3MJ9A

Crystal structure of jaml in complex with the stimulatory antibody hl4e10
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
229
structure length
229
Chain Sequence
b'VSSPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVLPEEPRDLRVRVGDTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVGKLESRKTIVLHVVQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Junctional adhesion molecule-like
molecule tags Immune system
source organism Mus musculus
publication title Molecular insights into gamma delta T cell costimulation by an anti-JAML antibody.
pubmed doi rcsb
total genus 62
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9A02
5T3ZH 3W9DB 3AUVA 3UCRA 4ZD3H 1FAKT 1Q38A 3ARDB 5J56B 4UV4H 2XT1B 3B3IA 3C5ZD 1LD9A 1RJLA 2XWJB 2Q7YA 3BW9A 2V5SA 2VZOA 4N8VA 1H8NA 4U7MA 3REVA 2RGSA 5DD0L 2IBBA 1ZSDB 2D7MA 4JPVH 1FFRA 5HHPB 1RIVL 2R2EA 4DKAA 3RWJB 1WAAF 2MOVA 4RX4A 1AD0B 5HHOA 3VCLB 1DEEA 1KG0A 4L4VA 5HHME 3HMXL 3MRCB 2O5ZL 5CJOL 5DUMH 4OD1L 5D2NB 3LKSA 3L95A 4KROB 1KENL 4QHNA 1ZGLB 3MRKB 4K94C 3QNZB 1S7RA 5I76B 1I75A 1QLFB 1S7UA 3OR7B 5E2UL 1RPQA 1R3LB 2PO6A 4NN6B 1IGMH 2OR7A 1AP2B 4BK4A 3BD3A 3BWAA 2DLFH 1HQ4B 1Z9MA 2YXMA 2HH0H 1FZMA 1CE6A 4MAYD 5TDOB 3H7BB 4HUUA 4M1GH 5A2IH 3ZKMC 5FV1L 3MRNA 2BNQB 2IPKA 3G04B 1RZJH 3RWIA 4F8TA 2X7LB 1J8HE 5IW6A 1MVUA 2EE2A 3MZTA 3NZ8B 2NY0B 4N8CH 1K3ZA 4NQCA 5CINL 5EBLA 5IB2A 4TQEL 5EUOE 5B39B 5BZDA 1CFVL 5B4MC 4EN3A 4MD5B 2F53E 3W11D 3BESR 4XH2A 1A7RL 2ZSVA 2EIZB 4MHHG 3X14A 3TPUB 1FNLA 5DT1L 3ARUA 1ZEAH 4KJYA 4PGCB 4G6AC 1CQYA 2JJUA 3WLWC 2IQAB 2VLKB 4P9HC 3M1BB 5GGUB 1FL6B 1KELL 2APWA 3S9DB 2R2CA 1GIGH 1UYWH 5C0EB 4NRZA 3OKKA 4FQXA 2O5XH 1T22A 1EEYB 3ZYIA 2A6DA 2BVQB 3PHOA 1S7QB 4MZ2A 4RGNB 4RIRB 3EO0A 3WCYA 3OHXB 1D5MB 1MJ7L 3GSRA 1PY9A 2GUOB 5MEPA 4MMZC 2GCYA 1R3JB 3HUJB 1RK0B 3GRWA 1KLFA 1CZ8L 4MZ3A 3LQAH 3GSVB 3CH8A 3EKCA 2OTPA 1A14L 4EN3B 5E2JA 5EOTA 3OWEA 2A77H 3LKPB 1S7VB 3IDMB 4FTVA 3FQUA 4FZEL 3N0PB 4OCNC 2D31A 4JHZA 4I0CC 1RZJL 1NL0L 3QZWG 3BMVA 1BF8A 3U1SL 4GG6E 4E42A 1HDMB 1ZA6B 4N0FB 1AD9B 2FHCA 4M9PA 2JKXA 1RAMA 1QFPA 2OR8A 1IC5H 5E2WH 1U8IA 1BZ7B 2IWGA 2D7QA 1KIQA 4GUPA 1KB5B 5F7YC 1UM6L 4UB0H 1D5BA 1L0XA 4CVWA 4KV5E 4ZQKB 1DQTA 2XFXA 3X12B 2BZDA 4XTRD 3R0NA 5DEGB 4FG6D 1NANH 5D7KE 4S1RH 3MJ9H 3K46A 4NFCA 2NXYC 4TNWF 1LE5A 1K4DB 5IVXB 3BKJL 3C8KA 1NJ9B 2ZKHL 4NC1E 2N56A 1UH3A 3SHSA 3MRCA 4LSPL 4V1DA 4TSBL 4JVPA 5B3JF 1FZJA 2BVYA 4EN3C 2DD8L 3V8CA 4F7MA 3BUYB 4PJAA 3MXVL 4C54A 5C8JA 2C1OB 1RIUH 2A9NH 4FNLL 4XNMB 2X09A 4YBHA 3CCHA 2QSCH 1RIUL 2HT4C 3WS3A 4CDGC 5I2IB 5CZXC 2VLJA 3B4NA 1CZ8H 5D6DA 3DV6B 5K9JL 3CC5B 1NGWB 3H3BC 1I85A 1L7TH 4JRXD 5D7JA 1CD9B 1D6VH 1HILA 1V3JA 2CLZB 1R3HA 3BKMH 2FRGP 1XCTA 5GGQH 2AXJA 3P77A 4RGOL 4R4FH 5CEYB 1KLGB 1KJMB 5DQJA 5LBSL 3RHWF 32C2B 3NZHH 3W5MA 4Y5YC 1CGUA 1PKQB 4G80A 4QGYA 1TVBB 5IT2H 3VFUB 2B1HL 4PLOB 3TYFB 4BZ2H 4DVBB 3EYVA 3ME0A 4HMEA 1NH6A 2A6IB 1AIFA 1DDHA 4CVUA 4K8RH 3RPKA 2VLRA 2VLKA 2IMNA 4C56A 3EO1A 4XMLH 1P53A 4G6FB 3HMWH 3NAAL 2KKQA 5C6TL 4Z7OF 1P7KA 4HUVA 4WO4D 1DN0B 1L7IL 1F13A 4JGMA 1AHWC 3MOAL 1BM3L 4JGUA 1L0YA 2FZ3A 5I1HH 1XIWA 2SEBB 3CXDL 4O02L 1WWCA 5CJQH 3ZTJH 2XZCL 1CBVH 3FKUS 5AYQA 3FHQA 3IAGC 3GJFK 3V79C 3FMGH 5ELIA 1CN4A 1JVKA 2L7UA 5GSVB 1P5UA 2JK5A 1QZ1A 2AK4D 2X5PA 2IANE 4O4YL 3V4VH 3T0EB 5I8KH 1SEBA 2ADFL 1X5ZA 1OTSC 2AJ3B 4P2YA 3V6BR 2ZP0T 4PPTA 3KXFD 4D9RE 1WLHA 5D5MF 5D96C 5CP7B 2VDMH 1VEMA 3QNZA 3H9ZA 5A3ID 1EVTC 3DUUA 1VKXB 2IGFH 5D1XD 3T4AB 4D3CL 1R3LA 4WIQA 5JQ6L 3Q6FA 3KAAA 5D1QC 1UWGL 3WO4B 4FQLH 5EZIL 4YIQA 3RZCB 1BD2D 5FFLA 4WFEE 5E2VL 5DRZB 5KSBB 4P2QD 4LRIC 3VG0H 1MHHA 1NAMA 1N2RA 3ULVD 1UADC 1I3VA 1MQ8A 4HPYH 2WBJB 1TCRA 4HWZB 2OYPA 3ZO0A 2J4WL 5ADOH 3T4AA 3DV4A 5E94B 3BI9X 3DYOA 3LEVL 5HPMB 1G6VK 4OV5A 2E7LA 4C58B 2XI9A 3BQUD 2A83A 1M7XA 3LEVH 2EIBA 4WUUE 4PV9A 1A7OH 1S78D 4GXUM 1A6VH 1MHCA 4PLKD 3QSKB 5HGBB 1XGUA 4HIEB 3F7VB 1DZBA 3H9SD 4JRXA 4M1GL 1CD1B 5C6PB 1GC1H 2PYEB 4ONFH 3A6CH 4HJGB 3DGGB 1YEJL 2A9MH 4K3JH 3TBTA 1UA6L 1FV1B 3PL6B 5HGHB 3MV8B 4KQ3H 2IBZY 3Q3GB 3MLUL 1QNZH 3QQ9C 1A8JH 4YHNB 5K93A 3BP5A 1EMTL 3SE3C 4EEEA 4UZGA 2BSSB 3LPGA 2D0HA 1JUFA 3X17A 5IQ9A 5DD1H 2EEAA 4E9LA 3SKMB 1JGUH 1OY3B 4I0KA 1A3QA 2CLZA 1D5ZB 1WT5C 2J88H 4OM0L 1VFUA 3BKCH 2X4NB 2HVJA 3KPLA 5AZEL 2ZOLA 3BVNA 2K9UA 3QXVA 2D9CA 1EJ6A 1KLUB 5CHNA 4YBQC 1X5KA 2WINB 4OM1H 3VFUA 2E7CA 2VL5A 1VA9A 5E8PA 4HQQH 3ZE1E 4M7LT 5A2LH 2WUBL 3TNMB 1TZHA 3FMGL 5C0NC 4YLQT 4PGDA 3GSXA 5GGSA 2HJLB 3BPLB 3O45B 2I9TB 1AQDB 1NDGB 3IS0X 1RHHA 3CU7A 1KJMA 3QXUA 2BCKA 4DGYH 1Q1JH 2DM7A 2R0KL 4Y4KA 5IESH 2DB8A 2FEEL 3PXHA 3SJVE 4R97B 4YBLB 3UC0L 2BSTA 5K9OA 3QJFA 1TZGH 3NIFF 1HQ4A 1M4KA 4UIKL 2C3VB 5E6ID 1VGKB 4IM8A 3I02B 3U36B 5SV4A 1OSZB 1IFHH 4L8CA 1SVCP 2GTWA 3MFFB 2IALA 3PWUB 3DWTA 5D9SB 4HHAB 2NY6D 3G08B 3RWHB 4PJCE 4XNYH 1I7RA 1DQLL 1TMCB 1FLTX 3NIGE 3FOMA 4CU7A 4ELKB 3BPNB 4JFZL 1NDMB 1U6AH 4G3YH 3L7EB 4S2SA 1ZVHA 4NZTL 4APQA 3STZB 3NCFB 2X89A 3C8HA 1T0NA 1YEFL 4LSVL 3C09C 3D39A 4JM4L 2NY6B 5EOQL 1IC5L 1AE6H 1TXKA 3AM8C 4R2GB 