2C3HA

Structure of cbm26 from bacillus halodurans amylase in complex with maltose
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
SGLTIYFKKPDSWGTPHLYYYDTNPKVDEPTWSEAPEMEHYEGDWYTHTIEGVESVRLLFKDRGTNQWPGPGEPGFFRDQDGWFDGEWHVDRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-AMYLASE G-6
publication title A Structural and Functional Analysis of Alpha-Glucan Recognition by Family 25 and 26 Carbohydrate-Binding Modules Reveals a Conserved Mode of Starch Recognition
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Carbohydrate-binding module
total genus 14
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16738 CBM26 Starch-binding module 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c3hA00
2QHLA 2AXGA 5IMMB 4Y8AA 4PG2A 3FN9A 2YUVA 1JNHA 2Y36H 1N6VA 2B5IC 3KJ6H 3X14B 1KJMA 2X42A 2G75B 2ZUYA 3BRGC 2B20A 5JOFB 3SJVB 5JOPD 2BNQD 3CMOH 5MENE 4QRTA 2EO1A 3SDAB 2AGJH 3RUGB 3M1BB 3WN5C 4X98B 5FHBL 4ODTL 3OTTA 3BP5B 5FO8B 4OIAA 4CN4A 3BN9C 5DQDL 4LPWA 3QQNA 3RWIB 4M93B 5IOPA 2D03L 1RJYB 4HPYH 4HMDA 1WISA 4JREB 2ERJC 4NRXA 5DRWA 1FVEB 1M05A 1ZA3B 4NQDA 4E41A 5DQ9A 4ODVH 1YEIL 1T1XB 5F89B 2B4CH 4OD3L 2AQ2A 4ZS6C 1BQUA 3D6GA 4PB9L 5D6CB 3BHBB 5CP3H 4JZNA 1VADA 4LRIA 4WTWA 3O41A 3FFDB 4X6DA 3X3FH 4EI5C 4XNQB 5BOPA 3EHBC 5D2LA 4JR9L 1VERA 2FHBA 1EXUB 5JDSA 4LSSL 3B8SA 1RPQA 2Y4SA 4JKMA 4D0BB 4HIJB 5C9JB 5B3JF 3ARXA 4QOKA 3CXDL 4NDMA 3B8YA 4P2OD 3U1SL 1DCLA 1R6VA 5I71C 3Q48A 3LHPL 1L0XA 4OCLC 4LSPL 1C8PA 2R2EA 2JIXD 1VFUA 1AY1H 1DBML 4WHYH 3MLVH 2VR5A 3MA9H 2CDGA 3F58H 4JJ5B 1KB5H 3V4UL 3BPOC 1QQDB 1NAMA 4FQHB 5ERWB 3ARFC 3D85A 1LO0H 5FO9A 2DIAA 1QBLL 1YEDA 1F58H 4PJIA 5TE6H 4JZOA 4XT1C 1A6VH 2G5RA 3WLWC 3OJ2C 4LSVH 4XC1L 5KG9B 1CD0A 4LLDA 3AMLA 3RVXD 5IVZB 2B39A 2X41A 5ESAA 2EO9A 4PRNA 2Y6SD 2ORBL 5IVOA 4X5XA 5ICZA 1NFIB 2BK8A 5F1KC 4LLQA 3S96A 5BXFA 1CFNA 1BOYA 1S7WA 4HUKB 5MI0B 1FFOA 2GY5A 2XV6B 4X6DE 3T1FB 5C1MB 1J1OL 5IKCA 4PJDA 4JQVA 3WFDH 4Y16A 1M71B 4UTBL 5DFWH 5HHVL 1F3JB 1F97A 5ILTL 4PJEA 1OHQA 4M48H 5T1KB 1SJEA 5F93C 3P3YA 2D7TH 5CINL 1LE5B 1T21A 2W0PA 1BAFL 5T3XE 3MBEB 1ZLVH 2PW1A 1X5YA 4X5WA 1LEIB 3NIFE 5F3BA 3VDBA 1BZ9A 4MXWL 5D4QA 5E8PA 2R2BB 3I75B 1R5WB 4HJ0D 3ARDA 1TZGL 4M1CD 3VWJB 4OF6A 2FECL 4Q6IA 1PX4A 1OW0A 1B0RB 4NQXB 1C12B 5GS0D 3VI3E 4PUBL 3NIDF 3FT3A 1RZIA 3RPKA 1UXSB 4OZGE 3WKMH 1V3MA 4RGNB 1R0AL 4HWEH 3OAYK 4LRNL 1I85C 1NCAH 4M7JH 3E8UL 3AAZB 2XN9B 1FAIH 4UUJA 5K59E 3O6FA 3TT3H 3FHQA 2Q8AH 3G6JA 4MHHG 1INDH 3HFML 5EIVA 1U93B 1F4HA 5IMLB 3H7LA 3PWVA 5GS1B 4FMFA 1T04A 4OM0L 4OF7A 4RFEB 1LO5A 1IEAB 1ZANL 4WI8A 2C1OB 4HZLA 4OZHF 4B50A 4ETQA 1JGEA 2ZSWB 5K9QG 1CS6A 4HC1H 3HUJE 4PBVC 2EDRA 2IANA 2GSGA 4OZFA 3RAJL 3QWOA 5DEGA 5E70A 3GK8H 2JCCF 2P8LA 3CAFA 3C87A 2XOTA 4LLWA 3IXAB 3DUUB 4G8GD 5EA0L 4ONFH 4QTHB 1MLCB 5CJBA 3MPCA 4N9GB 4XHQA 2OX5A 4Y4HD 5DQDH 3ALPA 1KLFA 3JSSA 1WVZA 5F6IC 3WEXA 5LCVL 1OM3H 3OKNA 4RA3A 3O3AB 4L4VB 3VXQB 3V0WL 1SMAA 4RAVB 3CX2A 4D9QD 3K46A 1QBAA 1T2QH 3LMJH 3OKMB 5D2NB 3ZDXE 4H8WC 5J13B 4P5KB 3KYOB 4CMHB 5E6IC 4BQ8A 3EOBB 4H25B 4OCYL 4JFFD 2EYSA 3U30B 1DQDL 5H37G 1VFBB 4G6KL 5SWSD 3BMWA 5EU5B 5EPMA 2YD8A 3L3HB 4NNPL 4MCZB 1DN0B 3G5YB 1MI5E 2H6PA 3MCLH 1JZ4A 4JDVA 5KANI 4M5ZL 3LKPA 1P1ZA 2DI8A 2XA3A 3LRSA 1HXYA 1U8LA 3HI6H 3P4OB 4Q9RH 3H9SD 3VWKC 1A2YA 1IVLA 3ULSA 4HLZH 4V1DD 3IB4A 1KIUA 2X4UA 3VE0A 3RGVB 3KPRD 4LARH 2IAMC 2CH8A 3HR5A 5D5MB 4WFHE 1H8SA 5J0BA 4NHCL 3AS1A 1WWAX 2Y5TA 5E8EB 2NY2D 4RNRB 3NOIA 4FFYL 1DBMH 3TFKC 3RVUD 4LCYB 4JB9L 3KLHD 4Q9QH 3UYRH 3V4UH 5ITBL 1T6WA 1OAQH 2VLJD 4O4YH 3JTSB 2NXYC 3GBLA 2O93L 1IQDA 2X6MA 1SEBA 2F15A 5K9JL 3OG6B 3VXMB 4XC1H 3LKSA 4EUPH 4OAWA 4LEOA 2V9RA 3DETC 1I3RA 3ZTNL 4WUUA 5FKAB 5MEND 3QDMA 5T33H 1IGIH 4XBPB 1X44A 1YC8A 3KPPB 1TVHB 2VIRA 3NN8A 1DBAL 4Z7VF 3P11L 2P44B 3AB0B 4HIIA 3BZFA 1F6AB 3FQXB 3NFSH 1ED3B 1K6QL 1ZEAL 4LSUL 3GFUA 2QKIB 3VFGH 3N9GH 4X4XA 4W81A 3ZTJG 4UIKL 1BAFH 4E5XA 1XF4B 3V8CA 3MOBH 1JWMA 3QIBB 5EZIH 4K07A 3WUZA 3I6KB 2AI0L 4GRWF 4MXWH 1KC5L 3U6RA 4PJFB 4RZCB 3C8KA 5JMOC 3VXTA 2DQFB 5JW4M 3WXWL 3TIDA 2HJKB 5INDA 4J4PD 4XWOC 3MOAL 1J10A 2VDOH 4HKJB 1Y0LA 1NBZB 2FJGB 2XY1A 4PRIB 2ARJB 3DMMD 1IGCL 3M8OL 5FV1L 3NCJH 4JHAH 4KKBD 4AEHL 2UZIH 1GGCL 4PRDB 3V7AG 3WFCL 2RFXA 3WIFB 1AQDA 5IUSA 3RWDB 3E8UH 4P49A 1TCMA 1F2QA 4UDUA 4TSAH 4K2UH 1DQLH 2EDYA 4QHMA 1I1YA 4XXDA 5GGSY 1YYML 1CFQA 3ZDZF 4I1NB 5CILL 4KAQH 5JXEA 2CLVB 3CMGA 1V3LA 4DTGL 1F4XL 1ZANH 4MNGB 3C09B 1VACA 2WSKA 3PP4H 3ARVA 3S5LA 1MVUB 5SWZB 1BJMA 1T0MA 1KEMH 3UC0L 3BD4A 3RBGA 3SQOH 3EYQD 2VZ3A 1SEQL 5DUPH 1MWAB 2A2QT 3WHE1 5C0NC 1IQWL 1U6AL 2V2WA 1OL0A 2DQHL 3TF7C 2ATPB 4YK4B 3NCMA 2IF7A 2I07B 2HRPH 3B43A 2ADIB 3MRCB 3C6LA 4I0PB 4GAYA 2GK0B 4KI5E 3MLYL 3MACH 3ALXA 1KN4H 3VFTA 3V95A 4R8WL 1XGRB 1GL4B 4X6EA 2Q6WB 5MEOA 4WEUD 1OARL 3QHZL 4P46B 4PLOB 3NFPA 2AKRB 4XNUH 1DQDH 4G6KH 1ZVSB 2FJHA 1JFQL 2CPCA 43CAB 1PG7W 2B4CC 1INQB 1MHHB 3ALWA 1ZLSL 4KQ3H 4U6XB 1U8PB 2YK1L 1NUGA 2BY1A 2ZOKB 4LLVA 4AL8L 4Z7OF 3BP7B 1JK8A 4UILL 1LE9B 4MNQE 1DFBL 5HGAB 5GRWA 5IB4B 4N0UB 4BK4A 2ICES 3CX5J 