3MJ9A

Crystal structure of jaml in complex with the stimulatory antibody hl4e10
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
229
structure length
229
Chain Sequence
VSSPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVLPEEPRDLRVRVGDTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVGKLESRKTIVLHVVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Junctional adhesion molecule-like
publication title Molecular insights into gamma delta T cell costimulation by an anti-JAML antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 62
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9A02
1P4IL 2YA2A 4JFZL 3R1GH 4ZUWB 1OAQH 5D7IF 4D0DB 5CJ8A 5F89B 2CO6B 4JVPA 3K2UH 1A6PA 2VDNH 3EYFB 2VXVL 1OD7A 2HFTA 2HVJA 1MNUH 2FD6H 3H9SA 4JPWH 5DUBB 2XIDA 3HE7C 5L2KA 2WLZA 3OKMB 3DSNA 1RURL 3VA2C 1WBYA 1AQKH 3P0YL 3WE6B 4X9FA 1G6RB 2GI7A 2D7PA 4OCRL 4KPHH 4ODXB 4ZSOE 3KWWA 3CUPB 1OTUC 2ZUTA 2J6EA 5ACZA 4JZJA 1Q72L 2A0LC 1U8QA 2EIEA 2R56H 1X5JA 4OCXL 5I66B 4WWKC 3ULVD 4YHNB 1EHXA 4ESKA 3IXAB 5T5FL 1HYSD 3LN9A 4M8QA 2NY3B 2ZUQB 4L1HA 3ZDXE 3SKMA 3QEQA 4AIZB 2R4SL 3MBXL 3VMPA 2YK1H 1IAOA 1NAMH 5JOFB 2AJ3B 4OQTA 3ZE0E 4PS4L 4ENED 3MLRH 4GAFB 3EDKA 2F5BH 1CU4H 4PJAE 1KPVB 1N6UA 1ZS8B 1TVBB 3VWJC 1QBBA 1P7QA 2VISA 2YRPA 3U83A 9CGTA 2QR0A 4K71B 5AUMB 1KG0A 2FGWL 4Y16C 1WWBX 5DMIL 5C0CE 3V52H 1YEFH 5HHNB 3QCTL 1K85A 1CT8A 3RIFK 1B4RA 2IH1B 4XPHH 3HA0A 4HMEA 4LCYA 3IB4A 3LKPB 2OXHA 4WFGE 1KLUA 4O00A 1JI1A 4GXUM 1X9QA 5CZVH 1ETZB 1Q9KB 3FOMA 3NABH 4Y2OA 2HJLB 1FDLL 5IUSA 3BRGC 4PJIF 4N0UE 4G6FD 4AQ1B 1GZPB 3OKKA 4ZSOB 2YPKB 1IKFH 2LQRA 5ENWA 2R1XA 4PJCA 4OGXH 5I8OL 3QB7C 3NOIA 1SJHB 5JPMB 2VL5B 3NVQA 3SBWA 3MCLL 1IAIH 4H88H 3QJHA 5EBMB 1G9MC 1IC1A 3FQXA 5EZIH 4JAMA 1G7LB 3LN5A 5MEND 1AXSB 4Z0XA 5GGTH 2VLMD 1S3KH 4MWFB 4NQUA 3RI5K 4NOFA 3MA7A 5EO9A 5FHAL 4XMPL 4DUVA 4UT9H 2VUYA 3TIEB 1FGNH 5F1NA 4E41A 2MWCA 1AO7D 3FONA 5J3HC 4PJAB 1J5OH 1EHLL 3KYNA 4CKVX 3R0MA 4LDLB 4KI5F 5I8EA 1G9EA 3P30H 1IQWL 3VXQB 4HUXA 3WUWG 2A77H 3NACH 5C0CB 3MXWH 5DJXB 3MRLA 1JYXA 1LILA 1MREH 3WFEH 5C7XH 4Z7UA 4Q6IC 2I9TA 3OWEA 1KELH 1BWMA 4OB5H 4ORGB 1KTDA 3VCLA 2EXYC 1HEZB 4V2CB 4HH8A 2YPLA 4H0GA 4I13B 4K94H 2D0GA 2H26A 5C0AD 4BH8B 5SX5K 2A1WL 4N0UB 3ILPB 4YPJA 3BZFB 2ITCA 5D6DA 5DJAB 2M1KA 5IBUG 2NY2D 1X5LA 3U9UA 3BO8A 2X10A 2Q86B 3I3BA 2WP3T 3ZKQD 1RZ8A 5F7WC 4QHKI 1OTTC 4DAGL 1AGEA 3EKCA 4QRPA 5IT2L 1MFAH 3MRGA 1E0OB 1QD0A 4ZAKD 3UYOD 3MJ9A 5ID1B 1RD6A 3L6FA 3AUVA 4JQXC 2M8XA 3VDAA 3QEHA 4RMSA 3K8KA 4P5KA 4HAGA 4CADB 2DRUA 4JDVA 2GFBA 4WW2B 2PR4L 4EN3A 3GMPB 3J7HA 2AJXL 2XICA 3KJ4C 3T4AB 2I26N 1JPSL 1G6VK 4KVNH 3DTXA 3RDTC 3VDCA 4DOHE 2XZAH 3NIFE 4K7PY 2CKBA 2Z4QB 4MQTB 1RZKL 3FQRB 2BDNH 1LP9E 1YUHA 4WY7H 4DK6A 1K4CB 4O4YL 3LRHA 1TVHA 3GSWA 1BEYL 5DRZB 4LF3B 4MD4A 4CNIB 4NHCL 4JDTL 5HYQB 5IB1B 5LKNA 3O2VL 1OP5K 4RISL 4HWNA 3N9GH 2F54E 1GH7A 2LVCA 2D0HA 4FABH 1DQJA 4QHUA 5BZWB 4I9WE 5JTWA 1RIVH 5F7DB 2GCYA 2BK8A 1GCFA 4MDIB 4IHOA 4XPTL 5DEGB 5DI8B 3HCVA 3RTQA 2QQKL 1EZVY 1ZTXL 1PYWB 5JOEA 1KIQB 1A14L 1YNTA 4HK0B 5IW1B 1T6VN 5KSVA 3GSOB 3PWPA 5IMLB 1H3PL 5GISH 1I8LC 2EKSB 4JDZA 4P48A 5GRUL 1Z3GL 5C8JB 3W39B 4IRJD 2FATL 5ID0B 3VRJB 1X44A 1U91B 2DWEB 4P59H 3HE7B 3T4YB 3PQYE 1AGCA 4XVTL 4RFOL 5D5ME 1KJMB 4CW1B 4R2GC 5GSVB 1JHTB 4KV5E 4NFCA 2MKLC 4JO1L 1G7IA 5IOPB 4DOHB 2A38A 1UB6B 1H15B 2EDHA 1XZ0A 1RUKH 5IMOB 1MJ7L 5DK0B 3IDYB 3QUKB 4NZDA 3MLUL 1LP9B 3GMQA 1MWAL 3F6LA 1UQSB 3H7BA 5IG7A 4GO6B 5CEZL 4U6XA 5DVKA 1C5CH 1FL3A 1QPPA 1XAUA 4EI6B 3PGFL 5HHOA 2J1KA 1JWSB 5ACMA 5IJVA 3HC4H 2F54B 1C5DA 2HJKA 3FFCA 2X89A 3QCUH 5KVFL 4GSDL 5LGKA 2C3VA 4ZUTB 4P23A 5B38A 1NBYA 2C1PB 3U30C 4N0YH 4LLWA 2OXGA 5DJ2B 3OKOB 4PBVC 5JHLH 4YDJB 4JG1H 3PP4L 1NCWH 3MCKB 5ESQB 3RL2B 1NLDH 2AJUL 5F9OH 3WLWC 3CCHA 2YBRA 1JWMB 4JFFA 1I9IH 2HLFC 4FQCL 4O2CB 1I7UA 1P4IH 4JFZH 4A6YL 3S98A 4P4KD 3PQYB 5SWSD 1JPFB 3KXFE 1RI8A 3DHJA 5I1KL 5HHMD 3MRRA 5DGQA 5D5MB 2A73A 3FB5B 5EN2A 3EAKA 5EU6E 3B9DA 2VXVH 5E8DH 3U1SH 2Y06H 4K3DL 3VFVA 1RURH 1TTUA 3GO1L 5GS2D 2AABL 3P0YH 1NDMB 1BOYA 5CJOH 5I18H 4OCRH 1UM6H 2CIIB 4U0RC 3UZQA 2A6KB 3BSZL 3LEYL 4F80A 3DYPA 1U2HA 2FWOB 2NY0C 2CIKB 5D1ZD 3CZJA 4OCXH 1UADC 4YGAB 5KJRL 3HI6H 5T5FH 3KHQA 2NW2A 4I77L 5C0BE 5F21B 1B0GB 3VXSD 2R4SH 4RRPG 1ORQB 3L95A 1FL6A 1KPRA 3MBXH 2B4CC 3GSNL 4IOFD 3P73B 4G42B 4I0PC 4IRSD 1QBML 2DICA 3V5HA 3JWOC 5B3JF 4PS4H 2G5BB 1JGDA 2I24N 1RJYB 3U7AA 2VXQL 4JFXB 5HHPA 4QRRA 2H9GB 3RWHB 1PY4A 4Z7NE 3OB0K 1FNGB 3ARFA 2X4TA 4NUJA 4TUJA 1OT2A 3FQWB 1MHHA 1NANI 1VKXB 3K81A 2PXYA 5F9JB 2Q7YA 2FGWH 4U7KA 2BNRE 5DMIH 3KXFB 4J3OC 5GGUA 3QCTH 1X5XA 3VG9C 3BDYL 4HGWB 3S5LA 3MLTA 1N5AA 5EU6B 3AU1A 2E7MA 4PFEA 4Q2ZA 3WFZA 3RZCD 1Q1JL 3G5XB 1CGTA 4QRUB 1VACB 5TDOB 4ODVL 3SHSA 3WUWB 1Q9LB 3IKKA 4X6EA 1Z5LA 3CPLB 4DGYH 1C16B 2DMCA 4ZUVA 1FDLH 1QSEA 3EIFA 4HHAB 5D96C 3T8XB 1QBAA 4H0HB 4JRYA 5EU5B 4GKSB 3L7FA 3KPRD 5DRNA 4WI6A 1X5AA 1D9KB 5T1MA 4WUUA 2WUBL 3QXAA 3WIFA 1SM3L 1Y18A 3MCLH 1M7IB 2RIKA 3DUSA 5ALCL 4R0LA 5C0BB 4YNYA 1HI6A 3RUGF 5CIPA 2X70B 5IBUB 