CQYA 5DQ9A 4KRPB 1IGYB 1FRGL 35C8L 3NCJH 5AG8A 5IJKA 3MRFA 4HF5L 2AEPH 1IGJB 2HN7A 3ZDXF 3CCHB 5A16A 3MCKA 3WL9A 4Q9RL 2ZOLB 3FL7A 2OXHA 4P3DB 1I3UA 1D5BB 4DK3A 3MUY1 5FUOL 2YD4A 4D9QD 4ZSOB 1FFPB 3PABB 5C92A 4RA0C 1CE1L 4Q6IA 5KVFL 3S3PA 4MD4A 4HJJL 1AKJB 3T2OA 4PJDF 3QEGL 3SGKC 4APQD 3EO0B 5IB2B 3KLAB 2ARJA 4JHWH 3TIDB 2Q6WA 3VFMB 4LAQH 3HE6C 1ZWIA 3P77A 1FLRH 3W9DA 4BUGA 1EZVY 1WUNT 4PJ9A 2OTWA 2D0FA 2EEDA 5F7DA 1UWEL 1LO2H 2M2DA 3TYFA 2PR4L 3NTCH 5HVHB 4L4TE 5BS0D 4FFWC 4L3EA 4WFGD 4PRID 1ZTXH 4WUUD 2VDOL 3DGCR 1J1PH 5KTEL 5E8OB 2JIXD 1I9JH 1MVFA 4I5BA 5HJ3B 43CAB 4DEPB 1F5WA 2R1YA 1T1ZA 1YEJH 3GMOA 5E9DE 4OFPA 1NL0H 2CUIA 4LU5L 2VMFA 3EHBD 5E2TH 1JTTA 3SDXF 5EORH 3TN0B 1K4CB 4NZUH 5EO0A 4JCMA 3S3JA 3UPRB 2A6KA 5C0FB 1P7HL 2NX5B 2AJXH 1VGKB 5BRZE 2ADFH 5KSBE 4DTGL 1RZ7L 4Z7UF 5KSAA 2PW2B 4YDIL 4ZAKD 1JNLL 1KEMH 3B5HA 2ZZUT 1JWUA 2OS7A 4WDIB 4XNMB 4ODUA 3ARED 2VC2L 3ZT5A 4XVSL 3VH8G 3VXSD 3RWJA 5DEFA 3PQYB 2ADIB 1MQKL 3OR6B 4JO4H 8CGTA 4ZUWA 4PBVC 2R56L 2VO5A 4HLZH 1FL5A 3DECA 1XCQA 1X5LA 4O2EB 5IB3A 1PGRB 1AGCA 1T5XA 1KIRA 5GGSB 3F65A 4KKCD 1TJHH 3SJVA 4D0CB 5JHDA 3AC0A 3HPLA 5BO1H 1RUAL 2X9WA 3BVNB 3MGTA 4LLDA 4PJCF 4WFHE 1RZFL 4G7VL 4WU7B 1VPOH 3QUKB 1RURH 2HVJB 3IFNL 3GMQB 4YIQB 3RDTD 4QHLA 5D1XA 2HKFL 1BLNB 5EU7C 4L8BA 3IU4L 4BFBD 5IJVA 5KSUA 4M7KH 1KCSH 4PR5A 4PY7B 3R4DA 3GKWL 4GKZA 3BH9B 5T3XD 1QG3A 4M8VA 3HR5A 3MNVB 2J4WL 4L3CB 4NZRH 4DUXA 3HB3D 2ID5A 3OV6A 4Y2DD 2FJGB 4LSTL 1CU4H 5C2UB 2N4IA 2VLME 1B0WA 3INUL 3MZGB 1DP0A 3EGSB 4ZFFB 3U7WH 2BHYA 4NKDB 3X12B 4OCWL 2VXQL 3C8DA 1O5DT 3MRPA 4MA7L 3TCLA 4R8WH 4TUJA 2F58H 2EEAA 3F58H 2BDNL 1V7NH 3MRBA 4ZOCA 3ARDC 4ZFGH 4PBWD 2KDGA 1JPST 1OLLA 3MBEB 3VXMB 4ZUUA 5TFSL 3S37H 2FL5B 1YNLH 2ZG3A 1CXFA 3D9AL 3ZKND 1F42A 4RNRB 1QSFB 1MWAL 2J7LA 4E0RB 3DUUA 2ESVA 2Z92A 4UI2A 2CDEA 4Q2ZA 5JOPE 3SO5A 2AK1H 1S9WB 3IJYB 4JRXB 1DANT 3F62A 1SBSL 1QHPA 4O58L 4XNZB 4KDTC 5D7IA 3DVNA 3PDDA 3QAZB 2DIAA 4JZNB 4K8RC 3UTPE 1LP9B 1IAIM 3ARGB 1A6TA 2V17H 4GBXB 2BOBA 4JFZH 2IF7A 1PAMA 4OZ4A 3IAGC 1MREL 1INEH 1N26A 1NCAH 3ARWA 4XPTH 1QLRA 2OP4H 3AY4A 3TVMC 4IS6A 1FO0A 2QR0B 4MA8L 5KG9A 4DZBA 4NCC1 4UILL 1JUFB 1E6OH 1V3LA 1NCBH 3HC0A 3SO3C 5I75B 1FO0H 1T2QH 3WD5H 3E3QE 3QIBD 3WIHA 2L4OA 1QBBA 2BP3A 1YECH 2H2PC 2HA1A 5GRJH 5EU6E 3UMTA 1S7QA 3WIHH 3Q6GL 1NBZA 1X7QB 4LSQL 3RVVC 4HS3B 5E8EA 4UB0H 5C0AE 4ENED 2XN9A 1NBVH 2FATH 1JTPA 2APBA 1EVUA 1OSPL 5I74B 5DMIH 4XHJC 3SPVA 2HG5A 3B6SA 3FN3A 1YC7A 1TCRA 4QRUB 32C2B 1QA9A 3UTSE 4HXAL 3N1GC 1ITCA 1A21A 1FZMA 4GSDH 5D8JL 4UQ2B 1DBAL 2YD9A 4K2UH 1UKQA 2GSIB 3ORJA 4PREA 5DMGD 2IMNA 2QEJA 4CW1B 3LD8B 3MR9A 4P46C 4BH8B 4RQQB 3X13A 2OXGA 5GSVA 3V52L 5FGBC 1TVBA 4YXHL 2DTMH 3T0DA 3RZCB 5GGVH 5GS2H 1MRDH 1NSNL 2JCCE 4HC1L 1BJMA 4WFED 3FFDB 4F7MA 1W8NA 5E2VH 3TBVB 2IAMC 2BY0A 4I2XA 4PY8J 2ATPB 3LKSB 4OQ1A 5C0CB 3BN9D 4I18C 4D94A 3C6SB 1XAUA 