2C3HA

Structure of cbm26 from bacillus halodurans amylase in complex with maltose
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
SGLTIYFKKPDSWGTPHLYYYDTNPKVDEPTWSEAPEMEHYEGDWYTHTIEGVESVRLLFKDRGTNQWPGPGEPGFFRDQDGWFDGEWHVDRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-AMYLASE G-6
publication title A Structural and Functional Analysis of Alpha-Glucan Recognition by Family 25 and 26 Carbohydrate-Binding Modules Reveals a Conserved Mode of Starch Recognition
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Carbohydrate-binding module
total genus 14
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16738 CBM26 Starch-binding module 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c3hA00
2BVTA 1M7IA 5GS0C 4UV4H 2AJVL 5FB8B 5IFHL 1KPRB 2Y4SA 4MA8L 1LGVA 3PNWA 4JO2L 2HP4A 3AMLA 2FX9L 5CJQL 1IAII 1W0WB 2CIKB 1PKQB 4Z0BL 4NUJA 1IL1B 4Z7NF 5FUOL 4XPBL 4L8SA 3U7YL 1C1EL 1K3ZA 1R5IB 4QRPA 3PF2A 1N0XH 1UWGL 4Y2DC 5LXGH 3TA3C 3QEUB 5DDHB 1YY8A 3K8MA 2YPVL 4G6KL 5HTSA 3LKQA 5FGCE 1PGRB 5BV7C 1ZSDB 2FWOB 4GW5B 1MHCB 3SDCB 3THML 1ZT7A 1G7IA 3FB7B 4LPTA 4LDOB 2XYCA 3RVXD 1GGIL 4PG9B 2FO1A 2ADFH 3KYKH 2DMBA 2CDEB 1JGVH 1MCDA 2YK1L 4RGNC 5IKCB 3VXNA 1NGZB 5C07E 4HJJH 1K2DB 1WICA 2DLHA 4WO4B 1DBBL 1HHGA 2J8UA 3MREB 2B1AH 3SQBA 1LO4L 4TUJB 3S96B 5BMFL 3FTGB 4Z7NE 5T1MA 2APFA 4G8GB 4OM0L 4XP4H 3JTTA 3HCVA 5I1CH 2VRAA 4PJDE 3PABA 2CK2A 3Q2CA 4KDVA 1QSFE 4XP6L 2A83A 2R2HB 3WV0A 3LMJL 3RU8L 5SWZB 2IQAB 1BD2B 3LAFA 12E8L 4L3AA 4C54A 1OW0A 3OB0H 1BFSA 3E6HA 4P4KB 1T04A 2HH0L 3FO2A 5HHQA 1VA9A 3ETBF 4LCCB 3U46B 4PJAF 3REVA 4X6FB 1XGQB 3F12B 1QEWB 4RFEA 1ZGLP 2PNDA 1EPFA 1HQRA 2F54E 3RZCD 4KFZC 1KELL 4ONOA 3NCJL 1DN0B 1K4DB 5CHNB 4NJ9L 3HFML 4NQTA 1NDMB 3JWDC 3NCBB 2VR4A 5ESAB 1FVEB 4KVNL 4IDJL 2YPLA 3KJ4B 2WBJC 4BZYA 5IW6A 2GSGB 2I5YL 3MBEB 2EYTB 2VDNL 1I9RH 4XPHH 3ULVL 1DLHA 1P7KB 2ITDB 4YDJB 5DURB 4EDXB 4NWTH 3DGCR 3MGOA 5AZ2H 4B41A 2WP3T 4HMDA 3B6SA 1FC1A 3EO0A 1S7VA 1JN6B 2LE9A 3CX2A 5A2LH 1D5ZB 3S88L 4NM4L 3GKWL 3EKCA 3WO4B 3OGOE 2W9DH 2EXYD 3VFWB 1QHPA 1YEFH 1JHKH 2YC1B 3SKUD 2H45A 3OXRB 2Y72A 1NAMH 2EZ0D 4LSTH 3RVTC 5IV2B 4OKDA 3S4SG 3LRGA 3IFNL 2AJUH 1XF2A 2EDQA 2QHRL 4JKMA 2X1OA 1OF2A 4KK8D 4OCSH 3PWNA 4L3EB 4LGRB 3QPXL 3GRWH 4LKXA 4OZFH 1FL3B 1JNNH 5TDOB 2IQ9L 5I9QC 2BVOB 3DXAA 1MF2L 1VFBA 4R4ND 1N2RB 4KHXH 1YA5A 4I48B 1LK3L 4HGMA 1A1NB 2CD0A 3BVNB 1V7NH 4LMQE 4LPXA 3GM8A 2P1YA 3FO1A 1FFNB 1NQBA 3U1SH 1FYTE 4JDVB 2YD7A 4FOMA 3SCMA 3IJHB 3RTQC 2OR7A 4XMLH 1J87A 3X17A 5C0NC 3EOYG 4NSKB 1SVCP 3UJTH 1TXKA 3K3QA 3VW3L 3TYGL 3UBXB 1I4FB 3MV9D 1YEJH 1SMAA 4X0KB 1Z0MA 3BN9C 2CLVA 4HFUL 1MIEL 3VGAB 4NQDE 1X5HA 3P9LA 1ZGLB 4HF5H 4ZMAT 2HFFB 2H2PD 2R0ZL 2C1OB 3O0RL 3IU4L 3QIBD 1LO0H 4M62H 3OPZL 1VSCA 4M4PA 1CTNA 1KIQB 2P8PA 4WFFE 3O4LB 4MXVF 3EJYD 2IBZY 3MRIA 3BJ91 1RV6X 4B7IA 2UVFA 3RWFB 2H2SC 5B39G 4RGOL 2EC9T 3OAUL 4Y8DC 3HAEA 3NPSC 1X4XA 3NABH 3HR6A 1U36A 1YNKH 3ULUF 4JDZA 5D2LB 2IALB 5KSBA 4I3RH 4LRIA 4X6BB 3UTTA 1OAQL 3O3EA 3NCYP 2PCPB 1G0DA 1PJ9A 1WIUA 5KW9H 3JWNC 4KXZH 3RY6A 5IQ7L 3AC0A 5SX5K 1M6OB 2XN9D 1PG7L 2ERJC 2Q86A 4M7LH 5KVGH 4E41A 5CEZH 5D7LB 1G7PA 1F8TH 1A6WH 3QCVH 1JMZA 4KRMB 3FRUB 1A6VH 1JF6A 1R3JB 3Q1SH 4I3GA 4YLQT 5MP6L 4MXVE 1J05B 1A6TA 3L3JA 3AXLA 3E1F1 4CNIA 1DQTA 1HHKB 1XR9A 5CFHA 2LTQC 1DQMH 4OBSA 3L5HA 1OVZA 5I8CB 4Y4HD 5BJTA 1A3LH 2UUDH 4PY8I 3KJ6L 2DQDL 2FJGB 1IAIM 3F58L 5BXFA 4KRLB 5FGSA 3CD4A 3P73A 4PJGB 2ZNXA 4YX2H 3K4DA 3SGJC 3WXVH 4UQ3B 3H7LA 5EUOA 4OD1H 4JFOA 3O3AA 1QFOA 4LLWA 3MRRB 1BQUA 5F1NA 4RZCA 1IAOB 4Y2OA 3RWEB 3SJVE 4WEBL 3O6ML 3BRGC 1H15B 4MQXD 3RVXC 4Q9CA 1MPAL 2NX5E 5KTEH 1DEEA 5GGSB 3QQNA 1F6LL 4YAQA 1C5BL 2EH7H 3DVGB 4EN3A 2CRMA 2MTPA 4X7SL 3CH1B 3U4BH 5JLZA 4YDVB 4H20L 1JZ8A 1GYAA 3BDBA 3U9UA 2EEDA 3CK0L 2ADGB 1NC4D 2DKSA 2WWMD 2VH5L 1F4WH 4XNXH 1A7OL 2FB4H 4PGDB 4HDIB 4GKSA 1QFWH 4OZGF 5GRYA 2APWA 4MLIA 4O02L 4EJ1C 1CLZL 3HLAB 5M94B 4WI5A 1CLYH 3MJ9A 1NGYB 4UNVA 1CBVL 4M6MH 1RULH 4JAMB 3EAKA 4OUOA 3R06A 1GAFL 4R4FL 4G6AD 4DUXA 4YH6A 5DT1H 3QZWG 2YSSA 1H0DB 4Z7UA 3Q6FB 5BOPA 1S9YA 4GG6A 3RZCC 1IQWL 4G9FE 2FZ3B 4X9FA 5D7SL 4MDJB 3SO3C 1WWWX 3EFDL 2B4CL 1EGJL 3CFBB 4QRPE 2HVKB 3UPCA 1E4XH 3NN8A 4Y5XC 4JPKL 2I26N 3CVHL 4JHWL 4JY5L 2YR3A 3X13A 2VLRB 3RJDA 1MAML 3WHXB 4XH2B 4F58H 3QI9B 5IMMB 1X5LA 4G6ML 3PIQB 4DEPC 2W0FA 3MUZ1 5GRWA 4WU7A 5CJOL 3EYQD 2OYPA 3F5WA 1TQBC 5I1HH 3SDCD 