3L5JA

Crystal structure of fniii domains of human gp130 (domains 4-6)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
288
structure length
283
Chain Sequence
EDRPSKAPSFWYKIDPYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Interleukin-6 receptor subunit beta
publication title Crystal structure of the entire ectodomain of gp130: insights into the molecular assembly of the tall cytokine receptor complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 283
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5jA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5jA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5jA03
1BAFH 2R2HA 2P5EE 1QR4A 4MAUL 2BNQE 1QLRB 2HJKA 4XC1H 5E2TL 4O51B 1I9RH 2ARWA 1LEIA 2HRPL 4PJ5B 1ZVYA 2ZUXA 5D72H 4CMHB 4QCIA 4LMQI 2WUCH 4GAYB 4IJ3B 4NBZB 5D1ZC 4UQ2A 3VXSA 4LHUA 4Y4HB 1OAZH 3FT4B 1ORQA 4D9QE 1YZZA 4N0RA 3HR6A 1JNHB 3MV11 4KY1L 4HUWA 1F6FB 4P48A 4YDIH 1TVBA 3G6JA 2ATPA 2DBJA 4L8CA 1F90H 1CIDA 1CGSL 5KSAB 2QR0B 5F3BA 3Q2CA 4U49A 4DFIA 4XVJH 2DAVA 1XIWA 3EO9H 4U0QB 5CS7A 2OL3A 4XNYL 5BZDA 4NQED 4Z7VB 4Z0BH 5GS0L 1KYOJ 4FFZH 2IMMA 1KNOB 3TN0B 4WUUE 3QUYC 3IF1A 5CWSB 3TBVA 1TVHB 4QRRD 1BFVL 3WJJA 1T80A 1GOGA 2X40A 4U1KA 4LCWE 2DQUL 4OZGB 4CVXA 1Y6KR 3SE8L 3CFCL 5CGMA 4ENED 2YPLA 4G7YH 2IQAB 2OR8A 3MROB 2XKNB 1WC7A 2ZG3A 5CP7A 1QUNA 2AKRA 2F74B 2AXHA 2H32H 3VD9A 5AG9A 3B9AA 4OJFH 2WNGA 1ES0A 2YBRA 4PJDF 1I1AD 1MCJA 3EHBD 4JY6B 5JMRA 3ILPB 3T0EC 2EC9U 4JFXA 4O02L 4G9DB 1MEXH 3VXUB 3SGEI 1L0XA 1A5FL 1OAQH 3HAEH 3FTGB 3PXHA 1UADC 2X2YA 3LKRB 4GW1B 4C56E 5LWYL 3KXFB 3L7EB 5KSBA 5LCVH 1QVOB 2J12B 2IPKA 4RMQA 4K7PX 4PRNB 4Q6IB 5E8EB 3QUXB 2KL6A 2R1YB 3F6IA 2P8LB 3LB6D 4F37K 4HKZB 1INQA 3KAAA 1MQKL 1KIUA 1T0PB 1UKTA 5EDXA 4NZTL 4DGVL 1T2QL 1MCOH 3TBSA 4MJID 1DVFA 1VERA 3ZSSA 4JZJA 3G6DL 4NM4H 2DQCL 4LLYA 1MLBB 3AFLA 2WUBL 2E6PA 4YDJA 1GIGL 5CGYD 4PRBB 5HPMB 5IF0A 4NDMA 4I0PD 3AMKA 5E8OB 3DMMC 2JJTA 5D2NA 3AC0A 3DXAB 1KJ2A 3DVNB 3L3HB 4JN1L 4LHJB 4U1HB 4OZFA 4TNVK 2WBJA 3BP7B 1IZKA 3E2HB 4A2MA 4Z7OF 2YUVA 1TVDA 4GG6A 3S8WA 4PD4K 1QHPA 1HXMA 1VFMA 3X11A 2E9IA 1HYSD 4HS6B 4IDLA 5FUOL 3WHXA 1QFWI 1FNSL 3PP3K 4RWYH 4RGNB 1S9WA 4OLYH 5DYOB 2QBWA 1BJ1H 2V5MA 2X10A 2AJYL 4QHNA 3ZHDA 5CHNA 3B43A 3TNMA 3IDYC 1JV5A 5BJTB 3ZTNH 4O9HL 3CDGA 1YNLH 5HTSA 5BRZB 4X80L 3ZE2F 4PP2B 4WWKA 1JPFB 1Z0MA 3MV8E 4D0DA 3NPZB 2GYSA 4F9PA 4ELME 3MGTB 5TDNB 4QY8A 2NNAB 3JTSB 3EJYC 5TF1H 4HHAB 1EO8H 1YPZA 5DGQA 3CDFA 3GSQB 4H20H 2B5IB 1HILB 3DYOA 1II4E 4NT6B 5IR1B 3MRQB 5DUPL 2AJUL 1X5ZA 4JO1H 3TIDB 4W6XB 4Y88A 1G7MA 4M4RA 1T7YA 4UT7H 3K8MA 2MCPH 4KPHH 3WLWC 4Z7WB 3CK0L 2PTTA 1WCBB 3W5NA 1MCLA 1T89C 1PQZB 4HWUA 4NZRH 2R8SH 1GHFL 1SEBB 3DGCR 2PYED 2ZUQB 1NCWH 1F6LL 2NR6C 2OP4H 1RJZA 4PRDA 3ROLB 4NWTL 5FGCE 1SY6L 3I6GB 3MFFA 4OM1L 1U8OB 3VXPA 5EORL 2Z93A 5EO1B 5I1HL 3GHEH 3B8YA 4CU8A 1OSPH 1I7RA 1Z9SA 4PS4L 2WV3A 4HT1H 3G5ZA 3O4LD 1X9QA 4M1DL 2VITB 3WXWL 3UCRA 1DN0B 2EKJA 7FABH 2Y07H 3VWJA 1Q94A 4UU9A 5F7EH 4UB0L 5D93C 5FM8A 5GZOC 1JRHL 4CVZB 3VW3H 1IC1A 1AY1H 4XWOD 3VI3F 1S7RB 5FYJU 5F1IB 3RUGB 1MCDA 4LSRL 3MNWB 2J4WL 2AQ1A 1QFHA 2ITDB 5DFWH 3FB8A 1G6RA 4XVUD 3AGVA 4X7SL 3BN3B 1VGKB 2WWKT 1HOCB 2BNRE 4RISH 3DX8B 5IP4A 5BXFA 1S9VA 3MUY1 3P0YL 5JOFA 1GZQB 4W68A 5I8OH 4ZS7H 1DUZB 1E28B 2EH7L 4KTYA 4PJ8D 3BPNB 5MHSE 1JNLH 4B53A 1J1XL 5DLMH 4X4XB 3JTTB 4RNRA 3VFRB 4AEIL 2C3HA 5T33H 1QBMH 4KK9C 5I75B 3MXWL 3VRJA 5D7LB 4KDVA 5GS1B 2NZIA 3L7FA 5I73B 3OKEA 3H9HA 4TTGA 1M7XA 1T7ZA 5ESQB 1FE8L 4HKBA 1DUYB 5AYUH 3RVUC 5I2IA 2VDRH 2W9DH 3IU3B 4XT1C 2CMRL 3EDDA 1DL7L 3CVHL 4BK5A 1CFSB 1CICB 3I50H 4TPRL 3GUTA 2A9NL 4YAQA 1TMCB 3HAEG 2VKXA 4ONFL 3N1PC 4NQSB 1UVQA 3DOSA 3QXDB 4JPVH 3V0WL 3PF2A 1BBDL 4ZAKD 3ULUC 3QUKB 1R6VA 1QOKA 4ODUA 3RGHA 3U9PH 2PXYA 3OL2A 4DKDC 1FH5H 4UV7H 4TUJB 5EULV 4HWNA 5BOPA 5CUSL 4L9LC 3L6FA 3LHPL 1NBYA 4TTDC 1N5YL 5IMKA 4LVOC 3IB4A 3U7AA 2VR4A 3FQRB 4KJYB 4DW2L 1MCWM 1FV1A 3FQNA 4P2RB 1BQHB 5EIIB 3UTTB 43C9A 1U8KA 2DYPB 5EUKA 1QR1A 4ZNEA 3H0TB 1YYML 3MCLL 1YEKH 3SJVE 2P8MA 3HE6A 4TSBL 1T22B 2GJZB 3G6JF 4P3DB 4YBLB 4ZFFA 4HF5H 4WV1A 1MJ8H 2FATH 2X4RB 2H9GA 1DQDH 4G6FD 43CAB 1R24A 2QQLH 5IMMA 1CBVH 4DN4H 4TN9A 4NO0B 4NQXA 1WEJL 3CJJA 4GRWF 5L2KE 2OTUA 3SO5A 4CJ1A 4UAOC 4F7TA 4CMMA 1IKFL 1UXSB 3D25B 2CD0A 2A6DB 2H26B 4G42A 5H8DA 4M6NH 5HHPA 2Q7NA 5JQ6H 1VPOH 1CDBA 3FT2A 1PY9A 3PP3H 4MAYC 2EECA 3QRFM 2X1OA 3VGBA 3MLWL 3H2WA 2NY6D 1RZFH 3GSUB 4UTAL 1BOYA 1BD2D 3DSFL 4PTUB 1P2CB 4Y16A 4WO4A 5HHNA 3GMPA 4YDKL 3UTQB 2EYTB 4U6VH 4LSQH 3HMWH 1I7ZB 5ALBL 3P0GB 3U4EB 4F57H 3QIWA 5E56A 2JB5H 3B5TA 3DX7B 1I1CA 3HNVH 3VMNA 1TIUA 1MCPL 4WVRA 1AGBB 2XRAH 2C9AA 3MRGB 4JFYA 4W4OA 2IAMC 3MRNB 5GGTL 1AE6L 1P4BH 4TNWF 3G5YA 1E4XH 3B9VA 3L3IA 4JFQA 4U1MA 4X6CA 1LK2A 3NIGE 5FEBA 3T0ED 5F7WC 2NTFA 4CN4A 1KEMH 2Z8RA 3NN8B 4BH8B 4F7PA 2X4UA 5KSBF 1A9BB 2HJLB 2MQCA 4FOMA 4ORGB 4YXHH 5C0AB 2FJGB 3HFMH 3MODL 4JN2A 3SGJC 4DKEH 5H35B 4NZUL 4JFEB 1LQSR 1V3KA 1OTUC 4IIQB 2B1HH 5JR1L 2Q76B 3VFTB 3ARWA 4JKWA 4N0CC 4Y4KB 5SWZD 1INEL 3NA9H 5DD1L 2ZUYA 1QRNB 2C3VA 