4YK4C 4HZAA 1RUKH 3E8UH 1QFWI 4UB0L 4I5BA 1JWUB 1HSBB 3T1WA 1BZQK 2FIKA 3J8F7 3O6ML 1I8LA 1A4JA 7FABL 4XWGH 1VFAA 2IAMB 1R5IA 3KGRA 1MHEB 1T04A 3W2DL 3PP4H 4RIRA 1SHMA 3FONB 4XZUB 4UT6H 4J3SA 1KN2H 3V52H 4QEGA 2F74B 5C08B 1ZT1A 3P73B 4M3KB 4YXLL 4ODHL 2MNUA 2P43B 3R8QA 1I7ZB 4PRAB 4XXCA 4LCUA 1RMFH 5EBWB 5D71L 3I75A 3EYQC 3X13B 4A2LA 1JWSA 3HZYB 4WFFE 1DQQB 1W0VB 4HJ0C 3GK8H 4S0TD 2P8LA 3TBVB 4UI2A 5IP4A 3NCCB 3D5OF 2E8ZA 1KB9K 3QIBB 2W9EH 3GMLB 3A6BH 3LKOB 3AXLB 2EIDA 5F71A 1DFBL 3HNSH 4LVOB 1H3WM 3VXQA 1A6WL 3RRQA 4ZTPH 3BP4B 3MNWA 4WEUD 3P0VL 5KSUB 4LF3A 4BELD 2VQ1A 2F58L 1YPZB 4JFFD 1DBAL 2ICWA 3S6CA 2J8OA 5IW1A 5TJWK 4O51A 2G60L 3D69A 4UDUB 4OZIE 5I1KH 3V5HA 3QDGA 1QBLH 2ZG1A 2JB6A 4HF5H 4NQSB 2CK0L 4G9FA 1BAFL 5JIIA 5TQ0H 3EYFB 4HF5L 2VLJB 3F12A 3IKCB 4BFBD 4OIIH 1FL3B 2ATPA 4H0GA 5TQ0L 4MD5A 1PY4A 5F7UA 5T1LD 3RKDD 5FCSH 4OIIL 1MJUL 1MWAA 4U1MA 3GSXB 2A2QT 3MOAH 2ESVA 3OMZA 4Y19B 1A47A 2I27N 2M1KA 3NABL 2O61B 4PJEA 5L8LB 3EO9L 2RFXA 3I6KB 3P0VH 2GAZA 4KK6C 4GS7B 1B0GB 1WZKA 5IFAL 1JNHA 1RK1B 4ISVA 4ODVL 1QKZH 4HUXA 4KTEL 4YGVA 5C0IA 4KK9C 3EYUL 3EUUA 1X6NA 3TVMC 3GSRB 4LLMA 1BF2A 4ALAL 3W39B 4HKZA 4P2QA 3BP6B 3BPOC 4JE4B 2HLFC 5HGAA 3IJHA 4YHKH 5F7MC 4FXKB 4KUZL 1JNNL 1REIA 3CLFL 5D2NC 5E4EB 3U7WH 3JWOL 5KSBF 4PJDB 2NY7L 3IDGA 4AEHH 5KVDH 4KROC 2C3HA 3HCVA 4KPHL 4OT1L 5ESAA 5FF6A 1X5HA 1NUDA 3RTQB 3TESA 4CKVX 2L0DA 5JUEH 3DRQB 1X4ZA 4JY5L 2XACC 5B8CB 4IRJC 5HPMA 4FNLH 2CMRH 3U9UB 3RIFK 5I1DB 3LRSB 4XPGL 1A1MB 3VDCA 4GS7C 1HXMB 3GBMH 3WJLC 2MCPL 4MMXC 5I1IH 2HT3C 2KZ1B 3K8LA 5IM7A 4JHWL 1D5ZA 1NGQH 1Y0LA 3IVKB 3G04A 2BOBA 3RVXC 3DX6B 1Z3GH 2P8MB 4JG0L 4A6YA 4YHNA 4GRMB 5GGVH 3BWAB 3IFPA 3VFSA 3JWOC 2VLRD 5T5FL 1S9WB 3VXOB 4CW1A 1D5BB 3TJEH 1PKOA 4M6NL 5CP7A 5C0AB 3RL1A 3NCYP 1QFUL 4Q2ZA 3UPRA 3VWJC 3Q0HA 1DBML 3IXTB 1R5VA 5TGBA 2XQYG 4P49A 4Y5XA 4PTUA 3IETA 5T33H 3RTQC 4L8BA 1D5XA 4TUOB 3GBML 4QXUH 2E9BA 2HFGL 2VWEE 3ELAT 3GO1L 5KSAB 5LVEA 4FQPA 1AY1L 1Q72H 4P4RB 5AEAA 2GKIA 5J6HA 3F62A 2JJTC 2Q3AA 3QWOA 3WN5C 5C0AD 4XCCL 1WFOA 1WZ1L 4HKXA 5DUBB 1WQVT 1A7PL 4LSRL 5JXAH 3DO7B 4F15B 1OAQL 2VLMD 2EDNA 2I5YH 1CL7L 4M61B 3LN9A 4QWWD 2OJEB 2Z0BA 3VXMD 5ESVA 4BZ1H 3QNXB 4U3CA 4JRYA 3LB6D 2VQ1B 3MFGB 1G1YA 1EFQA 4NIKB 3OAZH 4OF0A 4M7LL 3BKCL 4OGXH 2LAGB 5F1IB 3ARPA 3U4BL 1H9VA 1RZKC 4JFXB 4S1RL 2RHEA 1XZ0B 2NY1C 3DVGA 2PCPA 4HC1L 5DXWA 4JCLA 2FWOA 1J0JA 4C4KT 4UNUA 1G7MA 4DKEH 4OLWL 4YHIA 5T3XL 1A6ZB 3NPZB 1NFIB 5KANG 4GKZB 3RDTA 3V6ZB 5E5RB 1UA6H 3P11H 2A6JA 4D8PB 5LWYH 4EI5D 4JDVB 1BX2A 1IM9D 1TDQA 1JF1B 5FYLE 2Z8VC 4KJQC 1VEPA 4LU5H 1QSED 1RZIB 4L1DA 3QFJA 3GSUB 1KCLA 3DTXA 1WC7B 2HMID 4FG6C 1WSST 1MCLA 3G6DH 1UZ6F 4LHUA 3BUYA 1YMHB 3O41B 1BFOB 3PGDA 4F7TB 4L3EB 5JPNB 4GMTH 2VDKL 3SKUD 3QISA 1PLGL 4P2CG 3DGCR 4GRLD 3CFIC 5FHBH 3T0BA 3HG1B 5I1AB 1EZVX 3DTXB 3LQZB 2AJUL 3BN9C 4X98B 2CJUL 4OCSH 1FRGH 2NX5A 3FCTA 4I0PB 5ICZB 5GZND 3B9VA 2C3WA 1R3HB 1YDPA 3HC4L 1K8IA 5GZOC 3NH7L 3H8NA 4S2SB 3BZEB 3ARGD 1PSKL 1SEQH 1YZZA 1WBYB 5E1AA 1O5DT 5DUPH 4FQJL 2O5YH 3SJVD 4TULH 4XGZB 3HMXA 1QO3A 4PGBB 4PJ5B 4N8VB 1I1AC 4RQQB 1UGNA 4CU6A 4FTVB 1QRNA 1E28A 1XGRA 3D6GA 1NC4A 1HZHL 3MJ6A 4LSRH 2UZYB 3ZDZE 3JTTA 4PJEE 3FFCE 2JB6B 5HGDB 1Q0YL 5D70H 4OZIF 4NQCD 2DL2A 2VSCA 5TF1H 3QDJB 3HPLB 4QCIA 4OZFG 2OTWA 1S9WA 3FN3A 3RDTC 1BVKB 4JO3L 4X5LA 1OTUD 3OPZL 3S97C 1TJIL 1YY9C 4H0IA 1J9CT 1QR1B 3QIUA 2EDHA 1FIGL 3P3YA 3EHBC 5E8NA 1I4FB 4M43L 3QXAB 2ID5A 3L5WB 3CXHJ 3QA3A 4KTDL 1EEQA 2BVPB 4OSUL 3RGHA 1HKFA 1VDGA 3PQYB 2P4AB 4KZEH 2H3NB 4G9DB 4NO0B 4PRID 3VGGA 2Y5TA 1P84K 4U4BA 2AJUH 1RZ8B 1SY6A 2PXYD 2R8SH 1L6ZA 4PJ9C 3NCJH 4N5ED 2NPLX 4IJ3C 5LXGL 5FYKL 5J6GB 5J12B 4D0DB 4U6VH 5I1GL 4DN4H 5IWLA 3TH2T 3BDXA 3JV4A 3VWKC 4EDWH 5FGBA 25C8H 3HKFA 5L8KB 4UMGA 3UROR 4I48B 4HG4J 3UYRL 4JM2B 3MLYH 3MUY1 4H88L 2J2ZA 4WI2A 5DO2C 3WEXA 4O00A 1DLHA 2BOCA 4XBEH 3VGBA 2XIDA 1HHJA 3CUPB 2HT2D 3K1DA 3F5WB 1HOCB 4TUJA 4D0DA 3RUGF 5BRZB 4R4ND 1IE5A 1MFDL 4PRHD 4P46D 3JWNC 4AG4L 3NFPA 3EFDL 4MVBC 5EWIH 4F7PB 4I3SH 4Z76B 3KPRE 4M6OL 1F58L 1MIEL 5IMLA 1FG2A 1F90L 4W6WB 2B5IB 1LP9E 2X2YA 3UDWC 4MJIE 3EGSA 4HFWA 4XMPH 4W4NA 3BGFB 4PR5A 1T66D 5CUSL 2VITA 4P23C 5HI5D 1KTLA 3MJ9L 2ADIA 4WO4B 4PYHA 4DZ8B 2V5TA 3L7EA 2CKBB 4K7FA 2XN9E 1F45A 1U3YA 4ONGH 3VFTA 1GZQA 3RY5A 3NFPB 5BV7L 1BFSA 3HE6C 4X98A 3EO9H 4XPTH 4P4RA 3O6FC 5E2WL 5K33A 5DZLA 3WLBA 4WW2C 4N8CL 1NEUA 1TJHL 2APFA 5GSRA 1CS6A 1FFOA 2ZPKH 3WFDH 2NXZD 1IT9H 4JAMB 3UO1L 2WMPA 3BDYH 1RJCA 4L4TB 1A1OA 1P9MA 5C07B 1IT9L 5DFVD 3GB7B 2HJFA 1RD6A 3FFCD 3QEQA 2QHRH 1HYRC 4PJXE 5EU4A 4WWKA 2R15A 4JRYE 2ESVD 4WFHD 2D7NA 3MPCA 1NFDF 4QXUL 2B20A 2GY7B 4KHXL 1EA9C 1E6JL 3VXTB 1PG7X 2DLIA 3LD8C 3EJYC 1EZVY 1ITCA 3B2VL 4L29A 2Y06L 1FPTL 4RDQG 2CGRH 4NQDD 3CPLA 3D48R 1G7PA 4UU9B 3EYOA 3B9AA 3WFCH 4DCQA 3IDIA 4U05A 4KV5F 2ZSVB 3OJVC 2P46B 5T3ZD 4CW1B 5BZWA 3ARSA 5I75B 5DLML 1U9KA 2VMFA 5DJDA 5F6IC 3QFJE 3QIWA 4NQEA 2XKSA 1F11B 1FC2D 3S4SG 3DGGA 5DQJB 5C0CB 5GGQL 4ZO9A 3WFBH 5KVGL 4G6JH 4OZHF 2B4CH 2MQ3A 1F3JA 2HKFH 4U7SA 3AMKA 3T8XA 4WU7A 2OK0H 1NC2B 