3L5JA

Crystal structure of fniii domains of human gp130 (domains 4-6)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
288
structure length
283
Chain Sequence
EDRPSKAPSFWYKIDPYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the entire ectodomain of gp130: insights into the molecular assembly of the tall cytokine receptor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Interleukin-6 receptor subunit beta
total genus 42
structure length 283
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5jA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5jA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5jA03
5J13C 4WWKB 1CT8B 1I1RA 1LEIA 5GGTL 3PHOB 1UADC 2FJFA 1PW3A 3U0TB 1RZGB 5GS0L 5C0CA 5JDSA 2FWOA 1A6UL 4XVSH 2BRRL 4LSVL 3QQ4B 3MFFA 1GIGH 3C60C 2DQUH 1ZLWK 3FL7A 2P43B 5DD6A 3OKNB 4F15B 4X80H 3GEWB 5JHLH 1IARB 5HHPA 2CR3A 4L1DA 1R5IB 4I77L 3O2VH 3FQTA 2BXYA 4XPTL 4JFQB 3L3IA 4RMVA 1E4WH 3HMXH 1BM3L 2BVOA 4HX1A 4PRPA 1OTSC 2NYYD 1DBKL 1K2DB 1TVBA 1T83A 5FECB 3MV9B 3R1GL 5IMMB 2IANE 4RAVA 2B7DT 4L8BA 1X5YA 1UWGL 4PJFA 2CLZA 1UKQA 3D39D 4OF5A 4PJIE 5IW1B 5FDYA 4JO2L 2XA8H 4JPIA 1WBXB 1B0RA 2VR4A 5T1LD 4I9WE 1OQXA 5L0QC 4YHMH 3ULUC 5JXED 4P2OB 1Z9MA 3VXSB 1KG0B 4OZFA 5HHOA 4U0QB 1DBBL 1LP9F 4JFPB 4NKMB 1UM5H 3MNVB 3SE4A 5IBLD 3CZJA 1LO5A 1EHAA 5I1LA 4JZNA 1WBZA 2HKFL 3CDCA 1D5ZB 1FZJA 3F65A 5E95B 1DCLA 2XICA 3FKUS 4X5XA 1RZKC 2VDPH 1HSBA 4MD5B 2AEPH 4NOBA 4MXQD 5HHOE 1OGTA 2QSVA 1X4XA 1DN0A 1VEOA 3GBNH 1A2YB 4YWGL 4I5BA 1DQQA 3S37H 4UT6L 4PRHB 4ODHH 1BOGA 4FQ2L 4YR6A 2MOVA 3VFVB 1RIHH 5INDA 4UUJB 3TA3A 1RK0B 4HV8B 4XCEA 4FQJL 2PXYA 4TUKH 4L8SC 1INDH 1SY6L 3WV0A 5F7EL 1A9BB 1S7WA 1NGPL 1UCBL 4RAVB 1KGCE 4ZYKA 4F9LC 3EYQD 2ZZUT 3HE7C 1ZEAL 4HQQH 3QHTC 3TT1H 1A7PL 2G75A 3OAUH 4ZAKC 3GI9H 4IIQA 1FH5L 3E2HB 3FO1B 5FA4A 2ESVE 1S7RB 2GSIB 2YHGA 1KCKA 4MD4A 3VFUB 3WFBH 1FNHA 5C0AA 4M00A 3PDOB 3UAJC 3TFKC 1P9MA 3K8KA 1FLRH 3JV4B 4K9EL 5DA4A 1NBZA 5EU6E 4QXUL 2XFXB 4J3TA 5E03A 3U7AA 4XPHL 3EO1B 3VWJD 2CKBA 4X4YB 4RFEB 4OGAC 4G6JL 2GTWA 3AMKA 5FKPB 5CBEB 2VWEE 3BIKA 1PLGH 5DMJB 3UPAA 5IW1A 1QLEL 4GS7C 1GGBL 3PHOA 4DCQB 4X8JA 1CXLA 3G6JB 5IMMA 3RNKB 4P4RB 1A3RL 3KWWB 5JW4Q 4L9LA 2R4RH 3HC0B 4FQLH 1DQTA 4MCZA 4NN5C 3U0WL 4AENB 1A1OB 4IHOB 4NP4H 3U9UB 1ZLWH 3SE9L 1HHJA 2FR4A 1NBVH 1Q0XL 3E6HB 2HVKB 2YPVH 5HDBF 1CD1A 1H3WM 1AD9A 1S8DB 4PJBF 4K3EH 3ZO0A 3PQYB 5C6TL 1W72B 3LCYA 5IVXF 4JJ5A 2IFFL 3PWVA 1IQWH 5CJQL 5HSFA 4U1LB 1T0MB 4OLVH 1CG9A 1U8OA 1B6DA 2DYPD 3GKZA 3IKCB 1D6VH 4YHYC 1CD0A 1DVFD 2VE6B 3U79A 4KK8D 3O3EB 4MJ6B 2J5LC 3X12A 4DUXA 4PJBA 5DEGB 3VXSD 2ADFL 1PBYA 2VUYA 4OCWH 1A3LH 3IXAB 3MLUH 4Z8FL 1SMOA 3DBXB 4A6YA 3O8XB 2XZCL 3CLFL 3OXRA 4P3CL 4M4PA 3RWHB 2HLAA 2B4CC 3NZ8B 1URLA 3UTTA 4H1LH 1DQMH 4JM4L 4X7SH 3FB7B 3VRJA 3CSYA 4CVWA 4HUWB 4YHZL 3RHWK 1H8OA 1EUUA 3KXFA 1A1MA 2ESVD 3D0VB 3OJDA 1S9KC 3LKSB 3DUUA 3ULUH 3NAAH 5EWIL 1UJ3B 4X8XA 7CGTA 5JIKA 3HB3C 4U1IB 2DKUA 4NPYA 5I71C 5MP6L 1EJ6A 4MXVF 3VFOB 2H32H 2A6JA 5EU6D 3EYOB 5BZDB 3CH1B 1ED3B 2FO4A 3RWFA 5C0DB 4HS8H 5F9DC 1EFXD 4OF0A 1R3KB 3L9RB 1UQSA 3MBXH 1GYAA 4U6VH 4ONGH 3VDCA 3MODL 3V0VA 2HLFC 4NQDE 5E2UL 3OKMA 1LEKA 3EHBC 3SGDH 2BSRB 1NCBH 4JPWH 1JP5A 2AGJH 1OPGL 4YHOH 4C57C 4YPJA 5T1KA 4MJ5B 5HVHC 1ODAA 4IDJH 3REWA 3HR5A 1YPZA 3HE6A 5MERA 5FYKE 1NJ9A 2WQRA 4PY8J 1OP5K 3C87A 1CU4H 5ANME 5F7UA 1P6AB 5EBWA 4HLZG 4I3RL 3H7BA 5DJZA 1NGQL 2HRLA 1YMME 1T0PB 5ILTH 1OAUL 4N5EC 2BMKB 4G6KH 1KLFA 2VDKL 5IGXH 2QSCH 2XT1B 4KQ3H 4PJ7B 2VDRH 3O6FC 3DVNB 4OCXH 3OSKA 3IF1A 4NHCH 1YUHA 2Y06H 3ZLQC 1CWVA 4HPYH 2JB5H 2A77L 2ICES 2YXFA 2ZUTA 1A7NL 4UIMB 5HDLA 3QUZB 1L0QA 3D2UA 4K07A 4UB0L 2O5ZH 4QOKB 3CLEH 1JZ7A 5E6IB 3ARYA 3KR3H 5JPNA 3V8CA 5DK3A 6CGTA 1SJEA 4P2CG 3RX5A 5JOPD 2AK1L 1WC7B 4ISVA 4D9LH 5KAQG 1EIBA 4OCMC 5E4EC 5C0NC 3MRBA 1YYMH 1J8HB 5J56B 2QV2A 2AS5M 4ZSOB 4YX2H 4GRMA 3W0WA 4NGHH 3QIUB 2VSDA 5AEAA 5KVDH 1IGML 4MNGE 5F6IC 1IC4H 4QRSB 3D9AL 3VRLF 5EIIA 4M93B 3GMPA 5KSBF 3TVMD 4K8RH 3BI9X 1UM6L 1YEJH 2AJVL 4YHLH 2DI9A 2N7AA 1U8LA 2E7LC 4O58H 1QPPA 1S7SB 3T3PF 4LRIC 5IROA 1XGTB 4R0LB 4EQ3A 4ESKA 4I0PC 4ZUVB 2EDEA 2MTPA 1VFBB 5ECJE 3PE9A 1AH1A 4NOFA 2X70B 1BECA 5CEYA 4WHDA 3GSQB 3NN8B 1JRHH 4JREC 3ZE0F 5MENB 4U1JB 2MNUA 1N5AA 3UBXG 3EYSL 4NKDA 2W9DL 5A2KH 1VFMA 1JV5B 2EXYD 1JPSL 1ZHKB 3DV4A 3OKKA 2YD2A 3GSXA 1I3GH 2VLLA 1WLHA 2DI8A 4U1GC 2FIKA 3VXTB 4WV1A 2AJ3A 4U3HA 2QQKH 3BW9B 3V6OA 4ODWA 4Y0GA 1J88A 1RMFH 1QR1B 1MCJA 4E41D 4LVHB 3NFPA 2AV7B 1I8IA 1QQDA 1IQWL 3CH8A 4P23B 5IIEA 5ERWB 4OZHF 1JNLH 1HI6B 2VQUA 4LRIA 1A14H 5IROC 1BZ7B 1OWWA 3QIWD 1FYTE 1NUFA 4QLRA 4M1GH 1RJYB 4GKOA 3H3PL 2PTTB 1DLHA 1OAZH 4RGNC 1BBJB 1RMFL 4UIMA 3RTQC 4NZUH 3IU4L 4I2XB 1FG2A 2XY2A 1QRNE 3NCJL 2VLRB 4WUUA 2R4RL 4HK0A 3DVFA 1N6UA 3QSKB 4V1DA 3DROB 1S7XB 4ZO6A 3CFKB 1EEZB 5IVZA 4WO4A 3AROA 3TIDA 2V5TA 3HUJF 3T0EB 1IGJB 1JGVL 1NC2B 4KAQL 3RKDC 2D0GA 1HEZA 4Y4FA 4PJHE 4OLXL 4YHKH 3QCVH 3SE8H 2QADC 3T0XA 3KJ6H 4YDJB 4GKNB 3AS1A 5FO7A 3QO1A 5GGRB 2Z91B 1Q9OB 4HBQA 3JWOH 1N59A 3QUMA 4WCYL 1H3UA 2HRPH 1VADB 4P5MB 