3MJ9A

Crystal structure of jaml in complex with the stimulatory antibody hl4e10
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
229
structure length
229
Chain Sequence
VSSPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVLPEEPRDLRVRVGDTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVGKLESRKTIVLHVVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Junctional adhesion molecule-like
publication title Molecular insights into gamma delta T cell costimulation by an anti-JAML antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 62
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9A02
5IR1B 3ARFB 2VABA 4V1DB 3VFSB 1Q9LB 3W0WD 1NDGB 2F5BH 3V6OE 1NBQA 1NGWA 4XP4L 5T1KB 1QSEB 3SBWA 3VWKB 3CFKB 4AEIH 1DUYA 4KRLB 2VRAA 3HI5H 1IAII 3BEWB 3RX8A 1NGXA 4FQHA 3NCYP 3IKCA 1FAIH 3OPZL 4IRJA 1XGYL 5ALBL 3QIUD 1IKNC 1FNSH 1WVZA 4HBCH 4KY1H 2DLGA 2AJ3A 3QEQA 4I48B 1NCUA 2Y1VA 5CCKL 4IEFB 3OR7B 1JL8A 4DAGH 1WIUA 3HE6A 3P9WB 2IANB 2M1KA 5AWNH 1JBJA 1JYWA 1J1OH 1XEDA 1A7BA 3OJVC 4M1GH 1Q9WB 2VMFA 4I8DA 3JV5A 5B4MC 4IJ3B 1QSFD 3QWOA 2FL5B 3JV4A 2OL3L 4HIXL 5F1SA 3AB0C 5GISH 2AS5M 1JHLL 3GRWH 1QQDB 3CVIH 3DSFH 1PG7W 1LEIB 4OCWH 1WBXA 2XZCL 3X12A 1ETZB 1FNLA 2GTWA 2QHRL 5L2JB 1N6QL 4JFED 2J2ZA 3WDJA 3A67L 4Z76B 1MCKA 4HJ0C 4ZUUB 5CILL 1U6AH 5CKAA 4WHDA 3EJZC 1PW3A 4L8CB 3EO0B 4WWKC 4P57B 4KK9D 5E1AB 5AYQA 2GCYB 4LHUD 3V6ZA 3R0NA 3K4AA 3RWJB 4M93B 1D3CA 4PRID 5CEZE 2AEQL 1CE6A 1U8NA 4I77L 2YD2A 3OMZA 5EWIH 2J8HA 2BNRA 1PG7L 3GSXB 4PYGA 5DD0H 4OJFH 5C0AB 1RJLB 3IJHA 1HE7A 3TPUA 3CD4A 1RJYA 4JN2A 1NKRA 2VDKL 4GW1B 3AC0A 4PJHA 4LCWE 2DQTL 3OKKA 4U6YA 5IFJA 4TUJB 2AJVL 1AJ7H 4APQB 4M7ZC 4ZFFA 4HF5H 1JGLH 5SWZD 4MXQC 5E2TH 3QI9B 4WI2A 4KK8C 4WDIB 5C6TL 2YZ1A 1A6AB 5KSBA 3QUZB 3DX8A 3QEUB 4TVPE 4CDGC 4KRNA 5ESQA 1ORSA 2R4SH 1AXTL 4C57C 2ZOKA 3FQTB 3OKLA 3HNVH 3QT2A 4RA0C 3P9MB 3ZKND 2M2DA 4YHLH 3CZFA 3L5WB 3GHEH 2ZUUA 4HUVB 3U30B 2ZG1A 3D3VE 5DEGB 2YA0A 2NMSA 2WUBL 4LHJB 5MEOA 2VLRB 3N85L 3VFUA 3VGGA 1BQSA 1RVFH 3F12A 4CNIB 5ISZA 4MXWL 5IKCA 3MGAA 3RVTD 3Q48A 2MHAA 3RPIB 4NM8H 4PJ7E 2NTSP 4KVCH 4HGWB 3ECBB 9CGTA 5JQHC 5CZXD 2IBBA 3TA3C 2IADB 1PFCA 4J3TA 3NFPA 4ZUWA 2JTDA 4EVNB 2X70A 1UFUA 4HUMB 1EIBA 1KB5B 2Z31C 1MLCB 5C6WH 1AGBA 5T3XD 1OP5H 6FABL 1UM5L 2FEDC 3IDUA 4HQQH 1CVSC 3PWUA 2WV3A 3VXSE 5HVHC 5C09B 3N1PC 5EZLB 4NN6B 4MJ5B 1G7HA 2APWA 1HHJA 4GMSH 1BFVH 3OKOB 4PLKD 5DTFA 5EC2B 2ZSWB 2JJVA 4I3SL 3BUTA 3I85A 3QWQB 1N26A 1P4LB 1ZV5A 4F7MA 4X4MA 2B7DT 5EA0L 4L5FH 3TIEB 1WGOA 1ZE3C 2E9WA 3C6LD 4X6EA 3UXFA 3VXUE 3P2TA 3RRQA 2R56H 3MODH 3H3BC 4MNQD 4FQ1H 4NO2A 5TDPA 2XTJC 2CKBB 5ABDE 5DUMH 1D5XA 1D9KA 1WZ1H 1T1WB 2C4FU 5ELIA 1VFOA 2HLFC 4JPKL 3ZZ1A 5IJVB 4G8GD 5LXGH 2Q8AL 1OOAA 3LN5B 5F9OL 3KPSD 3GSNH 1Z9MA 2A0LC 4LCUB 4LL9A 1TNNA 2ICEB 3LIZL 4JHWH 5JORA 2CH8A 3ZTJG 4L8SB 1A7QL 4G7YL 2V2WA 5J3HD 1P5VA 1OGTB 3J7HA 2E27H 3LDBB 4HZLB 2NXZB 4ELKA 4KZEH 2EYRB 4Z7WB 5D96B 1MI5D 2Y7QA 4Z0XB 1T1YB 3G6JE 3WFBH 4RISL 5E00B 3HS0B 4J3VA 3T0DA 4F58H 2BY0A 3STLB 3EO9L 1T1XB 5AZ2L 5D7KD 3FRUA 3QFJD 2DQUH 4CJ0A 5D1XA 5KJRL 4HWUA 2BNUA 1KTDA 4JGUA 1SJHB 1K4CA 3PP3K 4L4TD 3TH3T 5KBNC 4RFNB 3KR3L 1NFIB 2NX5B 4L1DA 4TNWF 2YK1H 3G6JF 1KIRA 1TPXB 2HLAA 3T2QA 4PBXA 4UV7H 4J6RL 5C0JA 1UZ8A 5EU5B 1BFSA 1MAJA 4U7SA 5I16B 2V7HB 3MRGA 1FNEA 3K1KC 2MSPA 5B21A 3MCKB 2X1OA 1JF1B 2NZIA 4JRXE 4BZ2L 1EHXA 2FB4H 4X6BA 1TCRB 1YEEH 5I19H 4OZFG 2ATKB 3MROA 3BWUC 3MV7E 3RA7H 3H7BB 4N9GB 5JXAL 2X4PB 1LE5A 3MRFA 4F80A 4XX1G 3IFPB 2OK0H 1T2QH 3JWOH 1ZVHA 3UJJL 2XQBL 3JWDC 4PTUB 3HC0A 5CKGA 1IT9L 1IAIL 3WFDL 4Z6AT 2VLKD 4H1LG 5HDOA 3V52H 3L3JB 1WTLA 3S7GA 4G3YH 2IAMD 4O2CB 4XNUL 4FOMA 3WFHB 4E41A 1BVZA 4HDIB 3MSPA 3QPQD 2XT1B 2CRMA 4HAFA 3ZYZA 1YEHH 4Q9BA 3ILPB 5E2UH 3KPOA 5CP7B 1E0OB 2OTWA 3QUYD 5IB5A 1UJ3B 2A6KA 1PKQA 3FFDA 4LSUL 3L7EB 5HHOB 2RQ8A 1UCBH 4I3RH 5IT2H 1DQJA 2PYFA 3HR6A 2ICWB 1KULA 4XPGL 1JZ7A 2J8UB 3MA7B 3MRQB 5F7DA 4GQ9L 5DD3H 2VITB 5F3BB 3U4AA 1D5BB 2X7LB 2CXGA 3HPJB 3VRIA 1FYTE 3W2DL 1T0NB 4ODUA 1OCWL 1JRHI 1WUNT 4X6CA 4EI5A 5F71A 5A40E 5I30H 1BZ7A 2CUHA 2IFFH 1OPGH 3NA9H 5AG9A 2NY4D 2PW2A 2PYEB 1R3IL 4LOUC 4DGVH 2X4NA 1DBML 4PRHA 1FRGL 4OFKA 3KDMA 1GGUA 5DJXA 5HYFA 4R96A 2CLVA 3ESVF 4NQDA 1JPTH 1TMCB 4ESKA 3OKEA 4JY6B 4TULL 1V8HA 4LLDA 1A9BA 1U2HA 1KELH 3P0YH 4YEEA 5HHPA 2XN9A 4NHCL 1B88A 5FUZL 1NEUA 1NAMB 4U1GC 3NIGF 3CXDH 3LKRA 3VRLE 2CGRH 4K3JH 1J0KA 5C70A 3DI3B 1DLFH 1ZWIA 2QKIB 3PGCA 1P6AB 4JHZA 1A7RL 3D0LB 4OM1H 3BKJL 4JY4B 3VCLB 1T03L 4XMLL 5DK0A 4IRJD 3VFOA 3WS6C 4UTAL 3QEQD 2VTFA 1A6WH 3VRLF 1NSNL 4OD1H 3U82B 1KCUL 5F3HB 1KPVB 2VDNH 4UINH 4RAVA 1AKJA 1QRNE 3BHBA 3L6FB 1G84A 1BX2A 4GKZB 1T20A 4PJDF 2GY5A 3EO1B 5LJYH 4ETQB 1XH3A 1RK1B 4RAHA 2XTJE 3OAZK 3RUGF 4KTEL 3TWCL 1BQHA 1A4JB 3KWWB 4A6YH 4IOIB 1TITA 3WFZA 1ZLSL 3MNVB 3TIDA 1HYRC 1MJUL 3MRBB 2F74B 3QH3A 4XTRD 4Y4HB 3ZTNL 1IJ9A 1QP1A 5D93B 1GC1C 3ZKMC 4IMKC 4DCQA 2VE6A 3FQWA 2A74A 3GSWB 3HAEB 5C07B 2V9QA 3U1SL 2XZAH 2YXFA 3UBXA 1YJDL 2V17L 4Z7UF 3O11A 4HIJA 1BD2B 3SEPA 1BF2A 1N7ML 3MLYL 1YC8A 4KZDL 