4KKCD 2EXYC 4OQTA 4JN2B 4FMFA 1AHWB 5AYUH 1MCJA 4Q9RL 1UKTA 2EZ0C 4M61A 1BIIB 4HIJB 5DQJA 1NSNH 2J8UE 4KZDL 2XPGA 5EBWB 1LD9B 4N0FA 2MKLC 2VN7A 3BP6A 3FFCB 3RWCB 1CDGA 4Z7QF 1QBLL 1E27A 4MJ2A 1A4JA 1MQKL 1VKXB 2X10A 4WO4D 1RZFL 1X4YA 3H2WA 3MOQA 5CILL 5GJSL 3L3GA 5IGXH 1PFCA 3GBNH 1L7IL 2Y25A 5E2VH 5E8EB 4G8GD 4YIQA 1N6QH 4J4PC 3HE7B 1OAUL 4ELMA 3P4OA 5CJBA 4XPFL 2PYFB 4IOIB 5ANMB 5SWZD 4XNZC 5HHME 1LO3L 4PLJD 1BD2D 1ZWIB 4ZSOE 5CEXA 3DV6A 1XGUB 2R23A 5HGBB 1WGOA 4P4KD 3BW9A 4Y0GA 4CU7A 3V6ZB 4TUKL 1MRDH 3C08L 3SEPA 3UTPD 1Z9OA 3U4AA 3TNMA 2GTZA 1W72A 5E00A 3MUGA 5INDA 3CMOL 3TBVB 3WNPA 3KXFB 3MJGX 5HHNB 4N68A 4G7YL 4NCC2 4KUCD 4W6WB 4NDMB 4TTGA 1X5IA 1NCNA 2H2PC 3QIBC 4I3SL 4GUPA 3GMQA 4FZEH 1QP1A 3MBED 4HX1B 1WBZB 4GT7A 4PJIA 4PTUB 5DURD 3I75A 3UC0H 3H9HA 1MCIA 4XCFH 3HMXL 4PUBL 3NIDE 3U30B 5HHVH 1OY3B 5CIPB 3BGMB 1P6FA 3VFNA 4L8BA 4NZUH 4XBGA 1U8NB 3QXUA 3ARGA 4NKMA 5F3BB 4L4TE 1A21A 1S78D 3DIFA 4BZ2H 4FQIL 3CJJA 4K3JL 1TVBB 4P3DA 4ONHB 4NZDA 4L3ED 5DZNA 5I8EA 3T0DA 3O41B 5I73C 4J3XA 4Z77A 1B3JA 1TZGH 3RUGA 3V4PL 1HILB 1R3IL 1X5KA 3AROA 5ABDE 2YD6A 1KACB 1HHJB 3UEZA 5DEZA 1HOCA 2VABA 4NQVA 1NLDL 2ZCLH 3O4OC 3OAYK 2DQGL 3L3HA 4X7TB 1DQQA 1U8HB 3BP5A 1UC6A 3MXWL 4O2FB 5HVGB 1KLUA 2R9HC 2JJUA 2P7TA 2NW3A 3MLZH 2AJXH 4P2CG 4WHDA 5DWUL 4MDIB 1NAKL 1R5VA 3QUMH 5FGCB 2V5MA 3RNKB 5J1SC 5HVHC 3S4SB 2APBA 1U6AL 4ZPTB 1L0QA 5FO8B 3IS0X 1A6ZA 1J9CT 2X89D 4HWBH 4D3CL 5GGUA 5I15L 2YPKA 2ZUTA 1K4CB 2CQVA 4LLQA 1GIGL 4I0KA 4PBVC 3RPIB 1FVDA 3V9FA 5C07B 4M6AA 3M1BA 3CVIH 3NA9H 4GRLA 1KC5L 3EYOB 4H0IA 4R96A 1AGFA 1YC7A 3O4LD 4BH8A 3WFZA 3ZHKA 1IFHH 4L4VE 2HG5A 4MQXC 4WI9A 4F57H 4HBQA 2VAAA 2XZQH 1WIPA 3WKML 4RAUB 1U8MB 3QG7H 2R8SH 4PJDB 3ZKSD 1MCLA 1NMCB 3DTXA 3O2VH 3SDAB 4YGVB 3SGEH 3ABZA 5F1KC 4E41E 1MNUH 1VFOA 4IEFB 4FQ2H 2VSCA 4XPAL 1BBJB 2Q7YB 2WWMC 1Y6KR 1TPXB 1CTOA 1LHZA 4K3DL 2I60L 5GS1B 1D5BB 5I66B 4MCZB 5D7LD 3FHQA 2F54B 4UV4L 5FUCC 2HKHL 3FO9A 1IBGL 1P7QB 5AWNH 3B5HA 1FFPA 1R5WA 3MRKA 3K81A 3OG6B 4PJHA 5GPRA 1Z3GL 1IC1A 5D93C 3VI4F 1EO8L 3PJSB 5AAWA 1A2YB 3NCEB 1NMAH 4MSWB 3DMMB 4G6AC 3S5LA 2V7HB 1M4KA 4MAYB 4YGAB 4PRNA 4MA7L 1T1YA 5F8RC 4FFYH 1KNOA 5EUOE 1A0QH 2EDDA 4LHJB 1AXTH 1J18A 1PYWB 4XNYH 5JUEH 5IWLA 4YXHH 3X14A 4XVTH 1V7MH 1SJEB 2Z35A 4M7KL 5GGVL 1R3LB 3L5XH 4NWUH 3DYPA 5BCAA 1OWRM 4F2MB 2R2CA 3UTZB 3CFDA 1YDPB 1F58H 3MV8B 3EYQC 4ZXBB 3D39A 1WC7A 3BUYB 2IF7A 3HC4L 2COQA 4OLZL 1G6VK 4ZOEA 3SDCC 4KKCC 1I8MB 2VXTH 3MNWB 4M7LT 4OF3A 1T03H 4MD4B 3V0WH 4JG0L 5AG8A 1C5DA 1RUPH 3QPQD 4HAGA 5I18H 5DHYA 3WXWL 5DHVB 4JGJA 1FYTB 1G1YA 1NFIA 4RSVA 4WO4C 4J3SA 3VFTA 1JP5A 3P4MB 1GZQA 1GGTA 2PTUA 5FM5O 1FRGL 1JNLL 4QF1B 1M05B 4DGIH 3IFPB 4NFDA 1T7WA 3QUYC 2A9ML 1MCOL 2UZIL 5IP4A 3BEVB 3TZVB 4NN7B 4D0BA 3PHOA 5CINH 1RIUH 4HFWA 3EOBB 3G08A 5HI3C 4PLKC 4Z7UE 2WIIA 1IE5A 2E7CA 4GG6E 4P4KC 1NBVH 3TBTA 4UV7L 1QBBA 4EOWH 1MCNA 4LSPL 5A40E 1ZMYA 2J8OA 3QYCA 4WRLA 1FNEA 4QXGH 2WWKO 1CIUA 1DN2A 1S9WA 2I9TB 2Z92A 1CG9A 2OTPA 1RPQA 2V5RA 3MLUL 3TCLB 4X5XB 4EQ3A 4ONFL 3KJ4C 2NNAA 2VLRD 1EVTC 3RKPA 2J4WH 5HI5D 3QI9D 1GC1C 1T7XA 2BVPA 3AAZB 4Z8FL 2IJ0C 3FO0H 5JPNB 5KVDL 5E08H 5LBSH 3RIFK 1NCDH 4K23H 4J3WA 1M7XA 1X4ZA 3BKML 3QO0A 4JO3H 3WO4C 3SE4A 4AIZB 4TPRH 4U0QB 4JM4H 3PG2A 4X4YA 1S78C 2PW1B 1GGYA 3QZWB 1V7NL 3OR6B 4F7TB 1F00I 4BQCA 2EDXA 1NJ9B 1ADQL 3FFCD 5KN5A 3JV5A 1T0NA 3NACL 4I9WE 4XMLL 4ELME 1RK0B 2JTDA 3SGDI 2LAGB 1GH7A 1CXKA 4PG2A 4I0PB 2BVQA 2DQFA 5ESVA 2E6QA 2OK0H 5JQ6H 2V9RA 1E4KA 2FX8L 3HE7D 5KSVB 2R1XA 5ICZA 4HF5L 3QRGH 5I30L 2W59A 2J6EA 3K2UH 1YEDB 4NZTL 3RWHA 2GJZA 3AB0B 4R9HA 1JPFB 5BZWB 3VMNA 1RJYA 5MEPB 3SJVB 1JGLH 1YN7B 4M8QB 1OP3K 1CFVL 4ZFOB 1NFDA 1BQHG 3REWA 3VGAC 3KXFD 4PJ9B 3QG6B 3RNQB 4U1JA 3OSKA 2R0WL 3GJFB 3X3GL 1U8QA 5TPWH 3GMRA 4PV8B 5IUSA 4CN6A 1QFPA 4LF3B 1OHQA 5HYJA 4P0DA 2GAZA 4PBXA 4M43L 5HYSG 1KENH 4E9LA 4N0YH 5DEFB 5DZOA 4QNPF 1E4WL 4IRZH 4Y8AA 1BM3L 4QYOA 2FL5A 4X99B 3GSNB 2XKUA 3RIAK 3S34H 4MQTB 3D6GA 1FO0A 3V79C 5KVGL 4JPWL 1CFSA 2D9QB 3MLSH 5JW3H 2HLFD 1T21A 1JGDA 3JVGA 1RZJL 3IFOB 3MNVB 4ZO9A 1CI5A 3GSRB 3K1KC 4A6YA 2DQIH 3C5JB 5I6XB 5DK2B 5DD0L 1QLEH 2F19H 3MRGA 4M6OL 1MRFL 5TF1H 1JBJA 2Q6WA 2JJVA 2BNRE 3P40A 4PJFF 2Y07H 4G9FB 1QBMH 2AP2A 3NMEA 4L8SB 2JELL 3D69A 4QRPB 3ZL4L 4QXTA 4RAVA 3VG9C 4CVZA 1N6VA 3GSXB 4NOFA 2X4QB 3RAJL 3HG1E 3BPOC 1G9MH 2ILLA 5KVFL 1GZPA 2CK0H 3SDDA 5GRXG 5LAXA 1VGEL 3LS5H 4OZGB 