3VU2A 1T66C 3QUZD 4XAWL 5EO1B 5FM8A 3VH8B 4R96A 4I3RL 5L2KB 1FL5B 3QI9C 5GGSB 4KXZI 1PQZA 2FR4A 3UPRB 3VD9A 4XBEH 5HI3C 3RJDA 3AU1B 4JB9H 2GW5A 2UWEF 3D3VD 4M1GL 5GZNC 4F7PA 1DLFH 3L1OL 3CFJA 4HUWB 4OFYA 4YGVB 4IJ3C 5KSAA 2CKBL 5JXAH 3BZ4A 3PGFH 4WHYG 4LCCC 1JYXA 1JZ7A 2NY3C 4ZNCD 5K9JH 1FNLA 1ZE3C 1OAXH 2BP3A 1ACZA 4R7NA 3EOYG 2DQUH 2JB6B 2VDKH 3QPQC 5DWUH 4JFOA 1ONQA 4P23D 5KW9H 4KTEH 4JFDB 4Q97A 2AEIT 1DBAH 5D7JB 3P11H 1BVLA 3NCBB 4TOYH 1NGZB 1VPOH 1MWAH 2DMKA 2LAAA 3HMWH 4E42B 4LSQH 4ISVB 3IU4H 4YHPB 4XCYB 3ZL4L 3WKNA 1BPVA 4HBQA 3SDAC 1EFXA 4LPCA 1QOKA 4X7EC 1PYWB 1RIHH 2ICEB 5JQ6H 1JIBA 3K8KA 1Z6JT 5F21B 2G9HB 1U8MA 2HVKB 3FQRB 4MB4A 4G6FD 1KXVC 4EVNA 2W65A 4ZD3H 1II4E 1P53A 4OD2B 3WXWH 4HGWA 4JY4A 4R2GB 4FZEH 1YEKL 4K23H 1IGCH 3M8OH 1MI5D 1Z9MA 4GUPA 4M6NL 5GISH 4NM8H 3O9WD 4CADA 1A9BB 4PLJD 1W0VB 4HUXB 4OLUH 3DRQB 4Y19D 2PTVA 4WFFE 3C5ZB 5I75B 1T4KB 1MFEL 3L5HA 3RWJA 4I18C 4QKXB 3AVEA 5D8JL 3WLBB 1U9KA 3QNZA 1U2HA 3HE6D 1LEKB 2J8UB 4MAYB 3EFFA 2GFBB 4U1GB 3DX9A 2LTQC 4NWTL 3ZT5A 4OM1L 4I77H 3ROOB 5F9JB 3FOMA 1NGXA 3WN5A 5L8KB 1IC4H 3U7AA 3HZMA 4LK4A 4ZUWA 4C58B 4HFUH 1YJDH 2Z91A 5TJWK 4ZAKD 4K94H 3IDYB 2DQHH 2GCYB 1Q38A 1DL7L 2YEZB 3PABB 5E8OA 4HAFA 1A7PL 4QXGL 5D9SA 5EUOB 1KIQA 5I1KL 4NKMA 1Q72H 3QULB 5KSBE 1BD2E 5EO9A 4OZHB 5HDQH 4OFDA 4OZIA 4LVOB 1F90L 2ZKHL 1MCFA 3ULUH 3HPJB 5LGJA 3QJFA 5EBGA 5IWLC 1CK0L 1OQXA 2XKSA 3MSPA 2CO7B 3EBAA 1KULA 5I76B 2WUCL 4XNZB 3QB7C 5IVXA 2JCCB 3PIQA 3KPSD 4JHBA 5HGGS 1JFQH 5ACLA 5IMOB 2ZCLL 4W6YB 3TBTA 3MBXH 3IETA 4OT1H 2VYRE 1HZHL 4RMWA 4NQEB 4P5MB 4AIZB 4UILH 3RZCC 1CGUA 3EDEA 1OVZA 2SEBA 4KVNH 4PJAF 4UV7L 4FQCL 1DVFD 4I4WA 4L3EA 4Y88A 1GGBL 1BREA 4JDZA 1HHGB 3CFKA 1NC2D 3UTPE 3DTXB 1LDPL 5EBWB 5KS9F 4HLZG 1IAKB 1X5LA 2HJFB 1CLYL 2NW2B 3ARFA 2YBRB 4WY7L 3H9HB 5DJ0B 3L1OH 1AP2B 3S4SB 3JVGC 4J6RH 1I8MB 2QLVB 1MRFH 3IDMB 4FQLH 4U1KB 4DCQA 2PTUA 2V7NA 4BFIB 3OAYH 3MLUH 3VMPA 3P0GB 4PJCA 4LF3B 4MXVE 3TVMD 4Y5VB 4IS6B 2YN3A 5DD1L 3IDJA 1G6VK 4KK8C 1CR9L 5IVXE 3UPCA 1AGFA 5SX5K 3OQ3B 4U49A 4I5BA 3B4NA 4HKXB 4ODUB 5FUCE 1DZBA 1TDQA 1YNTA 4JO1H 4EN3D 3L5JA 4ODXB 4NSKB 1YY9C 1NJ9A 3EJYC 4XPTH 5I6XB 4RQQA 3VXSE 2P8MA 2AAVA 5I1AA 5EWIL 1A4JA 1S9YB 3GSVB 1MCSA 4Z95H 5I1GL 3CCHB 2G2RB 1IAIM 2DQCL 2RBLA 3CIQA 4RFNB 3RHWF 5L88L 5FYLL 4PJXE 4L3EE 1PDKA 4POUB 4YXHL 1QZ1A 1TVDA 4FRWA 4KRMB 2RCSL 3T2QA 3WNOA 5EBLB 3QIWB 4Z77B 5EN2A 1BVKB 2IQAB 5D70L 2ZG3A 4KZEL 3LQAH 5EOQH 2VJXA 3RHWK 1P9MC 3L5WB 4Z5RB 3W11D 3W39A 1MCBA 4U31A 3MLRH 2A73A 3GRWH 5J13C 1KSRA 4WTXA 3UO1L 5EZJA 1I85A 1UC6A 1J12A 3SE8H 5E5MB 2BY0A 3HNSL 3TBWB 5SX4I 4V2CB 4MNQD 1KLGB 3FRUA 3I3EA 4HEPG 4NWUL 1I9IL 4QYOA 3TM6A 5F9AC 2R0LL 1CDUA 1CU4L 1MLBA 3KPNA 3F7QA 4FXKA 4UTAH 3WD5L 2W60B 1QFUL 4GRWB 4ZNEA 3IS0X 3IU3B 4N90D 3AY4A 5DDHB 1UWGH 4GAJL 5C0CB 1G84A 2MOVA 3H7BA 4Y1AD 2FYYB 1Q0XL 5C0JB 3BPCA 4X6CE 1EX0A 1I3GL 3E3QC 3GSOB 1XT5A 5IHZB 4MQSB 5GS3A 3TN0B 4F8QA 1QO3B 4AIXA 1HOCB 4MXQD 2Y9RT 5E2TL 1BBJB 2W9LA 2QADD 3LB6C 1IBGL 1JP5A 5GSRB 2KZ1B 1CF8L 1NGPL 3QUMA 1VESA 4TYUA 5JHDB 3E2HC 5HXMA 1A7PH 4QXGH 3BH8B 1JVKA 3NCYS 1CE1L 3P77B 5EZOH 5JLZA 5FGSA 1FC1A 2I25N 5E6IA 1F90H 4TPRL 1GZQB 2W92A 3NABH 2I26N 1S3KH 2GSIA 2OQJB 3B2VL 5KSUA 4URTB 4L3CB 4YHKL 4JRYA 4Z7UA 1QSEB 3CSBA 1F2XK 4QY8B 3GDBA 4WO4B 1NUFA 1CDBA 5EUKB 4MZ3A 4ZNEE 5GRJL 3BE1L 4MQ7B 3VWKA 2XTJD 2EKSA 3O3EB 1MFAH 3IF1A 5FYKL 1RK1B 2MJWA 5DJ6B 1I4FB 2F53B 2IAMA 1S7XA 3MR9B 4EI6B 4X8JB 1BFVL 1KG0A 5CD5D 4WWID 3VD7A 3CLFH 5EU6E 1BHGA 1SYVB 2X40A 1U8JA 4L29B 1T22A 1XFPA 4HCRA 2BSTA 4MJIA 3UAJC 2NY5L 5C3TA 1F3DH 3KLDA 5I66B 4OUUA 1CLOL 1KJ2A 1QG3A 4AQOA 4QF1B 2A6IA 5TF1L 3O45A 5ISZA 1CLYH 1QSFB 4PS4H 4RGMB 4APQB 1XGUB 1JPSL 1XF3B 1RFDH 3G6DL 3PG2A 5ADOL 5BO1L 4QRPB 4KK6C 1RUPH 1HHKB 2JELL 4P99A 3RWCA 1G0YR 1H9VA 1UQSA 1ZT1A 3QG6A 5HVHB 1MCEA 4G5ZH 4FOMA 4IRSB 4O2EB 3WDIA 3DV6A 4MD5A 2NZ9D 3H6JA 4QHNA 1HYRC 3B5TA 3HHRB 3V0VA 4YZFF 4JVPA 2NZIA 3H8NA 2CLRA 2JB5H 2HAZA 1I9JL 5KJRH 2UWEB 3H3KA 4U6YB 2WWKO 4GKSB 1RQ5A 1DDHB 5DVNA 3CFCL 5I1DA 1BD2D 5EWIH 3RZWA 2FEDC 2GTZA 3REVB 3FQNB 1X7QA 2HKHH 3ILQC 4G9DA 1I1FB 2F54E 4YDIH 3PHOA 1E4XH 5DRZA 5AZEL 5L88H 4PRPE 2JJTC 3NACL 3DXAD 1MPAL 2ITCB 1BX2A 3DX6B 1HQ4A 3N1FC 1GGUA 2VWEC 4HIXL 4MJIE 4JM2F 5CKAA 3JTTB 4ZQKA 4MD4A 1NFDB 1YMHA 4DGVL 2CDEA 1P4BH 5CEZH 3VXUB 2V2XA 4WENB 1RUKL 1OGTB 4BQ6A 3MRLA 2R4RL 1NCUA 3BUTA 4CUCA 3ARPA 3V6FA 2D4FA 1EH9A 4DUVA 2HRLA 4WDIB 4RMSA 2EEBA 4NWUH 3IGAB 1I1RA 1I9IH 4W6XB 3CVIH 4YHIA 3GKZA 4XZUA 5HDBF 2WWMC 1XCTA 5FA4A 1NEUA 3KGRA 2DIBA 4OLVH 3S88L 4S1QH 1A4KB 1NUNB 3GMMA 3UTPD 1DBJH 2X4SA 3OHXB 2XG4A 2J88L 1N0XL 4GAJH 3QEGL 4H1LA 4GMTL 1Q0XH 5EOCL 1WBXA 1X6NA 4QRRB 3IDIB 5IROC 4G80A 4IHOB 4IIQC 4JGJA 5CS7A 1A22B 3OKLA 1RUAL 4GG6F 3G5ZB 1EMTH 3VH8G 3ZHKA 1A8JH 1AO7B 3DVFA 1A7NH 3UJJL 5DZLA 2P47B 5BVPL 1OQOA 2VABA 3QDJE 2YPVH 4BKLB 1CF8H 1NGPH 3T77B 1A02N 3SCMB 3DHMA 3H9SA 4HBCL 2P7TA 4MQXD 2XICA 4FTVA 4V1DA 4XH2A 1YQVH 3QO1B 1T03L 1KNOA 3R1GH 4MD0A 3KPRA 3A6CH 4XNYH 5I18H 3WUWB 1S8DA 1JZ5A 3WNPA 5CCKL 4FHBD 4U1HA 4PBWD 2GJ6B 4LLYA 