3L5JA

Crystal structure of fniii domains of human gp130 (domains 4-6)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
288
structure length
283
Chain Sequence
b'EDRPSKAPSFWYKIDPYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin-6 receptor subunit beta
publication title Crystal structure of the entire ectodomain of gp130: insights into the molecular assembly of the tall cytokine receptor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 283
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5jA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5jA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5jA03
1QVOA 1QO3A 3L3JB 2DI9A 1MPAH 2AK1H 5I1AB 1JNNH 1NDMA 2FEEI 1S5IH 4Y5XA 3T3MF 1K4CA 1GHFH 4DK3A 4JM4H 4PJEA 1N59B 3UPRA 2PW1A 2R9HC 1K4DA 1ZWIB 4P5MA 5DVOA 4P2QB 4PLJC 4YHPB 4C4KO 5JPNB 2IPTH 3NCBB 2BSRB 5F9AC 4PGDA 1I85C 4JG1H 5DFVC 2Z31B 4M1GH 1ITCA 4P2OB 2UY6A 4N9OB 2BMKA 4XGZA 4OCXL 3EW3B 1WAAA 1MCBA 3BP4B 2Q8AH 1F90H 1T7VA 2B1AH 5I15H 1A6ZA 4GW5B 3CCHB 3HS0A 2HKFL 3DRTA 4OGXL 2IANB 3V6ZB 5T5NF 5D93B 3BD3A 5HHNA 1HI6B 3VDBA 4OUOA 4K9EH 1I7RA 3WKNA 3G6AA 3F5WA 1F58L 1CGSH 3EDJA 1F11B 4RIRB 1Y0LB 1HHJA 2LABA 3IDNA 1HOCA 3D39D 3LPWA 3QEQA 3SDCA 3RNQB 4JQXC 1YPZB 5HYSA 1FFRA 4KKLC 1LEGA 4I3RH 5J1AA 1GGCL 5GGTA 5F88A 3DURA 1UVQB 3O0RH 3WFCH 4NRZA 5DRZA 2FIRT 2XNAB 1URLA 5T1LA 4FTVB 1UB5A 3EYUL 4KJQC 4TRPH 5FGSA 4DKAA 3B2UC 1KGCD 3PUCA 1I3RA 4HUMB 1L7TH 4HFWA 1IAKA 4ZTPH 1NCWH 5IF0B 1QHPA 4MCZA 5A1AA 4WUUD 3VFGH 4P2QE 3VW3L 3FQRA 3EOTH 3MROB 1NAMA 4HMEA 3VXMB 5AG9A 4WI2A 1G7IB 3MRJB 3R06A 1YNLH 5E1AA 5JPMA 4PJ7A 3ARBC 3X14B 2ZSVB 5E9DD 4W4OA 5KTEH 2A9NL 3UAJD 1MNUH 5EZIH 2EDYA 3FFDA 2AEIT 3QUZC 1G1YA 4I77L 3UYRH 3MYJB 1N64H 3MUGB 4OV6F 4Q9RH 3ES6A 1S7SA 5GS0H 3GHBL 2AP2A 4KVNL 2IANE 1U95B 2HLFC 1OGAE 4JDZA 1B2WL 3HNVL 3ET9F 3LKRA 4K8RC 3VD4A 1P4LA 1FV1A 3HLAB 2HT2C 2VSDA 5ICXB 5D1QB 5E99L 4C54A 1VFBB 3IDYB 1BJMA 3MRBB 4KJYA 2FH6A 3L3OB 4EBQL 1OD9A 1O7VA 3VFUA 1YPZE 2DICA 1YECL 4MVBD 4WVRA 1YEKH 1KC5H 2ZG2A 7FABL 4FQHA 4S1RL 1KB9K 5DZLA 4PJDF 3QNYB 4OZGF 1S7RA 5DMGD 3VCLA 1R5WA 4O5LL 2RCSH 5B3JE 4PB9L 3ULUF 4FTVE 4PJBA 5KSAC 4M93B 2YHGA 3TIEA 4FG6C 5MEOA 1T04A 2AV1B 1W2KT 3MRGA 3KPOA 3NCJL 4R9HA 4QOKD 4CVZB 1A1NA 4ZOAA 1OARL 1BGXH 4PJAA 3R0NA 3GI8L 4P4KA 1TVHA 1WFOA 4KMTH 4XPGL 3VXOA 5E03A 4K23H 4LP4A 1IFHH 5MI0C 5DMIL 2CKBL 2O5ZH 3VXTB 3DV6A 2ICEA 2GUOA 2J2ZA 2HFGL 1HN1A 5DRNB 4Y16B 3RDTC 4P5TD 1P7HL 2AV7A 2IH1B 4PJGF 4UB0H 4WDIA 5BV7B 5IW6A 2R1YA 5D7KE 2BOBB 1RK0B 2GSGA 1EV2E 4IMLB 5BQ7A 4OJFL 4YGVA 1INEL 5GZOC 3MRPA 3L5XL 1YEGL 5K9KB 5EOTA 1H8NA 4K3JH 1RIUL 4OZIF 4X4ME 3LKQB 2F19L 3FQXB 3TBTA 2H6PA 4XWGL 4J4PA 1AGDA 2JJSC 5TFSH 4LSSL 3D0LA 1JN6A 4WU7B 3L3GA 1J8HB 4EJ1C 1TZHB 5DJ6A 4OI9A 1N0XL 2X4PB 4XVTH 1CR9H 3O4LE 3ZKNC 4ZUSB 3VD5A 1J10A 5K59F 4NQEB 4XTRD 4B5EA 1ZHNB 3EBAA 2J6EH 3ULVH 3MR9B 1TQCC 4K71B 1N6QH 4AT6A 5L88L 4EI6A 4CN1A 4C56A 4ERSL 4JFFD 5E94B 1XF2A 4ZAKB 3I50H 1UM5L 5SWSA 4UT9H 3ILQC 1T7XA 2X4RA 3KJ6H 1IGIL 2A1WH 3VXMD 1MHEA 2VL5B 4IRJB 3T4YA 1C5BL 4AIXA 3RY4A 4AH2A 3MC0A 1EZVX 2HJKA 2CO7B 3TV3L 2XT1B 5HPOA 4JHWL 1EBPA 3QHTC 4EDXA 4OGZA 4NM4H 2KUTA 2GSIA 3BT2H 3FB6A 4N90D 2P49B 1T80A 5F1IB 4IOIB 1D6EA 3L3HB 1U58A 1WZ1H 4TSAL 3U1SH 4V1DB 3M17A 2VJXA 1DQQA 3QUYA 2AK4A 3TBSA 4H1LH 4RBPH 3WFEL 5E08L 2OL3A 4I2XB 3SKMB 4WUKH 1PZ5A 5FK9A 5IB1B 2P48B 3B9EA 5ITFB 2Q76A 1JGDA 3CXDL 4U1GB 4G80B 5D1QD 1QA9B 2R2EB 1P84K 2Q8BL 4XPTL 1U92A 1U9KA 5E6YA 1KIRB 4BH8B 1IE5A 2VZ1A 4G3YL 1NKOA 4MZ2A 3PE9A 3HZMA 4I13B 5LQBL 3H42L 3T8XB 4K2UL 4KTDL 4TULH 2BP3A 4TYUA 3CXHJ 3UPAA 2WIIA 4UIMB 2XOTA 1ERNA 3QCVH 1DBMH 4XAWL 3L5WA 1HIMH 3GMMA 5A2LH 4S2SA 4NQEE 1J1OL 4NC0B 1G9NH 3BPNC 1UT9A 2E7BA 5ACMA 5GHWL 5TGBB 1EHLH 2BVTA 3UTZA 3GJEA 3V95A 1FNSH 1FL3A 2CRYA 3H9HB 4OF3A 3PJSA 1UEMA 5DC9B 5ISZD 2A6JA 2Q1EA 4Y2DB 3D48R 4AIZB 3DECA 1R3LA 4KZEH 4EDWH 1JVKA 1CTOA 3UC0H 1FFPA 2LVEA 3QFDB 4IDJH 3RZCC 5JZ7D 4LLWA 1QYGL 4LSPL 5IROA 4JY6B 4OKVB 3BRFA 1NGPL 3GSXA 1ZLVK 3THML 5DK0A 3DUUB 1YYML 2DI7A 4PD4J 4Y16D 4N0FB 3GMNB 2DQIL 2XTJC 4IIQC 3QAZC 1DL7L 1MI5A 2NMSA 3RVWD 4LRNL 2EZ0D 4V1DE 4WWKA 4OQ1A 1YMHA 3L5IA 4YGAB 1LO0L 5D70H 1F2QA 4JFPA 1T66D 1ORSB 4OM0L 4F9LC 1SY6H 1ZLSH 2ZZUT 2VITB 3AM8A 5GRJH 3MLTB 3TCXA 3K1DA 1JYXA 3NN8B 1RUMH 3V8OA 1CGYA 4LAJH 4X4YB 1J8HD 1HSAA 4GBXC 4LL9A 4AMKL 5I0ZA 1E4XI 5ID0B 3IDMB 3QWOB 5JDJA 2CUHA 4CNIA 4OV5A 4I8DA 1EH9A 2Q20A 4RAHA 1P6FA 4OFYD 3PP3H 1B88A 5J57B 5DHVA 5DRWB 1MJ8H 4NC1C 3DHMA 3S35X 3X17A 2YSSB 5C08B 2YKLL 2YC1A 1MFCH 5BV7L 1I4FB 5E70A 3LB6C 4NQDD 1G9MH 1FIGL 1BREA 1WBZA 3FO1A 4MB3A 5J12B 3PWPE 4Q7DA 4MXQD 1OTSD 3CPLA 1PG7W 2ZCHH 3VI4E 3NZHL 3WXVH 4JJ5B 2UYLB 4HWZA 4I18B 1T5XA 1OCWL 3KPRB 3H8NA 4TVPE 4X5XB 3HC4L 4OLYL 5C07D 4GKSA 3KYMA 4DZ8A 4ENED 4DVRH 4JFZH 3NIGE 5FV2A 2ZP0T 3HAEH 4AG4L 4DFHA 4Y89A 4Z76B 1ONQB 1TETH 4OCSL 4PY7A 1AXSA 3I75B 1CLOH 4Y8DC 15C8H 2E27L 3CK0H 3SOBH 4ODHL 4YDJA 1J1PH 3MRIA 5FXCH 2LAAA 3CVHB 3ZKMD 1KJVB 4ZDHB 2VOTA 4X7FC 4BKLB 1MAML 3H0TA 3Q5YA 3B3IA 3G6JE 4OT1H 4MD5A 5E6IC 