1MIEH 2Q76B 1F11A 3QG6B 3EFFA 1RJCA 3CPLA 4KJYA 1VPOH 5IB2A 4PP1D 3H0TA 3K4ZA 2OXHA 3IS1X 3B2VH 4TSBH 1DVFB 4NFDA 2V7NB 5H37G 4OD2B 4QNPE 1WFOA 1OW0C 1H3WM 1E6JL 3HZYA 1VDGA 4FQIH 3M17A 3CZJA 4LSPH 4ZQKB 4KVNL 2GJ6A 5HYQB 1UQSB 5DD5L 1BFOA 4RIRA 4PJXE 4QNPF 5HYEA 15C8H 5I74B 2MJWA 1SHMA 2VXTL 2EZ0D 5FGCE 4F7TB 3DMMC 4P4RB 2JCCB 3NFNB 2C3VA 1OAZH 1MCDA 3VXQB 2XA8H 3WL9A 1BMGA 1NCTA 3QDMD 4S1QH 3DX6A 1B4RA 5ISZD 1BREA 4G5ZL 5ID1A 4PJXF 1FFNB 3GKZA 3HFML 2DM2A 5DDHA 4GAGH 2YUXA 4LQFH 1AO7A 3IU3A 1RUPL 4K8RD 4HIEB 3CLEL 2W65B 1RJZB 3CVHA 4M7KL 3VFMB 2Y25A 2AXFB 1SYVB 2HT2D 2JKXA 5ECJE 4YEFA 2ENYA 5CJBA 1KNOB 1J1PH 3QP3A 1A47A 1KJ2A 3D9AH 4PRBB 4PUBL 4GW5B 1U8JA 4CN6A 1CR9L 4P46A 4JO2H 3MRKA 3LKNA 4KTYA 1MCWM 3MV8B 2DAVA 2J6EL 3P77A 1K5NA 1NKOA 3LVEA 2W0KA 4LCYB 2HVJB 1A6VL 3H2WA 2MQ3A 2GSIB 4JO1L 1RUAH 3FT4B 3MRHA 1DQML 4KI5D 2FYYA 4XNQA 2R2CA 4JFXB 1MAMH 1G0DA 2LFGA 4NC1E 4AG4L 1LK3H 2PXYB 1D9KD 3A6CH 3D2UA 4PJGF 4QT5B 1YECH 3QHFL 2UWEA 1A7PL 3EDFA 2RBLA 3LQZB 4ZG1A 4M48H 2R1YA 3GSNA 1W8NA 1Y6KR 5E9DD 3FB8B 3OHXB 3S36X 2Q3AA 4JFDA 4U1LA 3LH2L 4PY7B 5I17A 4XP4H 1JK8B 3SDAA 1R3JA 3H9SE 2OZ4A 1NBZA 3VI4E 3UJIL 3V4VH 4PJAE 1U3YA 4HUXB 1GIGL 3G6AB 2P5WA 1XIWB 3OPZH 5JOPD 1DEEA 3I3DA 3G5VA 5ALBH 4UV4L 5ALCH 1K2DB 1HSBB 5FGBC 2VNCA 5CIPB 5CCKH 4HFUH 1L0YA 1JNNH 4BFGA 4PV8A 3DTXA 3BRFA 3VI4F 4PJAF 2IBGA 1JRHL 2H9GA 2P24B 3HCVB 4S1DD 2NNAA 2Q6WB 3QIBB 1U2CA 4F33A 3MTRA 2YPVL 4HIXH 4JAMA 1M7DB 2Q7YB 1CCZA 1ZHKA 2CDFB 4P2RA 4NQCA 3RVVC 5HYIA 4NO0B 4WW2A 1I3RA 2XZCH 1DN0A 4O9HL 3WUWB 3T4AA 2Z0BA 4U1KA 3QDJA 1N59A 3A67H 2FNBA 5CILH 1S7XA 2ADJB 4FQQA 4LVHC 1XGUA 5HPMA 2YRZA 4CVXB 3E1F1 4DN3L 1MVUB 1MFAL 4HIIA 4WENB 4HK3J 3RTQB 4PJ8C 4JM2B 1GVIA 2X9YA 4P3WA 1S78D 4I77H 1AIFA 1MWAA 1MFEL 3HRPA 4LIQH 5IUSA 3RGVD 1WZLA 2HTLC 3VGFA 4Y8DC 1PG7H 3MMEB 1XAUA 5DR5L 1LDPL 1X5HA 4DOHB 2VDKH 1YY9D 4Y19D 2E8ZA 1U8KB 4EQ3A 4JQXA 4PGCB 3BDYL 2DQTH 4AEHH 3WNLA 2JJSC 4LLMA 5IJKC 3E6HA 4JE4B 2HT4D 3HE7D 1NGPL 1JPST 4XCFL 4P9HL 1EEYB 3WIHL 5C6TH 4PJ7B 4PB0L 5J6GA 4GBXB 2P4AB 4PY8I 1UEYA 3U7AA 3B5GA 3MUY1 1AXTH 2R2EB 1N4XH 3LQAC 3NFSL 4Q2ZB 3B9EA 3O6LL 4AEEA 4KROD 4TVPL 4Y5XA 5D2NE 2DL9A 1WQVT 4EI5D 1YEFL 3VFVA 5JA8B 4G43B 1UM6L 4QF1A 2WUBH 5ICXB 3K4DA 4WNQB 5E5MB 3RDTC 2DQJL 3VXSB 3BAEL 4PRHD 1OTTD 2JLLA 5C7XH 2Q8BL 4MJIE 4PJBE 4KH2A 4JRYB 3ARTA 4MXWH 1TFHA 5IHBA 2MQCA 4NQDD 2PO6D 3HI6H 2H3NA 3QXAA 3O3DA 2DQCL 2GYSA 4JFHD 1ZLWH 1P9MC 3UTOA 3PL6C 2BVYA 3C87A 3IVKA 4RAUA 3VXUB 1EHAA 3QNYB 3ARVA 2XN9D 4JFYB 5C0DA 4D9QD 3DURB 4MGXA 5C0BA 4HFWB 4MA8L 4PJBF 4ZYKA 2BOCB 3D85D 2GUOB 4HUNB 4P5MB 5EOQL 5GSVB 1JF6A 1BWMA 1T22A 4HJGB 4MNGA 4GRLB 6FABH 2WWMC 4GRMA 5I1IL 4ZDHA 1HHKA 3ZO0A 3GSQA 5IFHL 5T3ZE 4H8WL 3INUL 4QXTB 4XT1C 1JNLL 1X5YA 2OSLA 2ZOLB 4I3SH 2Y4SA 2ZUQC 2LABA 4NQXB 1V3LA 5EA0H 1AKJD 3WKML 4NT6A 4X7FC 1AY1H 1YQ2A 2HKHL 4X6DF 1NQBA 5IHZA 1H0DA 4OLXL 3QA3B 1T6VN 3TBYA 4NM4H 2X89A 3RY6A 1A1OA 2GJZA 1DBJH 2VZSA 1KLUB 5C0GB 4HLZG 4HIHB 5FA3B 1KBGH 1MCOH 4ONOA 3TP4A 4BZ1H 2Q8AH 2GT9A 2FJGA 1QZ1A 4XI5D 5F9OH 3IDGB 4X8JA 1IQDB 3KPMB 4ENEC 2J3SA 4U1NA 2DQFA 4BFBD 1B6DA 3LIZH 1PKOA 2VJXA 4YBQD 5GGRY 1A7QH 3AB0B 4L3CA 4HKXA 1QSFE 2KH2B 4U49A 4GLRI 2QBWA 1WIPA 3QZWA 3UDWC 3ZMRA 3B83A 1T7WA 3TVMC 4O02H 4RISH 3OR6A 3HG1B 2IBZX 3BW9B 4XCYB 2Y5EA 3EO9H 5K9QG 4EDWL 3CFCH 5AZ2H 2XWBA 2AABL 3BPCB 4R7NB 2YUVA 3QNZA 3SE8L 4JFEE 4P2QA 3OXSA 5GZND 4M02A 4WWKB 1S9KC 3W81A 4LGRB 1Q9OB 5KJRH 4LLAA 5F7KC 3TT1L 3SGKC 3U48A 4OI7A 1U8LB 1XGPB 5HGGS 3KR3H 2B39A 5SX4H 1RMFH 1OAUL 1RIHH 3TGXA 5A2FA 1ULVA 4PRIE 4DZ8A 1RY7B 1S7TA 4GRWE 3R8QA 5BRZB 5I8CB 4J6RH 1O7VA 5F7MC 4XMPL 4LNRA 4G42B 3U36A 1M1SA 3L3GB 3R1GL 4LLWA 5CINL 5DJ2A 1CG9B 4GQPH 1IEBA 1BZ9B 2GJ6D 3DXAA 4NUJB 3NCMA 3CFEA 3RWEA 2YPLA 3EDEA 2WBJA 4NOBA 1VACA 4M7ZB 2VXQL 1A0QL 1CU4L 4GRWF 4MAYA 2FBJL 5FUCE 4LEOB 3ROLB 1JPSL 4NOFA 5JXAH 1RIVL 5SWZE 2EDXA 3KPPB 3LV3A 2H45A 4K9EC 3TNMB 3DUUB 5ESAA 3RNQA 4OGZA 4ELMA 3WYRA 4ZFOB 5E7FA 4XAWL 1VEMA 4MVBD 2BJML 3UJJH 2XQBH 2OR7A 4XNZC 5IOPB 5D2LB 3LEYH 2X4RA 4Y16C 1IT9H 2VLLA 1IAIH 3WFDH 3BPLC 4XNUH 1EEQA 3LB6C 5EPMB 1FV1A 4I3GA 3T2OA 2NY4C 1DDHB 3I9GL 5BZDA 1YC7A 1AO7D 1ORQB 2O61B 1V5JA 3C60C 5BJTB 1DTUA 3I84A 5IVXE 1YNTA 4CMMA 5KVMC 2RCSL 3QISA 4U6HA 4G9FB 4ZUTB 5KN5A 2HH0L 3GJFA 4QXUL 4YDKL 2PUQT 5H35B 3DI2B 4Y4FA 4XPGH 1CGTA 3TZVC 1EUTA 4JANA 4GQ9H 4XP6H 4WU5B 4MD0B 2GITB 5GRYA 4P49A 3TA3B 4RFOL 4P5KB 4PJEB 1H3PL 3B8YA 5IVXF 4PRDA 3VRJB 2I60L 1WWCA 2Z8RA 3PGFL 5I76A 4ZFGL 3GO1L 1S7UA 2XACC 1G7QA 3SBWC 5T3XE 5E1HB 1C5CH 1DBMH 5AD0A 3F58H 1FRGH 4X4XB 5HVHB 3AGVA 4XC1H 1R3LA 5IBTH 1CF8H 4I2XB 4M61B 3PWNA 3FTGA 3FB6A 3M1BB 1LQSR 4YHPA 3D2UD 1QEWB 1D5ZA 3ILQC 2BSSB 3MRIB 4JO4L 5J06A 4XWOD 4HJJL 3U7YL 1JNHA 4CVUA 5CWSB 3HE6C 1AGEB 1UWXK 4NHCH 5BVPL 1FFOB 2UVEA 2LTQC 5DWUH 5FHAL 4I0PD 4LFHD 4JFDD 4TPRL 4LLUA 2XTJB 1JIBA 1TTUA 3DRTA 4CGTA 1EZVX 3SDAD 3G04B 2BP3A 4DZBA 1A7RH 1S7QA 5HI4C 4G8GE 2P5WD 4PJIE 1I3GL 4RGMC 1CDHA 4N0UB 3KPSE 3V0VB 4HGMA 4X0KA 1CT8A 4NNPL 2CRZA 1UWXH 3ZDZE 1MI5E 1LO2L 4OSUH 3VDCA 