1AGEB 4LIQH 4XPHH 4L8CB 5IF0A 5A43C 3QEQA 3KXFA 4XNMB 5C0FA 1IKFH 2ED9A 1G7JB 4XX1G 2YN5A 5D7JC 4L8SB 3CZFB 2BFVH 2XRAH 4H88H 4BFEA 1I1CA 5IR1A 2HLFC 1YZZA 1V7NL 4PJ5D 2NCMA 2ZUUA 3SDXA 1MHCB 3C2SA 4XP1L 5FYKH 4C56D 3O2WH 3WJLC 5CSGA 4AYFA 1BFVH 1N5AA 4MWFB 3IRPX 5ETUA 1TZHB 3N1GC 3J8F7 4OV6F 3QI9A 1CVRA 4LSDA 1A9EB 3P9LB 3QCVH 4LLMA 5J3HD 2FBJH 3VFOA 4WFED 4MNHB 2NY5H 5CMAB 1JPFA 3TV3L 1T20A 5HGHB 2X89D 2FSEB 4R2GC 1XGYL 2VSDA 1MCPH 1FV1B 2G60L 4NZTH 8FABB 5B39B 5SWQB 5DZNA 1M7IA 5E8NB 3UZVB 4NM4L 1PKQB 1Q9LB 5D1QB 1JPSH 5DJ2B 1EVTC 4LCCA 1CFTB 5FAAA 3L3GA 5BO1H 4GO6B 2GI7A 1KLUB 4X5LA 4P59H 5IMMA 1M7DB 1I9EA 3BVNA 3CU1A 3OF6A 5E9DB 4RWYH 1T1WB 3QEQE 3OX8B 1KFAL 2APTA 3KXFE 3V5HA 3VXOA 3V5DA 3VXRD 1D5ZB 5KS9B 5D1XD 3OSKA 1PG7L 1U58B 2CUMA 2VKXA 3BX7C 4U1GC 3H9ZA 3RL2B 4K7PX 2DIJA 4G3YL 1L6XA 2P5WA 1T5WB 3P4NB 5LVEA 4B5EA 5IFJB 2QR0A 1PLGH 3CFCH 3EOAA 4JFXA 2HG5B 4KQ4L 4LMQI 5HHOD 2C3HA 4GW1B 5TGBA 4HS3B 3F65A 1NBQA 5FGCE 4YBQD 3KPLA 4YBHA 3FB6A 1CDGA 4MA8H 3DLQR 3QUXB 2DL2A 4XBGB 5EU4A 1S78C 4TUKL 3BH9B 3KNBA 5D7LB 3ZKSD 4XPAL 3EYVA 3MRRA 2APXA 1J5OH 3GMRA 4DGVH 5C2UB 3PV6A 2BOBB 4WEBL 1T1XA 3RBSA 3FL7A 3RTQC 1BQHA 1TETL 3ARGD 4XNXL 4HQQL 5F96H 4X6BA 4J1UB 2UUDK 4ZDHA 3TIEA 3MROB 3BHBA 3B2UC 4S1DC 5IB2B 5FA3B 5IK3A 4I18A 1HHJA 3BDYL 3QH3A 1HEZB 3AS0A 2R4SL 1YMMB 2DQGL 5EU6D 5EB9A 1XCQA 4P5TD 1NEZA 4QRUB 3N1PC 3S88H 2QQNL 1G7MA 3VGGA 3ORJA 3QBTB 5DYOB 5JHLH 1IAII 3O2VL 3AXLA 3SJVE 2WBJC 3BXNB 5IFAL 2Z35A 2PUQT 3QEGH 5JTWA 5L6YL 5DI8B 5I1HH 4JO4L 4ZUSA 1LP9F 2H1PL 3NTCL 2FO4B 3QFJA 4RSVA 4OI9A 3T08A 4EBQL 4YXLL 5E1HB 4LCUB 4BELD 5GQBA 4KUCF 5EU7C 2IPTL 1AIFA 4JJ5A 1R5IB 5BVPH 1ZA6A 2H3NA 4FQHA 4IOIA 4YR6B 5DT1H 4EXPX 5I1CH 4R97B 3NCFB 4HBCH 3K80A 3S3SA 3VRIA 3GSWA 2NXZD 1FL3A 5LKNA 1T03H 2BZDA 4HXAL 3S4SG 3QUZA 5ANMB 1A1NA 4OKDA 2KQMA 4M61B 3UROR 1MELA 5IWLA 2XQBL 2DLGA 5CCKH 2PN5A 1BIIB 4PTUA 2ATKB 4ZTPL 1L9MA 4Y4FC 2IMNA 1VFAA 4HWNA 1KXQE 3CJJA 5JW5B 4WHCA 3SO3C 3OB0K 4NJAH 5T1DL 3VFNB 3RP1A 4YHZH 3VXNB 4WUKH 1CDIA 2F54D 1EEYA 3ZKNC 3SKUD 3DUSB 4HAGA 4TVPH 5SX5H 1N59A 2VXUL 3RZCA 3DSFL 5AYUL 4PGEA 2KPNA 3O8XB 5FK9B 1A7BA 3TBSB 1JYVA 2E5EA 2R1WB 2DM2A 4CRPA 5HHQA 1UWXK 3SDDD 1CDHA 4K3JL 1BEYL 1X4XA 4RFNC 5DEFB 5IGXL 3QFJE 4X4MA 3MUHL 5DC0A 3NAAH 1FIGL 3GJFK 3ZHLA 4PJHF 2QSTA 4HFWA 4PG9A 4WJ5B 5JPNA 4FZ8H 4KI1A 1MQKL 5ALBH 2DWDB 3INUH 4MMZC 1QLFB 3IFPB 5T1LD 4G8FA 3EO9H 1YECL 3JVGA 5TFSL 1IM9A 1RZGA 3AAZA 5CJOL 5EORL 32C2A 3C6SB 5C0RH 3DROB 3X13B 5A3ID 5I2IA 1QRNB 2K3TA 1OSPH 3DV4B 1G9ML 1FNFA 3PDOA 4A2MA 3MV9A 4JPVH 4NFDA 1ODAA 1UT9A 4WV1C 4NCDA 1IEAA 2C1OA 1I3VA 1I1AD 3UPAA 4HWZA 1I7UB 3V4PH 4NKOA 5DGRA 1MAKA 2IH1B 1Z5LA 5DO2D 3TO4B 1CCZA 2ZSWA 2EXWD 5BV7B 3U46B 2WV3A 2JKXA 1U8OA 5BS0B 1MNUL 4XHJC 1U3JA 2CQVA 3QDJD 2H32B 5CGTA 4XVSH 4UT7L 4U1LA 4JO2H 1OAUH 3MJ7A 1QBBA 4QTHA 3P4LA 1FGNH 3MJ9H 2DQEH 3L3DB 1ADQA 1MF2H 5INCA 2DYPB 2VITA 5IV2A 4D8PA 2VLRA 4YWGH 1MHPL 3SE9L 3X12A 1P9MA 5FKPA 3WL9A 3GSNL 4OQTA 4RGNE 4N8VA 3DRTA 3MREA 1JNLL 1G7HB 1N64H 2BXYA 3CX5K 2XN9E 5JR1H 3MXWH 5FM5O 1MCQA 3BKCL 3BT2H 3L3HA 4YEFA 2Y5EA 1MH5B 3Q1SL 3HZVB 3EOTL 3G5YA 2DMCA 4NUJB 2B1AL 3MV9E 3TBYA 2A0LC 5D2LF 3QXDA 1A7RL 3BIBX 3JWOH 2A77H 2A9ML 3ZDYE 3RDTC 3ES6B 3PGDA 4NCC1 4JM2B 1T5XB 3TZVD 1RK0B 3HAEB 3QDGB 1JMZA 3MFFB 2VO5A 2EDXA 1UM5H 4FP8H 1FVDA 5H2BB 5E24E 1QSVA 2FZ3A 2H1PH 3LPFA 4GBXB 4YUEL 4QRSA 1HYSC 5E8EA 5IFHL 1Y18A 5DK3A 1IGML 2IPTH 2ZNXA 3IDNB 4S1RL 5JPMB 3WS3B 5DD3L 1ZT7B 3PV7A 5TQ0L 1TPXC 3FFCD 4MB5A 3N85L 4KJWC 2BMKB 2FJFA 2JLLA 1D9KD 3OR7A 4L4VE 5FUOL 4UQ2B 4APQC 2AK4A 3OR6B 1FZKA 5F1OB 1AR1D 2W9EH 4G9FD 4M62L 4PJIF 3OKDB 3WFZA 4MJ5A 4CN6A 2R56H 4F7EA 5LJYH 3TA3C 2BSSB 2NYYD 5GRUL 5HVHC 5BV7H 1QYGH 2GJJA 2FEEI 4IRSC 5I1IH 3HRPA 4QNPE 2H32H 4GG6B 3K1KC 3LEVH 5FFLA 3ZE2F 4JKPL 1P4LA 3BMVA 1XF5A 43C9B 4PJDF 4OTXL 1CQKA 4G42B 3V6ZB 4PJEF 1N2RB 1Q94B 3O0RL 4HZAA 4Z7QF 1JI2A 5TH2B 2O61A 3CFBB 2VLLA 1QR4A 1F4YL 1V8HA 2XWTA 3OAZK 1AC6A 5HHMD 5D5ME 5I19L 4GOSA 2AERT 3I9GL 4U0RC 4IMLB 4R26H 1L7IH 4HKJA 5E5UB 1IILE 1TJHL 3ILPB 4MJ4A 1MQKH 3HE7C 3JV4B 3TYFB 5BJTA 4LVNB 1GZPB 2C4FU 3H3BC 5ESQB 5FV2A 5BRZB 2CRYA 3LAFA 1IFHL 5C3LD 2CD0A 2BJMH 4QCIB 2X70A 2ZUVA 3T2PA 1I8IB 5EORH 1KBGL 3C9NA 2XZCH 3I50H 3VFUB 1XGPA 5B8CB 4WI4A 3G6JF 4QRQA 3HAEH 1RZ7H 1FNSH 1I8LC 1NBYB 3C8HA 3L5IA 2IC2A 1YNKH 4HX1B 5E08L 4DK3A 4BUGA 4F15B 1SMOA 1PZUB 2AQ1A 1GGTA 5LWYL 4M7LL 4PJGA 1VA9A 5EO0A 4UIMB 5SWZA 1D6VL 1P2CA 4HW6A 1OAYL 5I8OL 2Z92A 4XGZB 2APBA 4X7FC 2A6KB 5KSVB 3HRZA 5C7XH 3MFGB 3DBXB 1CQYA 1NKOA 2JJTA 4PRAA 4PV9B 2X44D 4PJFE 3GBNH 3RRQA 1FC2D 1RI8A 1AKJA 5KANG 4ELMA 2BXZA 3SE9H 3GMQB 4PRIE 4TSCH 6FABL 3NPZB 1JRHI 3UTZA 4NQVB 5ADPH 2Q6WA 3FCTB 4M00A 4ODSH 3WUWG 3X3GH 3QIUB 1U8HB 1JNLH 3MRBA 2C5DC 2X9XA 5DFTA 5LGKA 1FO0B 3T3PF 3T3MF 1ZVSA 2H2PC 4YNYA 3Q1SH 3R06A 4NJ9L 4L8SC 1X5JA 2PO6B 3KPOA 2WIMA 1I8KA 3C5JB 1GC1L 1QVOB 1WBZA 2A9MH 3OKKA 5DUML 4FFWD 4MNGE 4M6AA 3MNZA 3P73A 4YH6A 4GW4B 2Y7QB 1A3LL 1RD6A 5SWZE 1H5BA 3TPUA 3BWAA 4UAOB 5I1EL 2O5YL 5CD3B 4IIQA 5IHUL 1HN1A 3H0TB 