2V5SA 3MRRB 4RGNB 2WIMA 4YBQC 2H9GA 1XZ0B 1YNTB 2AK4B 5D5ME 4WI5A 2MCG1 3SPVB 3QCUL 5F7DB 4DGIH 1NDGA 1H5BC 1FGVH 3P4OB 3RDTA 2IH3A 2NTFB 1QSZA 4P0DA 5TE7L 4NO5A 4PG2A 5FO8A 1L7IL 4APQC 1INEH 1PZ5B 4X6EB 4G8IA 2YD9A 1AGCA 1BJ8A 2VAAB 3NCYP 3U7YL 1MUJB 2APBA 3MRJB 1CL7L 4YDVA 3I2CL 2HLAB 1A7NH 3RAJH 1QP1A 2IADA 5TGBB 4RCAA 2MCPH 1F58H 2CGRH 1AP2A 5IESL 4PJHA 3MJ9L 1IGCL 3WFEL 3VA6A 1XCTA 4H26A 2ADJA 4JY4A 3QJFB 5IB4B 4TQEL 3SDYL 3RWCB 5JW4M 4M62H 3RTQD 1NLBH 1IRAY 4R26L 2MMXA 2W07A 2DDQH 1H5BA 1ZHLB 4G8GA 4GG8A 2FRGP 1MHCB 4M5ZH 4EI5A 4LPTA 3V95A 1S9VA 1OD9A 2VIRA 3KG5A 5I0DA 4JJ5B 1JPTL 3BJLA 3ZE0E 1W0VB 5CGTA 1MCNA 2ZSWB 1EZVX 1EA9C 2GJ6B 4HF5H 3QFDA 4KKLD 1YEGL 1SY6A 5ACLA 1NC4D 2HFGL 2GCYA 5D71H 4EIGB 3MCLH 2YUXA 4M8QA 3CVIL 3D39E 1F90L 3BP6B 2DS4A 1CGSH 1KPRB 3E8UH 3VWKB 4ZNEA 1JGLL 4OI9A 3OPZH 5DK0B 2DQTH 4Y5YC 4OD3H 4PRAA 4TNVK 5B4MC 2YA0A 3TNMB 1RUQL 5KTEL 2OYPA 4LPCA 1MVFA 2BCKB 4OB5L 1RZKH 3STZA 4LVNC 1T1XB 3MV7A 5D6DA 3EGSA 4QHKI 5TDOB 3WNPA 3ES6A 4D0DA 1MFAH 5I0ZA 3MGOB 1JGDB 3PP3K 3VFMB 4M8VA 2XWTA 3GIVB 4KVNL 1RJLB 5TE6L 3GB7A 1YMMA 5GGQH 2Q20A 1C12B 2DDQL 3THML 4PJEE 4E0RA 5E2TH 5C07B 3MREA 5JW3L 2ADIB 3BN9D 3VG0L 4Z8FH 2QQNH 3HNSH 5J11C 2Z35B 5C07A 5I74C 2FX7L 1KCRL 5HVHB 1IZKA 2P49B 5I76B 4YO0A 1EO8H 2OI9B 4F58H 2Z31D 3CX5K 2Z4QA 4MJIE 1NKOA 3LV3B 1D6VL 5DEFA 1P2CB 3WKNA 3IFNL 5C0BB 5L8LB 2B2XH 4E5XB 4KKAC 3QDME 5JQ6L 2IFFH 1RIUL 2LU4A 4ZDHA 1H15B 2GK0A 3VE0B 4ZFGL 3LVEA 5JQHC 3DX9A 1O0VA 5AD0A 1I8LC 4NQDD 5H2BA 4W4NA 5CSGA 2OZ4L 5T3ZE 2NY4B 1NBVL 1JFQH 4RBPH 4NQTA 5GS1C 1AD0B 1KPVA 5EO9A 5C07E 4ZAKA 5ESQA 5F3BA 4J7RA 2P5WA 2APVA 4HSQA 1M4KA 1MFBL 2ZSWA 3HR6A 3RWIB 2VDQH 3IU3B 4BFEA 4ZUSB 4GRLD 1PJ9A 4KI5D 2C3HA 1HKLH 4GG8B 1NAML 3OHXA 4WO4B 1JGDA 4XMKL 1UXWB 3TA3C 4HHAB 5I2IB 2VLRA 4R90L 5HPMA 3T65A 1HHKB 3UJIH 3SDXB 4M9OA 1PLGL 5KSAD 4JFEA 4MZ2A 2QBWA 4MXWH 4LGPB 5I8OH 4NKMA 1T89C 1BVZA 2B4CH 1OB1A 2FL5A 5I1DB 4LU5L 4OGZA 5K33A 4TOYH 3MYZA 4HPOL 3SDCB 5F7LB 4OZHA 3OF6D 4PJ5B 4UAOB 2QKIA 5JOPE 2ZP0T 3EDEA 4YDVB 1IL1B 1B4RA 2VDML 1X7QB 1ADQH 2CMRH 3E6FB 1W2KT 1LNUB 1G84A 4OGXH 1WTGT 2O61B 4NKOB 4NCC2 3O3DA 2D7PA 3SQOH 5I73B 3WFHB 3KYNB 1K3ZA 1K6QH 1ZWIA 1JN6A 2JCCB 1OY3B 2PO6A 4YIQB 3RWCA 1U3JA 5GPRA 4EN3D 1KTDA 1R5IA 1K85A 1OAYH 3GSNB 3TC9A 4HD9A 1N3NA 1CGYA 4RAUB 2IAMA 4FQ1L 3ALWA 4CU6A 5ENWA 1K4CB 2IANA 4PY8I 3HMWH 5D72L 1P53A 2X1OA 1AHWC 5HDBE 2ZCLH 1FV1B 3VFPB 4DGYH 3RIFK 3RIAK 4POUB 2HJLB 1QVOA 3QQ3B 1TPXC 4HWEL 1I1AA 2PF6A 3FQRA 3V4PL 1MUJA 5C6PB 3TN0A 3QDMA 3WEXB 4Z78A 4W68A 2B39A 35C8H 2V2XB 3HE6C 4GKZB 2J8HA 3HPJB 4JM2A 1NCAH 5I1JH 1FYHB 5EULV 3QHZL 2ZWLT 3DARA 4LARL 1QBLL 4JFFE 4PLKD 5GGQL 5C9JB 1JHTA 1F4YL 1CXFA 4MSWA 4O5LL 3V52L 2JCCE 2BY2A 3PWNB 3BSZL 4TNWF 1KB9K 5EC2B 3KPSA 5IVXB 1UA6H 2FEDD 2YS4A 2XN9D 3LDBC 4BFBD 4ODSH 2DTML 1YEJL 1N5YL 4OI7A 5KN5B 2Z93B 4PJDB 4A6YL 1LO4H 2YBRB 4IRSB 3UTSE 1S9YB 4PP1C 5I15H 4KK9D 1UM4H 1A64A 5CMAB 2VDOH 3S5LA 1RZ7H 1T7WA 4P23A 4YX2L 1L6XA 4NFCA 3S3PA 4LCWA 1KCVH 2UZIH 3G5ZA 1ZOXA 4HJ0D 3I84A 4IRZL 4KH2A 2VL4A 3EKCA 1F8TL 4JO3L 4TVPE 3GBMH 1C7SA 5IB3B 2VDOL 1V3KA 4Y5YB 3TIDB 1NBYB 1HQRB 1U8HB 1UH2A 4P57B 5I15L 1Y6KR 3QAZB 3P9WB 1N64L 1TMCB 4KMTH 5TDNA 1OT2A 1G9EA 5I30L 3U6RA 5E4EB 4RQQB 1INQA 1AQKH 3OKMB 5SWSA 4OCXL 1RZIB 4EN3C 3SDAB 3L5IA 4OJFH 3LKQA 3MLWL 3KYAA 4LMQI 5BZWB 4OIBA 4Y1AD 4B7LA 1AI1H 1ED3A 3QP3A 4J1UA 2B1HH 2BNRD 3GHBL 1TZGH 3V52H 4M93C 4ZPTB 4QRUA 8FABA 1GOHA 1IAMA 4HGWB 1PG7W 3RL2A 3UZEA 2GSGB 3LKOA 4LPUA 1NFDB 4TSCH 3LKSA 3HMWL 3GMPB 4RGMC 3FB6A 3FFCA 3JTTA 5DS8A 2VWEC 1YEHH 3MV01 2F8XC 1KV3A 4KKNA 2Q6WB 1IE5A 3ZE2E 1J9CT 1MJUH 5IBTH 2BSSA 1DEEA 3HG1E 4X7TB 4MCYB 4K3HA 1T1WA 5CP7A 3TN0D 2P8PB 3E3QE 3F8UB 5EIVA 4NBXB 2K9UA 2LQRA 5MENA 4DZBB 5LWYH 4OGXL 3IJHA 4CN6A 3MRPB 3GMMB 3L3DA 4ODUB 3TH4T 1XCQA 2MQ3A 1IEAB 3FFCE 4HKBB 3NAAL 4ZNEE 4M43L 3TBVA 4LCIH 2XN9E 3A6CL 1MCFA 1U8OB 5I19H 4EQ2A 5J8OA 1RK1A 1BX2B 1SVZA 4HIHA 4G43A 4U1LA 5GIRA 4KK5C 5IW6B 2HWZH 3K4ZA 2LV4A 5EOQH 2XTJD 4M7KH 3H7BB 5DJZB 3PP4L 5D96B 4E9LA 3QUXA 3QEHB 1E28A 5B38A 3IJHB 3QWRA 5I8CA 4QGTA 5FA3A 5E8PA 4UINL 2ADFH 5M94B 4AQOA 2R1XB 1YEKL 2DIBA 3G08A 4ELKA 1KEGL 2J88H 2NLJB 3NFSH 2ZOKA 2DWDB 3QT2A 2NYYC 4F3FB 1MI5A 1CFTB 5F1SA 3S36H 5GQBA 2OR7A 1H3TA 3LEXB 1BQHB 3EYFB 1NMBL 3EDFA 5IM7B 3PWUB 1BFVL 3FN3A 3S7GA 3VFOA 4KTEL 2W1NA 3DV6A 4O2CA 4YUEL 4Y1AE 3RY6A 3EOBA 3MRLB 5GRUL 3TCXA 1A6WH 3U0PB 4NP4L 5EBMA 1FSKC 1U8PB 1ITCA 1QA9B 5F7YC 5J1TC 1FBIH 1MWAB 4JPKL 4Z7WA 4C83B 4WFFD 2I27N 3VRJB 4MA1C 2H3NB 4G80B 3FQWB 1QTYT 3MRKB 1G7PA 1MH5A 1HN1A 3T65B 3OXRB 1F00I 3VXPA 3S35X 2BSRA 3MBED 4OCNC 3O3DB 3LS4L 1FVDB 2ITDB 5IFJA 3HG1D 4FZ8H 1AO7B 3NA9H 2BNQD 1QLFA 1U93B 1CK0L 5D93C 4R2GD 1FIEA 2D7MA 2P42B 3O2DA 2I07B 2FJHA 3TA3B 3EYVB 4CGTA 5IEHB 4KV5E 2VKXA 4YPGB 2QKIB 2I5YL 4U1IA 1J18A 3QIBD 1PY9A 2JB6A 1T4KA 3IFLH 2VH5L 4PB0L 4ELMA 4MAYA 1F97A 3BMWA 3VRLE 4ZDHB 5L2KB 4PJCB 2Z93A 2A6IB 1A1MB 3D0VA 3FO2B 4PJDA 5E2JA 3RVVD 1NMCB 2EDDA 4DFHA 1HH9B 5FGBC 4FQQB 5DVLA 2A9NH 1QEWA 4QRPA 3MRQA 2YXMA 5I1HH 