4PV9B 3CDGA 1QR1A 4JVPA 3VWKA 1CE6A 4J8RB 5J11C 3W9EA 5LCVL 3VE0B 5IVXA 1EMTL 4MCYB 1WISA 3VW3L 2IC2A 3L3OB 1H3TA 4F37F 4G9FE 1OL0A 4C4KT 4E41B 5D2LB 3N1QC 4P23D 4XP1H 1QRNA 5C0IB 3GJFA 2BY3A 1I3VA 2WWMC 3U30B 1I7UB 3O2WH 2C26A 3T4AB 3GJFH 1NANH 1FFQA 1A1MB 1C16A 4MSWB 1CGVA 4NZDA 5I1JH 2C9AA 5LGKA 1PZUB 2VJXA 1JV5B 4K7PY 2DBLL 3GFUA 4KRPD 1INDL 2AK4B 4MNQA 4V2CB 4X5WA 1IC7L 4OLWL 2ZPKH 5ICYA 1JK8B 3NCMA 2UZYB 4PJ8D 1BHGA 3L9RA 1DDHA 3I3EA 1AHWB 5KANG 2YKLL 1RPQA 3WIFB 3ZKXC 2NR6D 4M62H 1JMXA 1JZ6A 5F70A 5IR1B 4X7SL 4PJDB 1N8ZB 5F9JA 2WBKA 3QFDB 3BEWB 2R23A 1AKJD 1OD9A 4Y89A 4EI6A 1FAKT 3GUTA 5DRWA 4UIMB 5H37G 2WUBH 2MPAL 3GBNH 3UJTL 1MRFL 2DN7A 3RHWF 4P4KC 5MP6L 3BP5A 5JW4R 2H1PL 4QTIH 2E9IA 2CH8A 2Y1VA 3OKYA 4UINL 4QYOB 2GJ6E 2R4SL 4LPYA 2DQHL 3CDCA 4NKIH 1NJ9B 5ETUA 4GXVH 3B9KC 4GRLC 3KR3L 4UU9B 4K07A 1U93B 2PO6B 3MOAH 4DN3H 4Z7NE 1OAXL 5D1QA 1GZPB 2E7BA 1FH5L 2WP3T 4Y7MA 3SDXB 4FQ1L 3UBXA 2CKBB 4F3FB 1NPUA 4YHYC 4KKLD 4KROB 1KPRB 1QLFA 3C09C 4Z7UB 1HHHB 3WFBH 3OWEA 4HIIA 2NX5D 4NPYA 5ICZB 4FTVA 4YK4C 4OLXH 2BOCA 1A6ZA 1GZQB 3FB5A 3O9WA 3MV8A 4PV8B 5BXFB 2F8XC 1C1EH 3QO1A 4U1NB 1K6QL 3PQYD 3W2DH 4NC0B 4X4YB 5KN5B 4GAGH 4JM4L 3LH2L 1J86A 1KEGH 5E9DA 5ICXB 1JZ3A 5HHQA 2LTQC 3X3FH 4XPAL 3PL6B 4W4OA 4PJCB 4LK4A 1HSBB 5BRZA 3GDBA 4AMKL 4GQPH 4PJHE 4XP5L 3B2VL 3HZVA 2XWJA 3MLZH 5I76B 4RMTA 1OF2B 1K3ZA 3MMEA 4R96A 5KOMC 3RVTC 1A7RH 1J8HA 12E8L 4EXKA 3LN4B 3T0VA 2A74B 2OTUA 3ULVE 2LAAA 4GOSA 5TDNA 3BGFB 4NBXB 1JHLH 1K9TA 1X6LA 5I8CA 4M6MH 5IBLD 3O2DA 4NRZB 1I9RL 4Q58C 2I9TB 3KPTA 4IOSD 1MWAB 3FHAA 1MQ8A 4HWBH 3O2DH 4WW2A 3GNML 4DKFH 3EYUH 4OCXL 2YRZA 5F1IA 1H0DB 3U1SL 4JM2F 3S7GA 4OCLC 5FEBA 1DVFD 1NGYA 4JDZA 4U1HB 1D9KB 1CDIA 1DR9A 1IBGL 3MRCB 3TJHD 5ID0A 1TMCB 2HFGH 1ZLUK 1BVKB 5MENE 4NHUA 1CGSH 2DLFL 2DWDB 3O8XB 4NM8H 2MHAB 1QFUL 4NO3A 3T0EE 1RFDH 1B88A 3DYMA 3MBED 3HE7B 4LSSL 3V4PH 5LXGH 1NDGA 5D9SB 5EUKA 3HS0B 1MCBA 4FZEL 3FT2B 3PNWB 3BD4A 1VCAA 1YPZF 2EXWC 4X9HA 1FGNL 1W72L 3CDYA 3SGKA 1MIEH 4OZIE 2VDKH 3IS1X 5D5ME 3VGHA 2E7LA 5HHOB 3HE6A 4IRZH 5HHPA 1QNZL 4JRXD 5J57B 3WN5A 3FQNB 1U9KA 1U6AL 3FHQA 5HDBF 3GO1L 4ZPVB 5KVGL 1A3LL 5JO5A 4GBXD 3SQOL 3LIZL 2BNQA 3FCTA 4Z95H 2AEPL 4OCRH 4OJFL 2DMCA 5D70L 4EQ3A 2DIBA 3T4YA 2XKNB 4LLQB 3QEUB 5LGHH 3QXUA 3MA9L 4PJXF 2GSGB 2FJHA 2UVEA 1MFAH 1VFOA 5GJTH 2NY1D 1S9YA 2EDBA 2R0LL 4XCFL 3RVUC 3ETBF 5MHSE 4G6FB 2ERJB 1OSZA 3O3UN 4G8EB 2EKSB 4MHHI 3NCEB 5IF0B 3VI4E 5LKNA 1I75A 4L9LC 1T03L 5IFJA 2VABB 1P7KA 4DKAA 2VXTH 3C5JA 4FQQA 5JA9A 4M7LL 1SM3H 3MRNA 4PD4J 2OI9B 1FSKC 3G9AB 1F8TH 3GKZA 4NQVB 1OP5K 1TTUA 5IG7B 4LP5A 3KYMA 4WI3A 2PXYC 5DUPH 4U0QB 5SWQB 2IGFH 2YOCA 1F3RB 1MI5B 5HGGS 2AKRA 1MJJB 5BQ7B 3CXDH 1OD7A 5LAXA 4GKNB 5EUOE 5ISZE 3OKDB 4RMQA 3O3EB 2IH3A 4KUCD 5GRVL 5EU6A 4QHKI 4U1GB 2EDLA 2QSTA 4HWNA 5IGXH 2X4OA 1T89A 5M94B 4P4RA 4M3JA 5SV3A 4PLKD 1JPFA 5C0AA 5IQ7H 3EZ8A 