3SGKA 5D7LA 4AEEA 5HHVL 43C9A 4MDIB 1GOHA 2VDNL 4LEOB 4Y4FB 3EOBA 4LMQI 4GOSA 1I9IL 3SDXB 5HVWA 4AMKL 3JV4B 3J7HA 3EZJB 3WFDL 3NFSL 2H1PH 4LLUA 1OGTB 3QRGH 4FS0A 2FBJH 4ESKA 1CXEA 1GL4B 5CAYB 4XC3L 4Y1AB 2EXYC 1BHGA 1OAKH 2NX5E 1AR1D 4XP5H 5ERWA 1ZHKB 5D6CA 4QHUB 4HIJA 3UTPD 3T1FB 4AM0B 2Y07L 4IDJH 3O2DH 3AAZB 3SDDC 3TZVD 1I8IA 4ONGL 2VXTH 4PREB 3GMNB 5DJZB 2Q8BL 5HPOA 2VDQH 2DTSA 4L4TD 5IT2L 1BOGB 2R2HB 3ZKXB 3VXUA 1G7LB 4JG0H 4HXBL 3AB0C 3VFPA 2NY5L 5JR1H 4YGVB 5C0IB 4LIQL 2UVEA 2X4SA 3SBWC 2ZZUT 3N1FC 1HHJB 2AABH 1IAIM 4LHQB 4RISL 5DMJB 4MNHA 5E99L 4NGHH 4NZUL 5IV2B 3RIFF 1FVCA 4C55A 4YUEL 1JGEB 3OKEA 5IWLC 4XNQB 4Y16C 5HHMB 3T0EA 2V17H 1IGFH 1UEMA 3QUXD 3QWQB 2F54A 1KEGL 1OLZA 2XTJD 4LHUD 3JWOH 3VFRB 3BEWB 1N5AA 4OLXH 1LO3H 1J1XH 4HIHA 3JV0A 3OR6A 1N59A 2XWTA 5ID0B 1T5WB 3ROOB 4PJ7B 1T21A 1OAUH 3MLSL 2NQCA 1U0QA 5ITFB 3SE4A 3GUTB 3QCUH 2X40A 1EGJL 1QSEA 2E5EA 3GSWA 4KTEH 3A0OA 1FZOB 2HT3D 4Y16A 1F6AA 4P9HH 2NY2C 1JGLL 4NNPH 3SDYH 4M7JH 3C09B 1RUPH 1PZ5B 3CSGA 4RRPA 1H3TA 3OX8B 2NY6C 1N5YL 3G6AA 4M7LH 4OGXL 4DK3A 2M8XA 2W07A 5I1EH 3DX6A 5HSFA 1FLRH 3GIZL 5JXEA 2ZUQC 5HGHA 3PWPD 1EAJA 43CAB 3VXME 4GMTL 5DURD 2VDPL 1RZ7L 4X6DE 4XX1G 4X4ZA 4IOFC 1Z5LB 1FZOA 4Y16B 4WHYG 4ISVB 3C08L 3QO0A 3SDCC 1SJEB 3B2UD 4P23D 3U0PA 1OAZL 5SWSB 3CGTA 1BGXL 3HNVL 1ZLWH 3VXRE 4JRWA 2H32H 2VXUH 4IS6B 4JEGB 1Q0YH 3O8XA 4MNQD 1MPAH 1XF3B 4DZBB 5IB5A 4XNMA 4P9ML 4L3CA 4NPYA 4PGJA 2AJYL 5E4EC 1U91B 2AEIT 3E3QE 4MJ2A 1E4KC 2A73A 3VH8B 5C0RH 3HZMA 3AGVA 4PGEB 3MRPB 3PGCB 2AP2A 4X4ME 2AEQH 3QUZD 3GM8A 4IRSC 5HYFA 1MCNA 1YUHB 2DJSA 5IVNA 5DUPL 4GFTB 3EGSB 4KZDL 2NY2B 2HKHL 4DAGH 2BSED 2BY2A 1X5XA 2P1YA 3QDJD 3ESVF 3RWCA 5D7IE 2FWOB 3BSZL 4QY8B 3KG5A 3P4NB 1WJ3A 1XGPA 1CGYA 3WHXA 4OTXH 4U1SA 1T3FA 3HPLA 4QCIB 3QPXL 3BP4A 5GISL 4XNXH 1UKQA 4FQIH 4H5SB 1CLOH 1TIUA 3HLAA 2JJSA 4K3GA 5AD0B 5H35B 3SDCB 3X3FL 3KPSE 4H26A 5INDB 1K4CB 2IANB 4RA3A 3U9UA 4PJXA 3L3JB 4TVPE 2DTML 1AR2A 4HMCA 2NY3B 5KTEL 4XBEL 5SX4I 5T5NG 3VWJB 2CK2A 3N1PC 4JFHD 3AS0A 3OAYH 5MEQA 1U8PA 1BPVA 3E6FB 2EICA 3DHJA 4WTZG 4YAQB 4GO6B 2ARWA 5LXGH 4POZC 4X6EA 4O2CA 2DMKA 5C3TA 1RU9L 4JY6A 1T6VN 1JP5A 3EYQD 4YDKL 5MENE 4R90H 3SCMD 1LO2H 4L9LB 4LLMB 1OB1B 4L3EA 2NZ9D 5MHSE 4KTDH 4XNZB 3C5SB 4XT1C 3OXRB 1RJYA 2E7BA 1QQDA 2EYSA 3DIFB 1P4BL 2X44D 1TCMA 4XWOD 1OGAE 1PGRB 4Z0XA 1IAMA 4JM4H 4KHTH 4NZTH 4M61A 4FHBD 5JA8B 3TP4A 1HHIA 3OJ2C 4I77L 1QRNB 1JWSB 1RUMH 5IBUB 4HIHB 2DBJA 1J8HA 3QG7L 1F90H 1WZLA 5DUBA 4JQIL 3LV3B 1DVFB 1OP9A 1T21B 4JZOB 3P73A 3CDGA 4AIZB 3ZZ1A 5F1NA 3T08A 5FGRA 3X3GH 1QPPA 1EO8H 2FX8L 3BHBB 3QI9C 4OD3H 3QDJA 3BOVA 4GKZA 4NQDB 5EU4B 5A2KH 1BVKA 5HHOE 3P9LB 2Z91A 1KFAH 4WHDA 2LFGA 5EUKA 5GRJH 1FFOB 4LAQH 1JN6B 4OT1H 5JOPE 2GSIA 5MEOA 1NBZB 2DDQH 4WNQB 2QQNH 3RA7L 3WNMA 3MGOB 2YN5A 3KPPA 3EBAA 2AXGB 1H8OA 5B38A 2JCCA 3IFPB 2G5RA 4KXZH 1KPVA 5SX5H 5C09B 2EH8H 3HTLX 1MAML 1N6UA 3BN3B 4PRNA 1HHKA 3Q2CA 4LCYA 4CADB 4WHTB 1NSNH 2NTSP 4QRUA 1PEWA 5DGQA 5SV3A 5EOCJ 1S7RB 3QUKB 5I76A 4JREB 1X6LA 1LO2L 1CFQB 5DT1H 4ZUTB 2HVJB 1RZJC 4Y19A 4IDJL 3BH8A 3RU8H 4LVNB 3QCTL 4F7EB 4ZXBD 1CFSA 5J3HC 5I17B 3P0YH 1KULA 4F8QA 3LKPA 5L2KB 1IGYA 3IF1B 2YKLL 2NY1D 5L2KE 3MNVA 3RNQB 1K8DA 1I7TA 4TPRH 3H2WA 1T1ZA 5IMMB 1NBYB 3WD5H 5DD6A 5BQ7B 3F5WA 3CUPA 1TVDA 2NW3A 3BRDA 3MR9B 1YY8B 1T03L 4JZJA 1V7MH 1QSEE 1OD9A 2FECL 4OI8A 3U48A 4OAWB 3RQ3A 1JE6A 4XWOC 4DOHB 5DO2D 4JR9H 5KJRH 4R4BB 3MRGA 2ITCB 2HA1A 1HSAB 2Z31A 4F33B 3EDJA 3ZE1F 2O26U 4IRSA 5B3NA 3QQ9D 1V5JA 2BNQE 3F65A 1LK2A 1IEBB 1Z0NA 4GAGH 1HQRB 3TWCH 5B8CA 1KCKA 4TOYL 4P59H 3EJYD 1H0DA 2GYSA 4KKLD 4EVNA 3RDTB 2YD4A 3LRSA 1RVFL 2FO4B 3MBXL 5KSBA 3HCVB 4R7DA 1SMOA 3UJIH 5CBAA 2R1YB 2HTKD 4QOKA 2P7TB 4J7RA 5HYSA 4P9HL 1OB1A 3VXRA 3D39D 5IB3B 1G0XA 5ITBH 4NNPL 2VZVA 1NLDH 3VXNB 2VDML 3TIDA 3ZL4H 4C57C 3TFKD 1KXVC 2Z92A 5GS0D 5KJRL 4UIMA 1MQKL 4X4MA 5INCB 1OWRM 3DMMD 3PWJB 2OTWB 4UT6L 4ZS6D 1J1XL 4BSWA 1IEAB 3S3SA 2IAMA 1JPST 4N90D 1LE9A 1OHQA 5C70A 3BIKA 2BHUA 1S7TA 4CU8A 3VWKB 5E5UB 5LGHL 3ROOA 3P30L 2DJ4A 3MRLB 1KJ3L 5TF0A 1DBMH 2PN5A 4GRWF 4OIBA 1OAXL 3PWPB 4NGHL 3CK0H 4NZUH 4U6YA 5KSAA 3T2OA 1U8IB 1I1AD 4J3XA 2KUTA 3MUGA 5J6HB 5CEZH 1U8KB 1MCPL 2VC2L 3LKSB 2P7TA 5D7SL 4OLVH 3HAEH 5D7LD 5T1LB 2NW2A 1EDQA 2VLRE 3MGAA 4MCYB 5E9DE 4OF5A 2XWBB 5DSCB 2DKSA 5B22A 2VDQL 3O2DL 4PRPA 3FRUA 3QZWB 2PTTB 1YJDC 5FB8A 1DP0A 3PHSA 1BJ1H 2JCCB 2R4SL 1W72A 2D4DA 3E2HC 5CD3A 3VW3H 2GJ6B 4KGLA 4KJWC 2XKNB 3GJEA 2OL3A 5D7LB 1MFEH 3SKOB 5JOPD 3EOYG 3M8OL 2AK1H 1P84J 3GJFH 5DTFA 1I1AB 1YEGH 4UILH 1INQB 4XB8A 4X7DC 5DEFB 5L88L 4TN9A 5T1DL 1A9EB 1CIUA 3ZDZF 1HNGA 3V5DA 3D25A 4OLXL 1J18A 4OGYL 4MGXA 3VWJA 4NDMB 3QCVL 4OCMC 5E8DL 4L3EE 5EH1A 4RFNB 3MXWL 3QEQD 5BOZG 2FJGA 2FR4B 2UZIL 1YQ2A 4X6CF 5EG6C 2QJDA 3CLEH 5DR5L 1MJJA 1A6ZA 1OGAA 4WI5A 3EHBD 2RFXB 2IC2A 1LNUB 1FRGL 4N9OB 2DYPB 1TENA 4D94A 1KIRB 1OTUC 4J6RL 1A9BB 5CJXA 2J88L 1T2JA 3E2HB 5CD5C 1AIFB 2WV3A 5DTFB 1CU4L 3RVVC 4XCFL 4PJ9B 1A5FL 4Y1AD 5GS3A 4PUBH 4PJGE 4AEFA 1YEDA 3TLRA 2IF7A 1EEZA 5I1CH 5FYKU 3U2SB 2ICES 4TSAH 3ISWA 