3L5JA

Crystal structure of fniii domains of human gp130 (domains 4-6)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
288
structure length
283
Chain Sequence
EDRPSKAPSFWYKIDPYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin-6 receptor subunit beta
publication title Crystal structure of the entire ectodomain of gp130: insights into the molecular assembly of the tall cytokine receptor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 283
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5jA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5jA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5jA03
3ROLB 2VKXA 1I3GH 3JVGA 2I9LA 1N6QH 3M1BB 4CVWA 1OF2B 2FJGA 1UJ3B 3UZQA 4MX7B 8CGTA 2IANA 3LIZH 5JW4M 1RUML 3UP1A 2PN5A 5E0QA 1F42A 2BRQA 2Q8AL 2V7NB 4CJ0A 1J0HA 4ZS7H 4N68A 4NO0B 1HHGA 2AJZA 2AV1B 4L8BA 2QR0B 1XZ0A 5F3HB 2FYYB 4MB5A 2I5YH 1A0QH 4RGND 1IKNC 2YPLA 2FBJH 2ADIA 4V1DE 2D0HA 4AEHL 2DBLL 2EIEA 4NQCB 4JZJA 5CJXC 1QBML 1TQBC 4G7YL 3TBSB 1XIWC 3U36B 2Y5EA 1A14H 3TYFA 4DGVL 1HQRB 1Q9LA 3BKYH 5EO9B 3NA9L 2P5WA 5L0QC 1GGCL 3MV8B 4N8CH 4XPTL 4TOYH 4KK8D 3X12A 3IDIA 4YDIH 2YPLD 5E8EB 4H0HB 2EXYD 1RIHH 4L8SA 4XNZC 1CS6A 1HHJA 3QQ4A 3O6FB 3L3OA 1JUFA 5LG1A 4H1LG 4M7ZC 3E6FB 5IFAH 4WHTA 1I9RH 1ES0A 2CRYA 1ACYL 5T3XL 3SGDH 2ZZUT 1IC5H 4UT6L 1JPFB 25C8H 4G8IB 4LAQL 5L88H 1E6JH 4P3CL 4QWWD 2G5BB 1BFOB 4PGEB 5F3BB 4S2SB 3LKPB 3MRLA 3HPJB 1SY6H 3WHE0 3FB5B 3GO1L 2IG2H 1QSZA 2DQDH 5EFIA 4LLWA 4JM2B 3HCVB 4JFHD 1LP9F 3I02B 3X11A 4V1DB 9CGTA 1KT2B 5KN5B 1KPUB 4MAYB 4Q9QL 4HC1A 1HINH 2EH7L 4PLKC 3QPXL 5HI4D 1RD6A 4Z7QE 1H5BB 1W72B 2DIAA 4J1UB 5C07A 1XF5A 2VDNL 3LEVH 3VFPB 1WV7T 1NMBH 4IMKC 1E6OL 5KVEH 4Z0BL 3CLEL 2VXUH 3GMOA 3G5ZA 5FIEA 2YUZA 5GRJH 4M9OA 4B7IA 1F6LL 5C6TL 2B7DT 4HEPG 4GKSA 4JG0L 2VSCA 5MEOB 2BHYA 4XNUL 4IMLA 3LSOA 5C07D 4XMLL 1IGIH 2QADB 2ZCLH 1A6AA 3WNOA 3N50A 3SQOH 1JCKA 2DWEA 1IGMH 1IC1A 2AV7B 2EXYC 4LDEB 3C09C 2A6DA 3SJVE 3RP1A 1OTTD 3ESUF 4PRPE 1FZMB 4OJFH 1PYWA 3QUKB 3QG6A 2Z8WC 2PW2A 2DLIA 3BUTA 2DS4A 3ARRA 4I18A 5CGTA 1MPAL 3EFFA 3RUGA 1T04B 4PGBA 2NXYD 4TTDD 1Y18A 3BP4B 1MCCA 4ZQKA 5BRZA 4L8SC 2F8VA 5ESQB 3IFOB 3LQAC 4R8WL 2PKDA 4JO3L 4OZHF 1IFHL 2Q76B 2J12B 2Z91B 1FV1A 3DV4B 4FP8L 3WXVH 3R1GL 4XI5C 4WENB 3BQUA 1RZGB 4KRNA 3TIDA 3VGBA 2AVGA 3TN0A 2J2ZA 5T1MB 4NJAL 1U8LB 2OXHA 2D7QA 2HN7A 5BRZD 3WHXA 1MAKA 5D6CB 1U2CA 4K8RD 1A6TA 2DDQL 3PGFH 4DKFH 2J4WH 2Z31A 2ZKHL 3BQUD 3WNPA 1CFNA 4KRPD 2P8PB 3TN0D 3MRIB 4BSVA 4JZNB 1UA6H 4QRPB 3BZDA 4P9HH 2D31B 3JSSA 4NQEE 4FQ1H 5FF6B 2WLYA 5E9DA 3QA3B 4HQQH 3NFNB 2R4SH 3MJ7A 5HHQA 1CDCA 3ARFC 4ZUSB 3G6JA 5CWSB 5EZJB 4HH9A 1CDIA 1ZGLP 3IXAB 3K7UA 2NYYD 1LEKA 3V0AC 4QY8A 1UZ8B 4Z7OF 3D9AH 2NZ9C 1EEYA 4L9LC 4F37K 4PJFA 4R4NC 5E9DD 2XKUA 3FQWA 2GUOA 3GK8H 1ED3B 3P9LB 4MNQE 3LPGA 3QDGB 4TTDC 5HYQB 2NXYC 1K2DA 4XPBH 1I3GL 4RFOH 5EZLB 3C6LA 3UBXG 1N6QL 4OSUH 3MBEB 3ZT7A 4JKKA 2VB5A 1HHKB 1E4KA 1I9EA 1I1YB 3LIZL 2PCPA 3QHTC 3QO1B 5IVXE 4BFEA 1BD2E 3QXUA 5DD0H 2W1NA 4R6UA 4S1QH 4FMFA 4CNIB 4HUUB 4JY4A 3OKEB 3CFBB 3UROR 4ZS7L 4I18C 2N56A 5FA3A 3CH1A 3IFPA 5ICYA 5I1EL 3C6LD 2VLJE 2IH1B 2FATL 2V2WB 4LKXA 2I5YL 1A0QL 4OLZH 4P5TC 2FBJL 4Y8AA 5IHUH 4K8RC 2R1WB 1VPOH 5C70A 4FXKB 3K74B 4J8RA 4PTUB 1OGAB 2VRAA 3BQUC 3IU3B 5I6XB 1XGUA 1WGOA 2FEEL 1X5IA 3RPIA 2Z0BA 4YDIL 2GTWB 2CSPA 4QGTA 5SX5K 3LEYL 3S96B 4MNQB 2Z31C 1JZ5A 3P4OB 1CGSH 1HNGA 4GBXD 1I3RA 1KB5B 3OX8A 5IFAL 3H7BA 1F58L 5FA4B 1I9RL 5EZOH 5IR1B 3HR5A 4ONFH 5ISZE 3MGOA 3MXWH 4WW1A 2OM5A 1YJDH 2ATPB 1N59A 4OBRA 5IVXB 1XT5A 5L88L 1E6JL 1BD2B 3MNWA 2AQ2A 5JUEH 1HYSD 1JYXA 5J57B 3SDCB 4HX1B 1AIFB 1FFOA 2BOCB 1SY6L 5JPNB 2BXYA 1AR1D 1K8DB 4QRTB 1Z6JT 3ARVA 2DQDL 2VLJB 4OFPA 3SE3A 5ANMA 2BOBA 3F6LA 1A21A 2AKRA 4NBXB 4KQ4H 3SBWC 3BN9D 1UKQA 2DMCA 5HJ3B 4NN6B 5HHOE 1D9KA 4YPGA 5MHSE 5J4MA 5IBUB 3LKNA 1HINL 4MD4A 2X9WA 2FJHB 3IF1A 3BX7C 4WWKB 1JZ6A 2GJJA 3TO4A 1MNUH 3LEVL 1I8IB 1NMBL 3TVMB 4PYHA 1OW0A 5KVEL 1T2QH 2BCKA 2Y06H 1M71A 5GRJL 1D9KD 2R0KH 4CMMA 4GXUM 4EKXA 5JXEA 4IDJH 5ISZB 1NCUA 1YPZB 3DIFB 3TO4D 3TH4T 1IGIL 4P2QA 2ZCLL 3SQOL 5DFWH 3WXWH 1IGML 1AP2B 2Q1EA 3AB0C 4PD4K 1MCNA 2VZOA 3LEXB 2OYPA 1ERNA 1ND0B 5JXED 5LVEA 4O58H 4OJFL 1G0XA 2QQKL 1NANI 1MWAB 4PJ5E 1MCKA 4JGUA 4R0LB 2O61A 3QDME 3ARGA 3SGEI 3QFDB 4P2QD 2J8UF 4WY7H 1P2CB 3V2AR 4CKVX 3QQ9C 2HRLA 5IROA 4PTTA 3QBTB 4MB4A 4PJBF 1E0OB 4ONHA 2DI8A 5DRNA 3GSNH 4ZO8A 1AR1C 5KS9A 4U1IB 1IQDB 3ARGD 1JPGB 3HLAB 3OJDA 5AG9A 3H42H 3LAFA 5ID1A 2BDNH 3G5XB 3BN9C 3P0GB 1N6VA 2KQMA 2NX5E 3QPQD 1YYLH 1F6AA 1QNZH 2VTFA 4DKFL 2J4WL 1X7QA 1SEQH 3IDYB 2GIYA 5HVHC 2QSQA 1R3IL 1ACZA 1LP9A 1HN1A 2QKIB 5D2LF 3NBNA 4GXVH 1PZ5A 1N0LA 1UA6L 1ZLSH 3VXTB 1KTDB 4X7DC 4Z78B 4P9HL 3U6RA 2IMNA 2ZUYA 5L6YH 3QDMB 4ENED 3BO8B 5LGHH 4ZOBA 3TO4C 4HQQL 2R4SL 5EUOA 3R8BB 1OW0C 3MYJA 3D6GA 2H9GB 1J9CT 4PRHA 3GRWH 4J3SA 4ODTH 1CL7I 1JV5B 5JXEC 3D9AL 3CZFA 3MRCB 4F15B 3W11D 1MFBL 3AM8A 4AY0A 4EOWH 3GK8L 3CU1A 1P4IH 4NUGH 2BNRA 5BMFH 1AGCB 3OKOA 4RFOL 3K2UH 4HPOH 2NX5B 4OSUL 4MZ3A 3S88H 4PRHD 4PV8A 3S4SA 2VDPH 1ZSDB 