1OCWH 4LHUA 3IS1X 1R3IH 2O26U 3JUZA 2VB5A 2J4WH 2P42B 1S7UA 3V2AR 4KROB 4U1JA 4FQXC 4N0YL 4PP2A 5F7DA 5BZDA 1BZ7A 1NBVH 3FB7A 3KPQA 4HXBL 3KWWA 3MRHA 2IADB 3B5GA 5B39G 1JWSA 3LS4L 4XMLL 4IOFC 1E28A 1OT2A 4HUMB 3UTTA 5K33A 2AJUH 3ARZA 4L9LB 3G9AB 1B6UA 2BSED 2ZUTA 2WLYA 1LD9B 3U9PH 4NZUH 2CMRH 3MBED 3QFDB 3HZYA 1JWUA 5D1ZC 1MRDH 4PRBA 1ZGLA 3JV5A 5F9WB 5MERB 3HI5H 3VI4F 5IJVB 5DMKA 5SX4H 2DTSA 2HTKC 5IEHB 4OLZH 4KVCH 4OTXH 2XWBA 2V5SA 4JO3L 3CFEA 1JHLL 1PD6A 1Q0YL 5EBMB 3VWJD 5GGUA 1HSBA 1U3HB 3OXSB 4CMMB 3BKYH 1E27B 3LQZB 3F62A 2ZG2A 2A74A 4N0UE 1F4YH 4OV5A 1OTTC 3PGCA 4P4KB 3SGJC 1T1ZA 5SV4A 1AR2A 5DJ8A 2X4RB 3IT8D 4RGND 4FXLA 3QUXC 5L2KE 5IB1A 2XYCA 2CRZA 2BRQA 3DO7B 3PL6C 1EAJA 3O6LH 1BM3L 1TJHH 1FO0H 3OZ9L 3HPLB 2J5LB 3DJ9A 4HUXA 5B3JE 3ZYOA 2GITB 5DJCA 3VA6A 2YD5A 1UCTA 3GJFB 1JCKA 1URLA 3DXAA 1BIHA 2UUDH 4F7TA 3K2UL 1O0VA 3LV3A 3VGAC 2CKBA 4RX4A 3NVQA 3T65B 1YQ2A 4XX1E 4DQOL 3ULVF 3KPTA 2XY2A 2X7LA 5JOEA 5DJZA 4K3EL 5LWYH 1T1YA 1YN7A 1EAPA 4PJHB 1H3XA 4ERSH 1JHKL 3DIFA 4D3CL 4PJ7F 3CFDB 2F5BH 5J6GA 2YHGA 1OAYH 5E4EB 5I8OH 4L4VD 5HGDB 3A0OA 2VDRL 1I7TB 4XVTL 3GMLB 2RB8A 4MVBC 5DHYA 2EEDA 2F58H 3BZEB 2Y72A 4RA0C 2AJ3A 1LO4H 1KV3A 1U3ZA 4AMKL 4ONHB 3CVHB 4HMCA 4KY1L 3HLAA 5JORB 4Z18A 1KPRB 1WV7T 2APVA 2AXGB 2I5YH 2HVJA 5KAQF 1JNHB 2HT3C 1FPTL 4NO2A 1KJMB 3S37X 1G7QA 3BP4A 1DANT 2H8PA 5E94A 3RTQA 1UG9A 4PV8A 4CN1A 2V7HB 3HPJA 5EH1A 2FX7L 4WI2A 2MKWA 5I76A 3RVWD 4L4TD 4QHLA 4NNYA 2W59A 4QRTB 1NAML 3RGVD 2D7OA 2ADFH 5JZ7D 3IVKA 1A7OL 2C3GA 4JN1H 1G1CA 4BFBD 3OB0H 3DGGA 4FQQA 2J8UE 3HC0A 5DVOA 2NY1B 5DUMH 2WBJA 1JI1A 3BWUC 5DD0L 4KTYA 3VG0H 5IOPB 2VSCA 3NIDE 1AD9A 1HKLL 1F02I 4LGSB 3PXJA 3TWCH 4NRXB 5DRWB 1GAFL 1M05B 4NQDB 1JGLL 1RZ8A 3PWPD 4E41B 5HYFA 1PSKL 5DQ9B 2YZ1A 1UWXH 2VQ1A 2XZQL 2M26A 5I16A 3VXMD 2Q86A 4U3HA 4PYGA 2NW2A 1VADB 4KH2A 4ZPTB 5EUOE 2AABH 3O41B 3GJFH 4X6DB 5CBEA 2VC2L 5C70A 5D2LB 5GGVH 3EZ8A 5ID1A 7FABH 5JDSB 1I8MA 4ZXBD 4OZHE 2ZOLA 3FO1A 3QPXL 4ZO9A 5GRVK 1EDQA 4NQSA 4KRPB 1KACB 4QOKB 3GI8L 1MSPA 2NY6B 4NDMB 5ECJE 4Y4FA 3HNVL 2DI7A 2VUYA 1CFVH 2JCCE 4PFEA 2ESVB 4YDKH 5IB3A 4WHTA 3QIBD 5H35A 3BGMA 5LG1A 2R2EB 3TO4C 4JFED 4Y4KC 1E4JA 5IESL 5TPWL 2OR9H 2CDGB 1KCUH 3CDGA 4WTZA 3QA3A 5I9QB 1U95A 1ZHLA 3CVHH 5CAYB 1JGDA 1K8DA 1NAMB 4MA1B 3FRPA 4LU5H 3D85B 4OLYL 4PRID 3SY0A 5FO9B 1YEDB 4PJIB 1N6UA 4JZOB 5CZXC 2F8XC 2J3SA 2XACC 4KTDL 4LLDB 5ESAB 4PRNB 1DUZA 5DR5L 3B9DA 3L3IB 4X5XB 5ICZB 5ALCH 4Z7VA 4LLQB 3S96B 5EU3A 5BXFB 1CFNB 4JQIH 1S7WB 4QHUA 4NRZB 5IKCB 4PJDB 4Y16B 4HMEA 4H26A 4PJEB 3KG5A 1QACA 4G43B 1SJEB 1VEMA 3SN6N 5FF6A 1YNLL 3IKCA 1H3WM 3L9RA 1T21B 4TTDD 2PW1B 2CGRH 4X5WB 4WV1A 4IDJH 5AZ2L 2ICCA 2FO1A 2IQ9H 3GSQA 1HI6A 5HYSA 1BZ9B 4HG4J 3LKRA 1PEZA 2PW2A 2VXQH 3ILQD 5LQBL 5E8PB 5KZCB 2B1HH 4JM2C 4P9ML 5HYIA 3MXVL 3ARDB 1G9MC 4TQEL 4Q6IB 1QKZH 2YA1A 2H45A 4D3CH 3HAEG 2AXFA 3PWLA 4I0PD 4GBXC 4DW2L 4POZC 3FT3B 5IHLB 1RZIB 3UTSA 1OB1B 4RMRA 1AE6L 5FO7A 5HGBA 2F74A 1QFOA 2ICWA 2HFGH 2XA8L 3A6OA 1IKNA 2WINA 2UY7A 4UUJB 4P46D 3O6FB 3QWQB 4AMKH 2A38A 3BH8A 3G6JB 1SYSA 3MV8A 3S37L 1AGBA 1FYTA 1CZ8L 1HDMA 3PWVB 2ADJA 1R24A 1UZ8A 1T04B 5HPMA 2FIKB 1LO5B 1C5DA 2BNRA 4HZLB 5BMFL 4ETQB 4OZIF 1JGEB 3LPGA 2YPLA 4HSQA 5KVMC 1XZ0A 4NO3A 5I74B 2IANB 2CJUL 3WXVL 2VAJA 1D5XA 3BD3A 4GQPH 1NCTA 2GSGB 4OZFB 1NAMH 3QWOB 4QY8A 5DEGB 2P8LB 3G5VA 4LLWB 4GRWE 1QLEL 3K3QA 1SJVA 3RDTA 5T5NF 5C0CE 5E2VL 1WEJH 1Z9SA 1MJ8L 2D2OA 3WEXB 3OKNB 1HKLH 2ITDA 3F8UB 4U1SA 5T5FH 1JGLH 3OAZH 3UTSE 1EHXA 2YD7A 4UT9L 3E6HA 4G6AC 3OWEA 2EYSB 1XEDA 1E4KC 1S9WA 3GSXA 3ZKXC 5EPMB 3ZDZE 1TLKA 1ZT4A 1WJ3A 1XGUA 4YE4L 2VC2H 4ZS7L 2H6PB 4JFDD 5FYLE 3LDBB 2FX9L 4JDVB 3ULUD 5D7SL 1P1ZB 4GXVL 3B9KC 3TA3A 1HXYB 1U8LB 4YHML 2BNRE 4FQ2L 1A2YB 2AJYH 3ULSB 1MY5A 5BVJA 3LEYH 2QQKL 2YPLE 5J06A 2X4UB 3FQTA 2IH3A 3VE0B 1EJ6A 1QSEE 3K4AA 5D72H 3HR5B 3D39A 4F15C 4JPWH 3MRQA 1U8NA 4UINL 4RRPA 3RPIB 3VRLF 3DWTA 2Y5TB 3W0WA 4F7CA 2EDFA 1EV2E 2IPKA 5DHVA 5AAMA 1T6VN 1UKQA 2EE9A 1SVZA 3EYUH 3V9FA 3WDJA 4X99A 4CVWA 4LP5A 3ULVL 2HH0H 1BP3B 1IAIH 3GM8A 4FA8A 3FHAA 1KN2H 1IQDB 1QHOA 1SEBB 3LOWA 1FQ9C 1G9NH 3NBNA 4OAWB 1N0LA 3C5ZD 4LEOB 4JZJC 1EO8L 3GBMH 1I3RB 4WUUB 2CO6B 3QDMB 1P7KA 1UWEL 3HE7A 5DJAA 3P30L 4K3DH 5B4MC 1JGUH 4OZFH 2VR4A 2VIRB 1NMCB 3NN8B 1ZTXH 4N1CA 4F3FA 4P0DA 3QIUC 4Z7OE 4GKNA 4MAYD 4HIIB 3BZFB 4M03A 3MCKA 2GIYA 2NY0B 4X4XB 4E5XB 4JFZL 1JWMB 4L1HA 4GQ9H 5HYJA 1XMWA 4ODBD 3UMTA 5FHAH 2FEEL 2ED7A 4K8RH 1KXTB 2OJZL 4P9MH 3U6RB 3C8KB 2COQA 3VXTB 4J12A 3MXVH 2PXYC 3R8QA 2UWEE 2QJDA 3IDIA 3TIDB 4UAOC 5INDB 2F9BT 3MRPA 3L3KA 1Y0LB 1S9XA 2OLDA 5KTEL 2OL3A 1FORH 1YYLH 3QP3A 1AE6H 2LFGA 2NW3A 3BQUD 2RFXB 1AQDB 2BVEA 4ZTOL 2AJXL 4FABH 5FYKE 2GKIA 1MCOL 4F37K 4KMTL 1F00I 4UDUB 1NFDE 4QHMB 1I1YB 4XXDB 4KDWA 1CFQB 2E27L 4ENED 4OIBA 4N1EA 1OD9A 5C0BA 3GSUA 1VACB 5BMFH 1AGEA 4P2QA 4NQED 1JN6B 5IBTL 3S5LB 1F8TH 4CAGA 2R23A 3ECBA 4ODHL 1T0MB 4NZRH 1KPUA 3EFDL 1U36A 4IRJC 5HYJE 2HT4D 1QLEH 1SJHA 3BKML 4NQCA 2V2WB 1DUYA 5ICYA 1OTUD 5T1MA 1AXSA 1U3HC 2APFA 4OLXH 3HB3D 3C6LB 4GAYB 4QRRE 4U3XA 4P4KC 1UCBL 