2UY7A 5ILTH 3MUJA 4U1NA 3LZFH 4XVUD 2ZNWA 4HV8A 1D9KB 1I9IH 3KYMA 3TO4A 2HFEB 4BKLB 5HJ3A 1PG7L 4P5TB 4NQXA 3OKMB 3G6JF 5EU7E 2DQGH 4JFHE 1ZLVK 3VXNA 2FSEA 1NC2D 4PTTB 4X7EC 2X9WA 2P5EB 1QVOA 4K7FB 4DEPB 1JZ3A 3L3JA 1I85C 4J4PA 2W60B 4MA3B 2ZCKH 4X0KA 3DOSA 3H9YA 4WEMB 2EDQA 1D9KA 1NCDL 5IGXL 1YDPB 7CGTA 4LSUH 2FHBA 2QKIB 1EBPA 2BY0A 1URLA 4P5MB 4XVUC 4M3JA 1TJGL 2R0ZH 35C8H 4A6YB 5GISH 2FB4L 5L7XH 1GZPB 1KCUH 4NKIH 2VLKD 4OD1H 3VMPA 5IBTH 4K3EH 4MD0A 3V4PL 4HJJL 3DXAD 1KCUL 4NKIL 5HHQA 1PQZB 4PJ5D 1F58H 1MIEH 1DBKH 1D9KC 2HAZA 3CFJB 1MLCA 2VDLH 3O45A 5CBEA 4DQOH 1BIHA 3DHMA 1ZEAL 2VOTA 1P1ZA 1QBAA 3QEUA 4MQSB 2VXQH 5EZJA 3G6JA 3RBSA 4HG4K 3S5LA 1NFKA 4I2XB 3IF1A 3FB6B 4EI5C 1QACA 3AREB 1NCAL 4M48L 2KDGA 1VB9A 5EU6D 1D3CA 3DXAB 2AV7B 1BGXH 1INQA 2WNGA 3L7FB 3GHBL 1T80A 1TETL 2VZSA 1YNLL 4ZSOE 3PL6D 1DQJA 3GSVA 4FQ1L 4YNYB 4E41B 4P5KB 1LP9B 4V2BA 1A2YA 3OKYA 1KPVB 2MQCA 3HI6H 4WEBL 4LASL 4KROD 1A5FH 4KAQH 5KVEL 1NFDB 3HLAB 4RBPK 5AZEH 1G6RL 2MJWA 1ZHLB 4NKQB 5EO0A 3SQOH 3G9AB 1U41A 3W39A 3WYRA 3PHQB 3EDKA 1FIGH 3ALXA 4OGAC 5GRVK 2HWZH 1S5IH 5FUOL 2DIAA 2YXFA 3BH8B 4NYLA 2Y7QA 5D1ZC 5GGTH 5E8EB 3FT2B 2QQNL 1QSEB 1IAIH 1FJ1A 1RIVH 5ESVB 3IFLH 2Y4SA 1MFDH 2X70B 4GAJH 4MDJB 3U1SH 4LVEA 5FOBB 3V4UH 4YE4L 1LEGB 3BEVA 4ETQB 5MEQB 3MLRL 4EI5B 4G8EB 3UTTB 5TDPB 5DI8A 2WQ8A 2XTLA 3SY0A 5FO9A 5GRUH 1EIBA 1TZGL 5D5MA 3HG1E 1E6OH 1A14H 2BXYA 3MRLA 5GRUL 4M5YL 1WBYA 4GSDL 1MFBH 1VGKA 1RJZA 1FJ1B 4LKXB 5J0BA 4RSVA 4U1NB 4ZODA 4Y19D 3RVWC 4YJZL 1D5IH 1A7NH 1JTOA 4G7YL 3WLBB 5FDWB 1YEHH 4W4OA 1S78C 3TJHD 3PWLA 5EBMB 4YDVA 5JHLL 1OM3L 4JDZB 5TE4L 4YFLF 1JJUA 2F9BT 1U3HD 1OOAA 1JTTA 4M7KL 3DSFL 3IGAA 3OKDA 4KI5F 1OL0A 4P57A 4XNUH 3ZKXC 4L8DB 2DJUA 5IIEA 1JTPA 3LMJH 3AB0B 1Z6JT 4EI5A 5H2BA 1YUHA 4XRCB 3L95B 1M7IA 1J8HB 4JM2F 5A2FA 1G6RH 1KT2A 4NQVA 2X4OA 4X4XA 1JRHL 2YMXL 1T1WA 3DIFA 3U7YL 4WGWB 5B39G 4ZXBB 3QHZL 1A1NB 1U6AL 2AJXL 3Q5TA 1WIOA 1SJVA 1I1YA 2R2BB 5IROC 1IRAY 3KPMB 5I73C 5J4MA 1JFQH 1QFWM 2ESVE 4U1HA 5EOCL 4JRYD 5E9DB 3BPOB 4KKAD 5EU6B 4YXKL 3WUWA 1ORQB 3MRNB 5HI3D 3GIVB 2VLRB 2F74A 2YN3A 2LTQC 3MV01 5DEFA 4RAUA 4TSCH 5I8OH 5TDNB 5CILL 3QH3B 2DN7A 3MV9B 3S88H 4I48A 2YD1A 1RY7B 3O6FA 4RBPH 1EFXA 3ULUC 4MD0B 3JWDH 1N4XL 4Z5RA 3RY6C 5DJXB 4QHMA 1LK3L 3UP1A 5SWSD 1N6QH 3WJLA 3MRQB 3QXTA 1MCFA 1K2DA 3QDMB 4LSSH 4JFQA 1Z9SA 3PNWB 5IVOA 3VH8G 3WSQH 1R0AH 5B8CC 3QDME 4NHUB 4OZGF 4MJ4A 3SCMA 3TIEB 4M93B 4ZUTA 4XC1L 3TGXA 2YD9A 1XF4A 3ARFB 1Z2KA 4U0RC 4OZIA 3QEGL 3QDGE 2ZUQB 2ICEA 2OXHA 4G9FE 5C09A 1DQML 4U3HA 3C5JA 3UTOA 2I5YL 5E95B 4CADA 4M4PA 1ZHKA 2NW2B 1R3KB 3ZT7A 3G08A 1QR1A 2ZUWA 3G5YA 1ZXQA 4RWHA 3DVGB 3OKMA 3FOMB 2I26N 1T7ZA 4RX4D 3KYAA 2ORBH 1P4IL 2BY3A 2BSTB 2CIKA 5K9OB 3WXWH 2H8PB 4N0CD 5F7NC 3RHWK 2P5ED 3DVFA 3CXDH 2Q1EA 2OQJB 5J1TC 3N50A 2FGWL 4GLRH 4OZ4B 1I3RB 1G6RA 4MYWB 2ED7A 3P9MA 5F9OH 1WZ1H 3KDMA 3ZTNH 5GZOD 4ACPA 4LHUB 3DROA 4U3XA 2GUOA 3BXNB 2XA8H 4YXKH 3T3ME 3C60A 1OAZH 1TQCC 1T1YB 1ADQA 1RURH 1HHGA 3W0WB 5ADOL 3ZHDA 1FIEA 2R29H 3TF7C 1G7JA 4BFGA 2R1YA 3LKRB 3HFML 1A9BA 4R7DB 1OCWL 3H7LA 1CU4H 1NCUA 5HYSB 1EEUA 4KRPD 3LH2H 4GXVL 5JLZA 1A4KB 3E6HA 3GIZH 4MJID 4OKVB 5KVMC 5GJSL 3Q3GA 5FYKD 4I9WE 4JQXA 2X4RA 5GGRA 2UZIH 4CAGA 5JXAL 4LCUB 4X8XA 1T22B 4JFFB 4XCEA 1OD7A 1CD0A 4B7IA 4PRBB 5DA4A 4B41A 1QBML 2ICWI 1UWXK 3OX8A 4NO3B 4X80H 1A7BA 1NCCH 5AUMA 5ISZA 4M62H 3P4MA 4I3RH 5DK3A 5HYJA 2P24A 4JCMA 4WDIB 3F7RA 4K23L 1LWRA 3KPRB 3AREA 3KPSD 2J6EH 2QR0A 3KPMA 1AY1H 1Q72L 3LCYA 3DARA 4OM1L 3T65A 2VDRL 5FDYA 4HCRA 3L3DB 1NCTA 5DSCA 5GJSH 4ZFOL 4L9LC 5JNYA 1J1PH 2PW2B 4HS3B 1MJ8H 2RR3A 4JLRB 1AXTL 3VW3L 1ZA6A 1U3HA 4X0KB 1X5YA 3O9WB 3FB5B 3RI5F 4PJ7F 4KK5D 2OL3L 1FZMB 4GMSL 4K71B 4Z78A 4RNRB 3UPRB 3SKOA 4LDLB 3RPIA 4WI9A 1EK3A 5LAXA 2EYTA 1CDCA 5D1QD 5D5ME 1R5WB 4YFDB 1OP5H 5BO1H 3EJJX 1BD2B 4NUJB 4PJ8A 5K59F 2P24B 1JHTB 3VXUB 4ZFZB 4ONFL 4X99B 2J6EL 4Y5VC 5TPWL 2FYYA 4WGVB 4G7VL 5JHDE 2GT9A 3QDAA 5GJTH 3DYMA 1G9NC 4J12A 1FDLL 3O4LA 3VRLF 1SBBA 3REWB 2J5LC 4X80L 1II4E 1RSFA 1P2CB 4HUVB 1WUNT 3EOTH 5C9JB 1TTGA 2IFGA 4GT7A 3DUSB 2VAAB 5I0DA 1SEQL 43C9B 2A74B 4X7FC 5H2BB 4Q0XL 2HG5B 3T0DA 3ARTA 3FT4A 1VFBB 3ARDD 5F7WC 4ZUWA 2XQBL 5C0GB 2JJWA 4K8RD 3TV3L 2FB4H 1VEOA 5L7XL 2HVKB 4OF7A 4OF6A 3RJQB 4FXKA 3CZFA 5C0CE 1AJ7H 4P57B 2R0ZL 3MA7A 3FAWA 1PKQA 4HCRH 1ZANL 4OTXL 1QRNE 1IQWH 4HULB 5BJTB 3I6GB 1Q9OA 1HKLH 3TCLB 3DROB 4GQ9L 5IM7B 3WJJA 4EIGB 4PJIF 3RJDA 3MYJB 1C5CH 2GJ6D 1MY7A 2CO7B 4ZOBA 1EAPA 1ACZA 3C6LC 4K23H 1HSBA 2E9JA 4O2CB 2R9HD 1CLCA 4QHLB 1G0DA 1U3HC 3VD5A 4KVNH 4YX2L 3OKNB 1C5DA 4NN7B 5GPRA 4EDXA 1YN7B 1KN2L 1KGCD 3BEWA 5MP6L 4G8EA 1U92B 4LQFH 2EDKA 2QQKH 1C12B 1V7NL 3VXTA 4CRPA 4GH7B 4OZGA 4POUB 4IMLA 5HVHB 4CGTA 4U1GB 5C07A 1G9ML 2EDWA 3C9NA 3PDGA 2YEZB 1XGQB 1T0MA 4D9LH 1NSNL 4CVZB 4U6HB 1IL1B 4OFYD 1PQZA 1AFVH 3FCTB 1X4YA 3O8XC 3DXAE 4HC1H 1K6QL 4JFQB 1KYOK 2XFXB 3B5HA 1JN6A 3PWLB 5EBMA 2AERT 3DUUB 1VKXA 1YN6A 3PQYD 5JOEA 5L6YL 3MGOA 4QY8A 1KELH 3NGBC 4WNQA 1NMCB 1YEHL 4ZFFB 2GAZB 3FFCA 3GMRA 2W1NA 3WIIH 5DMYA 4H1LH 1XGQA 5I6XC 