2XNAB 3HUJA 2XWJA 3EOBA 3ZSSA 5DD0L 4LLAA 5FGCE 4S1QL 3D3VA 2CJUH 3FFCB 3BRGC 3G08A 2XYCA 1ZGLA 3OKKB 2NY3B 3DX6B 2BNRD 1QD0A 2GFBA 2A73A 5IROC 2X4QB 5JIPA 5TF1H 4PJDE 5CJOH 3VGDA 4OLZL 2EC9T 2H32B 1Q1JH 4MJIB 4WI6A 5IHUL 3JTSA 2ZUTA 3D3VD 4L4VA 4QEGA 1MUJB 4X6EA 3BIKA 4HJGB 2YSSB 3CD4A 1S7RB 4X7CC 5DA4A 4UOW1 1DBKL 2EDDA 5B4MD 5K9JH 3DROB 5ITBL 1T5XA 2P7TB 1J0KA 2NY7L 4YC2B 5IJKC 2D9QB 3BOVA 5I1LB 4YQXH 4F57H 3EIFA 4YJZL 3BPLB 1I3UA 1CGSL 5CBAB 1YEHH 2GKIA 2M8XA 2AQ1A 4XXCA 4YZFF 3I75B 5EZOL 4ONFL 5FO7B 4XPFH 3MXWL 2RIKA 2P44B 1YJDL 3O8XA 3KPQB 3TFKD 5KSBB 1DEEA 4LLYA 3ZYJA 4KV5E 3W39B 2EYTA 5FGCB 5DJYB 5JUEL 2HJFA 4NQDA 5J11B 5SWQA 1AQDB 1FFPA 2BX5A 1CFTB 3TBYA 4MSWB 4RGNB 1MCEA 3MCKB 2VJXA 5GSVA 5C6PB 4MWFA 1F97A 3DTXB 3K1DA 4OF6A 1I1FA 2NTFA 4EI5A 3O8XD 4HKBA 5CZKA 3VGEA 4ELME 5TE6H 3V7AG 3TZVA 4NQDD 2ITCA 2YD9A 5IB4A 4P2RA 3AM8C 5JOEA 1ZTXH 1ORSB 4XNMA 3MRKB 5FUCC 4LOUD 1A1OB 1MJJB 5E56A 5I8OL 1YA5A 4ODBD 2YA0A 3KJ4B 2C3HA 1MNUL 3QIBA 4EI5D 3EYOB 2FRGP 4JZJB 3CNKA 4NPYA 1T2QL 3TYFB 5I15H 3TZVD 2R0KL 3T0BA 3V5KB 2EYRA 4P2RD 1KUMA 3KHOA 5F7HA 1FP5A 4IEFB 4ZFOB 2ZP0T 4IDJL 2E7LA 1UC6A 1KJ3L 3VRIA 1TVBA 1I1AC 3QIBD 3VMPA 5K9KB 4RWYH 4RFEA 3WXWL 4GAYA 4WHTB 1NLDH 3FT2B 1ES0B 4WCYL 3I6KA 2BERA 3DURB 3P30H 2D03H 4Y4KA 3IETB 1CFVH 1NCBH 2LE9A 3QFJA 4O58L 2MSPA 4ZPTB 4QHKI 3MA9H 4QF1B 5E4EB 1O7SA 4FQIH 5F88A 4ELMB 3RVTD 4GMSH 3BD3A 3MRLB 1XAUA 4WY7L 5CEXB 3GSWB 5KSAB 4HFWA 4OF5A 3EOAA 4ZAKB 3SDAC 5DD3H 3GSNL 1QFUH 4Y4KD 4S1RH 5AUMB 3QFJD 3DUHA 3VI3E 3E6HB 4XXCC 3RKPA 1IARB 5KVFH 2NNAA 1UCBL 3MYZA 1JI2A 3ULSA 1K4DA 5GS0H 4OLVL 3H42L 3O8XC 5IJVA 2BDNL 5SWZA 1NCCH 3WN5B 1HWHB 5KSVB 1F4XH 4LBEB 4HIIB 1C7TA 4NO2A 2XRAH 1YYLL 4CVZB 4NDMA 3BXNA 4WDIA 4JDTH 1QNZL 4LOUC 4OFYA 4H0GA 2EICA 3V0WH 4G8FA 4QYOB 1UWEH 4I3GA 4LLVA 1AC6A 4U1HA 3TPUA 4NZRH 4EI5C 1BLNA 4OCYH 3MRDB 4GKSB 5IB5A 4YO0B 1INQA 2YMXH 4GXVL 3LSOB 4LEXH 5SWZD 3TZVC 3MUJA 1T5WA 4N8PA 1NBVH 1QQDB 1ZLSL 4GKZA 4D0DA 1LK3H 4OFYD 3ARYA 4P57A 1B9ZA 2I07A 5LGHL 1N3NB 3KWWA 4UUJB 4LSTH 3BVNA 4OV6F 1LD9A 1OP5H 1WTGT 1N8ZB 1HH9A 2OZ4A 3OV6A 4WHDA 1W8NA 3HB3C 5FFLA 3PGCA 4NIKB 3UAJC 3J8F7 3IDXH 3GRWL 4ODTL 2PW2B 4JDVB 3B5TA 3C9NB 1FZOA 1MHCB 2E7LC 3B2VL 4EOWL 4ZQKB 4HUWB 4Y5VB 4MCYA 3DGCR 2WZPD 5IWLA 4WV1B 3D39A 1E27A 3K2UL 4HPOL 3D69B 5HHXH 1U8IA 3L6FB 2VDPL 1MY5A 3NIGE 4JR9H 4Y4KC 4KRPB 1G9MH 4QLRA 4CBPA 2CJUL 4GRLA 4QHLB 3WNLA 2MQCA 4E5XA 3WHXB 1FZJB 1WZ1H 1J1PH 2J8UA 4M5YL 2X7LB 2YRPA 3D39D 4MXWH 3LKOA 5TF1L 3LRGA 3A6CH 1WJ3A 4FXGB 1QYGH 4PJBA 1GZPA 5D7IA 1XMWA 1CFNB 2VAAB 4WGVB 4XCYA 1F00I 1XR8B 3QUMH 3AS2A 3HE6C 4MA3B 4GRLD 4JJ5B 4OIAA 3VFOA 1NFDF 32C2A 3ARBA 2G2RA 3STLB 3KLDA 4PJ8B 5DWUH 3TPKA 1MHPH 1HXYB 4AEFA 1AKJA 3SCMA 1DLFH 3RZCC 2A83A 5H2BA 2CDFA 3DGGA 4YQXL 3CXHK 4FFVC 4F57L 3MLVH 1RUAH 1T3FB 3BD5A 1YEHL 1OTUC 4UBDC 3ARBD 4WI5A 4LQFH 4LPTA 4MD5A 4FNLH 4XPFL 4F7CA 1PKQA 3NPSB 4CADB 3QWOA 4PV9A 4NZJA 1QFWI 1AKJD 4YK4C 5LGJA 1RJLB 5BJTB 2M26A 2VYRE 1CE6A 4TVPD 1BIHA 4KUCD 5C08E 4PJHF 3UEZA 4PJEA 4DUWA 4PR5A 5INDB 4JREB 2EIDA 4JY4B 5TE6L 3B9DA 1JGVH 2HAZA 4O2EA 2OSLA 3VFWA 3U7WH 1A7QH 1ZTXL 3BEVA 4XX1E 5JQ6L 4HK0B 4LKXB 3KPNA 3PP4H 4O2FA 1IL1A 5DC0A 5DGRA 3F7YA 4GBXB 2J3SA 3G6AB 5C6WH 3QI9A 5I15L 4X6BA 4M8QB 1K3ZA 4NN5B 3GSQB 1EJOH 5DFVD 3DVNB 3CCHA 3ULVL 4GRLC 1ZHNB 2R9HD 3MRQB 1DN0A 5ICZA 5J13B 3TH3T 2IFGA 3RWEA 1KJVB 2V2TA 4RWYL 3OX8B 1X4YA 3GMMA 3TIEA 3H7BB 5ID0A 3QI9D 1NLDL 5KAQG 4HKXB 2A2QT 4KK9D 3P30L 5C08B 3B3IB 1R0AH 1NCBL 3UTSE 3ARBC 3MNWB 3MACH 3MA9L 4XCEA 1B0GB 3FB8A 1NAMA 4GMSL 2YPVH 3HC4H 4XH2A 4KU1A 1P53A 5SV3A 1TZIB 3TC9A 3SCMC 2E3VA 4Z7WF 1BJ8A 1JN6A 2ENSA 1AJ7H 5DD3L 4X4XB 1U8KA 5BS0E 4CDHA 1QFUL 4S1RL 3DVIA 3ULVF 5KVFL 4YPGB 4FQHB 2H2SD 5GS0L 4MD4B 3IF1B 4IRZH 5IQ9A 4WFEE 4ISVB 1NCCL 1S8DB 4WTZA 3TV3H 1F4XL 4EUPH 3UPRA 2IALB 4JHBA 2DB8A 4U2YA 5IMOB 1IGTB 4GKNA 4JDTL 4EZMA 1H8NA 3MXVH 4YE4H 3V0WL 1QLRB 2XQBL 4BFIA 5H37G 2NY6C 4NZRL 3MUGA 3FQNA 4Z76B 4OCYL 4LF3A 4NO5B 3DO7B 1EBAA 2YMXL 3H3PH 2PW1A 3C5JA 2J8HA 4Y2DA 4LEXL 5I8EB 4HG4J 3SE4A 3DOSA 3ABZA 3UTSB 1NBVL 4P2QB 3WS6A 2R9HC 4UQ2A 1R24B 3HMXH 3U7YH 2R15A 4LSTL 3T8XB 4Z77B 3CMOH 3CC5A 2FEDD 3QIWB 4YDJA 1UG9A 3SPVA 3E1F1 1DQML 3QI9C 4Y2DD 5DD1H 5BS0B 3IDXL 4LCCB 3K8KA 4CN6A 4XP1H 2EEAA 1S7SB 5BXFB 5C0EA 3ARGB 1IILE 4P9HC 4K9EH 4CL7A 1KGCD 3X3FH 2R2BB 4E9LA 3GGWA 2X1XR 4S1DD 2OL3H 1KG0B 2C5DC 1F4WH 1HH6B 4XMKL 5HHXL 3DHMA 5FUOH 2VWEE 4PJAF 1H3VA 4JR9L 5MEPB 5B38A 1G7JA 1G9ML 1OLLA 1NC4B 4W6YB 1WZ1L 1ZVSB 2E9IA 2PXYA 1V8HA 3CVHA 1RZ7H 1J1PL 3JV4A 5DK3A 5E1HB 5TGBA 1D5BB 1XF2B 4PYGA 4JJHA 2ITDB 1JZ8A 1G0DA 4K07A 4MXWL 1X7QB 4AH2B 1UH3A 1QYGL 2XPGB 3KGRA 1SYVA 1KNOA 3WSQH 4YHMH 2DICA 3QAZB 3QUML 1EHLH 1D5MB 5DRXA 1FL3B 1T66D 4LSDA 3ZDYE 2PXYD 3S6CA 3QXAA 2ICEB 1JYNA 3U6RB 4MXVF 5DWUL 1Q9WA 5IEHB 1IKFH 4LL9A 1GAFH 4YHNA 2BMKA 4KTDH 4H1LH 2Q7NA 4GJTB 1DLFL 5EUOB 5F21B 2BSSA 3QUYB 3MO1B 5GGUB 1FAKT 4G43A 4R97B 1ZT7B 1K5NA 1RUAL 3O2VL 1U8MB 3TWCL 1JWUB 2FEDC 1MJ8H 4LQFL 2B5IB 1HK6A 4FNLL 3CZFB 2NY1B 4Y2DC 1BP3B 1NMCB 2JK5B 1MIMH 