4HCRH 3A6BH 2XWBA 2IPUK 1KIPA 4P2RA 1TLKA 3W82A 4WU5A 3VXNB 2IBZX 4YWGL 2R2EB 2DLEA 1D9KB 1HHGB 2J8UB 4HUKB 5E6YA 1IAIL 5E7BA 5KBNC 4PJFE 3RDTA 5T1MB 2H9GB 5C07D 2O61B 2EIBA 3G5VA 3HCVB 4HUXA 1OP5H 4LBEA 4WHTB 1D5XA 3L5WA 2A83B 1OP9A 4XWGL 1FNGA 1IGMH 4ORGA 3UJJL 2HKFH 4N1CA 2ZUXA 3QPQC 3DV4A 2ZOKA 1T04B 5DRZB 5HHQB 4ERSL 1QRNA 5HHMB 2BRRL 3SDAD 3REVB 4ZSOB 3VCLA 5F8QC 4HEPG 1HIMH 1RMFH 3G9VA 1AGEB 1MHHB 5KSAC 1HQRB 1K3IA 1UJTA 4IS6A 5CSZB 1RUMH 5DT1L 1IKFH 4MQ7B 1FZJA 1NANI 3GB7A 1MJJA 4H1LA 2R29H 5DRXB 4AIOA 1FE8L 1NKRA 1IKNC 4O9HL 2F54D 2WUBH 1E28A 4HPYH 2R69L 1P7QD 2F5AL 2R56H 4K3EL 2AV1A 1Z5LA 1DLHB 4JLRB 4L3CA 1JYVA 2X9XA 4YZFF 5DMKA 1V3LA 1KTDA 3DMMD 4FQLL 5F70A 5CUSL 4R26H 3GEWB 3FJTA 1I1YA 1FVCA 3QDGA 3GNML 1D6EB 5LCVH 2PYEA 3JWOC 5KVEH 4PJ5A 1OF2B 2NLJB 4OKVA 4BELD 3PWNB 4MJIA 2IANA 2OTWA 2VZ1A 3HRZB 2X05A 4L4TB 1ULVA 2KPNA 3EYUL 3WHE1 5HI5C 3QI9C 4X7EC 3FT3B 5D6DC 2P49B 5JOPE 3MV8D 1KTLA 4DVBA 4ZXBD 4N8CH 3H42H 2VXSL 1MFAH 1UWXH 1MFBH 2OL3L 1IGIL 4M93B 1FGNH 3AU1B 1XR8A 4MB5A 3ULSA 4NC2B 4NO3B 3FO1B 1HN1A 4OI9A 4UOW1 1KG0A 3L3OB 1S7XA 4OF5A 3SCMB 1FG2A 2VDKL 4JFQA 1BVLB 3HR5A 3I85A 4U0RB 4PIRF 1ONQB 1DDHB 3BDXA 3BXNA 1FYTD 4UTBH 1G7LA 5F89A 3PWVA 2J2ZA 3QNXA 1BWWA 1S7UB 5TQ0L 4D2NA 1MIMH 4NHCL 1KPVA 3HE7C 3O2DA 5GRZA 1AD9B 3TZVD 4N9OB 2P44B 4OD2A 4S1RH 5E6ZA 3KPQA 5IB1A 2AJ3A 1Y18A 1AD0A 1EJOL 2OS7A 4I4WB 5DUPL 2VDPL 4NNPH 3MRIB 4PGEB 5F7EH 4XCYA 1II4E 3AVEA 1IEHA 2ZUWA 4WFFD 5FECB 2GW5A 4QRUB 4L4VB 4XCFL 3QXVA 4JDZB 5D7JA 1G9NL 3LQAC 5C6TL 5FOBA 3QISA 2OBGA 5L0QB 3ARFA 3S9DB 4NZUL 5C6PB 3O3EB 2BRQA 2KKQA 1MUJB 5F9WB 2B20A 1CGUA 3MA7B 5FHBL 2JCCF 4JFXA 1ZLUK 4E41B 4TRPL 1G7PB 3BQUA 3P0YL 1CICB 2G75A 3S35X 4YR6A 4O00A 4JZJB 2N56A 1AY1L 3KVQA 5ITBH 1RK1B 3AXLB 3GIZH 2HLFC 1I3RA 3O6FB 2FYYA 4ALAH 4GQ9L 2Q76A 4N0UA 2D7MA 2K7QA 3W9DB 1YEGH 1JE6A 3T2PA 4AG4H 1AE6H 4EDWL 5BXFB 5JMRA 2GFBA 3BGAA 3P73B 4XP5H 1B4JL 3LS4L 1J1OH 1DBKH 1RU9L 3ULUD 2O5YH 2Q20A 4I0PD 3WIHL 5EUOB 3QUML 1EEYA 4JFOB 4YBHA 4LLWB 1MWAH 4M5ZL 2JCCE 1TJHH 1CS6A 5L2JB 4RMQA 1KT2A 4XHQA 5B38A 5F7HA 2CRIA 2L0DA 3QFJA 4PGCB 3WJJA 2A38A 4JKPH 4LRNH 4NM8H 1R0AH 4CVXB 3CLFL 1QTYT 1D5MA 1NFDE 1Q9WA 2J5LB 3UZQA 2FGWL 5DR5H 3BWAA 3NZ8A 4O5LH 4PGZA 2Y06L 5F21B 1EV2E 2OZ4H 1K8IA 4L4JA 3SJVD 5DHVH 4S1SH 5IW1A 4JDTH 4HS6B 4GRMA 4OCXH 2OTUB 4Z7VF 5HYJE 1SYVA 4PJ9D 3P30H 2R8SL 2HVJB 4P49A 4LARH 1LP9F 5I1JL 4Y4KA 3HB3D 5CMAA 1I3GL 5JW4Q 3ET9F 4GSDL 2E7LA 5TDNB 4JRYE 4QRTA 4GKSB 4HH9B 1ZHLB 4P2OC 3EIFA 3FT4A 5CZVH 4YHZL 4NRYA 1BFVL 3CXDH 4WUUA 2I24N 3TPUA 3T4AA 5I1EH 4N0RA 1NMCC 3OJ2C 3SKNB 2Y5EA 2YSSB 3SDAC 3U4EA 2K3TA 4U1HB 5EU5A 4BM7A 2XV6B 1S9YB 4GG6B 1AGCB 3GK8H 4OT1L 4JKWA 5SV4A 1VHPA 1BQHB 4ZD3H 3RKDD 4HUVA 5ADPL 1MEXL 1Q9LB 1TPXC 1LP9E 1NUDA 1S9VA 2P8LA 5GS1C 2GIYA 2WBWB 3NN8B 4QGTA 1A0QL 1JPSL 5ILTH 2HAZA 5EC1B 4G9FD 3W2DL 1HKLH 5JUEL 4WI6A 2JJSC 5HYSB 4WWKA 3O45B 1FZOA 1I1CA 5KOVC 5SX4I 4QRPD 5KZCB 1Z2KA 1J5OH 4W70A 4YFDB 3U48A 3DMMC 4P2RE 3F5WB 1Z9MA 3W39A 4MAYC 4GKZA 5BOZG 3L1OL 2Y5TA 2CH8A 2IBGA 4JKLA 2BNUA 3U7WH 5CWSB 1DFBH 1PEWA 4Y89A 1LO2H 2H26A 1VDGA 3ES6B 5DJXA 4N0FB 4NO0A 3BP6B 1T03L 1RUQH 3V0WL 3ULUH 1E27B 1D9KD 1A4JB 3BEWA 1IGYA 2ZSWA 1MCFA 4OZ4A 5DLMH 2B2XL 5DK0A 4BZ1H 1NLBH 3TIEB 4GLRH 3ROOA 3Q0HA 3BH8A 1U8OB 3OXSA 4AJ0A 5D6CA 2DQHL 5ICXA 3FQTB 4JPVH 2Z4QB 4ZPVB 3K0WA 4EVNA 1QRNE 4P3CL 1T0MB 2QEJA 5CEXB 4TUOA 5K59E 2V2TA 3MQIA 4UB0H 5CINL 1CXIA 5HHMD 4AM0B 1XAUA 1DLFL 4FABL 2D7TH 5TJWK 2BSED 1T6WA 1BEYL 4DTGL 2GTZB 1J0YA 2UWEA 1SVZA 3K1DA 5E00B 3GJFH 3MUGB 3EYSL 1F6FB 5LGJA 5INDB 1UYWL 1EVUA 2BHYA 3MNZA 3L7FB 4XB7A 3MODL 4WV1B 3WFEH 3TZVC 4NN7C 3KPRA 3VFMA 5DFVC 4GUPB 3GSNH 3GMQB 3PGDA 1TIUA 3O8XB 2EDKA 4FMKA 4YPJA 4BFBD 3QDGE 1TVHA 1UG9A 4IM8A 4TVPH 1CGSL 1WEJH 2BJML 2PYEE 4H26A 4PJ5E 2D0GA 5TE4H 1U0QA 5C0GA 4NNYB 1KJVB 3ULVF 2YD5A 3VFNB 4L8BB 2IANE 4XBGB 1DSFL 2WINA 1CU4H 3IGAA 3ARGB 3EZ8A 1DE4A 4NKMB 1KB5L 4KJQD 3DIFB 4LFHG 2ZOLB 2BOBB 4JM4L 4NN5C 2GJJA 4BSVA 3O3BA 4CMMA 3B5GA 3NCFB 3MRNB 1Q9OB 4YPGA 4FFZH 2B7DT 4F9PC 4L4TD 1KCRL 3ZE0F 3I2CH 2YUZA 3P77A 4IIQB 3D0LB 1KJ2A 1PBYA 1I7RB 2QHLA 4UAOB 4BH7A 5J1AB 1VERA 1QSVA 2VABB 1TTUA 4D9LL 3GMMB 4GMSH 3AMKA 3L3HB 1DQQB 1LEKA 2BNRB 5JQ6L 2E9IA 3LEVH 1DBJH 1KLUB 5JORA 5A3ID 5H35B 3SCMD 5C71A 9CGTA 2WP3O 4ODSH 1JHTA 3MRFB 3N1QC 2MOVA 1RJZB 1HEZA 3C2SA 3QDMA 4PRAA 1R5VB 3HG1B 2FSEB 3AS2A 4PPTA 3EOTL 