3NIFF 2OZ4A 3VWKA 2FO4B 3MV9B 5KS9B 5D7IB 3QZWA 1I1RA 5GPRA 1G0YR 2DTML 4X4MA 4FQJH 2D7OA 1EHLL 1OCWL 5CZKA 2IGFL 3C5SB 5LGHL 3U30B 3T08A 1OT1A 3MPCA 4U1IA 3G5XB 4L4TA 2C26A 3RWCB 1H0DB 3AS0A 4D0CB 4R4FH 5FYKE 2YD1A 1P53A 4Y2DA 3S36L 5LJYH 4GG6F 3GMMB 2EE6A 3OKLA 2Q8BH 3MA9L 3E6HA 3DUUB 1PKQE 1QFWL 3QNXB 3ZHKA 1W0VA 3QUML 4K3DL 1YN7A 4GAGH 2OMNA 3MREB 5FKPB 2XWTA 3ZYOA 4LCIL 1U8PA 3TO4C 1ZLVH 5FO9A 3BRGC 1VEMA 1NFDB 4KHXL 3MLXH 1XGQB 2J6EA 2OR9L 5EUOE 3V7MA 3V0VA 1ZA3A 5HJ3B 4N8CL 2VLJE 5EPMA 2EXYC 4L3CA 4NQEB 1NSNH 1X5YA 3GMOA 2VQ1A 3FFDA 5E6IC 5L6YL 5DHVA 4JFFE 2YD4A 4G6AD 4FQIH 4QRRB 1CWVA 5DC0A 4LPWA 4M7ZC 1F4XH 1ITCA 4XBPA 4OCWH 1RUQH 4IRSA 4GW5A 4GBXD 3O11B 5B3JE 2O5ZL 4F2MB 3BO8A 4XCYA 2ZPKH 5IHLB 1RZGA 1GPOH 4HS8H 5I1EL 1U95B 4PJ7E 2YA2A 1YPZF 3I75A 4BELD 3DROB 4UNTA 4F7CA 3EJYD 1WT5C 4YUEH 4HK3N 4UBDC 4PGBA 3IU4L 3TYGL 1RZIB 2YUZA 3HCVB 4WUKH 4UUJA 1EVTC 4U1JA 3EOTH 5HYJD 2XZCL 2H2PC 4O2EA 1MAMH 3T0DA 4JPKL 4Z7UA 3EOYG 3S96B 3GSRB 4X6FA 1I1AB 2VDQL 1MCNA 3WLWD 1AQDA 2P24B 1F45A 3OAZK 3QP3A 2D03L 3K4DA 3PWVA 4X7TA 1NL0H 4MQ7B 3RVVC 1SM3H 3Q6FA 3CH1A 2F9BT 3KYNA 4XVSL 5HHVL 4PJ9A 3BWAA 3H3PH 3MRHA 3MV7E 3PGCB 1A7BA 3X14A 2FX9L 1S3KL 4HS3A 4HCRH 1A6ZB 5GGRA 5F96L 4A2LA 2ZCKL 3Q5OA 4XNMB 3GFUA 3P30L 5T5NF 2V9QA 4OZIB 4L4VE 2FB4L 1Y0LA 2K3TA 5JPNB 2DF3A 3BJLA 1HH9B 1KUMA 4PJ5E 5FOBA 3SDDC 4MJIB 4LEXL 3WLBB 3RNQB 3DVGB 4G6MH 4J4PC 2QKIB 2W60A 3SDYH 4JVUA 1YEDA 2HT2C 1E4KA 3WKMH 1A6WL 1LGVA 4KKBC 5GZOD 1DBKH 1J8HD 4I0PB 2R0LL 4IOIB 4LK4A 4QTIL 3AAZB 4CADA 1Q8MA 3HZYA 1HNFA 3QQ4A 5CAYB 2AV1B 3WS3A 1TQBB 2LU7A 3OHXB 1BFTA 5GRXG 2X1QA 5GGVL 4MJ4A 3FRPG 3H6JA 1OAYL 1CD9B 1B6DA 1EK3A 3OSKA 3WN5A 1FBIH 4Z7VE 5ACLA 1CFVH 5INCB 2JJWA 2V17L 35C8H 4AL8H 3RWEA 3OJDA 5F1SA 4Z18A 3DVIA 2Q86B 1EJOH 4ETQA 4KROD 1Y18B 3HLAA 1UJ3A 3NCYS 4ODVH 5IV2A 4YXLL 1E4WH 2ZSWA 4OCRL 1G6VK 2GITB 5ENWA 2FO1A 4X99B 3C09C 3TPKA 1RFDH 3RVUD 5ICYB 5BO1L 3UYOD 4MCYB 5H94A 5EZJA 2R39A 2ZOKB 4GS7B 3RWGB 4ODSL 4YHLL 4HBCL 2FX8L 2OL3L 3FB6B 4UQ3B 5DGRA 1QSFD 3GMRA 1NMCC 4OGYL 4L3ED 3SKNA 5D6DC 3UDWA 1IAIH 3IDUA 4YHML 3C9NB 3WEXA 5HVWA 4LRIC 3ULUD 4ZTPL 5CILL 5GGQL 1S8DA 5DJXA 2AJZA 1FG2B 5DMGD 2DQFA 1B4RA 5JXEA 3QH3A 1NBVL 3MR9B 2DTSA 2XICA 5CLWA 5JA8B 5CEYB 4D0BB 1RK0A 4U31A 1T5XA 3RWHA 4JPIB 2PYEB 1I3VA 1JHTB 4JHBA 2JK5B 4Z7NE 4NQDE 3RVTC 3H9ZA 2VAAA 2P5EA 3PWLB 1KG0B 2BNQA 3VG0H 1YY8B 5HI5C 3DO7A 2XTJB 1UACH 4PB9L 1L7IH 2JJSA 5FM4A 3RL2A 4P2OB 2ADJA 1P5VA 2PYFB 1A14L 1U6AL 3RY6A 3EO1A 4MXWL 4DCQB 1AJ7L 4S1SH 5CJOH 1RIHL 3MTRA 2J7LA 2DIAA 3I3DA 4OD2B 5KVEH 1KC5L 3G6AB 3IAQA 5C07E 2QADB 4ZFOB 2MPAH 3O4LB 3X17A 5F7YC 4P9HH 3K2UH 3TCXA 3FT3A 1FNEB 1HH6A 2RJMA 4P2QD 1CDJA 2XN9E 4KHTL 6CGTA 2NW3B 3LEYL 1B4JH 2R4SH 4LFHG 4MQTB 4HX1B 3RQ3A 2EDHA 3ZDYE 3P9MB 4N9OB 2ZZUT 2ICCA 5SX4I 1LO0L 5HHQA 4AMKL 5IFJB 1ODAA 1YNTA 3C08H 5LKNA 4ZG1A 2AXGA 3V6BR 5DEGB 5I9QC 5HDLA 4P4KA 2VZSA 3V4PH 4FZ8L 4HWBH 3E1F1 4HIXH 4PJ8B 5EU6B 3RGVA 1N3NA 4LLQA 1BJ1J 5L9DL 4X6CF 3VXRE 2HP4A 2IAMD 4N8VA 1HINL 2ICES 2GCYB 5TDPB 1BZ9B 2VIRB 2OI9B 4X7EC 3MLYH 4OFPA 1YEEH 4LSSL 3ZZ1A 4XP1L 4R0LA 2ADGA 3VXQB 4R2GD 3QDGA 1J1OL 4I0KA 5TJWK 1S5IH 1UEYA 1PGRB 2CO6B 3C8KA 3I02B 4M93C 1JUFA 1I8KB 2AEWA 2BOBB 3HI6L 4OV6F 4F8QA 5J1TC 4J1UB 1OTUD 4QF1A 4JM2C 3WHE0 5BV7B 2F5AL 3FO9A 3OAZH 4ZAKB 5DRZB 5MEPA 4Z7WE 5C6PB 4QHUB 3JSSA 3QISA 1RUKL 4HEME 1S7WB 1QKZH 4QNPF 1GGCL 4QXUH 5ALCL 1SVZA 2HN7A 5ANMB 3T3MF 2YZ8A 4QRPE 5CZXC 5D70L 3RIAK 1XH3A 1BIIA 4FNLL 3UP1A 2K7QA 4JG1L 4N9GA 4PJFB 2YPVL 5L0QB 4JRYA 4A6YH 2EE9A 4WI5A 5FA4A 3EBAA 4Y1AD 5CEZH 5DMKA 3CZFB 3SKJL 2VR5A 4G9FA 4MD4B 5IQ9A 1BOGA 1OB1B 8FABB 3HZMA 2XZQL 2Y7QB 2R1WB 3K81A 1T5WA 5MERA 1G1CA 1JWMB 3O0RL 4HFUL 2XXMB 1EMTH 3MBEC 1ADQH 1IFHL 1MFBL 1VACA 1Q0YL 4MJ6A 2RCSH 2EXYD 3WS6A 3G08A 5CZVL 4IM8A 3NTCH 1HCFX 2V5YA 4QYOB 1EEYB 4JLRB 2BFVH 1K5NB 3A0OA 4I2XB 3V2AR 4LEOA 3UBXG 1JGEB 4DUVA 3WIIL 2NY6B 5ESAA 5D2LE 2VDOH 1MUJA 4PRPD 4HMEA 1EUTA 4ODHH 4J2XA 2JJVA 4IHOB 5CIPB 3TA3D 3LQAH 3BWUC 2W07A 3O2DA 5J1AA 4OCSH 5E99H 3T65B 4UBDD 2G60L 3UC0L 2BVQA 5EIQA 4Z7UF 3ELAT 4NM8L 5HGAA 4MNHA 4N0FB 1V3LA 1DQQA 5EZOL 3MRKB 3Q6GL 3QWOA 1G6RL 3HB3C 2ICWJ 3EYOA 2Y06H 3SDCC 2FH6A 1WICA 3EYQC 3RI5K 2Y5TA 4FMKA 4YIQB 4QRQA 2AGJH 4OZ4A 4FXGA 5I1GL 3D85A 4HEPG 1OAXH 1DBBH 3HC4L 4PG2A 5E08H 3QXWA 3ZSTA 4JDZB 2AJ3B 4Z77B 1NGYB 3GM8A 5DK3A 1LE5B 2GW5A 3O3UN 2R29H 4S1RH 5SWZB 1YUHA 2XI9A 3P77B 1H5BB 1XIWD 1JPSH 3MYJA 4S0TD 1S7SA 2AERT 1X5AA 1RIUH 1CE6A 2PO6A 1U91B 4NC1E 1FAKT 1I1FB 2WM0A 5I1DB 5HHOD 1CXKA 3L5JA 1N8ZA 3QNYA 4FTVA 4Y5YB 5DD3H 4CAGA 2AJSH 1S5HA 2ORBL 5AAMA 1RK1B 3FQTB 4NCDA 1IGFH 5E1AA 3IFNL 2X4NB 4UINH 2C7UB 1ZEAH 3EW3B 4NRXA 2YPKA 5IGXL 4LF3B 4PRHD 5DVKA 1AD0A 4OB5L 3TBTA 1CXFA 3U36A 3HE7C 4LKXA 3ARBB 1KPVB 3ZKQD 5E24E 5GJSH 4EUPB 5ABDE 2C1OA 3ARUA 1AIFB 2OSLA 3IJYB 4LGSB 1TNMA 2VZUA 2BCKA 2YKLH 3DX6B 1JP5A 3VH8A 4RAVA 3CFKA 3QCTH 1X5XA 1BECA 4PD4J 4LLUA 5HYFA 3BXNA 4EI6A 3CC5A 2X89A 2F53D 3BEWB 5ITBL 4OSUH 1MCFA 2VB5A 3L9RA 1Y6NR 4F7EA 3IDYB 5IWLC 3TT3L 2V5TA 1PZUB 4WCYL 3BZFA 