3ME0A 4XCFL 3VFTB 4JE4B 2VZOA 1GC1C 4WW2A 1ZGLM 1E6JH 2NY4B 5MEOB 1AO7E 3QRFM 1EUUA 4OIIH 4LLUA 4Z8FL 3CSYA 3UTQB 3T0EB 3O4LA 2VZSA 4FQXA 3NFPB 4OCXH 3HNTL 1IZKA 4TULL 3D0LA 2H41A 4LPYA 1QHPA 2FJHB 4LOUD 4D0DA 4ELKA 1CGVA 3W9EA 1UH2A 4U4BA 1MAML 4AQ1B 3PQYA 1WIOA 1KLUA 2FHCA 5DK0B 5D7SH 4LLVB 4GXVH 5TE4L 1JK8B 4YHMH 1JRHL 4PJAA 2D7PA 4P2QE 4NHUA 1N3NB 3DI2B 2QQKH 1L6ZA 1T1WA 2AEPH 4N8PA 5D1ZA 4FQ1H 5DVMA 1UH3A 2LU7A 2ED8A 4R96B 5JW4Q 5IBUB 2BDNH 3H42L 5I17A 2AK1H 12E8H 1A1MA 1YC7A 4NQCE 2FR4B 5FUZH 1DQTA 1T5WA 1A64A 2XG5A 3QIWD 4XPGL 5E4EC 3IXTA 2FCBA 3EDFA 4OQ1A 3SGJA 4GMSH 4F7PB 4JPIA 1Q9KA 3CFJB 3BEVA 4WIQA 4WCYH 4Y2DD 5KSAB 3K0WA 3BZ4B 3WIIL 2Q3AA 2DRUA 4YHYC 5HYQA 4HH8A 3VXPA 4KHTL 3PL6A 2EYTA 4YIQA 4Y7MA 1TQCC 3O4LE 4WWKD 4PG2C 4R7NB 5KVFL 5FEBA 4GS7B 5CGYC 2OR7A 4O5LH 4JFOB 2R8SL 1FDLH 1ONQB 2RGSA 4CKVX 3BSZL 5DC4B 2X1OA 1BVLB 1N26A 2OTUA 3U0PA 3MLPA 4JRXD 5C0CD 4JY5H 3PQYE 3RX7A 3VGHA 2VDPL 4G6JH 2CDFA 1HIML 1H8OA 4PJAE 5ELIA 1EFXB 2FL5A 2UVEA 5D96C 4JFZH 3TN0D 5JNYA 1GIGH 1NSNH 1CLCA 1U8MB 4NN5B 3VGFA 3Q5TA 5KS9E 2YUXA 3Q0HA 2H2SD 4WI9A 2IJ0C 1XIWA 2OJZH 1KJVA 4EVNB 2W65B 5JHDD 1YUHA 3A67H 4OB5L 5I0DA 2ZWLT 4HGWB 4JY4B 2DKMA 5H8DA 1AJ7L 4IBLT 1LDSA 1NL0H 3QUYD 3TJHC 3EJJX 3U4BL 1CDYA 4FQJH 4GUPB 5FM5M 2Q8BH 3MLZH 4HWUA 1ZMYA 4CADB 1YY8B 3IFNH 4GAGL 5HJ3A 1F3DJ 2CUIA 2PETA 4DKAA 5H94A 3RWJB 4HC1A 5D7LE 4LPTA 2RR3A 4YBLB 4UMGA 5CEZD 2B5IB 5E56A 3RVVD 3QNZB 1Q1JL 2E27H 5KVDL 4WU5A 4WO4D 2DD8L 1RIVH 2C7UA 3G6AA 2NY6C 1DSFL 2ILLA 3EFFB 1BIIA 3UJTL 3DX9B 3RIAF 2AW2A 5JW5A 3BAEH 1G6RL 2VERN 4ODHH 4U2YA 4DOHB 2F53D 5E6ZA 3FOMB 1NGXB 1CL7L 4I9WD 1YMME 3HZMB 3X17A 2FX8L 4ZUWB 4NPYA 2A1WH 3RIAK 1PGRB 4GKZA 4FXGA 3LRHA 5I9QC 5E8OB 1L7TH 3S97C 4MA1C 2P48B 4TSBH 5D9SB 2QV2A 5FCUL 1KIQB 1J18A 4NKMB 5C6TH 5CUSL 3WIHL 3D2UD 3QQ4A 4XCFH 1QSFD 5B3NA 4FMKA 2YKLH 4OZIB 4S11A 4O02L 1PX3A 1X5FA 1NGWA 2HTLD 1H3PH 5LGJB 4QRPD 4Z8FH 3QJFB 3BKJH 1K2DA 3DUHA 2EDBA 4HK3N 4DZBB 4AG4L 5IVXB 3PIQB 4TULH 4IRSD 3MQIA 1LO2H 4Y16C 3IETB 1V3KA 2YMXH 5L2JA 1G9EA 4RGOH 5CJXC 5TQ2L 5GHWL 5TE4H 4OCSL 4G8IA 5EZLA 5JW4R 1JRHH 4DKEH 3FMGH 5MEQA 2R0KH 5I71B 2SEBB 1NMBL 4OI8A 4EEEA 2Z31C 1JNNL 4MQTB 3QWRA 3MUGA 4L3EB 4LFHG 3VGBA 4JDZB 3TO4A 5JO5A 1RY7B 3ESUF 4QGTA 4Y4KA 3ARDC 5DURD 4Q6IC 2R9HD 1JF6A 4EUPA 3QCTL 5FYKD 1JUFB 4LNRA 3ARFB 4WI5A 1EBAA 3EKCA 2GTWA 3PWUA 1NUDA 3VXUD 3STLA 1DBBH 3OAUH 4P2RD 4DCQB 4LDEB 3HTLX 5DUBA 4KHTH 5C0AA 1AD0A 2XZAL 4PJCB 5JUEH 3BI9X 4M8QA 2CK0L 1UA6L 3IDJB 2VZ1A 4BZ1H 3ARBC 3ARWA 1BF2A 1C08A 4I5BB 4U6TA 3BSZH 2XI9A 2F5AH 5TE7L 1NJ9B 1UJTA 1QRNE 1MCKA 2AQ3A 5A16A 1EGJL 3QUML 5A2KH 2P8MB 3TH3T 5I1AB 1A4JB 3V0AC 4OZFG 4JDTL 4NKIL 5F6HJ 1A0QH 5EIQA 4BH7A 3EO0A 1C5BH 4HUVA 1J87A 4JM2A 1LO3L 1H3UA 4O58L 3P0YH 1SBSH 1QEWA 1FIEA 2W9DH 5EN2B 3SCMD 1HH9A 5HI5D 4GBXA 3BUYA 4L4TA 2EC8A 1DE4A 3W39B 5C8JA 2A73B 2MMXA 5GJTL 1UZ6F 1CIDA 5EZJB 1VFOA 4P57A 4XWGL 5JPMA 3WFHA 3NIFF 4XP9L 3S35X 2P5EA 1SY6A 4GAGH 4LCWA 3TPKA 2GJ6D 1NCDL 1UACH 4KJQD 3FRUB 2PR4H 5CZKA 1RZFH 5C0AE 4FFVD 4QYOB 1GGIH 2VDNL 1RMFH 1MLBB 3KPNB 4FXKB 1S5HA 4PRHA 4YZFE 1K5NB 2NR6C 4G6ML 3SGEI 2BSSA 4F57H 3H7BB 3PWPA 4JKWA 3BPCB 4DGIL 3GHBH 5LBSL 1FRGH 1QBML 1X9QA 1AFVH 1YDPA 3GSNA 5AEAA 1DR9A 5E2UL 1KT2A 1SBBA 1OSZA 4GSDL 1AQKL 43C9A 3QG7H 1MCJA 1KCSL 1MRCL 4NT6B 4G42A 5F7EL 3MRMB 4HJJH 3FO2A 1R5VA 4ZXBA 4H0IA 4M1DL 3QUMB 3QDGE 3GO1L 4X7DC 2Z8RA 5DVLA 3T8XA 5CEYB 5CUSH 5CIPA 1Z3GL 2DQDL 3U2SA 3VFMA 5J1TC 5JLZB 5D1QD 3GSRB 4AENA 5E6IB 3GB7A 1CVSC 5CJQL 2AJZA 4O02H 4DN4L 1OGAD 2FB4L 4O2FB 4JFEA 1E4KA 3SGDI 1FLTX 4LCWE 2J6EL 3BFOA 4JRYB 4Z7UB 5HDBE 5E9DD 1S7TA 3MODL 2YD1A 3LN5A 1MFDL 4KUZH 4LSRL 35C8L 4MA3A 3S36H 4PRHE 3B9KA 3EDDA 4XTRD 2I60H 4XVUD 3VWKB 4EQ2A 2EKSB 4F33A 3CK0H 1JYWA 1MCHA 4JHZA 3IF1B 4ZFFA 2Q76A 1E0OB 4YFEA 3JWDL 2WM0A 2IAMB 1S7XB 4HX1A 4JG1H 15C8H 1NMBH 4QXTA 1WTLA 4ZSOA 4GG6E 1L0YA 2L7JA 4NC1E 1JNNH 1B2WL 3I2CL 2BVPA 5GRXG 1RU9L 4TVPD 1U8JB 1T22B 5D7IF 2BSTB 4MJIB 4HWBH 4PLKC 1UM4H 3B9AA 1FBIH 4OUUB 1KJ2B 1WCBA 2B0SL 5EOCJ 5D7LD 2A6IB 2W0LA 3QXUA 1J0KA 3O45B 5ISZB 1IGJA 4JLRA 4TUOA 4HS8L 4LEXL 4YHOL 3WSQL 5FYJD 4BH8A 4WGWB 2DQTL 2Z9TA 3RWCB 2HKFL 4JZJA 1UQSB 3QG6B 1ZT1B 2LAGB 1CI5A 3P0VL 4LDLB 2XZAH 3ULVC 4FG6D 4RDQG 4KKAC 3DV6B 2CK0H 4MD5B 1XF1A 5JXEC 4QHNB 3V0VB 5CKGA 1J88A 4TNVF 3MLTA 2CLRB 3SKJL 2L7UA 3VGEA 2AEQH 1B0WA 3TT1H 4X0KA 2DM7A 1KIPA 5DMGD 3S5LG 2NLJA 2IG2H 3QUMH 3THML 4UB0H 2EZ0C 5I1DB 1WZKA 2V6HA 2KH2B 1WFTA 2GTZB 1X7QB 2BC4A 3C5JA 1M1SA 5LXGL 4YX2L 4G9DB 2EE6A 2GJZA 2DL9A 4NKIH 4OSUH 3PHOB 3MLWL 5DRXA 4YQXH 1CGTA 4H8WH 1BX2B 1BBDL 1HQ4B 2D7MA 3D48R 4N0CD 1LK3H 2PXYA 1IGFL 5MHSD 4J8RA 3VW3L 1Y6MR 4ZQKB 1SM3H 5H37H 2EH7H 4MD4B 4JQXA 1YMHB 3T4AB 4PLNC 1FZOA 2E9IA 3BYTA 4EDWL 2J12B 2CDEB 5IP4A 3GNMH 1WQVT 2V2XB 2NY4C 3H3PH 1T7YA 3V4VL 3MRLB 3T0EC 1HSAA 4A6YL 3V6FB 3QHFL 5E99H 3DOSA 1EERB 2IADA 1FSKB 4LAQL 1RURH 4YHIB 4XZUB 4N5EC 3ZHDA 3R0MA 1XCTB 5FA4B 4ZFGL 4GRLD 3GMMB 1D5IL 1K3ZA 2X4SB 3EJZD 3E6FA 4UBDD 1LP9A 4HCRH 4H1LB 2JK5A 3QFDA 3QT2A 1WBXB 4HDIA 3O8XD 5CBAA 1XGTA 