1YPZA 4R3SB 4X6EB 1LEGB 2Z93B 4HIXL 4XPGL 3HNTL 5DUMH 3ULUC 3DURA 4NPYA 4I0PC 5IHZB 5JHLL 3FB8A 5BW7A 4H1LG 5HVWA 2F53A 4MMZC 3V0VB 3ZE0E 1F90H 3VFVA 5E7FA 3N06B 2ARJA 1UM5L 4BFGA 1ZEAH 4GO6B 1FVDB 2VE6A 5B3JF 5I71C 2YRLA 4X4XA 3D18B 1YUHB 4Y2DA 4LPVA 1CXHA 4R96B 4AK1A 4QRRB 1WF5A 5GGQH 1RVFL 4XRCA 3L3KB 2HG5B 2N4IA 3UYOD 5JIHA 4PJFB 3AB0C 2VAAB 3DSFL 3SKMA 2XG5A 4KJYB 1ZA3A 2EDLA 4H5SB 4L4VD 1NMBH 2XFXB 3DTXB 1YEEL 5EIQA 4PJ9C 3WFBL 1T89A 3NFSL 4BQBA 3CFIC 4P5TC 1ITBB 3K4ZA 4QTIH 1KTRL 1TFHA 1ZKAA 4YQXH 4LLYB 1U93A 3HB3C 3WFHA 5HPMA 5DD6A 3MOAH 4N1HB 5C0IA 1T4KA 5JHDE 1NGPL 4E41D 3H9SB 1CICD 3QWQB 1OCWL 3FO9B 1O0VA 3I3BA 2JIXB 3QEGL 2AABL 3FRPA 4N0UE 1FFPB 2I9LB 1R5WB 1EAPB 5GGTH 5AYQA 2YN3A 1P2CA 3O6FD 4LVOB 4RQQA 3S5LB 3STZB 3VD9A 3FN9A 4XCCL 3K74B 5E1AB 3WFDH 2WLZA 3MLYL 1YMMA 4HQQH 1I7UA 4PRNB 4FQQB 1KNOB 5TH2A 5I6XC 4UZGA 1BAFL 3RKDC 5C0JA 4N5ED 4GQPH 3LS5L 1HINL 3VU2A 1BQLL 1G6RA 2W60B 4FTVD 3JBG7 3EYFA 5E2UL 4Z18A 5HDQL 3QFJE 2Z35B 2A9NL 2HRLA 4GRWF 4L8SC 3VRJB 3ZT7A 2WBJA 1YEIH 2DJUA 2R4RH 4K9EL 4I2XA 3UBXI 3HZVB 1X5ZA 1AJ7L 1WC7B 4MB3A 4ZS7H 1I3UA 4TYUA 1DBML 2OJZH 1JPGB 1NGQH 4JY6A 4HWEH 3D25A 3W5MA 4WCYH 5DYOA 1QQDA 4MD0B 2XNAA 3B8SA 2BSTA 2C1PB 2XZAL 5C0RH 3P0VH 1A3RH 2D2OA 3G6DH 5DQ9A 5DHYB 4OSUH 3VGHA 3OR7B 2IGFL 1D9KC 1NFIB 5IB2A 2G9HA 3OKMB 5SWQB 1GZQB 35C8H 1MHEB 3ZE2E 2P47B 4KV5F 5F3HB 4A2MA 1HIML 1CQKA 1MFEL 2LU3A 1AXSB 4OF6A 4JFDB 5T3XL 2CLZB 2DWEB 1I9IH 3C6LA 2HTKD 3M17B 2CKBL 1I7TA 3G08B 3MYJA 5T3ZE 5GRJH 1J8HB 1OW0C 5J11C 2AK4A 5E4EB 5C9KA 2DDQL 4DJMA 4LSUL 8CGTA 2EDNA 1FNEB 2DJSA 5I17B 2C3VA 2C7UA 1YECH 4KU1A 5E6IB 1HXMA 5HHXH 4Z0XB 2NZ9D 4NKDB 1BJ1J 4KV5E 5CBAB 2NNAB 4ZFGL 3WD5L 2AGJL 4YUEH 2XXMB 4CDGC 1JZ5A 5KZCD 1OB1B 4NRZB 2VXVH 4HJ0C 3MTRA 4QHLA 3QSKB 2O5ZH 4MJ5A 1R3HA 2XQBH 3MACH 4JY4B 3E3QE 1SEQL 2X4SA 4KJQC 2RFXB 3TO4D 4H88H 4LU5L 1FL6A 5C0CA 2GT9B 5IMOB 5LVEA 3S37H 5KN5B 1ZS8B 1CFNA 2IPKA 5BV7L 4GXVH 1A1MA 2LFGA 3PL6B 1Q38A 3DGGA 2DWDA 4KTEH 5T1LB 1AGDB 1UACL 1JRHI 2NZIA 3I02A 2CKNA 3BE1H 2D3VA 3E8UH 4J2XA 4UTBL 3MRJA 4ODWA 1BGXH 1WWAX 4N1EA 4M93C 4FRWA 4I9WD 3RVVD 2ORBL 4LCIH 5TE7H 2R1XB 4Q2ZB 5A3IC 3SCMC 3CZFA 1EA9C 2JCCB 2UWEE 3KPPA 4UNTA 2SEBB 4I77L 2GK0A 4U0RC 4OF0A 1YC8A 3ECBA 1RJYB 1NAMA 1P1ZA 4RWYL 4JPIA 4W6YB 4XPTL 3UTSA 3MJ8B 3QIUB 1U91B 5I8KL 1CDCA 1U2CA 3KPRE 4P59L 4ODUA 3REWB 3SGJA 4JFZH 5EU3B 3LN4B 1CXLA 4OD3L 3GRWA 4OZFA 5T1KB 4LIQL 1OARL 4PB0H 1RIHL 5HYJB 1CXFA 2GAZB 2Y9RT 4XCEB 1MJ8H 3O8XD 4YHPA 3HE6A 5GGRA 1VGKA 2BHUA 4QYOB 2FL5B 1QPPA 3MCKA 1P9MA 4YHKL 5KG9B 3D9AH 2AI0L 4MWFB 1UM4H 3MGAA 2X1WL 3VFUA 4D9RE 1HH9A 3SQOH 1LEIA 2A74B 1JTPA 4JRYB 1KYOK 1QKZL 3ARGD 2DI7A 4LASH 4OGAD 3VA6A 5MHSE 3G6AA 5CGMA 1AR2A 3GI9L 4PLNC 4PTTB 5L0QC 3MRMA 3BZDA 2JE8A 1OAXL 4MNQB 4URTB 5CKGA 4ALAL 3RX8A 5CJ5A 3HI6H 5F9WC 4KKLD 4X6CA 2F74A 4EBQH 4MNGE 4OCNC 2Q6WB 5JNYB 1A7QL 1QVOB 4Z7VB 1CICC 4X4MA 3HI1A 3BOVA 2QQQA 4JZJC 4KGLA 4YFLF 2ZJSH 1KULA 3D69B 1DBKL 1LP9B 2VLME 3UO1L 1G7JA 4QXTB 4ZDHA 5JR1H 1INDH 4M1CD 3O6FC 2QLVB 1RZ7L 2D4FA 2BNRD 3JTSA 2F8VA 4QRSB 4HKBA 2QQKH 1GZPB 5LAXB 3QXAA 5IFJA 1Y6MR 1ZV5A 3BT2L 4YNYA 1CVRA 1KIPB 2F53E 3HG1D 4LPWA 2P5WE 4NP4H 4N5EC 3SE8L 4K7PX 2VQ1A 1QYGL 4UT9L 4KQ4H 4UIKH 4YHML 4NN6B 4F8TA 4UOW0 1GPOH 3CMGA 2F9BT 2OXHA 4U1KA 4QHMA 1GVIA 5IEKB 3OKNB 2OJEB 5JTWA 2UY6A 4NRXB 2A0LD 4L8CB 2YA0A 4XI5D 1LNUB 4QRRD 3CGTA 4LBEB 4UTAL 3GMLB 2GEEA 2BY3A 5TGBA 4DGVL 2DN7A 3LSOA 3IRZA 3STLB 4KMTH 2FCBA 2ID5A 2ZKHL 4ORGB 2BC4A 4V2BA 4ETYA 2J8HA 4CJ1A 1NCAH 3MLXH 5BS0E 2RJMA 3MV7A 1QRNB 1RI8A 2AJZB 4OZIA 3U79A 3RPKA 5GHWL 1SHMA 1WWCA 5CD3A 1FNLA 5T33H 4IS6B 4BSWB 2EIEA 1KPUA 3TWCL 1PZ5B 1FZJB 2FIKB 5JXED 1BLNA 5L6YH 4H1LB 5FO9B 4M48H 4XC1L 3GSVB 4MJ6A 1TENA 3H9SD 3CDCA 2JIXD 1I8LA 3QUXB 4HUWA 1YMME 3DUUA 3QWOA 4ZO7A 1FZKA 3OWEA 4L3CB 2BNQA 1INQB 3LHPL 4Q9QL 3P4LA 1SY6H 4R7DA 5DMKB 3DO7B 4WY7H 2DQJH 1WCQA 5MEOB 5FCUL 4KZEH 2FR4A 5GRVK 4I13B 4C4KT 1J5OL 1KJMB 1I1YB 1FVCB 3QDGB 5E2TL 3Q48A 2YWYA 4M03A 2EDJA 4NC0B 3I9GH 5J9PB 3R8BB 2FATH 4LCWB 2V9TA 2L7UA 3VXTB 1PY9A 3T04D 2EDBA 4I2XE 2PYEB 2NZ9C 5DJDA 2XOTA 3L6FB 3PWUB 4MGXA 4OFDA 3KPMA 4OKVB 4O58H 3BO8B 4MA1B 3OKDB 4KROC 3QIBA 1TVDA 2GSIA 5IBLD 3VFRA 2P5EE 2EDEA 1P4IH 2IG2H 4RISL 4HIIB 5HHOE 4DVBB 3GMPB 3IFLL 4JN1L 1KJ3L 1SM3H 3T8XB 1K85A 3U6RB 1DR9A 2AXGA 1WZKA 5JOPD 2H1PH 2EIZA 1KG0B 5BVPL 1S7XB 1YJDC 2YZ8A 4ZUWB 1KIRA 1RUAH 