1MCWW 3VA6A 4HULB 1QSED 1NANI 1H3TA 4GBXB 1I4FA 3P4MA 4PP1D 2BHZA 3UZEA 3U9UB 1U36A 3L95A 1KJVA 1HQ4A 4ZUWA 4QGYA 3MA7B 4EDXA 5FM5M 4TUKL 4M8QB 3IAGC 3M17B 4L4JA 4P59H 4HXAH 4ZPVB 2WQ8A 4LSPL 4X6EB 2W59A 4PJIE 2WZPD 2GJ6A 1T7VA 4L8DB 5DQJB 1NGPH 1BLNA 4URTB 3K8KA 4CDGC 5HYJB 3MO1A 1QSZA 5I15L 2ZUWA 1PSKL 5I1IL 4OCXH 4PGZA 1CIUA 5E2UH 2Z4QA 4G8EB 3SPVB 4QXTA 3VFWA 1P4IH 3RBGA 2DQDH 4HKXB 5DJ2B 3BE1H 1OSZA 2GTZB 1FHGA 3QJHA 4XXCA 1R3KA 4APQC 1UXWB 4L8BB 4MDJB 3GSWB 1J18A 3KHOA 1OAUH 5KS9E 2FHFA 3ZT5A 3RVTD 5K9OB 1P1ZA 4NQCA 4OAWA 2RQ8A 3QFJA 2XKSA 3GB7B 1QSVA 5E95B 2I24N 5HI5D 5JW3L 1Q72H 2B39A 3KPTA 4OBRA 4MA1C 1FAIH 1A3LL 1DQLL 5E9DB 1SJXA 4IS6B 2COQA 3BZ4B 4KQ4H 3JXAA 5C0RH 5F6HI 3SJVA 2NY3C 4XMKH 1A2YA 1ZGLM 3DHJA 4PRAB 4XMLH 5HBBA 3EGSA 3L3KA 2IANB 5D71H 5D1QC 5IBTH 2LTQC 4LBEB 3KJ4B 1U41A 3UTSA 2NMSA 3D3VE 5GGSY 1NH6A 3STBA 4HFWA 1BHGA 1SQ2N 3TPUB 5D93B 4YHZL 1RZJL 1W8OA 5C8JB 3KNBA 1J8HB 1C1EH 2NXYD 4P5TA 4G6KH 5A16B 2VDMH 2OZ4L 1RIVL 3OKOA 4U1GC 4MA7L 3OR6B 4OUUA 3JV6A 5IMOB 4JVPA 1FVDA 1LD9B 1TPXC 1IQDA 1UEMA 4Y7MA 4FFWC 2DKSA 2VXTH 4KRLB 2A38A 1TJGH 3MLTB 4N90D 2DWEA 1AH1A 3ILQC 4XCEB 4BKLA 4Z0XB 4KROB 4JE4B 5F8QC 1QFUH 4PJDB 3UZQA 4GMTL 3TGXA 3MRCA 4RMVA 5C0DB 4OM0L 1FL3A 5DQDH 4ONGH 1JYVA 5IMLB 4OCLC 1DBJL 1XMWA 5T1KD 1NCTA 1QQDA 2YD7A 1NEZG 2MJWA 1I7UA 3HPJA 3BZEB 5KVFH 3MRIA 4JM4H 4WW1B 1FDLH 1GOFA 2O5YH 2ADIA 2J6EL 2EYRA 2HH0H 1ZHNB 4YGVB 3LKSA 4G3YH 1U8QB 4CU6A 1N26A 3IAPA 3MLUH 4KVNL 1QSFB 2OQJA 4PJAA 1DEEB 2PR4L 2VLRA 4WTZG 4ISVA 1IT9H 4HZAA 2ZCLH 4FFVC 4Q0XH 1RJCA 3G9AB 1RY7B 1IKNC 3QA3A 3DUSA 1ULVA 1HHJA 4P49A 3D2UA 1YNKL 3SDAB 4Y19D 2VNCA 5IB5A 5TQ0H 3QDMA 2HKFH 5CINH 3MYZA 5EU4A 3IDMB 4PTTA 1EJ6A 3MSPA 5CZXD 3OXRA 4XBEL 2H3NB 5D5ME 1ACYL 1FFNA 3WSQH 1N0XH 1FVCB 4XAWL 1WAAA 1LP9E 1XGTB 3EOBB 1AO7E 3QJFA 1JWUA 5C1MB 4S1DC 4MJIE 5FYLL 1NCAL 3NAAH 1RPQA 2MWCA 1P4LB 4GKNB 5D8JH 3OTTA 2CIIB 1K8DB 4HLZH 3DV4A 1P9MA 3FONB 3S7GA 4Z8FH 5DJAB 1YYLH 3BQUC 4GXUM 4KK6C 4MXQD 4KUCF 2YSSA 1C16B 4C54A 3MBED 2VL5A 1N2RB 4WFED 5B3NA 1TCRA 3GZKA 1PBYA 1U2CA 4KQ3L 3HC3L 2V5SA 5D1XA 5EOCH 2ICEA 2AI0H 2G75B 3LMJH 4P2QB 1ZLUK 2BXYA 1A7NH 5EUOA 4R26L 4IRJC 3V4UH 2R1XA 3C6LA 3EDFA 3WHE1 4RDQG 3VXTB 4OF3A 1EFXD 3S88H 4LAQH 4TVPD 4JDVA 5IK3A 2ZSVB 1ZVSB 4LLMB 4QXGH 1DQTA 4FMFA 3P4OA 1NC2B 1HHIB 3IT8D 4LIQE 4MNGB 1FYTE 3WD5L 2VDKL 1FFOA 4XPHL 4PJ7A 1X5GA 3TP4A 2FJHB 2I07A 4KH2A 1YEGL 1EHNA 2IAMB 4UNUA 4POZD 1ZT1A 3VXOB 4EN3D 3GBML 3HB3D 1ZA6A 3B83A 2O5XH 4X0KA 3SDCD 2E3VA 4DVRL 3NBNA 2PCPB 4PGEB 4R2GB 4MNQD 5DFVC 4XPFL 2YK1L 3BFOA 4FQ2H 2Q20A 1QO3B 4H1LB 2R23A 1AGEB 2DLFH 3HNTH 1M05B 4OT1L 5T5FL 1MCCA 3UEZA 1F8TH 5F9OL 4ERSL 1Q9OA 3ZKNC 3BH8B 4LU5H 2WMPA 5F1KC 5DR5H 2UZYB 4NN6C 4I3SH 1XZ0B 3HR5B 2ESVD 2DQJL 1MIEL 1D5MA 3MV7A 3VFSB 4YK4C 5DJYB 2GAZA 5DDHB 1BMGA 4TOYH 1K8IB 5IFHH 4MSWA 1S9YA 2DD8L 4BZ2L 3BT2H 3U7YH 1HZHL 5E4IA 5DURD 1QLRA 3K1KC 4L4VA 1CZ8H 1L9MA 1FLRH 4PB0L 4PJ5A 5E1HB 1FO0A 4GO6B 3B9EA 4JKLA 3IDJB 4Y4HA 3FT4A 5J6HB 3T4YB 5GHWH 4Y4FB 4Y1AB 1TZGL 3IVKB 4XPGH 3F58H 3JWDL 1ERNA 1AQKH 2QR0A 4K7FB 3BKJH 1M6OB 5TPWH 1W72H 3WFDH 3AXLB 3KJ6H 3L3GA 4Z7VA 2QQNL 2JB6B 2EDNA 4G7VL 5HGDB 1VCAA 5CCKH 1KNOA 2Y6SC 3TN0A 4FQQA 5CWSA 1TVHA 5MEOB 2ATKA 5CEZE 5FO7A 1DCLA 3L3DB 5IESL 4MMXC 3RA7H 5J06A 2FEEI 1WGOA 2AS5M 4OZGA 4WHTB 4PRPB 1G9NL 2NX5E 1FRGL 2IQAA 3MROA 2XKNA 3W81A 3TA3B 1RZ8B 2ERJC 3N50A 4PRIE 4XCCL 2NY5H 4DJMA 1YEIL 4C55A 3X3GH 2F74A 1U8IB 2GJJA 5ILTH 3D39E 4JQVC 1QNZL 4G80B 4OIBA 4JEGB 3KPQA 4LCCC 5B4MD 3QIUA 2R2HB 4JY6A 1LK3H 3HA0A 2HJKB 2LQRA 4FZEH 1MRFL 1JHLL 4MJ5B 2BRQA 4NGHL 3BDYH 4M6OH 3VXUA 5E2WL 3VU2A 2EDRA 3U7WH 1XF4B 2HLFC 3LKRA 1J0ZA 4GW1A 3KXFA 2ED7A 5IIEB 3LH2H 4ESKA 1F3JA 4Z6AT 1A6PA 1WCQA 4KDTC 4FFYL 4Y8DC 5I1CL 5J57B 4Q6IA 3GIZH 3QUXA 2R1YA 4OZHB 4JHZA 1NJ9B 4MVBC 1JTPA 5IB1B 2P8LA 2Z8SA 1RVFL 1WK0A 5L88L 5F3BB 2IG2H 1U3HA 1G9ML 5D96C 5GIRB 1XIWB 3ULVC 4ODWB 1OD7A 4HUVB 4F9LA 1U3YA 4U05A 5A40E 2AJXL 1IGTB 4LAJH 3TBVB 1NUNB 5D1QD 4M7KH 4PJFE 3MQIA 5HPMA 4PRBA 3B2VL 1JE6A 1HN1A 1KEGH 2NYYD 4HIJB 4YGAB 5BQ7B 4KXZH 4U1KB 4HLZG 3TEUA 5HHOB 3DXAA 3DVNA 3LVEA 2DQGH 4NO2B 1YECL 4NBXB 3BP7A 5GISH 2H1PH 4J3VA 5FXCH 4JGUA 3W0WD 3K80A 4Z7QE 3L5XL 3LV3A 1CQYA 1KXTB 1F4YH 2XN9A 1WFNA 4PRHB 2JF1A 1XGPB 5BW7A 4FFWD 1ZLUH 1ZKAA 3BGFB 3THMH 5K59F 3V79C 1WTGT 4WEBH 3NACL 5GS2D 5D4QA 5C0BD 4FG6D 4JFXB 3O6LH 1BD2E 1HKLL 3NABH 2F58H 3QBTB 1OP9A 4H0IA 3H8NA 4HW6A 2F53B 1BQUA 1MRDL 4LVHC 5BRZA 1DLHB 4PP2A 3NIGF 4KKCD 3QCVH 4TULH 1IILE 1QSEB 1OY3B 4HG4K 4B0MM 3AU1B 3JTSA 3DSNA 3ROOB 1IE5A 4LQFH 4PJAF 3A6BL 4HHAA 2R0ZH 4D2NA 1A6UL 3EFFA 3SE4A 5DEFB 3TF7C 1N7MH 4JFDE 5K9KB 2D0HA 3V6OA 4N5EC 1HILA 3T0EE 4O5LH 4NT6A 1CK0H 5IR1A 4FFVD 4P9ML 3GSNH 2HWZL 3TIDA 3IS0X 4RGOH 4HZLA 4Q9BA 4Z7WA 3F8UB 1RMFH 4C57C 4OZFB 1PQZA 2AK1H 3EUUA 3O2DL 1B90A 1WAAF 1R3IH 1J11A 1RJYB 1RI8A 1SBSL 2CO7B 4KK5D 3H3BC 4OLXL 1JGLH 3ROLA 3I6GA 3FHAA 2AV7A 1U8OA 4S1DD 5CJXA 1V7ML 2DMCA 3P9WB 4I18B 1DBAH 3IFLH 5EO1A 2N56A 4JFOB 5HDOA 1C5DB 1JK8B 1WIUA 1CQKA 5CHNB 5J3HC 4MA3A 