4GXUM 1KJ2H 1OLZA 2IFFH 3OKLB 3U4AA 4TNWK 4IRJA 1MUJB 4GSDH 4BYHA 5IBUG 3M17A 2QSCL 4Y5YC 1G7IA 4EOWH 4DGYL 2MPAL 2VABB 1CGSL 3PNWA 1GGYA 4X6FA 4XP5L 3H9SB 2P7TB 4V1DB 4FTVB 4XH2B 5KSAC 1Z3GH 1NCBH 3VG9C 5A1AA 1KNOB 4MD0B 3KPRB 4XC3H 1UB5A 3BN3B 1DLHA 3VFPA 1IEHA 1RUMH 1S8DB 1G7LA 4U1HB 5I73C 1T0PB 3ET9F 1J1PL 1QRND 1RJLA 2FB4H 2NY2B 3IJSA 4LLYB 3ZTJH 3TESA 4XPBH 4HG4K 5IF0B 2Z4QA 3QEQB 3KXFB 5B38A 5C0FB 1EHLL 3QCUH 3N50A 1SVCP 5C0IA 2ZJSL 4YPGA 2DDQH 4A6YB 3ETBF 5IR1B 1ZHKA 5BS0D 3SDXB 1P7QD 4CDHA 1LP9E 1KEGL 2NY7H 3MV11 4XVJH 5E7BA 4B7IA 1N5AB 4NN5C 5ETUB 1B2WH 3BIKA 4NBXB 2A9NL 3A6BH 4LLMB 1M7XA 1OPGL 1PZ5A 4ZUUA 1A21A 3VFOB 1JPFB 3RKPA 2B0SH 3FN0L 1TCRA 4JFQA 5I8KL 4IJ3B 3VFSA 2E7HA 3F5WA 2YD6A 4GH7B 4LCCB 4PJ8D 5F1NA 3L3GB 2NY3B 2A83B 3LKQA 2JE8A 1NLBL 2VR9A 4KMQA 2R29L 4CVZA 4H1LH 4HF5L 4YBLC 3P0VH 3BVNB 4I0CC 1X5AA 3MLSL 4ELMF 1LNUA 1WF5A 2C9AA 3O2DL 3DX8A 3V5HB 3ZYZA 3VXOB 2IFGA 2V7HA 3V5DB 3C60D 2EC9T 4HH9A 2YRPA 1AGCA 4GJTB 3F7YA 3BQUA 3QDGD 2P5WB 4U7SA 1YEJL 2BNUA 4M4PA 2QR0B 5JA8B 5C09D 3EOAB 4JFXB 5KVGL 1A5FL 3BIAX 5TGBB 4LSTL 1GOHA 1U8QA 1WFUA 1ACYL 3NPSB 1T3FA 1MY7A 2YD4A 1K4CA 3KPLB 1U91A 5GXBB 3FB6B 2EIDA 4PJHE 5EU4B 4KDVA 5D6DC 1MCRA 3KNBB 2VTFA 1IGYA 4OGZA 4TUJA 3EYVB 3MRRB 2YA2A 3GMRB 4LQFH 3LEXA 5K93A 5F7HA 1INEH 4ZOEA 3PV6B 2VXSL 4R6UA 5J11C 2BVTA 1A14L 2C4XA 1BQHB 3W9DA 4X6BB 3T2OA 4LKXB 3SEPA 2HT2D 4ZDHB 4OGXH 3RY6C 2XIDA 3TIEB 4ZPTA 1F45A 5EC2A 3AREA 3NZHH 1FG2A 5IK3B 4F2MA 3QQ9D 4I18B 3S34L 1HHJB 2QQLL 2FATL 2ICWI 3QH3B 5HTSA 5HD8C 1XCQB 1XF2A 1CICA 1NEZB 2NQCA 2HWZL 1G7MB 3O11A 1FH5L 2LU3A 3T0BA 4Y8DC 1ZAGA 2EH8L 3AXLB 2Z35B 2LTQB 1I9RH 5J8OA 4ZUSB 3ZT7A 2ESVA 5MP6H 3QFJB 1K8IA 4QWWC 1ZOXA 1F5WA 4NNXA 2QQQA 4IRZH 4R7DB 5C2BL 4AEIL 3VFRB 1J86A 1U92A 1AIFB 4JG0H 4Z7NF 5L8LB 4KGLA 1NCWH 5L7XH 1MJUL 1ZA6B 2H3NB 1LK2A 4IOIB 1EEZA 3NCYP 4KK5C 2DJ4A 4XP5H 1HWHB 4U3CA 3VRIB 3GSWB 2MCPH 2PYEA 3HG1A 2XZZA 1FL3B 3DURA 1PBYA 4NQDE 4E41E 5BRZD 2V17H 3KHOA 3QUZB 1A1NB 3PJSA 2FD6H 5CFHA 3DNKA 3L3IA 5DXWA 4PJ9C 5IIEA 3C2AL 1KB9K 2GK2A 4PTUB 5GGTH 1VFAB 1MIML 4NRZA 4QXUH 5D2LE 2DB8A 1EHLH 2OTWA 2BOCA 1EEYB 4JHWH 2ZJSH 3MV7D 5CJXA 4G43A 3Q6FA 1CXIA 4QOKE 5ENWA 3U36A 1ADQL 1JGVL 1N59B 3RZCB 2NPLX 4MGXA 3G04A 4PGEB 4J3SA 1H15A 4XMPH 3IYLW 5HHQB 1EO7A 2Z31A 3U0WL 1J8HA 1WC7A 4WWKA 2ESVE 4RISL 4O51A 4Q6YA 4ODWA 3O3DA 4OQTL 3RA7L 4FFZL 4MA7L 2ZPKL 1OPGH 2HMID 1V5JA 5TDPA 4WW1A 2WQRA 4HFWB 4PG9B 4Z0XB 4JRXA 5JPNB 1ZS8A 3FZUD 1YEFH 4KHXL 4M43H 1OB1A 4G8FB 4PJIE 3MRKA 2CXGA 2H9GA 1IM9B 2B2XL 5IT2L 1MQ8A 1RZGB 2PYEE 3TO2A 5F6HI 2I9LA 32C2B 1C16A 4QTIH 1KENH 4FNLL 5L9DH 2OTPA 4YDVA 1NH6A 5FOBA 3R0NA 4J3XA 5I2IB 1NLBH 1G7PA 1RVFL 1LEGA 3PDOB 2UZXB 3MV9B 4HF5H 3CGTA 3ZE2E 5C07D 2FIKA 3ARBA 2PO6D 2EXYD 3AY4C 4HWZB 4PJDE 4NKOB 5D7IB 3QRGL 3VDCA 4I8DA 1Z5LB 4LMQE 4N0FA 4PJEE 2BCKA 2P45B 1U8OB 1GH7A 2CIKA 5DC9B 4Z7QE 1K3IA 1CFBA 3STZA 4Y19B 4X80L 4HULB 5KN5A 3RY4A 4U1LB 5KVGH 1A5FH 1FLRL 5A40E 1J8HE 5FHBH 3MJ7B 4ODTH 1A6AA 2J8OA 4Z7WA 4C83A 5INCB 1NQBA 5BW7C 2VITB 5IV2B 4KROD 4Y89A 4HV8A 4I13B 2D03H 2OP4L 2W1NA 4D8PB 2VLRB 1FE8L 3GUTB 3X12B 4P2OC 1UEYA 5AAWA 3QJHA 5FKPB 3WL9B 4N8VB 1YEIH 1EVUA 3DRTB 3MREB 4OD3H 4EJ1C 4XI5D 3TYGL 4PB9H 1MHEA 1U41A 3G6JE 3RKDD 2I27N 4P3CL 4J7RA 4JR9H 2QQLH 2YR3A 1F6LL 3TBYB 5KVEL 2BERA 4LSSH 1NMAL 4MCYB 1MFBL 3QXDB 3BPLC 3D2UA 2OYPA 3RI5F 5ACZA 2HWZH 3NA9L 1U8KA 2GAZA 3CXDH 3PGDB 1UM6L 4H20L 2HLAB 3U1SH 4P2YA 1N6QL 3RVXC 3KYNA 3AGVA 2IANE 1B88A 1FVDB 3LHPH 2FZ3B 1CE6A 4WFGD 4LSPH 4P4KD 3RPIA 4GRMA 4QRSB 3K81A 5J9PB 1Y18B 2F19L 3QXTA 4S0TD 1CBVL 3E2HB 3ESVF 1R3JA 4CDGC 5F9OL 1WIUA 2FJFB 5DRNA 3OR7B 4RFOL 1QBLH 2AK4B 5DD5L 5JIHA 1FZKB 3K7UA 4X6CF 4MJ5B 3MJ8A 4F7EB 5DFVD 1T2JA 1BWWA 2C3XA 2EDNA 2ORBH 3T3PE 4HJ0C 4M1CC 2W0FA 2G5BA 3HC3L 1MIMH 1J1OH 1V7ML 5GS0C 1P4LB 4UTBH 1XF5B 5HHVH 5ILTH 1CYGA 4R4BA 5AWNL 3EW3B 3PHSA 2HJLA 5CINH 1PKOA 1ADQH 1JGVH 4P2RA 2O61B 4UQ3A 2VLLB 2XWTB 2EIZA 2WMPA 3V6BR 4UT6L 4ZUVA 2X4QA 2DTML 3EUUA 3PXHA 1TZGH 2X4TA 2J1KA 3HMXL 4MA7H 1CD1A 4LCIL 3JWDC 4Z0BL 2WIIA 3LKNA 4KJPD 4PUBH 2VDML 2HA1A 5BJTB 3KPMA 1R0AH 2RHEA 4MS8D 4LRNH 2X70B 5C0GB 1QA9A 1IARB 3C9NB 5DA4A 3L3JA 2ZCKL 3RWEA 4CU7A 5IHBA 3HFMH 1XGPB 1FSKC 5IG7A 1Z9LA 5E8DL 4QRQB 4WUUE 4Y4HC 3QDME 3VDAA 4AIOA 5IBLD 5I30L 3NH7L 4DAGL 5DMJB 4OM0H 2C1PA 3BRFA 1AGDB 4QXWA 3QRGH 3RQ3A 4PJGB 1JN6A 4PJ7A 5EO0B 2NY1D 1NDGA 4JGMA 2Q7YA 1P2CB 4H1LG 2AJVL 3RVTD 3RAJH 2Z92B 2I24N 1RZJC 2YUZA 4BA8A 5F9DC 4BM7A 3KLAA 1FLRH 3HRZB 5CZVL 5EA0H 3VJ6A 3PF2A 1KTDA 4PRAB 5GZOD 3SDCD 1RZKL 2P8PA 3WFBL 3RIFF 4Z78A 4HK0B 5LCVH 1AKJB 2X4NA 2OP4H 3V0WH 4ELMB 4MDJA 1WCQA 3EYSL 4OF8A 3UTZB 1TJIL 3VMOA 2FGWL 4X8XA 3UTQA 3T0EA 4KRPD 1WITA 3MRBB 4QOKD 2NY2C 5T3XD 3V52L 3N06B 4OCYH 3RVUC 2QADB 4HKBA 2Q3ZA 3KLHC 1RJZA 4YNYB 4NNPH 1QFWL 1ZKAA 3R06B 3ULVE 2DLTA 3KPOB 4LHJB 1I8KB 4U1IB 4OCWL 5DK0A 1MFBH 4M5ZH 5F88B 3OKKB 1WBZB 3MNZB 3P73B 1UM6H 4HHAA 1N3NA 4PJ7E 3STBA 2WZPD 1P84J 1FFPA 1H5BB 4WU7A 1G0XA 3TPUB 3BWAB 4R90L 5BOZG 1J1XL 4IIQB 3D85D 3LKOA 4O00A 4NHCH 3MYJA 4LHUB 