1CFTA 3O2WH 3HR5B 3TBSA 3MRBA 3PDGA 2YD8A 3BXNB 5E94A 3ARDB 5F89B 4LAQH 2BZDA 3QFDA 1CL7I 3QQ3B 2FHCA 1FDLH 4UB0L 3PWVB 4LCYA 3F6LA 2XN9A 3UPRB 3V7AG 1J7VR 2D7TL 1KPVB 3KHOA 4LDEB 4FQCH 3U36B 2CPCA 2B0SL 4E5XA 2CLRB 1ZANL 1BPVA 4JFDD 3GSUA 1ZA6A 2IMMA 1FORL 4G8EA 3TH2T 2RGSA 5JW5A 4OLYL 4B0MM 5IB1B 2VDOH 4DAGL 5I1DA 1J8HD 5FYKL 3MA9L 3N9GH 4Y4HA 1MFDL 1FC2D 3IU3A 3FONA 3U9PL 4H8WC 4TNWF 4HG4K 1C08B 4XTRD 1OAZH 5D7JB 4HPOH 1GRWA 3P9MA 4IOSD 5E6ID 2NCMA 3FZUD 4WV1C 4M1GH 1IQDA 2VZSA 1JCKA 1F3JA 4YHIB 5IVZB 5HGHA 1C12B 2FEDD 3HTLX 3QEQB 4ZTPH 2EKSB 5B8CB 4L8DA 5HDBE 4OCYH 3IJYA 5DJYB 2NY3C 1BZ9B 1FNSH 2FH6A 5MERA 4YR6B 5EZIH 3AM8A 3V5DA 1XCTB 4RMWA 1NUGA 1F4YH 5F1IB 5JHDB 3F7VB 4P9MH 4QOKE 2WQ8A 1NCWH 3ARGC 2IH3B 4LLVA 4OGAC 5EPMA 3HUJF 1WBXA 2Q76B 3U0PB 2CDGA 2VZOA 1ZTXL 3U0WL 3HS0A 1F42A 2DLTA 5IVNA 4H0GA 5IEHB 3IJSA 1TZHB 2GFBB 3C09B 4KKLC 1RFDL 3PL6D 3VXSE 1NC4A 2EE6A 5C0BE 3ELAT 5T1LD 2E7HA 3TYFB 3NAAH 1ORSA 2VDLL 4IIQC 4YDIL 3KLDA 5DUBA 4LMQI 4RBPK 5TFSH 2BVYA 4UAOC 5ADOH 1X7QA 4LAJH 5DD3H 5EOTB 1JTOA 4NUGH 7CGTA 4M1CC 1KT2B 5L9DH 4LLMA 2YUWA 3HZYA 1HZHH 3QFJB 3DETC 1I9JL 4OB5L 3UTSE 4YXKL 3MV01 5DA4A 1Q9WB 2H6PA 3QULA 4PJ8A 3F62A 5EOCJ 2L7JA 3BWAB 4G9DA 4OLUH 1HHIB 3FB6A 4RFOL 5DI8A 4U6HB 5FYLL 1V3KA 2ATKA 4ZQKB 3QIUD 3C2AH 5FB8A 1JHLH 3OBAA 4FZ8L 1W0WA 5C7XL 1PKQA 1N3NB 1IL1A 5T1KD 1CDBA 2GYSA 2HLAB 4GS7B 4NIKB 1FFRA 1R5IA 4G3YL 4Y4KB 5HYJD 2A0LC 5CMAB 1A47A 4HV8A 3TT1H 3HNVH 3QEUA 3R4DA 5DDHA 4XI5C 1ZSDA 1GL4B 2FWOA 1MHCA 4NGHH 3FB7A 4IOFD 3S6CA 1ZLSH 2X2YA 3TPUB 3T4AB 3WFCH 4JRYD 3QR2A 4NQSB 4NJAL 4Y5YA 3U4EB 1UT9A 2DLIA 5EOQL 5JW4N 3M8OH 1K2DA 4KC3B 5E0QA 5EU5B 1Q94B 5ALBL 4X5LA 2ICEA 3MREA 4HWBA 4MNQD 4X4ME 4TUJA 4OTXL 2GI7A 5JXEC 3S96A 4HUVB 3FAXA 3FTGA 3IRPX 5FYJU 3MR9A 1UM6L 4BK4A 4DUVA 1N8ZA 3L95A 3MLTA 4HC1A 1DBAL 4LEXL 2VKXA 3N85L 3DARA 2EDWA 5A2KH 2R2HA 4AT6A 4KKNA 5SWZA 5IJVA 1RZ8A 1BD2A 5T1DH 1WFOA 2DMKA 1HDMB 5D5MF 3I6KA 3FQRB 4MXQD 4P4KA 2BFVH 3KYOB 3W39B 1OSPH 3QB7C 2NY5C 4LCCA 5IBTL 1B2WL 3ARQA 5C3TA 4CUCA 1VPOH 4X6FA 1XGQA 4RAHA 1KN2H 3F12A 1QEWA 4KHTH 1XIWA 2BNUB 4AH2A 1ZXQA 5F7LB 1IARB 2ICES 1QA9A 5TE6L 2YKLH 3CX5K 4LFHD 1NCCL 1DN0A 4KPHL 1K4DA 5FDWA 5CHNA 2XTLA 4NO0B 5CEZE 1NDMA 4O4YH 2GUOB 1OGAE 5D8JL 5MEQA 1P69B 5ESAA 3S35L 5IBLC 1IGYB 4WI7A 4ODXB 3FQUB 4OZ4B 5C70A 3OGCA 5DK0B 3MBEA 1HNGA 4YK4B 3IXAA 2QBWA 3D85B 3NIFE 2ITDA 4HEME 4TNVF 4YDJA 5ICYB 4EDXA 3BH8B 3N1PC 5IJKA 5D6CB 1I1AB 1QFHA 1F4AA 1RZKH 2DM2A 4DWHA 3OKKB 3J7HA 3BX7C 2BCKB 1SMOA 3MV7E 2AEQL 2B1HH 3MROB 1KTKE 3VFWA 5CLWA 3RWIB 4CAGA 1SJHB 4NCDA 1YNTB 1G7MA 5IV2A 5EC2B 1I9IL 4M00A 4LSRL 1N59B 1CD9B 3ARUA 1YN6B 1JK8B 1QRND 1HH6B 1WITA 2H32B 5KANI 4L3EA 4NT6B 1GGUA 4QLRA 2YMXH 1FL3A 1LMKA 2ARJQ 1T7YA 5TDOA 3BZFB 4K94C 2BVOA 5SV3A 3CCHB 1N2RA 1S5IH 4K2UL 1PZUB 3STBA 4I48A 4ZTOH 4K7PH 3WKNA 2BNQE 3CAFA 4ODBD 1KYOJ 2E8YA 4G7VH 1A1NA 3BVNA 3CLEH 3PGDB 4WI3A 4AEHL 1KFAH 1AC0A 1JWMA 3QUXD 3SDYL 1RSFA 3MRHB 4JDVA 4EEEA 2X70A 3E2HB 2DM4A 3IJHA 5E4EC 1UKSA 1FAIH 1H3WM 4XMPL 4RNRA 4NSKA 1EIBA 3H9YA 3ZT6A 5IG7A 4H26B 4LLDA 3P4NA 3DWTA 3LEYH 3QDGD 5IB4B 2VDQL 4OFIA 4XTRC 3K46A 2X89A 1WQVT 1DE4B 4LCWD 4X0KA 3V0AC 5E6IC 3JUYA 5K9QG 3FZUC 2NXZB 2PYED 3ARPA 2WM0A 1ZGLA 4CMMB 3UROR 2DQUH 2HFFA 2C1OA 4P9HH 4YPGB 4EIGB 2FEDC 5DTFB 4BSJA 1EZVY 4D9QE 1KIQA 4LNVA 2PN5A 1IT9H 3P77B 5AAMA 3FN0H 4RMUA 5E8DH 3RWFA 3C8KA 5E2WL 5B3NA 3AGVA 1KCVH 3SE4C 4M9OA 1WJ3A 4NOBA 4MNGB 4OLVL 4UT7H 5IHBA 1LEKB 2DS4A 1I7ZB 2W9EL 3MCLL 5D1QA 1QNZH 5J56B 2D7OA 2IALA 4F7CB 4YHNB 2HA1A 1JHTB 3VA2C 5F1OB 4ODHL 4CJ0A 1HEZB 1XF4A 1MCRA 3ARDD 2PCPA 3PL6C 2HFEB 3PP4L 4XP9H 4DKEH 4K07A 1PX3A 3MUHL 3FB8B 3J8F7 2F53B 4HHAB 2D4DA 4HKXA 5GZND 2P5WB 1E4KC 4UILH 4XP1H 2VAJA 1TCRB 3FRUA 4QY8A 4HXBH 1JIBA 15C8L 2YBRA 2VE6B 1G0YR 3B2UD 5E8PB 1FIEA 2Y36L 3IDYB 4R0LB 5BVJA 4WEUD 4XRCB 2AJVH 5I8CA 4PB9L 1U8PA 5I74B 4LP5A 4MA8H 5IFHH 5A2IH 4JO2H 3SKMB 3WUWA 2FX9H 2FJGA 5CJQH 1NEZA 3RZWA 4Z0BH 1ZA3B 5FUOH 4XPBH 3S36L 4KY1L 4PJCF 5D7JD 3U7YH 1C1EH 1ES0A 4UQ3A 1UWGH 2I07A 2YPVH 4G6KH 1LE5B 4UNUA 5BS0B 25C8L 3MRRA 1PW3A 3IDXL 3THMH 1PLGL 3QEQD 3RWEA 3TT3L 2A73A 5C0IB 1TZIB 1H15A 4IOFC 2CXKA 2PW2B 4YE4L 3I6LD 5GGSA 1OSZA 5JHDD 1P2CB 1DBBH 1OLZA 4S11A 3Q3GB 3JVGC 1LO4H 1UWEL 3ZDXF 5BMFH 1GC1L 1YMMB 1I7UB 1AGBB 3F7YA 3SN6N 5IESL 4PJCE 4OM0H 1QZ1A 3CH1A 3G5XB 5C0JB 4XP6H 1P4LB 3MV11 3LMJH 3RU8H 2ADGA 