3BIAX 5EORH 3FB5A 4DGVH 5GRVL 3RIAF 1QSVA 4EBQH 4MXVF 1KACB 4TRPL 5JO5A 2EYRB 4BK5A 3MUGB 4RQQA 1NGZA 4WHCA 4QRUB 4PLNC 3M45A 4WHTA 4I18C 4OUUA 2BNRE 2C7UB 1GGTA 4NJ9L 3SGDI 3QO1B 3N85L 1JGVL 1K3IA 4OD3L 1WAAA 2R56L 5BXFB 1WWAX 1EBAA 2H2SD 4G9FB 5FO7A 4ERSH 4UT7L 3FO9B 5DRXB 1P4LA 4MJIA 2Y5TB 1MFBL 5ESAB 1DVFD 5E08L 4XWGL 4FFVD 1EHLL 2ICWB 1DDHB 1S5IL 4TTGA 3LSOB 1D5MA 2YPKB 1JZ2A 5MEPB 4QWWC 3ROLB 3MR9A 2P8PB 5IEHB 5CSZB 2NW3B 2E27H 4WV1B 3QPXH 3TBTB 5EULV 4X9BA 2CJUH 2GFBA 2F5BH 1ES0B 5FK9B 5EUOB 1EHNA 1YEIL 4XP6H 1AE6L 4QRRE 4HGWA 4PFEA 3SGJA 1OTTD 2DS4A 2D03H 3H9HB 4MAUH 5MHSD 5J1SC 2HG5A 4WEBH 4QRRD 1ERNA 1VFBA 3NMEA 4ZUWB 4JO4L 2XKUA 4I18B 4PJBE 1FH5H 4PJGB 3WIHH 2V2TB 4X4YA 3W0WE 2XTJC 3ULUH 5T3XE 3F7PC 4NN6C 5IVXE 4YHYC 5HYJE 1VPOL 5FO7B 1BP3B 3D25B 1CT8B 2DQIH 3BYYA 3OV6A 4PJ8C 4UDTB 2P42B 2F54B 2MQ0A 4G43A 5DA0B 2E7HA 3KR3H 4Z7UB 1M7DB 1YNLH 4HWBH 1GOGA 5IHUH 1L0QA 2DQTH 3UC0H 1A6TB 4UOJA 2YA0A 5F89B 4L8BB 3NPSB 1YEKH 1DQDL 2EDLA 2FLBT 3RY6A 5L88H 2D9QB 3TBSB 4PJHF 4Q97A 1X9QA 5JIKA 3P9LA 4ODTL 3IDJB 4WRLA 4G6JL 4Z78B 5L6YH 3PXJA 2G75B 2CKBL 2EE6A 1ZA3A 4YC2B 4WO4A 5L9DL 1QHPA 1GIGL 1UYWL 1IGIH 2ZJSL 3EFFA 1DANT 1YMMD 4JFPA 3VMNA 3O6FD 4YPJA 1EJOL 2DLGA 4JQVA 3PQYE 2VR5A 3WFEH 4Q7DA 4RZCB 3O81A 1U3JA 4HUMB 4LPTA 1ZKAA 4A6YL 5HHOB 5FGSA 1F6LL 2W0PA 1FCCA 4J3OC 3WFCL 2DRUA 1U92A 3SDDB 3TN0A 1QRND 5F3HB 4XCYB 5FGBC 1U8OA 3VI3E 3LV3A 5EUOF 2FSEB 3EAKA 1RJYB 3U30B 1MCIA 3PDDA 4P99A 1IGFL 4JR9L 4LCWD 4OCYH 1UC6A 5F7EH 1Z5LA 5ECJE 4LPUA 4Z5RB 1VPOH 2DMCA 1MWAL 2DQIL 2QADB 2ITDB 4MNQE 3SGJC 3Q6GL 1T89A 4M9OA 2GEEA 3WUWB 3KLAA 3W82A 2FLRT 2QSQA 4TPRL 1F3RB 4XP1H 4HKBB 4Q6IA 4M6NH 5L8JB 5F1NB 1U58B 3SDAA 4ZPVA 3RWGA 1H3GA 5C0CA 3GJFB 4MXWH 3IJYB 5D8JL 1S9VA 1JV5B 2AXHA 4ONHB 2OSLA 4XP9L 4Y0GA 1PX3A 5E8OB 4YQXH 2B4CC 4XAWH 1RUPL 3K74B 3WFHB 2NTFB 3TA3B 5BS0B 4NUGL 4K2UH 3FT4B 5J13B 4M1CC 2ILLA 2BVTA 2IQAA 2ADGA 2CPCA 3ARBB 4QHKI 4P59L 3ULSB 3EOAA 5D93B 5EUOA 2VLLB 4Y5XC 3EW3B 5LQBL 1OAUL 3MLSH 3RKPA 3RAJH 2JE8A 5IJKA 3KDMB 5HBBA 2F53A 1OAYH 4K3DH 5FYJE 4LEXL 2YUWA 5JUEL 3BIBX 5FDWA 4GLRI 5BQ7A 1I8MB 3DX7B 4WW2F 1ADQL 5IK3B 4ODWB 5C07E 3QUXB 4UIMB 1GHFL 1MCDA 4OGYH 1E27A 3O2WL 4O02H 2H6PA 2QQLL 3RNKB 1WCBB 3VG9B 3MNVB 3RNQA 3CSYB 1JK8B 3GMPB 3IRPX 3ARWA 3UTTA 4NCC1 4PV8B 4TUKH 4LQ1A 3UXFA 3QUZB 2XA3A 3BRFA 3U46B 3RWDB 5FCUH 1GPOH 4NQTA 3HE7D 2ED8A 3FT2A 1JGUL 4M7JL 4XPBL 1HXMA 3QUML 3T0EE 1OARH 3R1GH 3L5XH 5DJCB 3ZSSA 2NX5B 2K7PA 2X4SB 2BNRA 4NZDA 3VGEA 4Q2ZB 5JHDD 3PNWA 3RX8A 3DURA 1ORSB 3PDOB 4DW2L 4PG2C 4LARH 5GRXG 3MOBL 3CMOH 2YUZA 1N64L 3MLXL 5J1AB 4KVNL 4KMTL 5IQ7H 5FO8B 4R6UA 1EFXB 4HX1A 1ZT7A 2V7HA 5F96H 2YD2A 4PB0L 4PRDB 4X6CA 2QHLA 1H5BB 4GW5B 5B38G 2BNUA 1JYWA 5FYJD 3CFKA 5I1JH 5D7IA 3HPJB 1C12A 5C0JB 1CDBA 3V0VA 1YEGL 3QIWB 4NQEB 1T1WB 3ZE0E 4GRWB 1NGYB 2D7TL 1HN1A 4DQOL 5E7FA 4HXAL 1A1NA 3DX8A 1N0LA 1I3UA 5EC1B 4X6DA 5FYLL 3N9GH 1L9MA 4V1DE 1DANU 1NPUA 4Z18A 4PJAB 4MDIA 1QYGL 4PJAE 4LOUC 3LIZL 1VHPA 1JGDB 5FA4B 1CFQA 5FYKE 1AH1A 3V0WL 4J4PC 4NQCB 3MTRA 1X7QA 3P40A 4Z0BH 3TV3H 3BSZH 1AC0A 3R4DA 2V2WA 1MFNA 3V6FA 4XCNA 1CDUA 1Y6NR 5JOFB 4YXLH 2ATPB 4LGRB 2RJMA 1X5LA 4MA7H 3UTSA 4NFDA 4BH8A 2VZ1A 2WZPD 2DICA 1CR9H 1MH5A 4XNZC 3BXNA 5JZ7C 3E6FA 1A7RH 4NSKB 5F9WC 3QNYA 3KLHD 3D69B 3MJ7B 3U0WL 4PJEB 1FHGA 3OTTA 4ZS7L 3I6KA 1HI6A 2VNCA 3T09A 3W9EA 3IU3A 1P6AB 5CJQL 1G7LA 5MENA 5ETUA 1UJ3A 2CDGB 4XX1E 2Y72A 2DLEA 2VABA 4I0PD 3RBGA 1UQSA 4DTGL 1UCBH 5DI8B 1NBVL 4JDTL 5C08E 5TDPA 5FA4A 4H25A 5IOPB 2Q86B 2F58H 2Q6WB 1AJ7L 4MNHB 5HI4C 3MRFB 5INDA 3GB7A 4M93C 2OL3H 1H3PH 5E8EA 4UOW0 3ARFC 1FBIH 1YMME 3VXSB 3MRDA 2DAVA 3CSYA 4W81A 3WUZA 5K9QI 2GHWB 1U2HA 3I6GA 5ALCH 4I0PA 4AT6B 4FN0A 3TBWB 3Q5OA 2IH3A 1CGSH 5HDLA 4PJ9A 1DQLH 3KXFE 3TNNB 4P4KC 5F9WB 1EHXA 2HVKA 4K9EH 4LAQL 3KNBA 4YHLL 2ZG3A 4ZAKC 4W6XB 4UUJB 2FO4A 1VFAB 5D72H 1A1MA 1KCSH 3LKNB 3C6SA 1CLZL 4LSTL 3X13A 1MCJA 1JF5A 3UTSD 4CJ1A 4XVTL 4TTDD 1W0VA 1T5WA 4K07A 4WCYH 3VRJB 3MLVH 3DRQA 4DFIA 1S9XB 5KN5A 5EN2B 4LVNC 3DVNA 4Y5VB 5BRZE 2EC9U 3PF2A 4DN4L 4KRMB 3KYKH 1XAUA 1IAOB 1TITA 3S5LB 1MHPL 1WIPA 3QHZH 1VCAA 3A67L 4PRDA 4X6CB 1FZJB 5I16A 1UM4L 1U8KA 1WFTA 2AV1B 4KI5D 2YD7A 4G6AD 4X7SH 3B6SB 2OR9L 4PJ7E 3VDBA 3SDAB 3QXAA 4R3SA 3HMXH 4P5MA 5I66A 1YEFH 3VFOB 3FQTA 2YPLD 3FQNA 1AP2A 5FB8B 2X4RB 1W0WA 5C07D 1UKTA 4WWKB 3D18B 4Z7VE 1RURL 2IJ0C 5IEKA 5KZCB 4JHBA 4WUUA 4NJAH 5HYQA 4YDKH 2JJVA 3KPSB 4O5LH 5E70A 2V2XA 4LK4A 5D4QA 1GXEA 4XNYL 2BP3A 1LO0H 2J6EA 4DGIL 5C9JA 5F7EL 2O61A 2A73B 3E3QC 5B39A 1CICB 4HWBA 2Z8SA 4AQOA 4F2MB 5E1AB 3D0VB 3RWFB 4FFYL 1I9RL 15C8H 4XGZA 4WU5B 2BNRD 2V5YA 1XIWB 2Z93A 2BNQA 15C8L 3UYOD 5DQDH 2R0KH 3MJ8A 3AU1A 4QTHA 3KPTA 3MBEC 4TUJB 4JQIH 1KB5H 3JBG7 1P7KB 4OZIB 4Y4KB 5E6ZA 5DF0A 4LLQB 3BKYL 5KSBE 3ARGB 2W9DL 1TLKA 4FFVC 4QOKE 4KUZH 4KRPB 4PLJC 1SBSL 4JFYA 5KW9H 1J1OL 2BERA 4OSUH 3QB7C 3RGVD 1BLNB 2VDOL 4HH9B 3M1BA 5EPMA 5GS1C 2BDNL 3GMNA 4HWUA 4GAGL 3TWCL 3HG1D 4NWTL 4E41A 5DS8B 4XP4H 2AJSL 4PJIE 3UTPE 2DIBA 3TA3A 2B0SH 1FGVH 4IRJD 4R2GD 1JYXA 2AEWA 3F6LA 