4YXKL 1JZ3A 2Y7QA 1OQXA 5IBLC 1RFDL 1NDGB 3DOSA 1A4KB 4PJ8B 5MP6L 5IFJB 2IMNA 1PYWA 1YPZF 5BVJB 5L6YH 3BOVA 4IRSC 3GMQB 3CSYB 1CQYA 1RIVH 1CYGA 4YHMH 1AHWB 3STZA 5TE4H 2FGZA 2I27N 1UKQA 1DANU 1DSFL 2IQAA 1W72B 5B3JF 2F5BH 4RWHA 1M6OB 3EYSL 2DQTH 3BKML 1UFUA 3MSPA 4OBRA 3V6OA 4I48A 4OLVL 4Y2DD 2DQDH 1J05B 2WWMD 1JF1A 1QFUH 1NCDH 1MCNA 4ZXBA 2GJ6B 1RJYB 3HI1A 3HG1E 1I1RA 3PWLB 1IGTB 1CE1L 2C26A 4TVPD 1M7IB 4MDIB 2B4CL 1Z0NA 3GSNH 2FIKA 4G42B 1MCSA 1KCLA 3OB8A 3GM8A 3BDYH 3ME0A 4P2CG 3P9MA 1DVFD 5T33H 4JFDD 1S7XA 4CU7A 2HAZA 3IU4L 1FZKA 1PD6A 5F9JB 3ULUH 4YK4B 5D1XC 3WNKA 3RPKA 3OKEA 4XXCA 1U8QA 2MCPL 4P57A 4GXVH 5DURB 2EE2A 4HCRL 1S3KL 1MRFH 4NT6A 4X8XA 3WS3B 2ADJB 3VE0A 2MOVA 4K7FB 4KK8D 1FJ1A 3VFOB 4TVPL 4OF5A 5SV4A 3BMWA 4GRMA 2J8OA 1IZKA 4NKQB 4LSVH 3LEXB 4HIJA 1Z9MA 4YDLB 2PYFA 4HV8A 5C08D 1JWSB 1JYVA 2UZYB 4N9GA 3QFJB 4AIOA 2RR3A 5B39A 2JCCB 2EDQA 3HPJA 3ZE2E 3TA3B 1PDKA 4P9ML 1EO8H 3RWHB 4O2CA 4XNYH 3QCUL 2ITCB 2AEPL 4WEMB 3LSOB 3VXQA 1CCZA 2FO4B 4WW2C 4BZ2H 2IADB 4JRXE 2W9LA 2F8VA 4XI5D 1IEBA 5I16B 2G60L 3KPRD 2EKSA 4GXUN 1MVUA 1RJZA 3T0EA 4C57C 5JORA 1I8IB 1TMCB 3J7HA 4KUZH 4G7VH 3RKPA 4CN6A 1NLBL 4WHYH 3OKNA 1NBVH 4U1MA 5IW1B 2ZNXA 3OJMB 5BJTA 3OGOE 2E8YA 2E6QA 2D0FA 3B9KB 3O6LH 2FATL 4Z6AT 3M8OH 4O2EB 2HKFH 2EDOA 4NN5C 4OGXH 3GSRB 3RL2B 4RGMC 4HWNA 8CGTA 2RIKA 4XP4L 3DROB 4M5YL 3BZEA 3QI9C 3GSVA 1U41A 3MRQB 1F58H 5TE7H 4PJ8D 4DQOL 2FL5B 3SJVD 2X4NA 4UI2A 3QRGH 3K8MA 2H32H 1PZUB 4OI8A 5LXGL 4TUOB 1QEWA 2C3HA 3WNPA 4MDJA 4HS6B 4DEPC 3AS2A 1W0VA 4U1KB 3QIWC 4JHAH 1G9EA 3UTSA 5T5FL 1WV7T 4PRBB 2JCCE 1BOGB 3CVHL 5HHMB 2XZCL 4OBSA 1KG0B 5F8QC 2I60L 2GJ6D 2HJFB 4KJWD 4TQEH 5DUBA 1JJUA 5I1KH 2HFEA 5J3HD 2R0ZL 3B2VL 5CJ8A 4YFLF 1MAKA 3JVGC 1FGVH 3C6LB 2ESVE 1S7WB 4JQIL 4I9WD 4HX1B 4PREA 1CFVL 5DI8B 1A7BA 2F5AH 2L0DA 4J23A 4I3GA 4MXWL 4R26L 3UAJC 5TDOA 4APQB 1CGWA 4DVBB 3FQWA 3LS5H 3I6LD 3TBYA 2OJEB 2PUQT 3FB5B 1W72L 5F6IC 4JFEB 1AY1H 2BNQE 5HYJD 5LGJA 3PQYA 2DF3A 4L3EA 4HIIB 1V3KA 4NFCA 4GS7B 4U33A 3DX7A 5BXFA 1Q72H 4LAQL 5I1JL 4LVNB 5DURD 3GHBH 3I3BA 2PYEA 2AJ3A 3LRHA 2BSTB 3CX5J 5KSUA 1HHHB 2GCYA 1LHZA 2NY4B 3HNVH 3V8CA 4LBEB 3QEHA 3L9RB 1OAYH 5E99H 1OGTA 3P2TA 2HFFB 3S36X 2W0FA 5I9QC 2W38A 4U6VL 3O41B 1CL7I 2I25N 3QFJD 1YEDA 3ARFC 4PTUB 3NVQA 4ZG1A 4IHOA 5DJAB 4YBQC 1WT5C 1YMMA 5DMGC 4MNGA 4OF6A 1U8JA 2NLJA 1U3JA 3QB7C 3HCVA 7FABH 3SE8L 1KCSL 4XNQB 1DEDA 4ELKB 4S1RH 3GUTB 2OK0L 5HHME 1JGEA 1ZHKA 2WM0A 4TNVF 1S8DA 3OKOB 3RWCB 1XGRA 3VI4F 4J3UA 1WC7A 1UWXK 4M7KH 1IKNA 4GAJL 5ID1A 1AKJD 1S7VB 1OARH 1JHLL 2DM2A 3HE7B 3GI8H 5DD6A 2DRUA 3TNMA 4PRPB 1G7JA 2CR3A 4JRYB 1Z9SA 1LK2B 3FRUB 3NIGF 4XPFH 4FA8A 2CKBH 4RAUA 4P5TC 4GRWB 3MJGX 4MD0A 2FJGB 4OLWL 4OGYL 3PL6A 5BVPH 5EA0H 2E7LC 3QH3A 2EIZB 3U0TB 3CVIL 1A7OL 4R4BA 5GSRB 2EC8A 4Q6IC 4PGBA 2R2BB 3W0WA 4GG8A 4JDVB 5CMAB 3B5HA 3KNBA 4EN3C 2QKIB 3VRJA 5DA4A 3N9GL 1YEGH 5KSAA 4KTYA 4BQ6A 4JO3L 2J88L 5HVFB 2F54A 4KKBD 2PW2B 4MWFA 3DVFA 4XWGH 4X8JA 4UILH 3S98A 2WBJC 1XCTA 5L2JB 1T2QL 3VXUA 1NGWB 3DMMA 1N0XH 3PG2A 5EOCL 1X5LA 1EEZA 4XTRC 3MA9L 5EU6A 4F9PC 1CT8B 3FZUC 4QYOA 1OSZB 3SDYL 3WNLA 2UWEB 4WI5A 2GFBB 3G5YB 2V7HA 2I07A 2J6EA 2VZOA 3GSQA 5HY9B 5H94B 1DCLA 5L88H 5I1DA 2X4SA 3FO2B 1K6QL 4U1SB 3LMJL 3ARGA 1JCKA 2P5WB 1UM5H 2XZZA 2VLMD 4PRHA 5DMKB 2NY6B 1IGIH 4HKXB 2X89D 3CIQA 1JWMA 1C5BH 3ALXA 1P2CB 4ZSOA 4LPCA 2ZJSL 4MSWA 4F7PA 1U36A 2GTWB 2Z0BA 4JHWH 1LE9B 4JFED 1RZGB 1CICC 2VISA 4NO5A 4Z7VA 4JRYE 4H20L 2O5XH 4F58L 4TSAH 3EO1B 5DEZA 3F7QA 3WFEH 4MLSA 2VB5A 1U3HA 2NY4D 4BFIA 2X9YA 1I7ZA 4RWYH 3K4AA 1X4YA 3C6SB 5HYQB 4NUJA 4XP5L 4PS4L 4BELD 5DSCA 3O3DB 2X70B 3SO3C 3BZFB 3MBED 1HSBA 4G3YH 4H8WL 1FO0B 4XBPA 1GJIA 3MUHL 5LQBH 3H42H 1HYSD 5JTWA 1BX2B 1EEYA 3EYFA 3ZE2F 2D7NA 1KCRL 5TE6L 2VQ1A 2VDQH 1JI1A 1IGCL 3HFML 2EEDA 1A8JH 1J1OH 1ZEAL 2R1WA 1FZJB 4HD9A 1IM9B 4HT1L 3VA2C 5EU5A 2OI9C 5GHWH 5SWZB 5JZ7C 3BIAX 3WHE0 5HYIA 2R0KL 5CZVL 1ZHLB 5ENWA 1FL5B 3FB7B 4R4FH 1MJUL 1N0LA 2P5WE 3HE7D 2WBKA 4JKWA 3N50A 3DIFB 1QFPA 4ZS6D 4PRPD 3AXLB 5F97E 4D0CB 2C1OA 3AAZA 5FO9B 3THMH 2BC4B 1YYMH 1NGYA 2D7PA 4M3JA 4HH9A 3I3DA 3RVWC 2EZ0C 1QACA 1A6TB 2DQIH 5DD5L 4N0UA 1B0GA 1DL7H 4DGVH 5JO5A 1T66C 1KN2L 2YPLA 2VDOL 4U4BA 1JZ8A 1IMHC 1JE6A 1EUUA 1GGBL 5K9QI 3SDAD 4MQTB 5I1IH 2HP4A 4OLXL 5GRUL 5C8JA 1HCFX 2FWOA 4L4TE 5T1KB 5I8OL 4NNXB 4OM0H 1SY6A 3IJHB 1DLFL 1YA5A 5ALBH 3TCLB 5KJRL 2ZPKH 1INQB 1I7TB 4JCLA 1D5ZB 4NN6C 1MJJB 4ZO6A 1A21A 1RZ8A 3V0VB 5DJXB 5IQ7L 3PGFH 5HI3D 1Q9OB 5EUOB 3RZCA 1ETZB 3S88L 3KPPA 3RGVD 4PV8B 2FYYA 3O6FD 1UG9A 5C0DA 5B8CC 5FO8B 5DS8B 2P8MA 2JCCF 3QYCA 3GFUA 4R7DA 1T1XB 5DQDL 4OZFA 2YKLH 5D96C 3PP4L 1LWRA 3MLUL 5BV7H 1CD0A 3WD5H 4H5SB 2P5WD 1TNNA 3DRQA 5CP7A 1OTSC 2HRPL 1HXYB 2NY6D 4O9HL 3QT2A 5SWZE 3VGGA 3EDDA 3KPLA 3ARUA 1C16B 3ZDZE 2FO1A 4RGNC 3P73B 1QSEB 3QXAB 1LO2L 2J1KA 1M71B 3ZE0F 3U7WL 4CVUA 3HMWL 4QXTB 43C9A 3BRDA 4GAYA 3SGEI 4ENEC 5DHXB 1AJ7L 1UZ6E 1OCWH 4GQPH 1PAMA 3CSPA 5ADPL 3SE3C 4ZOEA 3CH1A 4GBXA 5DYOA 3HAEA 5DT1L 4X9IA 5C0JA 3DXAE 4OCSH 1X5ZA 4ODVL 3ZKMC 3QXWA 5C1MB 5J56B 4LNRB 