4XBGA 3BP5B 5JMOC 1CZ8L 4LLYA 5F1OB 3VFRA 5KVEL 4WI9A 4OIIL 5FGRA 4GFTB 1SYSB 2X10A 4GUPA 3LIZL 2Y23A 3DIFB 3DJ9A 4FQIL 4HT1L 4E42B 4JM2F 3VXRD 3HZYB 4TPRL 1IT9L 2FX9H 4KZDL 3G6JA 2A9NL 4JFEE 5CSZB 3HCVB 4EVNA 4WW2C 5CILL 5E1AB 5GRJL 3O4LA 1XEDA 4ORGB 1VGEH 1B0RB 1MLBA 2YC1B 1KXTB 4KDTA 2AEPL 2ATKA 4DKFH 2GK0B 3VFSA 1NGZB 1OSPL 4PJAB 4JZOA 5E8OA 2D0FA 2HJKB 4JHZA 1B6UA 3VI3E 2EE3A 3KPRB 4NKIH 5IV2A 1MREH 5KVFH 1MLCA 1U41A 5F88A 4PRPB 4PJAF 1QBLH 3VWKA 3VD4A 1ZVSA 1RU9L 5ESAB 4GAFB 4BM7A 3I2CH 1JGEB 3BP6A 3T3PE 3PGCB 3QDAA 5GRVL 3HA0A 4XC1H 3VRIB 2BJML 3RP1A 4CNIB 5CZVH 4MNQE 4O51A 2YUZA 3X11A 4YNYB 2DJSA 3BQUC 1MIEL 2IH1B 2XZQH 1L6ZA 2P5WE 2YWYA 4RWHA 1NGZA 2HP4A 4PJAA 4I18C 1GRWA 2AJSH 1RK0A 4HV8A 4IOIB 4OUUA 4XCEB 1EEQA 3HUJE 3WLBA 4MXVE 3QULB 1LQSR 1NFIB 4HIEA 3QCUH 1QSED 5GHWL 3D3VE 2BNQA 3SBWC 5DJ0B 1KELH 1G9ML 3FO9A 2ADJB 3V6ZB 4H26B 2B20A 4DZ8A 4S1RL 1BZ9A 2X7LA 2RQ8A 4PJ8D 4NN6B 4OQ1A 4UDUB 4UIKL 5CJ8A 4K3JL 2C4FU 4L4TE 5T33L 3FO1A 3GO1L 3BP5A 1UXWA 4TUOB 2ADGA 3GI8H 4QRPB 5BOZG 4MJID 1P1ZA 2IBBA 2C1PA 5FCSH 4ZD3H 2GAZA 3LKNB 1WAAE 3HC4L 4XVTL 3DVIA 1KYOJ 4NIKB 1A3LL 4FFVC 1YY9D 5BS0E 3SEPA 4ZAKB 1UJTA 4NSKB 3LN4B 4NQDB 2W91A 1CS6A 4NM4L 5IBUB 4JFXB 4H0GA 5IW3A 2VDNL 4R4BA 2IG2L 5SV4A 3P4NA 3O4OC 1EBPA 3TYGL 3QIWA 2OQJB 3QRGH 2HWZL 5TH2A 4HWUA 1S9XB 4S2SA 4EJ1C 5J1SC 4OZIF 4S0TD 5BO1L 4HXBH 3SBWA 1JBJA 4M43H 1AP2B 1EV2E 5BOPA 5GS0C 5CWSA 4LEXH 1NAKL 1N6QL 1HKLL 4CMMB 4JRYB 2BERA 1VACB 1KLUB 5TDPB 3RPKA 4TNWK 2NY3C 1MFDH 1U36A 4Q58C 5IB1B 2HFFB 5E5RB 1HIMH 1KTLA 4QRPE 2P5ED 1ZGLM 5KS9E 4OZGA 4N0RA 1J0JA 2YPKA 4Y4FD 4LLWA 4FFWC 4X6EA 4D9RD 1A4JA 4XNYL 1PZ5A 2V9TA 3OR6B 1AFVL 2ZKHH 4K7PY 3VWKD 3U0PA 1N6QH 3O2WH 3WMSA 4C54A 5DJ2B 1QRNB 4AZ8A 3FB8A 5AZEL 1EEZA 2H2PC 2XWBB 3D2UD 4H1LA 4UI2A 1IM9A 3B9AA 2CD0A 2NY1D 3BZEB 5INCA 5HHNA 1MCWM 4OGYL 3BO8A 4PV9A 3RU8L 3ZKSD 4MX7A 2Z8VC 1XR8A 1ZSDB 2V9RA 1SM3H 1G7QB 4JN2B 3TO4A 2Z0BA 5K93A 3P4LA 4Q6IC 4M7LT 1U8NA 1P7QD 4PGDB 3TBYA 1I8KA 5DJXB 2HH0L 1WIUA 1WZLA 1KEML 2YPLE 4HFUL 5E8PB 4KVCH 4P2RE 1A7OL 4M7KL 4ZOAA 2X41A 4L4TD 4PJGB 3E1F1 3D18B 2GJ6A 3ET9F 3UDWC 3D25B 5IJKA 2G9HA 3Q3GA 3MFFB 1NGPH 5DSCA 3GBML 1KIPA 1M6OB 2DB8A 2V7HB 1RZKL 4QHUA 5E6YA 1HQ4A 2Y72A 2WINB 5KBNC 3PDGA 2NY4C 5BS0D 2NZ9D 4WW1B 5FYKL 3U46B 3WXVH 4UZGA 3DLQR 5F89A 4UOW0 4U1JA 1FFRA 2F5BH 4J3WA 3MV8D 4FQXC 3SY0A 3TGXA 4PLJD 2PTTA 1NFKA 3N06B 3TT3L 3NIFE 1R5WB 3CDGB 5BXFB 3EJJX 1YYML 3Q6GH 1NGYB 4V1DE 3QCTL 3W2DH 1OARH 4FFZL 1MRDL 1WITA 4XNMA 4NM8L 3RVUC 1A3QA 1XF3B 4PJDF 1CU4L 2PW1A 4FQHB 5MEPA 2R56H 3QHZH 4PTUB 2E9JA 3VI4F 2V5RA 3CFBB 4NJ9H 3QI9B 5ALBH 4EOWH 4LRNL 1AO7D 3F7VB 4NT6B 3TBTA 4NKDB 4YHML 4MXQC 5E70A 1SVCP 1T7YA 1TZIB 3T0EE 3MLPA 5LBSL 1T04A 2EDHA 5LVEA 4U1HB 2BY1A 5E6IA 2FGWH 1DN2A 1T03L 2H9GB 2DLGA 1N2RA 1INQB 1AGDA 2F74B 2ESVA 4GMSH 1WZMA 2OL3A 3QIUC 2YPLA 1A0QL 2DMCA 1OLLA 1U3HD 4MQXC 5CJ5A 1GXEA 3P73A 3KPPA 3M8OH 3SGKC 5F6HI 1MCCA 1MRFL 1XF2A 3VW3H 4BQ6A 2OXGA 1OQOA 3MFGB 3AC0A 1RIVH 2W0KA 1A5FH 4P5TC 3OMZA 4PGCA 1A6ZA 1QFPA 4MGXA 4X4ZA 4HJJL 5I1CL 4G9FD 4KTDH 3U7WL 2ZG3A 1MQ8A 3Q6FA 2BRRH 3M07A 5TQ0H 1DBAH 5A43C 2OSLA 1AXIB 1RZJH 5JPNB 1LP9E 3JSSA 1ZT1B 3IRZA 4TSBH 2K3TA 5DTFA 2VC2L 4GRWH 4XH2A 3NFNA 3NTCH 3JWOL 1RFDL 4OLZL 1CDHA 1KOAA 3FOMB 4GXUN 4X98A 1OGAB 2P45B 1LK3L 2D4FA 3KJ6L 1TZIA 2CXGA 3IDUA 3RZWA 5AZ2H 3S97C 1H9VA 3F7VA 4Z7NE 2CDGB 2HFEB 4N8PA 1NDMB 4M5YH 4YAQB 1KTKE 2Q8BH 4R90H 1JGVH 1I7ZB 4M48L 4XPFL 5GRVK 1CCZA 2IGFH 2P5EA 5J1AA 1I3UA 1ZGLB 3NCJH 4ERSL 4MNQA 3OKKB 3BT2L 4R3SA 4BQ8A 5B22A 4JB9H 4PJ7F 3W39B 2W9EL 4URTB 4NQCD 4NCC1 5CJQH 2ESVB 3VMOA 3AAZA 5JA9A 3MLYH 3HMXA 3EYUH 4KUZH 4JG1H 1FZOA 4X9HA 1LWRA 2WIIB 4JDVB 2C1OB 4PJFE 3DO3A 1QSFE 3V0VB 4EDXB 1YQVL 5BV7C 1BQLL 2NXYB 1DDHB 3T0ED 3VJ6B 4XTRD 5EN2B 2Q8AL 4L5FH 2A6JB 1DQJA 2DTSA 4JB9L 4P9HL 1I9JH 1HQ4B 4WTWA 3WFHA 3D5OF 3RPIB 5KVGL 4RBPK 4MNQB 1KEGH 1KIPB 2KQMA 1E4KC 2VC2H 1C7TA 4H25B 4OCSL 5CP3A 4L8CB 5ITFA 3U2SB 4AM0B 3DXAA 1AD9B 1P1ZB 5I1EL 3QJHB 4KKLC 4QF1A 2HVKA 4PRDA 1BFOB 5EU4B 5AZ2L 2JKXA 2X1QA 3MRHA 1CTNA 3OV6A 1AIFA 4KHTL 4BYHA 5B8CC 3EUUA 1I8KB 3THMH 3CUPB 5HI5C 4AENA 1NGYA 4Q6IB 5HYSB 2I9LA 2DM4A 4M6AA 5BRZD 3ZKMD 2QSTA 4K9EH 3RWJB 1BF2A 4HUXA 2X7LB 3F12B 5I1DA 4LKXA 3WHXA 1KIQA 2I26N 5ICXB 3LQZB 2PW2B 4Y5VA 4U6HB 5DTFB 1INDL 4H88H 4G9FA 4CRPA 3SCMB 1KPUA 1HHKA 4R8WH 1S9WA 1D5MB 4OSUL 2VNCA 4B50A 4F15C 4L3CA 3PWLB 4RWYH 5HGHA 1C5CL 3GI9L 4JRXB 4OUUB 2EYSA 1W0YT 1R5VA 3BKJL 4CBPA 5E5MA 2OMBA 2AJZA 3PP3H 1U8QA 1JFQL 1DP0A 5LKNA 1CD1B 2X4TA 3KPNA 1H0DB 4MA3A 4D2NA 4WU5A 4GAJH 1IAIM 5MEOA 5DLML 4IJ3C 5DRZB 4LHQB 5F9WB 1FN4A 3G9VA 3L3KB 2NZ9C 3HAEG 3GBNL 4IMKA 4J8RB 4E41E 1OHQA 5GGVH 2EECA 1MIEH 2XZQL 1R3KA 3L9RA 2B1HL 3QEQA 5INCB 4ZUWA 4RFNC 3EOTL 3AU1A 3AFLA 3V5KA 2B0SH 3MJ9H 1EERB 2YN5A 1OSPH 2RB8A 5CKGA 4RGND 2M8XA 4NT6A 2MCPL 3Q6GL 4KQ4L 4Q9BA 2GYSA 5DMIL 1IAII 1EGJH 1Q72H 1VKXA 3R1GH 2P5EE 4YDKL 3Q5YA 4GG6F 3FT3A 3HZKA 3SGJC 2BP3A 2FCBA 2EYRB 3B2VH 3QQ9D 4DUVA 1E4WL 1OD7A 1P5VA 3DMMA 1U91B 1PYWA 3BN9C 4AQ1B 5HYQB 4JFED 1XF4B 