3ESUF 3JTSB 5IG7A 3K1KC 5DDHB 4PJCA 4NM8H 4R26H 3S88L 4PJFF 1DQDH 3V0AC 2IQ9L 4NQUA 4YWGH 4X4YB 4QXWA 3IU4L 4ZXBA 5I6XB 1B9ZA 1MCOH 4ZAKD 3RFZC 1MI5A 3GMMA 3PP4L 2FATH 2AJXH 5DHVB 5JO5B 2DWDB 4TSAL 3RI5K 2ZCLH 3C08H 4KRPC 4ZUVA 4XPFL 4IEFB 5DVNA 1ZA3B 3WFEL 4I5BB 5C6WH 3QZWA 4MD4A 3ARFD 4XPBH 1GZPA 4GMSH 4U0QB 3TBSA 1JGLH 4MAUL 3IDIB 3D3VD 1G9NL 5DLMH 2YA1A 3BP7A 1KB5A 1S9KC 2E6JA 1S7WB 4R4FL 2MFNA 5BMFH 1F3DH 1M7IB 5JQ6H 2YRLA 5DD5L 1Y6MR 3ARED 4HSQA 1JPGA 3RZWA 5IGXH 5JNYB 3SJVB 4UU9A 3O6LL 3MBEA 4N9GB 4UOW1 4LLVB 1WTGT 3RZCA 1IGJB 2CDEA 3I3DA 3IU3B 1MVFA 3U4EB 2ZCHL 5ETUB 4TNWK 1NFDE 2DQTL 2QTEA 4G8FB 4QGTA 2B2XL 3RVTD 1PFCA 1E4XH 4I13B 1IJ9A 1S7TB 3NBNA 5DJAB 3D3VB 5TH2A 1V7ML 2EC8A 4O51B 4YHYB 5DK2A 1OQXA 4JQXC 2KL6A 3GO1H 1A1OB 2CIKB 2HFGH 2OZ4H 3C2SA 2OJZH 1JHTA 5I0ZA 4E0RB 5E99H 1BD2A 4NUJA 4PJ8B 4QRQA 4NNXA 5GGRY 3UZVB 3MRPA 3MNWB 2VQUA 5KSUA 3VXOA 4P48A 4P5TC 5DD5H 1S7XB 4RFOL 2BMKA 4LDEB 1FGNL 2VXSL 2VISB 1U8HB 3KXFA 3O8XB 3V9FA 3AS1A 1A7QL 4NWUL 2XZZA 2ADGB 3HN3A 1LMKA 3I3BA 4R96A 4QTIL 1D5XB 3JXAA 3MRHA 4P3DB 3VCLA 5KSVB 3BT2H 1WC7A 4X6DB 4Q6YA 3L3IA 2NTFA 1XGTB 4DVBA 1JHKL 4HS6A 1BECA 1OAKL 1G7QA 1L7TL 4WFHE 4MSWA 2V6HA 3Q48A 2FATL 4G8IB 2QQLH 2F5AL 1MCRA 4OAWA 1CFTB 3OZ9H 2DWEA 2WIIB 4JM2A 3BYTA 1NCAH 2YPLE 3RGVB 2OQJA 2OMBA 1R5IB 4YDLC 3OF6A 3O3DA 5F7DA 1U8JA 1VADA 2ZCHH 4JY5H 2FO1A 4LMQE 5F9JB 4YO0B 3ARRA 3BPCB 2FIRT 4EI6A 1CLZH 4PJ7A 2AK1L 3I6LE 1TQBC 4Y5VA 4PRIA 4RCAA 2FX7L 5KS9A 2RAMA 4PJXB 2AK4B 4G5ZL 3HAEB 3VU2A 4Z7VA 1E4WL 3WIHA 1C1EL 3C2AL 3K2UL 5IFHL 1MUJA 4DOHE 5DJCA 1CE1L 5I1EL 4JZNB 2XYCA 3C5ZC 1H15A 3MCKB 1A21A 2PYFB 4RMQA 3T1FA 1MLCB 4AM0A 4DVRL 5CBEB 1ZE3C 3BRGC 2P5WB 2PUQT 3QUZA 2HKHH 4DAGL 2AGJH 2AXGA 4C59B 1YA5A 1NBVH 1EMTH 5HHPA 4APQB 2PNDA 1LE5B 4QT5A 3GNMH 2VN7A 4G8GA 3WDJA 4N1HB 4KU1A 5HDBE 4OCXH 4AH2A 3KPNB 1AGCB 2XWJA 1SJEA 1I9JL 5EO1B 3STBA 5HD8D 5A3IC 3EOTL 2OJZL 5IW1B 1R3JA 3VRIA 4UDUA 3ALWA 1CWVA 3BO8A 1DQJB 1C16B 3I50H 4P4KD 3GMOA 4YDIH 3VH8A 4N0RA 1F4XL 1XF2A 1T4KA 4ZDHA 3VFSB 1CD8A 4IMKC 2R4RL 4PGEA 4Z77B 1IKNA 1MWAB 4ZTPL 1GOFA 3H42H 3FQUB 3SDXE 2P5WA 3FOLB 3HA0A 5CIPA 3SDXF 4ELMB 3MLTB 1INDH 5F3BA 4W4OC 4HPOL 2R1WB 3BZEA 4JHAL 4E41E 1MF2L 1T2QH 4PJIA 2PYED 3G6JE 4WU7B 1MF2H 1T2QL 3HC4H 1N8ZA 4JFED 1FBIL 2IGFL 3VWKD 3K0WA 1X5JA 1KYOJ 2VISA 1OTTC 1JNJA 3MUZ1 1LK3H 3B6SA 3F7YB 3HNTL 3LSOA 4CUCA 4ZYKA 1N6QL 3VDAA 1MVUB 5CSZA 1JHLL 4ODSH 3F8UB 1MI5E 2A0LC 4OB5H 4JPVL 4F7CA 3WE6B 3R0MA 5KG9B 4TQEH 1GH7A 4ODHH 2DLHA 4HWBL 2ITDA 4OZ4A 5IHUL 3HC0A 5IROA 4UBDC 3X14B 2DMBA 2N1KA 3HR5A 3VGDA 3A6OA 4ELMA 4KJYB 4NP4H 3BDYL 4HKZB 4P2QB 3NCYS 2FX8H 1QBLL 3WO4C 3OG6B 5F88A 5EZLB 3CCHB 2WLZA 5DJZA 4ONOA 4FXGB 1F00I 4H88H 2IFFH 4OCLC 3IS1X 2R23A 4L3AA 5D6CB 1J7VR 5TFSL 2WBJC 1N0XH 1YECH 1IGTA 2HWZL 4XMKL 1P4BH 3TNNA 5E6YA 3Q6FB 4EN3D 4MD4B 1BWWA 4Z7UF 3EJZD 3ZSTA 5LJYH 2E27L 3ARBC 2R0LH 2F5BL 3E0GA 1MNUH 4M7KH 1ROWA 3O4LD 2BRRH 2EDEA 1IFHL 5D6DC 2VUOA 3CSPA 4EKXA 1DLHB 2BOCB 5GGTA 3WKNA 3BD4A 2BOBB 1IGTB 3ARZA 2VR4A 3GSQA 5TDNA 3X11A 5J12C 5BCAA 2JK5B 3LVEA 1AD0A 4G6FD 4Z7VB 2EDJA 3HRZB 1R24A 1PW3A 4KXZI 1SJHB 5FM4A 1JK8A 4JM2C 1KOAA 1RV6X 4NRYB 1AHWB 3MXVH 2A9NL 4DN3L 3BIKB 1R5VB 2CKNA 5FUCE 3PIQB 4CMHC 5KZCD 1MJ7H 2X4UB 1T1XB 1RUKL 2VQTA 2VTFA 1XCQB 3M17A 4JY4B 4KK8D 5EBWA 3T77B 5JOFA 5LCVH 2KBGA 3FTGB 1ONQA 5IIEB 3JVGC 4Y2DA 1ND0A 1KCVH 3G6AB 1YQVL 4JFDE 3C5ZA 4BH7A 3TYGL 1T20B 4WTWA 1G1CA 1JI2A 1KLGA 2EDFA 5CSBA 5HYIA 2YC1B 1T1XA 4JO2L 5F72S 2DI9A 2YPLA 4Y88A 2BJMH 3IDNB 4QNPE 4NO0A 1VENA 2WUCH 1H3XA 2KH2B 4EOWH 2GI7A 1K8DB 4PLJD 3LS4L 1DSFL 1WWWX 3FOLA 3AU1B 4QTHB 5CIPB 2WBJA 4HWZA 5D1ZD 4LCIL 4YBQD 4FFWD 3DV4B 1BIIA 4OCYL 4I9WD 1MQKH 3BZFB 3MO1B 3KWWA 5KS9E 1A9EA 3WO3B 1VFMA 3MV8A 4TUOA 5HDQH 1MCKA 3H0TA 4FQXC 4JN2B 3ZL4L 1AQKL 2X9XA 4IOIB 4LARL 1MCOL 4OQ1A 5HHVH 3B9KD 1C7TA 4MS8C 2AJVL 4KDTA 5BV7H 3P0YL 5C09E 4XHQA 1XGUB 3RVUD 4YK4B 1IM9B 2BSRA 3BX7C 5DD6B 4ELKA 1YPZE 4JFYB 4NHUA 3SCMB 2PO6B 4FRWA 4U1IA 1FQ9C 4X8JA 3ABZA 1JWUA 1B88A 3IYLW 1NGPH 2BRQA 1XMWA 4G8GE 1BOGA 2R2HA 4WI4A 1DTUA 4U1SB 2VYRE 4G8GB 5I74C 2NY4C 2G5BA 1L4IA 1KIRA 1BZ7A 4PJ9D 5C2UB 2W9DH 1A6PA 2K7QA 4CMMA 3NA9L 1BREA 1U8NB 1LEKB 3SE8H 3SDAC 3IB4A 5FUZH 1QSZA 5GGSB 3VWJD 3BQUC 2ZOLB 3BVNB 2NMSA 1N7MH 3G5VB 5F6IB 1U8QB 5DQ9A 5GS0C 4PRAA 5IMLB 4Y7MA 3RNKA 3O4OC 3WD5L 1EXUB 5DVLA 3QR2A 5F7DB 4TSCL 4ZOCA 4BKLA 2EDBA 3BPCA 4ZUVB 4LEXH 5E24E 3UTZB 2BCKB 4M8VA 5C0RL 4C4KO 2E9IA 2Z92B 2EYSB 4KKLC 5FO8A 5J1AA 2DWEB 5C6TH 5GGRB 5EDXA 2XRAH 1XIWC 2IMMA 1J8KA 2XXCB 1XR8B 4FFZH 4LF3B 1IM3A 4AK1A 2C1PA 1F5WA 5ESQA 3WMSA 5D2LE 1BZ9A 3ZYJA 4OKVA 5FYJH 5HGDA 2X4UA 5T1KA 1G7PB 2MSPA 3W11C 1QLRA 9CGTA 5ISZE 4NWUH 5B4MD 1MJ8L 3GM0A 3WXVH 1AI1H 4X6BA 4G9DA 5EU7C 5IQ9B 2WLYA 3ZDXF 3LEYL 2ATKA 2YSSB 4R7NB 5DZOA 12E8L 5K9JH 2DQUL 3U4AA 5HYSG 4OJFH 4OUUB 3REWA 1HH9B 1I4FA 4OI9A 5GS0L 5IW6B 5J9PB 1NGQL 2LVEA 4HJGA 3MSPA 5JIPA 4MAYC 5HVGB 5E03A 4FA8A 2EZ0C 3ARGA 2X70A 1CG9B 4HH8A 1NJ9A 1CE6B 4GW1B 3GSNB 3UTSB 1HZHH 1YYLH 4H1LG 4GAJL 4NCDA 3IFOB 3D3VA 1OAYL 