3BIBX 1YUHB 3BHBB 1T83A 2L4OA 4KI5E 1FAIH 1EAJA 3BZFA 4KFZC 3PHQA 3EOBB 1W0VA 4Z18A 5B3JF 3GIZH 5HGDA 1YJDC 1NDMA 2OMBA 3L3DA 3G08B 1JGVL 4X5LA 3BWAA 4OZGF 3T3MF 4G9DB 3U7WL 2VL5A 3QSKB 2GFBB 1LNUA 1C16A 1DUZA 5EU3B 5H8DA 3PP4L 1HYRC 4KDTA 1T21B 1JGEA 2BSRA 5DJ2A 4X4YA 1HKLH 3JTSB 5CP7B 4J23A 3WIHA 4X6EB 4R9HA 4XAKE 4UINH 1YEDA 2IFFH 1YMHB 2VISA 1EJOL 1BQHB 4TUOB 2PTTB 1EJ6A 4IOFD 5JO5A 1HQ4A 5M7QA 4BKLB 4KDVA 4C4KT 3AUVA 3UTQA 1GGTA 2ERJC 5DQDH 3P4NA 2GJ6A 5EO1A 4LSRH 1JP5A 1H9VA 1LHZA 3KYKH 1J86A 3O41A 4IRJA 1R0AL 5DQJB 3DSNA 4S1SH 1FVDA 2DD8H 3LKQA 1VADA 4NQDB 4RISH 2W38A 1X6NA 5DFTA 2GJ6D 3UTPE 3HNTH 1UACH 4XT1C 2FX8H 5J7CC 5KSUA 3NZHH 4Y1AA 5T5NF 2DQFA 4MWFB 4IRJD 2A9MH 2CKBH 1I1FB 2NTFB 3ZTJG 4I8DA 5DT1L 5A43C 3BPOB 4HUNB 3NTCH 5E6ID 4P2OB 1FL5A 4HUKB 1KPVB 2FH8A 4IRZL 4ZNCD 1T83C 1DVFD 4Y1AD 2B1HH 4Z7UB 2ICWI 2Y23A 3HHRB 1DBMH 1XFPA 1MQ8A 1KLUB 4OZIA 3MXVL 4YE4L 1YY8A 3VD4A 1QP1A 2VQ1B 5L9DH 3BT2L 2QQNH 4XB7A 3ZDZE 3QG7L 3H3PL 4WU7B 2XZQH 1EFQA 2P47B 4OI9A 5E1AA 1JWSA 1TVBB 3VXQA 3RU8H 4JO4H 1IM9A 5IM7A 4OLXL 4WW2A 3HMXL 4KDTC 3U7YL 3EFDH 5ALBH 4HLJA 1AY1H 4OAWB 4DZBA 2RFXB 4PGDA 1G7PA 4NYLA 1A3RH 1X5XA 3CMOL 1FO0B 3I6KB 1ZT1B 2R2EA 3HAEG 4O2CB 4ORZC 5DD1L 3OHXA 4XP1L 5E2UH 4U49A 3RY5A 4GW5A 4OCSH 2VLLA 5CKGA 2VXVH 1ITCA 4K9EL 1IM9D 4CAGA 3KYMA 3X3FL 5C0NC 3KYOB 5DS8B 3VU2A 4HD9A 2OL3L 4OBSA 1ROWA 5CFHA 1A1MA 5HGGS 4KC3B 4N0UE 1EEZA 1F4WL 4JM4H 3FB6A 2BJMH 4U6VH 1T1XA 1V3JA 1ITBB 1EA9C 2YWYA 2I25N 3E0GA 3U9UA 3MV7E 3U30C 4MYWB 4NCDA 1T89A 1AGBB 2E6JA 2E7HA 3BESR 5LCVL 4JFFA 4Z7VE 2VITA 3KPOA 1RZ7L 3BXNB 1MVFA 1LEGB 4WDIB 5C2BH 4ODVH 3TA3C 3FFDB 1TZGH 1CDHA 1X5ZA 1QUNA 2A6JB 2YXMA 3WSQL 1Q72H 4YHML 1CT8A 1JGLL 3RWDA 4RMQA 1EHLL 4FA8A 1A6WH 4Z95H 3FRUA 3C5SB 3UMTA 5HYSA 1T5WB 3WUWA 2JF1A 2SEBB 4WJ5A 4P57B 1IKFL 1GAFL 4ZUWA 3OKDB 1OARH 4D9QD 3J7HA 2XY2A 3W9EA 3V5HA 3VFSB 5IMKB 2YK1H 1HH9B 3JTTA 3GEWB 4LLMA 1CXHA 2WAHA 3RVUC 3ULVD 5D2NC 1CLOH 4N0UB 1UZ6F 3VWJB 1MJ8L 5CJQL 3E8UH 1G1CA 1YMMA 3HE7B 2LAAA 4KXZI 3S5LB 3ALXA 4MA1C 1RJZB 1GOGA 2IPKB 1MCOH 4I5BB 1R5IA 5D72H 3D39B 1CVRA 1FAIL 4JG1L 4Z7VB 2UVFA 1T80A 1E28B 3AMLA 4UNTA 1MIEH 1Q9OA 1U95A 2X89A 3IAGC 4PJGF 3PWVA 4JFQB 3GIZL 2KZWA 1CLZH 1MCDA 4X6FA 4OGAD 1TNNA 2UYLB 5D96B 3SGKA 1QBLH 5FKPA 3VXRA 4DCQB 3MA7A 4BH7A 1OWWA 5AG8A 5D7LE 1NJ9B 2X89D 1EUTA 1HKLL 2AJSH 2ORBH 5C0AB 1Z2KA 1FG2B 2ZOLB 3B2UD 5HBBA 5ACZB 3V52H 4YUEL 1WAAF 4UINL 5GJSH 4TNWF 3VXRD 4BK4A 3TLRA 1T89C 3MRBB 4OIIL 4U1NB 3KPSA 1AKJB 4POYA 1T1YB 4O02H 5DQDL 4W68A 1Y0LA 3K8LA 2A9NH 4LSRL 2VZ1A 3EYQD 2VDLH 1JNNH 1M4KA 3L5IA 3KYKL 1GC1H 3QHZH 3FQTA 3RKDC 1PKQB 3ULVC 2XTJC 1NGZB 3QIUB 5IVZB 4S1SL 2DD8L 2HTLC 3KPSD 1CXFA 4DEPB 5LGJB 5DA0B 5TE7H 3PHOB 4RISL 1YQ2A 4X5XB 5EBWB 4PLNC 4NN7C 1F8TH 3O3AA 2UUDK 1CE6B 3HNTL 1UACL 2EKJA 2Z93B 4X98A 4D8PA 2HJLB 2FHFA 5IK3A 5I8KH 3NZHL 1H3WM 2FL5A 4PJEB 1AO7E 2YD6A 1J11A 1QZ1A 2CKBL 5D7LB 1TDQA 2W0LA 4I2XE 1TJIH 3NTCL 5TJWK 4LHUA 4OV5A 3Q2CA 3BEVB 3TJHD 1FDLH 2ARWA 4OGAC 3PWLA 3UTZA 5T1LD 3TCLB 4LNRA 3FQRB 3X3GH 5TFSH 1QLEH 2B1HL 2XT1B 1DBML 1RZ8A 1CGVA 5D1XA 4KMTH 2ARJQ 1JE6A 5HY9B 1M7DB 5IV2B 4X6BB 1BWMA 5L9DL 3JV5A 4LHUD 3P3YA 4GG6E 4J3XA 2Z92A 5BO1H 3ZT5A 1Q94A 5DDHA 3L3HA 1CBVL 3OAZH 3HZVA 3U0PA 3KXFA 5ICZB 3P11H 3D2UA 5DD6A 3RU8L 4JO4L 3QNYA 4N9OB 2V2TB 1EO7A 3GMMB 3EFDL 2I26N 2HH0L 5ID0B 3BP6A 1IAKA 1RUPH 1OSZA 5H94B 3NIDF 1A3RL 1YY9C 1CLYH 3EDKA 5EUKA 4NCC2 2V5YA 4TNVF 1DBJH 3KXFD 2XWBB 3B8SA 4XCEB 1QRND 4OCSL 2VXVL 3L3GA 2W9DH 4I2XB 3NCMA 4EXKA 4UV7H 4XH2B 3GDBA 4AJ0A 2X4SB 1I3VA 1HEZA 4WTWA 3VFMA 2R8SH 4MXQD 3Q0HA 2WK2A 1KEGL 4FTVA 4MB3A 4A6YA 1AD0A 3UJTH 4JM4L 4JPIA 2BJML 4U6VL 2X4OA 3VFVA 5C0JB 1TETH 1WBYB 4GKOA 3F65A 4M1CC 3PL6C 4HS6B 3TT3H 4QT5A 1UENA 3V8CA 3D18B 5IQ9B 3VXSE 4HJ0C 3Q6FB 5EOTB 5ADOH 1YN6B 4PBWD 1X6LA 1FNAA 4JFDD 4LASH 2D4DA 4PRNB 1D5XB 4FTVD 1XCQA 5C2BL 3QDHA 2ED7A 2ARJB 2DWDB 4FABH 2L7JA 5IB1A 5F7KC 1Q72L 4HDIA 4GMTH 4LF3B 4D0CA 3GBNH 1G9MC 2H8PA 4C56A 1QBAA 3CXDL 3G5VA 1JTOA 3O11A 3MRGB 4J4PA 1BBJA 3VI4E 4WRLA 5T3ZD 3TBVB 2FWOB 2VLRA 3ZKQD 3TNNB 3WCYA 3QEUB 1MCPH 1H3TA 1OARL 1GSMA 2R39A 1YEKH 5D1XC 2YK1L 1BFVH 1NBZB 4X6DE 4C56D 1QRKA 1W0WA 2G60H 1ETZB 2GK0A 4GSDH 4J4PD 1CLOL 1WFTA 1AR2A 3KR3H 4LLUB 2VLRD 1A1NB 3E8UL 3GSOB 3HNVH 2AEIT 3VWKC 4CRPA 1GOHA 2R2HA 4L4TA 2DJSA 4G9FA 3FO9B 4NOBA 1G7IA 3SGDI 1ZAGA 1ZXQA 1JWMA 1MCOL 3UCRA 3VXSB 1G1YA 5D72L 3B6SB 3CFJA 2P8LA 4PB0L 5FYKE 1MIEL 3WBDA 4NKDA 3B4NA 1R3JB 1C08B 1U8OB 4HWBA 4NFBA 4NM8H 4JHZA 4L4TD 1QR1B 4G9FD 1CLZL 4JE4B 1QBLL 1Z9LA 2PXYB 1QSFA 5TGBB 3JV4B 4IJ3C 4PY7A 3GUTB 1K85A 2OXGA 5D7JB 3IXTB 3LOWA 5IOPA 5EIIA 3F7QA 3UC0H 2X70A 2Y5TB 2HMID 1KNOB 2V7HB 4U7SA 2P45B 2AJSL 2ORBL 3G9AB 1D3CA 3CFCH 3LHPL 1UM4H 5I74C 4X6DB 5HDBF 2NTSP 5GJSL 2GJZB 1QSFD 4LK4A 2VLKA 1V3KA 4X8JB 4U6YB 2XG5A 2P24B 5IW6A 1KJMA 4F7MA 3IS0X 2H6PB 3GJFA 4OFVA 2EKSA 3UPCA 1A3QA 4O02L 1JPST 2A9NL 4E0RA 2VDLL 5IUSA 1GC1L 3BZ4A 1LE9B 2IBZX 4RFNC 5IVOA 1MH5A 3NCCB 1A7PH 3OKLB 3P4MA 1JYWA 1ZA3B 5TE7L 1TQBB 3FRPA 4UTBH 2HWZH 2CKNA 5B8CB 