1TZHA 1NH6A 1P7QD 1QO3B 1D7FA 1YNLH 3ES6A 4GG6E 5I2IA 1WFUA 2FD6L 5D7KE 2BC4A 3QFJE 3TWCH 2OTPA 4P2RD 3ARFA 4V1DA 3VFSA 1NBYB 4ZSOA 1Q9LA 3FONA 1NDGA 4NQCD 4L4TE 3EOAB 5T1KA 1QSEA 2VZTA 1ZLSH 3VWKA 1I8IB 3CFKA 3ZDZF 1MRDH 5F72S 4HKJB 1JGEB 4XVUC 4KGJA 4V2BA 3IDNB 4GG6F 2UV3A 3U1SH 1KT2A 3ZT6A 3FQRA 1YJDH 2V17H 3MUJA 2UUDK 4I48A 4U7KA 2X1PA 1N7MH 4LVNC 4IOSD 3KPRA 4XCEB 3SGDI 3BGFC 3O4OC 1FFQA 3KHOA 5LGHL 4P2YA 2ZUXA 3KPTA 1Q9WA 5HJ3A 4OZIE 1J7VR 4M6AA 1CS6A 4WUKL 1BJ8A 5JIHA 2FL5A 2WLZA 1F4WL 2A73B 1LEIA 1N5AB 1ETZA 1UH3A 3MRPA 4FXGB 4LU5L 4RGNC 4Q6IC 3ZKXC 4Z76A 2UUDH 4ZUUA 1RHHB 1TQCC 3GSUB 4HK3N 4L8CA 5ETUB 1XT5A 3EO0A 3FOMB 4EXKA 4KVNH 4P57A 2VLKE 4LSRL 3GMMB 3QCTH 5GRUL 3MLRL 3O2DH 5EO0B 3RWJA 5DD5H 1TDQA 3H3PL 3DO3A 3HA0A 3NCEB 2VXTH 5AAWA 3GSXA 4PBVC 2A9NL 5C0AA 4JKPL 4EZMA 4MJ2A 3IYLW 4HC1H 5KZCD 3CDYA 4K3GA 3MXVL 3MLZH 3EFDL 4GW1A 4MJ4A 4MZ2A 3K74B 3T09A 1WFTA 3BT2H 1CGSL 4X9IA 5EBWA 4ZTPL 4DK6A 4G5ZH 4TUJA 4FS0A 1C1EL 3ZDXE 3J8F7 4EDXB 4JKKA 3VXRB 3HFMH 5HHXL 3JWDL 2F8XC 2Y06L 3QI9A 1BP3B 4WDIA 1RQ5A 4DKEH 4U2YA 1FVCB 1A6AA 3P30L 4M43L 4ODHL 4WHYG 2LVEA 3QUZA 1J0YA 3CLEH 5SX5K 5I18L 2EKSB 4OZHE 5C0BD 3T0XA 3LY6A 3MBXL 3HPLB 1I4FA 2FBOJ 4LPXA 4PUBH 2AJYL 4DVRL 3WS3B 1CR9H 4X5XB 2AEIT 3L5WA 5DRWB 1IGTB 4HUVA 5I1GL 5DEGA 5GS0H 4U1GB 4PGBB 5I1CL 2RJMA 3RIAK 2QQNL 2QADC 5AEAA 5KSUB 2J6EH 4N5EC 1DSFL 1W72L 2NW3B 4OZHF 1W0YT 3ESUF 4CNIA 5IV2A 4JO1H 5SX5H 1JI1A 3M07A 4FFYL 4HGWA 2QR0B 3ECBA 4LCIL 1LK2B 4QWWD 1C08B 3VXOB 2X89D 4GAYA 4HSQA 5D1XC 3QEQE 3SJVA 4EVNA 1PDKA 5E2JA 1KB5A 1MLCA 3PWLA 4RWYL 3IDMB 1VKXB 1MUJA 4CAGA 1L6XA 3LH2H 4YXLL 5CJQL 5C09A 4H25B 4BSWB 4L4VD 5JW5A 4GXUM 2EDOA 3OKOA 4ODBD 4UOW0 4FTVD 1BECA 5EC2A 2YXMA 3SE3A 3UJIH 1PSKL 4NKDB 3T08A 3B9KD 1GIGH 1P4LA 2JIXB 4UV4H 3D1MC 2XY2A 2FX9L 2H2SD 2PETA 2Y5TB 1YQVL 3QSKB 4R6UA 2X05A 3I75B 3DV4B 2CKBA 3GGWB 1T1WA 2IALB 3IB4A 3TBTB 1OHQA 5HGAB 3LEXB 2X9XA 2DWDB 5GGQL 1K3IA 5IJVA 4MMZC 5CS7A 2D0HA 3LN5A 4LCUA 2XRAL 4L8SA 4KMLB 4W6WB 1JHKL 5FK9A 1OGTA 1KC5L 1SY6A 2HFGL 4O9HH 2HTKC 4CU8A 4H0IA 3DXAD 4HZLA 4PJHE 2EYRA 4Z7WA 2YPLD 5FCSH 4Z0XA 1T1YA 5E00A 1S5HB 4MAYD 3STLA 1OTUD 4LSTL 4DN3H 2CK0L 2YD8A 3JZ7A 1MFAH 2VDRL 2FRGP 1KTRL 2IH1A 2DQHL 3AS0A 3MREA 2AW2A 4L9LA 4FNLL 2QSCL 1SJHA 4NZUL 5CIPH 5KSBE 3IDXL 4PJHF 4YDIH 1NFIA 5CEZH 1ZHBB 5DR5H 1I75A 3FFCD 1NEZG 3WBDA 1CTNA 3W5MA 1PZUB 1NFDB 1Y6NR 4XP1L 5EU5A 3DMMB 4N8VA 1ZGLP 4KKAC 5I16A 2V7HA 5K59E 4MX7B 1KJMB 4S1SL 5JZ7C 1ITBB 4NCDA 1PEWA 1JF1A 4K94C 1QLFB 3U9UB 3QDME 4X9BA 4P9HH 1T89C 1ADQH 5ISZE 3WIHH 2G9HA 4PB0H 2ATKA 2CR3A 2YSSA 4FFWD 4G6FD 4K2UL 4N9GA 1NDMB 4Z0BH 2X4PA 2WBWB 3NFSH 5K59F 4WO4B 3O6LH 1ZGLA 1EGJL 1YEJL 3PXJA 5EBLB 2DDQL 3O6FC 3IFPA 1YEFH 3QQ9C 1KOAA 1J11A 2NY0C 1BOGB 1FSKC 1UM6H 4PTUA 1L9MA 3CXHK 1AGFB 5IFAH 1F3RB 4NZTH 3T04D 2DQJH 1EFXB 1G7JA 2R23B 3BAEH 4IOFC 2EDBA 4OZ4B 3L3JA 2Q8BH 3FRPG 3PHOA 4O2CA 5DJDB 3WFHA 3ARSA 3GI8L 4KI1A 3N9GH 1BGXL 3CDGB 4F37K 1J0JA 1ED3B 5CP7A 1UJ3A 5HHOA 1MQKL 4AENB 1C16B 4DEPC 4X4ME 1Q72L 3S37X 4MB3A 2ICWA 5TF1H 2J8UA 3MA7A 3MRQA 2VITA 5F3BA 2NQCA 3MJ7A 2X7LA 1DP0A 5DGQA 1TVHA 4YXHL 4TQEL 5TH2B 4HV8A 4Y2DC 5FCUL 5E8EB 2NY2B 4R4FL 3NCBB 4JDTL 5LQBL 2AGJH 3AMKA 4U1MB 4NCC2 2PYEA 1FC2D 1HWHB 4AIZB 5M7QA 4H8WH 3INUH 3N06B 5E9DE 4D3CL 4KI5F 4OFYA 1ND0B 4FQCL 1KIQB 3O3AB 4Y0GA 5EO9A 5HDLA 5T3ZL 2QV2A 1S9YA 5K33A 1CICA 1S7WB 3TEUA 3LN4B 5IEHB 4JY6A 5I1KL 1S9XA 5F8QC 4TNWK 2C3GA 4OLXH 5EIIB 5GGTA 3MV9B 1NAMA 3VGBA 3D25B 4JPVH 1EMTL 1OARL 2IWGA 3ULUC 5DQJA 3FT3B 3ARFD 4V1DD 1PVHA 4ORGB 2R2BB 3RNKB 1YMMB 2JJWA 5T1KD 1W8OA 1QSED 2NTFB 3VWKD 3VXTB 2FIKB 3DO7B 3LZFL 4JY4A 3QQNA 3VCLA 1YYLH 5DURB 4I13B 4ODSL 3HC3H 3BUYA 1DEDA 3IAGC 4YC2C 2C1OB 3CNKA 1IGIH 5L7XL 4RQQB 1F6LL 2ZUWA 5F3HA 1KPVA 5F9AC 1T4KB 2IAND 5F89B 3SE8H 4PG2A 1WT5A 1ZEAL 3EO1A 4ETQA 1CLYL 1W0WB 3MUZ1 2VZVA 1RK1A 4PJ8B 3TJHC 4QXGH 1JE6A 2RFXB 1OAUH 3CMOL 3OX8B 5I1HL 5BV7L 2HWZL 4IOIA 3HR5B 1DQDL 3MNVA 3MRBA 4Y4HA 4XMPH 5M94B 4JCMA 3PG2A 5IK3B 4H26B 2VUOA 2ZPKL 5J11C 3S3PA 4HG4J 1TQBC 4ZPVA 4E5XB 1FVEA 2EYTA 3GSWA 3HAEA 2CDEB 3DGCR 1F3JA 3K1DA 5CMAB 3C6SB 1I85C 1BD2A 1CU4H 4JFPB 4ZO7A 5DO2C 3QUMA 2FBJH 1P69B 3LPFA 4YUEH 4QTIL 2ZCLL 3QNXB 2Q76A 1PKQE 4ONGL 2VQ1A 5C0AD 3QG6A 1QPPA 1E4KA 4HC1A 4HWEL 3SCMA 4XAWH 1G7PA 1SEQL 4P46C 2BJMH 1U95A 3N1MC 2EDYA 1FGNL 1DVFA 3AAZB 5DHXB 2IBZY 2ORBL 4OD2A 4APQD 1CTOA 1QLEH 2WK2A 4X6CE 4CL7A 4LRIA 3QI9D 3RDTB 4F7EB 5JDSB 1DBKL 3PABA 4GS7C 4GAFB 3IAQA 1KCLA 2YPKA 3QUZD 5DGRA 2VR9A 1VGEL 4PRHE 2GFBA 5DLMH 2RCSH 4YDJB 4M7LT 5HYQA 5IHUH 3PV6A 2E6JA 4XXDB 1MLBB 2YMXL 4YDKH 3FQNB 1FL6A 4NQDE 3PL6B 4X6CF 4MD5B 4RZCB 1YEKL 4J12A 4JFHE 4X7CC 5E95B 4YWGL 2I25N 4F7TA 3WE6A 3S88H 4P4RA 2AXHA 3NFNA 2JCCA 2VLRD 2XN9E 4PPTA 5I66B 3BRDA 2VOTA 3VXQA 4D9QE 1KCSL 3GKWL 5KOMC 1JPFB 4HT1H 2PW1B 4OCMC 3CFDB 4ZFGH 3GO1H 3WMSA 2OR9L 3P9LA 2EEBA 2R0ZL 1TVDA 4PJIB 2FJHB 2BVEA 5T3XL 1SEBB 3UO1L 3B2UD 5JOEA 2ZUQB 4HIEA 2W65A 3FB7B 3VFMA 2H32B 2AXFA 4JFFA 5EOCH 1OGAB 1ZLVH 3W5NA 1KNOA 2YD7A 3VFWB 1CD0A 4PRBA 3X3FL 