3WO4C 4DTGL 5BXFA 1Q9OB 1RJLA 3NH7H 4FQ1H 4NQCA 4P46A 1TPXC 4XMPH 1WITA 3W9DB 4K7PX 2AEIT 1CF8L 1RUPL 3NPZB 4GS7C 1PY9A 1NLBL 4DKAA 1KXTB 3PDOB 2AXJA 5FYKU 1IQWH 2JB5H 2XPGA 4I18B 3D0LA 3MRDA 2BNRB 3RHWK 1I9JH 2OTPA 5GHWH 1RSFA 4YBQD 4RQQB 3X3FL 1T7YA 1CICC 4JY6B 3AAZA 3MRMA 1WCBA 1DLHA 3VXRA 4NNYB 3EDDA 2NPLX 1KTRL 4NZRL 3ORJA 1PG7L 2P5WD 2R0KL 1EBPA 5TF0A 1WFUA 5ITBH 3OR6B 1EZVX 3QWRD 3IFOB 1WC7B 4XCYB 3QI9D 1JFQH 4K3JL 1I85C 1NC4D 2E6PA 1CXIA 1KJ3L 4QOKA 1A4JB 3BWAB 1FPTL 4WV1A 4ZDHA 1KPUA 4ELMA 1U3HD 4D2NA 4DAGH 4URTB 1KLGB 2Y6SD 3QDMD 4MXVE 5HI5C 1KB5L 1NGPL 5C07D 5DD3L 5IT2H 2NTFA 3RWEB 5F8RC 3NCEB 3JV4B 1CFTA 5ICYB 1L0XA 4YHOL 1O7VA 1XGQB 2R0WL 1ZLWK 2BOCB 4POUB 1JNJA 4JFEA 5DEFA 4LHUD 4BFGA 4APQC 4KK8D 1KULA 1IM9D 1Z2KA 3OJ2C 3Q3GB 2PR4H 2NY4D 3KPNB 4Z7VA 4DZ8A 4PREA 1DQML 5FUOL 2O61B 3WFHB 1SEQL 4H1LA 4W4NA 3GRWL 2QADD 3M1BB 3D2UB 2B39A 5D93B 5E7FA 4G8GD 1XIWD 4O4YH 3ARGA 2H2PD 3WEXA 1BD2D 2XZZA 1BEYH 2A9NL 4TYUA 1WZ1L 2PYED 2MQ0A 4NHCH 4XZUA 4JDTH 5GZND 3O2VH 4RISH 4ZO7A 1OQXA 5E8EA 2HT2C 4LQFL 1GAFL 3OKLB 5CP7A 3M45A 3R06B 2L7JA 3ULVH 1CFSA 2XKSA 5JOPD 2VLRD 3CFBA 5I71C 4XPTH 2GIYA 3GSQB 1RZIA 3VFOB 2QQKH 3PIQB 3L5HA 1LEKB 1G0XA 1A7BA 3OKYA 1A14H 1YNLH 1UEYA 1UB5B 3CFKA 4OLYH 2CQVA 5F1SA 2OJEB 3OAZK 1HCVA 5L2KE 1NBVH 3DOSA 4KTDL 5GRUH 3NTCL 1Z3GH 2WBJC 5I8KL 2HLAA 3HMXA 1DQQA 1CR9L 1UM5L 1RHHB 4AEEA 2CRMA 1EEYB 4GW5A 4M4RA 5T1KB 4RFOH 2VQUA 4HGKC 3MLWL 3X3GL 3TBTA 3UTTE 2W9EL 4CBPA 2DF3A 4LLQA 4QGTA 2H6PA 2VABB 2YC1A 4JO1H 4LVHC 4ODWA 3ZYIA 5IB2B 4FQLH 2P24B 3MLUH 1MWAH 4JREC 5CKGA 2OZ4A 4R7NB 2Z93A 3TZVA 2WWKT 4YUEH 4DVBB 4Q9RL 4I0KA 3PG2A 3QULA 1S7SB 2IWGA 4Y4FA 5GIRA 1FYTA 1JK8A 3B5GA 4XWGH 3C60A 1KJ2B 5CINH 4CVXA 2D9QB 3MYJA 1DR9A 3SGJC 3HB3C 4S2SA 5KVFH 1P7KA 4GSDH 4E0RB 3R8BB 1FFOA 3O45B 5A43C 4HJGA 5IEHB 5JW3H 1AGFA 1YEKL 2DQEL 1EFXB 1N3NA 2EZ0C 1BJ8A 4NC1C 3PP4H 3PXJA 4D3CL 5FYKL 3RL1B 4NBYB 4Y8AA 5DRWA 3BQUA 5HGBA 5L2KB 3U7YL 4FQCH 3P4NA 1XH3B 2YPVL 4A6YH 5JO5A 1JTOA 2AJVH 1VEMA 3F12B 3ZTNL 5I1KH 4JG0L 3QO0A 4WEMB 1MCBA 3B6SA 3V6OA 3X11B 4OLWL 4F58L 1RVFL 3IVKB 3UTTB 1U8HB 4KMLB 5AG9A 3VXUE 3S36L 4K3DH 3F7PC 3T1FA 3GO1H 1P2CA 1XR9A 2AABH 1QACA 1FNFA 2D4FA 2HFGH 5D1QB 3K4DA 3SDYH 4GW4A 4XBPA 3LQAL 3I50H 1HWGB 1JGEA 2XA8H 3LB6D 2Z8RA 5E70A 5J13C 5HYSG 4XP9L 4KKAD 3LEYH 1FZOA 1I4FB 3EGSB 3FB7B 5DYOA 5KJRH 1MF2L 3FO0L 4FQXD 3I6KB 1A6AB 1JL8A 5HHVL 5BO1L 3DVNA 1JNHB 3OMZA 4ZUUB 4WWKA 3P0GB 1LWRA 4U31A 1A6TB 4NWUH 5F1IA 1QBMH 3WNMA 4FTVA 3C5ZC 3S37X 1DCLA 5HGHB 5FK9A 3SY0B 1UA6L 1U8OA 3KPMA 1KLUB 1NFDE 2DD8H 1EJOH 4GG8A 4U6YA 3JBG7 4N8VA 4ZPVB 5DDHA 1H3WM 3A6CL 3OKKB 3BDYH 3VWJA 2OTUB 5ENWB 4GXUN 1Q1JH 3GUTA 1K3ZA 5FHBL 3VXUB 4Y16A 3QUYB 4ODVH 3IDJA 3L3HA 4LCCB 4WRLA 4GQPH 5I76A 5ETUA 1NGZB 5DD0L 3GMNA 4L4VD 5CJBA 3V0VA 3HI1B 3EDEA 3RNKB 3UEZA 2ZNXA 1ONQA 2KQMA 4P2QD 3SJVE 4LMQI 1OAUL 1UC6A 2WUBH 1TZHB 4K8RC 4MB4A 3IJHB 3FONB 5JMRA 2APFA 4NQVA 5I1DB 1WBZB 3MNVA 5ALCH 5EU7E 4XTRD 1K8DB 2VC2H 1NANH 3EYOB 1N4XL 4APQB 3LH2L 2ATPB 1UENA 1NAMB 4WDIA 3K1KC 4M7LL 3WNPA 2LAAA 3GNMH 3OTTA 4FFWD 2XYCA 4JM2B 3V6FA 1FO0L 5DUML 1A3LL 1RUPH 1BVLB 2ENSA 3LD8C 1NLBH 3F7YB 3OX8A 2Y7QA 5GGVY 5DMYA 2E7LC 3Q6FB 4K3EH 5BOZG 1JV5A 1NFDB 2IBBA 3ZZ1A 4PJXA 1BJ1H 3QWQB 3GSNA 1KOAA 3O2DH 1T80A 2H26B 5GRJL 2GSIA 2CUIA 4AG4L 1CL7H 1NMCB 3MV8E 1EH9A 4C57C 1IBGL 4LEXL 3BO8B 3O2WL 5K9QI 1D7FA 2IMNA 4NZRH 1E28B 3F7VA 1PG7H 2R0KH 5EBWB 5E99L 3HN3A 5D7JD 3T0DA 4Q6IA 3ILQC 4B50A 3RGVD 3L5WA 5BQ7B 3O4LE 3U0PB 1FPTH 3VFPB 3SJVB 1QBLL 2MFNA 1VEOA 2ZWLT 1U8PB 1D5XA 4JDVB 4HBCL 3SDCD 4HMDA 1KB5H 1NGPH 2VERN 3H6JA 5EO1B 5DD3H 4ZOAA 5DD1L 4EN3B 5IMKB 1BF2A 4X80L 2R8SH 1HDMB 3QDGD 4ZTOL 4Y5VC 2Q3ZA 4L29A 1CQKA 3H3PL 3FT4B 3RQ3A 3WN5C 3DRQA 2Y25A 2PW1B 2CKBB 2J8UF 3DETC 4C4KT 1F02I 4PJBF 4LVHB 3MV7A 3MC0A 4PJEF 3WFCL 1NGXB 1QO3A 1JGLH 4M02A 1MJ8L 5J89A 2ITDA 4JQXA 4NO5A 2R2HA 3SCMB 5E6ZA 1DQMH 4KROC 5FUOH 1S7XB 1SEQH 2R2CA 3RWFA 2ZPKH 1QR1B 3GRWH 2YWZA 3HNTL 4NN5B 1DUYB 4ONGH 3A6OA 4YK4B 3MV8B 4UILH 1YN6A 1ZHLA 2MCPL 2C3HA 2GK0B 4HKXB 2R1WB 2GCYB 2A9NH 2X4UA 3RDTA 1WZ1H 4H8WL 4IHOB 2FBJL 5EU4A 1YEGL 5D8JH 3MYZA 1P4BL 2EIZA 1LE9A 2IALA 3WD5L 1QRND 1JF1B 1S7QA 1XF4A 1H0DA 3CMOL 3WUZA 3TA3D 2N4IA 4GUPB 3WYRA 4LQFH 5C08A 1GAFH 2YXFA 4JFHD 4ZODA 4FQJL 4OT1L 1YY8A 3LZFL 5I1GL 2CGRH 3O4LB 1DANU 3MOAL 4GRMA 3TM6A 3OL2A 5I1EL 4ZS6C 3ZLQC 1MRCL 3P9LB 1IQDA 4M1CC 5D7LE 1NC2A 2FNBA 3A0OA 3SDDB 4KTDH 1S7RB 3NTCH 3P9WB 5HVGB 5I8KH 1XZ0B 1YJDL 4JANA 1AI1L 2PCPB 4FXGA 1I8LA 3UPAA 4GBXC 3MLWH 3X3GH 4HPYH 3MRQA 4U05A 4WEUD 3GHEL 4ONHA 4OD3L 3O0RL 5F7YC 1FNHA 4QHLB 2PO6C 5TPWH 4KY1L 2CXGA 3DBXA 3HC0A 2DQFA 4Y2DA 1UXWB 1MEXL 4MCZA 1WF5A 3EOAB 2AK4A 3IDGA 5JW5B 3FHAA 2X9XA 4Q9RH 1I3UA 3OKDB 4YPGB 5KZCB 4MXQD 5DLML 2O5XH 2H8PA 4MNQE 5E8PB 4HUUB 2Z35B 2XN9A 5GS3A 2IQAA 5KSAD 5GGQH 4PJ7F 1QSZA 2WBWB 1TNMA 4X5LA 4WFFD 2V5RA 4QCIA 3D25A 3SPVA 4L9LB 5HYSB 5C0EA 2CK2A 1DE4B 1YEKH 1WTLA 3T0ED 2VIRA 3MR9B 4D3CH 5D7LB 5FYKH 1AKJB 1HH9B 4NM4L 5A3IC 2V2TB 5M94B 4P49A 1FE8L 3CMGA 1MRDL 4OCSL 3RVWD 