2OJEB 1E27B 3VH8A 1NANI 4X6CB 2VZ1A 1F5WA 1YJDC 2BCKA 3O3BB 4HS8L 1FFPA 1A6TB 3ZYIA 5EUOB 1HOCB 1AKJD 1S7WB 2ZUUA 1FNSH 1CFBA 1IC5H 4LQFL 4S2SB 4APQA 1LMKA 3MCLL 3RBGA 1FE8L 1Y18A 4MA1B 2GTZB 1Y0LA 3V6FB 4EI6A 2WLYA 4J6RH 2AABL 1I1CA 4F9PC 1CZ8H 2LTQB 5BQ7A 5J3HD 3WLBB 4X7SL 1CE1L 1GSMA 4JHWL 4CUCA 2IMNA 3GSUA 5DSCB 1DQML 1W72A 4QTIH 4PJCF 5GGTA 3GK8H 3AS3A 1K2DA 1TVBB 3GMOB 4XCYA 5D2NA 4Z7VF 5I1JL 5IFHH 2BVOB 4A2MA 5I1EH 3SKNA 5GS0H 4IRJC 4HAFA 4KAQH 1G7PB 2P1YA 4LHJB 3BAEL 5ESVA 3DYOA 5ITBL 4G80A 1FNFA 1J1OH 4PJHB 5DD6B 5BRZB 1QFWL 1CK0H 1JTPA 4XPAL 1IJ9A 1I9JL 3VXQB 5F3HA 4ZO8A 5HHNB 1CL7H 1JMXA 1VEPA 1D9KA 3CU1A 3VFSB 1IM9B 5DO2C 3ILQD 3D85B 2I25N 3C2SA 5DD1H 2NY1C 1BFVH 3QO0A 5DD1L 1BQHG 1EEUA 3O11B 3ZSTA 2GIYA 4YBLC 3NABL 4FRWA 4WHYG 3RX7A 4CKVX 1A4JB 4YZFE 5IMKB 2A2QT 1X5JA 4M7LL 3U0WH 3H42L 3VRIA 1WFOA 4ELKB 3UYRH 1RURH 3EAKA 4UQ2B 2CRZA 1U8IA 3OKEB 4XBGB 1D5BA 1OT1A 1RVFH 3D69A 1VESA 2AQ1A 4XPFH 3GM8A 4U7MA 5GGSY 1U9KA 3WJLC 3SKOB 3QEHA 3GRWA 3NOIA 5F1NA 1NGWA 5EG6C 3OAYK 2A0LD 3QQ4A 1JPGA 3F7YB 3MV8B 1P7HL 3IT8D 4PRBB 2APXA 4PP1D 1XGYL 1FC2D 1KJ3L 3QO1B 1I9RH 3QH3B 4TSBL 3C5ZB 4UBDC 4GBXB 3UJIL 1RUMH 1CT8A 4PJIA 3O41B 4FS0A 2R2HB 2EDXA 3WFBL 2WUCH 3RTQB 1AXTL 2NY2B 3IAQA 1QLFB 5F1IB 1O5DT 4G7VH 4OCRL 4YGAB 2QQLH 2VISA 4OTXL 1LDPL 1HSBB 1ZANL 2P8PA 3IS1X 4U33A 4DVRL 1UZ6E 3PNWB 4TUOA 1HZHH 3TA3D 1KLGA 3PL6D 5IJKC 3RVXC 1LO5B 5L9DL 4LLDB 5D5MA 3NIDF 2QADB 3TEUA 2VYRE 4OFYA 4NC2B 3P11L 2V17L 2QEJA 1G9MH 1CXIA 2GJ6E 2AK1H 2R9HC 2VOTA 3T09A 5LWYL 5D2LA 2EKSA 5DZOA 2VABB 5KAQF 4Y8DC 1XGUA 4HC1A 3QR2A 4KKBC 2R2BB 3R0NA 3D39B 1RU9H 2B5IB 3AXLB 1O7SA 4HPYL 2IEPA 3NFPB 1HHIA 2PO6C 4LSSL 3EYFA 1H3XA 1MREL 3QEQB 1U93A 1MHHB 1JL8A 1H3PH 4HCRL 3ARBC 5F9AC 2W9DH 4I3RH 4QRRA 4JQVA 1K3IA 3VG0H 1UM5L 3QIUD 1VGEL 1G9NH 2R0WL 4RNRB 2WUBL 2VKWA 1N64H 3D87B 4KMTL 4RMRA 2C7UA 1NMAH 4JHWH 4Z7WB 3MBEA 5A1AA 2XG5A 2H2SD 3HTLX 5J9PB 5LG1A 1NCBL 5IV2B 4WUKH 4KGJA 1MPAH 1UWEL 1GGCL 5GZNC 4RISH 2H2PD 4G43B 5I30H 2M26A 5CUSH 4OF7A 4PV8B 1UM4L 4Y4HC 5CJXC 1JZ4A 2PUQT 4V1DD 2FX9L 4KZDH 1CGTA 4NGHL 4ZUUA 1QRND 5L88H 4S11A 4HT1H 1UB5A 4MS8C 1LO4L 1BM3H 3JUYA 5FUCC 1PAMA 1KIQB 1WAAF 3UPRA 2ERJB 1MPAL 4O2FB 3KPSB 4GAYB 2NLJA 3OGCA 4P5TA 4HJGA 5FF6A 4KC3B 2XTJB 4K7FB 2I9LB 3KPMB 4K94H 2X4OB 3F6LA 3JZ7A 5EBLB 4NUJA 2IBZY 4HIJA 5DR5L 2DQUL 4HXAH 3CPLB 4C56B 4HW6A 4OD1H 1CLYH 1SJEB 3RZCC 3MLZH 5FK9A 2PNDA 3QJHA 1EGJL 4NHUB 2X44D 2Q6WA 1WCQA 4BZ2L 1I8MB 4AM0A 1CXEA 1YN6A 4XMPH 5HGAA 3X17A 4H25A 2CIIA 3DURA 3IXTB 3AS0A 3IVKB 1IGCH 3GSVA 3WFEH 4FZEL 3TV3H 3GZKA 4IBLT 1LHZA 3ZZ1A 1VGKA 1J7VR 4HMEA 2J1KA 3EYVA 2DF3A 3WS6C 2FX8L 4J1UB 5EBWB 1KCLA 4DN4H 3S3SA 3NA9L 1GPOL 3C60B 3G5XB 3MPCA 4G8FA 1BVKA 1DQDL 4X4MA 1NJ9B 1F42A 4WEMB 4XP9L 5BMFL 3QWOA 1G6RL 4L29A 3ZT6A 4RQQA 2BOCA 5FHBH 4DAGL 3FONA 1JWSA 4ZO9A 3M1BB 3V6OC 2R1YA 2Y7QA 3LPGA 1C1EL 5FGCE 5K9QI 4Z76A 2YR3A 5L2KE 5L7XL 5FCUL 4ZODA 1BHGA 3TZVC 2B1AL 4KUCD 2E8ZA 3ROOB 3PGDB 2QQLL 2XG4A 4G6AC 1B3JA 3EJYD 1L7TH 1A21A 2A73A 2Z8SA 5IUSA 2WZPD 3WL9B 2OR9L 4QRUB 4OZ4A 3BPLB 1CDJA 3EBAA 3B6SA 5D2LB 4LSPH 3WNKA 2EC8A 1RHHA 2W92A 2DYPA 4PGJA 4Z77A 1ZT7B 1AGBB 2B8OT 3BRGC 3NFNB 4JM4H 4CN1A 4OZFG 4YBQD 3QG7H 1TCRA 3BFOA 1WT5A 4LBEA 1MOEA 5FM4A 2IPKA 3OR7A 2JK5B 5HI4D 4LSPL 2IAMC 1ORQB 2QTEA 3A6CH 3OHXB 4X6BB 2VLJD 1HQRA 1J8HE 4X6CE 1XGQA 4NQCE 4P2QE 1HCVA 1FRGH 1QHPA 1TZHA 3PP4H 4H5SB 2NY4D 3W5MA 5D7LE 1OW0C 2WANA 5EU5B 4HQQL 5BJTB 1T2QL 2HG5B 4PYGA 1ZHBA 4LDLB 1FYTD 1ORSB 4UIKH 5CMAA 3I6LD 4U6YA 1WCBA 3BWAA 1C1EH 1SY6H 5KOMC 5F21B 4BSWA 3S35L 4NNYB 2YPVL 1MCBA 4LASH 5DJCB 3PQYA 4IS6B 5DYOB 1YNKH 2EDJA 4MWFB 2GY5A 1MCOL 3SKOA 4N0UA 3CVHL 4U1HA 1UVQA 1P2CA 1I9IH 3CCHB 4DN4L 5DZNA 5EU3B 2Y25A 4GKSB 2NY1B 3GKWL 3WN5B 5D1XD 4U6TA 2E27L 3SOBH 4KI1A 5JHDA 2OMNA 2H2SC 4FZEH 3D3VB 1BD2D 5F9OL 5HHMB 1D5IH 2EH7H 5EIQA 4P4RA 2FX7H 3B5HA 1DQDH 2P8MB 5BRZE 2BVEA 3V5HA 2XXMB 4ZUUB 1R6VA 1CFVH 1YMMB 5DDHB 3B9EA 4LCUB 4RMQA 5JIHA 5IEKA 3T0EC 4XPBH 4DN3L 3MRFA 4XVJH 5IQ7L 4KKBD 4OZHB 43C9B 1BPVA 3L3GA 2C3XA 3PWPD 4P2RB 2X42A 5HDQL 3QCTH 3W2DL 1LE9B 3CIQA 3DX7A 1KIUA 4KPHH 3VFWB 3HNSL 3WJLA 4JO2H 1Y6MR 4RAUA 1FE8H 1UEMA 3HAEB 4GLRH 4P4KD 4TN9A 5GRJH 1T1ZA 3B9KC 1I7RA 5SWSB 5C07D 3EJZD 1JNHA 2F54D 4KVNH 5HPMB 3DOSA 4IIQB 3MLRH 5CZXD 5ADOL 4YLQT 4Y88A 1UKTA 2YD5A 1MIML 3GMOA 5F96L 1OTTC 1CFQB 5F6IB 1M6OA 2JE8A 2CR6A 2YZ1A 3FQNA 3O6KH 2AQ3A 4J12A 4ODSL 1SEQH 4GW4B 5I16B 3DVGB 3V7MA 3S4SB 1FL5B 3HNTL 4PRIB 5I1HL 5ID1B 5MI0C 4PJXE 4U1NB 4BQBA 3ZYJA 5AG9A 3ZE1F 4PJ5A 4OUOA 4Y89A 3V6FA 2R1WA 4J3OC 4RGOH 1CICC 4JHAL 1YPZF 4MLIA 5KS9B 4RISL 1YDPA 1KEMH 4IRSA 4RGNE 2APWA 3ILPB 2COQA 3F7YA 4Y2DA 5I6XB 4NC1E 1DL7H 2AJYL 2FL5B 4R2GB 3TO4B 35C8L 3T04D 4ZFOA 1XR8B 1DEDA 3QFJA 3EOTH 2Z8WC 4LOUD 5GXBB 4KWUA 1JPTH 4XP4H 3BIAX 5HHQA 4LLDA 5D5MB 4PV9B 2I60H 1R3JA 4GQ9L 4LRNH 3ARWA 2Q3ZA 1SBSH 3T2NH 5IQ7H 2XN9B 3W9EA 2OJEA 3C5JB 4H8WH 2R0WH 4J4PD 3VXUB 2Z4QB 5I74B 5C9JA 1VEMA 2W60A 5I76A 2R39A 5FB8A 1PSKL 1LO3H 2AQ2A 5DHXB 3RWIA 1EX0A 4BK5A 5HHOB 4I8DA 1QFOA 2KKQA 3DHJA 