3PNWA 1R5VA 4HW6A 4KROD 5HGDA 4L29B 1MY5A 1K8IB 2HJLB 2XKSA 2PTVA 2CDGB 2K7QA 3V6BR 2R8SL 4E41B 1MAMH 2CMRL 5DJ0B 2HVKB 2GITA 4G8GE 4L8BB 5KVDL 1MCOL 1RUAL 4WRLA 5KSBA 1N7MH 4PJIB 4NYLA 2VH5H 3GDBA 4XVSL 4YDKL 3T2QA 1RFDH 5BS0A 4N5UA 2N7AA 4GW4B 4NQXA 2LQRA 3BEWB 5EUOE 1HEZA 3U46A 4ZNEE 1Q9WB 1KPUA 1EVTC 3QQ9D 4EQ3A 4FHBD 1AD0B 3MNWA 1FG2B 2DMBA 4ONOA 1A22B 5IV2B 2GK0B 4X9FA 3CDGB 1MHCA 3T65B 3RWJB 1Q94A 1SM3H 5A3ID 5EBWA 1DEEA 3A6OA 5KSVB 1IM9D 5SWZD 3TPUA 2E9BA 2WWMC 3E2HC 3EYSH 5DD0H 4JVWA 3BKMH 2MKWA 3F12A 4G6FD 2PO6C 4XBEL 2R0WH 3O6KL 1H3WM 1UJTA 4H88H 1HK6A 1XH3B 5EZOH 5L2KB 1BIIB 4MMXC 1CDIA 4UINL 3WBDA 3W82A 4ETQA 1A1OB 1ZGLP 3DUSA 1FO0L 1OLLA 1CE1H 3NFNB 4MNQE 2X1XR 3A6BL 4S1SL 5EO0A 4N8VA 3RX5A 3CAFA 4YAQB 4XNXH 5L0QC 3GSNA 3V2AR 4GRLA 3I6GA 4AM0B 4P9HH 1DVFC 5LAXB 3MGOB 4H0HB 4HZAA 2ILLA 3JWNC 4HXAL 1UWXH 2NXYB 4XCNB 4NRYB 1DQJB 2X4OB 1AGFA 3GMPA 5T1KD 5ACZA 4IRSA 4PJDA 4BUGA 1JGVL 4XH2B 4L1HA 4QTIL 2FX7H 3BSZL 5C6PB 3IU4H 4Y4HB 2R4SH 3OBAA 2AJSL 3MOBL 5L7XH 1HHKB 5F9OH 3L1OL 5D2NA 4RMSA 1MCPL 3C8KB 4JZNB 4P0DA 4E41E 4A6YB 2OJZL 3GO1L 3PV6B 2ATPB 1HDMB 4UT7H 3OAUL 4LLVA 3BE1L 4PBWD 1D7FA 4MJIB 5GJSH 4RFOL 1JF6A 1QKZL 1IGJB 4WO4C 1KACB 3NCCB 5HHQB 2Z4QB 1J0IA 4TVPH 1ORQA 4PJIE 3TYFB 3T2NH 3PGDA 1MFEH 3OR7B 3WIIH 5KVGL 1OP5K 2NY1D 3O9WB 5F7DB 3VD3A 4PJ5A 4QHLB 1AIFA 3NTCL 2ZSWB 3MO1A 4JN1H 2FBJH 3S37H 4QF1B 1GOHA 4PJGA 1YQVH 2BRRL 3HMXL 4BQCA 3GMOB 3QCUH 3S4SB 2AEPH 2HFTA 2DYPA 5HTSA 3ZHDA 3FAXA 4X6EB 1QSED 4KKAD 2I9LA 1O0VA 1YN6B 3IXAA 3MV01 4OZIA 5JR1H 5L2KE 1PVHA 1MLCA 1TZGL 3CMOH 4ELME 4OI7A 2G60H 3FJTA 2EDRA 1T21A 1WCQA 1FLRL 3U4BH 2GT9B 5I18L 3DYOA 4GW1B 4P3CL 2BSSA 4DZBB 4R8WL 1ZMYA 1NLDH 3MRKA 5EBLA 5GGVY 3VFTA 1GZPB 4WTZG 3CNKA 5FUZL 3WIHL 4P46A 5DUPH 4JFQA 4GRWF 4UNUA 1QQDB 2A6IB 5KS9B 3UBXA 1E27B 5MHSE 4E41D 1T89C 4J3TA 5DXWA 1X5GA 2XWJA 3L3IB 2CDFA 1EPFA 1YQ2A 4HPYL 4OM1L 3ILPB 3S3JA 3JWOC 3PABA 1S9YB 5IBTL 1CG9B 3WUWG 1AO7E 1AGEA 1AGCA 1BQUA 2JB5L 5DEGA 3KLDA 1G7PA 4RISL 3C5ZB 2JLLA 3JTTB 4BH7B 2X4TA 2H32A 4LDOB 3MLSH 3ARDD 5LXGH 4JO4L 3FCTB 3NMEA 2E6PA 2H1PH 4PR5A 3MBXH 25C8L 1F4HA 3FO0L 1IVLA 2BVEA 2UWEF 5T5FH 3ZDYE 4QWWC 4KJWC 3CVHH 4M6ML 2H2SD 2XZCH 5F7EH 1QLRA 2DDQL 4JG0L 1OAKL 5EUKA 4OTXH 3MGTB 4WFHD 2XRAL 4ZPVA 3PWNA 1AQDA 3PDDA 4FFWD 4P59L 4LRIC 3IVKA 1CFVH 5FYLD 3STBA 2VXSH 4YO0B 1JTOA 2G2RA 2VSCA 1Q9KA 3VWJD 3KJ4C 5C0AE 5F44A 1FL6B 4GXUM 3UP1A 3E6HB 5DD3L 3DX9B 4H26B 3MGAA 2EH7L 3GK8H 1KJ2B 4Q9CA 1W72H 5KVMC 4M7ZB 4K3GA 5SX4H 4PJEB 2D03L 5KS9E 1T22A 1WICA 3UPRB 3E8UH 1K4DB 2GAZB 4FQIL 2EC9T 3I85A 4HUUB 4U49A 4HWEL 4LARL 3WUWB 3QIBB 3V5DB 2EXYC 4FNLL 4MYWB 3NFSL 4MJID 1S9WA 5DJ8A 1T6WA 5GGRY 3LKNB 4QXUL 2FHCA 1BOYA 1ZANL 1Z9LA 2BMKB 1XR9A 4PY8I 5EWIH 3WL9B 4R7NB 4WUUA 3V52L 1T1WB 4WHTB 1A6ZB 4EXKA 1XGTA 1K2DA 2X7LA 2HVJA 4HZLB 5E9DA 1KYOK 2OR7A 4KQ3L 4NJ9L 1YEJL 3JXAA 3F58L 5AZEH 1FNEA 4PJ9C 1SVZA 3SE8H 1RK1A 3BQUD 4NPYA 5I2IB 4G7YL 1JRHL 4ONGL 4A6YL 3UYPA 4ORGB 3WEXA 5HHVH 3QEQB 3BIKA 3D87B 4HJGA 3MRHB 5LGKA 1PBYA 3LN4A 3CMGA 5GRVL 1RZ7L 1ZVHA 4GAJH 1EBAA 5IOPA 3HRZA 5F1SA 3IYLW 4KI5D 5AD0A 3BH8A 4KK5D 3KAAA 4JLRA 5A43C 4MHHI 1XGYH 3VFWB 1LDPL 3BWAB 5T1LB 2CKBA 4WHDA 3VH8A 3IT8D 3TNNB 1DR9A 3IETA 4HIXL 4KV5E 4OLUL 5CJQL 5A2KH 4L3CA 3B5TA 4IJ3C 4OGYH 4PG9A 3T3PF 1JGLL 3L3JA 1EFQA 4HFWB 4PJEE 1IAKB 2XN9B 5I1AA 1A7OH 1G6RH 3MJ8B 4X7CC 3FQRB 1N59A 1ZWIA 1ADQL 3C5ZD 4YHPA 4OIBA 3R06B 3NIDE 6FABH 3ZHLA 3GIVA 2BSRA 4JO3H 2IAMB 3B43A 5EUOF 3FFDB 4NOBA 1U0QA 1WAAE 4P2OA 3ZTNH 2UVFA 4FZEL 3MLYL 4EUPG 4YXLH 2RB8A 5EOCH 4NZRL 1VDGA 1P6AB 3BP4A 4JJHA 1VFAB 3MA9H 1GGYA 3BPOB 4OCMC 3FQTB 1LNUB 4JDZB 4ZUVB 4GW5A 3SDYH 3CCHA 2IANA 4RNRB 3V6ZA 4IM8A 4DN3L 4HBQA 1HI6A 5AWNL 1BFTA 32C2A 4YNYB 1AXTL 3MRLA 3OV6A 4OFDA 1H5BC 1OSPL 1CDUA 1MIEL 1NJ9A 3OB0H 1F11A 2NY0B 2W0KA 1Y0LA 3LMJH 3QEQE 4Q6IA 1GGIL 3VFUB 3CFJB 3MRDB 3CC5A 3SGJC 3QHZL 3VRIB 3RNQA 4KXZH 3ROOB 1YPZA 4H25B 5L9DL 2ZJSH 1W8NA 1U3ZA 5H2BB 3MX0A 3GSOB 3VCLB 5TF1H 1UVQA 4OB5H 4NCC2 3ARTA 4PJBB 1HXMB 1PLGH 3BUTA 3FKUS 3EYVB 5MEOB 2RHEA 2XNAA 4F58H 3O6MH 1T04B 4XXDB 1JZ4A 3MOAH 3UX9B 3S9DB 3K0WA 3EDEA 5C3TA 3QIBD 4F9PA 1P5VA 4JDTL 1KT2B 4PJHA 1UADC 7CGTA 4OF8A 1FH5L 3SQOL 3HPLB 4DKFL 3D3VD 4JFFA 4XP5H 3MBEC 4PS4H 2VLRD 4JPWL 3MROA 3S97C 3ULSA 4PJIF 1YEEL 3MLVL 4NC2B 5SWQA 2GUOB 3VXMA 4CDHA 3QUMB 1MFBL 4IDLA 3MRJA 1G7IA 1TQBB 3D1MC 4EUPB 3LDBB 4D9LH 3X14A 4LLDB 2E7HA 2QL1A 1A5FL 2W59A 3RU8L 2R1YB 4NJAL 4LKXA 3VRLF 3MYJA 3MUGA 4F15B 3VWKC 5TE6H 1S7TB 4OF7A 3HR5A 4KGLA 4N8CH 4C83A 1IGCH 4WTXA 1U95A 1HILB 3D5OF 1OP5H 1JTPA 1DQLL 3BI9X 3G9AB 5MEQB 3LS4L 4OD3H 3T04D 2QTEA 2LTQB 2R0KH 1HWHB 1X3DA 5D1QA 4ZS6C 1VFBA 4JO1L 4O02L 3FFCD 4FFVD 3VXRD 3F7YA 3OKLA 3L3OA 4GOSA 1FC1A 1N5AB 1Y6MR 3MPCA 5HHPA 5ICZA 4LQFL 2BDNH 3QUXB 1D5BB 2D4DA 4EI6B 3SDAC 2WSKA 5DD5H 5T1DL 4PJBE 2B7DT 5FGBC 4X4XB 2XN9D 3RX7A 1KN2H 2VDOH 4ZPTB 3MXVH 4HMCA 4R97C 2X4RB 4OLXH 5GRUH 1L0QA 3HNTL 3O3EB 3T4YB 5I8OH 5JUEL 5CZKA 5DQJA 1BM3H 4M7LT 4CVZA 4BZ1L 2BJML 4UV4H 5JOFB 3DGCR 2IAMD 5ISZA 5GGTL 1D6EB 1F8TH 3RGVC 