1XT5A 4PJ9C 5C0ND 3FOLB 1IL1A 3ZTNH 5K59F 5C09E 2QL1A 3ZKMC 1RZGB 4PYGA 4YHML 2QSQA 4OLWH 5E8NA 4F58H 1RVFH 2WSKA 4PY7B 5FF6B 4ZQKA 1HHKA 3GDBA 5KW9L 1KB9J 3O6FC 4JKLA 3VFMB 4LKXB 3X13A 3N50A 4HUKB 1G0DA 2EC8A 3C08L 4YDVB 1F6AB 3QRGH 3MCG1 1ES0B 2NQCA 4U2ZA 1P1ZA 3U4EA 1KPRB 4ZTPL 3RWDA 2IJ0C 4F9PC 4MNQB 2RJMA 3V5HB 3TIDB 3QPQD 3G6DH 1OCWL 5A2LH 1PEWA 4RWYL 4FFVD 1F4WH 1I1YB 1IC7L 2HN7B 3FO0H 1G7JB 3NGBB 1CXEA 3BRDA 3LHPL 2XY1A 5HHVH 3VXOB 5BO1H 3ULVC 4M03A 2FR4A 1HH6B 3LKOB 1XR8B 2H32A 1HYSC 1W0WB 1S5IL 2V9RA 4E5XA 1V7NH 1FFPB 4JRXA 1GPOH 3S35L 1D6EB 4X99A 3C6LB 1NJ9B 1LEIA 4UOW1 3T3PE 4I0PA 3C5JA 5FO8A 5HPMA 4JFQB 4TPRL 3HR5A 4X7SL 4S10A 3DV6A 1XCTA 2IBZX 5C09B 3ULSB 3AS0A 2APTA 5DHYB 5E00A 5GGRA 4X6CA 2NZ9D 3HZYB 4U6VL 3NMEA 3T65B 1T1XB 1A64A 2DQHL 3WIIL 3WNLA 4XHJD 5D1XA 4WO4B 4WW1A 3DUSB 1J1XL 1I7RA 2BXZA 2JCCE 2KBGA 1B2WL 3NCMA 3O8XD 3WHXA 4OM0L 4Z76A 3TO4D 3AS2A 1QKZL 1T1YB 5FUCC 4G9FE 4NO0D 4LVOB 1O0VA 1HSBA 4KDVA 4TUKL 3VGAC 3WN5B 5FECA 2OTWB 1YQ2A 1T83A 1WIOA 3QEUA 1JGUH 4HDIA 2DM3A 3U4BL 3NCJL 1R5VA 2W07A 3LV3A 3MRDB 4U7SA 1G9NC 4NP4L 5JPNA 4DEPB 4GG6E 1BIIA 1RQ5A 3GI8L 2ZG2A 1FO0H 5DUMH 1IT9L 5BJTA 2E9WA 4L3CB 3OR7A 4PRHE 1A5FH 1ULVA 3GSRB 3RX7A 1VADB 4NRYB 1OGAD 4LPXA 4MNHB 4XNQA 3UTZA 3NIDF 4YHYB 1U93A 4NRXB 4PJIA 3ZO0A 4XBGA 4POZC 5GRJH 2E7HA 3ARDB 5FB8B 1I1AB 3QQ3A 3RNQB 1IBGH 4LEXH 3ZE1E 4LOUC 4NNXB 4QYOA 5LBSH 4JGUA 2QLVB 1WFTA 1CICA 3PDGA 5C9JA 1KIRA 2JCCB 4JPVL 2Q7NA 4HIHB 1CI5A 2BRRL 3HMWL 1CTNA 5MI0C 1AXIB 5KOMC 1KN4L 4Y7MA 1KIUA 5E4IA 1QBLH 2BSTB 1QPXA 4YQXL 4G9FB 1I85A 4HBCH 1AC6A 2NY2C 4Y4HB 4HPOL 3L7EB 2E27L 4X80H 3LKSA 2W0FA 1PX4A 4ZTOH 1IEAB 3TN0D 3CU1A 2NX5D 4GG6B 5I1JL 3DPBA 3B3IA 2ARJA 1NGYB 3BE1L 4BFIA 4Y1AA 2D9CA 4PGEA 4PRHB 4HFWB 1MJ8H 3P77A 4XZUB 4KUZL 4L3ED 4LP4A 1ZANH 3U0WL 3E6FB 3LKRB 5BV7C 2YRLA 3HNTH 4DQOL 3NIGF 4R8WL 1IM3B 2HWZL 1FORH 1G7HA 4TULL 2MCPH 3MGAA 5EZJA 5B8CC 4Y88A 2EYRB 3O9WD 2HTLC 1CFSB 2A83A 4GRLB 1FJ1B 4MXWH 1CCZA 2HTKD 2PETA 1HXYA 3T77A 2NY7L 3EJZC 1DUZA 2VN7A 1YEGH 2EH7L 1XF3B 2EH8L 1P4BH 5IBTL 4D9QE 4ONOA 3CMOH 2BVOB 1QR4A 3ULVE 4EQ3A 3IGAA 4P2RE 4NKOA 4S1DC 4FQJH 1W72H 3ES6B 4LSVH 1HKFA 5ESAA 3LZFH 1Y0LA 3Q6GH 5I1GH 4OTXL 4JB9L 1P5VA 3MOAH 2H3NA 1AY1L 1TDQA 1M1SA 5DJZA 4QRQB 3MBEB 5I1EH 5MHSD 2EDJA 3CDCA 1MRCH 5ELIA 4PJ9B 2Y4SA 4UT7L 5FFLA 5CKAA 3S34H 5KSUB 4HCRL 4IIQA 1C7SA 2VUOA 5HXMA 1C8PA 4Z9KB 4DCQB 5DJYB 5AAMA 2DI8A 3NCCB 5C0FA 3DARA 3GHEH 2WBJA 3O0RH 3UTPD 5GGSB 4HSQA 1FG2B 4Z77B 1IGML 4K2UL 3BJLA 4CVXB 2AAVA 1BX2A 3RA7L 5D2NC 2VZ1A 1F8TL 1FFOB 4OUUB 2X4RA 3ARRA 1Y6NR 4CN4A 4P4RA 5D9SA 1N3NB 3MGTB 4JFYB 3QG7L 4N0CD 2VLJD 2QJDA 4G80A 1A4KB 4QHKJ 5HGBB 1X5KA 4N9GA 1J9CT 2B0SL 2R15A 4P2RB 2V2WA 3AM8C 1Q0XL 2FJHB 4XBEL 2I5YL 2UYLA 1FNEB 4OZHE 3H9HA 3OKEA 4HIEA 2VLME 1DVFD 4KHXH 5BRZA 3SGJA 3DVGA 5I73C 1ZHBB 4KJQD 4ZS7L 2W0PA 4OZGE 4ZNEE 3AMKA 4KI1A 4K23L 3DMMD 3OJDA 4NM4H 4OUOA 2ID5A 3HAEA 1CDIA 2ORBL 1L6ZA 2ED9A 3O4OC 3O41A 4NQSA 1UKTA 1FE8H 3MREB 2FO4A 4OCSH 1KXVC 3IJSB 2CMRL 3RVTD 3ISWA 1XGRB 3DX8B 4YHMH 2CRYA 3NFPA 3DLQR 4O02H 4CVZA 3AS3A 3SKNB 4NQDA 1F6FB 4S1RL 4NNPH 4MGXA 5KW9H 1NPUA 3U48A 4P4KC 3GM8A 5F7FA 4ZXBD 4L5FL 2BHZA 1MWAB 3D85A 3F7RA 3TF7C 3VI3E 5C0AE 3FAWA 1A7NL 4O2FB 3WBDA 4ZTPH 5CZKA 1BBJA 4HULB 3FQNB 1OCWH 2ESVE 4RWYH 4AH2A 1PD6A 4RSVA 1IC7H 2F8VA 4OZHB 3LHPH 5D1ZC 3QRFM 4U1LA 1UZ8A 2R2BA 2VH5L 4OZIE 1S5IH 2CR6A 3VGHA 4OZGB 4P2YA 1J8HD 4WTZG 2GUOB 3DX7A 4UOW0 3S35H 4HKZB 3OJVC 2X4PA 4A6YB 4PJHA 5DA4A 3QIUC 4IOFC 1AC0A 3U9PH 1H3TA 1YEJL 2B2XL 2GEEA 3E2HC 3EOTL 2J8OA 3DURB 5IB4B 4RA0C 4TPRH 3C5ZA 4X7SH 1R5WA 1DTUA 2YA1A 3ET9F 1A6VL 4UOJA 5LQBL 4XCCL 4HV8B 2EDOA 2AXGB 5DQ9A 4M61A 4U1GC 1B6UA 1C12A 4MS8D 2YKLL 2UVEA 5FEBA 4U6VH 1BHGA 3TNNA 4L8BB 4RFNC 3PGCB 1C08A 5JNYB 3GMOB 4KHTL 5TJWK 4M9OA 5IFJB 4AEFA 3RZCC 4QNPF 3B4NA 1J1XH 3MNVB 5C0AB 4NCDA 4F37F 2EIBA 1INDL 1B2WH 4U1NA 4TSCH 5H2BB 3QUML 2HFEB 3OGCB 3BH9B 3BMWA 2NY2B 3BEWB 1KJVA 2DMKA 2GITB 3UTSD 1QKZH 3VH8G 2ESVB 4H25A 4X8JA 5HVFB 4ZYKA 2Y7QB 2JJTA 3ZTJH 2P46B 2BC4A 3TGXA 5B39A 3U4BH 5GGSY 1IAKA 3MOBL 4ZAKB 1J86A 5EIIB 2ZSWA 4NP4H 1OM3L 4OZIB 3GMRB 4I3SL 3GI8H 1IT9H 4K7FA 1MOEA 4NDMA 3V4PL 1NFKA 1VFUA 5TQ2L 4GT7A 3QBTB 2Z92B 4NSKA 3UBXI 3TBWA 3MZTA 3G6JF 5B8CB 5IF0A 1V3KA 1BQLH 3QZWA 1SY6L 4Y4KC 3VRIA 1KC5H 3CU7A 3CIQA 5C08E 4XPGL 2E7LA 2GSGA 4LP5A 2YD2A 4X4ZA 3V6ZB 1YEDB 1NFIB 4EKXA 3NAAL 3WIHL 4YC2C 4UDTA 5EC1A 4YBQC 4JQIL 3SDXF 2NY1D 2C7UA 1IILE 1S78D 2B7DT 5E2WL 2E3VA 4JPVH 2FBOJ 3PWLA 2BRRH 3HMWH 1UACH 4HUVA 1E6OL 2NY3D 3I6GB 5TH2B 1JZ2A 5E2UL 3HC3H 1F3DH 4OCNC 3THMH 4CU7A 2O5ZH 1T4KB 4LHUG 5F7EL 5L88H 3TESA 2E27H 2BY2A 1EIBA 1CLOL 4L8CA 4QEGA 2WWMD 4P9MH 3HLAB 4OCYL 4Z7OE 1U3HC 5IM7A 2Y6SC 3O3BB 5I1JH 3BW9B 4IRJB 2VRAA 1MI5A 3PWNA 1TETH 2W60A 5KVMC 4U1SA 2X4UB 3EDJA 4Y5VA 1CVRA 1EFQA 2IPTH 4NQEA 3QO1B 1U8NA 1FFNB 4KUZH 4OBSA 3U0WH 3QSKB 1H0DB 2VR5A 4JHWL 4R8WH 3QA3A 1BECA 5C08B 2X6MA 2XFXB 1BJ1J 1UXSA 1P69B 2HFFB 5DSCA 1F3RB 1N2RA 3QJFB 5EUKA 2EH7H 1AIFA 3RWCA 3B5HA 2QADC 4PLNC 4FQPA 4OI7A 