3TNMB 2A6JB 1S9KC 2G9HA 2Z31C 4N1EA 3RAJL 5ADOH 4CVZA 3BYYA 5EUOF 1ZT4B 1I9JH 3VXMD 3QUZA 4FQLH 3UYRL 3NOIA 3RUGA 3NZ8B 4D0DB 1AXSB 3MNWA 5F71A 2P5WD 3RU8H 4IRJD 2NXYB 3C8HA 2W92A 2WBWB 1JMZA 3WJLA 4HIEA 3NMEA 2EYSB 5CKAA 1HOCA 2F19H 4U6HB 4PJ7F 3S6CA 1ONQB 1DUZA 1E28A 4NN7B 1INDH 2FGWH 1HK6A 4R97C 4X4XA 4YC2B 1B9ZA 3JTTA 2VRAA 1BFSA 4HMCA 3VFRA 1G7MB 2WWMD 3PWNB 3LZFL 3K4AA 5GS1A 3EO0A 4HBQA 5AD0B 1JFQL 5ESQA 1DUYA 3SN6N 1S7TB 2Y23A 4PJCB 1AR1C 3QEGH 4XCNA 5D7JD 3CFBB 3JVGA 1Z3GH 1CFSA 1CICA 5DFVD 2AQ2A 1IZJA 2DQEH 1SHMA 4RFNC 5I1KL 3C5ZD 1KLFA 4YE4H 2OJZL 1LO2L 1WZLA 3MLRH 3VXPB 4G5ZH 3MGOB 3MLSH 2Z93B 4P2CG 4NQSA 3QXDA 4D9QD 1JGUH 3ZKND 1I7RB 4N5UA 4OLZL 2A1WL 1ZK9A 4P4RB 1X5HA 3EYFB 3G5ZB 3QIBD 1CGYA 3ZTJH 1N4XH 2FWOB 4DAGL 1DBMH 2R9HC 1Q94B 1XCTB 4ZTOL 3OB0K 5HI3D 3L3JA 3FQRA 3BN9C 4IRZL 1CVRA 3P4NB 1CR9L 1NGZB 4Y19B 5A3IC 4KJYA 3MUZ1 1WBZB 4P2RA 1BQHA 1UM5L 5FOJA 5EIIA 4WUUD 3UTTA 4EVNA 1G6RB 1Q9WB 3VG9B 2IFFH 1MFDL 3FO1B 5IJKA 3H0TA 2J3SA 1Q1JH 3V9FA 1NAMA 4LCWD 3MLPA 4NWUL 2GJZA 4P3DA 1VGEH 4HDIA 4Q2ZA 2HFTA 1J1PL 5KANI 4M5ZH 1Z9MA 5T3ZH 4DVBA 43CAA 4CRPA 3BAEL 1OPGL 1VSCA 5B39G 4NRZB 3V4VL 3HZKB 1EERB 4Z7VF 1CLZL 1F6AB 4XPAH 4MHHI 5IW1A 3VRJB 1B0WA 3D25A 1IJ9A 1KJ3H 2A6DA 2FEEL 4WY7L 5ACMA 4XP6L 5MEQB 1F97A 1UYWH 3P11L 4PUBL 1KLUB 3CH8A 2YRPA 3MBEB 3S35H 1RUAH 1DJSA 2Y6SD 4HJGA 5JIIA 2G5RA 4YHKH 3EZ8A 4AM0B 5DC9B 3GJFK 2YXFA 1EGJA 5GQBA 2VDPH 3GUTB 3GSUA 1FL5B 2ZG2A 4PTUA 1JZ2A 1BM3L 4C56D 3JV5A 3UTQA 2EYTA 4LASL 1C5BH 1J9CT 2AEQH 3GI8H 1I7ZA 1NMBL 1YN6B 4HGKC 5HYSB 2VZ3A 3EDKA 3DX7A 1I3GH 3ZYJA 3K7UA 1AGBA 2R2EB 4XNZC 4YHYB 4JREB 4J6RL 4L9DA 1ETZB 2XIDA 3MRNA 4U6TA 3WO4B 1NBYB 4UIKL 2R69H 4X4ZA 2EDWA 4Y5XC 1NUFA 1DLFL 4GXVH 4PJIA 1FV1B 1K3ZA 4EN3B 2A73B 4Q74A 4WIQA 1A9BA 2HJLA 4ORGA 1U8KB 4YFLI 3P3YA 5C0AA 1B88A 5EUKB 4UILH 2FJGA 5D2NC 2HLFD 2E9BA 4L3EE 4MNQB 5TE6L 4PV9B 4GJTB 5H35A 3BW9B 4QHKI 4PR5B 4QKXB 2WBJC 1EH9A 1T20A 3ULUE 1BVLB 2Q76A 1FCCA 3V0AC 4BUHA 5JPMB 2OJEB 4UIMA 2NY0D 4Z7NF 3QQ3B 3CVIH 3TH3T 3WFCH 3LKQB 4ZD3H 1QRNA 2CPCA 2AVGA 2OTUB 1IGIL 4PYGA 2FO4A 4K9EH 5KS9A 4CMMB 2ESVB 2PW1B 3ULVD 1HYRC 1OGTB 1EHXA 3C5SA 1MAJA 2AABL 4HUUA 5GZNC 3Q1SL 3FT2B 5E7BA 1D6EA 3G5XA 3RWCA 1H0DA 5DURB 1J0JA 4D0CA 1KENH 3MV01 7CGTA 2ZOLA 3HRZB 3PGFL 3GMMA 1KULA 2X42A 4WO4B 1V8HA 3QNXA 4WWKC 1P6AB 4L5FL 2W38A 3QIWB 3MV8D 1HQRB 3MREA 4LHQB 5FKPA 1EEQA 1MREH 2W0FB 2XA3A 3U0PB 1YEFL 2DDQL 3GNMH 5CD5C 3VD4A 1JPST 4K23H 1B2WH 3NCBB 4M1GH 1XGQA 4TSAH 5C9KA 4I77H 1RHFA 4JPWH 4OI7A 5EFIB 3L3IB 1YMMD 4U1MB 5HJ3A 1ZHLB 5IHUL 5FYJH 1NGXA 2XFXB 5KN5A 2NTFB 4NQEA 3IYLW 3ZKXC 3QI9C 5EWIL 2X4UB 3VXNB 5FHAL 4KJQC 5F6IB 5E6YA 3P4LA 5JHLL 1PW3A 4D8PB 1WWWX 4QRRA 5EOCJ 4JN2B 4K8RL 3WNNA 1F58H 3WDHA 1KB5B 3BMWA 3OKMB 4XWGH 3V5HB 3O11A 5CMAA 1JNJA 2X4PB 5DZNA 1U95A 1A7RH 3QXUA 5DWUL 2RBLA 3JUYA 3DROA 3LEVL 2C3VB 1ZTXH 2IQ9L 1RZIA 4AG4L 3QZWB 2IADB 4YQXH 5FUZL 2L0DA 4N5ED 2F54D 3GO1L 4GRLD 1QFPA 1BWMA 3S96A 1OARL 4Z7WF 5FKAB 1I1AA 3BP4B 1QP1A 4I3GA 3QXTA 4Z5RA 3OJ2C 1SEQL 3B2UD 3VWJC 3QSKB 4Y2DB 4PJHB 3ZTJG 3P9LB 4YDIL 5BMFH 3OKLB 2P24A 1L0QA 4D3CL 3NGBB 1YN7B 4MQ7A 1R0AH 1PX3A 3BDBA 4HIIB 4LRNH 1KYOK 1PG7W 3PGCA 1HHGB 4YDLC 5IJVB 4DWHA 5BVPL 3W9EB 3L5HA 3IETA 2L4OA 3NFPB 5D5MA 2BNRD 4MAUH 3ZE1E 5E2TH 4OZIA 5JPNA 1ZA3B 5B38G 5JLZA 2HRPH 4LSUL 4HUNB 4L3CB 1BFOA 2DICA 4MJIA 5D9SB 4I13B 3WLBA 3RNQA 3TT1H 3DVGA 5MHSD 3OF6D 4KKLC 1AC6A 4XX1G 1IM3A 2CXGA 5D1QB 3BVNB 3LPGA 3RUGF 4OV5B 2Z31D 4G7YL 4XBPB 1RSFA 4KY1H 2YC1B 4I0PA 4IOIA 1KCVL 3AAZA 5INDA 3BO8B 4XCYB 2OM5A 4PJGE 1CGSH 3OHXA 5IEKA 3UZVB 3W0WB 3WNOA 5GSRB 2GY7B 3DPBA 2AQ3A 1PVHA 3G04B 1VFBA 1NLDL 4XNYH 4PGBB 1ZGLB 4V1DD 5GS0H 3CCHB 3QPXL 4RMTA 1VEOA 5INCA 1O7VA 2IBBA 4UUJB 3GJFH 4U1JB 4UV4L 5GRWA 2CLRB 2QHLA 3QEQE 4MB5A 1MEXL 2F5BL 1IC5L 1BFVH 2Q86A 3P40A 4N0UE 1O7SA 1Y18A 1JZ6A 4K94L 3BRDA 2FECI 1FO0L 3AY4A 1MFNA 1LMKA 2PXYC 5LCVL 5C0BB 3SE8H 1FYTA 1YQVH 2GITA 1UKSA 3CFCH 3DV6B 4BA8A 1JZ4A 4X99A 2Z92B 4PRPE 1AQDB 1ZS8B 4ZOAA 4QOKE 4U7KA 5SX5K 2CDFB 5ICYA 4KTEL 1NDMB 5HGBA 4ZO7A 1F5WA 2ZOKA 1A7PL 1WIPA 3LS4L 3RWGA 3S5LB 3DRTB 4PJBE 3O4OB 4HK0A 1MCOL 4HS3B 5HGHA 5IB2B 3FB6A 2X9WA 4NM4L 4ORZC 3HE6C 2FBJL 3IKKA 1RURH 1MHHB 3C9NA 1Y0LB 1DANT 1NGWB 4KZDH 1KCRL 5FOBB 2VLKD 1A5FH 3QWRA 5LWYH 3VJ6B 3UPAA 1JI2A 2R9HD 3OAUH 5L2KD 1XF1A 4GAFB 4NHUB 5DD5L 2RFXA 4LNVA 3HZYB 1FNLA 5CEYA 3QQ4B 3IJHA 3VFVB 1FORH 1T66C 4D0BA 5A3ID 5ADPL 4U2ZA 4F15B 1J88A 1MQKH 2PYEA 2V6HA 4JPIA 2JK5A 4D94A 3TM6A 1FZMB 4XGZB 3KPRD 1FNFA 3PWLA 3BIKB 4DGVH 2A74B 1T2QH 3WN5B 1WVZA 4M8VA 5B22A 3MX0A 1C12A 3RZWA 4S0SD 2DQCH 4N0YL 2WUBH 3OJDB 1GIGH 5T1DH 2PYFA 1T1ZB 4ETQB 5KG9B 3K0WA 4LLAA 4DCQA 4JY4B 4OD2A 5IV2B 4JN1H 1ZLWK 2ZSWB 4WW2C 3O4LA 4N1CA 1D6VL 4DK3A 2X41A 3LD8C 1BX2B 3OQ3B 4JANB 2I9LB 3OGCB 5EU3B 5LQBL 4O4YL 2NW3A 3RY4A 3VXMB 3BKML 25C8L 1EO8L 5FHBL 5FUOH 1X4ZA 1FNSH 4H20L 4DGIL 5A2IH 3LY6A 4X6BB 1I1YB 2LV4A 2CUMA 5MI0C 3KDMB 4XH2A 2NCMA 2AJYH 5DEGA 3WEXB 2BMKA 3GRWH 4UT7L 1BZ7B 3U1SL 5IVXE 4YHNA 1S8DB 3NCFB 4LCUB 5F9WC 2MCPL 4PJ8A 5HD8D 