3O6FC 3M17B 5IQ7H 3QUYB 5I73C 2A38A 2AK4B 2FSEB 3TBSB 2V5TA 3VXTA 5DRNA 2P5ED 4GRWH 1RUPL 4Y16A 3ZDYF 4O58H 2YD1A 1INDH 3SE4C 3ARSA 3E6FA 4G6KL 4M9OA 5EOQH 5GRVK 5DQDH 1QFWL 2IH1A 3NACL 3PP4H 2VWEE 1MELA 2VTFA 1RK0A 2NY0D 4XX1E 4IMLA 4LHUG 1I1YB 3K4ZA 3WSQL 5C9JB 2NTSP 3JV4B 5K9KA 1UJ3C 2DM3A 1FAKT 1MWAB 2ERJC 4L8DA 3UO1L 3GGWB 3QSKB 3LKQA 4EVNB 3T1WA 5JHDB 2R29L 2VKWA 3RIFF 3DO3A 4WU7A 1J8HA 3P0YL 1TZHA 3L5WB 1HKFA 5D72L 4S2SB 2DB8A 3WJJC 1F3JA 1F4WL 4R4ND 1FP5A 4LMQE 1XCQB 3SCMB 3UTZB 3ZLQC 3TPKA 3RIFK 3QIUC 4C56E 3MR9A 5IMKB 5E2TL 4KROC 5KS9F 3PJSB 3LY6A 4Z18A 5SWSE 5FKPB 4XMKL 4ALAL 4NHUB 5E94A 2IJ0C 3OJDA 4X6CB 5KVFL 2R8SH 3P4MB 3GSXB 5DVNA 2CMRH 2VL5A 2DKMA 1I3VA 2NZ9D 2A73B 3C60B 1RUAH 1D6VL 1Z2KA 3NAAL 4YDKH 2DQGH 4G6ML 4DOHB 4P4RA 2XQYK 1NUNB 4MAUL 5F1IA 3KLSA 2AK4E 4IOIA 1Q38A 3ZE1F 3L3HA 5CBAA 2ARJQ 4UQ3B 4V1DA 1GVIA 2R15A 3HI5H 2V5SA 4DTGH 3VGHA 4CGTA 4I2XA 4Z7QE 1WIOA 1A9BB 3MV9B 5ITFA 2ZUQC 3C09C 5EULV 1X6NA 1L7IL 4AZ8A 1IT9L 4G80A 1HSAB 4YHLL 1QA9A 1HH6A 2FGWL 2R2EA 4JM2D 1IAOB 2W91A 4OV5B 5BO1H 5D7JC 4UINH 2EIBA 3ZKSD 1KXTB 4F7MB 5JHLL 1KCKA 3EOBB 1N8ZB 1I8MB 2B5IC 4S1SH 3A6BH 4TUJB 3QUXD 1IRAY 4WEBL 4FQ2L 3LPFA 3P77B 2OM5A 4UIMA 3HZYB 4PP1D 1T0MB 4YC2C 3S35L 1V5JA 4LCUB 4YHKL 1OWWA 1YJDC 4YPGA 3RTQC 2UUDK 2ICWI 4HXAH 1ULVA 3GB7A 4UU9A 3AGVA 4PJEF 1LO3H 3CDCA 4F57L 4QTIH 3BSZH 5TGBA 3EJZC 3H9HA 4YUEL 2WW8A 1GAFH 4Y2DA 5DJYB 4AIZA 4N5ED 1MCPH 3NIDF 3G6DL 3QFDA 2C9AA 2OJZH 3GO1H 4N0CD 3QDMB 5JQ6H 2O5YL 3U7YL 4U1LA 4OKVA 4RFOH 1QKZH 1T7ZA 3QEUB 3SHSA 3HNSL 3DUUA 2NY1C 4LCCC 3DX8B 4N0FA 1QNZL 1YEFH 4K94C 3GMNA 5F96H 5KVGH 4Z7NE 4YDJB 2BNUB 3MRIB 5CJXA 2HTKD 4TTDD 2PR4L 1T4KB 1I8LC 2C3GA 3V4UL 2APWA 3ABZA 3H0TB 3NTCH 3Q6GH 4KJPD 1E4KA 1ORSA 3VG0L 5CFHA 2YD2A 2BRRH 1JMXA 1ACYH 2VITA 3MV9E 3ZL4L 3MYZA 3HC3H 3MLTA 1QLEL 3NN8A 5JHDD 3WLBA 1PFCA 4X4YA 2AS5M 5IHUH 3MLWL 5ID0A 3QWOA 4WJ5B 1A6WH 4S0TD 3VI3F 5FA4B 1BD2B 4U7SA 1DFBL 4Z95L 3ZT6A 3SCMD 4ZTOL 5DRWA 4V2BA 1ZHBB 1WTLA 2YSSA 4B50A 5FUZH 3ELAT 2C1PB 5C08A 3WIHH 1AQKH 1MY7A 1I4FA 5CGTA 1BFSA 2APXA 2QBWA 4ZXBB 3FOLB 1CDHA 4XCFL 5C6WH 4EIGB 4YE4H 4CAGA 5DO2D 5CEYB 2DBLH 4OM1H 1BHGA 2VZSA 4Y4KB 1I3GL 3C60D 4XCCL 3FMGH 2XWTB 3SGKC 5DC0A 4AENB 4JJ5A 2FEEL 2UYLA 1S78D 4IOSD 4I18A 3QDME 5HVHC 3RPIA 3IXTB 2JB5H 4UOW0 1OAZH 3ARDC 1IAIH 4FQPA 3KPRA 4RISH 2AQ2A 3TT3L 4D8PB 1KOAA 4X5XA 4OFVA 2X9XA 4JO4H 1QRKA 2W9DL 4Z76A 5JW4Q 1ONQA 3QG7L 25C8H 4LHUD 2FZ3B 1DBBL 3SDDB 3FO0H 3W39A 2CD0A 5ELIA 1TJGL 1KXQE 3CVHA 1HZHL 4M6MH 4O51A 4ZDHA 4GLRH 1RUQL 4BKLA 1HINH 1KNOB 2DDQH 2FB4L 4JG0H 5JDSB 4FFWC 4X6DA 2MQ0A 4JFHE 4GRMB 1MCWM 2XRAH 3ZKXC 1RMFL 4HV8B 1N6UA 3VWJC 1KBGL 1TCRB 1A4KA 3K7UA 4PJ8A 4N9GB 2CUMA 1EO7A 5B39B 5BVJA 3HPJB 3SJVA 4HGWB 1BD2E 3GMQA 3CSYA 1AHWA 1FQ9C 2QSTA 5HI5D 4HXBL 4O2CB 1F6FB 4PJBF 3V6OE 5BMFL 2MHAB 2GK2A 1RZFH 3B9DA 1M6OA 1U2CA 5F7HA 1OPGH 2FR4A 2OZ4H 3WLWC 3WHE1 2D03H 1YZZA 1J05A 1P7QD 2GJ6A 3JBG7 4HWEH 3QDMD 1RJYA 4AEHL 4KMLB 2C3XA 3PWLA 1IGTA 3C5JB 3T0EB 5JORB 1RZKH 2IQ9H 3I2CL 1M7IA 4QXUH 1HE7A 1T83A 5IJKC 2OMNA 3RVXD 4MDIA 3VG9C 2QHRL 5BJTB 3RWGB 2YZ8A 2LU7A 3HE6D 4MAYB 2VLLB 5FEBA 2DQUL 5GIRA 1ZT7A 4QRUB 5EFIB 2FD6L 4UNVA 1AP2B 1FORL 2B20A 3ZYJA 5J0BA 2NR6D 2BOCB 3BQUC 1A47A 5DTFB 5F9JA 1YEJH 3F58H 1IC1A 2HKHL 3DVGB 5C2UB 1OTTC 3DV4A 4G7YH 4ONGH 4PG2C 4PRNB 2X2YA 5K9JL 2X4NB 3WS3A 2ADJA 4K7FA 1CQKA 2NW2B 4KI5C 2JB6A 4KK5C 3UMTA 3VFOA 2Y23A 1D5MA 1RQ5A 4MDJB 1RZ7H 3BDXA 4EI5D 3WFHB 3WNOA 3LRSB 3LEXA 2DN7A 3Q1SL 2EECA 3QPXH 1FDLL 3KYKL 3MREA 1CXFA 5C6TL 4YHIB 4AL8L 1JWSA 4J6RL 3MRNA 1CD8A 4WI6A 4JY4A 3QFJA 1PKQB 2JCCA 5FF6B 3HHRB 3TA3A 4X80L 5DUBB 4J3XA 5IGXH 2HFEB 3RWHA 4XC3H 1IGFH 4P99A 2EDXA 2FNBA 5AAWA 3G08A 1KENH 4Y4KD 3LSOA 5GS1C 4KDWA 1OB1B 2DIJA 1G6RA 4X99A 1ZT1B 2IADA 3SKJL 5I16A 4KI1A 3T0EE 4Y1AB 1FSKC 2EYTB 3KDMA 3FQWB 1OF2B 3FN0L 4X7SL 2HTLD 3TBYB 5E1HB 5A2IH 1AKJA 1I8IA 1ZVYA 3IFLL 1I1CA 5FHBL 1KV3A 4UTAH 2YR3A 5IW1A 4FZEH 1V05A 4X7TB 1ZA6B 1KTDB 5E8OA 3HZKB 4LLUA 4NZRH 1ZLWK 3TN0D 3B9KA 3TZVD 1N5YH 1FN4B 2AJ3B 1OW0A 4O2EA 5C71A 4M1DL 3W11D 3GSRA 3RL2A 5AWNH 2YPKB 5IW3A 3DROA 5B4MD 1AXTH 1CZ8H 3VGAB 1MIEH 1J5OL 4MMZC 2XIDA 2IALA 1UZ8B 2NNAB 1HNGA 5IJVB 2ICWJ 3S36L 3DPBA 3CFEB 4PJFB 3HUJB 4XMPL 5E2VH 1NANH 4R90L 4PGCA 4PV9B 3QHZH 3GHEL 1P5UA 4MNGB 2NTFB 3MODL 1UQSB 4JE4B 3EAKA 5L9DH 3ARBB 3GIZH 4U1KA 1IAIM 3ARPA 3VFVB 5AYUH 1ZHKB 1MRCL 1PKQE 3EO0B 2CH8A 1S8DB 1BOGA 3QUZB 4OCYH 4PRBA 1BVKB 4LGPB 4YH6A 1XGRB 1ZLUH 3CXHK 4HK3J 3NPZB 1KG0A 2QQLH 2HJFA 5C9KA 2CK0H 4KVCH 2VKXA 4JDTH 4JY5H 2EEBA 4X6CF 5J9PA 2AJXH 4LFHG 1FH5H 3DX6B 3C6LA 2BVQB 1S7WA 3QNXA 5JMRA 2UUDH 4HX1A 3TNMB 1A3QA 5DI8A 1KXVC 1QR1B 4MAYD 4Y1AE 4JPWH 1H5BA 4R2GD 4NZUL 1YEEH 3MLVH 2EICA 2IGFH 4XZUB 4F3FA 3TVMD 1MFBH 4MD0B 4APQA 4Z7NF 2XYCA 3HC0A 3PQYE 5IM7A 3QH3B 1PEZA 1MPAL 2YOCA 3SGJA 4L3EE 3ZO0A 1KB5B 1KJ2H 2OJEA 1A5FH 2YUZA 3FB5A 1S5IL 1QSFD 4HHAB 3RU8H 4JFEA 1Q0YH 4HIIA 4PD4K 1FZMB 2PYEE 5C0RL 3OKKB 4JR9L 5KSAB 2OX5A 4GG6A 2R9HD 2BSTA 2F54B 5H37G 1HHHA 3W81A 3O4OC 4JG1L 1DQLH 1IC5L 4M1GL 