5LWYL 5FHAH 5C0ND 4GW5A 2OLDA 3DETC 4LP5A 2E6PA 1TJIL 2A6IB 5C09D 4EOWL 5IQ7L 1Q0YL 5CUSL 3TJEL 4DJMA 3ULSB 1F02I 4QEGA 1D5IH 4RMVA 1INEL 2D7PA 4LCYA 2HVJA 1I3GH 1VFAB 1IAIM 3WFCL 3BMWA 2GIYA 4JZOA 1VFBB 2EKJA 2GSIA 2N1KA 2FATH 1EFQA 4MB4A 3MPCA 2VZ1A 4UZGA 4JFXA 3BX7C 4IHOB 1G6RB 3U4EB 3UPCA 3TVMB 1EHLL 5DFVD 5D1QA 2PXYA 1IM3B 1LO2H 2R0LL 1F6FB 3O6KL 3VA6A 1KEML 3IFLL 5E6ZA 3PV7A 3MJGX 3LQZA 2BVOB 1KFAL 5HI5D 5ACMA 3UTZB 4ODTL 5B8CC 2CO6B 3MFGB 1TZIB 2D7OA 1BQHG 1GL4B 1JK8A 4JQXC 4HZAA 2NXZD 1ZKAA 3A6OA 4JVWA 4I9WD 1FO0L 1XIWA 3IDYC 1G6VK 5JMOC 3UP1A 1UT9A 1K2DA 2PTTB 3G9AB 3ZHDA 1GGYA 4WUUA 4UT9L 4GT7A 4X7DC 3FJTA 2IG2L 2IPUG 2GJ6E 3L5XL 2NX5D 2N7BA 3MC0A 2P24A 4BSJA 2Q6WA 3MXWH 3QIBA 3OBAA 1QNZL 4WUKH 2D3VA 3HRZB 5FFLA 5GGUB 3BISA 1ZTXH 1F4WH 4Q9QL 3TBVA 1IAKB 1P5UA 1M7DA 4YJZL 4KGLA 2CDFA 3X3GH 5GZOD 3WHE1 4Y4KC 3FAXA 4XNZB 4LU5H 2G5BB 3WUWA 4UAOC 2QQLL 4Y16B 3ROOB 4MQXC 4LEXL 5CD3B 2F9BT 3BPLB 4CVXA 4LSRH 3RVWD 3RTQA 1CQYA 2E7LC 5F6HI 1HXMA 3VFNB 5C0CB 3TFKD 3C60B 4JM2A 4RDQF 1AO7E 4MSWB 4XMKL 3H3PH 3L5HA 4NKIL 1OWRM 2XTLA 1U41A 2GSGB 2W9DL 2A9NH 2B1HL 3B9DA 4JKPH 1A6PA 4RNRB 5DD6A 4PRAB 4QGYA 4LAQL 3TZVB 3T3ME 4OFVA 4KAQL 4ZOCA 1Z0NA 4RDQG 4KJWC 1G9NC 1U8KA 4GLRH 1GPOL 5EUOB 3ZKQD 1CGSH 3AU1B 4PGCA 4YHYC 3WJJC 3LRSB 1N8ZB 4ZTPH 1C1EH 1VGKB 1FLTX 4KK5D 5HHXH 3JWDH 1JYVA 4HG4K 1EEYA 2Y06H 1B9ZA 5HHOD 5EUKB 2NZ9D 5HHVL 4HUKB 5FHBL 3T3MF 4ODHH 4KHXL 5F7EL 5EBMB 3IKCB 5I18H 5D72L 3MLTA 5IF0B 1XF3A 1NLDL 5CJXC 1LNUA 3LAFA 4Q2ZA 2BHZA 2AJ3B 3QWRA 4XBPB 4PIRF 4KKCD 1HKLH 2AJYH 4P4KA 4DVRH 2O5XL 3MQIA 2AI0L 3HE6B 5HYJA 5HDBF 2UWEE 4G43A 1PD6A 1JWSB 1GRWA 2FDBP 3LD8C 4G6AD 5I1GH 2LTQB 5I1CH 2DQGH 2QQNH 2PYED 4YHOL 2E8YA 5DA0B 5E5MA 1FDLL 1W72H 4XWGH 4H5SB 3SDCC 4OFYD 4JFDE 4JRYA 4XH2B 2JJTC 4R4BA 1SJXA 3BKML 4PV9B 4TSCH 4J1UA 5ICYB 5MI0C 4E9LA 3X12B 1B0WA 4RGMB 2GTWB 4LCIH 2E3VA 2P5WE 1AR2A 5CJ5A 2LE9A 5GXBB 1HDMB 3QNYA 2DWEA 4U4BA 4JLRB 3DURA 3WN5C 4KRPC 2BOCA 3ALPA 2PR4H 3LCYA 3DVNB 3G08B 4P5MA 4K07A 5GSVA 4OGYL 4RWYH 4GRLA 1A5FL 1CE6B 1U8NB 1K6QH 1N64L 4YXLH 1B2WH 5CJQH 2BNRB 1QHOA 4LVOC 4LFHG 3IJHB 4Z7VF 5F7WC 4QXTA 5KVDL 4JN2B 2ZOLA 1PSKH 2YHGA 2M8XA 4NQXA 4P2RE 3V5DB 2R29L 4FQJL 3GIZL 4NQCE 5E5RB 4U6YB 5IFJB 3KYNB 2WBJC 3QDJE 3H42H 5IB1A 2P5EA 4OKDA 1OAKH 4OCLC 1YQVH 3MOBL 4NDMB 2XG5A 1FL5B 1EV2E 5FYLE 1HNGA 3A0OA 2L7UA 4WFFD 5B3JF 3DX8B 5B39B 1TJGL 1KLUA 1Z0MA 5GGQH 3BGFB 3OF6A 4WW2F 3O4OB 3MYZA 4YDVB 3QXWA 2YUWA 1IQDA 2AAVA 1GGBL 4Y4HD 3RVXD 3MR9B 3T1FB 1FHGA 4ORZC 3R0MA 1JHKH 3U0WL 2HFGH 1KC5H 5E8DL 5C07D 3T0EC 4DVBB 3CX5J 4KJQD 2FH6A 1IAOB 1F3DJ 2MNUA 1FG2B 1XF1A 1BD2D 3HG1A 3Q6GL 4RGNB 2IGFL 3NZ8A 3Q5YA 4XCYA 3F12B 4LSTH 4Q6IB 5MENB 1G9EA 1Q94B 4HPYL 4PD4J 2CK0H 5LKNA 1BF8A 3ZKXB 5IKCB 3X13B 3BPCA 5DZLA 4R7NA 5CSZB 1TQCB 1CL7H 5E8NA 2CIKB 3MLSH 4WWKA 5GJTH 1Q9OA 2DQHH 4HXAH 1FYHB 5J1AB 2QSCH 1U8LA 1XGPA 4NZUH 4Y4FC 1WSST 3L5IA 3KLHC 4Q7DA 4OZFB 1DVFD 3EYSL 5CSGA 4ZUWB 4I4WB 1OP9A 3T77A 1UYWL 3I6LE 5BRZA 1HKFA 5I8CA 4XP1H 4K7PX 2V2XB 3IDIA 3EYOB 2R0WL 4G42A 3V6FB 5MEPB 1X5GA 2XA3A 3L3GA 1AQKL 3RVUD 1A1MA 1YNKL 2ED7A 4O58L 2FO4B 3EYUL 1BZ9A 1MHPL 1F90L 1G7HB 1LO0L 2HMID 1V7ML 5DTFB 2H26A 3K2UL 4OAWB 1I1CA 3SPVA 4H1LB 4K2UH 5FV1L 3TNMA 3KPPA 5GS0D 3DUUA 2Y6SC 4IM8A 3GMNA 4X6EB 1BIIB 2Y36L 1EGJH 1YEJH 1ONQB 2UZIH 2DDQH 2J5LC 3P73B 4ZFOA 3TM6A 4LASL 3TBSB 5C0BE 4DGYH 5ACZA 1Z3GH 5IOPA 3UBXI 5D2LA 4K8RL 3ZE2E 4DFHA 5TQ0L 4MNGE 2A6DA 3OXRA 2WM0A 3Q6FB 5EPMA 2QADB 4JGJA 1EX0A 3DBXB 4GO6B 3GI8H 1INDH 1ORQA 2O61A 4MS8C 5BJTA 2V2WB 1RZKL 5A3ID 3SGDH 3MJ8B 4FMFA 1D5MB 4G9FA 1UZ6F 1Q72H 5DRXB 2WP3O 5H35A 3SE4A 3OJ2C 3UTTB 3EJYD 5FDWB 4WU5A 4MD0A 4F2MB 2GITA 5KSAC 2EXYC 1II4E 1OAXL 4YXHH 5D1XB 4PJEA 1RUKH 4KWUA 2BNUB 2ZUSA 3MV8D 1KTDB 5FCUH 1C5DB 1K4CB 3DROB 2CDGA 4R4FH 4BQ8A 4JDTH 3FO9A 3HUJA 3TF7C 5FECB 1CFTB 2Z8SA 4BSVB 4UTBL 1EEZB 2IPTH 4D3CH 4X4XA 5DHYB 4KU1A 4WEBH 4RRPG 1UZ8B 1NCDL 2AKRB 5ICZB 3PWJB 5GS1C 1IQWH 1MCWW 3FMGH 4I2XA 4Y1AA 4M61A 4L4VE 4U6VL 3R4DA 1BM3L 2A77L 3M1BA 2PXYD 4FTVE 1QEWA 1FNFA 2BSSA 3K80A 3MRIA 2BERA 3OKYA 1U8QB 4JDZA 2NY3C 5CWSA 2Y07L 1AGEA 1FFOA 4XPFH 1OARH 1CLOH 3HC4L 5M95B 4LSSH 3R06A 4OLEA 4N0YL 1NCBL 3G04A 5DD1L 4JRWA 3VXPB 4QHKI 3MLXL 1GXEA 2F5AL 3ARXA 3L5JA 1QYGH 1XIWD 2QHLA 1MCLA 3HC0B 1MCFA 1DL7L 1RZFL 4N0UA 1KCRL 2R15A 4ODSH 2FHFA 3QZWG 4WUUD 3ZSSA 5L7XH 4PJDB 3FQXB 4IBLT 4DN4H 4E41B 3S36L 5JXEA 3DXAE 5CEZD 5CEXB 1IEAB 2YPLE 4BKLB 3N0PB 3UYOD 2EO1A 3RUGB 2C4FT 1QO3A 1GZPB 3QIBD 4JR9L 1UXSB 4M8QA 1SVZA 1DQJB 3NACL 3CMOH 1PLGL 4ELME 1NBYA 5BV7H 2HWZH 5BO1L 4NO0D 1BEYL 3EOAA 2DL2A 3PJSB 4KQ3L 5DQDH 1DQDH 1I8IA 5LCVH 2BDNL 4GRWH 1LDSA 3JVGC 4HKJA 3QXDB 3HZKB 4Z7UB 3IDNA 5IBLD 1NMAH 2DI7A 3RTQD 2X4NB 4JM2D 4ELMF 3LS4L 5J89A 4YFLF 1K3ZA 1IGCL 3QUKB 5DJXB 2ADGB 3I02B 4QTIH 2ZCLH 2V2TA 4ONGH 4HWEH 4N1HB 4V2CB 4LLDB 3KJ4C 5FUOL 4JFOB 3RHWF 5AZEL 2JJUA 2HJKB 3QCVL 2A73A 1CE1H 1FGNH 3BKYL 5T1DL 1EVTC 3O6FB 2ZP0T 4QRPB 2EDHA 2OL3A 2ORBH 3LKRB 2NY0B 3L9RA 1I3VA 1FSKB 2B4CL 1ZWIB 1EAPB 4FXGA 4M5ZH 1ZAGA 2NY1C 