5J6GA 1F8TL 2A74A 2YUXA 3WS3A 1CD1A 4XXDB 5I8KL 2UWEF 3BP7A 1J8HD 3ALWA 4FRWA 2KL6A 3OR7A 1W0VB 4R90H 3MLSH 1KN2H 2R0ZH 1NDMB 2IANE 3L9RA 2GEEA 1H3UA 1TJIL 4N0YH 1YYML 5E8PA 3QNXB 1VGKA 1FDLL 4QRSA 1JK8B 4ODWB 5E95B 3X3GL 3R06A 1QLEL 4FZ8H 5GISH 4TYUA 1KCUH 1KOAA 1HKFA 1T7XA 4KMTL 3VXPB 3PWNA 4U1JB 2LTQC 1CF8H 5M95B 3RY6C 5MERA 3SDDD 1NGQH 3SDXA 3U9PH 1U8NA 5E2TH 3IDJA 4WUUE 5JOPD 1NQBA 2WIIB 1VACA 2P5WE 1ZHBB 1AGDA 3P11L 4JFXB 4KK5C 2Y36H 3GB7B 5BVJA 5EO1B 1T22B 4M7KH 4HZAA 4NKOB 5ELIA 1P9MC 1RUPL 1S9YA 4DZ8B 5I1HH 4I0PA 3EJZC 1CLYL 1A7OL 3CJJA 2A6IA 1FVDB 3LD8B 5E6IB 4Z8FH 2W9DL 4FFWC 4UV7L 1VFBB 2CK0H 3IDMB 2PO6D 1U8PB 3CFIC 1DVFB 1FCGA 4YBLB 5K59F 2DQFB 4LSUH 4I0PD 3UJTL 5FAAA 4FS0A 1ADQH 1MFAL 5D70H 1X5AA 5GZNC 1DUYA 1FL5B 3UO1H 1U92B 4M7LT 2HG5B 3BPCB 4JFPA 4K9EC 3C09B 4ZOAA 5E70A 3TT3L 4JHWL 5C09E 5EU6E 5I66A 4LASL 2X4NA 4WUUB 1F4YL 4H8WH 2NW3B 3S4SG 5CEYA 3BWUC 1FYHB 4FABL 4IIQB 4N0RA 3TBWA 4GMTL 1DSFH 5J3HD 3GBNL 1A3LH 3MRFB 3N1MC 2F5BH 1FBIL 2F8OA 2O5YL 3S97C 4L5FH 3T0DA 1RK0B 3NZ8A 4NZDA 5C0GA 1PJ9A 3Q1SL 1MCPL 4WW2B 4JO1H 3ARUA 8FABB 1FYTA 1YEKL 4XAWL 1KPRA 1BFVL 3F62A 3LN5A 4GSDL 2G60L 5JORA 1CK0H 3H9HA 1NANH 4Y5YA 3QH3A 4F37F 1URLA 1C5BH 4YFEA 1M6OA 3HNVL 3H0TB 5MEQA 5H35A 3WO4B 1MCIA 1PX3A 2DTSA 4XP4H 4C59B 2AJVH 3M17A 3VFRB 3SDYH 4RNRA 3RVVC 3MRRA 3RVWD 4DN3H 5DHVB 1UVQA 5EU6B 5INCA 1NBYB 3HRZB 4Q97A 3IVKA 5ICXA 1A4JB 5KANI 2Q7YA 3GSVA 5I76B 1WIOA 5CZXD 1WWWX 2CPCA 4NM8L 3C6SA 1FE8H 1JIBA 4M1GL 3L3JB 3KDMB 5CJ8A 1DFBH 2W0FB 3MUZ1 3MFGB 3RRQA 3PV7A 1F13A 5C0CA 4XCCH 3UC0L 4QHKJ 3I50H 4L9LB 1E4WH 4DK3A 1XR9A 4UB0L 3F58H 3CFCL 5A3IC 4H88L 5FYLE 5HYSB 5J3HC 5F9WC 4NSKA 2E7CA 3HZYA 4TTGA 1QG3A 4LVHB 5C0CD 4K94C 4OGXH 4LVOB 3V5HB 4KROC 3CX5J 3D25A 4FQXA 3P0VH 5CBEA 4WFHD 1KCKA 2JELH 3HKFA 3D0LB 1BOGB 3PV6B 5F6IC 1CL7H 4BZYA 3BDYH 4DWHA 3KPRE 1A7PL 2NLJA 3F5WA 4UTBL 2HWZL 4HW6A 1UEMA 4FQXD 2XI9A 4LFHD 5CEZL 2FIKA 5DJDA 3CH8A 3L3KB 1FGNL 1KJ2B 2NY5C 5D5ME 5ESAA 1RPQA 4XCNB 5KW9H 4R90L 1OP9A 1KN2L 2J7LA 2R0ZL 3MLSL 5ETUA 3HPLA 3RQ3A 4JQVA 3H3BC 3LS5H 3LS4H 2CMRL 4HIJA 2CGRH 4N0YL 2OTWB 1FNGB 3MGTA 2DLHA 1BREA 2JCCF 4QRQA 1KYOK 4JKPH 1JGDA 4LGPB 1KCRH 4KZEH 4G3YH 4OCXH 5GISL 4FZ8L 3FN9A 1KCUL 5DMGC 1D5ZB 5H37H 4AIXA 2FH6A 1C12B 1R5VA 2BVUA 2RB8A 4IOSD 5HD8D 5C0BA 1A6ZB 2EE9A 5GIRB 5TDOA 2EDJA 1CF8L 2ESVE 4LLDB 4U0QB 3G6DH 3RWGA 1ZANH 1G7MB 1PX4A 1XF4B 1UB6B 2XFXB 1F3JB 4BQ9A 5DJAB 2VXQL 1D7FA 2AXFA 1NGQL 3QZWA 2EYSA 1A6VL 4U6HB 3U9PL 4X6CA 1NKRA 2W91A 4JAMB 4LCWA 4PJ7E 1G7LB 1HSBB 3WYRA 4DVRH 5C0BD 5FOBA 3KPRB 1EDQA 2YRZA 2Y36L 5HPOA 2DMKA 4M7KL 1QR4A 2LU7A 3FKUS 2HKFL 5B39B 3Q5TA 4J12A 1GOFA 1I7TA 1U93A 5I1HL 1BPVA 4KTEH 5D5MB 2R4RH 2DLFH 2HFEB 2OP4H 4CMHB 1FRGL 3EDEA 3GJEA 4AIZB 1QBBA 2Q86A 4K7FB 1BVKA 4LCWD 4Z8FL 4LVNB 3FO0H 5CP3A 3N1GC 4DGIH 5T1LB 2CK0L 3C2SA 4MDIA 1TPXB 1UXSA 5IK3B 4IOIA 4AT6A 1S7TB 2FL5B 4FQXC 1N5YH 4LSUL 4I4WB 4F3FA 1ADQL 1S9KC 2JJVA 1PQZB 4HWEH 2E9WA 3UO1L 2ESVB 3P9WB 5F1SA 4RZCB 2EDFA 3BPNB 4KKBD 4YDLC 4NNYA 4C55A 4HKZA 3VDCA 3EYSH 2O93L 4WI4A 4PJ7B 3QXDA 1FNEB 5DVKA 5B21A 1DSFL 4Y4FA 4J7RA 5FHAH 5DJZB 1A3LL 1CQYA 2F5BL 1NCNA 1WQVT 2NW2B 2ED9A 1W72L 4L5FL 35C8H 1QRNB 5E00B 5IB2A 3QUZA 2I9TB 4QRRE 3C8DA 4Y5XC 1SMOA 3VMNA 3TO2A 2O5ZH 1TQCB 4G80A 4QKXB 2FR4A 4JO1L 4P4KA 3T4YA 4EIGB 2DQHH 4PS4H 5HHNB 2F19H 1Q9KA 1EAPA 1SYSB 1TXKA 4W4OA 2JIXD 4JFYB 4EVNA 2BNQA 2C3GA 4PLJC 1CK0L 1MCRA 1QEWB 3JZ7A 3QUZD 4P2YA 3L3GB 1C5BL 5I1GH 3RWCA 3PQYA 2X1WL 4JM2F 2VZTA 4P4KD 4XP4L 2AJVL 4JFDB 3SDYL 4DN3L 1XGYH 2YOCA 3EHBD 4D0BB 4QXWA 5D93C 4TUKH 4JVPA 1PAMA 4A6YB 4OKDA 4XPGL 1NFIB 4RWHA 1MWAH 1U3HA 2BNQD 3V6FA 4YNYB 4OZFB 4ZG1A 4N1CA 1F11A 3W2DH 4R7NA 3PQYD 1AFVH 4QT5B 1BF8A 4U3CA 1FE8L 2F53E 4X83A 3ZE2E 4M93C 3T77A 4WTXA 4U1SB 1JGUH 1B3JA 3TBTA 1U3HD 5B22A 5F7DA 3N06B 2OJEB 1BX2B 4JRWA 4QRRB 3I50L 5EBGA 1E4WL 3EO0B 2RHEA 5F1OB 1CICA 3T0EE 2D4FA 1R3LA 4F2MA 4ZXBB 4XBGB 3G5VB 4PP1D 4D94A 4PPTA 1LP9E 4P5KB 1HSAB 5C9KA 4MA8L 4NQXB 1OLZA 5CKAA 1VSCA 4CDGC 2OK0H 5A2JH 5HYJE 4NHCH 4OGXL 1F3RB 1CICD 3CPLA 5GHWH 1DQJB 2JELL 3UPAA 5K9OB 2OLDA 3B43A 3L7EB 5GRVL 1KXTB 4QTHA 2VIRA 2WIMA 3D0VB 4Y4FC 5F8QC 3BKJH 3K3QA 5DMIH 3KLHD 5T3XE 4YAQA 15C8H 1CL7L 3HG1E 2YKLL 4L4TB 4G9FB 3BDYL 4Z7QF 3FMGL 5JW4Q 5E6YA 3QUZC 1G7IB 2F53B 1R6VA 3GMQA 1LO5A 3ZTJH 4XP9H 2P8LB 2X44D 5FUCE 4P59L 3AXLB 1NGYA 3EHBC 2XA8H 4NKDB 3BW9A 1QSVA 4JKMA 4RGMC 5E2JA 4BM7A 5KW9L 4KK6D 3ARDB 1T1WB 1FC1A 3LS5L 3T0EB 5FYKH 3LS4L 5I17A 2GT9A 2CGRL 4DW2H 5JHLH 4ZUTB 4ZYKA 3VE0B 2UZXB 1P4LB 1QSEE 3EOTH 4JKPL 1IAOA 3K4DA 5DUMH 3AROA 5IOPB 1OAXH 1KCRL 5BZWB 3CFKA 4NQVA 4EN3A 4KZEL 1KIQA 1HCVA 4OCXL 2CDGB 4YDVB 1QKZH 4QCIB 1CYGA 1G6RB 3S8WA 2BZDA 5HYJB 3KHQA 5FYJD 3B9EA 3SKOA 4OKVA 3H9SD 4M00A 1EEUA 1ZANL 5DO2D 4OZHE 1MVUA 2EH8H 2E6PA 4L4VE 1A4KA 4BQ6A 5J12C 4WTZG 2NMSA 3REVA 4EN3D 4R7DB 2Y7QA 2H32H 3HRPA 4F7MB 1I9IL 3HG1B 4ZO6A 4DVRL 2LAGB 4QXTA 5DJ8B 3WNKA 5FECA 1WTLA 3HAEH 3AU1B 4O4YH 3T1FA 1CICC 4ZUVB 4NQSA 1J8HB 3BZ4B 2CLVB 5CIPH 4LHQB 3ILQC 1N5AB 1ZS8B 3DMMA 4KTEL 2DTMH 2R4RL 