3MZGB 5F9OH 3T4YA 1RUPH 3WYRA 1U3HB 5IFAL 3ZKXC 1K9TA 4WFHD 4NWUL 4Z7QF 5A2JH 1ZHNB 1HYRC 1ZMYA 2C3GA 4OLUL 2X5PA 5DVMA 1FGVL 3W9EB 4R2GC 1HZHL 3EO0A 4JEGB 4WFGD 1RD6A 2CDFB 4FXKA 3BMVA 4PJGE 3BEVA 1G7HA 4NNXB 2APFA 2VR5A 4BFIA 5FYKH 3MV9A 4XNQA 3MRRA 5DFVD 5HI4C 2BVYA 3GSNA 1M1SA 5BCAA 1Z6JT 1DUZB 1TIUA 5E4IA 5L6YH 2OQJA 2R1WB 2EH8H 4JR9L 3GRWL 4P9ML 1E6JH 3VGHA 3MMEA 1U3HA 1A1NA 4WUUD 2DQEL 1CR9L 1U3HC 4WGVB 4P5KB 4BSVB 3BPLC 3TJEL 4MNGA 1B0WA 4PRNA 3IDMA 1HEZB 3LN5A 4IRJA 1TNMA 4JLRA 1EXUA 4MXWL 4EXPX 5IMLB 4AT6A 3ZYOA 1J86A 1MHCA 5B8CA 3JXAA 3LKPA 3VXUA 1V3LA 1JPFB 3FHQA 4NQEE 1KJ2A 3HI6H 4JJHA 1QFUL 3GJEB 2E9BA 2CRIA 5CHNA 3QJFA 5IB4A 1C16A 3LS5H 1DLHB 2X9XA 2J2ZA 4MB4A 5ICXA 5C92A 3FHAA 4YFDB 1G0YR 4L4VD 5HJ3B 3OJVC 5HD8D 3RWJA 2KL6A 3ILPA 2IPUK 1D5XB 3MR9B 4DKDC 4JHBA 5C0CD 4U7SA 3O9WB 5E7FA 4R7DA 2PETA 2AJXL 1CDGA 1IQDB 3T0WA 4FXGB 1RZFH 4LSQH 1NCTA 4AG4L 1BFOA 4TVPD 3DMMB 3MACL 3FZUC 3BRFA 1OM3H 1WBYA 3UROR 2VDLH 4WW2A 3S98A 4KI5E 1I1FB 3S4SA 3RDTD 1I7UA 5EU7E 4XPAH 2ICWA 2N7BA 1XMWA 1KPVB 4M1GL 4KJWC 5EO9B 3T1FA 1BFTA 5EDXA 1MJUL 3IDYC 25C8L 5FHBL 5D8JH 4LGRB 3RFZC 4MNQD 4NQEB 2NW2A 3WN5A 4NZRL 4R97C 2P46B 3V7AG 4M5YL 1Y18B 3SKJL 1QLEH 4X7DC 1DTUA 5J6HA 4QRRE 9CGTA 5E00A 4P23D 1EK3A 3FQUB 1C5BL 5CKAA 2OTUB 5JW4R 1I1YB 2F53B 2IADB 4ODTL 4KKAD 3TV3L 3EO0B 3RIFF 3MUGB 2EYTB 3GSNH 3I6GB 1U91A 2I9TA 4FFYH 2IALA 1Q9LB 3C8KB 4MQXD 1F4XL 1DANU 4MA3B 4ETYA 5FO7B 3I3BA 4RX4A 5KTEH 1AGCB 3MA9L 4PR5A 4GT7A 4JHAH 1JNNL 3HZYA 1IC5L 3G6JF 1A7PH 4QNPF 5T33H 4QTHB 4TPRH 2DQFB 3LDBB 4EUPB 1XAUA 2D03L 2HT3C 2JLLA 3DROA 2YN3A 5D71L 3V5KB 2VLKD 3SKMA 4I0PD 1KELL 3C6SA 1LE5B 5A16A 2DQTL 5I1IH 3KR3L 5HI3D 1FL6B 3QXDA 1PG7H 4ZNCD 1FFNA 4WHCA 2UVEA 1PD6A 3KYOA 1VADA 3CVIH 2XTJE 2FB4H 3KPSD 3Q6FB 2N4IA 5D1QB 1UZ6F 2JJWA 2OTPA 1YMHB 2VUOA 1A6PA 5HHXH 3C2AL 1UA6L 4PJEB 5CEZL 4PJCE 1T66C 5E6IC 3ZDYF 5FYKD 4P99A 4ZXBC 5K9JL 2FIKB 3PV7A 4ETQB 4LAQL 1UB6B 1ZLSL 1XGQB 3H9HA 3KLSA 3GMLB 3QUZD 1DANT 4M62L 1DE4A 2HKHL 5FYLL 2QSCL 4KQ3L 1YY8B 1QSVA 1D5IL 3WS3B 2LU3A 2UZYB 4HCRH 3LAFA 1A7BA 1CICD 4XP6H 1OVZA 3WHXB 4QXTA 5DI8B 2X1XR 3MRNA 1LE9A 5C0BD 1BQUA 3P0VL 1FBIL 1ZA6A 4NWTH 3O0RL 1ZVHA 2R2EB 5K9OA 3DGGA 3VFGL 2CRYA 4X9BA 4HH9B 4OQTH 4PJ9D 3QI9A 5HY9B 2G2RB 2NTSP 3CAFA 4JGMA 3P11H 4YZFF 4YE4H 3PABA 1NMBH 1YC8A 1SEBB 2Y5EA 4HK3J 3BGMB 3OKDA 4HGMA 4YGVB 1JV5A 2ID5A 2OXHA 5DURD 5EFIA 4M03A 2WP3O 2X4OA 3FB5A 3MRMB 3BGFC 3BH9B 4CL7A 4HJGB 2DLTA 1Q9KB 1ADQL 3CCHA 1NUGA 3OKLA 3FOMA 3QCVL 3SE8L 2XWJB 2Q3AA 2ZPKL 4QRTB 4WENB 4I18B 1QPXA 5D7JA 4P46B 1G7LB 3QUZA 3ARTA 4HWNA 4X7EC 1S5IL 4WW1A 3U46A 2OSLB 5DFVC 3HUJB 2DQDL 4CJ0A 3ARQA 4M1CD 3IS0X 3SJVB 3RL1A 3HZVB 4CVXA 2BMKA 1MSPA 1ZGLA 3NACL 4YDJA 5DQJB 4PGCB 4F2MA 5SX5K 3AREC 3V79C 2L4OA 1BJ1J 2XKNB 1TZHB 2ZOLA 5L2KD 3HI1B 2IQAA 3X13B 1L7TL 5CZKA 3CPLA 3MLVH 2J6EH 4X4XA 1XGRB 4GW1B 4L4TB 3GUTA 5DQDL 4JKMA 2YPLB 5ABDE 3ECBA 4OFDA 5LJYH 4D3CL 3IJYA 1NL0L 3O6FA 3MJ6A 3MBEC 3UPRB 5DWUH 2YZ8A 4XH2B 5F7WC 2DLIA 3NZHL 3QUKA 3KAAA 3CFDA 1YQVH 2VL5B 3I75B 2YEZB 4OKVA 5BMFH 2Q7YB 5BZDA 4Q9QH 2ZCHL 3MLYL 3GHEL 2FBJL 1JK8B 2WP3T 5B3JF 1MJJB 4EUPA 4C55A 1EFXA 1NFDE 1K8IA 3LS5L 4ZUTB 3UTSA 3E0GA 1U2HA 1S7UA 1T2XA 4LNRA 1I3GL 4PIRF 1Q38A 4QXUH 3TBWA 2GUOA 3GHBH 2EC9U 3LKQB 3F58L 4U6XB 1XF3A 3SE3C 4KUCF 4Z76B 3T2QA 3C8KA 3R8BB 4G6FB 5GSRB 2E7CA 5J12B 5C6WH 4PTTA 3VGEA 4JQXA 4N8CH 3TJEH 5CGMA 1OW0A 1MNUL 2YD6A 2EEBA 1N5AB 4U3XA 2A83B 3DRTA 3QXAA 3MLXH 1IGMH 1ZEAH 4TTGA 4C4KT 3QYCA 5E00B 3RGVD 1RIVL 3O3EA 4PP2B 4IRZH 1VFBA 5CBAA 3FAWA 1X5XA 2X4SB 5KANI 1NMCC 1T89A 4JPVL 2WBJA 5LQBL 2RCSL 2EE2A 5L88L 4R0LC 4KK5D 3OPZL 1X44A 3SDCD 2FEEL 3OQ3B 4K3GA 5MEPB 3JTSA 1WIOA 3OB8A 3FMGL 1T03H 2X6MA 3K8LA 5I1GH 5MHSE 4KROB 4DEPC 4PRIE 3QIUA 1MRFH 3MXVH 3DGCR 3EYQC 5C09D 2X4PB 2HFGH 3RWDB 4POZC 1TJGH 5EBLA 2VDKH 5EZLA 1RUPL 1T1YA 1HXYA 4ZFFB 1YEHL 4A6YB 4K7FA 4LL9A 3FN9A 1NSNL 4UDUA 3U4EB 3CLEL 1LO3L 3ABZA 5JZ7D 4NJ9L 5EZJB 3EW3B 4P2OD 4CN4A 1ZXQA 4D0BB 4MMXC 3OAZH 3X12B 2OR8A 2NNAB 1NUDA 5I1KL 1P69B 1SBSL 3T2NL 3CK0L 3RY4A 5GZND 3DVNA 1MRDH 2WINA 3WS6A 1QRNA 1DUYB 3MLWH 3JWOC 1E4XH 1LP9B 1QBBA 4F7CB 4LP4A 2X1PA 2FECL 3MV9E 2PYED 3LSOB 3ZKXB 4YNYA 3F5WA 5FECA 5BRZA 4PJGA 4P5TD 2L7UA 3OX8B 4UQ3A 5EU6B 1GJIA 2OK0H 4G3YH 1ONQA 3MA7A 1T0NB 4IDJL 2AXFA 1FCCA 3VFUA 1Q94A 2EDOA 5MP6H 1RSFA 5IB1A 3L3HB 3LIZH 5T1KB 3VFNB 4FNLL 2MPAH 1ZVSB 1IGTB 3FTGB 3GSRA 3VGBA 3QBTB 5TE7H 2YD7A 1J05B 3W9DB 3T77A 4Z0XB 3UMTA 3W11D 5CWSB 3WJJC 2NMSA 5EUKB 3OWEA 1EPFA 3KPRA 3TVMA 3IFOA 2AXGB 3SQOL 1DUYA 4DKEL 2ICWI 1IL1A 5HGDA 2FLBT 1E4JA 1N8ZA 3MCG1 4XP5L 2XWBA 2VO5A 5IJVB 4HFUH 2R2BA 2CUMA 4ODXB 1S7TA 4C56E 4KPHL 2X4UB 2FHFA 3DUSB 3OKOB 3J8F7 4KK8C 3PIQB 1TCMA 2J3SA 5E2VL 4XX1G 5FDWB 3LKNA 2YPLD 2DQJH 3N1QC 3PXHA 3BGAA 4YQXH 5T1MB 2JJTA 5AAMA 3L1OH 4HWBL 3AM8A 3QUYA 5H35B 4HS3A 1KTLB 3L5HA 2WWKT 4ZOEA 3SDXA 1G0XA 4X6CA 4A2LA 2NXYC 3NZ8A 1FFOB 1KLGB 3O45A 3RRQA 1D5ZA 1EHLH 3CU7A 4U0RB 2AP2A 1TVHA 2WBKA 3RWDA 1R3JB 3CX2A 2EH7L 4ZXBB 1IM9D 4PG9B 4OCSH 1AFVH 1XF5A 4ONFH 3PL6B 