5JQHC 2KZWA 3EGSB 4LBEA 3LS4H 1M1SA 1EFXD 3L9RA 3W2DH 1H3PL 5CJ5A 4JO1H 2EE3A 1EEZB 4O02H 4YQXH 2HFFA 3HUJE 4PJFE 5AAMA 1F90L 2H8PB 1F4XL 3Q48A 3O41A 5I15L 4HUNB 2CLVB 1YMME 2VL4A 5MI0B 4MNGE 2I07B 1MIML 1JP5A 5I8CB 4QKXB 3RY6A 5D9SB 5F89A 5CGYD 2A0LD 1CGSL 4XNQA 3G5XA 3RDTB 1HNFA 1KIUA 1WEJL 4ELKA 3GUTA 1BZ9A 4PRHB 2BK8A 3OKOA 4D9RD 3VXSD 4RX4A 4M7JL 4Y4FC 5JUEH 2DD8H 4YPJA 4HEPG 2MQ3A 2IPUG 5IB5B 4W81A 4I3RL 1KB9J 1S7VA 3MRRB 3NFPB 4U6HA 3HE7A 3EFFB 4KKLD 1H3XA 1Z3GH 5F6HI 3T0AA 4PRPA 1PQZA 3WKMH 2QJDA 4BQBA 4QO1A 3FRUA 5IMMB 4HJ0C 5D1ZD 2EYRB 1CFQB 3K2MC 3SY0B 2FJGA 2HRLA 1I7ZB 4KUCD 5JOPD 1EXUB 5DZNA 1L7TL 3W0WE 2EIZA 4G6KH 3U0TA 1TQCB 2NX5B 2NY0C 4XNUL 4ZTPL 3B2UD 3U4EB 2R56L 4Q74A 5GSRA 4QRPB 4NQVB 4U0RC 3SDAA 3TJEH 2IBGA 5DSCB 2R1XB 5CMAA 2QKIA 5IIEB 1HSBB 1MCHA 2F54E 1YNLL 3IF1B 4XBPB 2DMKA 4FS0A 2RJMA 5EZIL 1A0QL 3ARWA 3G5ZB 2R29H 3H9ZA 3BHBB 3ARBD 1FNFA 2XFXA 1K3ZA 1N64L 2HH0H 4Q9RL 5EU6E 5L2JA 1NFDA 4NO0B 1NGWA 5I1GL 2VQ1B 4OCWL 1I3UA 3D6GA 5GS0L 3QUZD 2KH2B 4DCQB 3WDIA 1F4WH 1UWEH 2DKUA 3RGVA 1OSZA 3O6FA 2V2WB 2UWEA 2H41A 3OAZK 5HY9A 5E2TH 5FCSH 5H94A 1DUYA 4KDVA 5ENWB 1X5FA 1ITBB 3FO2A 4K8RD 4PRHE 3SE4A 4XMKH 2NY2D 4OD1L 2Z91A 4ALAH 3F6LA 4U1SA 2P5WA 5KVFH 5AZ2H 1X44A 5DMKA 2NZ9C 4WWID 4ZSOE 1I9IL 4HKXA 3O2VL 4KKCD 3Q5TA 2XG5A 1KC5L 1P2CA 1XF1A 2AJVL 1D6VH 3BFOA 2ORBL 3NAAH 2GTWA 1LE9A 4G6MH 1RZGA 4FQXC 5KG9A 3TO4D 2FLBT 3LKSB 4F8QA 3INUH 1BWMA 4BK5A 3I6KB 1KEML 3EO1A 4LCWD 2NXZD 4J12A 1FCGA 2ADGB 4FG6D 4NCDA 4QGTA 3BPNB 2Y25A 2NX5E 4JM2C 3C6SA 3D85D 5C2BH 1BQHG 2PXYC 3JUZA 4KMTL 1IT9H 3B4NA 5GISL 3LH2L 4K23L 4YHLH 2VDLL 4NO3B 2VXVH 3O3DA 2X70A 4MA8H 4G43B 3RZCB 2BVOB 5IWLC 4L3AA 3I3EA 1IL1B 2FYYB 2W1NA 3IJYB 3JWDC 3QUMH 3ZT7A 4EUPH 4PP1C 5JA8B 3DLQR 4X5WB 2BY3A 3R1GL 4WEBH 1TVDA 4OZFB 4ZUWB 1U8OB 4C58B 4UB0L 5IHBA 4XHJC 3UYOD 3S35H 3DARA 2XTJB 1BZQK 4IIQB 3RDTD 3TP4A 3QAZB 4FQQB 1NH6A 4N0RA 2AKRB 1RY7B 3O81A 4LFHD 4WI8A 1J11A 3KPLB 2VLJD 2X1QA 1FZJA 5FHAH 4F57H 4FABL 1U2HA 1IM9A 2YA2A 3PIQB 5SWZA 3SE9L 3OF6A 2C5DC 1KEGH 1ZHLA 1FL5A 1A7PH 4K3DH 3S5LG 1BQLH 1KCVH 4GAYB 4XVTL 5BRZB 3G6DH 3D9AH 1CK0H 3DIFA 3IRPX 3CH1B 2O5YH 4GBXB 2VN7A 1X6LA 3AXLA 5EZLB 4Q0XL 4U6YB 4OGAC 5FO9A 2BC4A 3PWUB 2YD7A 2HTKC 3T2OA 4FN0A 4TTDC 2HT4D 5HHOB 1A6TA 4NKDB 1S7QB 4X9BA 1GXEA 3PDGA 4KJPC 1WWAX 2VZUA 3S6CA 2ATKA 3I50L 3Q5OA 2ZG1A 2X6MA 4QRPD 4UQ2B 5L8LB 4UT9L 5A2FA 4BSVB 3T3ME 1I8KB 3V4UH 2A1WL 1J1XL 5T1KA 1BQHB 4NNXA 2EXWC 1MQ8A 5KSBB 4NIKB 1ODAA 2A6KA 3DI2B 3ZL4H 1RU9L 1CBVH 1INQA 5BS0B 1NC4D 3Q0HA 4NM4L 2CRZA 1YEIL 1ZLWH 3WN5C 3E0GA 4GKNB 5DJXA 4MA7H 1WZ1L 1MF2L 4NO0D 2WUBL 3U1SL 5TH2A 1A9EB 1EDQA 1Q9OA 3D69B 3MLWH 1SHMA 3FOMB 5LJYH 3P9LB 1ETZA 1VADB 4Z77B 2DTML 3RJQB 3WFBH 1DEEB 4YFLI 1KJ3L 4G8EB 4WUKL 1CFNB 5FO8A 1KIQB 1LP9B 5DS8A 5D7SL 3U4AA 2GKIA 3WIHA 1T1XA 3U2SB 3QG6B 2G75B 5HPMB 5DO2C 5F9WC 4H5SA 3IDUA 1R3JB 5IMLA 4TNWK 3NZ8B 3G04B 1HXYA 1QPXA 3S5LB 3ECBB 4WGWB 1MWAH 1XR8B 1MCRA 4RMTA 2AAVA 5FYKD 5E6IB 3P73A 1UH2A 1QSEA 3QXAA 4MLIA 3FRPG 3QCVL 3S34H 2K1MA 1DBML 5I1HH 5DR5L 4XVUD 2Y5TA 5D7IA 3TT3H 3GMPB 4IRSB 2QEJA 1JIBA 4P23D 4Z8FL 2VDPH 4YEEA 2Q3ZA 1NPUA 4LVHC 2W9DH 1ZOXA 4MA1C 3QG7H 1DBBH 2X4QA 1A02N 2ADFH 4KZEL 3DI3B 4LNRA 4CADB 2WANA 3KXFD 4JFYA 1TJGH 1I1AD 5T3XD 2V5MA 4KUCF 2HJLA 1K8IA 3CSBA 4L29A 4LLVB 1JMZA 2CDGA 1HZHH 4E41A 1RUQH 2FB4H 5KSBE 1ORQB 5DJ0A 1DN0B 2HA1A 1PSKL 1T1ZA 4D2NA 2UVEA 3KG5A 4L8BA 5BS0E 1WWCA 4JHBA 4LDLB 4M7LH 4PJFF 3HUJF 4QGYA 4A2LA 4OZHA 4P3DB 2J8UA 3CX5K 4GW4A 1AIFB 2XTJD 3BEWA 1Q9WA 5HI5C 1E4WH 5D70L 5IR1B 5EIVA 4AEIH 1SY6L 1A6VL 1FG2A 1ZLSL 5KW9L 5IV2A 2GK0A 3MOQA 5GRJL 3CDGA 1P9MC 1LP9E 3RWJA 5KSVA 2I9LB 5GGUB 3ZYIA 1SEBB 2OZ4A 1D5XB 5ICYB 5D1XB 1ZSDB 1MLCB 4V2CB 5BRZD 2KQNA 4MGXA 5L2KA 5FA3B 2COQA 3CLEH 5EG6C 3RVXC 4JAMA 4BJLA 1A1OA 5DGRA 4OFIA 1MJ8L 3NFNA 3RBGA 1CTNA 1PX4A 4HH8A 5EBLB 3HE6C 1YY8B 5K9QG 1BJ8A 2QV2A 3QWQB 4M8VA 5HHOD 5K9OB 2QHRH 4JFQB 1MFCL 4AM0A 2NR6C 5LAXA 1REIA 5I30H 2FD6H 3UTTB 1WBXB 1FORH 1X5HA 4XCNA 4NRYA 1DQJA 2X4OA 4YJZL 3ULUE 3NGBC 1FBIH 3QA3A 4OCLC 2ZCHL 4PYHA 3MV7D 4Y4HA 5LG1A 1EIBA 4POZD 2IWGA 4HQQH 3MNVB 3CDFA 3C8KA 4WW2B 3PV6A 3RVTC 2ATPA 4U2ZA 4JFOB 5C0CB 2X4TB 4MJIA 4EI5C 2XWBA 4ZYKA 1IGJA 4DVRL 4JFZL 3GI9H 5HHQA 2Z4QA 3PDOA 2AJYL 3OTTA 3OR7A 3VDCA 4PJ5E 4KK9D 4LLQA 3Q1SH 1CLOL 1VGKB 15C8L 1FDLH 3SOBL 1CD9B 5C6TH 1IILE 5F7DA 2AERT 4U7MA 4QHLA 5ITBL 1EUTA 4PJGE 2ZSWA 4WI9A 1T6VN 1FVEB 4X80H 2Y06H 5E5UB 4ZPVB 1AQDB 3GMOA 4G8IA 4NN5B 4DUVA 2MJWA 3SBWC 3IVKB 5E6ID 4X6EA 4RGMB 1J0ZA 1YN6A 3SDCD 3QI9B 1ZVSB 3D39B 1RIVL 2HTLC 4K55A 4YHML 4NQCB 5TE4L 1ZE3C 2DQJL 4GW1A 2NY5C 5GRXG 2C7UB 1TPXC 5GGRB 4DZBA 4RQQB 1FPTL 5K59E 3IFLH 4JZJC 2FLRT 1GZPA 2DQTL 4M6AA 1MCDA 1U8PB 3TN0C 4DEPB 3P0VL 1JBJA 3TZVC 3QIWB 1QQDA 1QFUL 2A6IA 1NCDL 3UTTE 5FO7B 3V0AC 4NM8H 1U91B 3WJLC 5KS9A 3V4VL 1E27A 1EAPB 1S9WB 5KAQG 5DJ8B 2BX5A 3L3IA 5B4MC 1LEKB 5FIEA 4RBPK 3ILPA 1MEXH 1KSRA 1MCKA 2EH8L 3GSNL 2BVPB 1S9YA 4RMUA 1Z5LB 1CG9A 1VGEH 1RJLB 1CDJA 5C0CE 4F37F 3BGAA 2QSVA 3BGFC 3S36H 1X5AA 3C5ZA 1XGTB 3CGTA 