1D6EA 4MQXC 3BP6A 5LAXB 3BDBA 2G9HB 2N7BA 1P7QD 1T7YA 3MOQA 4XMLL 1JBJA 3WS3B 4BQ8A 2J8UE 1QRKA 1T6WA 1KLUA 5CHNB 2FH6A 4NUGH 1G0YR 4XBPA 5BMFL 1K6QH 3DRTA 3MACL 5BOPA 2FL5A 4M8QB 4PY8J 3SQOL 4LSUL 1DQQA 2D0FA 4D3CH 1CGSL 1JNLL 3CX2A 5EO9A 5HVHC 4PR5B 4OQTA 2ADJB 5DWUL 4IRJB 3VE0B 4L4TE 3QPQC 4EUPB 4KZDH 1MI5D 5DJ6A 1YECL 1CXHA 2HT4D 3QFJB 2VDKH 4L3CB 3QI9D 1HIML 2R0WH 1OAQH 2C3VA 1HYSD 4MWFB 1F4YL 5CGYC 3OAUL 2EEDA 3O3DB 1IM9A 2BSRB 2Q7YB 3L9RB 3TT3H 3L3HA 2EDXA 1OPGH 4Z7QF 1M6OB 4F7TA 1ZVYA 2AJZB 1RK0A 3DX7A 5IK3A 1C5CL 5T5NF 3OGCA 5MERB 4Z95H 2FIKB 1NKOA 5KTEH 4G80B 3U79A 1DL7H 3ARBD 3VXUE 4ZS7H 4NZJA 3MA7B 5ENWB 1IKNC 4UAOC 4XCEB 1DFBH 2O5YL 3P11L 5LWYL 2V9RA 2DQFA 3C87A 2K1MA 4PJCB 3ZKSD 35C8L 4ZPTA 2YS4A 4GJTB 5DMIH 4F9PC 4Q9RH 2RB8A 1ZWIB 5IBTL 4NC0B 2OXGA 2PR4H 5ITFA 4FABL 4XNUL 1IQWL 4UUJA 1MAMH 4JHAH 1QHOA 3BP5B 3OKDB 3U4BH 4PJDA 1W8NA 1ZVSA 3OKOA 4F9LA 1WGOA 1C8PA 5EU6E 1XR8A 1S7XA 2BMKB 5ESQB 4MX7B 2R9HC 3RWIB 2GSGA 3CVIL 5ACZA 4NN5C 5DEGA 3IETB 5GRJL 3X11B 3JUYA 3V52L 4F9PA 1NUGA 4QRQB 1P7QB 1DBBL 2Y06H 4LCWB 4LKCA 1MCWM 2IG2L 4HLZH 3V6OE 5DJ2A 3C8KB 4KDVA 3KR3L 1UCBL 5TDOA 3FZUD 4XPHL 1NGWA 4PGBA 4PJ5A 4GBXD 2WP3O 3AM8A 1SM3H 1YPZA 4UAOB 3RPIB 1XGRB 5I1KL 1QLEL 2I9TA 2GW5A 2GSGB 5ACZB 2E8YA 3BZFA 3MO1A 4NM8L 4XVJH 1I8LC 3LKOA 1CICA 4JVUA 2XNAA 3MZGB 3MRMB 3OG4B 3IKCA 4PJHB 1NAMB 1U2CA 4IIQC 1WCQA 2GT9B 3VXPB 4Z7NE 3VI4F 2HRPH 4XPTL 2V2XB 3OB0H 5I19L 2ZUUA 5FUCC 1Y6KR 4NKMB 4U31A 1RQ5A 2GCYB 3PHQA 3GKZA 3P4NA 4GRMA 5KS9B 3HE6A 1NLBH 2EH8L 1V8HA 1WAAE 2Q87A 3MV11 1OSZA 3V5DB 3I2CH 4O58L 3QUYC 2E3VA 4R4BA 1O0VA 4UQ2B 2FBJL 5JTWA 3CK0L 1SY6L 4JB9L 3TO4D 3VA2C 1W0YT 2EDRA 1M1SA 3MYZA 5E2TL 3DSNA 5K9KA 2YWYA 2FH8A 4YHPA 4APQC 2Q8AL 4ERSL 5E2TH 2ICCA 3QRFM 1KFAL 2VERN 3QQNA 1IC4L 4HQQL 4KPHH 4FQCH 4MWFA 4I0PC 1S7VA 2IG2H 4QRRA 2SEBA 5CBAB 2WANA 3VFGL 1KCSL 4HIIB 5D2LA 2WWKO 2MCG1 3HUJE 1IKFL 3OF6D 1KJ2A 3VGHA 1K5NA 2BVEA 2FJFB 4CL7A 4PJBA 1X5FA 3ZYZA 5TQ2L 5J11C 4RMRA 5DZNA 5T1KB 2IH1A 5DC4B 1HHGB 3W0WA 1K4DA 3IDGB 5IVXA 3IGAB 3ZE2E 1NCBH 3QAZC 1UWEL 2BK8A 4GXVH 4UTAH 2YBRB 1EEYA 4UQ2A 4HWNA 2UZXB 1CF8H 2XPGA 4JFXA 4N90E 1HWHB 1I7RB 1R3IH 3B9KA 5MEND 3EDEA 1GGBH 3EDFA 1SYSA 3WS6C 1YY8A 2VDRH 2XV6B 3O0RH 5LGHH 3MRIB 3I9GH 4CJ0A 5DJYA 3P30H 5ID1B 4HGMA 1SM3L 4MNQA 5H8DA 3MV7A 4EQ3A 3N06B 4CN6A 3P2TA 4MJ5A 1G84A 1X44A 2NY2D 3D3VE 5IHBA 4YDLB 4MX7A 2C26A 2GY5A 2R56H 5TE6H 1AO7D 3U0TB 2OZ4L 1TCRB 1ZS8B 4AIZA 3ULVF 1OTSD 4PTUB 3BD5A 4Z7WF 4Y89A 1TQBB 5AZ2H 5C0BB 5J11B 1RZGA 3QEQB 1AXIB 1KG0B 5BO1L 4OGAD 3F12B 3QO0B 1JPTH 5I1CL 3PJSA 4I3GA 4MNQB 3HNSL 3BP7B 2WBJD 3L5JA 1RZ7H 1AGBA 2FJHA 5E2VH 4Y2DD 3QAZB 4K7PH 2LU4A 5DHXB 2BDNH 3C5ZB 1JPSL 1CLYL 2VL4A 4BH7B 1AR1C 5I18L 5KSAD 1BQLL 1S3KL 4NCC2 3PABA 3ORJA 4JPKH 2R39A 1F8TH 1KEMH 5I66B 1X7QB 2P5EE 5AWNH 2H26B 3K4DA 3RZCD 1SVZA 4XAWL 3LQZA 1WBZA 3T77A 4KUCD 1TVBA 4MXWL 5IB1A 4ODUA 3JWDL 4QRTA 5BZWB 3C5JB 1E4WH 4PD4K 5FKPB 5SWSE 3SO3B 4YHOL 5DHYB 2C4FU 2CDFA 3DMMA 3WSQL 1AQKH 1NAMH 5F21B 5SWZD 2FJGB 3WDHA 5F3BB 3T0EC 4HAGA 5C0DB 3CFDB 3T0ED 4XHJC 4TVSa 4S1SL 5F9OL 4F7PA 4Z76A 4LFHG 1S9YA 5I17A 2J8UB 1FDLH 4NDMA 3C8DA 1XGTA 3VXRD 1HIMH 2R0WL 4P2OA 2KPNA 4QOKD 4GKNB 1F97A 5I8OL 4OGZA 5GS1A 1JF1A 2CK0H 3LS4H 2AJZA 5K9KB 3KS0H 1KTDA 4BM7A 1UENA 5C7XH 4R96B 3TT3L 3RZCC 4D0CB 1ZHBA 6FABL 4Y19E 2LABA 4YWGL 3QA3B 1CDJA 4X99A 5E4IA 1WV7T 2JJTA 3PP3K 3S34H 2QSTA 3NA9H 1L7IH 1JNLH 4IRSD 2GJ6A 3BUTA 5D9SA 3MFFA 4PS4H 1I7TB 3MJ9A 4P2OC 3ARQA 5LBSH 5HHNB 4JPWH 4U1IB 5CEYA 4PREA 4IRJA 3NZHL 3VE0A 3SO3C 3TH3T 5GGUA 5I18H 1TZIB 5HY9B 4LBEA 5FXCH 1T0MB 4UV7H 4ZTOH 2F8VA 4X6CE 3S98A 1G7JB 4XBPB 2NXYD 5E7BA 3OXSA 3UJTH 3QULA 3N1QC 1M7DA 2F53D 3S36H 2PKDA 3V8OA 5I9QC 1ADQH 4OZHB 3FO2B 3LN5B 1CI5A 4S0SD 3FFDB 4PTTA 4ZOAA 3S37L 1MREH 1KXTB 1QEWB 5J06A 1LO5B 2CXGA 5GGVY 3D87B 5DJYB 2ARJQ 5DK0B 2WUBH 1MEXL 5EIIB 1AGCA 1Q9OB 4NKDA 4JO1H 3WEXB 3H7BA 4HUUB 3RL1B 4YDJB 4Z9KB 4DGVL 3V7AG 2PXYB 1E28B 4RAHA 1BQHG 1FYTB 1JI1A 1QFUH 3X12A 5DJDB 3TIDB 3ZE0F 1FV1A 5F7KC 3HR6A 5DYOA 1UXSA 3FQTB 3RL2A 5HD8C 4K9EC 3DX9B 5SWZA 1RULH 2W0KA 4NO2B 3DI2B 3LH2L 3FHAA 3UTSE 4K2UL 4NRXA 4K55A 4HFWB 1UACL 3TPUA 2ZWLT 3S5LG 4JFEB 2D2OA 3TBVA 5I9QB 4MNGB 2X1XR 1IZJA 5D96B 3CIQA 4KJPC 5TFSH 2HN7A 4PYGA 2OTUA 1MEXH 3GI8H 3ILPA 4P2RE 4PJFB 3C6LA 2ENSA 1S9VB 5D1XC 3FB6A 1E4XL 1TTUA 3QYCA 5FA3A 4JFOB 5M7QA 1BX2B 4YHZH 4V2CB 2PXYC 3P77B 1BQHA 2P45B 3KJ4C 2IADB 4YHIB 4U1LA 1YMMA 4OV5B 1CFTA 4HS8L 4DEPC 4K9EL 1O7VA 3V6OC 5D1XA 4FQQB 5FM5M 4GKSA 4C83A 5DWUH 4X9IA 4QHNB 4FFWC 3RIAK 3CFBB 5EO9B 2O5XL 4TRPH 5T3ZE 4R9HA 1XEDA 5EC2A 1S7SA 4J3WA 1ACYL 5DJ6B 4Y4HD 5H94A 1ZANH 1P7HL 4YXHH 1ACYH 1C7SA 3QPQD 4H5SA 3RVTC 3QWOB 3SDCA 5H35A 2VXVL 5HHNA 4TTDC 4GG6F 2OMNA 1MAKA 5BRZA 1F4XH 1T1YA 4FP8L 4RMUA 3MJ7A 5CJBA 1ZT4A 4YX2H 4LNRB 3KJ4B 1M71A 2YK1H 1VACB 4M48H 1MELA 3K4ZA 3VFMA 3QJFB 4OFIA 1B4JL 2DQCH 1JFQL 1I3RA 1PG7H 4X9GA 4P5TD 4X5XB 4XB7A 1U3ZA 2DQGL 1F4YH 4BFIB 1MIML 5GZNC 3EO0B 5F6HJ 3QUMB 3K4AA 3R8BB 4MAYB 4OZFA 1BAFH 1EV2E 2VDLL 4R3SB 1RUQL 5I8EB 2I60H 