3DV6A 3D0VB 1T5WA 2EEAA 5DMYA 3CX5K 1N6UA 3GSUA 3ULVC 4GBXD 3FOMA 1VGEH 1H3TA 3P0VH 3GMMA 3BD4A 4PD4K 1XF2B 1M4KA 4PYHA 3QWRD 1CGWA 1FZOB 2YMXH 3VXNB 4EN3C 2AV1B 5I8EB 4DEPB 4YWGH 4RAVB 3BHBB 4CW1A 1GCFA 5J7CC 4EUPB 3VXSD 3BEVB 1XH3B 1KCSH 2XKSA 4HS3A 4UIKL 3SDDC 3VMOA 2IEPA 2QTEA 4JRYD 4NN6C 4Y2DB 3V0WL 4EDXA 3VXRA 4R2GC 1I9IL 6CGTA 1IE5A 4ISVA 5T3XH 1ZSDB 4AEIL 2FSEB 4N5UA 1N3NB 1OQOA 1FVCA 3HI5L 3UO1H 5E7BA 3K2MC 4KMQA 2A74B 2H2PC 3S3JA 1FAIL 2EKSA 3O45B 2F53B 1NCAH 5F6IC 3SKMB 4B5EA 2F58L 1GH7A 5ANMB 4GRLD 2C3XA 4WW1B 4P99A 5DMJB 3WS3A 4X5XA 1VSCA 5DRWA 5DMKB 5AWNL 1N0XL 1J1OL 4PGBA 2DTMH 3RGHA 1Q0YH 4WEUD 5CUSH 3TJEH 4M1GL 3FN3A 5KSUA 1INEH 3QO0B 5TE6L 4L8SC 4V1DE 5GISL 1CD9B 1WAAA 5IGXH 1QSEE 1A02N 4PJGB 4M6NL 2QR0A 3KPLA 1U3HC 4GFTB 3VXMB 3RWDA 1LK2A 4YC2B 1X5JA 1EHLH 3VXOA 2VWEE 1MFNA 3OB8A 4O2FB 3HMXA 4NQVA 1K8DA 3D18B 4B53A 3VFPB 4YBLC 3MV11 4L9LC 1I1FA 3BZ4A 4LIQE 1KFAH 2F8VA 4ODTH 4DWHA 1VKXA 4LQ1A 5B4MD 1G7MB 1X4ZA 5C08B 2MQ0A 5ITFB 2AJXL 4H25A 3FQUB 5DD0L 4BSWA 4OJFL 2ZCKL 4QOKB 2C3VB 5HI3C 4MB5A 1YN6A 4NKDA 3HG1D 4DTGL 5HGDB 2FX7L 1FO0H 4XP9H 4Z78A 2JIXA 4F7PB 5AAMA 4HJ0D 4IMKA 1AJ7L 4NC0B 2XKNB 1HCFX 3DUHA 3EJZD 5J11B 1TQBB 5MERA 4WWKD 1SJEB 3QQ4B 4HF5L 5BOZG 1CDIA 2VR5A 1FIEA 4M00A 5IB4B 5DDHB 4UBDC 2VDPH 3I75A 1UWGL 3DV4A 3GSVB 3GGWA 2IALA 5FA4A 2VXSH 5DJ8B 5HGAA 2X4TB 5B38A 3CVHB 2DWDA 2R4SL 3C8DA 3ALXA 1QNZH 4MHHG 5BRZD 4BM7A 1LD9B 3HNVL 3SY0B 4Q9QH 3ALWA 5C0AE 2NR6C 4LPUA 1IARB 4P46B 3GHEL 3U9PL 1U9KA 1EA9C 5FYJD 4LSQH 3X17A 8FABA 3LKNB 2QQLH 5F21B 1MOEA 5CJ8A 3P77B 2DBJA 1OW0A 4LEXH 4NQEA 1S5HA 2NY6C 4MXQD 4UDTB 5ACLA 5F6HJ 3U4BL 4KK8D 2IH3A 2HYMA 4GS7B 5JHDB 2F54B 4KVCL 4TTGA 4OV6F 4NKIH 1ROWA 3LKOB 3WIFA 3P4MB 2P44B 3GIVA 2N4IA 1G0XA 2W9DH 3SN6N 1ZHBA 1KF9B 1UG9A 4LAQH 2W07A 4OV5A 2FZ3B 1NFDA 4K9EH 4UI2A 3DMMA 2DN7A 4KXZI 3ZE1F 3KYMB 3LKQB 4HS8H 1KJ2L 1EO8L 3NCFB 4MX7A 1KJMA 2VLRE 4GSDH 5FGSA 4YHNB 1ZT7A 2JB6B 4KV5E 1KJ3L 3U9UA 4BQ9A 4F7CB 1MJ8L 5KSVB 4G9FD 5HHVH 1CICC 5FHBH 3AREC 4KHXH 3AVEA 4KQ4L 5F7EH 4U33A 1WK0A 4GH7B 3GM0A 4LBEB 1NDMA 3BN3B 3G5VB 3SDXA 4L5FL 1NLDH 5EU7E 3TA3D 4OM0L 4WO4A 5IESH 1M71A 2HP4A 1F97A 2W0PA 3C5ZC 4WV1C 2R56L 2O5XH 3MODL 4WI9A 1BOGA 3SJVE 1PZ5B 1FPTL 5DUML 3L3DB 1WZ1L 4RBPK 4X83A 2FEDD 1IM9B 3CDCA 4YHOH 1EFXA 2R23A 2JB5L 1V3MA 1FDLH 5F7YC 4OZ4A 4UNTA 4OF6A 2EXWC 5DJDA 3GSNL 5C09E 3BKMH 1IZJA 4JHWL 3SOBH 1KIUA 3BP4A 3W9DA 5FAAA 3CDGA 3IT8D 1OB1B 1DN0B 4NSKB 2IMMA 5D7SH 2D7MA 4RMWA 4U1KB 3QDJB 2OZ4L 4AENA 1C16A 5DZNA 3WFBL 1V05A 5GGVL 3HLAA 2WWKO 1OSZA 5LAXB 2XTJD 4RBPH 4M1CC 5TH2A 3E0GA 4OGYH 3MZTA 2HLFD 1QR1B 1A5FH 5I0DA 2X4UB 5E8EA 1CN4A 1AIFB 1MWAB 4NFBA 1N64H 4U1HA 5D5MB 3ZT5A 4R90L 3P4LA 4OZGA 2YK1L 1MCSA 2A0LD 1JN6A 2E7MA 1R5IA 2FCBA 4OTXH 4AIZA 3JV6B 5B8CB 5KVDH 5C3LD 5AYUH 3RVXC 3DHJA 4NO3B 5BMFL 4XC3L 4N0FB 2R29H 4FQJH 3GIZH 5E6IC 2FR4A 1S7WA 5JXED 4Z7WE 3VG0H 4HK0B 1CXFA 5SWQA 3IDYB 3LN4A 5IEHA 2DI9A 2YD5A 4Q9RH 3MNZA 5EIIA 5I19L 5FGBA 3WEXB 3MV9A 4J2XA 3S3SA 3D25A 4Z7OE 3STBA 2WMPA 1TJGH 1CXIA 5FYLL 1AP2B 3SCMC 2R2BA 1YMMA 4FFZL 2NTFA 1I1AA 4Z7WF 1DVFC 1GGBH 2FIKA 1NC2B 1UEMA 2EIDA 3DO7A 2OK0L 4WJ5B 1MWAL 1T2QL 2A1WL 3JXAA 1QOKA 1T21B 5E8DH 5IQ9B 2XZQH 3DRQB 1LHZA 4Y4KB 3V52L 2IGFH 5D7IB 5EFIB 4UAOB 4HPYH 4Z8FL 1FCGA 1T4KA 5F89A 2CR6A 2GJJA 3MUHL 2APBA 2H3NB 3QXAB 2NYYC 1W0WA 3EOTH 5DHVA 3IVKB 3PWVA 3QHTC 1UCBL 4I3RL 3S6CA 5IT2L 2RFXA 2AJZB 3OX8A 2G60H 3I6KA 1T0MB 2VSCA 1CGYA 4L8DB 4ZYKB 5GSRB 1EEUA 3HR5A 1X9QA 2XPGA 2VL4A 1F2QA 5F44A 3MX0A 1OAQH 5J0BA 5IK3A 4H26A 4L3EB 4OCRL 3V0AC 5I30L 1ES0B 3QB7C 1AQKH 2IFFL 4YHYB 2CDEA 3NA9L 1X6NA 1K9TA 5IJKA 5KVGH 3PDDA 1MHPH 1F90H 4W4OA 5CMAA 1LO0H 3C6SA 2OSLB 4JFPA 3K2UH 1SQ2N 4HWBA 2GW5A 4NN7C 4HCRA 5HHOE 3VD9A 3NIDE 4XCCH 2CQVA 2Y36H 2BXYA 2ZKHL 2AK4B 1I8LC 4XCNA 4CRPA 2J8UE 4LASH 3TN0A 4M7JL 3TBYB 3AAZA 4U2ZA 3VGDA 1A1OB 2I27N 5TQ0H 2E6QA 4HX1B 3VXRD 4ZFZB 2KKQA 3EHBC 1HHGB 4LOUD 4OF3A 4XVSL 3RDTA 4F7EA 5CEYB 5JDSA 2BX5A 3NIDF 4MHHI 2DQFB 4WTZA 3SDCB 2PYEE 4ZUSB 4HXBL 2J8UF 4HKXB 1RZKH 3REVB 4YDJA 2D2OA 4PGZA 3UPRB 2ATPB 1J9CT 5DJAB 5MI0B 1JJUA 4CADB 3NBNA 5D1QC 7FABH 3JWNC 3PL6A 2DQEL 2VDNL 4UINL 3QNZB 4PLJC 4S2SA 3DOSA 3NABH 4U1SA 1MEXH 4WWID 1OAXH 4P2QB 3WN5B 5I66A 4KRPB 4MXVE 5GGRA 1JPFA 1RV6X 2PW1A 4LCCC 3CFDA 3H9YA 5DRNB 3NMEA 3GBMH 1WZMA 4A6YL 4DZ8B 4YXKL 1S7RA 3U6RB 1NFKA 5INDB 4ZOBA 4Q9CA 2FJHA 4LVOB 1NCDH 5LGKA 3BH9B 2X1WL 4LNRB 2CO7B 4U6VH 1LGVA 5T33L 1NPUA 4CMHC 5HTSA 1LO5B 4JFQA 3FB7A 1D6VL 2H32A 3MJ9A 1IEBB 3CFEB 3C09C 1OGAA 2WBJB 4WFEE 1FFRA 2Y07H 3VWJB 1JZ4A 3WKNA 4JGMA 3VFWA 1QD0A 1KN2H 4IDLA 4BZYA 1GOFA 3HC4H 2BNQB 2OQJA 4U3HA 5HHQB 2LU4A 4QHKJ 5DD1H 4WFFE 2FWOB 4M5YL 1BJ1J 2MMXA 1VPOL 1CXKA 1VESA 4P9ML 3B2VL 4ZXBC 1VFAA 2JIXD 1VFBA 1KCRH 2VLLB 3ZKMD 3CCHA 4P48A 3E3QC 3KPQB 4CKVX 3T0EB 4IHOA 1G6RA 4FQIL 3S36H 1FQ9C 2DLEA 3TVMA 1BQUA 1PY4A 1IM3A 1J1XH 2DLFL 3TYGL 1BD2E 1HK6A 1I8KB 4JR9H 2BVOA 5KN5B 2YEZB 2Q1EA 4DW2L 3NACH 4D9RD 4Y4FB 1J05B 1PLGH 1UH2A 1J0ZA 1F8TH 1TZIA 1A2YA 5TQ2L 3IGAB 1RZJL 4NO5A 4KQ3H 1NL0L 