4XAKD 4R90H 4BH7A 3VGFA 3UJJL 2VUYA 4W6WB 3GHEH 3FCTA 3ULUL 1QZ1A 1RK1B 3BD5A 4F37K 4AEFA 2M2DA 2AJUH 5FECA 5F6IB 3DETC 4GXVL 2R4RL 3D18B 1L9MA 1MRFL 5D1XD 1V3MA 4FQ1H 2VDRL 3WDHA 4WFGD 5FM4A 3LN4B 2NPLX 4QRTB 3TF7C 4KHTH 4TSCH 4CUCA 5CSZB 3BH8B 1XGUB 4GT7A 4R2GC 1CFSA 3GMRB 5CINH 3D39E 4XCEB 5ESQB 4LF3B 3TVMC 4HK0A 3AREC 3OZ9H 2C4XA 4WTZA 5I9QB 2F15A 2IPUK 1FL6A 3UTTD 2F53B 1UM4H 3E6HA 3RA7H 1CU4L 2P1YA 4L3CB 2OXHA 4XNYL 3ARFB 3DX9A 3H9SB 4H26A 1B6DA 4JQVA 1RJCA 1KJ2A 3B83A 4N0YL 4BZ2L 1XGQB 3GJFB 3WHXB 3BISA 1TCMA 2GAZA 5C0RH 4YFDB 4HUUA 1MAJA 4FRWA 4JR9H 5C0CD 3WUWA 3QIBA 3V5DA 3GIVB 1KGCE 4LPXA 1NCNA 4QOKB 4KUZL 3ZYOA 5CSBA 1A6PA 3LKNA 4G7VL 2JIXB 4WEUD 1NBVL 4X98B 2FDBP 1IC5H 4WUUE 2AW2A 5A16B 3D3VA 4PGEA 4E0RA 1H3PH 3WL9A 2GJZB 4R7NA 4U3CA 5EU7C 4NFDA 1T1WA 4LGRB 2B39A 1JF5A 3B6SA 1F4XH 4NBYB 3O6LL 4UAOC 1OL0A 2IMMA 3NABL 4PIRF 3M8OL 4WHTA 3T0XA 1HHGB 5E9DE 5DWUL 5LBSH 1VPOL 3NIFF 2A0LC 5CGYC 4M48L 1JWUB 2C3WA 1MIMH 1DBAL 4HZLA 4K3EH 1IQDB 4P5TB 3VGDA 32C2B 3PP3K 2HN7B 1U6AL 3MRLB 4M43H 4QHMA 5TE7L 1NJ9B 5I2IA 5EN2A 1WEJH 1KN4L 2R23B 4Q6IB 4YZFF 3QI9D 4J4PD 4ORGA 1IC4L 3QRGL 3CC5B 5E8PB 4EN3B 3C08L 3TGXA 2P8PB 4M7JH 4NQCD 2FJHB 3MRHA 3BP5B 5F72S 1QP1A 2GYSA 3MCKB 4JHAL 3VFNB 3FT4A 5J6HB 2HLAB 4ODWB 3U36B 1TTGA 1KLGB 1IM3A 2Z92B 1TIUA 3VFWA 4HC1H 5D1ZC 2WBJB 3QIWD 2E7CA 4POUB 5DVLA 3VXRA 3BWAA 1SYSB 2F53E 1JPTH 2X09A 4TQEL 1RAMA 4JPKL 3TNNA 3U6RB 4LEOA 5I1KL 3UDWA 4PJHB 1BEYH 5FYJD 3VGAC 4M5ZL 1FGVL 3FONB 4XB8A 4JPIB 1FNAA 4JFFB 4XNUH 2XN9A 1ZKAA 5EIIA 2GI7A 2HG5B 2R56H 3MJ8A 4RGOH 1DANT 2F5AL 5KSBF 2W0PA 3ULSB 1CLZL 3V9FA 1FVCB 5LKNA 5SWQB 1C7SA 2VR9A 3GMLB 4QOKE 2BERA 3BW9B 3PV7A 3U79A 3LS5L 3HA0A 3SEPA 4OAWB 1TFHA 5IBUG 1NUGA 2IAMA 1RURL 3RRQA 1AY1L 4G6JL 1A0QH 3F8UB 2JJUA 4GH7B 4LKXB 5E7BA 1Q72L 3HR5B 3MLRL 4RDQF 4M3KB 4C83B 5I1GH 4FXLA 5F3HB 4OCWH 1CICB 1LP9F 1VFAA 1Y6NR 3QQ4A 3FQTA 1LNUA 4JFXB 4ZUVA 5ADOH 1IC7L 2EE9A 3KLHD 2L4OA 1NUFA 5CEZD 1LO4L 1NFIB 1ZK9A 4RNRA 2IPKB 2NY2C 2V7NB 1BQSA 1OAYL 2V2TB 4YNYA 3SO5A 4OD1H 1WWWX 3F7YB 3OKLB 4KKCC 4L9DA 4NRXA 3HKFA 3QJFB 3QO1B 1BBDL 5HHPB 5ICZB 3CFJA 3SO3B 1I9IH 3MRDA 2F53D 3O2VH 5CD5C 4M4RA 1SJXA 3I9GH 3VRIA 3ARFD 3H9SD 3ROOA 2AJVH 4H25A 3TO4C 3ETBF 1NCUA 5H2BA 4YBQD 2ORBH 3O3UN 3GSOA 5DEFB 1G84A 3BEVB 1VSCA 5SX5K 3WO3B 1HXMA 2NXZC 3EYVA 2E5EA 5IESH 1MCWW 4XXDA 3G9VA 4PJHE 5DQJB 4M7KL 1KEMH 3MNZA 2WZPD 2WV3A 3GEWB 3W5MA 1KT2A 4JFFE 5ISZB 2JIXD 1WZLA 2ZCKH 2OI9B 3HPLA 2P42B 4K8RH 1UYWH 1EJ6A 5GISH 3LH2H 1FYTD 5IBUB 2EKJA 4KDTA 3VXME 2VDLH 4XPFL 1YY9C 1BLNB 4I0PD 1VKXA 2A2QT 2OMBA 4NO2B 3B8SA 3QUMA 4EUPA 5BVPL 5EA0L 5D6CB 4N90E 5GJTH 3E6FB 4LLDA 4HDIB 5CKGA 1KB5H 3R1GH 1U8MB 3MFGB 1KPRB 1T2XA 3IKKA 1OAUL 3GM0A 3IGAB 4XNZC 1S7TA 2A9MH 3ESVF 5IB3B 3G5VB 4O4YL 1BVLA 4L8DB 1HILA 4CVXB 4EN3D 1WFNA 4MHHG 2IC2A 4FABH 5MENB 3SE9H 3VD7A 5MEQA 1F13A 4UILL 5AUMA 5CUSH 4JKKA 1PY9A 2IBBA 1IAMA 4NN6B 2XPGB 1SVCP 1WQVT 1L0YA 4Y19D 1F3JB 4X83A 2WBJD 3DSFH 1N5AA 3T09A 1QPPA 4S10A 2HT4C 2DLIA 4Q0XH 3O3BB 1SJEB 3QUXA 2FJFB 1D5BA 3FZUD 3W9DA 5B8CB 1UH4A 3H3KA 4ZS7L 4X4XA 4NQDB 5HJ3B 3OJDB 4ZPTA 1CE6B 1CGXA 5D96B 5B21A 4FQJH 1FAIH 5D7LB 5C0NC 5FB8B 1J1XH 2I5YL 5GGSY 3O3EA 4LIQH 5GXBB 4MJ6B 4ZMAT 2D7TH 5ISZE 4WW2F 3DVIA 3DUHA 1PG7H 3EDKA 1RU9H 5JOFA 3OL2A 4KMQA 4RGNB 1AI1H 4P4RB 1YEIH 3IAPA 1X4XA 2CIKB 5HGGS 5CBAB 3ROLB 2O5XL 5HDQH 5J13C 1MF2H 2WUBH 4GUPB 5C07B 1CICD 5EU4B 2FSEA 1K85A 3BZDA 4U3XA 1WGOA 1WJ3A 4PRAB 2O61B 2DTMH 2Y9RT 1KJ3H 4LLYB 2IFGA 4RWYL 2QSCL 3M07A 5D7SH 1CLCA 4HGMA 4OLZH 2J4WH 4ZUTB 1ES0B 1HH6B 1QBAA 5H37H 3P11L 1I1YA 1D9KC 1MHPL 4YEFA 5D6DA 1F4YL 5C9JA 4QHKI 3JV4A 1MRDL 1EJOL 1MWAA 3WO4C 3VJ6B 1P4IL 5IEHB 3P4LA 3GGWA 1J8HE 4XVUC 4EVNA 5JHDA 2CQVA 3W9EB 4NUGL 1GL4B 4YPGB 2JF1A 3B9VA 5DR5H 1DJSA 4MS8D 4P23C 3MMEB 3RUGA 3H7LA 2VDQL 3GB7B 5C09B 3U83A 1J0YA 3IFPA 4UU9B 4PJCB 4Z8FH 3KYOB 1XCQA 3FB8B 3SCMA 5BW7A 5IMKA 1I1AC 5AYQA 4N8PA 1AFVH 4NQDE 4R4FL 5EC1A 1J88A 2R69H 1MCQA 4OIAA 4R0LC 1F3DJ 5FKPA 4WFFD 3E2HB 4FQCL 1QG3A 4NHUA 8FABA 2DL9A 4WCYH 3JUYA 2PO6B 4X6CA 4U1LB 4FQLL 4POYA 4MNHA 4PJXB 3P4MA 5EORH 3ARXA 1P69B 4L1DA 3TFKC 2W60A 2VE6B 1PSKH 1XF3B 1YDPB 4U1NB 2AXFB 4W68A 5INDB 3C60A 2A73A 4RGNE 2K7PA 2OBGA 4DGVL 4D3CH 5L0QB 5JXAL 1P7KB 4Q6YA 5C07E 5I1IL 1DVFB 2OLDA 5I71C 4MA3B 1ZS8A 4UQ3A 4JFDB 4QRRB 5JXEC 5ALBL 4I2XE 5J06A 1A6VH 5KW9H 1PW3A 3KPNA 2ZPKL 3QRFM 5T1MB 5JNYA 4LHUA 2MMXA 3GKZA 5MEND 1A9BA 3DGGA 3MV9A 1JPGB 2AI0H 3WLBB 4Q9QL 3PGFL 1YC7A 2DM4A 1IAOA 3T77B 2ZOKB 4GMTH 2Q7YA 4RFEB 4F7MA 3EOBA 1FGNH 3S3SA 5T3ZD 4NN7C 1N8ZA 1YNKL 1I8MA 3H2WA 4WO4B 5E00B 4TUJA 1C5CL 1KIPB 1T5WA 3P77A 4UTBH 4OZFH 4K7PY 3HZYA 2DM7A 1T0MA 3ARYA 2BXZA 1VEMA 4IOFD 1R6VA 3NCMA 4LCUA 2FX8H 4Y5XC 2VQTA 3IDXL 3VDAA 3WD5L 4PJCE 5KAQF 5D7LD 3BJLA 1TZIA 2FEDC 4KH2A 1VESA 4POZC 1KTLB 3PWJB 4D0DB 3NCYS 1P9MA 3MLZL 4LSRH 4RGND 5DJYA 3RPIB 3T1FB 1TITA 2YD3A 1QR4A 1FYHB 1P7QA 3QDMA 1QOKA 1RHFA 4J3OC 4U6TA 1M05B 4HKJB 4KK9C 3QEUA 5C0BD 3LQZB 2AJYH 5F8RC 3JSSA 1FZOB 3DX8A 5DDHB 3PHOA 3W39B 3VFPB 1S9XB 3HE6A 2CJUL 2BNUA 