5IESL 5KSVB 4BFIA 1DN0B 1A1OB 4F58H 2VDRL 4U4BA 3W39B 1G9MC 2IJ0C 4HX1A 5L88H 1WC7B 3V5KA 1LE9B 5FA3A 2D4FA 4S1RH 2VXSL 1BQLH 1ZT7B 3BPNB 1A6UL 5C0CD 4AEHH 4DKEL 1FJ1A 5E6IC 3OKKB 1LK3H 1UA6H 3K80A 5D6DC 3DRTA 4MD5B 1HIMH 1F6LL 3GB7A 3PV6A 4PFEA 1JN6B 3D25A 1DJSA 4WCYL 1JHTA 1UH2A 3QIUC 1YEIL 3WUWB 1R6VA 2KQMA 1HH6A 4EQ2A 2EO1A 2MQ0A 5BZWA 1T0PB 4I3GA 1BAFH 4MNGB 2KPNA 2V2XB 1WK0A 4YWGL 2MCG1 3D69B 3MRKB 4PLJD 5MEOA 5EBMB 4E41D 3QUXB 5C0JA 1SJXA 3QG7L 3RWFB 5HHME 4XMLL 3U36B 5JNYA 4KKNA 5F8RC 3VXNB 4Z8FH 3REVB 3TWCL 4C56B 1C08A 3WFHA 1T7YA 1NKRA 1YNKH 1DQJB 3MX0A 2E8YA 5HYSA 1KLUA 4OTXH 4LVNC 1S7RB 4CMHC 4NSKB 2CLZA 4NBZB 1JYWA 2AK4D 4D9LL 1LGVA 4ONOA 4G9FA 2D7TH 4GW4A 5A2FA 3Q3GB 5DUBA 2VXVH 3BPOC 1G9NL 4KZDH 2P45B 3P0VH 4HCRL 5EU4A 3OZ9L 3PGDB 4YFLI 4RDQF 3RVXC 5CZVH 3STZB 1JPTL 4K8RH 4I3RL 4Y1AE 3GK8H 4LLVA 4U2ZA 5D7IF 2N56A 1I8KB 3KS0H 1QFWH 2FEDC 3O4LE 4HGMA 3CZFA 4IRJB 5AWNL 4ZFGL 4XP6H 1F3JB 4LRIA 4RWHA 3MXVL 4JKLA 1P53A 2FCBA 3S34H 4JFFB 3M8OL 4HKBB 4HUUA 4DVRH 1QBAA 4RFEA 2C3HA 3IJSB 3KPPB 2D7NA 4YR6A 5IMOB 5J3HC 3I02A 1FORL 4Y16C 3VJ6A 3U6RA 5CBAB 5INCA 4JE4B 2AEWA 3QPXH 1T21B 3DV6A 3RTQC 5GRUH 3O3BA 3T2PA 3MNWB 4LHUB 4XBEL 4LNRB 2WBJC 3D48R 5EOCH 2X6MA 4MCZA 5F89A 5J7CC 4QHMB 1MCEA 2PO6D 3EOBA 1RK0A 4UUJA 4F9PC 4N1EA 3EYVA 1ZHBA 1P4BH 4GQ9H 5CSZB 2EE2A 2ZCLL 4I0PB 4PB9L 4LRNH 4G6AC 5BOPA 2X42A 5DDHB 3QXDB 5JTWA 3O11B 1F4YH 2D4DA 3SDAD 1WWBX 2GW5A 1E6OL 4KROD 4YNYB 3SGDH 3FOMA 5TPWL 3EYOA 4EI5A 3WD5L 2AJZB 3EOTH 5SV4A 3GIZH 5GRJL 4KJWC 4DFHA 2BVTA 4RAVB 5KBNC 3QQ4B 1U8NA 2DQTL 5IBUB 2KQNA 4NQSB 3WLBB 3C6LC 5CAYB 1IAOA 2R1WB 3IVKA 2IBZY 3H9SE 2EH8H 3PWJB 3CGTA 3ZE0E 2X1OA 3HMXL 3ZZ1A 4K9EC 2XTJC 4FQXC 4B7IA 4N0UE 1AD9A 1DQDL 4I18A 3JUZA 4NT6B 1UM4L 3GSRB 1HH9A 2P5EA 3AS1A 1SYVB 1XGRA 4YGVB 3NFNB 4ONGL 4F15B 2FO4A 5BMFH 3Q5YA 5IVZB 3PP4H 3IDMA 4QOKD 4LMQI 2W9DH 4ERSL 3QCVH 4P2OD 3T2NH 2P8MB 3BRDA 5I17A 1AFVL 2Z91A 4PJIA 1AXTH 2QV2A 2O5ZL 3PWPA 3PHOA 4GRWF 4ALAH 3IF1A 1RUKL 1T83A 1KACB 5IVXF 1A47A 1MRDL 1IGMH 1KCRH 4YDLC 2V5YA 3KYNB 3F6IA 3MBXH 4IJ3C 3MTRA 3REWB 1WFNA 4Z77A 3SEPA 1W72B 4OIIL 1IGFH 1YMHB 4NDMB 5GXBB 1K8DA 3L3GB 4JM2B 4P2QB 1F4XL 4H0IA 2A77L 4M02A 4E5XA 1X5FA 1D9KD 2Q20A 4FABL 5SX5K 1EIBA 4HHAA 2IADA 3O8XD 1JPSL 2FJFB 4HG4K 1CDYA 3IKKA 1I4FA 3HE7D 4B53A 5A16B 2CJUL 3MCKB 3WL9B 3L3JA 5L2KA 3O6LL 2YPKA 1B0RA 2F8OA 3KJ6L 1I3GL 4P9HC 5HDQH 1RU9H 1CFVH 5CP3A 1F6AA 4Q6IB 1ZXQA 3OKLA 2DOCA 2HVKA 3RPIA 5B21A 2P47B 4PP2A 2EH7L 2YWZA 4P4KA 2ARJB 4WRLA 1JHKL 5MENA 1INQA 1CYGA 4DGIH 2Q6WB 2GT9A 3K3QA 3R8BB 1ZWIB 3P77B 5JZ7C 3BSZH 3W9DB 1E6JL 3MRQA 4XNQA 4AQOA 3EJJX 4XVJH 4PJXB 4ORZC 2GK0B 4Q9QL 3N1FC 4PJ9B 2OTWB 2GYSA 1NAKL 2H41A 3DMMD 3FRPA 5TDPA 3V0WH 5F7DB 1QLEL 4UV7L 2HT3C 3VFNA 1A7NH 2GEEA 3TYFB 2IG2H 1MCIA 4OZIA 5I6XB 4G6FD 4MXQD 4L3EB 3IYLW 5FB8A 4U1JA 2OMNA 2H26A 2CLRA 3OJ2C 4I5BB 4OZFA 