4K3EL 2CIKB 4X80H 3S37X 3LKPB 2H6PA 3VWKC 4PJIF 2NY2D 2GCYA 5TDPA 2BSRB 1BZ9A 2VIRA 3UJTL 5IQ7L 5MENE 5HDBE 1RULH 4HLJA 3L3OB 4KUZH 3RWHB 3VXQA 1CGXA 3LPWA 4ZODA 1PFCA 2B1AL 4JJHA 5E2JA 2F8VA 2VAAB 2P5EB 2E8ZA 5D7JB 2BNQB 5FYKD 2BOBA 1K9TA 4NNYB 2HTLD 4K8RD 1OSPL 4M1CC 4J1UA 3U0WL 3V5KB 3RL2B 4HT1L 2ADJB 3C5ZB 5DUPH 4KK8C 2AJUH 4YZFF 3EO1B 5TQ2L 5KS9F 3S97C 3GHBL 4ZAKA 3UJIL 1CS6A 3BEVA 5DRZA 5C0FB 3CK0H 4U6XB 4QHUA 3QIBB 4JFZL 5J9PB 1HH6B 1MJJB 4YK4B 4EUPH 2VXQL 5GZND 1WWBX 2XG4A 2J8HA 2VLJD 4PGDB 4NWTH 3AUVA 1SY6H 1KCUH 4OM1H 5EORH 4WUUB 5I8OL 4JFFD 1SYVA 4PJFA 5HHQB 1CYGA 4UMGA 3DX9B 4PS4H 2AXGB 4LCWB 3MACH 2R4RH 4M1DH 4MD4A 3WXWH 2APXA 8FABA 4ZPTA 5SWSD 4GLRH 4M00A 4UB0H 1JRHH 3DIFB 2AK4E 2Y7QA 4KKAD 3ESUF 5CD5D 2NY4B 3O2VL 1NUGA 2W9DL 5KVGL 4ODTL 1MCSA 3EJZC 3I50L 3RKPA 5A2LH 1QBLL 3QI9D 1Z9OA 4QYOA 1EEYA 4AIXA 1K5NA 3P0YH 4I2XA 3T0AA 5T3ZE 3PV6B 4XX1E 2EH7H 1BD2A 4N90E 3HMXA 4QF1B 3SQOL 1J1XH 2BVEA 3ORJA 4J3XA 4IHOA 4UV7L 4AEIH 4C56B 4Q97A 5CIPA 1TQCC 2LE9A 3MXWH 4PJ9C 2IEPA 4EOWL 1HKFA 5SX5H 5MEPB 5I0DA 3GI9H 1AI1L 1IGYB 4N0FA 3L5WA 3OXSA 1T7XA 4WGWB 4PBVC 3MRKA 2CMRH 4WI7A 3IFPB 1DL7H 3CVHH 4TPRH 2A9NH 2HN7B 1URLA 2RR3A 3T0EA 4HF5L 4N9GB 2BOCB 1KBGH 3V0WH 2EXWC 1BBDH 1BPVA 2QQLL 2APTA 1E27A 5FA4B 1U3JA 2AXJA 3LEXA 5HI4C 4DOHE 4JDZA 3UXFA 4Z77A 5JXAL 4QWWD 4ELKA 2L7JA 1NGYA 5D5MF 1WLHA 1ZANL 3HZMB 3LHPH 5SWZA 2NY0B 4AH2A 1N5YH 3P77A 1H5BA 4OZIF 2QQKL 4M6NL 4X5LA 5GGSA 5CSZB 5FCUL 1UC6A 2DM3A 1VPOL 4M48L 4DW2H 1MH5A 5IB4A 3OJVC 3S3PA 2I26N 1CD8A 1NEUA 1VACB 4EQ2A 2EEAA 3QDJD 3CFJB 4XB7A 1JTTA 1U91A 4K07A 1YYMH 1I1FA 3MCLH 3VGAC 2IPTH 1UJ3C 1LHZA 5I1DA 4HD9A 3QO1B 4TSBH 4U6VL 4Y5YA 3HMWL 5FIEA 4QRSA 4NKOB 1RK1A 4X5WB 3FQTA 1A6TB 2FHCA 3DMMA 2X4NA 1MUJB 3MJ9A 2CKBB 1ZLWH 4E41D 4YX2L 1SVCP 3RX5A 1GYAA 1UH2A 4FABL 1W2KT 3MV8B 1P4BL 1GZPA 2FECL 1O0VA 5T1LD 5DC4B 5C08E 4ELMB 5EO0B 4MNHB 4XC3L 4GSDH 4TQEH 1DQQB 1V7NL 3IJYA 3QIUD 4X7DC 3WNPA 1A6AB 2KQMA 4UOJA 2DBLH 3DX6A 1KFAL 3HFML 4RGMC 5J13B 4UTAH 1MNUL 3DSFH 1IARB 1VEPA 1J12A 2BY2A 5DJDA 5IVOA 3ISWA 1NAML 4K3JL 1SJVA 3BEWA 4YDKH 3ARGC 4UT9H 5JXEC 5ALBH 3SEPA 1W8NA 1EBPA 3O9WD 5A43C 3INUL 5A2KH 1QLEH 4GBXA 3ARFC 3EYUH 5IKCA 1DQJA 5J1SC 2I27N 2VR9A 4BUGA 5FM5O 5LG1A 4BFIB 3MA7A 3SGEH 5HVGB 1WF5A 4M8QA 5GGTH 4NQDD 4ZPVA 3MYJB 2UV3A 4F58L 2JJSC 1S7SB 5E5RB 4L8DA 5FGCB 2V7NA 4R4FL 3TIEB 3RY6C 5HSFA 1A0QL 5HYJA 4E5XB 5K9QG 1CE6B 2F54B 3MODH 3LSOB 4GRLB 3LRSB 4MNQE 1K2DB 4G8EA 3SPVA 3QNYB 1FP5A 3OAYK 4NZUH 5C07D 1FPTL 2ARJB 4GAGL 5JR1H 1MHEA 3CU1A 1I8LC 2V7HB 4HKXA 1INEH 2GTZA 3KPLA 1T66D 4RX4D 1XT5A 1T89A 3QT2A 4L8BA 5GGUB 4MDJA 3GSWA 5E4EC 2IALA 4EUPG 2UZIL 4KVCL 1FQ9C 4LPVA 3TBTB 5K9OA 3U36B 2DTMH 3GB7A 5EC1B 3SO3C 1EHLH 1OCWH 5LGHH 1X7QB 5EZLA 1W0YT 5F9JA 1OAKL 4LVNB 4IS6A 3BZ4A 3BPCB 2BNRB 5B8CB 4P4KC 4PRAA 2HFFB 2R0WL 3S36H 4EI6B 4LBEA 3MA9H 4H26B 1QFWH 4LDOB 2ZPKL 2XPGA 4RSVA 2QSTA 1G7QB 3QUMH 4K3DH 3VXRD 5CGTA 4NKMB 3GEWB 4O2FB 4G8GD 5C8JA 4LCIH 1J8HA 4QRUB 5J0BA 4R0LC 2XZAL 5A16A 4QRTB 1KJVB 4KHXH 4WENB 4EDXB 2PF6A 3AS1A 3OR6A 3SGDI 5I30L 5IMOA 4YPJA 4XPTL 3FQUB 2XZZA 2OR9H 1MAML 3JWOL 3GDBA 4EIGB 4V1DB 3MLTA 1T03H 3D0LB 4HGMA 1U93B 1BLNB 1X44A 1UWXH 1JPGB 4Z0XA 4HJJL 1LO3H 1KIPB 3G9VA 5HDQL 3D1MC 3Q0HA 1F00I 2O5ZH 1TFHA 5DT1L 2EEDA 5I1EH 1J5OL 5FCSH 4C83A 1IAKA 1FVEB 4DKAA 1AXTH 1R3LB 3BZEA 3TYGH 3E3QE 2EO9A 5C0GA 4WW1A 3EFDL 4QRPD 1P1ZB 2ZNXA 4ZSOE 1I75A 4XHJC 2I60L 2XZCH 2E7MA 4YGVA 4E42A 4JPKH 4NPYA 1KN4L 1QSFA 3A67L 2WWKO 4L3EA 1DEEA 3SJVB 3RWFB 4RBPK 2VDQH 1XAUA 1A2YB 3WKML 3JBG7 3EGSB 3L3KB 5C09E 1MWAB 3KPNB 4C58B 1OWRM 3ME0A 2D03H 3CX2A 4NQTA 1MFEL 4PLOB 2EDBA 4ZOEA 4HFWB 3FJTA 5EU5A 3K46A 1GC1L 4XVSH 5HHVH 5L2KB 4XMPL 5DVMA 2FX9H 1XR9B 4HJ0D 1S3KH 4PJFF 3SCMD 5F96H 2ZCKH 1CFVL 5I6XC 2DJUA 1H3WM 2H3NA 35C8L 3KLHC 3BMVA 1FVCA 4R8WL 2FB4H 1XGTA 3EOBA 2XY2A 4CL7A 1KGCE 4LEXH 3U82B 2EE3A 1E4WL 4Z7QF 3ZDXE 4DEPB 1P4LA 2CIIA 4BKLB 3KLAB 1A6WH 4MDIB 2EC9T 4P9HC 1K8DA 4U3HA 3U0TA 3FONA 2R0LH 5CBAB 1XCQA 1Q38A 3OZ9H 5I19L 1BZQK 5C0EB 3TZVD 1C16A 4H0GA 4S2SA 2DLGA 1N2RA 2EDDA 2Y5EA 3EJZD 5GGVH 3MCG1 2HKHL 1OAYH 5KZCD 3UAJC 1JZ5A 4XAKE 1EV2E 2G75A 4P2QA 2I5YH 1K6QL 1XF3B 4R96B 3CMGA 2V17H 1HHHA 2EYRB 2NY1C 3SKUD 1JI1A 1PDKA 2ZSVA 4LLMA 4MX7B 4P3CL 4YXLH 3QCUL 1HHIA 1CU4H 2V2XA 4OCRH 4MNGA 1TNNA 3PL6D 4ZOBA 2FJHA 2J8UE 3O8XC 4PFEA 4XNZB 4RDQF 4PJEB 4NQUA 5K33A 3CFDB 2IAMA 4M7JL 2NY2B 4XPBL 4ODSH 5C0ND 3T4AB 4GUPA 3VXOA 5HY9B 4I5BB 4HBCH 2FX8H 2A83B 3DETC 3H7LA 4PTTB 5EU4B 2FX7L 2PO6C 3O3BB 2OL3H 1CFNB 3OXRB 4J3WA 1GRWA 2Z91B 4GRWH 4OGYH 5ID0A 2PCPA 3A6CL 4M3KB 2FD6L 2P1YA 4YHMH 1QO3A 4H1LA 4RIRA 2EXWD 3U2SB 4ZTPH 5CILH 5CJOL 5GGQH 1JWUB 1G7IB 3SGJA 3U4AA 1KCKA 3HNSH 3B9KC 3WXVL 1PKQB 3BH8A 4LIQL 3K2UL 2YD3A 4KTDL 1XZ0A 3HR5A 4ZO8A 3ALPA 4ZXBC 5JA9A 3VFSA 1MCEA 5DJYA 5C2BL 2E9WA 4NUJB 2R56L 2VL5B 1K8IA 1L0YA 1MPAL 5DJ0A 2DLHA 1TCRB 1MHPH 1OTTC 5EG6C 5EUOB 4PB9H 4AZ8A 1UCTA 5J7CC 2VLJB 2R1XB 4PLKC 3HG1E 4LNRB 1WFUA 3DWTA 1A14H 1U6AH 1ZHKA 3V4PL 1AJ7H 3HRPA 4JFFB 3IDJA 3N9GH 1MFCL 3WUWG 4P57B 