2VSDA 5IVXF 1KIUA 4YEEA 4LNRA 3NTCL 4P9HC 3EYFB 2HT3D 4PGDA 12E8H 2MPAL 5EB9A 3HLAA 2HH0H 4I2XB 4DQOL 4EI5B 4JAMA 3TGXA 3QFJD 4MXQC 3SDXA 4PD4K 5GXBB 1DCLA 2P5EB 1KELH 1H0DA 1BFOB 4JY6B 3NCJH 3B5TA 1U8JB 4DVRL 5E5RB 5DYOB 4PJEA 1QQDB 3HFMH 2EC9U 4NJ9H 3SOBH 3T3PF 5HHOB 1PKQE 5DJ8B 4IDJH 2FZ3A 5E2JA 4ZAKA 1ZLWK 4MDJA 2ICWA 1OT2A 2I5YH 4UUJB 4F37K 2XY1A 3ULVH 2NXYD 3QNYA 5JA8B 2FHBA 2G9HB 4X5WA 4XH2A 5F9DC 2BSSB 1EERB 4AEIL 3S88H 4GAYB 4NM4H 3GKWH 5IMMA 4QT5B 4Y4KD 1AI1L 5D6DA 5D72L 1MCPL 2WUCL 4HG4J 5F88A 3IFNH 2HRPL 5L6YL 2D0HA 2QHRH 4P2YA 2X4NA 4JN2A 1AHWA 1ZAGA 3S8WA 1E6JL 4JM2F 3QPXH 3BESR 2YUVA 1OLLA 4HIJA 4HCRA 2R1YA 5HYQB 5EBWA 1LD9A 2ZUVA 2FO4B 2IQ9H 2F5BL 3FFCA 4I5BA 1MF2H 2XICA 1RURL 5A1AA 1CDJA 1XT5A 3HI5L 3IETB 3LEXB 4PP1D 4R2GC 1SY6L 3A6OA 1VKXA 1A6PA 5CP7B 7FABH 1LK3H 2NTFB 1XZ0A 2C3VB 2C7UB 5SWZE 4XGZA 1HXMB 3SHSA 1LE9A 3RRQA 4U1IA 5EO1A 1RUKL 5DO2D 1SYSA 3HE7A 1QOKA 2LQRA 4HUNB 4I18B 1QFUL 1XGUA 4CL7A 4JHAL 5FIEA 4O58L 1D6VL 2VB5A 5HGBA 3VW3H 3TYGH 1ORQA 1LVEA 1X5JA 1PDKA 4L1DA 4HFUH 1MIEH 1H3PL 3KLSA 3NH7L 3KYMA 4BUHA 3KS0J 1WFNA 2R0ZH 4PREB 3O0RH 2WANA 3IU4H 2NY1C 5HHNA 3OPZH 2CO6B 4KKBD 4NDMA 4NO0D 3NFPB 2LU7A 4QOKB 4LKCB 4MA1C 5J06A 3B9EA 2YEZB 2W0LA 5GZOD 2C3GA 1WBZA 3I02B 4RGOH 3OAUH 3D85D 1XGYL 4X98B 5CD5D 3MRJB 4ODWB 4LHQB 3BUTA 1KEGL 3QUKB 1I1AD 5F7DB 3VXSB 5C0BB 2EIDA 4U6YB 4CRPA 2AV7B 3PGCB 5DJCA 3SE3C 4YBLB 4ODTL 3O6LL 1OAQH 3CZFB 1U8NA 1TQCC 5M7QA 5F3BA 2GK0B 4PYGA 5IQ7H 1CLOL 2ZCHL 1A6AB 4ONHA 2XQYG 1P1ZB 3ARDC 4JPIB 4P5MB 3O41A 1K5NA 5K9KA 3UTSB 3IVKA 5MP6H 4ODUB 5C08E 1DTUA 5GZNC 4C83A 1JRHL 4OF8A 3JV4B 1HHJA 3H7BB 4MA3A 5ISZB 4X7TA 2ZUSA 3HE6B 4M1GL 4O2FA 1VGKB 3W5NA 3KJ6H 2DQDH 4GRWH 3F58H 1KGCE 1A6UL 2V2XA 2OXGA 5I75B 2AJSL 1VEMA 3RNKA 1S3KL 3ILPB 3BP7A 5D7JC 5FO8A 5E5MB 3FT2B 3IDMB 4YBQD 5SWSB 4NQXA 3G6AB 3BJLA 2NXZD 2BK8A 4JFFA 4D9RD 3MRMB 3QO1B 1HHHB 4WEBH 3O6MH 4PJXF 5MHSD 4ZOCA 5B8CC 1MPAH 3WUZA 2OQJB 3VFOA 4OUUB 3EYOA 5D2NE 3BQUC 2K1MA 4W81A 1C5BH 3CX5J 1GOFA 1C16A 1DQLL 4GW4B 3C6SA 3I50L 4RAUA 4MHHG 5E99L 1U8MA 1KV3A 4X7SH 4W4OC 3PWPB 5ADOL 2AJYH 3ME0A 4H20H 1AIFA 3SDAA 3CK0H 2VLMD 4YGVA 1P7HL 1X5YA 1OTUD 2VH5H 3L7EA 2NQCA 1A7OH 3OZ9L 4X7CC 3C09C 3PV6B 1BBJA 4O02H 1CLZH 1N7ML 5FGRA 3V4VL 3FL7A 4Q97A 5I66A 5GS1A 1CBVH 4MCZA 3FQXA 2F53D 2ZNWA 2F54A 2P5WD 3OKOB 3T77B 4QHMB 1IMHC 1GAFH 2C9AA 4R4FH 3C2AL 2JJSA 5EU6E 1KXQE 1TJGL 4XZUB 3OQ3B 3BN3B 1OGAB 1QR1B 5DD5L 3PJSA 3ARXA 3WJJC 3CFEA 5B39A 5D7SH 2X40A 2EXWD 2B4CH 1EGJH 3EFDH 3LSOB 3EOAA 4CN1A 4P2QA 4JPKH 1I1FB 2H32H 3CVHH 4JHWH 4JY5H 2VXUL 5I1GH 1PYWA 4UMGA 5C92A 1MAMH 2IFGA 3DVNB 1EEQA 4Y1AA 3LB6D 2OLDA 3MRLB 3MV7B 4G6MH 3VMPA 5CJOH 2CUIA 3WLBA 43CAA 5ACMA 2VLLB 4PJAA 4MB4A 4GS7C 4F2MA 5BS0D 1F45A 3BYTA 1CE1L 3UTZA 3LKPA 4DK3A 1F4XL 1JWUB 1MRCL 1BBDL 1YDPA 2GHWB 4Y4KC 3W9EA 1BLNB 3M8OL 4FHBD 3MV8A 4ZXBA 3BUYA 1MWAA 4LSQH 2PR4L 3GZKA 3A6CL 3B83A 1I8MA 4KZDH 4PFEA 3MNWA 5FXCH 3DUUB 4CMHB 1FZKB 1QBLH 2BNQB 3HC3L 4HK0A 3FKUS 1MQKH 4HJGB 1RZFH 2FR4B 4IJ3C 5CILH 5GJSH 2OZ4A 4U3HA 1FV1B 1YMMD 5DHVA 4PP1C 1DZBA 1FYTA 1L7IH 2AAVA 3KPTA 2NY0B 3HKFA 4HIEB 1J10A 1BIHA 1OAUH 5FA3B 4XHJD 4XPFH 4QF1A 1M05A 3X11A 1LO3H 5K9JL 2MNUA 3KPMB 2RHEA 3TZVA 3SDXE 2GSIB 3LN5A 4WW2A 3VFRB 3PXHA 2YZ1A 3MGTB 4TUKH 5DMYA 4Z5RB 4YO0B 4EI5D 4PJEE 3C08H 1MLBA 3SBWC 4J7RA 4OLXL 5CKAA 1FFQA 3CMOH 2P5ED 2YXFA 3HNSH 2BY0A 3MRPB 4G7YH 4WI2A 2AXGB 5HHOD 3L3IB 2VR5A 3WUWG 3VXQB 1EBAA 1ZLVK 4F7MA 2I9TA 1WAAF 4I3SH 3D0VB 3E3QC 3DVFA 3TBSB 4X5XA 4MMXC 5E94B 4X8XA 5J7CC 4F9PA 4D0CA 2NY4B 4DN3H 4PUBH 5GZOC 1RJCA 1Z0NA 3F8UB 3AAZA 5CD5C 4RCAA 5JPNA 1MELA 1KLFA 4U2ZA 1JV5B 4IMLB 4OJFL 1ED3B 5F6IB 3GSUB 4AIZA 4ZOBA 4FQIH 5JW5B 4K3JH 3GDBA 5CLTA 4FFWD 1AC6A 2PW1A 3QHFL 3QZWA 2B4CC 4F7TA 4U7KA 3OG4B 1NJ9A 3FONB 3V4PH 1R3IH 1J1PL 4MVBD 1GJIA 4XBPA 1ZHNB 5D96C 4ZUUB 1L7TL 1YNLH 1T2QL 5HDOA 1NLDH 3CPLA 1CL7L 2DQGH 5EO9A 2APXA 2C5DC 3MLWL 4KVCL 3MXWH 2DLFH 4JFPB 3RX5A 1ACYL 1C7TA 2OL3B 4JVWA 2BOCA 1F2XK 1BHGA 5DWUH 2FD6L 4JZNA 5KSVA 4L8DB 2CDFA 5ID0A 4HIHB 4R4BB 1NAKH 3E2HC 1K6QL 1AKJA 2NR6D 1U6AH 5FUZL 1YY9D 4D3CH 5I15H 5BZWA 1JPFA 4FQXB 5F71A 5DRWB 5LG1A 1YN7A 5J4MA 1GIGH 4M8QA 2VMFA 4YBQC 4LLVB 4ZFOA 2C4XA 2R0LL 5H37G 4JO4L 2NXZC 3RGVB 4PJ9A 5FO7B 3QG6A 3FOMA 2ZPKL 5BRZA 1KC5H 3ARVA 3GJFA 3HS0B 4QOKD 1C8PA 5DMJB 4PV8A 1NKOA 4LF3A 1YQ2A 4PRDB 2ZG1A 4PJBF 2Z8SA 3WKMH 4PJCB 5EBMB 1P84K 