3OJDA 5HHPA 3UBXA 1YN6A 4FFYH 4Y5YA 4X9FA 5FDWA 2X5PA 1S7UB 3DX7B 4U1JB 1O7VA 2X9WA 5F7DB 4PP2B 5BZDB 1BZ7B 5ITBH 1VKXA 2X9YA 4PJBA 3FB7B 3KPQB 2XTJB 3KWWB 3MRHB 3Q3GA 1JWSB 2DWEA 5I0ZA 3LIZL 1E28B 1KF9B 2R0ZL 4Y16D 4X83A 3UTTB 4S1SL 3T0EE 2AV1A 1CG9B 3ZTNH 3QZWA 2AV7A 4FQPA 1NANI 3HZYB 3NCEB 1JWUB 1KCVL 4J4PC 4QHKJ 4PRBB 3HC3H 1ZGLB 4LFHD 2H26A 3DMMC 3MUZ1 5DMKB 4ORGA 4PB0L 4RAUB 4LPXA 4KKBC 5KZCD 2XWBB 1ORQA 2HFEA 4ONGL 1K6QH 5AWNH 1ZEAH 1FL6B 3CFEB 4LSUH 3ARDD 3EGSA 1P6FA 4YXKL 5GGUB 1HSBB 4UIKH 3E1F1 3FQUA 2A74B 4XXCC 4OV5B 3NPSC 3PGCB 4UNVA 1T1ZB 5F7KC 2AI0H 5DJ8B 4K9EL 1LMKA 3KHQA 2KL6A 4HGKC 3N1MC 4RMVA 3VRJA 1KC5H 2Y25A 3MRDA 5IB1B 1I3UA 1IEBA 3OGCB 3O6FD 1CDCA 3GGWA 1HH6A 1OAKL 1N5YL 3MOAH 2X09A 1IAOA 4NO0A 2VDMH 3LSOA 3PHQA 1YY8A 4AEHH 3B83A 1RHFA 1GGCH 3WFCH 3EYQC 1J11A 3GI9L 4M5YL 1BQHG 4KK9D 5DJCB 3OJMB 3WNNA 2VL5A 1TTGA 1CGYA 3DXAB 4F7TB 3LV3B 1A3RL 3D5OF 4OCMC 1YYMH 2CKBB 4WFHD 4X7TA 1NC4A 5CILH 3IJYA 2X7LB 4DTGH 4BSWA 4DZ8A 1F4XH 5DJZB 5FDYA 2N4IA 1NEZG 1A6PA 1BQLL 1T1YB 1YN7B 1EAPB 2DJSA 1TVBA 1XR9A 1CD9B 3DIFB 2Z8SA 5J6GB 1YPZF 1NCCL 3UC0H 3MNVB 5DHYB 4K8RD 1SEQH 4BUHA 3F7VA 3WV0A 1IQWH 1U6AH 2AJ3B 3ZMRA 3JUYA 4N5UA 2BSRA 5D6DA 2HYMA 3HLAB 4GRLA 3QNXA 4O9HL 4NGHL 3O81A 5GJSL 1E4WL 1Z0NA 1D7FA 3GMNA 3MLYH 4XPFL 1W0YT 1KELL 2HVJB 4KPHL 3QR2A 4NO2B 2EDJA 1B4JL 1EEUA 2E6JA 4R8WH 3QUZC 1G7QB 3BP4B 2H8PB 5E94B 3RTQB 5IB5A 3IAGC 1UFUA 2P4AB 1OARH 4PV8B 3QHZH 5F7LB 4WW2F 2FGWH 4JPKL 1WLHA 3RY6A 2O5ZL 2KZWA 1B90A 1UXWA 4DZBA 4QHLB 1VGKA 4NNYB 2B8OT 1BGXL 4ONOA 2Q7NA 1KPVA 2QSQA 4NO5A 2VDQL 2MQ0A 1ZLSH 3IVKB 5JIKA 1VDGA 2YSSA 4PGBA 2NX5A 2YK1H 3DGGB 4FQQB 1GPOL 4AL8H 3HC0B 1PY4A 1MIEL 5K9KA 2R15A 2WBJB 5C08A 5HI4D 4X9GA 3F12B 3UTOA 1DFBH 5I15L 1G1YA 2E9BA 1AD9B 5EG6C 4DOHE 4HEME 1JL8A 4XAWH 3KLSA 4K3GA 2QHRL 1RZ8B 4Y2OA 2CKNA 2R69L 4I3RH 4P23C 2VQ1B 2CSPA 3DPBA 3ZO0A 5I16B 2Q86B 5CGMA 1G6RA 3MJ6A 4PIRF 1JUFA 1B0GA 2ZUXA 4M1GH 3PE9A 3QDMD 2VLKA 1UADC 4PJ5B 5CBEB 4XAKE 4OF5A 4HJGA 1IGTA 1P7QA 5ID1B 5DK2A 2CKBH 4NC0B 2ZOLB 3FO1B 4OD1L 4OZIE 4NQSB 1LGVA 3FONA 4YDJA 4PJ9A 3RUGF 1UJ3A 25C8L 3WIHA 2NY0D 2K9UA 4Y4FB 4R0LC 3MMEA 3SO3B 1IC7L 4L4JA 4EXKA 1KCVH 3SO5A 5IB3B 4WHTB 5H35B 3BGMB 3FT4A 2YUWA 4H0GA 2WK2A 1CLZL 3O9WC 4X9IA 3CDGB 2NX5E 4JFHE 4ONGH 4YO0A 3WO4C 2V2TA 4PLJC 3RWHA 3QA3B 3ZL4H 4PJ8A 2X4PA 1U95B 1ZHLB 2DQIL 1NCNA 3MLXL 4KI5D 1JGDB 1K8DB 4YXKH 1FN4A 3PUCA 2I9TA 1FNGA 4U6VL 3SY0B 3RX8A 1YEGL 1N7ML 4MJ2A 1VB9A 1NAKL 4KKLD 2OK0L 3Q5YA 1NDMA 5J7CC 2FLRT 4DEPC 3HE6C 4UU9A 3TLRA 1DUZB 3PDDA 3QQ3A 3C60A 1OAKH 3BZDA 4YPJA 5FB8A 2DM4A 5HHXL 2BNQA 4Z7VB 4JM4L 5EU3B 1YEKH 1T0NA 1MCDA 4QHUB 4YLQT 2VLKE 5EC1A 5DLML 4M6NH 4G7YL 4MX7A 5DJDA 1OTSD 3C5SA 3MZGB 4N8VG 5HHOB 5IM7A 4H26B 4HIHA 3DSNA 1KTKE 4YAQA 4ZAKC 5FF6B 3IKCB 3L9RB 1MFEH 4PJCE 3ZZ1A 5D8JH 4WV1B 4GAFB 4TRPL 1K5NA 3GSQB 3NIGF 1HI6B 4HUUA 5HYSB 1E6OL 5HPOA 3VRLE 3LKRB 2PW2B 4DVRL 3AUVA 3U7WL 1UB6B 2BY2A 3CUPA 3UXFA 4NWTH 2AXFB 3PWLB 3C6LD 4OM1H 1NCCH 4O2CA 3WNMA 3UTSB 3L95A 1QNZL 4NT6A 3MRMA 5FO7B 5HGBB 2F74B 5J56B 2ICWB 1LVEA 4X7CC 1EGJA 2WINB 3G5XA 1DL7H 3T4YB 5BW7A 1MFCL 2W0KA 1SYSB 4O9HH 4NUGL 3MV8B 5CEYA 5I1KH 3RX5A 4P2OA 5L8JB 1AGBB 1E4WH 1FYTB 4N1HB 4KJYA 1KELH 3I84A 1HDMB 4KPHH 2ADJB 3BDBA 1R24B 1UZ8B 5HPMB 4KWUA 3GSRA 1DVFC 1C5DB 2BNRB 2ZKHH 3LH2L 2YOCA 2JIXA 4O2FA 4JGUA 4JN2B 4JPKH 3W82A 2YPLB 1CK0H 2O5ZH 1XZ0B 3L6FA 4NO3B 5GRZA 3T0VA 2WUCH 3RNQA 1C7TA 1D5XB 3OPZL 2KKQA 1CXEA 2PCPA 2ZCLH 3G5VB 4HKZA 4H5SA 3MC0A 1MJJA 1P69B 1HZHH 3RDTB 2DLHA 1A7QL 2OI9C 3HS0A 3K74B 1DTUA 1U8IA 5E5RB 1S9KC 2X10A 3JV6A 3IAQA 4Q2ZA 5J4MA 4UV7H 2Q20A 4FQCH 3TVMC 4U1NA 3D9AL 2ITDB 4U1SB 1GGBH 2XTLA 3D69A 2QHRH 1LDPH 1IC5L 4R4FL 3O3UN 1WZ1L 4WFFD 3E6HB 4EN3C 3KYKL 3MV7A 5DTFA 1TPXB 2Y06L 1S9WB 3GSXB 1ULVA 4XCNA 2P46B 4LHQB 4PP1D 1ZT4B 4WY7H 3DVNA 5JDJA 4LPVA 4GRWH 5EIIA 1RIUL 3BJLA 3WFEL 4J3UA 3TA3B 1X4YA 4I0KA 4CVXA 2VXTL 5BQ7A 5BVJB 3K8MA 4XP4L 4QO1A 1Q8MA 4KKCD 1IMHC 3FQTB 5DD1H 5F1IB 2IH3B 3ZKMD 4JRYE 4Z7UE 1EFXD 1CR9H 3D39B 2EC9U 1IC7H 3MRQB 1U8NB 4XRCB 1T7XA 2KBGA 3W11C 2Y36L 2OL3L 3W0WB 3KJ6L 5JIIA 4F7CB 2NNAA 2J6EA 4RBPK 2IPKB 3BP6A 5DHVB 2OZ4A 3RU8L 3QEUA 3O3BA 5F3HA 1A6TA 1S7RA 4X99B 5I1GH 4PREA 1LILA 3CMOL 2DQCH 5IVNA 1CFSA 5FYLH 2AGJL 3U9UA 3T0DA 4U0RB 4YXHH 1J05A 1FFRA 2RCSH 1JF1A 3SHSA 5D70H 3T4AA 3FB5B 4KZEH 1CGWA 1P7KB 3VCLA 1L9NA 3HE7B 5DJAB 5ISZE 3NGBB 3K1DA 4HPYL 4F3FB 2X05A 3UO1H 3F6IA 4GKNB 4MXQC 3HNSH 2EDTA 4G8GA 4ODVL 2DI9A 2QADC 3MCKB 1PY9A 2VNCA 4Y4HA 2R0LH 1CU4H 3ZYJA 2ZP0T 2ZUQB 3WD5H 5HYJB 2IPUK 1QFUH 4KRLB 4TRPH 3X3FL 1I7ZA 4OLEA 1E6OH 4P9HC 2QTEA 1ERNA 4LL9A 4AM0A 3GJEA 3BN9D 4UDTA 1H5BC 2X4OA 2VISA 2W38A 2XNAA 3MRPB 1I3GH 3L3KB 2UVFA 3PP3K 1FZMA 4JFFA 1S9XB 4Q0XL 1D3CA 1MUJA 4Q58C 5SWSA 3K4ZA 4QEGA 1MVFA 1TZIA 4QLRA 1J0IA 4W70A 2OL3B 1FJ1A 5E2TH 2VLME 4LHUG 5F8RC 1WWCA 2NW3B 5I1LA 4DVBB 1UEMA 1IBGH 3BPNC 5CLTA 4ZS6D 1KYOJ 3OKOA 1AY1L 3GMPA 3MLVL 2OMNA 3MA9L 4BQ9A 2XTJC 1CE1H 2P49B 3F58L 3BISA 4EI5D 1KB5L 1XR8A 4MYWB 3EHBD 3HZKA 1LO0L 1RZKC 2Z8VC 5CD5C 3HI1A 1BF8A 1F58L 