3SDYL 2UUDK 1GGTA 1RZIB 1T1ZB 3GBNL 4YEFA 4S0TD 3GMOB 3G6JA 3WFDL 5E2UL 1CS6A 4HIXH 3PGFL 4LSRH 3L5XH 3BP6A 2VLJE 2A6KB 2QHRH 2ZJSL 3JWDC 1DL7H 4RGOL 2H32A 2PUQT 3KG5A 1X5XA 5KSAB 1CR9H 2BY2A 5FYKE 5DJ2B 1JWUB 1RHFA 2H32H 4ZODA 4KFZC 4J6RH 1MI5D 4ODUB 5I9QB 4YHZH 4DN3L 4RMSA 5ID1B 1UEMA 2HT2D 3RWJB 5DEFB 1D6VH 3ZE2E 2Y06H 5GGTA 2WANA 2P5WE 2K3TA 4ZUWB 5JQ6L 1FL5B 2GFBA 4WU5A 1XCQB 5DFVC 5GGTH 2KL6A 3FONA 5IB3B 1AGCB 1H5BC 1T5XB 1KIRB 2JLLA 3RU8H 1I9EA 1J0KA 3SJVB 4M43L 5JHDB 1IEBA 4X9GA 5L9DH 4LLDB 3MGTB 3H8NA 4P2YA 2J8OA 5I1KH 5FGCE 5KSBF 1CFNA 4OLXL 4U3XA 4OCMC 3U0WH 4O2FA 4GAFB 2YUZA 5FM4A 2DQFB 1KBGL 3ARFD 5EUOA 4AQ1B 1IT9L 1OGTA 4QHLB 4ZTOH 1JWSA 1JF6A 5ISZA 3BZEA 2FYYA 3KPQA 3W2DL 4L8BB 5E1AA 3DXAE 5IJVB 3KPSD 2WW8A 5KSUB 5MERA 4PR5B 2CRYA 4NNPL 4OGXL 4GKZB 5ERWA 2I25N 4Y0GA 1JCKA 2EO9A 2X1QA 3K4DA 3HR5B 1KB5H 2FZ3B 1I1AA 1NUGA 4LHUG 3TT3L 2GAZA 1CXIA 5JOFB 1JRHH 4WW2F 3QUXD 3U7YH 3ZHKA 1RUPL 5F1KC 3HMWL 2XA8H 4L8SA 5GPRA 3MRPB 3TCLB 2BNRA 4TUJB 1YEKL 1I3RA 1T7XA 4C56D 4MQTB 2QQNH 4NQEB 3MRBB 3MODH 1MFNA 2CK0L 2GQHA 4ZOBA 5JXED 1EV2E 2APFA 4ZUUB 4YDKH 1H8NA 4TULL 1ZLUH 1FL3A 2ITDA 4APQC 2XXMB 3HTLX 3DUUB 2ESVB 5GHWL 5IBUG 2Z92B 2X89D 2CDEB 3VXRE 4HK0A 4OM1H 2DD8L 1PKQE 5D7IB 4YHLL 3DVNB 2HLFD 5ILTL 2O5XH 5JXAL 2IPKA 5EDXA 5KOVC 5J6GB 4UDTA 1UZ6E 2BFVL 4OZ4B 3OXSA 4MJ4A 3M45A 4JO3L 4TNWK 15C8L 3IDNA 1QLRB 1XR9A 1TJGH 1FO0B 3K4ZA 2FBOJ 4JFFD 3RRQA 4DZBB 5HYJE 1G1YA 3QHFL 3FN9A 4OCYL 1UWGL 4R0LA 5LQBH 5DMJB 3MJ9A 3ZO0A 4K71B 2P46B 1CT8A 2EEBA 1MEXL 4L9LA 2CK2A 5DJ6A 3MJ9H 1C7SA 3L5IA 4XMPL 1EO8H 4LHUD 2QSVA 3R1GL 3EHBC 1S7QB 3BH8A 1RULL 6FABL 1DBMH 1YMME 5E8EB 1J0IA 3P30H 3O4LA 3CFCH 4KKBD 1NC4A 2VZUA 3A6CH 4GAJH 2XN9B 4I0PD 1WWCA 4Z95L 5T33L 4OCRL 2YD1A 3D39E 3SPVB 2UYLA 2HG5B 3AREC 3B6SB 4RGNE 1IILE 5GJTL 1QA9B 4BSWB 1FZMB 1JIBA 2VOTA 4JFHD 3HCVA 5KANI 3QQNA 4ODHL 5DT1H 2GIYA 3MR9B 5J9PA 4JQIL 5GSVB 1WAAA 4XP4L 1OP5H 1TVBB 4KTDH 4DWHA 1AGFA 1CL7L 4KKCC 4TSBH 1SM3L 2DQUL 4Z0BH 4K55A 4MJIE 3CMOH 4K94L 3DO3A 3LQZA 4F7MB 4PBXA 1NMCB 4I2XB 3O0RH 5EWIH 2ZUTA 1J87A 5T5FL 1P69B 3U0TA 2F5BH 1QR1B 3VWKB 1CE6B 2J6EA 4KDWA 5D96B 4TNVK 1Z3GL 3ME0A 5J06A 2OR7A 4GRWB 1MHEA 2J6EH 3HB3C 5IVXB 4Y2DC 4PJBE 1CFBA 3L95A 4HKJA 3H9SA 3AB0B 3RIAF 5F7EL 3TJEL 1FAIL 4N0UA 5J12C 2JCCF 1U8IA 1QRNB 4GLRH 2V5MA 3GJFB 4JM2D 4P2QD 2DQCL 3LB6C 4RFOL 4LPCA 1R3KA 3DLQR 2VZ1A 4FFVD 5B3NA 2LFGA 1C16B 3UZEA 4QRRD 4O5LH 1SEQH 3ZKNC 4WUUE 4PY8I 4MNQB 1X5ZA 1UCBH 3RL1A 4MZ3A 4MZ2A 5GZOD 4OKVB 1O0VA 5ICYB 3H9ZA 5F8QC 2QLVB 1MY7A 1Z9LA 4UAOC 4KVNL 4P49A 3S5LG 3L9RB 1DDHB 1K4DA 3IKCA 2DYPA 4G8GD 2R2EA 4HLZG 1Z0NA 1CBVL 3HI6H 3LQAL 5F9JB 5CD5D 5FIEA 3NACH 3MXWH 3GUTB 4OTXL 3RA7L 5I8OH 2LU7A 5DK3A 3PF2A 3VXSE 4HQQL 5IB1A 4CVZA 1XGQA 3BE1H 3BP5B 1JNHA 3QIBC 2OQJA 2WQRA 5DHYA 1I9IH 3GI8H 4PJ9D 4ZXBC 2RR3A 1MNUH 4EJ1C 1R3JA 4FQJL 1PQZB 5CZVL 4OI7A 