4X9FA 2X70A 5J6HA 3T4YA 3P4OB 4Y1AA 5BS0E 3IVKA 4Y8AA 4G6JL 2ZKHL 3VGEA 4BFBD 3O6FD 4NJAL 3CFEA 4LFHD 4M61B 4NO3B 1TZHB 4KHTH 5TFSH 3AMLA 3HTLX 3HI5L 2AXFB 3CLEH 1CLCA 3LEYH 3V95A 3AXLA 5L8LB 1MAKA 5AZ2L 2HJFB 2NXZC 3BD3A 2JB6A 2P5WE 4K7PH 2QQQA 1LO0H 1ZA6B 1AD9B 3TO2B 4BK4A 4LGPB 4X0KB 2WP3T 4AMKH 3BPOC 3ARGD 2Q87A 2R23B 5LBSL 3H9SE 3LN9A 4K2UL 3LQAC 3MJ6A 4FZ8H 2Z0BA 4OF6A 3NPSC 2BY0A 2A9ML 3ARFD 5HVFB 1KJ2H 4PRPA 4KI5C 5L9DH 4DZBB 3BKYL 4UTBL 1HINH 1FIGL 1RZ8A 1JF6A 1RZ7L 2H32B 3VFGH 3IXAB 5AG8A 2V2TB 1U8IA 4LSSH 1WT5A 3BI9X 1EA9C 3MV7B 4G80A 5HVHC 1UG9A 5FF6B 4XP1H 3W11D 1DE4B 1J1OH 3T0BA 1P84J 1AFVL 3MCKB 4R4NC 3V5DB 3O6ML 3FOLB 3HI6H 5F1NB 5E03A 4L4VB 4MJ5A 3HAEB 1FO0B 4RBPH 3QO0A 1CLOH 1XF4A 3P73A 3QAZC 3D3VD 4YO0A 5IIEA 4P46C 2P7TA 2N4IA 5GJTL 3ARDC 3F6LA 5JOPE 2HAZA 3BKCL 4FQPA 4K7PY 5DJ8A 3WDJA 4OZHA 1NJ9A 2LVEA 1RUKH 5IB1A 3RI5F 1OGAD 4OIAA 1GGCH 4EBQL 5ALCH 1E6JH 4DGYL 1Z6JT 5GIRA 4LSTL 4ODWA 4U1SB 1MY7A 3ARRA 3SE9H 4HUVA 3L3GB 2VE6B 3QRGL 1J10A 3S37L 5D70H 5J89A 1I3RB 4FQQB 1GGTA 1IGTA 5TE7L 2ATKB 4CGTA 4AK1A 2VDOL 5FO7B 1SJHB 3CDYA 4ODHL 4HIJA 5BQ7A 5D6CB 2WANA 2BZDA 5HHOA 5EBMB 5BV7L 4R7NB 2M2DA 2MHAA 1HI6B 4NO2A 3CXHK 5C7XL 4EXPX 3BPLB 3O0RH 3WFBL 4HFUH 4YPGB 4LDEB 4J7RA 5I71C 5EH1A 1VFAB 4PRHA 5F3HA 1XGPA 1IFHH 1MFBH 1AGCA 2D2OA 1Q0YH 3KLSA 4NNXB 1BREA 5T1LB 3DURB 4I9WD 2OS7A 3HI1B 1SJEA 3ALXA 3I3BA 2FR4B 2YD6A 4AEHL 4IOSD 3KPQB 2RHEA 1Z9LA 4OD3L 2Q1EA 3QIUB 2AGJL 2CXKA 3FQXB 1AXIB 2RGSA 3WIIH 4LHUG 5ECJE 5IBLD 5E08L 1C8PA 5I74C 3QQ9C 3CMOL 3U48A 2F53A 3SGKC 1DLHA 4H25B 1F3JB 2R29L 3OV6A 4S1RL 3O9WB 4J3SA 4BSJA 5DUBB 2G60H 1G1YA 1QSEA 4JRXD 5AZEL 4NM8H 3AU1A 1PEWA 3ROOA 3IDNB 5EZOH 1U3HB 2IBZY 3Q6GH 4PJXE 3BGMB 4NQDB 3HS0A 1G6RH 5DEFA 4NN5C 1AO7D 4IMLA 3ULUF 5K9KA 2BVOA 3NVQA 3W39B 5D6DA 1OHQA 1CGVA 4J12A 2W0LA 4M6AA 5I1GH 1P9MC 3WE6B 3HMXL 3AREC 4PLJC 2D3VA 4U0RB 4XXDB 5C07B 4LSVH 3MJ8A 3PHQA 2Z35B 3TH4T 32C2B 1MFAH 2H41A 4ZQKA 4PY8I 1P7KA 2VDNL 5D1XC 1JYWA 3LV3B 1RJYA 2XN9B 3KLHD 1I8IB 3UTOA 3BH9A 3C6LC 2YKLL 2R15A 3ULVE 3STLB 3TH2T 3V8OA 1D5BA 4I18A 1M1SA 3AROA 1QLFA 1JCKA 4JFOA 1C5DA 1JK8A 2E6JA 4OSUL 2ORBH 5ICXA 1F11B 2B2XH 3GMLB 1FYTD 3SDXE 1AGFA 3IFNH 1DTUA 2A6JA 5IGXH 4WW2B 3RWJB 1ZT4A 4FQXD 1IC7L 3FMGL 3ZE0E 3VXRB 5L7XL 4JO4H 5M95B 2VXVH 4XI5D 2CKNA 1IBGH 3J7HA 4OB5H 3B6SB 4G8GB 3NZ8A 1NCBL 1AXSA 1KTRL 3ZE2E 5I8EB 2UWEE 2KUTA 1A6VL 2VDLH 5BZWB 2E9JA 2UY7A 3JWNC 3SKOA 2NY1D 2EYSA 1AHWC 4FXKA 3EFFB 1XF5B 4ALAL 3MOQA 1ORSA 5C0IB 4LL9A 1HSBB 2JELH 4U6HA 1YMME 4L8SB 3HKFA 1ONQA 2N7BA 1RAMA 3QWRD 5ITBH 4RA3A 1F02I 1BJMA 3F5WB 3O8XD 4WCYH 4YNYB 3MJ9L 3PWNA 4EI5C 2ICWB 4HZLB 1H3XA 5EA0L 5KBNC 2YR3A 1I85C 1Q9LA 1U2HA 5AD0A 5SV3A 2C3GA 4TUKH 1S7TA 3DETD 3EYSL 3BZDA 4PJCA 3B5GA 5T1KA 3CFBA 3GBNL 4LSPH 4N68A 4U3CA 4QRPB 2OTWB 2KQNA 3U4BL 5F88A 5I15H 2AV7B 4IJ3C 1PSKH 2F54E 5I1IH 2C3WA 4ETYA 3MGOA 5IBTL 4Y4HC 3B9KD 2JLLA 4P4RA 3EYFA 1QTYT 4ZXBD 2FEDD 2FWOA 2XYCA 5KSAC 4MA3B 1C1EL 2G9HB 3VE0B 4MQXC 1XCTA 2E6QA 4G6KL 4NKIL 5F9DC 4U6YB 3ZE1F 3NCJH 1ZLVK 3QUZB 5CSGA 3LN4B 3P4NA 1NGZA 4Y19A 1Z0NA 4YJZL 2K1MA 2YUWA 1MF2L 1WBZA 5JW3H 3TN0C 2C1PB 2YRZA 1Q9WA 3SCMB 4S10A 5CEZD 1A3LH 1DQLH 4KRPC 3FO1A 4HIEB 5DD0L 5CP3A 4NYLB 4PJGF 1OW0A 2KDGA 2GK2A 4WFFE 5D2LB 1UWGH 1K85A 4B7IA 5EOQL 3F7VB 4OFYD 2NX5D 1S78D 4NRZA 4HC1A 5C70A 5DQDL 4ONGL 3HZKA 5SX4H 5E70A 2OMBA 1F6AA 3D9AL 3L1OL 1RZJH 4PRID 2EDJA 3STZB 1HEZB 3D39D 3EO0B 5MEQA 2OZ4H 4MWFB 4JM4L 3TZVB 4X6DE 2YN3A 2DLIA 1KLUA 4MA7H 4XP9L 3MBEA 3OX8B 2O5YL 3WIFB 1AP2B 4YEEA 2YUXA 2P43B 5KZCB 4PY7B 3UMTA 4XCNB 1WZ1L 4NZJA 4AM0A 3RIFF 1M71B 2DB8A 1Q9KB 1EAJA 2ITCB 4V1DE 1FL5A 3RTQC 5T5NG 4Q0XL 1EFXA 1HCVA 5DJ6B 1YN6A 2JIXA 5HYSA 4Q6IC 4GMTH 1H15B 4PJBF 5DMIH 5DXWA 3KR3H 2BRRL 1TQCB 1WBXB 3T2NL 1U58A 2HRLA 2ED8A 2R2EA 5C3TA 4OQTA 3FCTA 3KHQA 1ETZA 3PL6B 1DBJH 3I9GL 3L3JB 1RU9L 4X7CC 4AQOA 5EOTB 3LKOA 1CE1L 5IG7B 4WEMB 1T83A 4OGAC 1UWEL 2J6EH 2A73A 1SYSB 4EN3A 2VH5L 3M1BB 4EVNB 1S7QB 2QJDA 3CFIC 1PZ5A 4KVNH 1EDQA 3SDCA 3VXSE 2PR4H 1NAMB 4MNQA 4OZHF 4XNQB 5D8JL 4BH7A 5D1ZD 4P46D 2AEIT 2J88L 4PV9A 1LWRA 4WU7B 5DHVH 3BW9A 4HDIB 4Q2ZB 4PR5A 3ARDD 1BVLA 3E2HC 3PQYD 3S98A 1RUMH 2VLKE 5EBLB 5JPMA 4DVBB 2OJEA 1YYLL 3G6JE 3TFKC 3QQ3A 3N1MC 1HDMB 3GK8H 3LKQA 1YNKH 1U92A 3FO0L 3RWDA 5F97E 1NBZB 5IW1B 2ESVA 2PW1A 3ETBF 1OGTA 4GRWE 1IGML 1XGRA 3F7PC 4KDWA 4XBEH 3VMPA 1ACYH 1EXUB 4HJGB 1UA6L 2D9CA 3QUYD 4XAWH 3QG7L 3S88L 3KPRE 5E7FA 2VKWA 5FYLH 3HRZA 1NCAH 5CJQL 4F33B 3WIHA 3AM8C 3NFSL 4J8RA 5C6TL 1CFBA 2BJML 1KIQB 2YPLE 3ULUL 2D9QB 1HQRA 3LN5A 1D3CA 1GVIA 1KJMB 1P6FA 1IQWH 2W0FA 3U0PA 1OT2A 4NUGH 3V7AG 4K3HA 3O6FB 4KQ3H 3VGFA 3HC3H 5FK9B 4QXWA 3SE4C 1JBJA 2DIBA 2O5XL 4HUKB 4OGXL 4R26H 5EFIA 5IVXF 4JFDD 3V6OC 2B5IC 1ZHLA 1ND0B 2XFXA 4PJIB 3VXNA 3QQ9D 1F8TL 4D8PA 4ZOCA 3M07A 5KSBE 1KB5A 3ARGB 3OMZA 5DR5L 3OKMA 3V5HA 1S7UA 2X1PA 1C5CL 5HDBF 3WD5H 3VFMB 2VDKH 4ZDHB 1T20B 5IWLA 4XPHH 1YY9C 2X4PA 2NY5C 4UIMB 2ZUQC 1YEGH 1N64H 4PJEE 5IFHL 1FNAA 2E7CA 2JTDA 4RA0C 2HT3C 3GJFA 3GBMH 1FL6A 3GMNA 2IADA 4ZSOA 1CZ8L 5CJXC 