2R2HA 1F3RB 4L3AA 3QDMD 3ISWA 2ZCLL 1R0AL 5HYJD 1PY4A 5C0FA 5CD5C 4Y1AB 1E6OH 1LO0H 4JFXA 2FBJH 1P6FA 1OAKH 1OM3L 2I07A 2R69L 2UWEB 4IOIA 2Y6SC 1CIUA 4P2YA 4AG4H 4K3EL 5ACZA 2FHBA 4DTGL 4L8BB 3TVMB 3DSFL 4HFWA 1A6TA 4XCFL 5DRXB 5I18L 3QXAB 2CPCA 1QD0A 4PRPE 4Y16B 4POYA 4O51B 1LO0L 3HE7D 3MRGA 5AYUL 5EB9A 3QFJD 4RMTA 4ACPA 5TF1L 1HK6A 1MH5B 3L3HA 2J8OA 2VDNH 1FRGL 1Q94B 3PV6A 4X9FA 4ONFL 3UAJD 1KFAL 2IGFL 5HHPB 1AO7E 5HTSA 4PBWD 5ITBH 4R4NC 4AEIL 4J3VA 4YXLL 3F5WB 3ULSB 1KCRH 2ADIA 4Y4KB 4XMLL 2BNQB 2WSKA 5HYIA 1BZQK 1DZBA 2E7LA 5E8OB 3EDJA 2BFVL 1R5VB 1TJIH 4HPOH 1FH5H 4JRXA 3GI8L 2GTWB 4GW5A 3B4NA 2V2TB 4PJXA 5TDOA 3MRDA 4OBSA 5C08A 3STZB 2EIDA 4PJFB 4XCCH 5C0IB 3WNNA 3SCMA 5E7BA 1YNLL 3TNMA 5L8JB 2P8MA 3VWJB 4KZEL 1ZGLP 2XKSA 3HC4H 1V8HA 3F12A 1QNZL 5JOFA 3G08B 4MD4B 4EXKA 4GKSA 4BUHA 5I1CH 4EI5D 5DMKA 3MRHB 3QPXL 4WTZG 2EDYA 3BE1H 3RGVB 3TCLA 1FAIL 5IVNA 2DN7A 1ZS8B 2GCYB 3MA7B 4PRDB 2X4TB 1MLCB 2HT2C 5GJTL 5FGSA 3C5SA 3BD4A 5CGYD 5JMRA 1P7QA 2VXSL 4J23A 1L9MA 1Q0YH 2AV1B 1IKNC 4N0YH 2MPAL 1EEYA 1F6AB 4HUNB 3RA7H 2D7TL 2HTLD 3MJ7A 1H5BB 5CZVL 2V5YA 1RIUH 3JBG7 3K1DA 4Y2DD 2B2XL 3ARBB 5D7IA 4WHYH 5BJTA 1JWUB 3GNML 4DFIA 1T22A 1E4XL 4PJBE 4KI5F 4TQEH 4D0CA 4GQ9H 5T1LB 1AR1D 1TJHH 2UUDK 3I6KA 3KLHC 4DK6A 2BJMH 4JFFB 1HH6B 1JE6A 1KN4L 3CK0H 4PTTB 1IGFL 3UTPD 4NDMB 1WBZB 3SCMD 2D31B 3QHFH 5TFSH 1DBBH 3EDDA 3QUYB 1JYNA 1MWAH 2EYRA 3TO2B 5C1MB 4ZOBA 4HZAA 5C0RL 3FT4A 3OBAA 4FFZH 3NIDE 4YAQA 3LKOB 4JREB 5I8EB 4GS7B 1W72H 2OLDA 5D7KE 3KPQA 4MQSB 2YRPA 4I77H 3WLWC 1CFSA 3O6KL 3WFCL 2X05A 1MFCH 1R3HB 5CBAB 4G8EA 5D6CA 1S5HA 1TDQA 1RZ7L 2ZUVA 3AU1B 3IDJA 2MWCA 2R0LL 3S8WA 2AXJA 1CTOA 3T0VA 5SWZD 3W9DA 4O2EB 2CKNA 1MHEB 3KGRA 1YY8A 2FYYA 3MGTA 3MRIA 4Q6YA 3SDAD 4PB0H 4PJ8A 4NO2B 4ONHA 5FKAB 3VD5A 2R1XA 3B9KD 5IB3A 4X4XB 1IAIL 1T0NA 5SV3A 5GRYA 1I1AD 4AEHL 2CSPA 5ICZA 3TBWB 2O5XH 5DK2B 5FUOH 4HAGA 3FO0H 2H8PB 4Y4FB 1QR4A 4KHTH 2FEDC 4XI5D 4I2XE 4N1EA 2A6DA 1Z9OA 2HH0H 4GRWB 4YHKL 1NEUA 1SJXA 3IFLL 1DQLL 5KG9B 4FFYL 4Z5RA 2BNRE 4GSDL 4UV4L 2I5YH 2AK4D 3RZCB 2YEZA 3BKMH 4FABH 1AC0A 2GJ6D 1SM3L 4CVUA 2VL5A 2IMMA 2BVUA 1PQZA 3FQXA 1RJYA 3RX8A 4ZXBD 3RUGA 4ZFFA 2PYEB 1FFQA 4Q6IA 2ZCHH 5HYSA 4JQIL 4UOJA 3BPOC 3SGEH 3KPMA 5C09E 4LASL 2BDNL 4HDIA 1FJ1B 2VXTH 1TPXB 1L7IH 2RHEA 4ZAKD 3OXSA 1AY1H 1XF1A 5DJDA 4PGEB 4PTUA 3IYLW 1MJ7H 1FZKA 1NCWL 5EUOF 4JRWA 3T0AA 1AJ7H 4DGIL 2YMXL 3VXUD 1IC1A 5SWSE 1LDPH 5KS9F 5JO5A 4X7CC 2CMRL 2LAGB 3F62A 3QG6A 3RUGE 3QIBC 3ORJA 1G6RA 3GDBA 3AB0C 4PS4H 5T3XL 1QBMH 4PRHD 1JCKA 1CGWA 1KF9B 2Y6SD 4J4PC 5E8EB 2EE6A 4Y8AA 4GJTB 3MV9D 3TNNA 3IDXL 1JWUA 1FZOB 4LCYA 4U1MB 1B4JL 1IGIL 3RVVC 1J0KA 3UTOA 5ALCH 1CQYA 4P57A 4OF3A 4IIQC 1CGUA 1FSKB 2J4WH 5D2NE 1BMGA 2B5IC 1S78D 5EIIB 4AIZA 2O61A 4JFDA 3JTTB 5A3IC 3ULUF 5J1AB 3N9GH 3FB6B 4EUPH 4CVZA 4ENEC 4O9HL 4Y4HA 5F7FA 3OAUL 2DQHL 3A0OA 2CDGA 1DBML 3D39A 1X5GA 4HG4K 2IQ9L 4JCMA 5ICYA 1II4E 1FNEA 2PYEA 3EZJB 3OAZK 4LCIL 5JOFB 2FH6A 3T08A 4M1DH 1KT2B 4Z7WE 3ALPA 5DJAA 3GMRB 3T3ME 2JIXD 2H1PL 1NH6A 3MCKA 1Z0MA 2VMFA 1T20B 3C6SB 3CGTA 4ODHL 5JOEA 3RZCA 4H1LB 3PWNA 3OTTA 1EAPB 3GGWB 1KJVA 2H26B 1CBVL 2A77H 3R4DA 4PJXF 5DMYA 2DQIH 1GHFL 3BDBA 3JVGA 2A6KA 1A6ZB 1JF1B 5CIPA 1HHHB 1R24B 3O9WD 2J6EA 4P46C 3ULSA 1B2WH 1FIGL 3KPLA 3IRPX 2YRZA 3MO1B 4B41A 4TRPH 2CIKB 3KVQA 4NRZB 5GRWA 3P73B 1GC1L 2OZ4A 1LILA 3ARFA 5F9JA 1TJIL 1MCKA 1DUZA 4PRBA 5FUOL 1FO0A 3WBDA 4NM8H 3HAEH 4IRSC 4E5XA 4NKIL 4XNQB 5ACMA 4AEIH 2RFXB 3ARXA 4OLWH 3S96B 5KSVA 4ZTPH 3L95A 1U92A 3LRSA 3WXWL 5T3ZL 1UM6H 1R3HA 3HZMA 4PRID 4PRPD 4LQFH 5AYUH 2GJJA 4PUBL 3KPQB 1DFBH 1HILB 5E1HB 4M02A 5BV7L 3E8UL 2Z35A 3CFBA 4H0IA 4BQ9A 2XIDA 3QNZA 3PABB 3LPFA 2V2XA 1N5YH 1I7UB 2HVJA 3QAZC 2DJUA 5GGSA 1JHKL 4XPTH 3QDMB 3WEXA 3ME0A 5FB8B 1AXSA 4XAWH 5D1XC 4RAHA 2NY5H 5EOTA 2HJLA 1NMAL 3QNYB 1OP5H 3ARPA 5IHZB 2GJZA 3VXQA 3BD5A 2D7QA 2BC4B 3BPCB 5E8DL 5DMIH 5JHDD 5B39A 3SDYH 4Y2DB 3EOAB 1BLNB 1PEWA 5J06A 4NC1C 5J13B 4OCWL 4OF8A 2EEAA 4P59L 1TJHL 1JN6B 3WDHA 1SJVA 3SKNB 2A38A 3X14B 3RY5A 1EEYB 3N0PB 1XIWD 3PWVB 4PLKC 3OGOE 1LNUA 3TZVD 1ERNA 2VLJB 4PPTA 4UTBL 1YQ2A 3UX9B 1OPGH 4YHOL 2ZUXA 4G8GB 2X4RB 1J0IA 2VITA 1IILE 4YEFA 1Z9LA 4QT5B 3NH7L 2GTZA 3GKWH 3UTZB 4R7DB 1HXMA 2AKRA 5I17A 3FRUB 1U8NB 5EO1B 1GGTA 1QSFB 3ESVF 4U31A 1BZ9B 4JE4B 4YHPB 1OB1B 3KWWA 1PX3A 1F11A 1FVCB 3QWQB 2HMIC 4FQ1H 3DHMA 4OSUH 1JHKH 4EKXA 4OCRH 5DEFB 3VXOB 4MQ7A 1OAYL 3MRDB 4LSRL 4Z7NF 1NAKH 4HMDA 3MRFB 5IHUL 5FKPA 4PGBB 4ZUSA 4P3WA 1NUNB 2MFNA 4YHZH 4EVNB 1DLFL 3S36L 4ZS7H 4PRNB 1VFUA 2X4QA 4N9OB 1T6VN 1I85C 5DJ6B 2ORBH 4F7EA 3WUWA 4LSDA 2DKSA 4QHMA 4OLWL 4XNZC 5GS1B 4FN0A 1SJHA 3VFRB 4NJAH 3B3IA 5AWNL 2XN9A 3MRGB 3CSGA 4ZD3L 4L8DB 4ZUWB 4Y16A 2ORBL 2JJTC 2A74B 4MA7L 4BKLB 1MFBH 4Y2OA 3WO4C 4P5MA 5DZLA 3WHE0 2C3VA 5EZIL 4K3JH 2JIXA 5C8JB 4NZDA 2WBJB 5JIPA 4WU5B 4Q7DA 1ZHNA 1OSZB 3V6BR 3BZDA 3O4LB 4LFHD 3RVWC 1ZHBB 4XGZB 1NAMH 3WUWB 1OGAD 1U95B 2D4DA 4IMLB 4WI8A 4X6DF 1RIHL 4NSKA 5CINL 2XQYK 4GW4A 5I16A 1CD8A 1JRHI 4YDIH 1SYSA 3V9FA 5FYLD 2AJSL 4GRWE 2O5YH 3OJMB 3VFMA 1CF8L 3BD3A 