1XT5A 1NBQA 5ETUB 4ENEC 4UOW1 5SX4I 4H1LA 1CD1A 1D5MA 1BWWA 5ESQB 1VGEL 4XP9H 5D1QB 5DC0A 5E4IA 3O6KH 4J3OC 4R97B 3V0AC 4ZS6D 1R5WA 2CO6B 3D1MC 2M8XA 4NIKB 3CVIL 3LS5H 4AH2A 1FYTD 3I50H 4UOW0 1G0XA 4PLNC 4PB0L 4FQLL 3LCYA 5KVDL 4Q9CA 2ORBH 1QLFB 5FYJE 4RISH 5I30L 5T3XE 3DVIA 1WIOA 4HIIB 3H6JA 4NPYB 4UT6H 4YLQT 4OQTH 3LEXA 3BO8B 3KPOB 5KSAD 4FTVB 1OCWL 2A0LC 1RUQL 2O5YH 2EDRA 4LQFH 3SE8H 2BOCB 3QCUL 3VGEA 4L4TB 4LPTA 3O9WB 4OF6A 3MV8B 1CG9B 5DRXA 3QO1B 3DX7A 4Z7NF 3OSKA 1DN2A 2ZOKA 3T1FB 2CPCA 3C08H 4K9EH 4NOBA 2AJ3A 5GZND 3NGBB 1QSEE 5CGMA 5E9DB 5DSCA 4RDQG 3JWOC 5FDYA 5C8JB 1RUMH 3DX8A 2VLJA 3QUYA 5BRZB 3QQ3A 5KSBB 1ZGLM 3SJVD 5IVNA 3BFOA 5JHDD 5B8CA 4X8JB 3GIZL 1KELL 3HZVB 2XKUA 3ILQD 1I8MA 2XWJB 5F9WC 4P3CH 3VFGH 3HRZA 3QEQD 4HFUL 4WHCA 5HVFB 4ODBD 1NCNA 1AD0A 1MJUH 3MMEB 4R96B 3K0WA 5IW1A 4JG1L 1WEJH 1IVLA 2OTUB 1ZS8A 4M4PA 5TDNB 5IBTL 2P5WA 4K3EL 1QVOA 4NN6C 4KTEH 3QZWA 3DRQA 2DKMA 5HPMA 3ROOA 1WLHA 4WW2B 3VFRA 3KAAA 1KTDA 4PGBA 1J5OH 3FQXA 1F58H 4PJ7E 2FHFA 2UWEE 4LPUA 4PJHF 1CTOA 5C0EA 4JDZB 4KRPC 5ID0B 5HHNA 1C8PA 3H9YA 4M61A 5DVMA 1QZ1A 2WUCH 2XZZA 3DXAA 4NQED 3QWOA 3IFPA 2DDQH 4NO3B 2PN5A 3ULVF 4HKXB 1UM5H 2NR6C 3MBXL 1GHFH 1NDGB 5E8PA 4UQ3A 5EUKB 3HRPA 3ZKMD 2X4QB 5TF1H 4Q97A 3N50A 5CGYC 2DL2A 5CIPA 2DQDH 4PTTB 2ESVD 3WNMA 5CIPH 4RBPK 1E4WL 1A6PA 4R7NB 3WN5B 3FRUA 3P73B 4WHYG 1YN6B 3OJMB 5JO5B 3QA3A 2BRRL 3A67H 1DEEA 3QISA 2VISA 3FCTB 4HS8H 5C6PB 3K7UA 3ULVL 4M1GH 1F45A 3T4YB 1BJ1H 4LCIL 5HVHC 3VA2C 2FJHB 3TFKD 3L5WA 4HUVA 1S9YB 1N59A 5HDQL 4U6HA 4WEUD 3ILPA 4H8WH 4OIBA 5C0BE 1KN2L 2X4UA 2FH6A 3BAEH 5C7XH 4DEPC 4YHOL 3VXRA 4OZIF 5D5MF 5I1HL 1G7IA 1PKQA 2NQCA 4KK9C 4KKLC 4JG0H 1P6FA 4GW1B 1QP1A 3TN0C 4QHUA 5IFJB 2I5YH 2VZTA 4KDVA 1P7KB 5HPOA 3BKCH 3T1WA 4FFZH 2XN9D 3MJGX 2DLGA 4FQQB 3RAJL 2DWEA 1B4JL 3CFKB 3JWDH 2NY4B 3MZTA 5TQ0H 3RGVA 3V5HA 3LKQB 4EOWL 4FQ2L 4P57B 1KLGA 3KYMB 4C83A 4U3HA 2NY5H 3B83A 2UUDH 4XC3H 2CDFA 2UZIH 3ET9F 2AKRB 3EYSH 2VN4A 3FKUS 3QIWD 5CJOL 1R3IL 1PSKH 5T1KA 4I48A 4QGTA 5LAXB 3QP3A 3MRRA 5F93C 5EU6B 4NCC2 1A9EA 2X4OB 2B5IC 1YMMA 2FHBA 1DQLH 3QDGD 1JPFB 5C0AB 3VI4F 2RAMA 5CJBA 5IW6B 1RZKC 1MCPH 5F9DC 2YSSA 4WI8A 3L5XL 1KV3A 5C2BL 1TPXB 1N6VA 1Z5LB 3PGCA 4HX1B 1CDGA 3V5KB 5FA3B 4LASH 3EBAA 1BFVL 5INDA 1U8OA 1N5YL 2B1AL 4X4XA 1BIIA 4YBQD 5JW3L 4U49A 1EEZA 2X2YA 2YHGA 5IBLC 4CUCA 5EUOF 2VH5L 2HH0H 3K81A 3PV6B 3D25B 2D31A 4X9IA 4KQ3L 2HKHL 2WWKT 1HH6B 3BD3A 1Q1JH 5BZWB 1AI1L 3NIGE 2JCCB 3TPKA 1IAII 4MJIA 1GAFH 2NY0D 4ZOEA 1A14H 4LSUH 5MEOB 2D9CA 4Y5XB 2ED9A 1WZMA 1WBYB 2CRMA 4P5TB 4E42A 1QRND 3QUMA 3BKJH 3U0WL 1QKZL 2FH8A 1QBMH 3GSXA 5E08L 1DLHA 3QUMH 3V0VA 3MBEC 1BZQK 2AGJH 1WZKA 4HBCL 1C08B 2DMKA 2B1HL 3WFHB 4HFWA 1CFTA 2Y6SC 5CKGA 4DFIA 2V2TA 1MJ8L 5HYSB 1KLUB 4F80A 1KTKE 4PJBA 4X80L 2CLZB 5I1IL 1J05A 3LHPL 3CC5A 3SKUD 4MNQD 1JZ5A 1FZKA 4QY8A 3RWHA 3WO4B 4G9FB 1SQ2N 4XNZC 4GW4B 