1FLRL 4DVRH 3DARA 4HUUB 3QNZA 2YK1H 9CGTA 3KPSD 1ZXQA 5FKAA 1D6EB 3FQWB 2Y36H 3BP4A 5D2NE 4OT1H 5HPOA 4IOFC 2ZOLB 3DMMD 4XCFH 4PJHA 5F9OH 4ERSH 3TBYB 3MRLB 1TXKA 3P9LA 3QEHB 4JFHE 1C08A 1J8KA 4XPGL 3D3VB 5LXGL 4GG6E 1G7JB 2Q3ZA 1S7VB 3U83A 2FLRT 2VN4A 4HIIA 2DQJH 1MIEH 3RJDA 1CXLA 3PHSA 5TH2B 1HHGA 5IJVA 3P2TA 2YOCA 5JZ7C 3WJLC 4IDJL 1CFTA 2DD8H 4BZ2H 3MRFA 3W9EA 5CCKL 3SE3A 4F3FA 3NFPA 2WIIB 1UQSB 3RZCC 3ARTA 4PB0H 2MKLC 3TV3H 1NGXB 5KN5B 4DQOH 3S34L 4Q58C 3V6FB 1HE7A 3BPNC 5D9SA 3WFHA 4BQ6A 3SBWC 5KW9H 2C4FU 3WNKA 1JNNL 3QEUB 4HWZB 5D1QA 3BVNA 5I75C 4OV5A 2VLMD 5GS1C 1EEUA 5I73C 2DQHH 2YC1A 2PW2B 1TZGH 3VFPB 2E27H 2EZ0C 1KLGB 1GGUA 4H0HB 5CMAB 3JWDH 5E8DL 3WL9B 4Q9RL 3K8LA 3NFNA 4J3OC 5SWSE 3W0WA 5GSRA 5DUMH 5E2VL 3QZWG 4EZMA 1R3JB 3G04A 4AY0A 4NP4L 3VRIA 1ZGLA 3UJJL 2QQNH 3HC0B 2VUYA 3CCHA 3VFNA 3X3FL 4G7VH 4WHCA 1NANH 2CLRA 4EXKA 1E0OB 1MIML 2QSCL 5DZLA 3U7WL 1JMXA 2BVYA 5C0BA 3FB5B 3U46A 4Z5RB 1IM9D 4EI5D 3VDCA 4PJCF 3DV6A 1IGJA 2Z92A 1F4HA 2IBGA 1G9NH 4FQ1L 5FFLA 5CEXB 2VERN 1FRGH 2J8UA 1ZS8A 5FO8B 1XGYL 4U4BA 2CDFA 3N1GC 1JZ7A 1LDSA 1NDMA 4GG8B 4XCCH 2NR6D 1YEIH 3S5LA 1QNZH 3DRTA 1FZKB 5C86A 2BK8A 4JRXB 2M1KA 2UYLB 1NCCL 1KELL 5IB2A 4OGZA 3IETB 5D5MB 2X1WL 4YBLC 3V6ZB 4P3WA 4AENB 1LP9B 3I6LE 1JHLH 1MHHA 1AO7B 5JDSA 4NGHH 1NGWA 5JLZB 1BFOB 5E2WH 4MB4A 3O3EB 3VJ6A 5KSAD 1IM3B 3ZKSD 1VB9A 3GSVB 4MQXD 3BX7C 4FFYH 1IKNA 1FC2D 4NHUA 5I1CH 1LEGB 3FRUB 3DGGB 4AT6B 3M8OL 5INDB 4TUOA 3VFVA 1RVFH 1BWWA 1BGXH 5F89B 5L88H 5IEKB 1G9MH 1FZMA 4XGZA 1VFBB 4KRPD 2BNUB 3BIKA 5I6XB 2A74A 3RNKB 1U9KA 2QSVA 5DI8B 2CJUL 1GJIA 1T1ZA 5KG9A 3QDJE 4R90L 1TTFA 2YWYA 4JY4A 1RJLA 4WRLA 2FGZA 4KK9D 4TULL 1YECH 3BGAA 1FYTB 1QA9B 1BX2A 3L5XH 4JANA 2FSEB 2I9LA 3OGCA 5EU3A 4E41E 1S9XB 2CH8A 5HGBB 2YA0A 4FQXB 3VXMA 1S7XB 2R0ZL 1EFQA 4X9IA 4DN3L 1CXHA 1N7ML 4X6BA 1I1YA 2FZ3A 2P5WA 4LKCA 4IRJA 4HK0B 1MVUB 3RTQD 5HGHB 3UO1H 3KDMA 3JV4A 3NACH 2NY1B 3KG5A 3GSNL 4IIQC 1PG7X 1BZ7A 4LCUA 2BX5A 3FZUC 4Y4KC 5FGBA 2EDKA 1RMFL 1MRDH 2CIKA 1QZ1A 3LKPA 5I1LB 4JZNB 2DS4A 5DHYB 3QDHA 5I1JL 4TTDD 3O8XB 2BSRA 3BSZL 3KYAA 3V7AE 2AEPL 1UCBH 2RFXB 3MLVL 3IJHB 4NRYB 4U33A 4OGAD 1GGBL 3U30C 1JGLL 3A6BH 3L3OA 4JAMB 4NNPL 5JMOC 3TCLB 1A6UH 4NOBA 2YN5A 1DSFL 2CSPA 3OKNA 4ZNEE 4KC3B 5D7JA 1A1NB 3JUZA 1H8SA 2GHWB 4NNYA 5F7MC 2X9XA 1C12B 3V5KA 1NCDL 3C5ZA 4KI1A 1OF2B 2X7LA 2HWZH 3MLZL 3TFKD 3B9KB 1KV3A 3CDCA 5C0FA 4MD0B 4U6XA 2WIMA 3QIBA 1JGDA 4NJ9L 5IROC 3O2DH 4P23C 2OXHA 5J9PA 1MJJA 4ZFGL 5CJ5A 1NPUA 1SBSH 3C5JB 3K3QA 4Q9QH 1UENA 4WJ5A 1P5UA 4MAYD 4BFGA 4PGDA 4MS8C 3ET9F 1OM3H 2GEEA 2KKQA 1QBAA 1V7MH 4WUUA 4DTGL 3FB7B 4A6YB 4HUXB 4XH2B 3DX9A 2EDTA 4Y5VB 4LCWA 1MVFA 3VFOB 2BMKB 4YHNB 1GC1C 1MHCB 3KYKL 1A3RH 3O6KH 5I8KL 4AEEA 5JO5A 3RAJH 3SY0A 3DIFA 4YXKL 1CLYL 2NX5B 2H6PB 4RAHA 4ZFZA 1N6QH 5DJZB 4G8GE 4PRIB 4AQ1B 3QEGL 2YS4A 1ZVHA 2DQTH 4NIKB 3D39B 1MRCL 1QRKA 3QG6A 3ZHLA 4TRPL 3GIVB 1I1AC 3EHBC 4OTXH 3MNZB 5B21A 4MXVF 1U3ZA 4JRWA 3PV6A 3TLRA 5C71A 3CPLB 3UPCA 4GOSA 4M4PA 3B3IB 4ZS6C 4OLUH 4C56A 4N0CD 1P7QD 3FAXA 3NPSB 1AGDB 3LZFH 5L2JB 2VO5A 3BEVB 4RZCB 1CDGA 2Z8WC 1JFQH 1N6UA 2HT3D 3LB6C 1A4KB 1IGYA 4GQ9L 5JORB 3JV0A 1VKXB 4X4ME 4JQVA 5DTFB 1T0NB 4PJXA 4DZ8A 1T2XA 3IFPA 2XQBL 2WINA 4BSVB 5AYQA 4LCCA 4PJHF 2D7TL 2VWEC 4L4TE 5TDOB 3M45A 5I1KH 2OJZH 1LO2H 4IOFD 2DI8A 5F7DB 1IEAB 1BVZA 3T3ME 1SYVB 2BOCA 4OKVB 3RX8A 3T3PF 3OB8A 2BHYA 4I0PC 4U3XA 2GTWA 4ZO9A 3DVFA 4GKOA 1KPUB 1T6WA 5D1ZB 4P46B 4LP5A 4RAUB 4DAGH 2G5BA 1HIML 1T3FA 4N8VG 3PQYB 4ZPTB 3TO4D 4K9EC 4ZTOH 1ZV5A 4G6FB 2XWJB 5JZ7D 4RRPA 5I18L 5IT2L 5CSZA 4IRZH 1CR9H 2VSCA 1HYSC 4C4KT 4YHKL 3FFCE 1UM5H 1IRAY 3ZDXF 3RZCD 2DN7A 5ETUA 1T1YB 2WLZA 3PABA 3QEQD 4TSCL 1MFDH 4H5SA 4IMKA 3CFJA 4RFOH 5I1AB 5FGSA 2AW2A 2HA1A 1LO4L 3AY4C 2QHRL 5KAQF 5E6ID 3QO1A 3QUYB 4NWUH 4POYA 4E0RB 3GI8L 4NKOA 3C8DA 4UNVA 1J1PH 4M43L 4X5WA 2QV2A 4ZUTB 1A6TA 2LU3A 3SDXA 5IHZB 2VXUL 1BD2B 1I3GL 3BAEH 2CKBA 1OPGH 5KJRL 4QOKD 4JHAL 2O61A 1CDHA 1H3PL 3KYMB 4KU1A 2A77L 4OLVL 3MV8A 2R69L 4XP6H 5I71B 2HG5B 4I8DA 4ELMA 5EO0A 3VGDA 3L5WB 3D69B 3VGHA 3VCLB 3OXSB 1NC4D 3QULB 3CXHJ 2VZTA 1W0WB 4Z7UE 2CDEB 2H2PD 3EAKA 1A6AA 4XNXL 5JW4M 4FXLA 4JFDB 2EDOA 1YMMA 2J8UF 3T0EB 1BM3H 3R0NA 1B6UA 2WQRA 5I74B 4LQ1A 4X9GA 1GXEA 1E27B 1PLGH 3LEXB 3PWPD 3MOAL 3RVVD 2XOTA 4HC1L 2W65A 4ZUUA 4ELKB 3IRZA 1JJUA 1YJDC 2GUOA 1GAFH 4BFIA 2NZ9C 4WFGE 4AH2B 5DK0A 2DYPD 4UIKH 5GGSB 4WHDA 4OD1H 1T2JA 2XTJC 1LE9B 1KN2L 1NLBL 5CLTA 3SKMB 1MH5B 5IB4B 2BVTA 4P2OC 2NY7L 4UZGA 1IL1B 2ED9A 4HUMB 4NN5B 2EIBA 3TIEA 3TVMC 3SDDD 4E5XA 2F54A 3IRPX 2GSIB 3LSOA 4J4PD 4MLIA 4GRLA 3LRSA 4OFDA 4NO0D 1K2DA 1TETL 2QADC 2HT2D 3KGRA 1KPRB 4QRSB 2ARJA 4KKBD 1OD9A 1R3HB 3D87B 3TJEL 1BEYL 2APBA 4WFHD 4Z78A 4TVPL 3DMMB 2V7HA 2GFBA 3F7QA 4KZEL 1KCSL 5GRVK 3F7RA 5TF0A 5GGUA 4XWOC 4K23L 2VZ1A 1IGIH 3ARYA 4OQTL 4TSAL 2R2BA 2H45A 2LVCA 4QHLB 1GZPB 4S11A 4TYUA 5EC1A 1VADB 4MGXA 4CVUA 2GK0B 1X7QA 2ZCHL 3Q1SH 1UH4A 3BPCA 2BNRA 5B8CA 2HFFA 3PGFH 5DJDB 4PJ8C 3LS5L 4H26A 2E7HA 1LILA 1D9KC 1NGQH 3OF6A 4M5YL 4PV8A 4L5FH 1G7QA 1A7RL 4NKMA 2Z9TA 