5IBTH 1CK0H 12E8L 5CWSA 1UKSA 1XIWC 4OD2B 1ZVSA 2H2PC 3T1WA 3FB6A 4PRDB 2H41A 1BFOB 3FZUC 3MJ8B 2YWYA 2F53D 1OSZA 1U2CA 1MCJA 4N90D 5GZNC 4LU5L 3O3EB 3B9VA 4HEPG 3BHBB 4OTXH 4JB9H 2JE8A 3OPZH 2DLIA 1XCQB 5DR5L 2VSCA 3TH2T 4MVBC 1A2YB 1OF2B 1KB5B 3TBYB 3O4OB 2X4SB 1XFPA 1KTLB 2GT9B 3WS3B 1TJHH 3S6CA 5K9KB 1L9NA 2BHYA 3HZVB 4Y2DB 1FLRH 4LCUA 5EZLA 4N0FA 3PV7A 4YDLC 2DQUH 2W65B 4XNMB 3QIWD 4HH9B 4I4WA 4OQ1A 1ZT7A 2EYSA 4XNZB 4MJ5A 4G6KH 3CFEB 4AK1A 4H26A 1T0MB 3QCVL 2AV1A 1WISA 2BCKB 1J87A 3CLEL 1MJJA 3D0VB 1CE6A 4GBXA 3TJHD 3RA7H 1WQVT 4AJ0A 3QNZA 3EOBA 2BNQA 3JTSA 1WT5A 1IC4L 2PTTA 2UZYB 1KIPA 1K3IA 4KDWA 3BAEL 5D7IE 1HHGB 3UPCA 1MLCB 4JM4L 3WNOA 5DJ6A 3KPRE 3QG7H 5IVXA 1AXTL 3LEVH 3ULUF 2AEPL 3ZE2F 2NXYD 4JRXE 4QLRA 3L9RB 4NZTL 4TTDC 2B0SH 4HQQH 4XBEH 2I5YH 3M17A 1R3IL 3LCYA 2RCSL 4OM1L 3PWVA 2QHRL 4L3AA 3HI5L 4WFHE 4LEOB 5K9QG 2VLLA 5FYKE 1ZA3A 4IRSB 5E8NB 4ZS7H 2AJSH 3K8MA 4K23H 3GBML 1HINH 3WXVL 3IXTB 3KPSA 3BRFA 2DL2A 3LS4L 3VFRA 2V17L 1R3JA 1I8KA 3DGGB 4OLVL 3BPLB 2Q76B 1WWWX 4P2OD 2QSCH 3VFNA 4RFNB 1HIMH 1X5ZA 1UJ3B 4QXTA 3TCLA 4G8IB 1T04B 2WINA 4J8RB 4HCRA 5EDXA 4KJWD 3SE8H 4S1RH 4Q6YA 2DWDB 5IK3B 4MX7A 1F6LL 2EXWC 1E4WH 1OY3B 1AGDA 4L5FH 4R6UA 2P5WE 3L1OL 1B90A 3IETA 5SX4I 1GGCL 3BGMB 4WUKL 1A7NH 3O6FA 5D7IB 4AQOA 1K8IA 1OLLA 1UH3A 4WI8A 3KPRB 4TUOB 5F7MC 4JHAL 3LB6C 3MRPB 4JRXB 2DQCH 4OZ4A 2IFGA 2IPUG 2KZ1B 5EBGA 3QDME 3NZ8A 4KKAC 4QTIL 3EYSL 1AFVL 4PGDA 1ZA6A 3MRKB 1PZ5B 1T21B 1XCTB 4LLVB 2ZKHL 1FAIH 3VH8B 3BPOB 2QBWA 1J05B 5BOPA 3ZHLA 5K9OB 3FO2B 5I15L 1QSFE 3OXSA 2OCFD 3P3YA 2H2SD 3MXVH 2B2XH 1YEJH 5KSBF 1BMGA 3EOTH 4JFDD 2X9WA 2KDGA 5MERA 4LQ1A 5LQBH 4XCCH 4YC2B 3FRUA 1A7RL 3G5VB 4PP2A 2UWEA 2X1OA 1FRGL 2YKLH 4OLUH 1HXMB 5INDB 3MRCA 2I07A 1A1MA 3HE6A 4P5TA 3CH1A 2VITB 3GI9L 1DBKL 3BKYH 5ERWB 5F3BB 4PJFE 4WU5B 2P5WB 4KHTH 3ARTA 2XOTA 5FECB 4UMGA 4BSJA 3GSUA 3STZB 4XGZB 5IHZB 1N5YL 2F54D 4OBRA 1INDH 3QI9B 2FEDC 5F1OB 1NC4B 3DROA 4RMUA 3ALWA 1P84K 4Z78B 5JOPE 4Z95H 4XRCB 2HJFB 4HW6A 1AHWB 3QDMB 4X4YA 2AI0L 3CVIH 4U1IA 3SGEI 4ZUSB 2HT3C 1BFVL 3ARBA 1OOAA 3MACH 2I60L 4LCWD 4S1QL 1OP9A 4I3SH 2VZVA 4MCYA 4GW1A 3UROR 4XTRC 3OXRB 4UIMB 1U6AL 4LHUB 1NH6A 1QSFB 4X6FA 3AREB 3OHXA 3Q5TA 2NY4B 2EC9U 1HILA 1A3QA 5HJ3A 1AQDB 4WHTB 1IGTA 1SY6H 5MENA 1KIRB 1BF8A 2QADB 4XVSL 5ALBL 1ZT4A 4F8TA 3LEXB 5T5NG 1OGTB 2I27N 3L3KB 4LMQE 3WIHH 1HWHB 1AO7A 3DUUB 3VGBA 1G7PA 5J7CC 2X9YA 3E6HB 4JQIH 4PJFB 4CRPA 2NLJA 3LSOA 3P4OB 3EYUL 1T7VA 3VE0B 4F2MA 2DL9A 4I3RL 3CFIC 4PG9A 1OW0A 2W0FB 2EE3A 1E6OH 2VZTA 8FABA 4G9DB 5J56B 1LO5B 2OJZL 3FCTA 3QZWG 1LEGB 4CMMA 2BRQA 5D7JC 5E2UH 2DQJL 2HMID 3KPTA 1RK1A 1ZT1A 1PG7W 4EI5C 1V3LA 3BH8B 3D3VA 3IFPB 4HS8L 3RGVC 3U4AA 5E5MB 3QUMA 2J88L 5HTSA 4MQXD 3DV4A 4PRAA 3SDCC 1FO0B 3V7AG 5J6HB 2AV7B 5BS0E 5ICXA 3RIAF 4XI5D 1T7WA 3KXFD 4B7IA 3L5IA 5D70L 5CEYB 5K9JL 2X44D 4PRNA 3L3JB 4HWBA 3C8KA 2AKRB 3P0VL 4JHWH 4MYWB 4U4BA 3TPUA 1MCPL 4FNLL 5LAXB 1DBAH 1CLYH 4IDJH 1I8IA 3RWIB 3HG1A 1ACYL 5DTFA 1ZK9A 4WI3A 4LRNL 1VENA 12E8H 3ZTJG 5C2BL 4JGJA 3L3DB 4LU5H 4LSUL 1GSMA 1X7QB 5C0BD 2EDEA 2DB8A 1TCMA 4YGVB 5DR5H 5HY9B 1U92B 3FO9A 5E56A 3CC5B 3QP3A 3DIFB 5JLZA 2C4FU 4YFEA 5FGRA 4BH7A 1N0LA 2IPUK 4Y19E 3UTQB 3DVFA 3HFML 5IBLD 3IU3A 3S96B 2LTQB 1VGKB 2CSPA 4ISVA 2SEBA 1QNZL 4NYLB 4I48A 3IKCB 4LLDB 3L3GB 5BS0B 4OF7A 2BNRD 1M71A 1MAML 2IAMD 4M8VA 4LVNB 4N9OB 5DJ8B 3UBXA 6FABL 3DVIA 4M5ZL 2DQGH 4KK5D 3RVXC 4C83A 4X9BA 3N1MC 4J6RL 2RR3A 5E03A 1MY5A 2P8LA 3CLEH 4OFYD 4NO2B 4G8FB 2NMSA 5E08L 5LGJB 4OCWH 2IH3A 3CLFL 1KFAL 1DQDH 5HVHB 1BZ9A 1IC4H 4WNQB 2XV6B 4OKVA 1U8KA 3BAEH 1DN0A 3REVA 4JM4H 2ZG1A 5D2NA 2XQBL 3JWDC 1AXTH 4P2QE 2AEPH 2Q1EA 1S7UB 3MV9E 3KPPB 4V1DA 1W72B 4NZTH 3VU2A 4MXQC 5ISZA 5IGXL 1R3IH 4OM1H 2RCSH 3RPIA 4FQXB 5IKCA 3TNMB 1PG7X 5E2TH 3MNWA 1MFEL 3QQ4A 4F57H 3HI5H 3T2QA 3MLZH 5TE4L 5KVEL 3LMJL 3U6RA 3AM8A 4FP8H 4Y19B 3GBMH 2XKNA 1N0XH 1E27B 4NC2B 3WXVH 2DLEA 3CVHL 3LS4H 3T0EC 4J3UA 1T66D 4OLVH 5H37G 2E5EA 4MJ2A 2NYYD 5E2JA 2I25N 4XC3H 1F00I 4QXWA 4LHJB 5ITFA 4P99A 2GTZB 3DO7B 3DXAD 3D2UD 2WUCL 4GMTH 3RVWC 5B3JE 4NHUA 3VXNA 5C0NC 3O6MH 5MEPB 1OB1B 4BFEA 1XGYL 4F7TB 2V9QA 2O93L 4WUKH 2VDQL 4P4KA 4FFYL 5SWSA 2BSED 1HE7A 2XRAL 2AJZB 3MO1B 1J8KA 1LD9A 5DD5L 1H3UA 4P2QB 1I8MA 4R3SB 4JHAH 4M1DL 3MV9B 2KH2B 1TMCB 5F6IC 2VXSH 4UI2A 1ZGLB 3QPQC 3EYSH 1AFVH 2IANE 3MMEB 3QDGE 2CPCA 1YMMD 4FFVC 4I1NB 3W0WA 5D1ZA 3ULUD 3ARSA 5I15H 2N7AA 5T1LA 1C08B 5DUPL 5INCA 2NXZD 3KYAA 3HUJE 3V7AE 5E94B 3RUGE 5HDBF 5FA4B 2LU7A 3VXSA 4BSVA 4X4MA 4U1NB 4TQEH 3QIUA 1FRGH 1MFNA 4RFEA 1KUMA 2YD3A 4P0DA 4PGCB 4MAYA 4NQXA 2UV3A 3GI9H 4RBPH 1DBKH 3QUZB 5IR1B 3NA9L 4BJLA 1UWEH 2NZ9C 4LFHG 5C0JA 1QRNE 1K2DA 4YHPA 1WEJH 3BXNB 3RGVB 4XHJC 5TE7L 2DBLL 5D2LA 1PLGH 3MJ7A 1QA9B 3UO1L 3RZCA 1EFXD 3O8XC 1N59B 1A1NB 3H9SD 1BQHG 3TO4C 4FRWA 2AI0H 3B9KB 2IANB 1BREA 3QZWB 5L2KD 2W91A 5E2VH 3QDGB 4G7YH 4JJ5B 3VD4A 1G7MA 1MUJA 3A67L 3O11A 4S1QH 4OV5B 2ICWJ 1GL4B 1QLRB 4PJGA 3LRSA 4HX1A 5JDSA 3GIZH 1U6AH 4MSWB 3O3UN 4C56E 2ZUUA 4F15C 4MLSA 1WFNA 5EC1B 2MPAL 2PYFB 1YNKL 