4ESKA 2DLFL 2OP4L 3GI9H 2VN4A 5EULV 5GGTH 2X4UA 4DGIL 4MA7H 1KB5L 4PG9B 1UGNA 2WP3T 2H41A 5I0ZA 3SKMA 1QSEB 1FNHA 3GMLA 5IW3A 2DYPB 1C5DB 3CSYB 2VNCA 3P77B 3DMMD 1BHGA 5DQ9A 3ULUD 1I1AB 4XVJL 4X9HA 3EJYC 4HUXA 4KK6C 4HWEL 5JLZA 5CD3B 3S35X 3SDDB 5KTEL 5CUSL 2CH8A 5KANG 4QRSB 1JF1A 5C0DA 1VKXA 3C8KA 3ELAT 4OZHB 5FM8A 4Z7OE 3EZ8A 3R06B 5BVPH 4IS6A 3BH9B 3EYSL 4I9WD 5HHMB 3DX7A 5GGRB 5ESVB 1NEUA 3QP3A 4ERSH 1HHIB 3ZKMD 4IRSD 5EOQH 5B38G 3GMNA 1I7UA 5FHAL 4JY6A 3PABA 1RVFH 1U8NB 1MI5A 5DO2C 1RIUH 35C8L 1VACB 2D7MA 4PJCA 2WBJB 3QCUH 3HA0A 4D9RE 3RVXD 4EN3C 2PO6B 1AGEB 1I8LA 2DQHL 3JV6A 2F19L 1QHOA 4U6XA 5EU7C 4UOW0 4KKAC 1XGTB 1J0YA 3U2SB 1MI5D 3M8OL 5IFHH 3JWDH 5FYJU 3T1WA 1OWRM 3HC3H 4JLRA 2NY2C 4MMXC 3LQAH 3GBLA 2Q87A 4E41A 2G75B 3BE1H 4N90D 5I16B 2AXGA 3RDTA 3L5XH 5L7XH 4XVTH 1XGYL 4YDKH 1RU9H 4TUKL 1MWAL 3GKWH 2QQLH 4MJ2A 5IG7B 3OGOE 3PNWA 5CILH 1ZWIB 3HC0B 1TZHA 2OS7A 4FG6D 4WI8A 1EERB 2WUBH 2CRIA 5ERWA 5FDWA 3KNBA 1EIBA 1AFVL 3ROLA 1EO5A 1YEJL 1K6QH 3M1BA 1OF2A 1UJ3A 3BP5B 4MNGA 4MX7A 3RDTD 4Y7MA 4UU9B 4OGYH 1BVZA 1XGPB 3CFEA 1MF2L 4GQPH 1JGUL 2F15A 1L0QA 4GRMB 3LRSB 2V7NA 4ZFZB 4HC1H 1RUKH 3O9WB 3O4OC 4NO0A 1YPZF 2AV1A 2QR0A 1TVHA 4JQIL 3O0RH 3RWJB 2HFTA 4TVSa 4AEIH 3QO0B 4DKEL 4NQCA 2OK0L 2CRMA 5D9SA 3TBSA 3U36A 2X4RB 4NHCL 4Y16C 1HQRA 2ZWLT 4HAFA 3TP4A 1IGCL 4NO0D 2V2XB 5GHWL 1X5JA 3MV8A 4KKCC 3LRHA 5JHDE 5ECJE 2J6EA 2E5EA 1AH1A 3BKJL 2ICWJ 3FT4B 3K1KC 5DI8B 5DMIL 3WHE1 1M6OB 15C8L 3ZKND 3O6FA 4NQCD 5H35B 3ESVF 3T0WA 2A0LD 3E6FA 4NGHH 1G7HB 4LKCB 1I8LC 3MV8D 4GS7B 4G8IA 4RAVB 4P46C 4Q6IC 5FGBA 1KTLA 2EZ0C 2CIIB 2G5BA 4YFDB 1BFOA 4PGEA 3KPPA 5F3BA 4S2SA 3RZCB 3LKPA 3O6FD 3HPJA 4FG6C 3FB5A 1BIIB 2VMFA 4JRYE 4ZNEE 4HFUH 4K8RH 4JM2A 1O7VA 3EOTL 5DUML 3HCVA 3RDTC 3V4PH 4J3VA 3I02A 5L2KE 4MQTB 4V1DA 1KULA 1KT2A 5KN5A 3QDAA 4MAYA 1XR9B 4KGLA 3NGBC 1QKZL 2RAMA 4YK4B 4KMLB 2CDEB 3PDDA 5IW1B 1K4CB 1FZKA 4KTYA 2YD8A 1PSKH 2XA3A 1H5BA 3MBXL 1W72A 1RK1B 2OTUB 4J1UA 4DVBB 1OCWH 3U46A 4OI7A 2X40A 2EH8L 1GL4B 4JM2D 3VFPA 5JHDB 2UVEA 1NH6A 5JXAL 3BGFB 4I77H 4KKLD 2BSTB 3V4VH 4V1DD 3WL9B 1A6UH 5ADPH 5FYLH 1ZLUH 4EDWH 4MAYD 2D7TH 1SQ2N 4DGYH 3QUXD 5CBEB 1C1EH 5MEOA 3MLUH 4O4YL 5HYIA 3GIVB 2GYSA 2F74B 5DJ0B 3TH2T 4ODHH 2DTML 4NO3B 3GI9L 2EXWC 3PWPB 1IGJB 1MCHA 5GGTL 2AV7A 4DN4H 5D2LE 1F3DJ 1FL6A 4MJ6B 3MRNB 1GXEA 3FOMB 4HLZG 4MA7L 4JRYB 3PP3K 1FZMA 5DJDB 1OOAA 2A0LC 2AK1L 3QUKA 5C9JB 5IMMB 1J10A 3GSRB 5L2KB 4HJJH 1RZFH 2QADD 5IEKB 2KPNA 2H3NA 1RHHB 3B5GA 4D2NA 3BP4A 4QRUB 5ESQA 3O6FC 3U0TB 3IFOA 1PG7L 5GGSY 3MV11 3DV4A 2Z91A 1P69B 1FJ1B 2IADB 2B1AH 1RZGA 1R5VB 3DX9B 3NCBB 5E8DL 5T1MA 4ERSL 2YEZB 1DE4B 3VXNB 2AJYH 4HBCL 5EOQL 1ONQB 3DARA 3RWHB 1RAMA 1LO4H 4X6CB 5DHXB 3AFLA 1RVFL 1RIUL 3CZJA 5E5RB 3V79C 2JTDA 3SOBH 4JM2C 5EO0B 3QCUL 5HHPB 3DRQB 2HLAB 2P8PA 4KKLC 4ONGH 4WGWB 3MRIA 5D2LB 1NAKH 3SO3B 5EG6C 4JZNA 5KSBF 4PRPA 1WBZB 4M6NH 4MMZC 4QRPA 4XPAH 2D31A 1DQLH 5FF6A 3FOLB 1H5BC 1MHEB 5HYSG 5IFHL 3JWDL 3QA3A 3WUWG 3HC3L 5DRZB 2GITB 3NFNA 1BVKB 4ZUSA 4XWGH 4LNVA 5CWSA 5EZJA 2FBOJ 3NN8B 5I1DB 3IXAA 3TJEH 1HE7A 2ZNXA 1NEZB 4HPYH 3V6OE 5L7XL 4F7EA 3MR9B 4PRPD 4YDKL 1UZ8A 3FHQA 1RU9L 5F7LB 4F3FB 1KIPB 5GSRB 3GKWL 2QQLL 5FO8B 4KRMB 5CILL 4MS8D 2MCG1 3WFCH 4ORGA 4NJ9H 1X44A 3P9LA 2CO6B 2WUBL 2QADC 5HYQA 5EZLA 1LWRA 4YZFE 4RMVA 1B0WA 2IQ9H 4MJ4A 3MBEA 1K6QL 3SQBA 3C60D 4NNYB 1AHWC 1HHKA 4PJXE 3QO1A 1I1YA 4OGYL 1EO8H 4KDWA 1OAYH 1N7ML 3BMVA 2RBLA 4CNIA 4HUUA 4POZD 4P23B 2OX5A 3CFBA 1S9XB 1F6FB 4HC1L 1RUKL 2JIXB 2EIZB 2Z4QB 2IH1A 3MBED 1LILA 3BZEB 2V2WA 2NR6D 4NQEA 2QEJA 3O0RL 4X9BA 3K2MC 2R1WA 4AEIL 1OVZA 4FXKA 4YGVA 4P4KB 5D1QB 4PTUA 3T4AB 1C8PA 2X6MA 4GLRI 3IU3A 4UAOC 2M2DA 4WFGE 4QHMB 4NQED 2C1OB 5CINH 2J5LB 2GTWA 5HGHB 1FLRH 3S96A 4MNQA 3P4OA 3DUSB 5A16B 1KB5A 1TJHH 1GGIH 2JKXA 2IQAB 5FA4A 5IR1A 4APQB 5D6DA 1A9BA 4OLWH 4PJXB 2ADJA 1P84K 5IVXA 3LDBB 1UQSB 1BD2A 3NFPB 1MJ7H 1F11B 1VFMA 2YD3A 4R2GB 3WLBB 4JO2H 4HX1A 1AIFA 2IPUG 4YFLI 2BOCA 4MNQD 5JPNA 3EUUA 1K8DA 3KYAA 4QRTA 2DN7A 2BY3A 2VLJA 2X1QA 4UNUA 4HFUL 3OXRB 4K8RL 3JUYA 5EBMA 1INDH 4I0CC 2XN9B 5F7DB 3V4PL 5GRUH 4B53A 4RMWA 1BD2D 5HJ3A 1DP0A 2YD2A 4B50A 5AZ2H 4F2MB 4YHYC 4N0CD 1XGQA 2HTKD 2NY4C 2FJHA 2UZIH 4WWKA 3WFZA 4LHUG 1CI5A 4EJ1C 2VLJD 1EZVX 1OCWL 6FABH 2HFFB 1I8IA 2VDRL 1I9JL 4I77L 2NR6C 1OAUL 4ZTPH 4G7YH 3L95B 3VG9B 3V4VL 3PG2A 4EDWL 4DGYL 2J1KA 1S3KH 4YXLH 4WHYH 3RUGF 3MLUL 4QTHB 3LKRA 2IAMA 2VIRB 4WWKD 5ISZA 2DF3A 4XTRC 1YPZA 3DIFA 4N1HB 4ODHL 3T65B 2FGWL 1QVOB 2VSDA 4P5MB 4KXZH 4HZLB 1AP2A 4DN4L 4GH7B 1T7YA 1LO5B 3LEXA 1WVZA 3ZLQC 4AENB 1S5HB 2J8OA 2IAMD 5ISZD 4M1DH 5C86A 3BW9B 4R0LA 3DV6B 3UBXI 5I6XC 4HJJL 3QFDA 1RZFL 1P2CA 3S3SA 5HHOA 1LQSR 4HUVA 2ERJB 3H9SB 4ZYKB 1WSST 1IAOB 3ISWA 3L7FB 2MPAH 5F9JB 5DMKB 4U1IA 2B1AL 3LB6D 5D6DC 4CN1A 1IZKA 1IQDA 1JPGA 1BQUA 4XPHH 3WNNA 3G5XA 2EH7H 5HHOD 3SKOB 5MHSD 4OKVB 1PDKA 1RJYB 4UI2A 5IT2H 2AJYL 3SDCC 4OCLC 1Z0MA 3MJ8B 4YEFA 1V05A 3G6JF 2X42A 2WWMD 1E6OH 3SOBL 3UTTE 4X80L 4ONGL 3I6LE 4PJIB 2QKIA 4CU7A 1NAKL 4PJFF 2BY0A 4FMKA 4L1DA 4NQSB 5EDXA 1TCRB 