4WUUB 1OTSD 4N0CC 2DIJA 1XIWA 1A7QL 3MUHL 4G9FB 3QPQD 5KSAC 3ARFD 3B5GA 3ZE2F 3MR9A 1GGBH 3QNXA 4UTBH 3LQZA 4E41B 1PDKA 4CDGC 4XVUD 2NY7H 1CE6B 3GFUA 3TIEB 2MKLC 5TPWL 5EO1A 3IDNB 3GK8L 2CXKA 3V0AC 1FDLH 4P2RA 5FO9B 2VZUA 3CUPA 4WFGE 3G6DL 1NGXB 3PQYD 2ZJSH 5SWQB 1VERA 1CE1H 4G9DB 3LKPB 4P59H 3ULVH 1A22B 4FQXB 4PRIA 1CXKA 4LPWA 2AJYH 1B4JH 5T5NF 2ARJQ 3T8XA 1D9KD 4OFKA 1T21A 3ZHDA 2CLVA 4XP5H 5KW9H 3B2UC 1JHLL 3VXPB 1IFHH 4BZ1L 3ECBB 3K2UL 3WIHH 2R0ZL 3H9ZA 4LLUA 5DR5H 3OZ9L 4WUUE 3VXUE 2NY5L 4WRLA 5F7DA 4GW1A 4ZSOE 4FQCL 2AEQH 3MXWH 4ODVL 3UXFA 4G8FB 5F88B 5LAXB 1E28B 3F7PC 1U42A 4MWFA 1YNTA 5JPMA 3NCYS 1NL0H 4JDVA 1AGEA 5D1QC 5DJCA 3U4AA 3VD3A 3MV8E 2YSSA 3H3KA 3EOBB 3MRLA 1XGPA 4ALAL 1QBAA 3HG1B 4ODBD 5ADPL 5JO5B 5E9DD 5DQDH 3RL1B 4BH7A 4L1HA 1CGSL 3AS2A 1QOKA 4YHIB 3MLVL 4J3UA 4HLZH 4U49A 2VQ1B 4PJ8C 2Y06L 3MNZB 2E5EA 1GGYA 5CSZA 1Z5LA 5FAAA 1W8NA 1T80A 2KDGA 4XPGL 4JFHD 4I18A 5BW7C 2B0SL 4TYUA 3CZFA 3KS0H 1CD9B 1IAOB 3OXSB 4GUPB 4WIQA 5E0QA 1MCEA 2XRAL 5DVKA 1EH9A 1HXYB 4MDJB 3RAJL 1OGAA 5D7LD 2BSSB 3BKML 1GC1H 2W0LA 3V4UL 1AQDB 1SYVA 1HINH 4FZ8L 1FG2B 4GAYA 4GSDH 1KCSH 4LVOC 2QJDA 1MCWW 4RMUA 2OTWA 2EDKA 3VWJC 2A6IA 3FO2A 3QIWC 3MNZA 3KYMB 2EDWA 5T1KD 2ICEB 4Z95H 3BXNB 1QLRB 3VCLB 5GZOC 5IIEB 5K9OB 4GKNA 4OD2B 2W65B 1QRKA 3O8XC 3HPLB 4WHTB 3BUYB 3AGVA 1Z0NA 1JWMA 5JPMB 4KMLB 1T5XB 2ZG2A 2FD6L 1KJMA 4X6DE 1RV6X 2NY6C 4OZIE 1YPZB 4H88L 3PF2A 4HIXL 4RNRA 4NO0B 1KJVB 1YY9C 1RULH 3U48A 1MCPL 3VFGH 4ENED 1KN2L 5TDNB 3O9WC 4P46D 3SN6N 1ZLUK 1MHEA 3BYYA 2ZSVB 1IBGL 3L7EA 1GIGL 1C8PA 4C83A 5M7QA 4XZUA 5D6DC 3ARRA 4L9DA 4DGVL 2WUCL 3BHBA 2FO4B 3RWFB 3BUYA 4JRXD 4G8EB 5D6CB 5FYLH 3VD7A 4RFNB 5GGRY 12E8H 1S3KH 3S5LB 2VLKE 2Y5TA 3LB6D 1ROWA 2Y9RT 1HYSC 5LXGH 2EZ0C 3PWUA 4XNZB 3P0GB 2V6HA 3M17A 4R97B 3ARGD 1IEBA 1O7VA 5I8OL 1XR9B 3KPSE 4X6DB 2ZSVA 1MHPL 3L7EB 3S6CA 2YK1L 3U6RB 3V7AE 5GISH 2P7TB 4NUJB 4YHYB 2ZKHL 4D8PA 2L7JA 4LCYB 4L4TA 5CJBA 5D7SL 4XXCC 1U8KB 5MEQA 1BVKB 3O6LH 4Y4KC 4MNHB 1NCCH 4XNUL 4WI6A 5DHYA 3EJYC 5IMOA 5HGBA 3H3PH 4PRHE 3UO1L 2CKBH 5JHDE 2J6EL 1VGKB 3T0BA 3P2TA 4XRCB 2VXTL 3EFDL 4YHIA 1JPSH 2D2OA 3MJ7B 1A8JH 5A2FA 1F6AA 4QXWA 3ARGC 5DHVH 1DBJH 4UU9B 1XGPB 2DI7A 5FYJH 5A40E 4MYWB 4PFEA 5C0BE 4HZLB 2OTWB 3C5SB 5J9PA 1NLDH 2VLJE 3FZUD 3UJTH 5IVXA 3KDMA 4XPHH 4OLZH 1IGYB 4JM2D 3V5DA 3TCLB 3HE6B 1U2CA 4YIQA 1T1WB 4MD0B 2JELH 1ETZB 4MCYA 2ENYA 5AG8A 1DQLH 1SBBA 8CGTA 5TQ0L 3BGMA 4Q0XH 4BK4A 5E94B 4N0CD 1KUMA 1G7JB 1EMTH 1FORH 3MLZL 2Z31C 4OLYH 5BVJA 1Z5LB 4ZTOH 4YC2B 4ORZC 3ZKQD 2FDBP 1RHHB 2VQ1A 4DVBA 1JZ5A 1BEYL 4K94L 4PJ7A 3H9SD 2XQBH 2R8SH 2AABH 3E2HC 4AEFA 3LZFH 4U1SA 4JDTH 4RMWA 5J3HC 2R4SL 2EZ0D 3ZTJG 5KZCB 5C08D 3JV4A 4OQTL 4N9GB 3LRGA 2PTVA 5KVDL 3SDAA 5CINH 3KLHD 2R0LH 5D2LF 4OZGB 3WS3A 1IM3A 4JVUA 1RZFL 3K1KC 2HA1A 3DX6B 4A6YH 1MCSA 4TUJB 1DSFL 7FABL 4CAGA 3DYPA 3MGTB 1UGNA 4LKCB 2UVFA 5EU7C 4Y5YA 2QSQA 4LFHG 5I1AA 3NCEB 4MLSA 5H37G 3H8NA 5LGKA 3A6BH 2BSTB 3PWPE 3P9MB 2UWEA 1A1NB 3U30C 2L0DA 1FP5A 2W65A 3EYOA 4LCWB 4JFOB 2MHAB 3TPKA 5C0FB 2CJUH 2VZ3A 2DAVA 1ZT4A 4G6ML 1GL4B 2PN5A 3ILQC 2C3WA 1QACA 32C2B 2F5AL 2ICEA 2XACC 3KYOB 1RUKH 3C2AH 1VA9A 4BKLA 4NQVA 3QNXB 5IT2L 1V3JA 4I48A 5A16B 4JFEB 1JYWA 3WFZA 1UWGH 3LEYL 3O6ML 4NDMA 4QWWD 5EH1A 1JYVA 1A7RH 3LV3A 2KUTA 2DMBA 3SJVE 4G7YH 5CGYC 3SDDA 2AGJL 4MVBC 4OBRA 3WD5L 2XY1A 3MLSH 5T1LA 1NCDH 2X9WA 5D1ZB 3MODH 4CU8A 4PREB 1GCFA 2EDRA 4J4PA 4F8QA 3BZ4A 3RWEA 1FAIH 5IJVA 3RQ3A 4BH7B 1QO3A 4D0DB 1N8ZB 3RNQB 3FOLA 4IM8A 4GMTH 1A6UH 1UWXH 2IPTL 3FRPG 4LHUA 4XVSL 3S88L 3LOWA 3WD5H 1FQ9C 1S8DA 1T7VA 4NFDA 1VCAA 1YEEH 1A7RL 4PJFF 1YNLH 1QSFA 3L3KA 5DT1L 5GGTH 5KSBA 1N3NB 1ZS8A 3FRUA 5D96C 3ARDB 4K9EC 1KTDB 4IHOA 4PLOB 1JGEA 4X7FC 4KRPC 5EPMB 1MCHA 4YDLC 1EHNA 1BGXH 1NEZB 3ZHLA 1M05A 4JFDD 3IDGB 3O3UN 5DJYA 2ICWB 3T1FB 1FL5A 5CD3B 2VLJA 3MLUL 5DQ9A 1HHHA 1R24A 1V5JA 2AJZB 1LP9A 3R06A 5FYJE 2DQCH 2CK0H 4AYFA 1RJLA 4UT9L 4TVSa 3NBNA 4AJ0A 1ZHLA 1Q0XH 5JUEH 4ORGA 3GSWB 4YR6B 3I50L 5HVGB 5DGRA 1PKQA 4NKQB 3ELAT 4PRHA 1T1ZB 5I8KH 4X99B 1X3DA 3EOAA 1HOCA 4P9HC 3NPZB 4KTEH 4DJMA 1FFPB 2BVPA 3QDGB 2LABA 3L3GB 3SKUD 4P4KB 4V2CB 3WIHL 4ZPVA 1YEDA 4G6JH 1RJZB 2E6JA 2X4PA 4FQQA 4CVZB 3LKRA 4NO0D 3VG9B 4KJQC 5KOVC 2DL9A 3FT3B 3HZKB 2XTLA 3O3AA 4G8IB 4RFOH 1OP3H 4MNGB 5DURB 3QNZB 1LGVA 4I0CC 3RPIA 2N1KA 4Z7VA 3D3VA 2EDFA 1H3GA 4QCIA 3MTRA 3EYSH 3JWDL 1OSZA 4JRYD 1CVSC 4LVNB 3MUY1 5EU3A 5JW3H 5EN2A 4AL8L 2DQEH 1B0GB 3B43A 4YFLI 4APQB 2HTLC 1H15A 4K2UL 3L95B 1XT5A 3NTCL 5CFHA 5KSVB 3NCCB 5E2VH 2WIIA 4MD5A 4LHUB 3MROB 1G6RB 1VDGA 3FOLB 4FQJH 4BZYA 3WIFB 1GHFH 3NCFB 2Y36H 4EBQL 2BXZA 5HYQA 3ARFB 3MRKA 3BWAB 3TH2T 4HUVA 4YHNB 2CIKA 1CQKA 5EOCL 4K7PX 1OP3K 1MCOH 3FJTA 4F7EB 5KSBE 1N26A 4I0KA 4L8SA 3NGBC 5EU5A 4OZFB 4MAYC 3ZYZA 3Q0HA 4F33B 3MNWA 3S35H 5C71A 4L3EE 3VW3L 2ICWJ 1AE6H 4P2OA 3RVXD 5IBTL 1J11A 4QRRD 2QQQA 3MGOA 3RGVC 5FYJD 3C5JA 1R3LB 1X5IA 4MAUL 4MQ7B 4NZJA 4OFVA 1KPUB 5E9DB 4JY6A 2RFXA 1YZZA 2AI0L 4MJ4A 4K7PL 4Z6AT 3PG2A 5HVFB 3O6FB 1C5DA 3IDYB 4Z77B 2DQCL 3GSRB 5HYJE 1OAXH 1FN4B 5HD8C 