2YUWA 3OKNA 1D6VL 1IJ9A 5DHVH 3HUJB 2C7UB 4AENB 3RUGB 2RGSA 5EUOE 2DQIH 4XVSH 5ALBH 3B8SA 1SJEB 5H94A 4KQ4H 3UDWC 1QFWM 1Z9OA 1S5HB 1MFBL 1RZJL 4Y4KA 3V7MA 3QAZB 4F7EA 2FECI 4WU7B 1GIGL 1LE5A 4AEHL 2BVQB 2D7MA 3BVNA 1WK0A 3EYUH 5DO2C 1QRNB 4Z7WE 4C59B 5GQBA 3TA3B 4I3RH 5KAQF 4M1GH 5AEAA 1I3RB 3SGEH 4Z5RA 3PP3H 2OJZH 5I1AA 1P7QD 2DQJH 2VWEC 1WAAE 2C26A 3QIBB 1WUNT 3F5WA 4UQ3A 1KGCD 2CD0A 3JWNC 4HS8H 5K93A 3T0EE 3PJSA 1NCTA 3TT3L 2J88H 3QWRA 5GS0D 1U8NB 4RMQA 4CJ1A 3EO0A 4HIIA 4ELMF 1BOGB 1TIUA 1UYWL 1DEEA 3MRFA 3TBSB 1MH5A 3GJFH 4ELKB 1ED3B 3V5DB 4LKCB 3ELAT 1YY9C 5FCUL 1D5BB 3GFUA 5D70H 3VXTA 4H20H 4C56B 1A3RL 3QXUA 1U3HA 1JN6A 3RWCB 3TN0C 4HK3N 2APWA 2FECL 5C07A 2ZCLH 4NT6A 1BVKB 3VXUD 2W0LA 3QUYD 2CLVB 3EO1B 3P0VH 3V0WL 1M7XA 1MCPH 4FNLH 5EUOB 3ETBF 4Z7VF 2YSSB 3MRIA 4M6OL 1DQTA 4Z0BL 1OAKL 4PRIA 3CSYB 1EUTA 2WIMA 4AM0A 1HHJA 4LRNH 1IM9A 1IARB 3OB8A 3VXPB 1A7OL 5CSBA 1F45A 1TZIB 5MEQB 4OF5A 3ECBA 1H3XA 5IB5B 2ICEA 4Z7WB 2HTKC 5KSAB 5SWQB 3PL6B 4AYFA 4LSUH 3MJGX 3KJ6L 5DVOA 1A6UL 1HSAA 1XIWA 4X9IA 1BD2A 2NY5L 2EKJA 2PYEA 1CD8A 3T0EB 4JM2D 3PGDA 4AY0A 1QLFB 4MJ5B 4JY5L 3RIFF 5CGYD 1F3DJ 4H26B 4RGNE 1T03H 1QNZH 5GXBB 3ULUL 2BY0A 3RWJB 1K4DA 3JTTA 2A6IA 3CFJB 2C1OA 2YPLD 4UUJB 1I7TA 2MQ3A 2VLRA 3PNWA 1MAMH 4X7DC 2QSTA 2XKUA 2Z9TA 3EFFA 4GMSL 1LO2L 1MIEH 4X5WA 6FABH 4M5ZH 4X7TA 2D7NA 5ADOL 2DI9A 5CEXB 4J6RH 1RAMA 4ZFFA 2B20A 3VFGL 4U6HA 4HWZA 3QFDA 4FZEL 3SKJL 5E08H 1C7TA 3B43A 5I2IB 2V7HA 2ADJB 2EEBA 1YMHB 3L5XL 4FXKB 5TFSL 1NSNL 2XT1B 5I74C 1D5ZB 1P53A 1NBZB 3FRPA 1B3JA 3RI5F 3JV0A 2XQBH 2BP3A 4PY8I 3UBXG 1LDPH 2FX7H 4KJYA 3F6IA 2AGJL 3S8WA 1EUUA 3O3DA 3TYFA 1U58B 4WW2F 2VYRE 3BP6B 5E1AB 5DMGD 3V2AR 3QXDB 5IGXH 4EN3D 3G6AB 2BY3A 3ROLB 1MFEH 2WM0A 2P8PA 1I9EA 3TLRA 4NKMA 4ZO8A 5KVEH 3LMJH 2W92A 1ZHNA 3TCLB 4JN2B 1TITA 4GXVL 5L8LB 2NNAA 3JVGC 3O3AB 5H35B 4L8DB 3C9NB 4RGNB 1DVFC 4M7JH 3CVHH 1CE1H 2ADIB 5HDQH 4Z6AT 2J6EL 1S9YB 2L4OA 1HQRB 3MV8D 4AIOA 2DQTL 2WUCH 3A6BL 1YPZE 1BAFH 1NMBL 1RFDH 3QPXL 4NKDA 3RVTC 3K7UA 2GYSA 1LDSA 2DTML 1R3LA 1HZHL 2ICCA 5I9QB 1U8IB 1AR1D 3TP4A 3FTGB 2VWEE 1JWUB 1HNGA 4OQTL 1QFPA 3BGAA 4FQIH 4FFYH 2R23B 2XRAH 3C09C 4ZXBC 3VFWA 4ODUA 5DD5H 1IGFL 1FV1A 3GHBH 3O4LD 1IKNC 4NO3B 1D5IL 2CRIA 2IC2A 4NO0B 3R8QA 1T7XA 3HRZA 3X12B 3K8LA 4DKFH 4LLMB 4JPIB 3P9MB 5JIHA 1S9WA 3SDDD 2KL6A 5MERB 3KNBA 3BN9C 3FB8B 1H5BC 4RMRA 5F88A 1RIUL 3FRUB 2ZOLA 1MCLA 3ARXA 4OZFA 3BP4B 3H42L 1LP9F 3BX7C 4GAYB 4D9RE 1RK0A 5CSZB 1S8DA 3LQZB 5KG9A 1BQHB 5J1SC 1EEUA 5EFIB 5CHNA 1T5WB 5C71A 4W6XB 3GSUB 4MMXC 4LGPB 3CXDL 4XCNB 2FSEA 1WCQA 3FFCD 1UKQA 3T0BA 1FVEA 3TBVA 2JJSC 25C8H 2DYPB 2DKSA 1RIHL 4P23D 1YPZB 2FZ3A 2OX5A 4U1MA 4WCYL 1F90H 5KZCD 5CBEA 3NA9H 3WHE1 1JUFA 4QTHB 1JNNL 4NJ9H 4MS8C 2AJYL 3MV01 1R3KA 1WFOA 2X7LA 3MFGB 3PDDA 4X4YB 4ETQB 4QY8A 4YO0A 3EJYC 4JFFD 4JFOA 5EORL 5TE7H 1SYVB 3SE3C 3V5KB 3UO1H 32C2A 4M00A 3GSVA 3ARZA 2F5AH 2P7TA 5D5MF 1JNLH 3HPLB 1R5IB 5MHSE 3KLHC 5D7LD 3RVUD 4K9EL 4W70A 4H0IA 4J12A 2MHAB 4L4VA 1CXHA 5FXCH 1JI2A 3NPSB 5TE6L 1AE6L 1ERNA 3SOBL 3QR2A 4LRIC 3FQUB 2K3TA 4ZPTB 3IF1B 3B5TA 4RX4A 2HG5A 1AGBA 1DSFL 1KV3A 2G5RA 2F19L 1KNOB 3OSKA 4HKBB 5F44A 3UTPE 4NGHL 4RNRB 2YEZA 5ESVB 4JO2H 1RJCA 3INUH 4U33A 4XHQA 2X40A 1JP5A 2YD8A 3X17A 3CFDA 3WMSA 2ZUVA 2VLKA 5CD3B 3O9WB 1B0WA 2J8UE 1RZJH 4PJBE 1LGVA 4PJEE 1GIGH 4AEHH 5E5UB 2DI7A 3MJ9L 4H5SB 1DP0A 2VLJE 1HHIB 1LO3L 3V4VH 1IGIL 3PWUB 4KK6D 1G1CA 4QRRD 4LLYB 1AP2A 5IW6B 1KCRH 3BZ4A 3WXWL 3DV4B 5B3NA 3HPJA 1TZGL 4PJ8B 1DEDA 3BKCH 5FOBA 1S78C 5IVZB 5AYQA 2FH6A 2PXYD 43C9A 3ABZA 4LBEA 5BVPH 2NY3C 4MLIA 5FYLD 2UZIL 2ZUQC 3G6JA 1ACZA 3RU8L 3TT3H 3MNZA 4BSWA 5DS8B 5D7JA 4EDWL 3D9AL 4EI5A 3AXLB 4R26H 2OMBA 1LNUB 5I6XB 3OBAA 5AD0B 2F74A 1YYMH 4HWEL 1QSED 4M7KH 5FCUH 5C09D 4HKJA 2WWMC 4JO4L 3BEVB 2XZCH 5C86A 4OAWB 3SDCA 2ICWA 3JV6B 4K71C 3HS0B 1NCCH 4KZEL 5IWLC 3HZMB 1EXUB 1UZ6E 2VO5A 1HQ4B 4QHNA 1P4LB 4M6OH 4KZDL 4Z0BH 5ISZE 2J8UB 3QYCA 3K1DA 5AZEL 1RJZB 1DFBL 4PJBB 1NCBH 4PJEB 4LNRA 2CXKA 4BH7B 2VLJB 4O51A 4HD9A 5C0RL 2EO9A 4Z7NF 2KQNA 2FJGA 4KRPD 5JUEH 2GY7B 1KN2L 4OIIL 4Q9BA 2F15A 2VTFA 3KJ6H 4XPFL 5E9DE 4EOWH 4UINL 4W68A 3MODL 4JY4A 1EO8L 3LKNA 4J4PA 1DVFB 2NY5H 2VL4A 5FGBC 2JJUA 4F7MB 3GB7A 3UBXB 3PHOB 5E0QA 1OAYL 4IMLA 3TO2A 3CFCH 4PG2C 4JY5H 4F7CB 1FZJB 3DMMB 3VXRD 4YXHL 1YYLL 3REWA 4C54A 3ULUH 4PJ7E 2ATKA 3VFSA 4BK5A 2V5TA 4X0KB 4LGSB 1U95A 4Q7DA 4I2XA 5J6GB 1LO2H 2R0ZL 1VPOL 4ODBD 2ZOKB 4L8SB 5L2JA 3PV6B 3VFGH 1BBDL 4FZEH 3SKJH 2PNDA 1G7QA 4ZXBB 2X1XR 4ZFOA 1FL5B 1S7WA 4JZNB 1HOCB 4EUPA 3SDAB 3WFBL 5ISZB 3MRBB 4U1JA 1AD9A 1L7TL 2X4QB 4PV9A 1KJ2H 5TFSH 3MNWB 1M4KA 1ORSB 4PTUB 1FVCB 1NSNH 5K59E 4PJ5E 3TJHC 2MTPA 3F58L 1QFHA 1HN1A 5HHQB 2YD1A 1X3DA 5F3HB 3K3QA 3U7WL 1MCKA 5TDPB 1BWWA 2A74B 3UTSE 4HS6B 2AGJH 4EVNB 3V4UH 4D94A 5FDWA 4J3XA 4Y4HD 1A22B 2R39A 5E9DB 4QF1B 4UU9A 5I1IL 4BKLB 3VXMA 3STLB 5D72L 1EO7A 1JPGA 2NXYC 3LAFA 4AMKL 5KANG 3BIBX 3RHWF 3BIAX 1CD1A 4X4ME 3GKWL 3MGOA 4HC1A 4GXVH 1F3JA 3ARGD 4NM8L 4NHUB 1FIEA 2BSRB 1CLZL 2YN3A 4PJ7B 3KLAB 3WFDL 5GRWA 4Z7QF 4M7ZB 