1FCCA 1OAZL 1P1ZB 1GGIL 4NYLA 1NUDA 4MA3B 2GK0B 5I76B 1GGCL 1G7QB 4G8FB 3OAUH 3ETBF 1IFHL 2PTTA 5HVWA 1XZ0A 3LS4H 4JVUA 5C9JB 3QXUA 3P0GB 1CFSA 2NPLX 2YA1A 1IGCH 1UACH 4GAGL 4LQFL 3BE1L 5ADOH 3FTGB 1WZKA 4OUUB 4I1NB 3DUSB 5DI8B 3ZDYE 4JFZH 3S5LG 1JNHB 4P4KC 2CJUL 5DEFB 3HRZA 1BVKA 5FUOH 5GGUA 4NKQB 3DMMD 5AZEH 3QCVH 1J1PL 3BKYH 4QRSB 3D9AL 2J5LB 3CIQA 3DVIA 2JCCE 1QUNA 1YPZB 2ZCHL 3JWOC 4JO2L 2DM3A 3LSOA 5MP6H 2D7QA 2G5BA 5SX4I 1U8PB 4CUCA 4Y16A 3VGHA 4AJ0A 3EOBB 1JFQL 3ROOA 5HHNB 2X2YA 4PTTB 5CD3A 3REWB 2OTUA 3ZDYF 5H2BB 5T5FL 3VFNA 5C0CA 5KVFL 1OY3B 1RUAL 4WO4D 1JHTB 2JCCF 3QPXL 5JW4R 4MSWA 4K94H 4X7TA 3TCLB 3C8HA 2GSGA 3GI9L 1LK3L 4OGAC 3DIFA 3F7YB 1YECL 4PRAA 1TZHB 2QQKH 1BHGA 4XNMA 3U2SA 1EFXD 1LP9B 1LE9A 5KSAB 4WTWA 5I2IB 3TO2B 4UIKH 5I9QC 2A38A 3LRSA 2AEPL 3V0WH 5KW9L 2XICA 5I15H 1VGKA 3MV8E 4ZSOB 2LU3A 3FONB 4XVTL 1I9IH 5HGBA 3RIAF 5EUKA 3V4VL 2YKLL 2Z35B 2WP3T 2F19L 5EN2B 4HHAA 2P1YA 4XPAL 5EBMA 4M03A 5GS1B 3ZHKA 5IF0A 1KT2B 2WANA 4PFEA 5ALCL 3FQRB 4CVZB 3AXLA 1E6OL 1U92B 3IXTB 4XBPA 2BZDA 2F58H 4GG8B 5DK2B 4HFUL 2NY3B 1JNNL 4WGWB 2NY2D 3QRGL 3KPRB 5D6CB 1EPFA 1JWSA 1N0XH 4Z7QE 3KLAB 3T8XA 1H8OA 2X4QA 5HJ3B 3EYVB 5HVGB 2IPUK 4H5SA 3NN8B 5TE6H 3S37L 1TCMA 4XH2A 2LVCA 1P4BL 4PV9A 4OT1L 1VENA 3D5OF 5ICYA 1WITA 5JDJA 3MRPB 3I50L 3ARRA 1YEGL 3KYOB 4M6NH 3FO2B 1HDMA 5IVNA 5L8LB 4JLRA 1G9ML 3GDBA 3MV9D 4X80H 3ARDB 4WUUE 1YMMD 3DVNA 3G08A 4ONHB 3IU4L 1RULH 4WU7A 3VD4A 3SKJL 1SM3L 4LIQL 1I7UA 2AJXH 1KIPB 4EBQH 5DURD 2XKUA 2ZCKH 5DFWH 1Q1JL 3NGBC 3RVVD 2ICWI 3FOLB 5EULV 4Y8AA 1C5BL 3K3QA 3V5DA 4UQ3B 4DTGH 4L1HA 2FX7H 5EBWB 3DNKA 3UZQA 4AEHL 1UA6L 3KYNA 3HB3C 1ZT4B 3EZJB 4G6KL 4R4NC 4NDMA 2P7TB 3SQBA 1FL5A 2R39A 1JMZA 3LPWA 1WEJL 4P23A 1QFOA 1UWGH 4PJ8D 4WHTB 5F7FA 3VGAC 5B39A 1E27B 2HTLD 4WY7H 3V4UL 5CD5C 4YDVA 1N4XL 1JUFA 1P2CB 1IBGL 4JG0H 3D39B 1I4FB 4WHCA 5EU6A 3MR9A 3KJ4B 5GS2D 3T1FA 1P7KB 3RKDD 3U9PH 4ALAL 4DOHE 4DVBA 1OWWA 1OP5K 4NIKB 4R26L 4FG6C 1IAOA 4A2MA 1FG2A 4JM2F 1CBVL 1NEZB 1CZ8H 3FZUC 5C7XL 4Q6IA 5MENA 2NY1B 1Q94A 3U4BH 1WBZB 4YHIB 3X13A 1F58H 4OLZL 5CSZA 3TT3L 5IV2B 2CIKA 2P8LB 3HI6L 1UXWA 5J1AA 3SE4C 4OCNC 1OT2A 2BFVH 4QRTB 5DC4B 4OZFA 4EN3B 4GAYB 4YR6A 2R2HA 2D0GA 3CVHH 4I4WA 4ZODA 1BJ1H 3SJVB 2WZPD 2QJDA 2DF3A 3PWLB 5HYJE 4PJFB 1Y18B 2V2XA 3VJ6A 3RDTD 3EYOA 3S35X 1KJ2H 3V6FA 1EO8H 4PJ7F 5MEPA 1NANI 1CFVL 1MUJB 1CDBA 3SDDB 1UC6A 1A6UL 1KJ3H 2FO4A 5JW5B 2MKWA 1MJ8H 2CRYA 4JRYE 4R2GB 2SEBB 4Q0XH 3OZ9L 4GMTL 4KQ4H 4OAWA 4H1LA 5BVJB 3PL6D 1C12B 1AQDA 3G6DH 4OM0H 1OAYH 1AY1L 1HXYB 1BIIA 4O51B 1L7TH 1ONQA 2X6MA 1UKQA 3MV7A 3P73A 4F37F 5FM8A 3TBSA 5F6IB 3L1OH 4NM4L 1FPTH 2IQAB 4POYA 2A83B 2WWMD 5DSCB 1N5YL 4HWZB 3UAJC 1DBJL 2YBRB 3CUPB 3FN9A 4ODXA 5CZVL 2JB5H 1KBGL 1MCOL 4BZ1L 4R7DA 1KB5L 1J0HA 1MIML 3Q6FA 4FQLL 2AJSH 4XVJH 5E94A 2BVUA 1JTOA 3DBXA 4YH6A 4XXCA 3DPBA 2OYPA 3KVQA 3MLWL 2FLBT 4KKBC 1XGRB 1EUUA 3BN9C 5FK9B 4D0DB 4D0CA 2D03L 5BQ7B 3MJ8A 5I1DB 4JJHA 2VH5H 2OZ4H 1D5MA 1OGAD 2HJLB 5JW4Q 5JXEC 4O02L 5DRXA 5GGVH 1T7XA 2HVKB 4RMQA 3UTTA 1U3HB 4QLRA 3CFCL 2YS4A 5FDWA 4L8BB 4QYOB 5IBUB 4F2MA 1V3JA 5GIRB 2IH1B 5C0IA 4PJ5B 4YBLB 3MREB 4L9LB 1QFUH 4W4NA 3WLWC 1C5DA 1GYAA 2BOBA 3DROA 4TTDC 4R90H 4ZPTB 5BXFB 5HYSB 4RFEB 1FJ1B 1RMFL 5FECA 2CKBL 1RIHL 4ENED 1CFTA 4BSVA 1RZ7L 1EEZA 2LV4A 4S1RL 5JHLL 5DHYA 5BMFH 4XC3H 3I3EA 2AKRA 2C7UB 3MBEC 3PWJA 4LMQE 4N8VB 4XPHL 5ICZA 3TVMD 4M9PA 5DF0A 3O81A 3HG1E 3O8XA 1MHHB 1U8QA 1IGFL 2G9HB 1FZKB 2YSSB 1RAMA 4YZFE 1QG3A 5FYLH 1CFNB 4FFZH 4MMXC 1ZGLB 3VXPA 5L0QC 1TVBB 2BY3A 1MWAH 2A1WH 1Z6JT 5BRZE 3LEYL 2HRPH 5HXMA 3N50A 5ENWB 1G7JB 4YZFF 1YUHB 2X09A 1I9RH 3UYRH 3PHOB 4PJDA 3FQXA 5FYJE 5FGRA 4Z8FH 3KYAA 4DQOL 1GZQA 3GEWB 2IF7A 1IEAA 5CEXA 2DIAA 4NHUB 2NY6B 4BKLA 5FM5M 2YR3A 1MPAL 3RUGA 1GZPA 5CBEB 4H0HB 1UXSA 1RFDH 3OKDB 4FP8H 1O0VA 5DRZA 3O3BB 3GMRB 1QRNA 4FZEL 4U1IB 4ERSH 2PN5A 4XP6L 3MJ7B 5IG7B 3PJSA 5L6YL 1TVHB 2C5DC 4Y16D 4HV8B 4PRPB 1EAJA 5D2LE 5HGHB 1ACYL 12E8L 4OCRH 3OKMB 3PUCA 3QXDA 3HZKA 4HBQA 4Z7UA 1I9JL 3LB6D 1LO3L 1X5FA 4C55A 1L4IA 5C0CD 1C5CL 1WJ3A 2C3HA 3C60D 3F58L 3JBG7 4XC1L 3PXHA 4O4YL 3QUKA 1T89A 5EO9B 2ADGA 5IBTL 1CF8L 1S9YB 3I02A 1CICB 5A2JH 3AREB 4G9FE 3TZVD 4X9GA 4BH7B 2ZKHH 2XFXA 1S9XB 3BJ91 4JFOA 2HJKA 3PIQB 2JE8A 4M7JH 2AP2A 5FM4A 3C5ZB 3O6FA 5DWUL 4WV1B 3B43A 5EC1A 4QRPA 4XNXL 5DQJB 1JMXA 4PJEE 4DFIA 3MNWA 2EC9U 1EAPA 3CU7A 4EQ2A 3D0VA 2VZUA 4XVSH 3HUJE 2P43B 3QRFM 1WC7B 3M8OH 3VFTA 4HXBH 1T7YA 4UDUB 3BUYB 1XF2A 3LOWA 2QEJA 2XZZA 4I2XE 4Y1AE 1FZOA 4PJEF 4UUJA 3VXNA 1A22B 3LHPL 3ILQD 2D9CA 2AV1A 5I8EA 2QL1A 4YNYB 4HEME 2DQEH 3HE6D 4DKFL 1EJOL 1QSZA 5IWLC 5J8OA 4OSUL 5E2WL 4EUPA 4ZAKC 5LBSL 1CGUA 4HLJA 4Y88A 3BEVA 2W9EH 1CWVA 1YNLL 4BELD 1QKZL 5B3NA 1H3GA 2KZWA 4Y2DA 1NAML 5GRXG 5TE7L 4O2EB 4YXKH 5HI4D 2VC2L 1F45A 5K9JH 25C8L 1ZSDA 3ARUA 1DUZB 1NGQH 5E8OB 3UTPD 3Q3GA 2FSEA 1MRDL 1N3NA 1S7VB 2WWKT 4N0UE 1WBYB 5T33H 4ZPVB 2UY7A 4QRUA 5E6IB 1FVEB 2EYTB 2X41A 3O45A 4JQVC 2F8OA 1D6VH 2F53A 1F3JB 3VGEA 5F88A 1ZA6B 3SKMA 2VISB 2CIIB 5ANMA 4NJAH 5IW6A 3QUMB 4WW1A 4KUCF 