2A9NH 5DUBB 5SWZE 2XPGA 1MFDL 2IBBA 2FBJH 1L0YA 2GY5A 3HFMH 3U4AA 5DR5H 4RWYL 2R2HA 4LEXL 3ARGC 5EBGA 1CQKA 1RAMA 4FXGA 4GBXC 3GHBL 3VGBA 1HXYA 1JGEA 2YEZA 5T3ZL 2BVPA 3SGJC 1X44A 4LLWA 4LLVB 3RY6C 5AZEL 2Y07H 2WK2A 3G5ZB 1B2WL 4P99A 1MAML 3CZFB 2KZWA 1X5IA 3ZKQD 2NY7H 4DJMA 1U2CA 4PRIA 2VDQH 3Q6FA 4WUUA 3CXHK 4PG2C 4KZEL 4AY0A 3VRLE 4QXUL 2CLVA 2HWZH 1MCSA 2VAAA 4OUUB 3KYOA 4H88H 4L1DA 3CUPA 3SDDB 4YR6B 5ADPH 3I02B 4X5XB 3VJ6B 3RNQA 3VXQA 1AY1H 1JZ4A 5INCB 3U6RB 2XWBA 3DV6B 4M5ZH 3PWUA 4NWTH 2J3SA 4MYWB 3O3BB 2BSRA 3AROA 2DI8A 2X4TA 4ZAKA 2O5XL 3ULSB 1RK0B 2AJYH 3LN5A 2ICCA 3EYVB 1ZHBB 5E94A 5I74C 5D1QD 3QI9D 1M4KA 3UJIH 1ZGLB 4ZUSA 4YXLL 4BUHA 1OT2A 3VXSA 3SE3C 1AQDA 4LOUC 3CLEH 2WMPA 1GPOL 1OQXA 1TQCB 3WHXA 1B9ZA 2APXA 3FOMB 2YUWA 3EYOB 2C1PA 2R29H 3LD8C 3L1OH 2E6QA 4EI5B 2ZUWA 5H2BA 4QRPE 1T3FA 2X40A 4UNTA 2GJ6B 3QH3A 2EDNA 1P2CA 3RZCC 3H7BB 3V4VL 2NNAA 4L4TD 5ADOL 2HAZA 3O9WD 1U8NB 3BP4B 3UTQA 1ED3A 1IAOB 3TBSA 4WIQA 3RDTA 1WTGT 1WWWX 1AD9B 5IHZA 1VESA 4OD3H 5E9DD 4JPVL 2X41A 1HH9B 2P5EB 3ARXA 4JRWA 4LVOB 4RAUB 1XGRB 3C8HA 2Q8BL 1H3XA 5BRZD 5FYKU 5FYJH 2E6JA 3BKMH 3IDMB 2NW3B 3P0GB 5KVEL 5DT1L 5T3XH 2G75B 1IQWH 2YPVH 4GAYA 1JNNH 2YD3A 5L8JB 5IFHL 3BPCA 1JVKA 4J3VA 2Z91B 2DAVA 2DM7A 5FCUL 3PHOB 3UX9B 1ZANH 3IF1B 2NCMA 4TSBL 4BZ2L 1IM9B 1AJ7L 2P7TA 3OHXB 1EHLH 1KJ2L 4Z0BL 5F6IC 3FMGH 1QSEA 3ZE0F 2EZ0D 5DD3L 2YA0A 4Z77B 3EDDA 3U30C 3U83A 1EK3A 5L6YL 4TTGA 3VH8A 3TZVB 1K8DB 4JFPA 5GGRY 4WFHD 3OQ3B 2E9BA 4H5SA 5TJWK 4E5XB 4DAGH 5EOCJ 4AG4L 1BJ8A 1SJVA 2LU3A 4HAFA 4ZQKA 4OD1H 1OARH 2J8HA 4HHAB 2BMKA 1A5FL 2IADB 5T1LA 4JN2A 1YJDH 4B5EA 5EZJA 1WFUA 1AHWC 2ZCHL 3CVHH 4ODWA 5DD1L 4U6XA 4XAWH 1MFEH 2Z31B 3N0PB 1I4FB 3FQWB 3EJYD 3TH4T 4OLEA 2EXYD 5E2WH 3L3JB 5L2KB 1GYAA 1CF8L 2YPKB 1FE8H 1B0RB 1N2RA 1VFUA 3EDJA 1E4JA 1ZLVK 4MA3A 3W81A 3OKLB 2EDKA 4LDLB 4IHOA 2QL1A 2HVKB 4NN5B 3RPIB 4UNUA 3TBTA 2F53E 5JR1L 4PP2B 1P4LA 3JUYA 3RVWD 3QIBA 5MENB 4YUEL 1FNEB 2GT9B 2A1WL 4PRBA 1FFOA 5IT2L 1FZJA 3MRQB 4XNQB 4M7ZB 3W82A 1AH1A 1J1OL 1W8OA 3TC9A 5F7KC 3HZYA 4RZCB 5EOTA 3LDBB 2PO6C 5TDPB 1ORSA 1UACL 1R0AH 3VFNB 1VA9A 3QFJE 4XWGL 3HI6L 4OZIB 4YXKH 4TSAL 5ANME 5JOPD 5FB8B 4U1JB 2A2QT 5ESVA 4KPHH 3G6DH 2H26B 5I8OL 4KROC 2CLRB 4DUWA 4OZFB 3UTPD 2ATKA 5BVPH 3PWLA 3G6JB 3TLRA 5I0ZA 1OAQL 3S35L 5EA0L 3BP6B 2PTTB 4IIQA 2NY4D 1MVUA 3UO1L 2IPUG 2H32B 2VZ3A 4KRMB 4X4ME 5KVMC 1GRWA 5D6CA 2VTFA 1LWRA 1UXWA 4LARH 3VA6A 2D7OA 2DQJL 1U3HA 5C0BA 4BELD 1X4ZA 2A38A 3ZHDA 5CILH 1ZEAL 4ZO9A 3HI5L 4HKZA 5EU6D 5C86A 3E6FA 3RY5A 1CI5A 3PL6C 4K7PL 5DZNA 2CGRH 4JDVB 2MNUA 2XICA 4YAQA 4WU5B 5C0AD 1YZZA 3JWOH 3U7AA 1OW0A 4R7DB 2ORBL 3BJLA 3FONB 4RISL 1S5IL 2A73A 2ZP0T 7FABL 2OR9H 4C54A 4JCLA 1IEBB 1WFTA 5E24E 2G2RA 3UTSD 2FLRT 4M48H 4NM4L 3SDCB 2AV1A 3C60A 4O2FB 1MCHA 4AK1A 4P23A 5EUOB 3LEVL 1OGTB 3IDGA 2IFFH 3WUZA 1JWSB 4PRHE 4M5YL 4F57L 2FYYB 3KPQB 