2J6EH 2G75A 1SYSA 4BUGA 5E7BA 2W38A 5ADPH 2VZOA 5FV2A 2NY6D 1NGWB 4RGOL 3LQMA 2DJUA 4GRLD 3DECA 4JN1L 5FO7B 1MQKL 1NMBH 1JZ3A 4DGVL 2DTMH 3U2SA 4KVCL 1JYNA 1CFQB 1CG9B 4OF8A 3QWOB 3CSGA 3FT3A 3MROA 2B8OT 5DC9B 3G5YB 4KU1A 2EDQA 3GIVA 3ZT5A 4OQTH 4FXLA 5D6CB 3GMLB 1AD0B 4PJ5B 2RB8A 1VEPA 3VW3H 3WSQL 4JLRA 2BSSA 4MA7H 2A6DA 1D5IH 2K7QA 1BP3B 5FO9B 3UTSB 3MUJA 4GKZA 3QISA 3MBED 4F9LC 4WVRA 5C0IA 2FLRT 1JHLL 4I8DA 5FCSH 3RAJL 1GOGA 4X6BB 1RIUH 3H42H 1U8LB 3NN8A 3WL9A 1JYWA 2P8MA 1A6ZB 4RFEB 4EZMA 2FGZA 3O6LL 1NCDL 4IS6B 4MAYB 4HZLB 3VFTB 2ADFL 1YDPB 1I7ZB 2OI9B 3DRTB 1FYTD 5C0JB 1K2DB 4HWUA 1MHPH 4MA1B 4QRTB 3X14B 3FN9A 4RBPK 4M93B 4X7CC 4PP1D 2HVKB 4OGYL 1R24A 4G43B 1RIHH 1YQVH 3MJ7B 2OR9L 4JFPB 4WCYH 1U8JB 2X4NB 3WHE0 2JIXA 3PHQB 1F5WA 3IDYC 5TDNA 3GJEA 4D9QD 1TQBB 2AJYH 4GQ9L 4X6CF 4DZBA 2NY1B 3FQTA 5DMKB 2CDEB 4QT5B 1ND0A 3KDMB 1FVDB 1KTKE 4P2RD 4MJ6B 5AZ2L 4HIJA 1T5XA 2F53E 3KYOB 4N90E 5DJDB 5B4MD 4K7PL 3QNYA 1JHKL 5I17A 5J06A 3WLBA 5I1HL 3FO1A 1O5DT 2G2RA 2AEQL 2IG2L 1CDUA 2ZNWA 4K9EH 2GK2A 4XP4L 5KSBA 3SO3B 1V3JA 2APBA 5L8KB 4XNXL 1LO4L 3GGWA 2FL5B 1EA9C 4I0CC 1AE6H 3O8XA 2GAZA 3SKOB 2BVPB 4YE4L 3SOBH 5JW4M 4BZ2L 4CAGA 3CNKA 4ODSH 4W4OC 4GKOA 3TO4A 3C87A 3K46A 2XWBB 1DSFH 1RPQA 3GSXB 2F19H 3UPRB 1T0NA 1GGIL 4V2BA 2AVGA 2JKXA 3VJ6A 2VZSA 1QLEL 1NUNB 3MRJB 1S7TA 1R3HB 1OTUD 1AH1A 1QVOB 5IW3A 2BJML 2EO1A 2JK5B 5CEZD 2R2EB 2A0LD 4JZOA 4AEIH 5BVJB 5I16B 2GJ6A 5EU3B 4XPBL 1BIHA 1YZZA 3DX6B 5CUSL 4YAQA 5I1CH 5EBLA 1OGAA 3MJ9H 3PJSB 3UDWA 1LO3H 5BZDA 3PP3K 3U46A 1FZKA 5HGAA 3QNXA 3WXWH 2F53B 5EOTA 3T08A 5JA9A 1A6WL 4HUWB 3BP7A 4UNUA 1TZGH 3MRNB 2ZSVB 3WNNA 4IBLT 2L7UA 5I75B 3TPKA 1DL7L 1KCSH 4PTTA 3J8F7 3PWJA 3VWJD 3GM0A 4P3WA 3GJFK 5F9WB 4MA3A 1BZ7B 2CKBH 2HMIC 2P43B 4Y16D 1IEBA 1N8ZB 1NDGA 2JELH 2FO1A 1A1OA 4FQHB 3MRIB 4XP1L 4OFDA 2Q6WB 4HWEH 1CD9B 1FN4B 3QIWB 4MQXC 4GLRI 4JO4H 1TCRB 2K9UA 1FGVL 1UCBL 4I5BB 1GC1L 5DHVB 3UYRL 1DBML 4LLUA 1DQLH 5KN5A 5GSRB 4WEBH 3WJJC 3IFLL 4CMHC 5HYJA 2R1YB 3LPWA 5IV2A 3KS0H 3ZYOA 3TN0A 3LDBC 2NX5A 4L1DA 3CZFB 3G5ZB 3HZKA 5AZEH 1DFBH 5DQDL 2OP4H 3I75B 2ZZUT 1DLFL 1TJIL 2BVEA 2XZQL 3MLXL 3BPCB 1F11B 1PBYA 5IB3A 2F58L 3HMXL 4L3EA 4BFBD 2ESVD 2F9BT 2NXYB 43CAA 2FYYA 1KN2H 2Z8VC 1CXKA 4UINH 1D9KC 1FZMA 2JF1A 4MHHI 4OLEA 4J1UB 5J3HD 4YR6A 1RUAL 3IDMA 1Y6MR 4M5YL 4PB9L 4G8EB 3MUGA 3W9EA 3OAYH 4R7DA 5DZLA 1Q0YL 4M6NL 1YYLH 3GJFB 2OZ4L 4P9HC 4IRZL 4XX1G 1G84A 5IBLC 3UJIL 1MAJA 4JFDE 2VAAB 4XC1H 5C0DA 4PJDE 4P2OB 4JKPL 1T2QL 2XWJB 3MX0A 2R0ZH 2YZ8A 4PV8A 5DD6B 1VPOH 3JUZA 2EXYD 1F13A 2N1KA 4I18C 3L5JA 1BBDH 3C8DA 2IAMC 5KVGL 1CDBA 3S4SG 4DFIA 1ZSDA 5E4EC 1INQA 4XXDB 1OARL 4DN4L 1MCCA 3NFNB 3NCYS 3WFBH 4J3SA 4P3DA 3H9ZA 1HHHB 4OLXL 2FIKA 5L9DL 1OP3H 3B2VL 2OL3A 4LIQH 1MHEA 1VFBB 4NQTA 4G6AD 3U7WH 5DK3A 4KH2A 5FGCE 1PSKL 1W2KT 1I3GL 3QQ9D 4KGJA 3BT2L 4LAJH 5AYUL 2BOBB 1ZVHA 4WI7A 5D72H 1WBXA 3KPOB 2W59A 5AG8A 1QFUL 3GKWH 4LCWE 3KPLB 1JGVH 5J1AB 3D69A 1EAJA 3NFSL 4DUXA 3RDTD 3LN4A 1A9EA 1MCDA 4LLAA 2WQ8A 1R0AH 1M05A 1XEDA 3WFDH 2EDWA 1F2XK 3MFFB 4JFDB 3WCYA 3JVGA 5HDLA 4PJDB 5C08D 1VFAB 3EYVA 4FQQA 1PKQA 3CDGB 4RGOH 5LGHH 1S9XB 4JN1H 4YBLB 2CDFB 4FN0A 3EW3B 1FV1B 2NYYC 4DGVH 4CU8A 5I1LA 3ZL4H 3C6SA 4OI8A 3IDIB 4JRWA 5TGBB 5D93C 3G08B 3QG6A 1NC2D 4YIQB 4ETYA 3ZYJA 2VDKH 4MNGE 5DQJA 4NN6B 3DX9A 4G3YL 3WSQH 5D4QA 3U0TA 3S37L 3ZKNC 4XH2B 2Y5TA 4JKKA 3IJYB 5FGCB 4YHKL 3DGCR 5IESL 1S8DB 5KG9B 2GJJA 1T0PB 2X42A 3E3QE 5FYLH 1IKNA 4QNPE 4Y2DD 3MLPA 1ZE3C 3IU4H 4U7MA 3RAJH 1HCFX 2E9BA 4IEFB 1Y6KR 2Y36L 1MCRA 4LCWB 2AK4D 4RAVB 1CFVL 3N85L 3PABA 3VGFA 1G0YR 1NCDH 3W2DL 3CVHB 4XVUD 3AY4A 4YDKL 1IEHA 2BMKA 4UDUA 4X4XB 1H5BA 4Y5YC 2WWKO 4R96B 3QHFL 4L4TA 4P5MB 2Z91B 4PJHF 3BIKA 1MVUB 5IFAL 3KPQA 4OGYH 2E8ZA 4HAFA 3H3KA 2OR9H 5DJCA 1J8HA 3WKNA 5TF1L 4TN9A 2AXFA 5F71A 2DAVA 3C5SA 5CIPH 3ARQA 2BNUA 1DDHB 1Q72H 4GQ9H 2HRLA 2JJSA 5IJKC 1SHMA 2JB6A 3GMMA 1QFOA 5JHDA 5DK2A 1F58L 2XACC 4MNGB 1PQZA 1D5MA 5AZ2H 1G9ML 1V7ML 4LSRL 2XNAB 1A9BB 4B41A 4NKQB 5CMAA 1JHKH 4PUBL 2IF7A 5I1HH 3BMVA 3MQIA 4W81A 1RHFA 5IQ9A 4OGAC 3RKDD 3WLWD 4BQ8A 4X98B 2HLFD 4MQ7B 4NN7B 3SE3A 3SDXE 1MHCB 2FJFB 4RIRB 5ICZB 4TVPD 1ZEAL 2CLRA 5T3ZD 4ZOCA 2P5EA 2IPKB 1MLBB 2QQNL 2E7CA 4YE4H 1XF2B 3FL7A 1F97A 5J11B 1KT2A 4GAGL 3TVMA 2H45A 2VDRL 4CMHB 5J9PA 2YUVA 3LDBB 1TNNA 1ZOXA 4R4BB 4XX1E 3CD4A 1DBJL 1LK2A 5CBAB 3P4MA 1S7VB 2I9LB 4YHIB 4X6DA 1QLEH 3GBNL 4MD0B 3RFZC 3MJ6A 2BFVL 1Q38A 2BJMH 1NCAL 1FCCA 4Y8DC 3D39E 5FOBB 4ZUWA 3QUXB 1PAMA 4D0DA 2QKIB 5F89A 5D1QC 4YHZL 4XPBH 1EGJL 4F3FB 3H0TA 5IP4A 5CUSH 5I8OH 2E6JA 3EYFA 1S9VB 5DUBA 4F7PB 4JRXD 1SEBB 3EZ8A 3OKMA 2EYTB 5DGRA 1A6WH 2E8YA 5EPMB 4XCEB 3WE6A 1G6RA 4PLJD 1JE6A 4WFHD 1OPGL 4MJIE 4KGLA 5DRXB 4ODXA 1IC5L 5FHAH 3CUPA 1B0RB 4H1LH 5FYKD 5C1MB 3BZEB 3SDXB 4QO1A 5DJ0B 2UVFA 1EHLH 5I66A 4YHNA 4LSQL 3IXAA 5SWZA 2Z8WC 4Y5XB 5D1XD 35C8L 4XP1H 5GS0C 4LDOB 1M7DB 4AIZA 2IAMB 3K0WA 4KUCF 1JTPA 4TRPL 4U3CA 1QHOA 5E4EB 1FGVH 3DXAE 1UCBH 5B21A 5C70A 5JOFA 1GC1H 2AJ3A 1EEZB 1MCFA 1DBMH 5KS9E 3GBLA 3QDJE 4QHMB 4HJJL 2CDGB 5E8OB 