4XMLH 4M6NL 4XPAL 3VXTA 4Z78A 1J5OH 1BOYA 1M7IA 4PJ5A 1DQLL 1YECL 4WWKC 1ZHKA 3BGAA 3QDMA 5E8OB 3BO8A 3GSNB 1RUQH 5F9OH 3CDFA 3EGSB 1DL7H 5HSFA 5MP6L 3WFHA 3TVMC 1NFDE 4XWGL 3DVFA 4YHKH 3TJEL 1GZQB 4HPYL 1FGVH 1KIUA 1FFQA 1JV5A 4PJ5D 3QDJB 3MRCA 1SHMA 5DQ9B 3QDMD 3G9VA 3WFCL 4IRSB 4NJ9L 1MAMH 2H2PC 4K3JH 3MOQA 2NX5A 1I8KA 4YPJA 2IQ9L 1SJHB 3N85H 2RCSH 2WWKT 1EO8L 5CJBA 1ZSDA 4U3XA 1OAYL 1P7QA 1R3KA 4R0LC 3FFCA 3S3JA 5LBSH 3UTTB 2Z35B 2FJFA 2DL9A 1PG7X 3OKKA 3P2TA 3MSPA 5DTFB 3DX6A 4PRBA 4PJHE 2OI9C 1YNLL 2NX5D 1KENH 5D2NE 5JW3H 2L0DA 3NFSH 5FEBA 4MJIA 1II4E 4LEOB 1B4RA 3L3IB 4C57C 1IEAB 2WWMC 4RSVA 1P7QD 5FGSA 5CGYC 3FFCD 3U30B 3JV6B 1MUJA 1NFDB 3IKCB 4HJGA 1MCBA 3UJIH 5IF0B 2YSSA 4G8GE 2NY3D 1X4XA 4M6OH 2YHGA 5AAMA 3DROA 3V0VA 4FQJH 2JJUA 2P7TA 5BZDA 5CINL 3BDBA 1U9KA 4MJID 1CGYA 2WM0A 2Q8BH 5I1LA 1ORQA 1FLRL 2AXGB 5CBAA 1TJHL 3VRLE 1CDYA 1EPFA 4BSWB 3I75A 2YXFA 3IGAA 5FO7A 4OLWL 5J9PB 5EU4B 3PNWB 5KSBA 1TZHB 4NC2B 5F8RC 3AS3A 2FX9H 3DRTB 5DJYA 5FDWB 1AD9B 4PG2C 4JO2L 3V7MA 1AQDA 5EA0L 1CFTA 4XGZB 1PFCA 4MNGB 4MSWA 2AERT 3FRPG 3I85A 5LWYH 3MCKA 3CFEB 3LKSB 5AEAA 4OF7A 1INDL 2FO1A 3DTXA 1KV3A 4F9LA 4JFFE 4QXGH 3FCTB 5GRUL 2VDQH 3IU4H 1CGTA 5EORH 3OJMB 1ULVA 2X4PB 3O3EB 4Z7WE 2GTZB 4F15C 5AZ2L 1WITA 1DBAH 1ZGLM 5I1EH 1ORSA 3E2HB 1TVHB 3MRKA 2FATH 4UIMB 1A1OA 2UZIL 1MJJA 1S9WB 2X9XA 1CCZA 1KACB 6FABL 3ULVE 2XTJE 3EYOA 4H25B 3FZUC 4ZTPL 3P73B 5D9SB 3VDAA 2YZ1A 1CQKA 2D9CA 3V5KA 1S3KL 4YXLL 4NT6A 1BF2A 4FXLA 5F93C 3VD5A 4PJ9C 2V5RA 4ZFOA 1MCWW 2JJSA 4G7VH 5EOCH 5F9DC 3VD9A 3LEYH 1HNFA 5K9KA 1UM5H 1YMME 4KQ3H 1F58H 2MJWA 3FT2A 5DJ6B 5KS9F 2OZ4H 2ZSVB 4HV8B 3BUYB 1T0MB 2B8OT 3DURA 2EDYA 3IETA 4BELD 4JEGB 1V5JA 4ZPTA 3BGMB 1KTLB 4M1DL 2BRRL 3VD3A 4LVEA 5T1DH 4M02A 4QF1A 3KPPB 1U8HA 2FZ3B 4ELMA 5CEXA 2XZAL 4Z7WB 3TGXA 1R3HB 3GSWA 2CUMA 4YC2C 3T08A 5KSAA 4ZAKA 3DWTA 5JPMB 3NCJH 1A8JH 3BPLC 4OD2B 1FHGA 5AUMA 2IC2A 2X05A 3RWFB 1S7WB 2MPAL 3C5ZB 3E6HA 2XTJB 2VDMH 3QUXB 4XPHL 1FZKB 4NN7B 5DZOA 5KSAD 4PGCA 3WN5A 5J11C 5KSVA 4LBEA 5HGAB 4HIIA 5IT2L 4ZAKD 3U46B 3RI5F 3JVGC 5EUOF 5KZCB 4CVZA 1IT9H 3MREA 5HI5D 4PJAE 5J1AB 4WFFE 4QYOA 4RGNC 2ZG1A 3BSZH 2F54E 3BIAX 4JN1H 3CIQA 3LY6A 3MRDA 3R4DA 4YO0A 2YD5A 2Y25A 5CAYB 5KOMC 5AZEH 1QA9B 3C2AH 1QQDA 3U4AA 1J5OL 1JNJA 4YIQB 4L8DB 4G5ZH 4KK8C 3S37X 1RUQL 5F9OL 2BC4A 1N3NA 3KJ4C 4G6FB 4UUJA 1TCMA 1DL7L 1FL6B 1N8ZA 4O9HH 4JZJC 3ZO0A 4TVPH 3HUJF 2QQKH 5HVWA 4MXVE 4YHKL 4HS8H 2MKWA 3H8NA 1FGVL 3Q3GB 3T2OA 4JDVA 5JNYB 3C9NA 5D7SL 2H3NB 5GS3A 1MHCA 4QWWC 3JWDC 4HUWA 4Y5VA 2R1XB 4TN9A 1MAML 3HZMB 1X3DA 4K3JL 4WV1A 5LAXB 1OP3H 3D69A 3SKJH 3BAEL 3N85L 2RCSL 3L6FA 3QNZB 4PJAB 3FL7A 5IHBA 4PRIE 1IC4H 5LBSL 4DUXA 4QHLA 4Q7DA 1FZJA 5E94B 4QNPF 3BFOA 2BNUB 2X7LA 1WCQA 5HI4C 1KENL 2R23B 4K55A 5IQ7L 4FXGA 4ZAKC 5B3JE 5JW3L 4MQSB 2PF6A 3NFSL 3DBXB 5HI5C 2VAAA 1R3IH 4Q58C 1XR8A 5E6ZA 4OZGE 3T3ME 3PL6B 1K9TA 4MA3A 3SJVB 4JJ5A 1DR9A 1HXMB 4PRPB 3UJIL 1TITA 5E99H 3STLA 1UWGL 4PJ8A 4CVXB 4M6OL 3OJVC 4BFBD 1HXYA 2ZUWA 1JHTB 5CSZB 4FQJL 2QHLA 5DRWB 3VA2C 3ZZ1A 1M1SA 4MZ2A 2Q8BL 4XNQB 1RZKC 3L5JA 4ZO9A 3K4AA 3C60B 1T3FA 1AXSB 3S36L 4F7EB 1N64L 1OTTC 3ECBB 4LFHG 3SEPA 4PJ8D 4CADA 1MFBH 5IMLB 1DJSA 4W81A 4ORGB 4Q6YA 1RJLA 2FX9L 5D8JH 5BJTA 1NAMH 4PRIB 4Z0XA 4Z7UF 2CD0A 3UJJH 4U33A 2RGSA 2H45A 3N1PC 3QUMB 4YHOH 5LWYL 4M62H 4M61B 2D7PA 3UZEA 3RJDA 3MFFB 4KJPD 5INDA 5JDJA 4QXGL 2VDQL 3IU4L 5EORL 3EYVB 4OZGB 2APXA 1DBAL 2R1YB 2A6KB 2CLRB 5KBNC 3DYOA 1OL0A 4HK0A 5I1CH 3VH8B 4NQEB 3VFUB 4YGVB 4GBXA 3G6AA 5ABDE 2B20A 4KRPC 4M8QA 5E2VH 3RY4A 4X7FC 3TN0C 3GSQA 1OAQH 3DVNA 3T0AA 1ZHNA 4IJ3B 1DBKH 5JIKA 3MRQA 5ITBH 4MQXD 5IKCB 4YBHA 2NY7H 4G7VL 43C9B 5JA8B 3QZWG 4KJYA 5EOCL 5E08H 1KJVA 5ITFA 4X7EC 1UM5L 4L3EE 4HGWB 2HT3D 4KQ3L 4O51B 4JKLA 2OZ4L 5I74B 1A9BB 4HKXA 2HT4D 4UQ3B 5C08A 3B3IA 2NYYC 2ADJB 43CAB 4UV4L 1J12A 5I71B 5T1DL 5HDLA 3ZDZF 4W4NA 1B0GA 1CFSB 1P7KB 2FD6L 1TZIA 4J3WA 4JDZA 4PRAB 1FH5L 4X4XA 3NCJL 5EBMB 4XHQA 5C08D 2Z8RA 3K80A 3WFBH 2NY0D 3VCLB 5AD0B 4AL8H 4FQHA 2VDML 2YRLA 4GRWH 1X5HA 3NPSC 1XGQB 2WQRA 1CE1H 4U1MB 4V2CB 5I8OH 4ISVA 3ZYIA 1S8DA 3CVHH 1UWXH 2KQNA 2IALA 4M9PA 3C6LC 5IMOA 1IGTA 1IT9L 5A2KH 2E9BA 3GNMH 1E4KC 1QLRA 3BSZL 2VLKE 1E4XL 4Z76A 2XY1A 1UCTA 4JN1L 4L3EB 3STZA 1FFNB 4NO5A 5T33H 2E7MA 3DO7A 1FN4B 3LKRB 2IAMB 3OKNA 5J1SC 5DVMA 5I8EA 1KJ3H 1HCFX 2YD1A 4LAJH 5AZEL 3UTSA 3C2AL 1KC5H 1R24A 4G5ZL 2XZCL 3W0WE 4Z7VF 4NWUH 4WCYH 3CUPB 1A2YB 3T8XA 4Z77A 2P42B 2DQUH 4O9HL 3QIWA 3EYUH 4TVPL 4GBXC 4EI6B 2HT3C 5BS0A 4N8VB 4LCCA 4HS8L 4NN5C 2HT4C 1S7SA 5IBTH 5BXFA 3UTSD 5GS1B 4EUPB 4BQ8A 5I1IH 5HHOB 4S10A 3I2CH 1MY7A 2MKLC 5GJTH 2R2BA 4HUVB 1NDGB 5GS2D 5J13C 1HYSC 1KG0A 5D7IF 3QIWD 1UZ6E 1HH6A 3SKJL 3FQUB 3ME0A 5BS0D 1UCBH 5AWNH 4UDUA 5MEPA 3ARZA 4OLVH 5JOPE 1GIGH 1AGFB 1IC4L 1NC4A 3GM8A 1B0RB 5F71A 4M6MH 5F44A 4QHNB 4N0FA 1ZVSA 4WFED 1JNHB 1D5BA 1XF2A 2ITDA 5KG9B 4UOJA 2YN5A 4PJGE 3SE3C 4AH2A 2XPGA 4DKAA 2UV3A 4CU6A 2GY5A 4KUCF 3W0WB 3HS0B 4ZD3L 3WIHH 2E9JA 1NC4D 1D5MA 1D9KC 1FL3A 3PXHA 4QO1A 5J6HA 4H20H 5E99L 1M7IB 2ICEA 2W9LA 1T6VN 