5KVFL 3RBSA 4Z7UB 5EO0B 1BAFL 1MHPH 3VFNA 1VPOH 3U4BH 4TTDD 1MVUB 1OAUH 3FQTB 1ZT4B 1Q9OA 3CNKA 1UXSA 2A6DB 3KPNB 1QFHA 4WO4C 1DL7L 2K7QA 3ARED 3OX8A 5EU6A 5LCVL 5A2IH 4U3CA 4X83A 1YEIL 2PKDA 2ATPB 4JANA 3VXTA 4JFDB 4WEBL 1S5IH 4LPYA 4N5ED 2ITCB 1GZQA 2OJZL 3K4AA 4L3EB 4Z0BL 3UTQB 2LE9A 4EI5B 1YEEL 1LD9B 4XVUC 4GAJL 3NCBB 4V1DB 5IVZB 5BQ7B 4HK0B 3GMQA 3VFTA 5I75B 1ES0A 4TUJA 1GZPB 1AGDB 1INEL 2NW3A 3S9DB 4L29B 2BX5A 2NNAA 1QHOA 5E9DE 5HGGS 5KVEH 3BGFB 3PUCA 1LK2A 1JIBA 3C09C 4OV6F 1UWXK 3GMRA 3AB0B 2NY3B 3PGFL 4N9GA 1YYLH 1DVFB 1DJSA 4HBCH 2HLFD 4JFHE 3NH7H 2H32B 4YE4L 3QWRD 4K71B 4XAKD 2JJVA 2RCSH 2ZUQC 3HMXL 1NC2D 3CC5B 2G60H 4ONOA 3WN5C 3KS0J 5E99L 1ZK9A 2IAMD 4DVBB 5BVPL 3RVUD 3KYKH 2NY0B 3C5ZC 4FQHA 3QEGL 5DS8B 3O0RH 2Z92B 4TVPL 1KCUH 3B8SA 3TO2A 3QXVA 4RZCB 2HJFB 2DBLH 1I7ZA 4XPBL 4DN3H 3DV4B 2EDQA 4S0SD 5HY9A 4WTXA 3INUH 3RL2B 4HIJB 4IRJD 3P4OA 1WTLA 1HH6A 3BN3B 2R2EA 2HT4C 4Z7VE 4NRYA 3ZKMC 2VZTA 5ETUB 1CYGA 3BISA 4O2FA 4GG6B 2Q76B 4XBPA 3FCTA 2YD3A 4K23H 3V4PH 4HKXA 3IETA 1X5AA 1XZ0A 2C4XA 4S1QH 4D94A 1HNGA 2Z8RA 2XRAH 5FV1L 3UBXI 5C2BL 4JPKH 3ARBA 5D7IB 4ZUVA 3UBXA 3ZKND 1EVTC 4MHHI 3TJHD 4F37F 3I9GL 3HI5L 2VLKA 5KVMC 5HHXL 1A6WL 4Q9QL 3CSPA 3QB7C 1U8QB 1WAAA 5DJDB 1NC2A 3UTPE 2C7UB 1ND0A 4U0RC 4YFEA 3GMNA 5HHVH 1T2QH 1MVUA 1EZVY 4D8PB 3HN3A 1EAPA 2OCFD 3GGWA 4JRXE 5HVWA 4PJ8B 4ERSH 1V3MA 3AREA 4KRLB 4OKVB 2CLRB 3FFCD 1TTUA 4TULL 2QHLA 1N2RB 4XX1E 5D7LA 4OFPA 1MHHA 4DOHE 1KSRA 5SX4H 3IDJB 2XZAL 3SKMB 4BZ1H 3VG9C 1XFPA 2RBLA 1IAKB 3T4AB 3LMJH 4PJ5E 3TYGH 1FO0L 2Y5TB 1IGFH 4QTHA 2UWEE 1I8IB 1QYGL 4NQCB 2JELL 4Y4HB 1HSAA 3TH3T 3BKYH 2DICA 5DK2A 1KB5A 1XF2B 4N90E 2E7BA 1FGNH 2VLLB 1JGUL 5C0JA 3VXNA 3PV6B 5D70L 2AJVH 4YHLL 4EDWH 4K7PH 1FDLL 2UY7A 5GS2D 5AAWA 4XNMB 4MJ5A 4ONHB 5FYJU 3WIFA 1YN7B 1QVOB 3JVGC 2CDEB 5JTWA 3ZT7A 5DUBB 3MX0A 4MAUH 1PGRB 2DQGH 2VISB 1KB5L 3I6KB 1QSEA 4X6FB 4P46A 5L7XH 4BFGA 5GJSL 4N0YL 4D0CB 4TUKL 3UO1H 4KY1H 3BDYL 3MOBL 3O41A 2O5YL 3MRMA 1EO7A 4JKKA 3VXMB 1KYOK 3EO9L 2IQ9H 5B4MD 4YC2C 2PO6B 3QH3A 1TQBC 3AMLA 5C0GA 2OS7A 2EICA 2P47B 1BFSA 5EFIB 3VD9A 5MEND 4MMZC 4NN7B 4G7VL 3ARZA 3HKFA 3UTQA 4XWGL 2NR6D 5D70H 4OFIA 1BD2E 3MYJA 5B38G 5JDJA 1X7QA 1AI1L 3RI5F 4JO4H 4NHUA 2HTKD 5F6HJ 4OV5B 4UNTA 5FXCH 4LCWE 5ILTL 2BSED 1HKFA 4ZSOA 4C56A 3MSPA 4FXGA 5IQ9A 4NUGH 2DM2A 3MRBB 4OQTA 4LMQE 3SDCA 1ZVYA 4J2XA 1R5WA 3CDGA 3H9SE 3IXAA 1GOGA 5DEGA 5AWNH 4M61B 3VWJA 1ZSDA 5SWSD 2NXZB 3QUMH 5C08E 2R0KL 4IJ3B 4JO3H 1DVFC 5E9DA 1S7TB 5AUMB 1BWMA 1ES0B 3IF1B 3DXAD 4DKFL 1R3LA 4HHAA 1JF5A 1RURL 1U6AH 4KMQA 3CXDL 4PJ9C 3UCRA 1CG9B 4F7MB 4Y4HD 2BNRB 3D85A 4RMSA 1E6JL 3QEUA 5HHVL 3QQ9C 4PD4K 3MJ8B 2GY7B 3U1SL 4MJ2A 3EFFB 2IH1A 3S4SG 1PG7L 5I75C 4YXKH 2F5BL 4F33A 2W59A 1IT9H 3QXTA 5I18H 2WV3A 3SE3A 5JW5A 5IHUH 1JYXA 1CDCA 4FQIH 4JM2C 1M05B 1FNGB 4BH8A 1J1XL 4QHLA 4OIIH 1FL3B 4RA3A 2FHCA 4PJ7E 1I1AC 3TVMC 3VXRE 4KROD 1P7KB 1R0AH 2ZCKH 1VACA 4X80L 2NXZC 5CEZE 4C59B 2CLVB 1T21B 2FECI 2YUWA 4TSAH 2A0LC 4F7CA 4IOSD 1L9NA 1JNNH 2F58H 3L7FA 1F3JA 4JZOB 4PJ9B 4UV4H 4YDLB 3L5XH 3RUGF 1Q1JL 4NQSA 2CUHA 5IFHL 2RIKA 3TBTB 2X4NB 4WDIB 4YO0B 2GITB 1UJ3A 4R6UA 4Q74A 3QA3A 4TSAL 5D1ZA 3DTXA 5EUOA 4PR5B 4PB9L 1C12A 1NFDF 2XWTB 4X5XB 1RJZA 1T1YB 5FA4B 1YJDH 4KU1A 3UTTB 3ESUF 3ES6B 3VH8B 3PL6C 1X5KA 4OZHE 3MRQB 1T1XA 25C8H 1HDMB 3IFPB 2HT4D 2VN7A 3TYFA 4Q2ZB 1HH9A 5L0QB 4LGSB 4OI8A 5KSAB 1JZ6A 3OJ2C 5ACZB 3DECA 5KJRL 3V8OA 2ARWA 1B0GA 1QSEE 3FO9B 1WGOA 3MOAH 5F89B 3PHQA 4S1DD 3AY4A 5GRUH 3IDIA 4MS8D 4LSQL 2AEQL 3MXWL 4ODVH 1U58A 2SEBA 3PHQB 2C3VB 3MLRL 2MQCA 1CLZH 2HFTA 2RGSA 3NIGE 3ZT5A 1NKRA 3A67H 1Q72L 4JY5H 1MEXL 4JFDE 3HNVH 2ARJA 3MUZ1 1FVDA 2ITDA 1OWRM 5IFJB 2A83A 4TOYL 1HDMA 3IFPA 5F9WC 3WNOA 4LEOA 1A6VH 1FZJB 1KN4H 5DRZA 3C08H 1RY7B 1IMHC 3DMMC 1FFOA 1WWWX 1A1OA 4Y5XB 5GSRA 4WY7H 2HT3D 4K55A 4PGDA 3ULVL 4HS3B 4WVRA 4UNVA 4QHLB 5IBLC 1MQKH 2ZUWA 4NQED 1MRCH 4JFPA 1ONQB 4BH8B 1MWAA 4O02H 4DZ8B 4J3XA 3VFWA 3GNMH 1S7UB 4BA8A 3DPBA 5C0IA 4UMGA 2D7OA 5HI5D 1CI5A 1MY5A 2HJKA 5C0EA 43C9A 4PYHA 3GO1H 3TT1L 1JK8A 4M7LH 5C0CE 1P4LA 3WDIA 3BZFA 3LQAC 1TJGL 3SOBL 1S9WB 5L6YL 2G5BB 4M7JH 4JLRB 3NIFF 2LFGA 2VXSH 2YA2A 1FLTX 4AEEA 2NY5C 2NZIA 3TM6A 5GJTH 3BUTA 2O26U 1HWHB 2YWZA 3PXJA 1JJUA 5JQ6H 1NEZA 1W8OA 4FQ2H 4WI7A 1TLKA 4OF6A 2IH3B 2NTFA 4UT6H 4JFQA 2GSIA 4LDOB 1UENA 2NXYD 1V7ML 3LHPL 3HLAA 4OLUH 2VITB 5F7MC 4IOFD 4QXGH 1JI1A 2Z31B 4DW2H 3ARDD 4HC1H 5K9KA 2ARJB 1K5NB 1F02I 1EO8L 3KLDA 4F58L 1FZMB 1HE7A 4Z7OF 1UACH 1TNNA 4O4YH 4BSWB 2KH2B 4KJYB 5D7IE 5TH2B 4OLYL 3ZTNH 3WIHA 3VXRA 1MFEL 4OT1L 3G6AA 1MLBB 2YC1A 2BNUA 5GGRA 5GGUB 3O4OB 5DRWA 2FJHB 3RY6C 5T1DL 2JJUA 5CZXC 5AYQA 1BLNA 1XCQB 4D9QD 2XKUA 3GMMA 3L3DB 3ZKNC 5KSAA 1MY7A 1OGTB 4PG9A 1UZ8A 3UJJH 4OJFL 3DRTB 3RDTC 4N8VA 5IHZA 4L4VA 3LMJL 3MOQA 4WI2A 2P7TA 2A1WL 3QRFM 4X0KB 1FNLA 2XXCB 5T3XH 2OR9H 4LVHC 2GUOB 4FFWD 5DVOA 2DKMA 5DMGC 2XOTA 4WGWB 1I9EA 4HH9A 1T4KB 2GITA 4AIXA 3KPRD 4HGWA 1J10A 3B2VL 1NFIA 1UT9A 2ED7A 2JJSA 5HHMD 5ADOH 4U1NA 5DGQA 3S5LG 1HYSD 5FGCB 3VXMA 1WFTA 2Q7YA 4M5ZL 5D9SB 4UB0H 4WJ5B