3OAYH 4P5TA 3LS5H 3MRLB 3NCCB 5E6YA 5DMKA 5FF6A 2BNRD 3K81A 4KXZH 2HFFA 2VQ1B 5EZOL 4M5YH 2XG4A 3SCMB 3QO0A 1L6ZA 1G7PB 4IDJL 1QSVA 4P9MH 1U95B 5D1ZC 2IPKB 5LG1A 2J88H 4ZOEA 3NPZB 4JKWA 4XVUD 4A2LA 2AK1L 4QRRB 1E4XI 1P6FA 5E08H 4PJGA 5JW3H 3VXMA 3PABB 4O2FA 1AHWA 4MCYA 4PB9L 4R0LC 2YPKB 3D18A 2DLFH 3VFPA 1K4DA 2GFBB 3TYGH 3RHWK 3BSZL 3QCTL 1MF2L 4ODVH 3O2DL 4XPTH 3FCTB 5CGYC 1IILE 3BP5B 3PV6B 5F93C 1MJ7L 2H6PA 4DW2H 1JWUB 1FL6B 4MD4B 1JYXA 1G7MA 5F1KC 5C08A 1RZGB 5TQ2H 5ITFA 3B4NA 3FQUA 1RZJH 4G7VL 3WE6B 4QOKA 1NL0H 1NMCC 3DECA 4HC1L 1GGIH 4UNUA 3GJFK 3NZHH 3IAPA 3MLZL 4C83A 4RGND 4FXLA 5HGDA 1U8HB 3BT2L 5MEND 1GGCH 1XFPA 4F7PA 2WBKA 3WXVL 4PJCB 4ZMAT 2XKNA 3P9LB 1IFHH 1SJEA 3QQ4A 1U3JA 3DX9B 2CKNA 2B0SL 5EZIL 4U1JB 5IB4A 1WISA 4DKEL 4JPWL 1I7RA 5F97E 1I85A 3BE1H 3GSVA 3C5JB 2ZZUT 1GGTA 4WO4C 5DJ8A 2X4TA 5C0EB 4JFFB 5JUEL 1B4JL 4NN7B 2CJUH 5GGSY 1LD9A 3SY0A 4P3DB 5LGJB 1MFBL 3GJFH 5JW4N 2VAJA 4Q74A 2ZCHH 5GS0L 1AR1C 3QUXC 3BGMA 1JFQH 2LU7A 1CVRA 4KJPC 4R97C 3CSYA 5B22A 4UDTA 3VXRE 5T5FH 2ADIA 4IRZH 4JZOB 5KVFH 1U91B 2F54A 5JHDA 4K7PL 3QPXH 2DMKA 3BXNA 4LMQI 3LKOA 3MO1B 3P4MA 1WV7T 4S11A 5IROC 3GNML 2B1AH 3GI9H 5D1QB 1M05B 1HZHL 4UB0H 4J3XA 4B7IA 2VLJB 2FZ3A 43CAB 1ZHNB 2NY2C 43C9B 2HFEA 1S9WA 5EU4B 3IF1B 1CXHA 2QADD 3KYMA 2AEPH 2F15A 3LKQA 4N5ED 5KW9H 4YHNA 1ITCA 5GRJL 1AI1H 4LCCB 2JB6A 4XVTH 2G2RB 1TETH 4F7CA 2OMBA 1B0RB 5KSVA 2IFGA 4F57H 1WAAE 2VDLL 2YKLH 2DQIL 2F19H 4XPAH 3UTTD 5BCAA 3PWPB 2YD3A 4LBEA 3GSOB 1HN1A 4PG9A 4CMHB 4N0CC 1E6OH 5D1XD 1AFVL 3Q5TA 4WUUB 4JPIA 4DK3A 1MQ8A 2BXZA 2DMCA 3U46B 3C09B 5IW1B 2X44D 3FKUS 3QRGH 1PZ5A 2OX5A 3L3DA 4C56A 1IM9A 1I1AC 2JK5B 5DC0A 3DYOA 4M6OL 5JMRA 3RWCB 5D4QA 3ARWA 5D2NA 5DFTA 3S37H 2CUIA 3UTSB 3TBVB 1P4BH 3H9ZA 3CH1B 1XCQA 4KKLC 4OI9A 4OT1H 4NBZB 4ZXBB 1MCJA 1OB1A 2E9JA 4NSKA 3I50H 3TLRA 1TLKA 1YEGH 2HT3C 5GPRA 1DE4A 3QDAA 5D7JA 5CZKA 4WFHD 1G9MH 3P4NB 3VFRB 3AM8C 4MLIA 2YD9A 3BVNB 5LAXA 1HXMB 4XB7A 5DA4A 3IU4H 1QR1A 3UYPA 4GKNB 2X4UA 3SKJH 1SM3H 4BFEA 5D5MA 3BOVA 4TSAL 4YDIL 1I9EA 1MH5A 5CEZL 4NGHH 3U7WL 5F1OB 2ICWJ 5DD6B 2GY7B 3JV6A 4K3DH 5B8CA 1Q1JH 4D9RE 4NO3A 1C5BH 4N0FA 4NNYB 1YY8B 3T1WA 3RKDC 4AH2B 3BZEB 3MGTB 2HTKD 3EYFA 1OP3K 4E41D 5F7NC 4X6DA 3WUZA 1PGRB 4W4OC 1UA6H 2AERT 4HK0A 4QY8B 2VXUH 4G6KH 3MCG1 1YJDC 1ADQL 1WEJH 3W0WA 4HH9B 3WEXA 4OLUL 4XHJC 3S96B 2D7TL 2XQYG 4ONFH 1T66C 2X4OB 3MLTB 1AP2A 4OCYL 3MFFB 4Z0BL 1ZLWK 3V4UH 1XF3B 1FORL 1LNUB 1IBGH 3TN0C 2X4SB 3IRPX 4X6FB 2AJUH 3QIUA 4AT6B 1QFWI 1NC2A 3G5YB 4P4KB 2RR3A 4I0CC 4WJ5A 5HYJB 1OP3H 4ALAH 1NFDE 1T21A 1PQZA 3N1FC 4KKAD 5IQ9A 4R8WH 5IFAL 3DRQA 4NZTL 1SBBA 4R26H 2WSKA 5JZ7D 4Y4KA 4POUB 1CBVH 4GKOA 3IKKA 5D7IA 5EFIA 4NP4L 5IMKB 4R4BB 4OLZH 3TT3H 2K1MA 3N9GL 4J1UB 32C2B 4BQ6A 2E7LA 1NFDF 3HNTL 5CSBA 1T7VA 2DWEB 2DM7A 4IS6B 2IJ0C 2AJZA 2A9MH 2GHWB 1YDPB 3NAAH 3O6FD 1T0MA 5TF1L 4QRPD 3TESA 3QQ9D 3STZA 4L8DA 5GSRA 5GRZA 2NY0D 2VL5B 1T2JA 4F9LA 1IVLA 4RMSA 5I8OH 1IC4L 2QSVA 4JREC 5MEQB 4IOFD 4L3EA 1CFVH 1ES0A 5DUPL 1RZIB 5I9QB 1FE8L 1A6UH 5DYOB 3WJJA 2AGJL 3RIFF 4N1CA 3KJ6H 2EO9A 1X44A 4X4ZA 2DIBA 3RY5A 3OZ9H 4GMTH 1RU9L 5FM5O 1GJIA 1DBAH 1T04B 4DKDC 5H94B 1IC5H 2R4RH 3EAKA 3WLBA 3JTTB 5IB1B 2P5EB 1HQ4B 1NUNB 2AK4A 5CJXA 3PQYB 4FQXC 2DLTA 4Y2DD 4JPVL 1N5YH 3QDGB 5HDQL 5CZVH 4HX1A 4ZFZA 1HHGA 4U05A 3UCRA 4JN1L 1KB5H 4OZGE 1MIMH 2FECI 1ZANH 4FQLH 5CEYA 3O2WL 3SDCA 3MLWH 4ZUSA 1QVOB 3EDDA 3OSKA 1R3HB 1F5WA 1SBSL 2JJTA 3QG7H 4N1EA 1OL0A 2D03H 1YYLL 2F53D 3BYYA 3REVA 3HC3L 3UPRA 5A16B 2ATPA 5DJAA 4CADA 5HHME 1H15B 4NQSA 1H5BC 3NZ8B 3THMH 4HULB 1IGIL 3T0BA 3DSNA 2HFTA 2I9TB 4FMKA 5E8NB 4OBRA 1TTGA 3WN5A 3MV9E 3BWAB 3ULUD 3BH8B 3QAZC 4LLYB 3KPNB 3ORJA 4QXGL 5INCA 5DRNA 2CKBH 1YMME 3ZHLA 1RZ7H 4LDLB 4L29B 4POZC 3U6RA 3GZKA 1RZ8B 4HMEA 5INDA 3T77B 1AD9B 4S1RH 3TPKA 5JHLH 4QHUB 3BH9A 4Y5VA 3DYPA 4XPHH 3VXMD 3IDIB 3NGBB 3IETB 3BD3A 3V6OC 2BRRH 4LF3B 1LO5A 3OG4B 3BIBX 1A1MB 1X5KA 2O5ZH 1SY6H 1U8OB 4WCYL 1IGFH 4ZD3L 1BFTA 1Z5LA 3VWJA 2H26B 4HKBB 1DANT 3SPVB 3FB5B 2P42B 2Z91B 3K46A 4YUEL 3TJHD 1KUMA 5C08D 3S34L 2BNQA 3E8UL 5HHQA 3GMNB 4LHUG 3VGAB 4QOKD 4AM0A 1SMAA 2FWOA 4D9LL 4LPCA 4XRCA 5HVFB 5ACZB 4OF8A 1UKTA 2VZOA 4MNQA 3VW3L 1QLEL 2A6DB 3KPQA 3OXRB 3T0EA 4W68A 2HJFB 4KFZC 5CP3A 4Y7MA 5IB3B 3CC5A 4DQOH 5DO2D 1SVCP 1V3KA 3KPSA 5DLML 5FYJL 1MPAH 4X98B 4PLNC 5HD8C 1I8KA 3HHRB 5EOTB 3UC0L 5IHUL 1TZGH 2YEZA 1BVLB 1U8MB 2D4DA 2Z8VC 2EYSA 4FZEH 1J05A 4JHAL 2E7BA 3DX7B 2UZYB 3TNNB 4LLQB 4P46D 3IGAA 3S88L 1NAKL 3E2HC 5L6YH 3G5ZB 3O4LB 4NPYB 1MREH 1RSFA 1P1ZA 3QJHB 5AG8A 1OD7A 1ACYH 12E8H 4ZFOL 2CDGB 2W59A 1KEGH 4HT1L 1JZ3A 1I9JH 4MA3A 2GK0A 3FO9B 3HUJB 1LO3H 4G8FA 4JHBA 3RJQB 5JHDD 2F54D 2P8PB 1J8HB 3TV3L 3EUUA 4K71C 5C9JA 4P2OC 4O4YH 3BP6B 4Y1AB 1DBBH 4IRSC 5I73B 5FO9B 4EEEA 4OUUA 3DUSA 5F1NB 3RL1B 5DQ9A 5DI8A 4OBSA 4JDZB 4J4PC 3NTCH 3ARBC 5DEFA 1J12A 2VR4A 5EOCL 3BQUC 1CL7I 4QRSA 1BBJB 1FFPA 4XNXH 1YPZA 3EOYG 2DB8A 3R06B 1U8PA 5CHNB 3KNBB 3ZE0E 3EOBA 5HHNA 1D5IL 4PTTA 3D6GA 3REWA 5H2BA 1BAFL 2W0FA 3MACH 4JJ5B 1D6EA 1T5XB 2KL6A 5BZWB 4C4KO 