4PJ5B 2OL3B 5EU5B 4LRNH 1ZHKB 5IEHA 2VDOH 2BVQB 2MQ0A 1SEBA 4X0KB 4Y89A 3MODH 4X9FA 3WFHB 3QUYA 2EE6A 3MO1A 5GGUA 1WAAE 4PJEF 5CZVH 1ZT7A 3QQNA 2MOVA 1U8MA 1T7ZA 1JWUA 5JW4R 1ZA6B 2EDQA 1P1ZB 2Z8VC 2A1WH 3X13B 1MAJA 3B2VH 3MRJB 2JK5A 1YUHA 3BHBA 5D8JL 1NAML 3QUYD 1I8KB 3HFML 4KZDH 3V6BR 3UJJL 4R26H 4YHOL 4G8EA 4DKDC 4M62L 3FO1A 3KLAB 4PJGB 4DFHA 3INUH 4HS3B 1P7QB 2NY1D 1IAIL 1R3KB 2IH3B 5CCKH 4RRPA 4ZOEA 5EC2B 3AREB 2FJFB 3ARGC 4H1LB 3ARPA 3W9DB 4PRBB 4G9DA 4R4FH 4M5YH 2VOTA 5EU3A 5DJCA 5I1CL 5JTWA 3QPQC 5TDPB 2CIKB 7FABL 1T21A 5F89B 1Z9MA 5ACLA 2ZUVA 3MLRH 5CP7A 3I84A 3ZT6A 5C3LD 4ODUB 5GZOD 5F9AC 4C58B 4Z7NF 4UDTB 3V5DB 5DZLA 5E2VL 2B4CC 1YMHA 1PY9A 1OAQL 1BQHA 4TUOA 2PTTA 1FYTE 2V5MA 4DQOH 3V0VB 4BKLA 4PREB 5BZDB 5E08L 4HLZH 4ENEC 1ORQB 1BMGA 3QAZC 3RIAK 4OTXL 3IGAB 5DQJA 2MMXA 1VEMA 1EXUA 3ROOA 1QFPA 3G04B 4PGJA 3MROB 1X5FA 3W11C 2X5PA 3S36X 1BQLH 5IESH 3HR6A 4D9LH 4KI5D 4ETQB 3QUYC 5DYOB 4DJMA 4PJDB 4R97C 5BV7H 3ZL4H 5F6IB 5I73B 5DEFB 4OM0H 3WFBL 2P43B 1P5VA 3IFNH 4U1GC 2FGZA 2HJKB 1OP5K 4AL8L 1KCSH 2VDKL 1FQ9C 3BI9X 2VWEC 4P2OA 1KPVA 1NMCC 1CE1L 4AZ8A 4MQ7B 5JQ6H 4TRPH 1BEYH 2VH5H 5JOFB 3CVHL 1LGVA 4Z7UA 2AABH 1P6AB 2YPKB 1KLUA 2R29L 3GNML 4BK5A 1CR9H 3MNZA 4BH8B 1HIMH 4FHBD 2VQ1A 2VUOA 4S0TD 3GSUB 4P2OD 5T33L 4NT6B 3ULVH 4XAKD 1P4BH 5GZOC 2XTLA 3H9YA 4FQPA 4WU7A 3ARTA 4Z9KB 1ZVHA 4UIKH 5GRWA 4U3HA 5D1ZA 1PG7W 2CXGA 3ZSTA 5C7XH 5B4MC 1A9EB 1KC5L 1AQKH 1S7UB 1VESA 4Y2OA 5FKAB 1G9NH 4NWUL 3M45A 4OAWA 2RFXA 3WO3B 2DQUL 1FO0A 1ZT1A 3DXAE 3EYUL 5HDQH 4O2CA 1L9MA 4GRWF 5D1ZD 5IBTL 1U8HB 3RAJH 3KS0J 3TFKC 5I1IL 1TJGH 4WO4A 2DM7A 5I0DA 3I2CL 4OLYH 5GJTL 3KYOA 4QXUH 5DS8A 1NBQA 3UTPD 1NCDL 3QRGH 5F1IB 3ALPA 4K7PX 4RMSA 1KIRB 5AWNL 5BW7A 4ODSH 4Y19E 4XBPA 4JQXA 1GIGL 4WO4D 1Z5LB 3LVEA 1AGBA 4PGCB 4M6ML 4RBPK 4RIRB 2GCYA 1LEGA 3MREB 3ZHDA 3FFDA 2A6JA 2XQBH 5KOVC 1MFCH 3MLWH 5CSGA 4YBQD 5GRZA 3WIHL 4MLSA 1GVIA 4HIHB 3C5SA 3UBXB 1P6FA 3DXAB 4P2OC 4YDLB 4H20L 2SEBA 4LRNL 1I75A 2VDOL 1XGRB 2BC4B 1JHLH 3OKDA 3MODL 4JGJA 1E4JA 5L8LB 3QIBC 3VFSA 5IMKA 5HDBE 4PB9L 5CZVL 3OB8A 1CG9B 1DQMH 4KAQH 5TDNA 4HMCA 1UKTA 4N0UA 1EHNA 3SKNB 3VWJA 3HE7A 1MJUL 3U4EA 2A1WL 3BKMH 3X17A 1C5CH 4W70A 4Y19B 3S5LA 3MV7A 1KTKE 5DLML 1RJZA 1T1ZB 4MD0A 3RVTC 2IPKA 4JFEE 3ZKXC 4I5BA 1WBXB 1CVSC 4XMKH 4KZDL 4Z7VA 4HIEB 5HDOA 1E28A 4R26L 1MELA 3OB0H 4Q9BA 1CIUA 2EDEA 3QQ3B 3VWJD 2ZUQB 5E8NA 2VO5A 2KDGA 3INUL 4KJWD 1B88A 3HE7D 4P3DB 4JFQA 5CCKL 3MV7D 2ZSWB 2Y4SA 2UYLA 4LSSH 1RI8A 4MAUH 3REWB 5DK0B 4DCQA 4R4FL 5DJXA 2UWEE 3V6ZB 4MCZA 3VXOB 1F5WA 1NJ9A 2OQJA 5SWSE 3MLRL 5C0AA 5I9QB 4G42B 1KELL 3FT3B 5J1TC 2BXZA 1FG2A 2ZOLA 4XZUB 4ZDHB 3T04D 5ACZA 3UX9B 1YNTA 4ZFGH 1I85A 4O5LH 3WV0A 1F90H 5DURB 3B9AA 3MRBA 4CUCA 1OAZH 4AM0A 4DQOL 1OPGL 4U1NA 4QTIH 4IHOB 1KLFA 1YQVH 3KYNB 5CLTA 2QSCH 1T1YA 3W5NA 3OKYA 4J3UA 3MRMB 5C0AD 4JFEB 1VFAB 3O2VH 1U8QA 1GH7A 3G5YB 4PRDA 3TWCH 5JZ7D 3O45B 5LXGH 1NGZA 3QIUA 5IVZA 4Y88A 1XF3B 4OB5L 4Z0XB 2QBWA 3PHOA 4CJ1A 4X5XA 5EBWA 3BRDA 1BQLL 5IESL 1XCTB 4OZIF 2Z93A 2YA1A 4OQTA 4M4RA 4D9LL 2HJLA 3HI1B 5BV7L 3ZL4L 4XWOD 5D7LA 4OM0L 2X1PA 5SWSB 3IFNL 3QIUD 3PP3H 4UT7H 1U3ZA 1F02I 4YX2H 1KCSL 3HE7C 3D5OF 4LMQI 3JWOC 2IMMA 5K59E 3TCLA 4TRPL 3FQRA 1BEYL 4WW2F 5T3ZH 2VH5L 4GUPB 2W65B 5IWLC 1NUGA 1UB5A 2AABL 5HXMA 5D7LD 2MHAB 1CR9L 3KS0H 1VCAA 4GFTB 5HY9A 1O0VA 1M7DA 5IV2A 1HIML 3NCEB 2C1PB 3EBAA 4HMEA 1P4BL 1T4KA 5D96C 4UIKL 4KJYB 1IGYB 5C7XL 4F9PA 1AQKL 5ITFB 1ZLWK 1OB1B 1G9NL 3O6KL 5H94A 3BH8B 3X14A 3BN3B 5HDQL 3MLTB 2NY0B 3QISA 1U91B 1UEYA 1WWBX 2HFGH 3K81A 2XWBA 3RAJL 4I2XA 4KJQD 1I1RA 1TJGL 2X4SA 4OLYL 4QXUL 4JDZB 4ZMAT 2VXTH 3QRGL 4GO6B 2F58H 3MCLH 5DT1H 5C0JA 1WBYA 1AO7D 2YN3A 4YWGH 4ZODA 2DBJA 1B4JH 4ODSL 4HWBH 4XWOC 4HK3N 4HS6A 3QIUC 3D18A 3LH2H 3Q6FA 5EOTA 1YN6A 3QHFH 4PRNA 5EU7E 4YGAB 1B2WH 1G0YR 4XMPH 1D5XA 3AVEA 4DFIA 3VFTB 2DQIH 3CSPA 2ARJA 3IDUA 1PKOA 2DWDA 1MFCL 3MLWL 3PXJA 4ODXB 1P7HL 3STZB 3NCYS 3BT2H 2V17H 3QG7H 3OKNB 3MRGA 5JDSB 5DFVC 3TBVA 2FWOA 3TNNA 4OLXH 3QEUA 5JIHA 3DX8B 3GJFH 4YHIA 1JHLL 4PP2B 2BVOB 4NBZB 4XP5L 1DANU 2JB6B 4TUJA 1NBZA 1FLTX 4FQQB 1OSPH 4ZTOH 1ETZA 3N1QC 4KAQL 2AP2A 2ZJSH 1MCSA 4KK9C 4LLUA 2GI7A 4XHJD 5FCSH 1A1NA 3GSOA 4NZTH 3BKML 1C5CL 4I3SL 1BZ9A 4ZPVA 1V3MA 3FO9A 3C87A 4X4ME 3T0VA 4NKQB 3V7AE 3QCTH 2XV6B 4KJQC 4F9PC 3D85B 3VXSA 1CLCA 4MVBD 3B6SA 1MRFH 4Y8DC 2MWCA 3SHSA 3FN3A 2UY6A 1H3PL 4UDUB 1R3JA 1C08A 4Y4HD 4B5EA 5BQ7A 3WKML 1U8OA 1X5YA 1QR1A 4NHUB 5LCVH 3KPLA 1OTSD 2H2SC 2IEPA 4LSSL 4MAUL 4OUOA 5I1AB 4N0FB 3VXSD 3GUTA 4ZFFB 5D7JA 3IXTA 4OZ4B 5IB3B 3O2DL 4KUZL 2R56L 2Y5TA 3FO2A 1JI1A 4OF3A 2V7HA 5I8CB 2CRZA 2LFGA 1JGLH 4DAGL 2PYEE 3RTQD 2JCCE 5D5MF 3IJYB 4X6DA 4ZFGL 5IBUG 5J6HB 1TIUA 4O5LL 2GJZA 4HG4K 1CU4H 4XVUD 1F90L 1R5WB 5D7JD 4X8JA 4NUJB 4U6YA 1OAZL 1SEBB 2P24A 4QTIL 1ODAA 2A77L 1YQVL 2H6PA 2QSCL 4EDXB 3VGAC 4TNVK 3O4OB 3DYPA 4GG8B 1ZKAA 1Z9SA 3GBMH 4NRXB 1LMKA 3DVGB 4O00A 4E41E 5CJQH 1MFNA 1YEIH 5LXGL 4TPRL 5CEZE 1IKNA 1LE9A 3SE4C 3CGTA 3GSXB 3F8UB 3OKLA 5TQ0H 5CJXA 1ZA3A 2CUIA 2P1YA 3WS6C 4XB8A 5B8CA 3EO1B 