1G0XA 5ITBH 1T4KA 1TTFA 4O51B 4JFDE 5F71A 1CL7H 4H1LG 4X6DB 3HRPA 4S11A 4DAGL 1N7ML 5CIPB 3SDCC 2VH5L 2Z8SA 4PBXA 1JNHA 3RY5A 3NA4A 5DJCA 1JNJA 2YD4A 5J11C 3SJVB 2EEAA 5JLZB 3WV0A 3UTSD 3FAWA 4WJ5A 4I5BA 5C09D 5FA4A 5HGHB 1BD2A 1SM3L 1GH7A 4GLRI 2DQJH 3JZ7A 4Z7WB 4EI5A 5C08E 1BJ1J 1FPTH 4WTWA 1ZHBA 1MOEA 5DD0L 3MUZ1 2FR4B 2C1PA 5FFLA 1JFQH 3P0VH 2R0WL 3VXPA 4PJHF 1GC1C 1K9TA 4H88L 4E9LA 5EZOL 3FOLA 2A6DB 3UZEA 3V4VH 2PO6D 4NZJA 2P4AB 2VO5A 1AGBB 5CEYA 3BAEH 2Z35B 3X3FH 4P5KB 3O2WL 3P4OB 4XNXL 2EH8H 4Y4KA 4P9HL 2I26N 2XWTA 5SX5H 4XNMB 3C8HA 4AENA 3KPRE 4BSJA 5GIRB 1ZT7B 4ZFOB 4LHQB 3IXTA 5FDWB 2ZOLA 2X40A 4D8PA 4NNYB 3DO7A 3MV8B 4QRRD 3IS0X 2O26U 3AFLA 2GQHA 2FX7L 3KJ4B 3VXNB 3UJJH 1A3LL 1H3VA 3LV3B 2R4SL 5L7XL 5HYJB 5F9OL 2N56A 3QWRD 2YUVA 5HI4D 2EDWA 2APBA 2FZ3A 3DV4B 3SDDA 4MJ4A 2UZXB 2APFA 2PNDA 2R4RH 5CWSA 4UT7L 1IGYB 3EZJB 4X6DE 3TN0A 5E4IA 5GJSL 2VDRH 1KNOA 5ANMA 1RSFA 5JDSA 6CGTA 1RHHA 2JB6B 2Q3AA 4Y5VC 3VFRA 1D5MB 3T2NL 1MFEL 1QBMH 3CFKB 4WO4D 3WIIL 5CLTA 3MREB 4DKEH 5DVMA 3IFNL 4JPVH 1J18A 1C8PA 3MRNB 3SJVE 1TCRA 2MPAH 4JY4B 2QSQA 1MSPA 1CDYA 2GIYA 3U9UB 4JN1L 2FBJL 3S37L 1JRHI 4HGWA 4CMMB 1YQVL 1XEDA 1CU4H 4L4VB 3AB0C 2KKQA 3IFOB 3G08B 1F97A 3SKOB 3WDJA 4PBVC 2PKDA 4ZO8A 2MHAA 3MA7B 1G6RB 4HEME 4K7PX 4N0YH 4X99B 5GGVH 4G9FB 2GJ6E 4PJ9B 5IB2B 5JR1L 4JN2B 4P4KC 3S96A 1IQWH 3CMOL 4DFIA 5I1CH 3U4BL 3T2PA 4LSTL 1BFVH 3KDMB 4G6AC 1UGNA 4PP2B 3C5JA 2B2XH 1GOFA 1AKJB 1UACH 3OXRB 4L5FH 5I8KH 4I9WE 1FE8L 1NLDL 1NMBL 3OX8B 3BKJL 5DUPL 4NKIL 5JMOC 4LVEA 3RWGA 5E8OB 1S7UB 5F7KC 4XP9H 4LLUB 4MAYA 2VLLA 3PL6D 4BFBD 1RVFH 2A83A 2Y6SD 4QRUA 5EFIA 1AP2A 2N4IA 3NABH 3OAYK 3I6LE 1S9KC 2CXKA 5EBMB 5DWUH 3RVVC 1VPOH 4F7CB 4M48H 3WCYA 2BOCA 5HYJE 1NCAH 1Q8MA 1DBAH 3WNNA 3KHQA 5FM5O 1QSFA 5DTFA 4IJ3B 1U6AH 5E5MB 5L8JB 4KHXH 2XY2A 3DVGA 4J4PC 2IALB 5F1KC 1KN4H 1JNLL 2IG2L 4HS8H 1Q9LB 4PRNA 4QTHB 2G9HA 1IC4H 4PGCB 2ICWB 2LVCA 3C08H 3MLSL 3VXUD 2NW2A 2PETA 1U8KA 2H1PL 1NBZB 3MBXL 3WFHA 2DKSA 2YRLA 3LRSA 1I85A 3QFJE 4ISVB 4DUXA 4YHIA 4HC1A 12E8L 3ULVD 1OHQA 4EQ2A 2ED8A 5F7EL 3UJIH 1PKQA 3V6FB 3WFDL 4OTXL 4M00A 4QWWD 5CZXD 1DE4B 5FF6A 4JPKH 1TTUA 3DYMA 1ROWA 1XF5B 3A6CL 5J9PB 3ARGD 3I02A 1NANI 4M5ZH 1WIUA 3WIFB 4D0BB 3QNXB 1OB1A 4YHNB 2IBZY 3BN3B 1ZT1A 2YPVH 2VXSL 3KPSB 1H5BB 3AS0A 5M7QA 3LRGA 3ZE0E 1LO5A 3SDXA 1CLZH 4F3FB 4Y1AA 2EYTA 3TBVB 3HC0B 3MV8D 4WFED 1LK3L 1OF2A 5IM7B 3GK8L 4XB7A 3O11A 4J3WA 1DBJH 2VZTA 1KCUL 1RURH 4YX2L 4JQXA 5CHNA 2CRIA 4G6JH 4ODBD 5I75C 3E8UL 3RI5F 4X7TA 1ZA6A 1KTDA 3MLRH 4UUJB 5AG8A 5LCVH 3HZKA 3KLHC 2VDNH 3WYRA 5E4EC 3BIBX 4A2MA 1CGUA 3RVUC 1FN4A 5D1ZA 4GG6B 1IC7H 5DJZA 1MH5B 3F7RA 4FFYH 1X9QA 5FYJH 1LO4H 2EXYD 1YC8A 2XQBH 3L5HA 2KPNA 2YPKA 3RI5K 1WITA 5EWIL 1A7RH 3ZKQD 1T0NB 2F74B 3K1KC 4HF5H 1UZ8A 2NNAA 5IJVA 3MBEB 3A67H 1QLFA 3CFEA 3HUJA 4HIHB 1L4IA 2LU3A 1BBDH 4PJFA 5HXMA 3O8XD 4PV9A 2DJ4A 2VAAA 4N1HB 5F89B 1FC2D 4L4VD 2NTFA 4X6BB 5AZEL 1UQSA 4HJJH 3ARBA 3G5XB 3KPMB 3B5GA 3ZMRA 3VFVA 4PJCF 1BZ9B 4G9FD 2DLGA 3EO0A 3QUZA 4KAQH 4PJ9D 3K81A 4GFTB 5HHVL 1X4ZA 1BVKA 1C08B 3VWKB 4H0IA 5JW4N 5IROC 4KY1H 3TWCH 2BCKB 3HB3D 3KGRA 4F80A 4GKOA 4U6HB 4TNVK 4PJXF 2H3NA 3DX6A 1DQML 1XGYL 2BVQA 2VLME 5TPWL 3EYQC 4I0PC 1RULL 1VACB 1KTRL 5D8JH 1QR1A 3O2DL 1PQZB 1C5DB 3GRWA 4WWKC 1DDHA 5GGQH 4XZUA 1SYVA 4LCIL 2YA0A 4LCYA 3QDGD 4N1EA 5JIPA 4NHCL 5BZDB 2X9WA 4JFEE 4LLMB 1ZT4B 3AM8C 4ODUA 1KB5A 4HHAA 1G6RL 2HT3C 4Z7UB 3SDAB 2X1PA 1K5NB 1OAUH 3GJFH 3P4NA 1FZMA 4GG6E 4F7TB 3OKKA 4S1DC 5DVKA 6FABL 4R97B 4O4YH 1JYNA 4CMHC 4WHCA 4KK6C 1GGUA 3EGSA 5J7CC 2XFXB 3D85A 3ZTNL 5KOVC 5CLWA 1NFDB 5I6XC 1WIPA 4YXLL 3P40A 2X4UB 4JGUA 2H8PA 1HH9A 3QQNA 1QFWI 3RGVB 1YYLH 2CLVA 3O6FB 5I73B 3GBNH 4P2RB 4ZFZB 4ZFGL 2KQMA 2YK1L 5I8CA 2OQJB 1Q0XL 1DUYB 3M1BB 5D9SA 4ZQKA 4ZS7H 3RDTA 3MLXH 4NQTA 3K46A 2Z91B 2MKLC 4J8RA 2D31A 1UCBL 3KPSD 3CFDB 3MLPA 2I5YH 1KFAH 2VLJA 4KPHL 4TUKL 2CIIA 1MJ7L 3M45A 1KTKE 3KWWA 1UJ3B 1CXKA 5KZCD 2ERJB 5IB5A 5TF1L 3MRRA 2NZIA 3NFPA 2WWKT 4OB5L 2IBZX 1W0YT 4PRPE 3RWFB 5KG9B 2JJSA 1IZJA 3EFFA 1PLGL 2H26A 4QRSA 3MRMB 5CILH 3BPLC 3O6ML 3R4DA 4RRPG 4PRIB 4GRWE 3MOAL 4U1HB 2DQFA 4CVWA 5IMMA 4NGHH 1LEIB 2EDBA 1VCAA 2EYRA 1CFQA 2GY5A 1N3NB 4RFNC 3SY0A 3C2AH 3IS1X 4Z7UE 1EXUA 2QSCH 4PB0H 3MTRA 3QIUB 1MLBB 4X6DF 2NX5A 3U4EA 4KROB 3SGDH 3O3AA 3RHWF 4QCIA 4QRPA 4NQVA 3V4PL 3H3PH 1JPST 2VDMH 2R1XA 3P11H 2VXTL 2Y4SA 4JKLA 4XBGB 3BPCB 3OKMB 5IIEA 1MHPH 5INCA 1F4YH 3LCYA 1MRDH 3IF1A 1EJOH 4L4JA 4D9LL 4HUXB 1P4IH 2EDHA 4OFPA 5ABDE 4LEXH 4U2YA 4L9LC 4MS8C 4LPYA 1NC4A 2R39A 1NFDE 3RHWK 2K3TA 3LQAC 5EU3A 3G5ZA 3BHBA 4AYFA 4NUGH 4Z7WF 1OT2A 4NO0A 3V6OC 4N8CL 2JELL 1CN4A 3H3BC 1JHTB 2UWEE 4DCQA 3TEUA 3VWKD 1FNHA 3CJJA 1OD7A 2V2WA 1CLYL 5DFTA 2CGRL 2YD9A 1GRWA 4KRPD 4OD3L 3AC0A 4DUWA 5CAYB 4G6FB 2BNRB 2XZAL 4S1QL 2QADC 2ZUQB 3C09B 1F02I 4FQCH 1MQKL 1J8KA 3TH2T 3BN9D 1QRNB 3X12A 2D7MA 4FQLH 4CN4A 4R96B 3WUZA 2BDNL 3F62A 5D7JB 1D3CA 1EO5A 4M1CD 5AEAA 3OXSB 4JO2H 1XIWD 2B5IB 1E6JH 2FBOJ 4ODSH 4WENB 2ATKB 2VIRB 5JXAH 3MXVL 5GZNC 4YC2B 4YR6B 3LKSA 2P44B 4XXCC 4R3SB 