4S1QL 4K8RC 2DI8A 4X99A 3GSNA 4L9LA 3WEXB 3ALWA 4F7PA 3VXSD 5KSUA 5C0BD 1IC7L 2BXYA 3HZYB 3VFSB 1I9EA 4XPAH 3IFOA 3MNVA 3VI3F 5E03A 5JW4M 1OTUC 3QULB 4PJ8B 3GSRA 4FQ1L 4K3DH 2MJWA 2I60H 5ESQA 3WNMA 3C5JA 2GITB 5DK2A 2PETA 2ATKB 3UTSD 2HKHH 1IBGH 2AQ1A 5EZJB 3RWDA 5C6WH 5BW7C 1Z3GH 1EO8H 4G9FA 2DQCH 4PJBE 2A6KA 3HPJB 4ZODA 3DRTA 1K8DB 1T80A 4JRXB 5ISZD 1F3DJ 1T83A 1N4XL 4JREB 4MA7H 4HV8B 3GSXA 5FKPA 3HE6D 3IDYC 3PP3K 2X4QA 4R0LC 5IVXB 4POZD 2DAVA 3IT8D 4EKXA 3OAZH 1BZ7B 3GMNB 4U33A 3QUZA 4OZGA 2X4PA 5EU7E 5I74C 1EEZB 2UY7A 4JFFE 1INEL 5IB5B 4M7KH 4GOSA 1EZVX 5GGVH 4FXLA 2VO5A 3LB6C 4Y5YB 5SWSD 3CH8A 1T89C 5I16B 3QUMB 2R2EA 3VXME 2YWZA 3HC4H 1D9KA 4IHOA 4NHUB 4OLZH 2R1WB 2ICEB 4OAWA 3ALPA 2PKDA 2H9GA 4OI7A 2DF3A 3MR9B 2O61A 4JG0H 4RA3A 1N8ZB 3GIVA 3L95B 3MLTB 4MYWB 3LDBB 1B0RB 4WHTA 2IPTL 4AT6B 2HTLD 3H3KA 5DMIL 5EOCL 1FAKT 1HQ4A 5IJVB 1RZ8B 2OR9L 3WXWH 1FGVL 1A1OA 2DD8L 3PWPD 3UX9B 3C60B 3I6KB 3QAZB 5DRZA 3CDYA 3O9WB 1FRGH 1JNLH 4ZSOA 4HUMB 1XIWB 4AH2B 1AGEA 1MHHA 2A9MH 1MCOH 2UZIH 5CSZA 3TVMB 1QA9B 1W0VA 4XHJC 4MQ7A 5FDWB 5DRXA 3SOBL 5MEQB 4UV7H 3OGCB 4LSPH 5E5UB 4EI5C 5CEZD 3IXAB 4JLRA 1OGAD 2CR3A 4P2QE 3ARZA 5ETUB 5GISL 3ZYOA 4MCYB 3OHXA 1A4KB 2P43B 5GGTA 1L6ZA 2GKIA 1FCGA 4Y1AE 1G7QB 3MXVH 4WHYG 3MLUH 4HZLB 2A77L 1D6EA 1G7MB 4ONFH 4PJAE 3GHBL 4RRPG 3NFNB 1N64L 2GK2A 3MV7D 2NLJA 3MRQA 1OTTD 3MV8E 3GSOA 4Z8FH 3DJ9A 4P5KA 3HRZA 4WW2F 5J12B 5KVDH 4LEOA 4L4TA 5IR1B 5MENA 3TNNB 2X4UA 3BKMH 2A1WL 2VZTA 4P48A 3FT3A 5DJ2B 7FABL 2QTEA 3N1GC 3AU1A 3C6LC 3LIZL 4RA0C 4XVUD 4K55A 2DIAA 4NO3A 5C08B 3IAGC 1JWMB 3RWJA 4PR5B 1ADQH 4FFWC 3L3OA 4U7SA 4WJ5A 1A7NL 1WZ1H 2BNQD 3EO1A 2X70B 3P9WB 1FIGL 5GGRY 3NACH 1BVLA 3OKEB 4RNRB 4MVBC 1ONQA 1DDHA 5IG7B 1CZ8L 1WFTA 4LLDB 3P4NB 1G7HA 2NY0D 4Y16B 3V5KB 2FX8H 4PRIA 3OX8A 4Y88A 1Q9KB 1S7UA 5CP3H 4OIIL 1OPGL 4GAGH 4PY7B 1EDQA 5I30H 2H3NB 1AD9A 3QHTC 4NZTH 1Y0LB 3LOWA 1MREL 4I18C 2M1KA 2V2WB 4BK5A 4I4WA 3N0PB 5LQBL 4P57B 2A6JA 2NR6C 4PGEA 4P46B 1CFVH 3C8KB 3IDNA 1YY9C 1JWSA 2M8XA 4QXWA 2EYSB 2P48B 4D9QD 1Q0YL 5AD0B 3UYPA 5D2NB 4JANB 1FN4B 3ZT5A 4QRUA 5FECA 2R0WH 5D1QB 3X3GH 4L4VA 3F65A 4AL8L 4LOUD 1EHNA 2J3SA 4C4KO 3RVUC 1EO5A 4M43H 2X1PA 3LZFL 5F9JB 4X6DF 1E4WH 4M02A 1BM3H 4Z95L 1QBAA 1XF4B 1DQDL 1MUJA 1S7RB 3CDGB 2NY4D 4HSQA 2CGRL 5JIKA 3MA7A 4PY8J 2W1NA 4PGJA 3WSQL 3AREA 4HK3J 1IILE 4JPWH 4HKXB 5TDPA 1CICA 4QY8B 4JZJA 3OJMB 1RZJH 4TOYL 2YBRB 2OMBA 4YBLC 1RK1A 4PJXB 1NBYB 3O6FA 4WHCA 3WN5A 1KB5B 1T3FA 2ZCKL 5BVJB 5J6GA 1L9NA 3W9DA 1ZK9A 4LSSL 5DD0H 5EU6B 5IF0B 5HYIA 1U8PB 5D1ZB 3ULUE 2DQEL 4M6OH 1MRFH 3WUWB 3PGFL 3PQYB 1NEZB 4PP2B 1O5DT 4OFYA 1U92A 2N7AA 4X6DE 2JELH 3VH8G 1ES0B 4FTVA 3ZL4H 1R3KB 2IADA 1OL0A 3C5ZB 1JF5A 1B0WA 3RAJH 2I07B 5HYEA 4WI4A 3ZKMD 2V6HA 4BJLA 4ZNEA 5KVFH 3CFJA 4JGUA 5L2JA 1VGEH 3PV7A 3HE6C 1N5YH 4PRPD 4KDTA 4PGCA 2A73B 2EYRA 5DQDL 1M71A 1ERNA 4OFKA 4ZUTB 1P9MC 4CVXA 3FB5B 3WBDA 2ITCA 2BVUA 2ADJB 2PO6A 3VDCA 1TJIL 4YWGH 3BRDA 4FQXD 1OSZB 5D70L 5KS9F 5BRZE 5C0EB 4WTXA 1OOAA 3G5ZA 4HS6A 5I1KL 1D5IH 1IAIH 1NGWA 2OTUA 4FQPA 3RGVD 3F7YB 2HVJA 3NOIA 4RX4D 1FH5L 3T65B 3VXRE 4MNHA 2VITB 2AJYL 3LH2L 4LVNB 3CFKB 3JV0A 2Z8VC 3LQZB 4QCIB 4XWGH 3VDAA 3DHJA 4LNRB 5L7XL 3UJJH 3T0BA 4TVPE 5TDNA 4Q6YA 4HH9A 1PEZA 1ZHLA 4QRQB 4ODVL 3TC9A 4ERSH 3EHBD 2BRRH 3VWJB 4EUPG 4G6JH 3DLQR 3SDXB 5IOPB 3SKNA 1EHLL 3ARYA 4FQJL 1U3YA 3IYLW 4PJ8D 1HXYA 4PJEB 4U1HA 1FE8H 1AGCA 5GRVL 2FEEI 4O9HH 4JHZA 4P23B 5D7IF 1BQHA 5HJ3B 4ZAKB 2JB5L 1YYLL 2R69H 2ICWB 1Q9LA 2NY6B 2F5AH 4XX1E 1T7VA 4K3EH 4Z78A 1U3ZA 1ZVYA 3RVWD 3QNYB 4OZHF 1CYGA 5EC1A 5I1GL 4FQLH 5E8NA 4X5WB 5HYSA 1GSMA 4JRXD 3O45A 2BDNL 4UDTB 5CUSH 4OZGE 3SKJL 1MY7A 2O26U 4U7MA 1GHFL 3CFCL 3GNMH 4OCWL 3QXDB 2QADB 1RZJC 5F88B 2J88L 3B9AA 2X4NB 5CWSA 1PQZA 4JFEE 4LSQL 3EYUH 3WS6C 2R1YB 3TO4A 5DEGA 1A7PL 3ES6A 1S8DB 4KK8C 1OTTC 4I5BB 2Q3ZA 4L1HA 3OB0K 2VXSH 5F7WC 1XZ0B 2OL3H 1IGIH 3TIEA 5KJRL 4R4NC 1KCSL 4XGZB 3LY6A 2P8MB 1U8LA 1LE9B 4HXAL 2QQNL 1U8OA 3V95A 5FYLE 1KCLA 4U1IB 5EO1B 3FQTA 1Q1JL 1SYSB 1XGPA 2VDKH 4XVUC 2Z4QA 3CU1A 1I8LC 4ZPVA 3RQ3A 5I1IL 2BMKA 4CMHC 4DW2L 1MHPL 1T0MA 4O2EB 4D0DB 3T09A 1ORQB 3C60D 4MQSB 3O9WD 2D7NA 2H41A 3QHZL 4AM0A 5TQ0H 4NHCH 1U8KB 2NY0C 1P84J 1XIWD 3VJ6B 3KYMB 4Z7QE 3TVMD 3BDYL 1SEBA 3HPLB 3HNSL 3L7FA 1F97A 1KB9K 4WV1A 1U58A 1EJOH 5DUPH 2VDPH 5IIEB 5ELIA 5A2FA 3O8XA 2ZUQB 2WAHA 4XX1G 3ISWA 3EJYC 4CKVX 2ADIA 5CS7A 4DN3L 1G9NH 