3BZEB 3V6OC 5E1AB 5MERB 3LV3A 3ZE2F 2BVOA 4ODTL 3VGDA 5GS1A 1S7VA 1SY6A 3D2UA 2BHZA 5ERWB 3WSQL 3HC4H 4YHML 5C3LD 4QRQA 4ZNEE 1CFQB 3OF6D 3M1BA 1SY6H 2HP4A 3D85B 1I1AB 3UPAA 2GAZB 3DWTA 1NUFA 2Z4QA 3SE9H 1U8PB 1MUJA 4Z7VE 4OLZL 4V1DD 4P5TD 1IGJA 4N0CD 5FYKL 4L8SB 3FQUA 1P84K 3O8XC 2BJML 4PJ8A 5FKPB 5E95B 1Q8MA 5DJZA 4ELME 4P3DA 1XGYL 4U05A 3U2SB 4FFYH 4G5ZL 3HE7C 1I3RB 1TNNA 5DF0A 3WNLA 1OB1A 3PABA 4OSUL 1AKJA 2IALA 3QDHA 3EO0A 4K23L 1TNMA 1EUUA 3T08A 5IB2A 2OJZH 2HLAA 2O61A 1PZ5A 3WXVH 2ITDB 2P48B 4G9FD 4KJQD 3EO1B 5GRYA 3DI3B 1OPGH 1BM3L 1IJ9A 1BREA 5FYLE 1MAKA 2I07A 2IEPA 5HHMB 3TT1L 4Z76A 4PJEE 3OKEA 4J4PA 1MAJA 4L8CA 1AXSA 2IPKB 5AAWA 3AS2A 4UDTB 1FV1A 4CU6A 3T8XB 2JTDA 1OP3H 1BBDH 2E27H 3DIFB 1V3KA 1LO0H 4XMKH 4YDVA 3IDNB 4RBPH 4LHQB 1XR9B 2EIDA 1DQTA 4I1NB 2NZ9C 2ERJC 2DQDL 3SDDD 4R0LB 4HWEL 4R26H 3AM8A 5J89A 4XTRD 3HNSL 4HIJA 4OLVL 1CT8B 5SWZA 2D0HA 4NQCE 2NYYC 4AENA 1YEEL 2PW2A 3BH8B 3LQMA 2OX5A 5C6TL 3WFEL 3O4LB 3CH1A 2OI9C 1NC4B 3FO2B 5BOZG 1RZGB 4WJ5A 1UZ6F 3V4UH 5DWUH 5GJSH 3GEWB 4B0MM 1JTOA 3V6FA 1N6QL 3OR6A 2UYLB 1IC4H 1MPAH 3HG1E 4W70A 2HT2C 3P9LA 4XWOD 5HVGB 1Q9WA 4U1GC 3HCVB 3VG0L 3BAEL 2GJ6D 2VL5A 5GGSA 1IL1A 4HS6B 2BVEA 5J9PB 3FQTA 2MQCA 4OCSH 2VQUA 5H37H 4QXGL 1CXLA 2J12B 1AGFB 1KB9K 1NFDE 3QUKA 1JBJA 1E4KC 2HVJA 1LO4L 4XB7A 4KC3B 3WKNA 4F37K 2IANE 3BPNC 1BLNA 3S8WA 5FYJU 1VADB 2NY5L 4PY7A 4PGDA 5I8KL 4K3JL 3MRLB 2BXZA 1PSKL 3HPJB 3U0TB 1VENA 3NZHH 5IROA 1EA9C 4TSCL 1LEKA 1PY9A 1LDSA 3BIBX 1ZLSL 1KJMA 1MHEB 3HNTL 3NCYS 4ZFFA 1DVFA 5C07E 1IC5H 4HXBL 4NC1C 1VFMA 3L95B 4HKJB 3MV7E 5D7SL 1CDUA 3H9SB 3PIQA 3QUXC 1IM9D 1YQVH 1NCTA 4HH9A 1YEGL 1OT1A 4M6NH 4N0UB 1M71B 5FV2A 2VE6A 4LASL 4CJ0A 1U8IB 4AEEA 4O4YL 1EO7A 2R0ZH 3PJSA 5FOJA 2R4RL 3TZVD 4BZ1L 5L0QB 2FL5A 2NW2B 4CJ1A 4OZFG 3VI3E 1R3KB 3D0VA 5JXEC 4EUPA 3WJLA 1FVCB 2RHEA 2QSCH 3OAZK 5IIEB 3DUSA 1S9WA 4X7DC 3AMKA 4TOYL 5GS0L 3NA9L 3ULVD 4HT1H 3RHWK 4XXDA 4PJBF 1UZ8A 2V5RA 3UEZA 3RL1B 4JZNA 4PS4L 1GH7A 1PLGL 2DQGL 1A7PL 1LP9A 1P5VA 2Z31D 3B43A 5HHVH 2HLFC 1K4DB 3NFSH 3IKCB 4ZS7L 2R2EB 5FO9A 4IRJC 4MXVE 2ICWA 4DK6A 1L7TL 4AEIL 4LGPB 4C4KO 2B2XL 4GT7A 4S0SD 5MEND 2WQ8A 4LSPH 1TTGA 4O9HL 4QTHA 1LK2A 4JB9H 4OFYD 5IB1B 4CVZB 3NABL 4UV4H 1XGQB 3T0ED 1JNHB 2AAVA 2OQJB 4ODSH 3HAEA 4DN4H 4M7JH 5DHYB 2PTUA 1Q0XH 3RKDC 1DQMH 1JGDB 5DR5L 5EOQL 5F3HA 1R3JB 2JJVA 3SKJL 5TE4L 4I13B 4KKBC 4MQ7A 1HKLL 1N7ML 5CEYA 4I0PC 2IQ9L 4H1LB 1CD1B 4NHCL 4U7MA 1D5MB 3PXHA 3BZ4A 1IGIL 4JN1L 4DOHE 5EO1B 5IWLC 2GSIA 4BH7A 1J9CT 1C5CL 2FO1A 1CN4A 2BCKA 4ESKA 3UAJD 4JPKL 4LSVH 4BH8A 4RQQA 3QDJE 4AH2B 3TV3H 3KPSE 3BZFA 1FN4A 1RJLA 1AY1L 3LEXB 1NGXB 5CGTA 4YO0A 1M6OA 4HJ0D 4L4VD 2I60L 3FFDA 4N1HB 5MHSD 2AJYL 5DRXB 1YYLL 5KJRH 3DX7B 5CWSA 5E03A 4XX1E 5I1CH 3EO9L 1TVHA 2JB6A 2ZOKB 4K3GA 3C6SA 3OPZH 2AJ3B 4G43A 2WV3A 4F15C 4IOFD 5AYUL 5BJTA 1OAZH 1GGCL 4MAUH 3V7MA 5DSCB 1FIGL 