1IEAB 4CJ1A 2F58H 3RTQB 4WNQA 3I6KA 4P23A 2MWCA 1BM3L 1LQSR 2ADGA 4JANB 2A6KB 2PCPB 3OMZA 2YXFA 4UV4L 4QXWA 2DQCH 5ESAA 5LGHL 4Q9QH 1F8TL 1G0YR 1I1AA 4M6NL 4LMQI 3OAYH 5C0GA 5TH2B 3MRFA 1R0AL 1B90A 4NO3A 5HBBA 4G43A 5IK3B 2HMID 2BVOA 1FFOB 1OAXL 5DJ2B 4Y0GA 1IL1A 3IJYA 2AEQL 1GSMA 2XY1A 1VA9A 4O58L 4YHZH 4P2RD 1YNKH 3BWUC 4ZFFA 1INDL 3CUPA 2NY3C 4IOFC 5I1LA 2NY1B 4X5WA 4LCCB 1BAFL 1C5CH 5EOQL 4WV1C 2CLRA 4OIIH 5F21B 4ZUWA 1U8OA 4NQUA 4YDIH 1G7MA 4IIQA 5FUCE 4HK3N 3IDXH 2J12B 3DTXB 5IMLB 4FQQA 1ZXQA 2AKRA 1EMTH 2AXJA 2VDKH 5F1NA 4JHZA 3PIQA 4F9LA 3N1GC 1PJ9A 4KRMB 4U1IB 3LHPH 4DGYL 3MLZH 3DJ9A 4Y7MA 4UV7H 2WAHA 2FHBA 2Y5TB 5D7IB 3U30C 5BRZA 1QFHA 4NP4L 4I1NB 5CJBA 1CWVA 4PRID 4P46D 3K8KA 1JGUH 5EZLA 5T3ZH 4U6YA 3KPQB 5C0IA 2H9GB 3PWUA 5I76B 3IU3B 5I8EB 1XFPA 5HHOA 1AD9A 1QBBA 2X4QB 5C86A 4NKDA 4K9EC 5B38G 4JFYB 1S7QA 3T3PE 3QIUD 2CJUH 2PN5A 4UQ2A 4BSVA 4PLKD 3I84A 2NQCA 1I8KA 5HHXL 2AGJL 1BQHA 1T1ZB 1PG7X 4DAGH 4U6XA 4XRCB 3MV7A 3BJ91 4OZHB 4G9DA 2G5BB 2DQGL 2J8UB 3MJ6A 2QR0B 5E24E 1XF4B 4GKNA 3U0WL 1IEHA 1OTUC 2F9BT 5DRXB 5EBGA 1A9EA 1KF9B 5F7WC 5HVHB 3OB0K 3HI5L 3D69A 4DTGL 3FOMA 3ARDB 3P9LA 4RA0C 3REVA 2DWEB 1VADA 4Z77A 4G8EA 3GNML 2VABB 1WFUA 1CFNA 1KIQA 1LP9A 4UBDD 1OGAB 2BNRD 2BRQA 1F45A 2PTTA 3L3DB 3LKOB 5JIKA 3U2SA 3TYGH 3C5SB 3QG6A 5GRZA 2G75A 4E42A 2BFVH 5HPMA 2E7MA 5BO1L 3PHQB 2DIBA 1QRND 1R3JA 3NZ8A 4JAMB 3G04A 4D94A 3SKUD 3S5LA 3ECBA 1QSEE 1XR8A 2E3VA 5D7JD 3TT1H 3O2WH 5JW3H 3CU1A 5E8DH 5E6IA 4BK4A 4HFUH 5D7IE 4LP5A 2UZIH 3ZKXB 3QHFL 3MACL 2M26A 4UT6H 4KZDL 3L95B 3VWJB 5ESVB 3NA9L 5B38B 3L6FA 5GS0C 3RTQD 1NQBA 1LO3L 3QA3B 2QQKH 5HI4C 1A3LH 2YXMA 1Y6KR 2DI8A 1ZGLB 1KULA 4Q2ZB 2KDGA 4XT1C 2IH3B 3J8F7 1GAFL 4GG6F 4CADA 1EZVY 3EJZD 3BP6A 3OKDA 5JQ6L 1CXIA 1DBKH 4F33A 1FFNB 1D5IL 2XWBB 4ZYKB 5FCUH 1YUHB 3PDOB 1GZQB 3K3QA 1DN0A 4OZHE 2AJZA 1YEFL 2J8UE 2Y1VA 4LLQB 5F96L 2EDTA 3ZTJG 4ZNCD 2FRGP 3IFNH 2ED7A 4P3DA 3VG9B 5JW4R 3CFCL 5KVEH 3Q6GL 5IR1A 1YJDL 3FTGB 3VRLE 1HWGB 5F7FA 3P9WB 1ACYL 3TO2B 1TJHH 4G8IB 3HC3L 1IKNC 5DD1H 3BQUB 4ZUUB 2WQRA 4WI7A 5GGUA 1SEBA 1D5XA 5IHUL 5ICYA 3CH8A 5EB9A 5D1XA 5DMYA 3CZJA 1JPSL 4WFHE 1ZSDA 1QBLL 3T0WA 4YXHH 1NGZA 1A6WL 1CIUA 3FRPA 4LSTH 3QNZB 2GW5A 5FA3A 4DN4H 1IGMH 1XZ0B 2C4FU 2DMCA 1FE8H 2N7BA 1NMBH 5FYLE 1YY8A 4Y5VA 3PL6C 4EZMA 3BO8B 3O4LB 1AQKL 2Y6SC 3BKJH 5K9OA 4NKIH 4JVUA 2Z93A 4K94L 4BFGA 2J8HA 1GCFA 1NMCC 4HSQA 4YE4L 1I9EA 3UTTA 1WBXA 4Z7UF 2MQCA 2DBLL 4QHUB 2DQHL 2IFFL 4XP1H 3RJDA 1LD9B 2LU4A 5JIHA 3FMGL 2BY0A 4P2QD 4QY8B 35C8H 1UENA 2Y07L 5ETUB 5FM5M 3MNVA 5I17B 5GS1B 5ECJE 4MJIE 1OAZL 1IAIL 4YBLC 4WW2A 5FKAA 1JNLH 2IG2H 3DMMC 2Z31D 4JFOA 4E5XB 5C0CA 2VXUH 1ZV5A 4P2OD 4J1UA 2X41A 1NFDF 4NKMB 4TPRH 2V5RA 1FSKB 4NBXB 1PKOA 1WCBB 3ULVC 5FECB 1VGKA 4UIKL 3RKDD 5CZXC 4QXGH 2VMFA 2IAND 4RZCB 1OGAD 12E8H 5JW5B 1HINL 3QR2A 5HGAB 3ARGC 3MV11 4RCAA 3WFDH 5FGCB 3EFDH 1FVEA 2DJUA 1I1FB 5HVGB 3AY4C 3GSWB 3F7VB 3P30L 1BBJB 1B4RA 3A6CH 5CIPH 1CFSB 1IKFH 3U0PB 3JWOH 4CDGC 1TVBA 4HK0B 4Y5YB 3QI9A 4WY7L 1ZVSA 5CJOL 3D39A 3IKCB 1JYWA 4NQCA 5IG7B 4KI5E 3T0DA 5FYJU 4WU5A 5IP4A 1I9RL 1LK3H 3U82B 2C7UA 2R2CA 4F2MB 5GGRA 4LK4A 4RQQA 1RZFL 5ALCH 1KCUH 4YX2H 1OPGL 1U3HC 4FTVD 2OZ4L 2XTLA 1U8PA 3QIWA 1NSNH 2DWDA 5FO7A 1U91A 3WLWD 3D25B 5CBEA 1EAPA 2ZUYA 1E4JA 4Q58C 5A40E 5IEKB 5E2WL 2ZKHH 1RZKL 1DZBA 3DBXB 2IQ9L 4YDVB 3MFFB 4HAGA 1LEKA 2ADIB 3OG4B 3RWIA 1UB6A 5IB4B 2BY2A 3D3VB 4OUUA 4PGEB 4E0RB 2BVPA 1MCIA 5FYLL 1UC6A 3KYNB 2VLRB 1Z5LA 1RJLA 4U3HA 3IRZA 3JVGA 4HAFA 3B6SB 3O8XC 1MFAL 1GPOL 4FMFA 3RAJH 2V2XA 5FDYA 5TDPA 4DGIL 1TNMA 3ZE1E 1UXWB 4IRZL 1G9NC 3QCTL 5IFAH 1EGJH 1OT1A 5D7KD 5ERWA 1B4JL 4QHMB 5EN2B 3N0PB 4QRQA 3D18A 5FGCE 1OTTD 4FZ8H 3HB3C 5H35B 1KLUB 4LSDA 43CAB 4QRTA 4B7LA 3FT4B 2GTZB 3QPXL 1A1MA 5CSZA 3O4OB 1XGUA 3RWEA 5EZJA 3FFCB 1RZJC 3O4LD 1IM3B 1DQMH 5TPWH 1NC2B 3GMRA 1RULH 3BH9A 3VXRB 4XCEA 5ESQA 4LF3A 3O2DH 3OGCB 1BFOB 2J5LC 2WWKO 4U05A 1J87A 4LEOB 5IGXL 3BZ4B 2F53A 4XC3L 1IGFL 4LCIH 3ARFA 4NHCH 3H9SA 1KENL 4NDMB 1UM6L 1WT5A 5EIIB 1JZ6A 3PWPB 1XGQA 4NKOB 3GJFA 5DHYB 3WHXA 2EDDA 3GKWH 1X5JA 1I7UB 2VN4A 3EYOB 2R0LH 4QOKA 3D3VE 4Y4FB 2JIXA 4X98A 2VLRE 4X0KB 3DHJA 5A16A 4UTAL 3B8YA 2RQ8A 2VQUA 2WLZA 1DQDH 1FYTA 2GJZA 1F5WA 3QULB 4LVOC 3HR6A 3U48A 1RZJH 4I0PA 3QQ4B 1N5YL 1OM3H 1G9MC 3REWB 4DW2L 2UY7A 1HHGA 2P5EB 4HG4K 4ZFGH 2V6HA 1JWUA 3DVNA 2YK1H 4P5TA 1IQDA 1Q0XH 4TTGA 4GQ9L 4Q9BA 2HN7A 1CZ8L 4WGVB 3E3QC 2E7LA 3KLAA 3G6JB 2IF7A 2R23A 4P48A 4NRXB 1UCBH 4U0RB 5E2VL 4M03A 4FFZH 4HLJA 2OXGA 5EO9B 5E8PA 5JW4M 4EN3A 1B9ZA 3QXVA 2P8PA 4JRWA 4KPHH 4TUKH 4OCNC 4BSWA 3BX7C 1UXSB 2FJHA 1MJ7H 5D7IF 3BP5A 5I66A 3GIZL 3FFCE 4ONFL 5F7MC 3VI3E 1OWRM 3MCKA 4XPAL 3VFNA 5AYUL 3VXRE 5J6HA 3QZWG 3IAGC 2G5RA 1H15A 2HLAA 4ODWA 3U36A 4NQED 4OCYL 1KLGA 2Z92A 5TQ0L 4HGKC 4Y19A 2GY7B 5GRYA 2WBJA 1SYSA 1NMAH 2QQLL 4GMSH 3CZFA 4XP6H 2CK0L 4KVCL 3MNZB 4TOYL 4ODXB 3U6RA 1C1EL 1JUFB 4ZAKD 4JY5L 4I4WB 2XN9E 2AJXL 4YWGH 3X11B 2EIDA 3FONA 4JPIA 1HQRA 4IRJD 4C59B 3HG1B 1BF8A 2HG5A 5DLML 3V4PH 4BQ8A 3VFSB 2VXTH 4OZHF 2IGFL 1FVCA 1VKXB 3GML