4JG1H 4Y16B 2BP3A 4S1DC 2WBKA 3IAQA 5HYFA 4XXDA 3I6GB 1DBBH 4G8EB 5DHYB 3FO1B 1N0XH 5FYKD 4A6YL 5TH2B 4ETYA 3IDNB 3QB7C 3RA7L 4FFYL 5DVLA 1RJCA 4WNQB 2I60H 4UT7L 2PYEB 4YX2L 5FO9B 2JCCB 2ZOKB 2ZCKH 3QNXA 1I7RB 1JK8A 4ODWA 4LCYB 1ZLVH 1M05B 1OTSC 5DJCB 5DUBB 4L29B 4K94H 3QXVA 5T3ZL 3LMJH 3MJ9A 4P46B 4YHZH 1DDHB 3QXTA 5IP4A 2YR3A 3H6JA 3VXPA 4U1JA 2N4IA 1J1OH 4NBYB 1SVZA 1PEZA 2DAVA 4YUEH 4GLRH 2MFNA 4JKWA 2D7OA 3WFEH 5ENWB 1T66C 4OIIH 3P4LA 2C9AA 2KUTA 2PXYC 2WIIA 2LU4A 3O3BB 1ZHBA 2FO4B 1DLHB 4X9GA 1GCFA 5D7JC 4JFXA 3ZYOA 4NC1C 3IFLH 1LDPH 3GB7A 1J0JA 4C4KO 1T22A 4HMDA 1UXWB 2NY5H 4NKOA 2AJUH 3MZGB 3NIFF 2C7UB 3Q48A 4N9GB 4DZ8A 4KVCH 1J05B 4M03A 1EXUB 1EGJL 2L7UA 4MDJB 3ROOB 4IMKA 2FLRT 1MRDH 2ATKA 2HFGL 2K7PA 5E6IA 4HULB 3DHJA 2DKMA 2ZUUA 1VFBA 3IDMA 2AI0H 1DEDA 2Y1VA 1I8MA 1U8PA 2VXTL 1GYAA 1DVFA 4PLKD 3AC0A 3HTLX 1YZZA 3HNSL 3IDGB 4JANA 2F58L 4YR6B 3MCLL 2W59A 3V95A 4XC3H 1NGXA 2WINB 2AQ3A 1WFOA 4YWGL 3RNKB 1B4JL 2IAND 3FTGB 1U92A 4HWBL 3MNVA 2HG5A 3BPCA 3WUZA 4U7MA 4EBQH 3F7VB 1I4FB 3LH2L 5HTSA 1TTUA 3QHFL 5B8CC 1B2WL 4XMPL 1FSKB 2AEPH 4WUUA 4K71B 2DQIL 2FSEB 2VE6B 2NW3A 5HYEA 1L7IL 5HVFB 3MNZB 1U58B 4RA3A 3C8HA 1HI6A 1G6RL 4IIQA 4L3CA 4HH8A 4CW1A 3AMKA 4L9DA 3OR6B 2V17L 5FYKU 2JB5H 3MRFA 5EBLB 1CBVH 3VGFA 1RK0A 2FNBA 5D1ZB 1MLCB 2QLVB 4IOFC 5E5MB 4WUUD 1IM3B 1L6ZA 3ZE2F 5GXBB 3EJJX 2P5WD 4N1EA 2HH0H 8FABA 1H0DB 2B0SH 1T7WA 2DL2A 4NFDA 1GGYA 1TTGA 2H26A 4AQOA 1OSPL 4ZTOL 5K9QI 4WEUD 1LEIB 2ZJSL 2CQVA 3BEWB 4X7TA 2PNDA 4XI5D 4MLIA 4NZTL 4DUVA 3TNMA 3H0TA 4WO4B 1NCTA 2CXKA 3LPFA 4I1NB 1NCWH 1JNLL 3VFRA 3SY0B 3QCTL 5DHVA 5C09A 5EU6A 1KEGH 5GGVL 4I48B 1NBYA 3HRZA 2R2CA 4R96A 1MRFL 3PWJB 1LO3H 1QACA 3LZFH 4P48A 4OCMC 1A4JA 4IRJC 3CDCA 4XBPB 5EC1B 5I76A 2OR7A 3ARFA 3CDGB 5FB8B 3LD8C 5E6IC 1CD8A 3L3JA 3KDMA 2GCYB 2W0FA 4K3DH 5EU6D 5C09D 3NAAH 3VJ6B 2W60A 3NCFB 1DVFC 2X4TB 4L9LA 4YBLC 4GW1B 3CXDH 5I75B 3ARFD 1NUFA 1WCBA 3QEHB 1CU4L 1AHWB 2EC8A 3A6BL 2DM2A 4KWUA 4QRPE 2NZ9D 2WANA 1QLFA 2XWTB 4R4ND 2ID5A 5C0IB 3IS1X 3LCYA 5EZIH 3HZKB 1VENA 2VAJA 4OI8A 3U79A 5TDNB 4IIQC 3D0LA 1BOGA 3GBML 3PV6A 2WQ8A 3MUY1 2AK4E 4F8QA 3U83A 1YEIL 3U4EB 1ZMYA 4P5TA 5DEGB 3ZE0F 3FB7B 4S0SD 3MV7B 3BRFA 1WF5A 2P5EE 3B9KB 5TQ0L 2ZG3A 4MD0B 5CP3H 3SO5A 5GQBA 5F1KC 4WW2C 4UAOB 4PB0H 1LDSA 3OAZK 3OXSB 3TCXA 2HYMA 3NOIA 3VRJB 3L3KA 3QDGE 5C8JB 1KJ2A 4WEMB 5F7FA 1DBBL 2AEWA 1N0XL 5E8NB 4XCNA 5D7KE 4JRXE 1FNSH 1U42A 4P5TD 4HHAB 2LV4A 4OLUH 4A2LA 3SDXF 2I60L 2OTWA 2WLZA 1FNGA 3LV3B 1H15B 2ZCKL 5DJXB 1DQQB 4PY8I 4NRYB 3WO4C 2CR6A 4U6TA 5F97E 4MCZB 4U0RB 4K94L 1EV2E 3LMJL 1D5ZA 2OQJB 5I2IB 1C12A 3VXME 4YHZL 5BV7C 4G6KH 3CFDB 1A6ZA 5GIRA 4Q2ZB 1MCFA 1X9QA 3LHPH 2DRUA 4F7PB 1J1OL 1YC8A 1YNTB 4LSQH 3PWUB 4LLDA 4P0DA 4WWID 1G7MA 2Z31D 1XF4A 1UB6A 4L4JA 2XFXA 1F3JA 2IBGA 1OGAE 5DJAA 3NACH 1IEBB 3VXUE 5FYLD 4U6HA 3WFEL 2AK4B 4AM0B 1H8SA 2F8XC 1NSNH 4JAMA 3SBWA 1G7LA 1HSBA 1RULL 3IFLL 1LDPL 3KPRA 2P5EB 4L8CB 4YHYB 2V9RA 1U8QB 2NY5L 2MQ3A 2HLFD 4PRDB 2AJUL 5B39A 4LIQL 2NY4B 4KVCL 4AK1A 3RPKA 5D5MA 3VMOA 2HFEA 3F7PC 4JRXB 1MRDL 4AIZA 4K7FA 3RL2B 4UTAH 2OMNA 4LVHC 3E3QC 3KPRD 5IIEB 1JTTA 5T1LA 4OUUB 4W6WB 2AI0L 1FPTH 1G9NC 4LVOC 4NC0B 1S7TA 2OR9H 2XACC 4HWUA 2GAZB 3F12B 3NMEA 4I4WA 3QULA 3VFNB 2ZUXA 1KCVH 2VLME 4XC3L 3MTRA 1U3YA 3LN4B 3VXMB 4BZ2H 4YLQT 1YYMH 1PQZA 1CD9B 2ESVA 4WEBH 3UTOA 4EBQL 4RZCA 4MNHA 2PTUA 3O2DA 3L5WB 4JPVH 3VXUB 2K1MA 4P4RB 2V6HA 1A14L 2YA2A 4ACPA 1UB5B 2AEPL 4PBVC 3BKYL 5EPMA 4K2UH 3OAYK 4HCRA 4P99A 5HGBA 4PJ7A 3HI5H 4C83A 4N8CL 4DTGH 1FNEA 4TOYL 1WWAX 5DUPH 4YEEA 2ESVD 3B2UC 1RIHL 5DJZA 2JB5L 2NW2A 1F4AA 1T4KB 3SGKC 3QJFB 4PD4J 3PHSA 1QRNA 5E00A 1HZHH 2I9TA 4C54A 4YFLF 1QPPA 5E03A 2IWGA 4PLOB 1IC5L 2W0KA 1LVEA 1YPZE 5DD5H 25C8L 5HHNA 2DQCH 3QQ9D 2QL1A 3CVIH 1SYSA 2B0SL 5C0RH 3X14B 4OCNC 4JFYA 1A7OH 1S7VB 3EYQC 4X8XA 2HLFC 4YHPB 1AO7B 3IRZA 3MMEA 1QEWA 2EEBA 2IG2L 4M5ZH 5DK2B 3ZHKA 2Y9RT 5MI0C 1NCWL 5CMAB 1K8IB 2ICWA 4JFDA 1CWVA 4D0BA 2VR9A 3GZKA 1KB9J 2P48B 4GQ9H 1NFIA 1OY3B 2BY1A 4YNYA 1MFAH 3QEQE 1T03H 1LO3L 2JLLA 3LZFL 3K0WA 4OZFA 3RGVB 3ETBF 5FYJH 2ADGB 4JHWH 4CMHC 2GSIB 4GG6B 1WC7B 4LVNC 3TJHC 4K3DL 4ZUUB 2VXUL 4U1SA 3STBA 3PDGA 3ZTNH 3NAAL 1F4YH 1TPXC 4RAUB 4RCAA 3MV9E 2Q20A 1D6EB 1BX2A 2OJEA 4QRRA 1FVCB 1B6DA 3EO0A 5BOZG 3AAZB 5T1KB 4OLEA 2DIJA 3FQXB 4ZXBA 4XBGA 3O4LE 1FBIH 4NQTA 2O5YH 3QT2A 1Y6NR 4RMRA 3WIFB 4P5KA 1HSAA 4JVUA 3BPNC 4NQXA 3Q1SH 1QFOA 2NXZB 1EHAA 4YHIB 4QRRD 2DOCA 4X5WB 4K3GA 5F7UA 1RV6X 4XAWH 4N5UA 4TUJB 1Z9OA 1DQJA 1YN7B 5EZIL 4ZXBD 5K9OA 1OD9A 3L7EA 4F80A 2OI9B 1H8OA 4KI1A 3D0VA 1KLGA 1EGJA 1OT1A 4KVNH 3MLZH 4Y4HB 3QEQB 1BZ7A 3ULUH 3UDWA 4ZSOE 1BZ9B 4ZPVB 4NNXB 4RQQB 5C0FB 3WD5H 3WXVL 1JF6A 5DC4B 4MJ5B 2F53A 2X09A 1GRWA 1IZJA 1TQCC 3LQZB 4MXQC 3MRHB 4X99B 3R0MA 5SX5H 1KB9K 4LGSB 2X41A 3AXLA 4BUGA 1ZT4B 3ZDXF 3MV9B 3MRPA 5BQ7B 1T2XA 1FNSL 1V7NH 4QOKE 3RTQB 1MLBB 3D48R 4OLUL 3ARDA 1T1WA 5IJKA 3PE9A 4RA0C 3T0EA 4M1GH 1X5LA 3PGFL 4X6CF 5MENE 3KPLB 5DF0A 5T5FH 1QO3B 4ZUTA 3VE0A 2EDOA 2F53D 3O4LB 2Z8SA 3ES6B 3FFCE 1P4LA 3JBG7 5FK9B 1N2RB 4XX1G