4IOIB 1U8MB 1KPVA 3JSSA 1JRHI 1ZS8A 1TVBA 3JZ7A 1KBGL 3FN3A 2A1WH 5AUMA 3D39B 5IWLA 3QUYC 5DQDH 4JY4B 4LCCC 1DLFH 4UIKL 5HHNA 1J0KA 4N5ED 1X5GA 2XZQH 4HGMA 3S4SB 1QFWI 2F58H 2IH1A 4UNVA 3LKPA 1NUDA 4P57B 4N8PA 3LKQB 5IMMB 2OMNA 1XGTB 4YXLL 1ETZA 1Q9KA 4PBXA 2HJLA 5J8OA 3RKPA 3FFDB 1GZPA 1K5NB 4MJIB 2WIIB 1YMME 4ZSOA 2YPKA 3U36B 3RWGB 1J7VR 4GLRH 4M5YH 1QYGL 4AT6B 2VDOL 5GS1B 1NUFA 1QEWB 5C0GB 4BQBA 4RAUB 4UT6L 3ULUE 2OSLB 1SJHA 1Q0YH 3L3OB 4M6NH 5JPMA 1QSFD 3ZE2E 3VWKB 2VL5A 3ARED 4UTAL 2XI9A 2OZ4H 5FGBA 2Z31B 2J8HA 3D18B 4IRZH 5JQ6L 2AJXH 2K7PA 2XXCB 4JM2C 1CICD 2PKDA 1JRHL 1CGVA 1CZ8L 1G7LA 1JPSH 3FT2B 3QDAA 2D03L 1AXSA 4PG2A 4U1HA 5HGDB 3BPNB 1YN7B 1MFDL 1T2QH 2PW2B 4JKPH 5E6IB 4PV9B 3DXAB 1RZKH 5FYJU 5KS9B 3TIEA 3QDJB 2ZUXA 2J2ZA 5KVGH 1QFWL 1RMFL 1CDJA 4PJAA 5IHUL 4O2EB 1NMCC 1I1FB 5D6DC 1OARH 4KI5D 4LPYA 4DN4H 3VXQA 1VFOA 5EULV 3MA9L 3SGDI 1W0YT 4UQ2B 4KJPD 5FKPB 4OLXH 5FKAB 1GOHA 5C0CA 5L9DH 1GGYA 5DJXA 4FZ8L 5HI4D 1Q9WB 1BM3L 5FA3B 2IADB 1PSKH 4Y1AD 1RU9L 3T2NL 2JJWA 2UUDH 3UJJL 1ZTXH 5F9DC 4C4KO 4X9GA 1HEZA 3BT2H 5T1DL 5IVXF 2EDBA 5AYUH 1H3PH 3H9SE 3QFJA 4N0UA 3ILPA 2RFXB 5I8CB 3BZFA 1UGNA 4ZFZA 1YMMB 4TVPL 5DJAA 3IFNL 2FATH 4Y5YB 4CN6A 1UT9A 5DMGC 5I30L 5T3ZL 4EN3C 4MB5A 2Q86A 2LE9A 5EU7C 5CP3A 3VRLF 5IIEB 4XVTH 2O26U 1FSKB 2A6JB 2RAMA 3Q2CA 2WK2A 2X4OB 4D0CB 2NXZB 1IGYB 1PW3A 4PRBB 4GRWF 1A02N 1MJ7H 2YR3A 3NA4A 5ID1A 4F33B 3SCMC 1FH5L 2DKUA 3QEQE 2NW3B 1T1WB 4CADA 1QP1A 4NN5C 4TNVK 5CEZH 4YK4C 1Q8MA 4WW2A 2FH8A 3GMPA 3PGFH 1CXLA 3T4AA 3KLDA 5C3TA 1A0QL 2DS4A 3BUYB 4G3YH 4K94C 1AR1C 3SGKA 2Z4QA 3FQRA 2GW5A 4KKBD 1NGQL 2B4CL 3D87B 1K4CA 4YXKL 1IE5A 1P9MC 2G9HA 4YHKH 1QUNA 1KGCE 5DRZA 3JWOL 4LF3A 4CNIA 3RX8A 5T33L 5IESH 4PB0L 5IB1A 4CVUA 5HYQA 3EZJB 2YZ1A 2JJVA 2AJUH 3H9SB 3TEUA 2HVJB 1X5YA 3SE9L 1FAKT 2Y36H 5BZWA 4IJ3B 4F9LA 1WBYB 5BS0D 2LU4A 5F7DA 1E4KC 3N85H 1VESA 4MDIA 5DEGA 5DI8A 3SDDC 2HRPL 4YDKH 1AJ7L 2GQHA 4XXCC 2AW2A 5B38G 3KWWB 1PYWA 1KIQA 4HK0A 5IW1A 4PJCE 5ACZB 3QHFH 4JZJB 3GSOA 5IMLA 1U8QB 2EKSA 2MNUA 3ULVF 1W0VA 5C8JA 3W39A 1CDYA 5F7NC 4YDIL 4M8QB 5ID0A 1SMAA 3VRJA 3UAJC 1J0JA 1U91A 2DWEA 5DF0A 3SKMB 3HE7A 3QEQB 5TF1H 3T4YA 1EO5A 1E6JL 1N26A 5BRZD 1WWCA 2G2RB 2UWEF 1Q94A 3BSZH 4CW1A 5GSVA 1JHTA 2W0KA 1IAOB 5IFHL 4P23C 5FIEA 4PY8J 1F58H 4E41E 5IOPA 3UYPA 1CDGA 1G9MH 3AB0C 1UB6A 4LPVA 1H15A 4LSRH 5IMOA 3GGWB 3T3MF 5DK0A 3QUKA 3GKZA 4I77H 1LP9A 4PUBH 1P7QB 2VISB 5T3XL 1MAKA 4F8QA 2QR0B 1UQSA 1KG0B 4HMCA 3TH4T 3GSNH 2Y5EA 4Y19D 4EI6A 1CT8B 4U3HA 1JWSA 1LMKA 4L9LC 5JW4N 2VXQH 4Z7UE 1ZEAH 4LCYB 2X41A 2F54A 1T0NB 2QQNH 2ARJQ 5HYJE 3QXVA 2YPLE 4ZUTA 1OAZL 3RVUC 1QTYT 2C1PA 3FOMB 1FG9C 4GAGH 5DJ2A 5FYJL 1M6OA 3B83A 2VDRH 3OKOA 3BD5A 4YDJA 2R1XB 2RBLA 4PJCB 3MCKA 5ESQA 3RL2A 4W4OA 1SVCP 3I3EA 1JWMA 3QXTA 3GBNH 4O2CA 2BFVH 3MRHA 3QJHB 2V7NA 4QRPE 4XAKE 4OZHF 1RZ7L 1NCAH 3FQXB 4JAMB 4U3XA 3ZKXB 3LN5B 4Z0XB 5J12B 3PQYA 1JPFA 4YHZH 5D5MA 3MA7B 3FB5A 5EO9B 3QT2A 3MV9D 5F1NB 3NBNA 4E41B 1JZ8A 3S5LG 1SM3H 3KYNB 1NDMA 5I8EB 4DTGH 4HUXB 1OPGH 2CIIA 4KK6C 1JIBA 1IC5H 3CK0L 2A6KA 4PBWD 4UV4L 2YK1L 3MRLB 1CF8H 3IDXL 3NGBC 4YEFA 2FWOA 2CIKA 3H8NA 4Z7UB 1CD0A 2I9TB 2PXYC 3MLRL 4LSQH 3S3PA 2XTJD 1NMAL 1KTDB 5HYJB 3VCLB 4DVRL 2YPLB 1J18A 1ZLVH 2XG4A 4BZ1L 3MLVL 1B0GA 3C6LC 1ORQA 4C58B 1ODAA 2ITCB 3X3FH 3V52L 3P73A 1T20A 3FJTA 2F8XC 3U9UB 2G5BA 4PGJA 1RJYA 4HJJH 4JFXA 4X8XA 2H9GA 3QUZD 3RWHA 1RZ8B 3STBA 1GVIA 4EJ1C 1FNGA 1AGEB 1TXKA 3FQWA 4QRPB 3RVVC 5HPOA 3MRGB 3K4AA 3PWPE 5F9JA 1VKXA 4S1SL 4K3JH 3ROOA 3KXFA 4XB7A 1KXQE 4UIKH 3WJJA 3IDMB 4HGWA 3L6FB 1KJ3H 4WO4C 5EU6A 1BFTA 1IKFL 3KYMA 5JDJA 3QEHB 1T89C 3G5XA 4P5KB 4QRUA 3UZVB 1VACA 5TDOA 3WUWA 1Q9LA 5L0QB 2GFBB 4YXLH 4OSUL 3VD7A 3CPLA 1C16A 4H88L 3B9KD 1EGJA 5EZIL 2IAND 2P44B 3DTXB 4HHAA 4YHOH 3OAYK 4LVOC 2R0WH 3T8XA 5EU5A 4GKSA 2VDOH 1RUML 1YUHB 1D9KA 4UT9L 4KMTL 1TVHB 2UZXB 3GSWB 1FFQA 1F4AA 4DEPC 1J5OL 3V8OA 4MD4B 1M7IA 5JQ6H 5DVMA 1IAMA 1JRHH 5HHOE 1CIDA 5C0BA 2D03H 2X70A 1Q9OA 4UAOB 1T2XA 3FFCE 3VGGA 1DQJB 3AMLA 4QHUB 4HJ0C 3I85A 5E5RB 3W9DA 3VD3A 4YHYC 5D7KD 3K74B 3WFEL 1QFWH 1RMFH 5IHUH 3ARDC 3IS1X 3HCVB 3RTQB 3ILQD 4OB5L 4JHBA 1I1AC 3PDOA 2QSVA 5EO0A 1OHQA 1UCTA 1YNTB 1OP3K 5KSVB 3PWPB 4I18A 2BNRA 4D9LL 4LIQE 3K4ZA 1ITBB 4JDZB 3KS0J 4WV1C 4TTGA 4JFFE 3K2MC 4RQQA 3BD4A 4JY6A 4BQ6A 4H1LG 3FN0L 2ZUYA 1BM3H 3QIBD 1MI5D 2R4RL 1RU9H 4NNYA 1AGCB 3UJJH 2DTSA 5T1DH 3OR6A 4NQED 3IFOA 2GHWB 3RBSA 1WC7A 4XNYL 4XCYA 1G7IB 4TVPH 3IFNH 1CR9H 1UM5H 4Y4HC 1W8NA 2VXTL 5I30H 5T3ZH 1A4JA 3GMQB 1SBBA 2APVA 4KROD 3H7BB 4C56D 5FUZL 1Z9MA 5IG7B 3I6LD 1KLGA 4I3GA 3F7QA 4U6XB 5HSFA 2DJ4A 2W9EH 1FL3B 1FIGL 3P11L 1MJUL 5HHOB 3RWEA 3JV4A 3SGDH 3IAPA 5IJVB 5ICYA 2VKXA 5CFHA 4R97B 4U2YA 3F8UB 4ALAL 2V5YA 1JZ4A 1J0ZA 1C5DB 2HJKB 3FFCB 1XGQA 2C3VB 2BOCA 2OBGA 3U0TB 1FH5H 2BDNL 4P23B 1NBYB 5B38B 4BUHA 4WY7L 4LLWB 4LL9A 3AB0B 4PLOB 3Q3GA 3KPNA 5D7SL 2QEJA 4GRLC 2H32H 2O61A 3KAAA 1FNLA 3WFHA 3PL6D 3CCHB 4QRRE 4FHBD 5HDBE 1A0QH 1H8SA 2YBRB 3M1BA 4JFFB 3D2UA 1IZKA 2DM7A 2LABA 1I7UB 3FAXA 3LY6A 4OV6F 5JQHC 1NGQH 