2P5EA 2H2PD 1CICC 2PO6C 5HGGS 1EVUA 5KAQG 3BWUC 4QXTA 3CH1A 2YMXH 4YR6A 1AGDB 4RDQF 1KCVL 1WT5A 1WVZA 3HZYA 2A74A 1GGBL 5SWSA 4EJ1C 1W72H 2P8LB 2XTJE 4Z0BL 1ZSDA 1LK2B 2ZUVA 2J8UF 3C5SA 2VLJD 4DN3H 3CD4A 5JHLH 2UUDK 3GJFA 4Y4HA 4ZO6A 1NGYA 5CLWA 5F7FA 1DUYA 4N0CC 3O8XD 1V3LA 2VB5A 3DLQR 4I3SL 4J3TA 4ODXB 4RMSA 3F7VA 4P23A 5A1AA 1V05A 5GS1B 4DUXA 2KQNA 2FD6H 1PYWB 4F58L 2COQA 3B83A 3DO7A 4WI3A 4LLDB 4FQCL 1NEZA 1UJ3C 3GUTA 3RX7A 3VI4E 1J05B 1S9YB 2VE6A 3VJ6A 2A1WL 5CD3B 5CD5D 3LRHA 1QA9A 4NKOB 3O0RL 4FOMA 3VA6A 2VZUA 4B53A 2R1XB 5EORL 3F58L 3SPVA 2BXZA 1KB9J 4NBYB 1HWGB 2ADJA 3P4OB 4MVBD 4OLUL 5JR1L 2P49B 1TPXB 1RUML 1X4XA 3MLTA 4UBDD 1KT2B 3C6LD 4NQVB 1ZMYA 4X4XB 1VESA 3ARFA 1CGVA 4N68A 3O2VL 1G7MB 3MV9E 5DS8A 2XG5A 3UBXI 1ETZB 1FYTD 4JQVC 1YNTA 3D2UB 4JHWH 2IFFL 4OZFH 4UTAL 4XVSL 3CMGA 1WBXA 2X1QA 4KKNA 1HH6A 1U42A 5GSVA 2A1WH 4K8RC 4L8SC 4HIXL 3ARDC 2DKMA 3JVGA 3WE6A 1CG9A 3JV6B 3ZHLA 2GQHA 2Z9TA 1ZLUK 1TVHA 4KJWD 5GHWH 4D2NA 5F7HA 5IMOB 1UJTA 3TNMA 3SKNB 3UTTD 1NCCL 3MJ8B 1YJDH 5I73B 2XZAH 3WV0A 1RZIA 1XF3A 4YEFA 3ARBA 2WBWB 1JNNH 3CLFH 4U1KA 4PB9H 5F88B 3MRJA 3GRWL 1PBYA 3ULSA 3R06B 2DQHL 4L8SA 5SWZE 3ARDA 1BWMA 4LLYA 1GAFL 3EYVB 3HC0B 3LDBB 4WW2A 1HHIB 2WP3T 2VDOH 5CWSA 5IHZB 5ICZA 4IRSB 3OB8A 4ELMF 1F8TL 2YD6A 2LAAA 4N1EA 5BVPL 2H9GB 4YH6A 3MCLH 1MRCH 1QQDB 1CLYH 4IOFD 1BFTA 3FQRA 5ALBL 3PL6A 3HG1A 1XFPA 1ZLSH 2P47B 2GFBB 5F97E 4JY4A 4I2XE 3L6FB 3UZEA 5CEZL 5KOVC 4XMPL 4BZYA 3BKYH 2DYPA 1I3GH 5IB4A 4G5ZH 1F4WH 3VMOA 1JF6A 5IHZA 1ULVA 4HWEH 2APXA 3QG6A 3ZLQC 3G6DL 3VFNA 1E6JH 1U36A 3CPLB 3DVNB 4M6ML 4Z6AT 1BD2E 4CNIB 5ICYA 5E00B 5KS9F 4FFYH 2FGWH 1IAKB 1MWAH 4PBXA 3MRMA 4LAJH 4LRNH 3GSNL 3T0VA 4I8DA 5GJTL 3Q6GH 1MCWW 4U6YB 4HUNB 4W68A 1TNMA 1G9EA 3NCEB 2APVA 1I1FB 5C71A 5FYLD 2NY1B 3QJHA 2IPKB 1I1CA 3PWNA 3QUKA 4HUKB 2E9WA 2HYMA 4B50A 5B3JE 3OQ3B 3KPRD 2G2RA 1C16A 3L5WA 2FX9H 1I8KA 4YIQB 1TQCB 1F6FB 4KK6D 1DCLA 5I30L 5FHAL 5DYOB 5DRZA 1LILA 2XICA 2Y1VA 4LCWA 4PUBL 1CE1H 3SGKC 3UPCA 4M4RA 3RP1A 2X4PA 4FMFA 1SBSH 5IBUG 4HHAA 3UEZA 3CFCH 3DYPA 3Q1SL 1ZGLA 4MS8D 1QLFA 4WWKD 3ZKND 5HYJD 3SE4C 3SKJH 1DR9A 1FVEB 3QIBA 2OP4L 5DMKB 1UB6A 5DMIL 1CXIA 4ODBD 3PGCA 3HZMB 1EGJH 4WTXA 3O6KL 1S8DB 2D7TH 3MLZL 4KKBD 3ZT5A 1K9TA 2VKWA 2ENYA 3PWNB 3AY4A 3T65B 2LV4A 3MODH 5J6GA 1GHFH 3CDGB 1A22B 2G9HA 3UZQA 2F5AH 1MRFL 5AAWA 2RQ8A 4NQSA 4HBCL 2DQJH 2OK0L 4J4PD 1YMMB 5F96L 1J88A 2DD8H 5ID1A 4KMTH 3S96A 5KSAC 4QYOA 1NC2A 3GI8L 3WIIL 1IZKA 1BJMA 2A6IA 1B4RA 3T3MF 5HHXH 2PF6A 1Q9KA 4KK8C 3MLRH 4WV1A 4G42A 4CVXA 4OM0H 1OGAD 5CGTA 1OARL 3CZFB 2H32A 4H8WC 5C0EA 4S1QL 3VFVA 3L3IB 4KAQL 5DVOA 1F6AB 1IQDA 3KJ6H 2AV1A 5AG9A 5FV2A 2VXTL 1MFAH 4RMWA 2W9LA 4YZFF 4PGCA 4M43H 3MA9H 3BE1H 2ERJC 3A67H 2X1OA 3W5NA 1R6VA 2MPAL 1FFNB 1FGNH 2VXSH 3MLUH 4MCZB 1NMAL 1QEWA 1PG7W 3MRJB 2H41A 3L5IA 2I07A 4UQ3A 3SE9H 1B0RB 2ZNXA 4UT9H 2B2XH 5I2IA 2JF1A 2JB5H 3QDGD 4MA3A 3HRZA 2CIIA 1P69B 3SE3A 1SJHA 3KYMB 3TO4B 4LU5L 4NP4L 4HV8B 4F7MB 4CMMB 3MLVL 3QDMD 1F4AA 2UWEF 4L4JA 2PXYA 3IRZA 4I3RL 5C09D 5IKCB 3OAZK 8FABA 2CRIA 1M05A 1BVLA 1PSKH 3BGMA 1ZT4B 3HE7C 3KNBB 5IV2A 4P46B 5I1LA 2DTMH 3HNTH 1A64A 1LO0L 1VSCA 4FQHA 4KKAC 1O7SA 1JHLH 1Q9WB 4ODSL 4DKEL 3VFPB 4U6XA 2J3SA 3MA9L 5GGTL 1B3JA 4XI5C 4BJLA 5IMKB 2W0FA 4PJEF 3V4UL 3SKJL 3WKML 4MLIA 3FQWB 4HT1H 3AY4C 3B43A 4LPWA 1BVLB 1AKJA 3PP3H 3HE6D 3U46A 4R0LB 4N0FA 2GITA 5DRWB 1ETZA 1DEEB 2ICEB 5D7JC 3IJSA 3NA4A 1DBJH 2H2SC 2VH5H 3WIFB 3ZDXE 4XXCC 1NC4D 1B2WH 4K3HA 3WL9B 5IMKA 3SKMA 4PBVC 4LASH 1AC6A 3TO4C 3JUZA 5F9AC 2QADD 2YR3A 4MXQD 2GSIB 4KHXH 4OFYA 3SDXA 1IMHC 2P5WE 1PD6A 4DUWA 2IADA 1PYWA 2D7PA 5I1LB 5F1SA 1JYNA 3QEUB 2RCSH 4P46C 1NUNB 4XPHH 3TVMD 3T8XB 1CDYA 4NC1C 2YK1L 4R4NC 2YZ1A 3HNVH 5CCKH 5SX4H 3NCBB 4XP4L 2D0GA 3CXHK 5I1GH 1I1RA 1MPAL 4MA7L 4OFPA 4ZUSA 1JMZA 4RFEA 1JZ4A 2IAMD 1BIIB 4LSQH 4O5LL 1RULL 1DBJL 4DZBA 4PRPB 1FL6A 1AGFB 3HE6B 1BBDH 1IAII 1B2WL 4FZ8L 4AEIL 1LNUA 4NM4L 3RUGB 3S96B 2Z8WC 5CJ5A 2MTPA 2XZQH 3GMQA 5JHDA 1HILB 1J1OH 1OF2B 5KAQF 5L9DH 4JPIB 3O4LE 1GYAA 4OF8A 4LP5A 5E8NB 2DYPD 2Q6WA 4G7YH 4ELME 4GG6B 3WKMH 1HQRA 1KJ2L 4CVXB 3MLPA 1OSPH 3RWEA 1OM3H 3NGBB 3HE7A 3L6FA 1R24B 4Y4KD 3QEHA 3QXDA 4B7LA 4AG4H 1NGXA 3D0LA 4NKDB 4Y5YB 1YJDL 2W65B 4JFDD 4NJ9H 2HFEA 4J1UA 1S5HB 3LN4B 3QUMA 3OSKA 2BC4A 1RHFA 4JAMA 1M6OA 2FECI 3QNYB 4OLYH 1F02I 5HDQL 5IFJB 1SYSB 1IC4H 2UV3A 3MLYL 3NOIA 5BV7B 3K80A 5FEBA 5ICXA 1RJZB 2AQ1A 5DFTA 3T2NH 4MJ6A 4HIXH 1NAKH 1PKQE 2X4QB 3I9GL 1N5AB 4QOKB 3WNNA 5AYUL 4JFDA 4QF1B 4YE4H 4JPIA 1K85A 2MHAA 3QT2A 1MFEL 1KTLB 2ZSWA 5IOPA 3KPLB 5JPMB 2PW2A 4HS3A 2CKBA 1OGAB 1FVEA 4YQXL 2XY1A 4WV1C 3LMJL 3PUCA 3HFMH 3SGEI 1J0YA 4NFBA 3TH4T 4O2FA 3D18A 3TC9A 2EDOA 4EDXB 5C0AE 1NCBL 4JGJA 3BPLC 4S1DD 4G3YL 4ZQKA 5H37G 3VWKA 1JPFB 3REVB 1MJUH 3OBAA 3BGFC 1QFWH 2NY5C 3Q5YA 5CEZE 1H8SA 1FFPA 5EB9A 1P7QA 3F58H 4IOIA 1VERA 3VFGH 4Q9QH 4XVTH 5DJ0A 2CRMA 5F6HI 1QLEH 2P5WD 2FCBA 5DMGD 1BBJB 4PGDB 3N85H 1Z0MA 3DXAA 3WS6A 1JPFA 3TVMA 1ZV5A 1FP5A 4CNIA 5ICYB 3SE8L 2PTTA 4LHUG 3WNPA 4AEHL 1LDPL 4QRPB 3ILPB 2H3NA 1UB5A