3B6SA 5TE6L 4TPRH 5C0BB 3GSUB 4KV5F 1A6VL 4P2QB 3TH2T 2EDDA 3B2VH 3VXSD 1V3JA 1YPZB 2R23B 4G8GE 3ECBB 4YHKH 5DHVH 1CXFA 4AT6A 1KPUB 3M45A 1BOGA 2VLJA 1CIUA 1OP9A 3TJEL 4L3ED 4A6YA 4ORZC 5GRJH 4ALAL 1SJHB 3BE1H 4NQCB 1DUYB 4D9QE 5ICYB 5T1MB 1AXSB 2E9WA 3WFDL 2LVCA 3W5NA 4M48L 3TEUA 1W72A 1FP5A 3ARFD 5CSZA 5MENA 1GVIA 2L0DA 4CU6A 4I3GA 4GLRI 3PWJA 5SWSE 4QHKI 4WW2B 3WLWD 2NZ9C 2YXFA 4LLUB 4BZYA 3CSYB 3O4LB 1WZ1H 5J12C 4FQXB 1CLOH 5CSBA 1W2KT 1VFMA 3QHTC 3KYKH 5TF1H 3D0LB 1N8ZA 3H9SE 4D0DB 4ELKB 4V1DE 4FTVE 4FS0A 5C71A 2EIBA 3W9EB 2VH5L 3RNKA 3G6DH 1KCLA 3KPRE 3PQYB 5ADOH 2A83A 5HHMB 3LD8B 3WKML 2JELH 4HWEL 2XPGB 4OZ4A 4PJAB 1NCAL 2E7MA 4M7JL 4NHUB 1FAIL 1T2XA 2R1YA 3ROLA 3TT3L 5C6WH 5JIPA 2Q8AL 4J4PA 5D1ZB 1INDL 3RL1A 1O5DT 1NGYA 3DMMA 5IW6A 2XT1B 2VLJE 5I17B 2OL3H 2E8ZA 1A1MB 1I9JH 2OR8A 2RQ8A 3SDXE 1RULL 5CEXA 4L1DA 3RU8H 3IXTB 3OKEA 4HC1L 4XXCA 3NMEA 4JPIB 1Q9KB 4NFCA 3BEVB 5AZEH 2DKSA 4Z76A 3GK8L 3NACH 2A6DA 1MCIA 1MPAH 5HYQB 4NIKB 4F80A 3VXPB 4HIXH 3PL6B 2EYTB 4YIQB 3MA7A 4ONFL 2D31A 2EDWA 4Z9KB 4EZMA 3DVGA 4K9EC 1OM3L 5A2LH 5DF0A 1RUKH 4LKXA 2QEJA 2OTUB 2R4RH 1T2QL 3U0PB 4EQ3A 3LMJL 1JPST 2CDFB 2VDLL 3SDCA 3VGAB 2FL5B 3WJJC 5GPRA 3AFLA 2IWGA 4MDIA 3IFOA 2OCFD 1G0DA 4MQXC 5JNYB 4JRWA 2J88H 1N0XH 1XIWB 3MCLL 3S9DB 2VZVA 1KJVB 5FOJA 5HVGB 5FUCC 4GMTH 5EOCH 1YUHB 2R39A 3HI6L 2XFXA 4Q9RL 1OF2A 3O2DA 2P5WE 2E9JA 4Q0XH 1E4XI 4R7DA 1RUAH 3VFRA 1BMGA 4LARL 3EO1A 1F13A 4N8CL 3UJJH 4LGPB 5E6ID 3L7EA 3FJTA 4PR5A 5HJ3B 1D5MA 5H94B 3ULUF 5E2JA 4JRYD 4Q9QL 1JZ8A 1X5ZA 3AMKA 3UYRL 1OAQL 3MRJA 5LGHL 4D0CA 1KCKA 4WU5B 1F11B 4O4YL 4R9HA 2C7UB 1HHHA 3GKWL 4OZGA 4EIGB 5DA0B 3G6AB 2N7AA 2V5MA 3KS0J 3IDXL 4RAHA 2PTTA 3VWKD 4BJLA 5J3HC 4F7MA 2R2CA 2C3VA 2IAMD 3D3VA 3L3OB 5T33L 1IGIL 4M3KB 2YPKA 4PRPD 4ZOBA 3TJEH 4NOBA 4NPYB 4WGVB 4ALAH 1V7NH 4GKZB 4MJID 3TFKD 4FXGB 3MGTA 4WTZG 4XP1H 4Q9CA 3HUJA 3NFSL 5AG9A 2DJUA 4PGDA 3FRPG 1BVZA 3VFGL 3C08L 3N9GL 5ISZD 3QQ4B 1UZ6E 3MOBL 2NXYD 4P23A 2VZTA 3GIVA 5EZIL 1NGWB 5D1XC 2FIRT 4Z0XA 3TV3H 3DETD 1K2DB 1XGYH 4WEMB 3ZE1F 2G60H 2J8UF 2CR3A 4BSVA 4KGJA 4NM4H 2VDOL 3AS2A 1QPPA 2VH5H 3MRIA 3TCLA 5L2JB 3NCJL 4JHAL 2UZIL 4YBQC 4ZUTA 4G8IB 5EZLB 4K7PY 5MEQB 4R0LA 1J7VR 1KFAH 5D7IA 4K7PL 3MUGB 2HN7A 2AJSL 3D3VE 4TSAL 4WRLA 5JO5B 4K2UL 5HYSG 1DQLL 1X5XA 4UV4L 5EUOF 1MI5A 2VLMD 1PG7H 4Y4KB 1ZLUK 5E4IA 3MYZA 3O9WA 4KAQL 3ARGC 3ZE0F 3LN9A 4Y19A 5GSVA 1SY6L 4EUPB 4G3YH 4K3HA 1RULH 3PP4L 4XWOD 4LNRB 4KQ4H 5A2IH 2GTWB 1KEML 3PWUB 3STLB 4X4ME 3SQOL 1IKNC 2AVGA 4P5TC 4V2BA 3HE6A 5J1AA 4TUKH 1XH3A 3FQWA 5DUPL 5DMIL 5DUBB 5C0AB 1AD0B 2PYFB 3WO3B 3GUTA 2EKJA 4M8QB 4XPAH 1EEQA 1C5CL 4C55A 5I8EA 4KXZH 2X2YA 5TDNA 2HRPL 3VA2C 4L8DA 4WEBH 3MACL 1C08B 1TETH 1KN4L 2WNGA 4XNXH 1P84K 4HQQH 1EO5A 4ZAKA 4L9DA 4BSJA 3X11A 5A16B 4U7MA 2VDLH 2MKLC 3BDYH 4WI6A 4MCYA 2R4SH 4XNUL 2DQGH 4I3SL 4BH7B 2QQNH 5D7IE 3EO0B 3IKKA 4IDLA 2NXZC 3BW9B 4HUVB 5C0ND 2HLAA 5C0DB 1NANH 4IOSD 3O2VH 4WNQA 1QEWB 4KQ3L 5IFAH 1JF5A 4M9PA 5L6YH 2YD9A 2OJEA 4JO4H 4Y19E 1HH9B 3NTCH 1KCRL 3TBVA 3BUYB 4L4TB 4YC2B 2OS7A 4EBQH 1WAAF 1DE4B 4FTVD 4YXLH 4LAJH 5C8JB 3KPSA 5J9PA 4P57B 4Y5XA 4N8CH 3WFHB 2P5EB 4LCWB 4ZO8A 4XMKL 2D7QA 5F7MC 1QSZA 2VLRE 2A6JA 3W5MA 2LV4A 3QEQD 3CDCA 3KXFD 4S2SA 4XBEL 3KYMA 3V5KA 1S5HB 4PRHB 3SDDC 4I48A 5B21A 4HXAH 5LGHH 1DVFA 1DLFL 1NC2A 3GKWH 5JXAL 3PWPB 4NRYA 2XQBH 3PGFL 3IDXH 2DMBA 3SKNA 4ZTPH 3FO0L 1OAXL 1YDPB 3GSNB 3EDKA 1KT2B 2VE6A 5T1DH 1T66D 1IZJA 3MCG1 1OSZB 2Y07L 2DQUL 4DK6A 2VDKL 3FOLA 5DWUL 4RRPG 3G08A 3QI9D 1T7WA 5KW9L 4KTEL 1S7SA 3FO2B 1R5VB 4ZXBB 4OGAC 3QISA 2VXUH 3DSFH 4TOYL 5AYUH 5HI3D 1VPOL 1ROWA 2NTFA 1MWAL 4RIRA 3HMWL 4OF3A 5A3IC 4LSQL 4N0RA 5AD0A 3IU4L 3CU7A 3T8XB 2BHUA 4RBPH 3E3QE 5GZND 4K3JH 5CIPB 3TVMA 1BEYH 2EDHA 1IT9L 3C08H 3VFMB 3U2SB 5IGXH 1BQSA 3WDHA 4TN9A 2ZG1A 3MZTA 3KPSE 4NN7B 4AENB 1RIHL 3GB7B 1I1AC 1YA5A 1OLLA 5JQ6L 5EFIA 1FIGH 2NY3D 2AJZB 5DO2C 4EN3A 2EXWC 3BO8A 4JFEB 3ZKXB 1MREL 2VN4A 5IQ9A 3NGBC 4ZD3L 1T89C 3QPQD 3UBXI 3OF6D 1H3VA 1S7TB 1S9VA 2AK4E 1YECH 2RIKA 5TFSH 5C0GA 3LN5B 4DUXA 4FZEL 4K23L 5CJOH 3BGFB 4MA3B 2D9CA 3B9KB 2JJUA 3SJVD 1RSFA 3SKMA 4NN6C 5GISL 4NM8L 4F33B 2EIEA 1G9MH 2E7CA 4OLUL 4ZFFB 4JANA 2P5WD 1QP1A 2Q76B 2ZUQC 3SDAD 3L5XL 4QXTB 4ZSOB 1W0WA 3BEWA 2E7LC 1AGDA 5D93C 2BVPB 4K7PH 2AJSH 4UV4H 1MCWM 1R3LA 4EDXA 1IM3A 1MNUH 1TENA 4KKNA 3QO0A 1RHHA 1W8OA 1SY6H 1WCBB 4RCAA 1EIBA 4MNQA 4OKVA 4UT7H 1IGJB 4JLRB 4TUOB 3PP3H 2V9TA 4I77L 4AJ0A 1IC4L 4G8EA 4BH8B 2YC1B 4HK0A 2E8YA 3HC4L 4HFUL 2D0GA 1YJDL 4Z7WF 1S5IL 4JZJB 4PGJA 9CGTA 4K94L 4Y1AA 4PTTA 5DMIH 5DGQA 1MHPH 3I6GB 3TZVC 3UZQA 1NGQL 1C5CH 1S7VA 3GSNH 1Q72L 3CPLA 3HMXA 1GJIA 1MFNA 3MLTB 4CL7A 4D9LL 2YZ8A 4ZPVA 5HDQL 3BKCH 4P3DA 4X0KB 1KIPB 2CRIA 2R1XA 2NLJB 3ULUL 4JVWA 3EOTH 3M07A 3N0PB 2B1AH 3QFJD 3UJIL 1D9KC 2BC4B 4U1IA 5CIPH 1A7RH 2GJZB 4NQUA 5F88A 3UZEA 4I3SH 4KFZC 5FCSH 2X1QA 1AR1C 5DRXB 4M6OL 4PJGE 2XWJA 5ESVA 3MBXL 4OT1L 2PXYB 1NLDL 4J8RB 3NFNA 2NYYC 3P9MA 2ZCHL 4XCEB 1CTOA 4P4RA 1FZOB 1KCRH 2XKNA 3IRZA 4YUEH 5C0EA 5DMYA 2FH6A 4QT5A 4HGMA 4KVNL 4WW2C 5E6YA 5IFHH