2B4CH 4YXKH 1RIVL 1NCNA 3DYOA 2DQEH 1NKRA 4PB0H 3MRRB 5FYLE 2A73B 5EN2B 2ARWA 3Q0HA 2HT4C 3SE9H 3TH3T 5AWNL 4E9LA 3U7YH 3OKLA 5GISL 3MBEC 3VFVB 1ZGLP 2YPVH 3R06A 2PF6A 1TVDA 5IVOA 1QSEE 2HRPH 3GSQA 4JG0H 1AJ7H 3PIQA 5F97E 2AXFB 1LEKA 4JRYE 3C5SB 4PRPA 2BNUB 3ESUF 1UB5A 4GKNA 3S36H 3S3SA 1FHGA 2CH8A 2OJEA 4WUUE 4L9DA 1FP5A 4LPTA 1PQZB 4YDIH 4MHHG 1CS6A 1RUKL 1RHHA 2NW2B 4XNUL 2ED8A 3LQAH 1EVUA 1EEYA 3JUYA 5T1KA 3TYGL 1RZKC 3L95B 1FL6B 4XP9H 4HK3J 4PP1C 1JJUA 3IS0X 3KG5A 4NQCE 2YD6A 5EA0L 5DFWH 5IFHH 4K8RL 1JGDB 2VABA 4MQSB 1FQ9C 5IB2A 5HHPB 4QRRB 1JZ6A 1MF2H 3HC4L 2EEAA 5SWZE 2P24A 3ARFB 4NCC1 2X4TB 4NUJB 5T3XH 4TUJB 1MHHB 5IJKA 1WWAX 4O5LL 4X83A 4R7NA 2PXYB 2Q7YB 4DVBA 3TVMB 2UY7A 5GGUB 1S7SA 5B4MC 5JHLL 5D2LF 5DXWA 5A3ID 3S5LB 3MLTB 1N5AB 3HNVL 4EQ2A 3AU1B 4Q2ZB 3RJDA 1KJ2A 1NCWL 1ADQA 4RGND 3VXRE 1X6NA 1UA6H 3P4MB 4X6EB 3O81A 3EUUA 4E0RA 1OAZH 1Z5LB 3N1QC 4ENEC 4ZUVB 3ESVF 3RX5A 5FYJH 3O45A 1QSEB 3A6CH 5IEHA 3O6FD 1EFXA 4JRYB 3VA6A 3H0TB 3L7FB 4XWOD 4QOKE 4PJGF 5DRNB 3RL1A 5FHBH 5E8DL 4NCC2 3U1SL 5T1MB 2Y06L 4WUUB 3QXAB 3WIFB 1XH3A 4ELME 1Y18B 4RRPA 5DD0H 1EJ6A 1RZ7H 4YH6A 1T1ZA 5CJOL 5J0BA 3F12A 4R0LB 4W6YB 1HI6B 4YNYB 5CIPB 5I18L 1UM6L 5BXFB 1RJLB 3X11A 4N8VG 4NQCB 3IVKA 4P46B 3UTTA 5KTEL 1U8HA 4JFEE 1OAUH 5CAYB 4LFHD 5D1QA 4KRPB 3G9VA 3EHBD 2J4WL 3HI6L 4Z7VE 5SWZB 3PF2A 4RAHA 3JV5A 3RP1A 1N4XH 2XPGB 3ARVA 3LH2H 3QHZL 3D0LB 3RGHA 3MUY1 4DJMA 1WIUA 4UZGA 4M7LH 3CK0H 4JKWA 4JE4B 4UV4H 1IMHC 3IDXH 1NAKL 3AAZB 1A3LH 5HI3D 3MRMB 2ZJSL 1WCBB 1I4FA 3EGSA 1DLHB 3FB7A 3HE6D 4P5TD 3BKJL 3VXRB 4YZFF 5A16A 1NMAH 3S9DB 4DVRH 2ERJC 3I6KA 4O9HL 4BZ1H 1A6AA 3MLVH 1IFHL 1JNHA 4AG4H 4ZUUA 4ZFGL 1WTGT 1FC1A 1A6TA 2DYPD 3O2WH 4QOKB 1WGOA 5HGHA 2JTDA 3SY0A 4LPCA 5JW4Q 4WV1B 4ZDHB 1KPUB 4ELMB 2VN4A 5E99H 5A2IH 4JCMA 4ZPVA 5JXED 1YC8A 2NTFB 4DGYL 4S1SH 3QFJE 1CFTB 3ARBD 3GK8L 2OTUA 1ZV5A 2X5PA 4JFEB 4MDJA 5DEFB 2XY2A 3VXUA 3QUYA 3MOQA 3BUTA 4LCCA 4N1HB 4Z7VB 5DD1H 2C4XA 4OSUH 1NGZA 4DZ8B 4PREB 5ANMA 4YLQT 4H1LB 4U1HB 4BK4A 3H3PH 3U79A 3HI1A 3NH7L 2CLZA 1EPFA 4FQ1L 3RNKA 1RUMH 3RBGA 4D9RD 1EBAA 5JW4R 2ADGA 3ARGB 4KMTH 4ZAKC 3WEXB 3WFCH 1TZHA 3IJHA 4ZOEA 4POZD 1CQYA 1B4JL 4PJFF 5I1DA 3PUCA 1FYTE 1WBZA 5E1HB 1K8DA 2JB5L 4KAQL 4LOUD 3EYOA 4APQA 5E8EB 2ATPA 1NAMA 4Z18A 2NY6B 1I9JL 5CP7B 3BZDA 5GHWL 1GGBL 2EICA 4JM2A 3CFBB 1BVLA 4H8WH 1ROWA 2FBJH 1PX3A 3F7YA 1RZIB 5CS7A 3Q6FA 3D3VD 1NFDA 3WD5H 5CLWA 5ITBL 3CFKB 3WDHA 1CGWA 3HRPA 4D9LH 4WFED 3QFJB 4OT1H 4ZFZB 3HAEH 1JFQL 4PJ8D 2HLAB 2UUDK 1DQQB 3FN0H 4OKDA 1EEQA 3B8YA 2R4RH 4GW5B 1J12A 1UJTA 1E28A 3V6OE 1K6QL 3TBTB 5EBWA 4G6AC 4LLQB 4XNYH 2H6PB 2YC1B 4ODWB 3BESR 3QQ9C 4LASL 1ZWIA 1YJDH 2VXTH 4IM8A 5BQ7A 1JBJA 1NUGA 2LVEA 1AI1H 1T6WA 3HHRB 3VFPA 3U0PA 3SJVA 3HG1D 2Z93B 5FUZH 3TZVB 3B2UD 1U8PA 4OD3H 3V6BR 3QULB 4IRJC 4Y4FB 5EO1A 5GIRB 4KY1H 5GGTA 3P11H 1FIGH 1FYTB 1MJUH 3I84A 5IMKA 2HTLD 1JK8B 3C60B 1MEXH 1HDMA 3MYJB 4ALAH 3EJZD 4S2SB 3FT4A 3ZDZE 1P7KB 2EIDA 2O5YL 3TWCL 2PW1A 5CEZE 4QXUL 1KENL 2Q87A 4HJGB 2G9HB 1NGXA 3CX2A 1AGFB 5DLMH 1X5IA 5D7SH 4S1DD 3SCMA 4FTVE 1S7XA 5DRWB 3BQUB 1QR1A 1JYVA 3L3IA 1II4E 1DUYA 2C3XA 4POYA 3B9EA 3MV8A 5F1KC 5DC4B 3P4NB 1XF5A 2D7QA 3ULVL 2GK0A 2DN7A 5JO5B 1SJXA 4HKXA 2R1WA 4Z8FL 2MMXA 3EFDL 1AR2A 4AIXA 3QO0B 3B6SB 3Q1SL 1JF1A 1YNLL 2RHEA 4GUPA 2CR3A 4OLYL 1P9MA 5AWNH 4YJZL 3T1FB 1TJGL 5ECJE 1I1CA 4KDTC 1NBVL 1P2CB 1W0VB 1XR9B 1MRDH 2OM5A 3WDJA 4GW4B 4XBPB 3O4LA 5JORA 4Y2DC 3SE4C 4TNWF 1JGEB 3Q5YA 1SJVA 4KXZI 1WJ3A 3P9LA 1Q94B 2VAJA 1FZOB 1E4KA 4XVUC 3KYKL 5HD8D 3SDDA 5DYOB 2FX8L 4V1DD 1S7RA 2D31A 4XNZC 4XP6L 4XXCA 4FQLL 3SDAD 2BERA 5ISZD 4XNUH 4CJ0A 3C08H 2K1MA 3I9GL 3SEPA 1WLHA 1J11A 5CD5D 2PCPA 3TYGH 3DVNB 1KF9B 4WWKB 4YUEL 1L7IL 5EA0H 5F1IB 4QHLA 4K8RH 5IVNA 3TC9A 4HBQA 4FTVB 4XWGL 1UXWA 3DNKA 5CJ5A 5CINL 2GKIA 1OD9A 5FK9B 3BISA 1U8OB 3EOAA 3KPMB 3OF6D 5IQ7L 4XPAL 5E9DD 5JW5A 1PEZA 2HH0L 2EDNA 1G9NL 4U6YB 4GG8B 4PJXE 1MCQA 4N8VB 4O5LH 5DDHB 1M6OB 1UWXH 3OKDA 4YPGA 5GZOD 5JW3L 5LVEA 3HNVH 5E8PA 3VWJB 4HUUA 1IZJA 2ERJB 2Z35A 1KYOK 3GUTB 3RKDC 4Y16B 3IDJB 1J0IA 4O58L 3L3HB 3LPFA 4IRSC 1BVZA 2NCMA 5I76B 5E95B 5ETUB 3MRHB 4NBXB 1MCHA 2V7NB 1F42A 2E9JA 3GMNB 4L9LA 3H3BC 5HYSA 2AJVL 3PXHA 1DE4A 4WI4A 3V0VB 1FCGA 5J1TC 3MR9A 4D0BA 1RUQL 3BPLC 1ZXQA 5D7LA 5FM5M 4ACPA 1AKJA 1ONQB 1HH9A 2XG5A 1GHFL 2DQHH 3WIIH 1UJ3C 2MOVA 2V2TA 4E42A 4NQVB 4YEEA 2HFGL 1CFBA 3SDYL 3FOLA 4PJ5D 3I50L 4NZJA 3ZDYF 1RZGA 2XA8L 4OM0H 4WDIB 2C9AA 4HF5L 4PY7A 3W0WD 5FF6A 5KTEH 4FMFA 2BXYA 3V6FB 3C2AL 1KEGL 2AQ2A 3MV7E 1JPTL 1OSPL 3VFMA 3OX8B 5T1LD 4TUKH 2DKMA 2J4WH 2W9DL 4LKXA 4XAWL 1JV5B 4PJXB 4YDVA 1F6AA 3NCJH 3GSNB 3QHZH 5JZ7D 1ES0A 5EC2A 3KVQA 1JF6A 4HWBL 2GSIB 1CN4A 3QIUD 1NAKH 3I02A 4M6AA 4MNQA 1T20B 5B22A 4NWUL 2ZJSH 4PLJC 3TIDA 4MAYD 1GRWA 3BKJH 4HEME 1ZLVK 4GH7B 3WS6C 1I1YA 3BPOC 3F7VB 5BV7L 3OQ3B 2HN7A 1G7JA 4O9HH 2DD8L 1EJOL 3VXOA 1IFHH 4Q6IB 2COQA 5GJSL 2B1HL 2ZCKL 4ZFGH 1KYOJ 5T5NF 1HH6A 3ROOB 3LKOA 1XR8A 1W0WA 3L5WB 1FLTX 5D1XC 3N1PC 2FCBA 4WI9A 1FFPA 3KYMB 1D6EA 3C6LA 1NJ9A 1ZLSL 4Q9QL 1B88A 1D5XB