1T1WA 4O2FA 1KXQE 2Z31A 4HV8A 5MEND 1EUUA 2EDEA 4QRUA 1ZTXL 2DDQH 5IKCB 1DQJB 4QRTA 1WBYA 2VXSH 4X6DA 3TWCL 1DDHA 5GS0C 4YQXL 2D31B 3E3QC 3FQUA 5IHUH 5GRJL 5TE4L 4DUWA 3QB7C 4JFED 4V1DA 5FGRA 5EWIH 3D0LA 2V7NB 5FHAH 1U93A 4JR9H 4Y4KD 1JPGA 5JHLH 5MP6L 3C87A 3WDIA 5BMFL 1RUPL 1KIPA 3JZ7A 1GGYA 3Q3GA 1ZE3C 3WIHL 5EBWB 4M7LH 1R0AL 4LRNL 1MHEB 5IUSA 1IM9B 1FVEA 3RX7A 1JHKL 3KPLB 1R3LA 3ALWA 4MJ2A 2IQ9H 2G2RB 5GRUL 2IALB 5ESVA 3BD5A 4AG4H 2AP2A 1H3UA 5FUZH 2BSSB 3GO1H 1YC7A 5EZLB 3VH8G 2W9EL 2HFEB 4WI4A 5L0QC 5F9JB 3TT1L 1OARH 3C6SB 3QDAA 3RWFA 5DVNA 1TITA 4H88L 3OKKA 1SEQH 2VAJA 3KYOA 4R4BB 4M6ML 3V8CA 3RBSA 2VLKA 1MI5D 1MWAA 2OTPA 3KPNA 4I4WB 1KB5L 2AK4D 2XPGB 4HXBL 4D3CH 3N85L 4P23D 1JYNA 5L2KA 4EEEA 3KPMB 2QTEA 2VC2L 1XR9A 3HUJE 4BSWB 5BVPH 1EHAA 5EZIL 5E00B 3W2DL 1OGAE 5CD3A 4MS8D 1RZKL 1AKJD 4HIHB 3QHFH 1L9NA 3KPRA 5T3ZD 4KRPB 4YDVB 3IS1X 4WNQA 4LSUH 2NY6C 3PP4L 5DRNB 3MJ7A 4EIZC 3MBXL 1YQVL 1DZBA 4YLQT 4ZMAT 3KLAA 2ADFL 4MDIA 4MA8H 4M9OA 5F1OB 3BJ91 1J05B 3ZT6A 1PEZA 1ZT7A 4OCMC 1MJ7H 3FN0L 1KCVH 3T8XB 5CBAA 5IOPB 3GJEB 4W4NA 5C0EA 5HHME 4C83B 2XA8L 1IAKB 4WTWA 2VMFA 3QDGE 3MRPB 2CLZA 4GAJL 1NLDH 5C0GB 3QPXH 1FGVH 1XF3A 4R96A 1RURL 3CXDL 3O2WL 1U0QA 4UV4H 4M62L 2MQ3A 5IBUB 2F5BH 4E42B 4KZDL 4I9WE 1IC5H 2DI9A 3RTQB 4NPYB 4JM2D 4K94H 1FO0H 4ZS6D 4MX7A 12E8H 1BVKB 4L3EB 3WMSA 3OAUL 1OP5K 4PBWD 5ISZE 3K4ZA 4DKFL 5JOEA 4PJXF 1H5BC 1FORL 4KTEH 1KOAA 5IFAH 3NIDE 1PJ9A 4PJEA 4X5XA 3CFDA 5EU5B 3GGWB 1A7PH 3LS4H 3MNVB 4L9LB 3KPOA 1KTLB 1T0MB 3T4AA 2Y25A 5HY9A 4I5BA 4LVOB 3MFGB 4K55A 4JVWA 2A83A 4Y5XA 4JRXE 3HZVB 1U8MB 3O3BA 3BUYB 4G8FB 4OI8A 1CFNA 2D7QA 2Z91A 3IKCB 2FBJH 4Y5YC 5T1DL 2EO1A 4JRYE 1Z5LA 3U2SA 1KCRH 4U2YA 1G7IA 4N8PA 1JL8A 3VD5A 4G9FE 3I85A 3K1DA 1VENA 4NCC2 1PKQA 1G7HA 4HQQL 1CG9A 3U0TB 5I66B 5DD5H 2O93L 3ULVF 3B5HA 3O3DB 4HPOL 3ARBC 5DFTA 3Q5YA 1XCQB 5IB3A 2DM2A 5ADPH 5C08D 4CBPA 4S2SB 4NUJA 4HWEL 4UAOB 1KTDA 1FLTX 5KTEH 4U1LB 4JO3L 4W6YB 3SDXF 3ZL4L 5F6HJ 4D9LL 2VLJA 4MAYB 3RRQA 4N0YH 3GRWL 5DF0A 1HHHB 4LNRA 3MXVL 4JKPL 3ZE0F 3C2AL 4G6AC 4JFFA 2D0GA 2JIXD 4M03A 1TJIL 2YHGA 4P57A 1BQSA 4GBXC 2UWEF 2V2XB 2KPNA 4ELMF 1D6VH 1F42A 3DRQB 4QT5B 3S4SG 3SOBL 5SWSA 3PIQB 5LQBH 1W72B 1RULL 1TZHA 4M61A 4NO3A 4O4YH 2IBZX 5FYJD 2AXFA 4KUZL 1H8NA 3BKMH 25C8H 2YRLA 15C8L 5FHBH 1A7OL 3RDTC 4GW4B 4KMQA 2HJFA 4GUPB 2CLVA 4DGIH 4GKSB 2PUQT 5K9JL 4W81A 3O3AA 3TO2A 1AD9A 3RHWK 5KSVB 4X98B 5ID0B 3EYQD 1CL7I 3EJJX 3QI9A 1K4DB 5DS8A 4LPUA 4RIRB 3U1SH 5AAWA 4PGCA 1YEHL 4G8IB 3PDGA 4D9RE 4WWID 2B4CL 4K3EH 2DLTA 1NKRA 4DZBA 1QYGL 3DYMA 3O41B 2NZ9D 1P7QB 4JKKA 1GSMA 2H32A 4I3RH 3IXAA 3X12B 4NKQB 3UJTH 5IQ7H 2V2TA 2XTJD 3GSOB 4KMTL 1WJ3A 5FF6A 1DE4A 4P2OD 5DJ0B 1KCUL 3TNNB 2B1AH 3TVMD 1FIEA 3MCKA 3V5DA 3FOLA 5F1NA 2D7NA 4FTVE 4OCYL 3HAEA 3U0WH 2QADD 5DSCB 3OKDB 4OF7A 5DJCB 3MACL 3KJ4C 2R4RL 3R06B 2E7LA 1ZHKB 5TQ2H 1I3UA 3GHBH 3UJIH 2X70B 4YWGL 4HSQA 4NKDB 3MMEA 2H8PB 4JFZH 3HE7D 4PJGB 1JPTL 4FA8A 1UM6L 3TO4B 1IC4L 1PG7L 3QFDA 3CFEB 1OP3K 1L4IA 2VXQH 5ID1A 4U1SA 4XBGB 4JB9H 2VE6A 5HHXL 4JJ5B 3WFEL 3RZCB 1I3RA 4JQIL 2V9RA 4NOFA 3QEQB 4KROC 5EU6D 3DBXA 3PWUB 3QDJA 4N0UB 1SJHA 1D9KD 3O45B 5D6CA 5E6IB 4YEFA 2BSTA 5EBMA 4WI8A 5T3XH 4X6DF 4M7ZB 4R7NA 5B39B 1JGVL 1HI6A 1CF8L 2Y72A 5F44A 3DLQR 2BVUA 3GI9L 3CNKA 4QOKB 4E41A 3O2VH 1YEJL 4YPGA 1EX0A 5GS0D 1NAKL 1VFAA 5KVGH 4ODTH 4YHIB 4JGMA 4PJBB 4NNXA 2GJ6E 1UZ6E 5T1LA 3DURA 2E5EA 3HI1A 2P45B 1QBLH 2FR4A 1NC4B 3IDIA 1TJHL 1ACZA 1KBGL 3FQXA 1UM4H 4HMDA 4UT6L 5C09D 3T0XA 3SQOH 1OP5H 1DP0A 3QO0B 3PNWB 5DMGC 3BP6B 4HKJA 2P4AB 3P73B 3SDAC 4YO0B 2D4FA 4H25A 2P7TB 3NZHH 4EOWH 4KI5E 1NMAH 3O9WA 4APQD 2R0KL 3L5IA 5DUBA 3OBAA 3PWPB 5DJ8B 1AI1H 1M7IB 4NQCE 4JZOB 3QFJE 3NCYP 3IDNA 3FN3A 4X4YB 5F7HA 3BGMA 5LGJB 4NQDA 6FABL 3BHBA 2IPTL 1KGCD 3W39A 3K2MC 2NY3D 2PETA 2EH8L 3GSNB 1T6VN 1GGIH 2K7PA 1Q0XL 3ECBA 3SDDB 4CN6A 2HVJB 3UTSE 1QEWB 3IGAB 1TZIA 2ZNWA 4OI9A 2EDXA 3WE6A 5I8CB 4XXDA 2GKIA 5FDYA 3NH7L 3UTZA 5C07A 4UOW1 5JXAH 1K3IA 2MHAB 2Z35A 4JQXC 1QFWM 32C2A 3IDXL 1ZANH 3PQYE 5FUCC 1ZHBA 1QBBA 1G7LA 1FG9C 2QQKH 5KANG 3BOVA 5FCUH 4RX4A 4XAKD 3DJ9A 4JO2L 4GSDL 4M48H 4TQEL 3WNMA 1I8IA 4XP4L 5F3HB 2DBLL 1AGCB 1ZSDB 4GKZB 4MHHG 1WISA 3STLA 4HPYL 3ZYZA 2Q8AH 3LQMA 2VZOA 2NW2B 1SJEB 4ZUVB 3LKNB 1G7PA 2ENYA 3ILQD 4EDWL 4UT9L 1F11A 5K59E 3UTPE 3GM0A 1KT2B 3PE9A 3GMLA 2AJVL 3MOBL 5IVXB 1FN4A 1L7TH 1QLEL 3EYUL 4WW2A 3RWJA 4YX2H 1KSRA 1D5IH 1JF1B 3VXRA 3EYVB 1IGCL 3C09B 4FABH 1I8MB 2FYYA 3B6SA 3EOAB 2NTSP 4H8WL 4G8GA 2ARJQ 5MENB 3E6FB 5I8EA 1AC0A 4XC3H 5D7SL 4R2GC 5BZWA 1V7NH 3H42L 4LLWB 4ZNCD 3ULVL 1XF5A 1KFAH 3HS0B 5C0IA 4IMLB 1HSBA 4PJAE 3PDOB 1MNUH 2BVOB 1NMCB 4FQCL 4I48B 1JF5A 2VLRE 4L8SA 1FJ1B 1NAMH 4K3JH 4PJEF 3WKNA 2GSGA 4IEFB 3F7YB 3F5WA 4GMSH 4YNYA 3H9YA 3INUH 2CKBL 2ICWA 3Q5TA 2CDGA 3MJ8B 3U6RB 3QDME 3PHQB 2CRYA 4XTRC 4ZQKB 1P7KB 1VFUA 4LLVB 1LNUA 4WTXA 4RMSA 4F58H 2J5LC 1LVEA 3BH9B 1WAAE 5L8JB 4QRPA 3HG1D 2OTWA 3QXAA 1A0QH 1EGJH 1D5BB 1KCLA 1QLFB 4Y4FC 3KPSE 5IW6B 3MRMA 1FPTH 5ICXB 3S9DB 5BS0D 1AGFB 2XTLA 3ARBD 1YMHA 3BQUD 4KK6D 2I