2FATL 1JHTA 4M6ML 5F1IA 1DCLA 3LHPH 3SO5A 2HKFH 3CX2A 3F6LA 4DKFH 4BYHA 3TCLA 2VLKA 1EJOH 1J5OL 1XCTB 4ZS6C 2I5YL 3F7YA 5EZJA 5E2WH 1OGAE 5LBSH 1IM9D 3TO4C 1LP9A 2J4WH 3DETD 3F5WB 4PJIF 5KSAA 3KXFB 4BH8A 4M8QB 3GHBL 3TO2A 1QKZH 5GGTH 2HN7A 4PJ9C 3ELAT 1NAMH 3ZT7A 5TE7H 4W6YB 2KZ1B 2R8SH 2VC2H 5F7HA 1L0XA 25C8H 1NCCL 4H8WC 3QDJD 3T4YA 1T80A 1KXTB 4OQTA 2Z35A 5EN2A 5DJYB 3MBEB 5GS1A 5FYLD 1OTSC 4UOJA 1X5XA 4X9HA 4CVZA 4BA8A 4P23C 5F7LB 1U92A 1IKFH 3IXTA 3MOAH 4QHNB 4GG8A 3KYKL 4XPBL 5DK2A 3LPGA 1MHEA 1A14L 1OF2B 5D6CA 2D31A 2V2TB 2OJEB 3KLAA 1IEHA 5EZOH 1NANH 5FB8B 3EYVA 3MXWL 2ZSVA 1AXSA 3CXHJ 3NN8A 4IDJH 1ZTXL 3KS0H 1Q8MA 2BMKB 1A1NA 5L0QB 3X3GL 2AK1H 2OL3B 3QBTB 3WD5H 3L9RB 3QULB 3VH8G 3SHSA 3KYOA 3FN0L 3DV6B 1T5WB 5E2VL 3FO2A 3IDJB 3ARGC 3K8MA 3ARDA 4OZIF 4PB9H 2AQ3A 3HAEH 5IMMB 3BSZH 1MF2H 1H3XA 1FIGL 4ONHA 4CJ1A 1QBLH 1MJ7H 4NQUA 3I6LD 3P11L 3QUMH 1NC2D 5E0QA 1IAMA 4W81A 4D0BB 1KIPA 2FECL 4CW1B 1S3KL 4G7VH 5F7UA 2VAAB 1Y6MR 1NJ9B 3FOLA 1V7NL 5J4MA 1YYMH 4Y4KD 4HS3B 4L3AA 1IL1B 4UQ3A 2FJFA 1C7SA 2YC1B 2NY5C 3JVGA 4MQXD 3WXVH 4GJTB 4GXVH 1ZT4A 1I3UA 1JNJA 3BGAA 2YN3A 4ISVB 4LLVB 2IMNA 4OCXL 2B0SH 2P7TA 5J9PB 5EZIH 1A7NH 4JPWH 4Y5YC 4DGIL 5C0CE 2JF1A 4NFCA 4WHTA 1E27A 1CXLA 2CLZB 2EDTA 2ITDA 5JUEH 1WICA 1B4JH 3CFJB 1P2CA 3ZDXF 3D39A 1MFBH 3RWFB 3QJFA 1HKLL 1P7KA 4L3ED 2WQ8A 4W6XB 4KJWD 3K8KA 3DVFA 3KHQA 4YHML 5MHSD 1YZZA 3PHQA 1P84J 2DQGL 3S4SG 5EUOE 1AH1A 2R9HC 4XWGL 1IRAY 1NEZA 4XXCC 3RFZC 1G0YR 4QHLB 1WBZA 4YHIA 5F96L 3WSQL 1WWAX 1CQKA 2COQA 4JQIH 4TSCL 2P8LA 4NKOB 1XR8A 4K7PH 3HTLX 3KPLB 2AK4D 3T65B 3RWDB 1WCBB 1KENH 3GJEB 3GNMH 4QRTA 1A7OL 5EUOF 1HZHH 4EN3A 3C2AH 4NQVB 5DMGC 1K8DB 2W91A 4I18A 1I1FB 2PR4L 3BZ4B 2BHYA 4ZAKB 4Z77B 4PJFA 1Y18A 2FX8H 3HKFA 3LN9A 1K6QL 5IVZB 3SDCD 1UVQB 5GRJH 1B2WL 3SDDA 1WWWX 5A2IH 1T0PB 1KCKA 5GJSL 5SWSB 4P0DA 2VDLH 2SEBA 2DQIH 4WTXA 1YN6B 3VMPA 3C9NA 2J7LA 4M62H 5BVJA 4Z78B 1KXQE 2P47B 1C12A 3FRPA 3O8XC 4TUOB 3QDMA 5SV4A 4ZNEA 3UTPE 4P2QD 5MERB 3H42L 1HXYA 1AFVH 2WLYA 4O51A 3SKNB 1OAKL 4KRPD 4NWTL 1HNFA 1YN7B 3WV0A 2IQAA 4YFDB 2A83A 5FA4B 4XB8A 5DSCA 4HWZA 4UILH 5BS0B 3HMXL 2YBRA 3CUPA 5B38B 1X5IA 3KLDA 4M6OH 2Q20A 1NLBH 3BMVA 4I5BB 2ED8A 3HZMB 1FH5H 2BNRE 2MKLC 1F6AB 4HH8A 4ODWB 4LRNL 1UB6A 1XGRA 4LK4A 5D1ZB 8FABB 4D0DA 3EGSB 5BQ7A 5I1DA 2HG5B 4K23H 2HJLA 2WBJD 3VWJD 1S7SB 4NQEB 2HVKA 3VD5A 2WW8A 5GGSB 1U3HA 5JNYA 4FXKB 1NCWH 5ERWB 3X14A 2IH3B 4L8BA 4MQSB 4QYOA 1CL7L 1Z9SA 1GC1L 4JZJA 5GIRA 2BNQD 5DJ0A 3MLSL 4R0LB 3O9WC 1Q9KB 4XHQA 5GJTL 4PJ5A 2EH7L 4HXAL 3WIFB 3KAAA 5EOCJ 3GIVB 4ZPTA 5BXFA 4TSAH 2FEEI 4ETYA 5HYSA 4RFEA 1FJ1A 3FAWA 1JPGA 3U7WH 2QSQA 3B8SA 5FKPB 5E4EC 5J12C 3T0VA 4OV5B 5EU6E 4MDJA 1JVKA 5KG9B 2B2XL 3T0ED 2C7UA 1NMCB 3MV01 4EXPX 5GRVL 5KSBF 5J56B 3HN3A 1ZT7B 2VXVH 5E9DA 2VUYA 1E4WH 4RGNE 1MHHA 1ZHLB 5MENE 1KYOJ 4OLUH 1FZKA 4YLQT 5K9OB 3NH7H 4PY8J 2D7TH 4Y4FD 1X4XA 1NGZB 1CFNA 2EDWA 4OCYH 3SDXB 4BFIB 3KLHD 3U0PB 5B39G 1FORH 5ILTH 4LKXA 4OKVB 3HMWL 1M71B 5TDOB 4WIQA 2UZIL 1TVBA 4JM4H 1VFUA 4Z95H 4DGYL 1Z3GL 4HUWA 2BVPB 3C8KB 5ENWA 3NVQA 4NRYB 1YUHA 4OFDA 3H9HA 3QUXB 4XX1E 4NP4H 2ZG2A 1JGUL 2ICCA 1YEDB 1INDL 1T83C 2YRPA 4R97B 3ET9F 4NHUA 1JI2A 3BP4B 3W9DB 3CLFL 4G8EA 5CBEA 4M8VA 3HNTH 2Y6SD 5KS9B 5JOFB 3OKDA 4Z9KB 3HLAB 5FYKD 3O3BA 3GMRA 4C58B 1AGCB 4U1IA 1OSZB 2CRIA 5D9SB 1L0QA 4LPWA 5IG7A 2KQNA 2VERN 1MY7A 3PP3H 4S0SD 4J23A 1RUKL 4PRPA 1IC4H 4WI5A 4Q6YA 5HGHA 1HI6B 1E4XH 3OKMA 4U1HB 5DUPH 2WUCH 4OZGB 1IC1A 1FE8H 1J0IA 3B9VA 1JN6B 4RMRA 1R5IB 3RJDA 3RGVA 4D2NA 4F3FB 4MS8D 2IPTL 1A6ZA 4WEBL 1RU9H 3SKOB 1XF4A 1IQWL 5EU3B 3FMGL 2FR4B 3MGOA 5HHMB 4Y19A 3AREA 3ZYJA 1PY9A 4JKLA 5SWQB 1XR9B 2EIZB 4BH7A 1MVFA 1E28A 2AXGA 3MNZB 4P5TC 5KSAD 3UTTE 4DUWA 2EXYD 3HE7A 3PIQA 3BFOA 4IIQC 5EB9A 3WHE0 1T1ZA 3C5ZA 1B0GB 4XPFL 4WV1A 2VQUA 1HOCB 2QQQA 1CLOL 3E6FB 4OLWL 5AUMA 5HDQH 3RZCC 3L3IA 5BW7A 3I3BA 4LSSL 5F9JB 1U3ZA 4JN1H 1I1AB 4NZRH 3FO1A 3O2WH 3TBWB 2OP4L 3G9VA 1P84K 1WC7A 4UT7H 1TTFA 1QYGL 1SBSH 3ZKSD 1IGML 4UDUA 1J8KA 4AK1A 3WIIH 5DMIH 2OI9C 1AHWC 4CDHA 1HILA 5CFHA 2NY3D 3QEGL 4YNYA 4DN4L 5DJZB 3KPRD 1CDGA 4YPGB 5I1LB 3NIGE 3V7AE 1EXUB 5ESVA 4WFHE 4NC1C 2DD8L 2XYCA 1ZMYA 5JR1H 1XMWA 5HY9B 5IM7B 1KV3A 1DQQA 5DHVB 2PO6A 3PWVB 3WFEH 3I6KB 1AC6A 3NCYS 4O2EA 1MCEA 5KTEH 2MPAL 2XPGB 3EYQC 4NRXB 5DQDL 5D7LB 1FBIL 5LCVL 1DUZA 5E8OA 3D85A 4BJLA 3F7QA 2FHCA 1S7VA 5JPNA 3FHQA 1VA9A 1WBYA 2VIRB 3ARDD 5E6IA 1NMAL 3VG9C 2ESVB 5FO7A 4XNYH 4WCYH 1EO7A 4ZD3H 1ZVYA 4PJDE 1ZA6A 4N90D 1HEZA 2VISA 4E41E 3V7AG 1HIMH 2CIIA 4TRPL 3MRLA 1NBVL 3RUGE 4GOSA 3S34H 3E8UH 3W11C 3HZVB 1INQB 4X4YB 4D9LH 2R0KH 5I8KL 3CSGA 4PR5A 4XCNB 2P46B 3TN0B 1R24B 1CE1L 2PTVA 4OLYH 1NGYB 2IPKA 2V5YA 2DKSA 2KBGA 1A3LH 3BZFB 4QRRA 3VW3H 1X7QB 3GRWA 4M5ZL 4Z7UE 1VEOA 4UIMB 3AROA 4NZJA 2WIMA 2PTUA 3P0VL 5FYJH 2O26U 3N1QC 2BCKB 3FCTA 3UC0H 1ZVSB 1B90A 2MOVA 4TOYL 3BP5A 3D39D 4OD3H 1JWUA 4YHZL 4MD4A 4JHAH 1C8PA 2AQ1A 3GMLA 1MCRA 4HWBL 3RZWA 1RZGA 4S2SB 5HSFA 4U1SB 1NAKH 1ZLVK 4HCRL 1T6WA 5GGRB 3MLUL 3OAZH 4QRPE 5ADPH 3LQAL 3S5LB 1T3FB 1U8HA 2NY1D