4FOMA 4XNYH 3BN3B 2EIBA 3H3PL 1BF8A 3BWAB 1KC5L 2VLJB 3QUYB 1U36A 1WT5A 1FVEA 4MCYA 3WFCH 3MLSL 5EZIH 1ZHNA 4FXKA 2AJSL 2E9WA 5B8CB 2CSPA 1LEIA 4HF5H 1REIA 5ITFA 3EFFA 3HRZB 3ZL4L 3SDCD 1JYNA 5D2LA 1AD0B 2VWEE 3S4SG 5IW1B 2ADJB 4U1LA 5ISZD 1EBAA 1CK0L 5FUOH 2BXYA 2YN3A 2P5WB 4ISVA 1UG9A 3SGEI 5KVFH 4HJJH 3QZWB 1PG7L 4JM2C 3QEGH 4MSWA 3DRQB 4NRYA 4FQPA 3MACL 2NLJA 5HPMB 1NANI 4KV5E 3ROOB 3D85D 4FFVC 1G1CA 3VFRB 1NKOA 3BKML 5F7FA 1KTDB 4PGBB 5FGCB 3T77B 2CIIA 5KZCB 5C0EB 1IGCH 2COQA 5HHNB 4LPXA 3TPUA 1MCKA 3UYPA 1AHWA 3WIFA 5GZOC 2VUYA 4PRHA 1UWEH 3K1KC 2VLKE 2N1KA 1E0OB 3DXAB 5IR1A 2GK2A 3QWOB 2LQRA 3IFPB 2PR4H 3RX5A 4K3DL 4JKKA 5T5NG 3VRIA 1OVZA 4Z0XB 8FABB 2VYRE 1CLOL 3UYOD 4UQ3B 1EAPA 4UIMA 4X98A 4Q6IC 5CD5C 5KTEH 5CIPB 4I77L 1R5IA 4LU5H 2X5PA 4Z7VA 5ITBL 3S36L 5HHMD 3B8YA 3BRGC 2XQYG 5GRVK 4PJ7F 2UWEF 4JFHE 1OARL 1RZ7H 3FRUB 1RQ5A 2BSTA 4YDIH 5FO7A 2NY3B 1JNLH 3B9DA 1YN7A 3EYQC 1YJDL 4NKOA 4N5UA 4PJ9C 3QA3B 2AXFB 4BK4A 1DEEB 4ZMAT 1ZLVH 1U93A 2PO6A 1MCRA 3TIEA 2VC2H 4ETYA 4GKOA 2Q7NA 4XVSH 1KCVL 3O41A 4P5MA 1MQKH 3JV6A 4X7CC 5I6XC 3DJ9A 1KSRA 4HUVB 1OAYL 2Z8SA 2R56H 4WWKA 1N59B 4U6HB 3ILPB 3SDAA 4ZS6C 4N0FA 4EZMA 5GRZA 3VXRB 3NN8A 4JZOA 1G7IB 3FAXA 1PKQB 4PJEA 5CSBA 1RUAH 2DQEL 4Y1AD 1RZFH 3UTOA 1F4WH 4QHUB 3UBXI 4G7VH 3Q5OA 1NC4D 5KSAC 4G7YH 3IFNH 2EECA 5BXFA 4JGUA 5DYOB 1ORQA 5IKCB 3RGVB 3V5HB 3MUZ1 1VFAA 5HYJB 5I9QC 1KLGB 2FGZA 1D5ZA 3IU4H 4P0DA 4C83B 5I1DA 3P4MA 43C9A 5F97E 4I0CC 3GKWH 5ICXA 2CDFB 3UP1A 2D7QA 4P9ML 1L9MA 2R1XA 5GZNC 4I48B 4PUBL 1HSBA 2J4WH 3MRRB 4LSTH 3KHQA 3G6DL 3ALPA 4QOKA 5JA8B 1A9EB 1N0XL 2X4PA 3BDXA 1YMMB 1XR8A 1RMFL 4P2OA 1JP5A 5HGHA 2C3XA 1EH9A 4QRRE 2YSSB 4XVUD 2GY7B 4OCWH 2VXQH 3ILQC 2ED8A 3PGCB 4MA7H 3QBTB 5HVWA 3D39B 3DV4A 3MFFA 2E7HA 4NZTH 1ETZB 2BDNH 5INDB 5DI8B 4CMMA 1EX0A 1BIIB 1V7ML 5TFSH 4HG4J 1U8MA 2NMSA 1EEZB 4CRPA 1MWAA 3B2UC 4HH8A 4G8GE 2HJLA 3RIFF 1HDMB 5CILL 4WENB 3D9AH 1MWAH 4BQ8A 1NFDA 4U1HA 5L8KB 1D9KA 3MRCA 1TZGL 1ZOXA 2H6PA 2DTSA 4O58H 1SBSH 4PG9A 3SOBL 3H9SD 5BVJA 4LHJB 5I15L 2Q76A 3EUUA 2P43B 4MJIB 1NLBL 1T04B 1BJ1J 4IMLB 2DWDA 4M8QB 5I18L 2HMIC 1KFAL 4Y8AA 4H1LG 4G6ML 2YK1L 4E42B 3QUMB 3HS0A 4MA8H 2Z0BA 4N8PA 3GSXB 3FQRA 2FECI 3QNZA 1G0YR 4HV8B 4XCNA 1DLHB 2Q86A 2XFXA 5TH2A 3UPCA 5J8OA 1EXUA 4HFWB 1CFTB 2CXKA 2V2TB 3ZKMC 4WI4A 3L7EB 4AYFA 2JF1A 5C07A 4PJBB 3MV7A 1J05B 4AEFA 3TM6A 1FZKB 3Q6GH 4LSQH 3RWHB 1KYOK 4R3SA 2F5AL 3KPNA 3Q1SL 1X6NA 1FYTE 3NIGF 2XPGB 1X5KA 1FNSH 1S7XA 2CDGB 1AR1C 4OT1H 2R2HB 1HZHL 4QHKJ 1OSPH 4OFKA 3GSOA 1HXYB 3LS4L 3L6FB 3QEUA 1JGEB 2YEZB 2YZ8A 1H3GA 3DMMA 4UTBL 2P44B 4LLWB 3ESVF 1D3CA 4XPGL 4HXAH 3AY4C 5D8JH 5BCAA 1NCUA 1DBAH 3OGOE 4QKXB 4BFEA 2FX8L 3TFKC 1AO7E 1DQQB 4WUUB 3Q6FB 3F8UB 2DJ4A 4K71C 4F7PA 2CLVB 2VAAB 1W0YT 3P9MB 3V52H 3CUPB 1WIPA 4YXHH 1LE5A 1MOEA 3VXQB 1JZ8A 3RNQB 4HC1A 1Q9KB 5DFWH 4ACPA 2XWBB 3PWUB 2HTLC 1NSNH 2BSR