5C6TH 3QNZA 4NQCB 2Z9TA 5DJCB 3R0MA 2LV4A 2D7QA 3DOSA 4NNYA 1KJVA 4LOUC 5ERWA 3SE9L 5MENE 2ZOLA 1CT8B 2BOBA 3VWKB 4TTDD 5FHBH 1TNNA 5LKNA 4U6TA 1MFNA 3CZJA 4TRPH 3MRNA 3P0YH 1Q9OA 4OGXL 1K5NB 3RIFF 3ARTA 5K9KB 4HWNA 2NY4C 3IDIB 3IVKB 1NUNB 1AY1H 3TP4A 1ZHBB 4IIQA 3D0LA 4LPUA 3BKCL 4C83B 1I7RA 5J13B 5J1AA 5F6IC 1YNLL 4GQ9H 4MA3B 4NNXA 3GMMA 5C08D 3OJDB 4G8IA 2BNRA 2DLFL 1MFCH 4J1UB 4EDWH 4PJBB 5H35A 1BX2B 3MC0A 2V2XB 4Y4HC 2KZWA 2NTSP 4PRIE 1B4JH 2EE2A 3LS4H 1RU9H 3KWWA 3MRFA 3T08A 5BV7B 1I1RA 1RJZA 3RWGB 3HG1A 3LN9A 3WIIL 2FSEA 4X8JB 3WIHH 3HA0A 1KGCD 3C5SB 5DJZB 3BP7B 4R3SA 4X6EA 1LEGA 4Y16D 2Z93A 4M5ZH 3RBGA 4G42B 2NY7L 1EJ6A 3MJ9L 4NQXB 5EULV 5IHZA 4OCLC 3T4YA 1TTFA 4JFFB 3V0VA 4D8PB 3ZKMC 3RL1B 2QR0B 3IKCB 3GI8L 4WENB 3PHQB 4HAFA 2BSRA 3C8DA 3CLFH 3V4UL 1JGUL 5C0AB 3D18A 1YUHA 2FGWH 3VXMB 3BPNB 3VFOB 2Y06H 2P24A 4QRRA 1CGYA 4P46D 3L3KA 5DJ0A 3AM8C 3ZDZF 4PJFA 1C16B 3MSPA 3C6SB 4FQXC 4RMSA 1ND0B 5KVMC 4LVHB 1XGTA 1TITA 4KJYA 5DVLA 1JZ4A 2C3HA 4H5SA 5D1QD 2XFXA 3SY0A 1UJ3A 1AIFB 5I1JH 3RGVC 3B9DA 2YD4A 4DGYL 4RWHA 1I3GH 3L7EB 4GSDH 2UZYB 1U8IA 2M26A 5A16A 5L88L 4BQ6A 4LLYA 4MLSA 3RIAF 4YHZH 4OQTL 5JXEA 1BFVH 2UUDK 3FQWB 1VEPA 2EO1A 5BO1L 2Y7QB 3BISA 3FQXB 3H9SA 4WFGD 4JR9L 1YJDL 4Y5VA 2JIXA 3EHBC 1DJSA 2I9LA 1EAPA 1AQKL 2AEPL 5C86A 2DQCL 5FV2A 1BFTA 2FBJL 4OT1H 3STZA 4AYFA 3CFEB 5B39B 1CFQA 5E1AA 5ADPH 2N1KA 1I3VA 1MEXH 3DUHA 5EU6D 4B5EA 4PJ8C 4FTVE 5IVOA 5D1ZD 4FQQA 3EOAB 1F6AA 4P2QB 3PQYD 1JPSH 3W2DH 2CUHA 4FN0A 4Y1AB 4ZNEE 2W60A 3V7MA 2VDRL 4KKAD 3RVWC 1CD8A 3EDDA 3C5ZD 3WLBB 43CAB 4PJAB 1W8OA 4Z6AT 3VRJA 1X9QA 4F33B 3JV6A 4A2LA 3LKPB 3HZVA 1FL5A 3W9EB 3L1OH 4JREC 3RHWF 3SKOB 4H8WL 1MWAB 5C9JA 4JGMA 1W72L 3VGGA 5I9QB 1T22B 3L3DB 1JPGA 3VI4E 1IGJB 2DRUA 3RL2B 4CBPA 4MD0A 1M1SA 4HK0B 2C1PA 3ARWA 2IEPA 2B2XH 3I3DA 4Y5YC 5DA0B 3OR7A 1CGXA 3RTQB 2DQHH 2R4SL 3OKMA 3TN0B 4APQB 4X9HA 2UZXB 4UIMA 3VH8B 5SWQA 1MY5A 2VZ3A 1MHEA 3GUTB 5F3HA 1WTGT 4JRWA 4JB9L 4P3CH 3RA7L 3X11B 1DQJA 4YDKL 1AXSA 3MX0A 3LDBC 5IROC 4JFDA 1JPTL 2CLZA 2DWEA 3BKJL 3P3YA 3QXWA 3LN5B 4ZS6D 4WW2B 3M17A 4PLJC 4EXPX 3VWJD 1DLFH 3W11D 4FABH 3GMOA 3W0WB 1RJLB 1J8HA 3WYRA 4BFIB 4ZUVA 1BEYH 1MLBB 3C60C 4DTGH 3QAZC 1UGNA 3GBLA 3O9WC 3EYSH 1C5CH 1UYWH 4LCCC 4UINH 1QHOA 4OM1L 1OAKL 1L6XA 1XIWC 3CIQA 3MODH 4PJ7F 5I17A 4BQ9A 3DX6A 3JXAA 1A7RL 4P23D 4F7MB 4ZAKD 5E6IA 4LPCA 2E7MA 2FECI 3MXVL 1MCWM 1WT5A 2NY6D 4Z0XA 2VQTA 3KPSA 4NKDA 2HMID 5CBAA 5HI4D 1U3HB 3MBEC 4D0CB 1KBGL 3AFLA 1NFKA 2JKXA 1CGSH 2MKWA 2BJMH 1OB1A 3BIKB 4NRZA 5H94A 5IJKC 4C57C 1S7WB 1DSFH 2QADD 4GAJL 1KB5H 4EUPB 4JJ5B 2KBGA 4JY4A 5FAAA 1JMXA 2RFXA 1DANT 1VFMA 4JG1L 4G5ZL 1KCRH 4ZYKA 1UA6H 2GT9A 3OB8A 2DQTH 4PJ7E 5IMOA 1HSAA 1ZS8A 5TQ2L 2LTQB 5J12C 1IGFL 1WZ1L 1OM3L 5L2KB 4XBPB 3PL6A 5T1LA 1AGDA 2VXQL 4D9LH 4YHLL 3BAEL 3CPLB 5EO9B 1UZ8B 2CO7B 3T0VA 2V5YA 4X6DB 2BOCB 1A14L 4JZNB 4GAGL 2CDFB 5ID0B 2YUXA 2ZUYA 4Q2ZA 5IHUL 1TETL 3FOLB 4QHUB 5IMLA 2JCCA 1AKJB 2N7BA 2IPUG 3EOTH 2SEBA 4HIXH 4XPGH 3HNTH 5D2LF 2DBJA 5D1XB 2DTML 1OT1A 4EIZC 5JHLH 1HK6A 4LQFH 3MJ8A 3QIUA 1U91A 5GGSY 3D3VA 4FQHB 1UM5H 5EU3A 3LN4A 3FOMB 5BRZB 5T1KA 1RVFH 4C59B 4KK9D 4G6FB 4XCEA 3DSFH 5FGBA 1YEHL 3VXRB 4P46C 4L9LB 4F7PB 3VGBA 5KG9A 1SJXA 1YEEH 5KSUB 4MWFA 3WO3B 2G5RA 3WFBH 5D2NC 4NQCD 3NFSH 2A74A 3WLWD 2DM3A 4JRYA 5D1QC 2XZCL 1UEYA 3DUSB 3MOBL 4G43A 4PJGF 4GBXA 4NC1E 2P42B 1FBIL 5DVKA 5H37H 1Q72L 4PTTA 3VWKD 2DI9A 1WUNT 4UQ2A 5ESQB 5LGHL 2XG4A 1NGPH 4MNQA 1JF1B 1OCWH 5BQ7A 3B4NA 3QEGH 2AABH 3RWDB 5IQ9B 5JNYA 2XQYK 1QVOA 4Z7VA 3G6JF 4OIAA 3SO3B 2A6KB 3DRTB 5HD8D 2WV3A 4XCCH 4QNPE 2V9QA 1LP9A 2C4FT 3MLYH 5EIVA 5FKPB 4M7JL 2QV2A 1YEKL 4QRSA 2YD3A 4XMKH 1BAFH 4OV6F 3INUH 4K3HA 4K94L 1QG3A 1HINH 3QUZB 2X4PB 1BQLH 1N5YL 5ALCL 3WE6B 5E2UH 3QQ9D 5HDQH 1EFQA 2A9NH 1MLCB 2IH1B 4IMKA 2OR8A 1HYSD 4K9EH 1QLRA 4KKAC 1AJ7H 4XVJL 2QSCL 3UBXG 2VR9A 4JFEB 4JFFD 2DOCA 3KYNB 4IHOB 1PKOA 3OKLB 4OLWL 1DBMH 3OKNA 1D5IL 4QRRE 4X80L 5IEKA 2OJEA 3HZMB 3G6JE 5DVNA 3B2VL 2ATPA 4OAWB 5C0AD 2XACC 4NRXA 5C3LD 3VXMD 4L8CA 5GS2D 4IRJA 3GIVB 3C87A 3MFGB 1LNUA 2ESVA 3GMLA 2EICA 2XZAH 4OZHB 3QDHA 1HQ4B 3MLRL 5I0DA 3STLA 4FXGB 1KB9J 3MMEB 1S5HB 2IGFH 2EE3A 2W91A 1A1OB 3L5JA 2AERT 2AJZA 1IC4L 4G6JL 1MFEH 4DKFL 1DVFB 3ZHLA 4LVNC 5MI0B 3H9SE 5T3XH 4BSWA 4F80A 3TF7C 2Z8WC 1NGXA 1PZ5A 1W0VB 2FIKA 1VFUA 1CR9H 2CKBH 4HMEA 5FO9A 1XGRB 3GSVA 2IAMB 3EDJA 4HBCL 1EX0A 4ZS6C 2Z91A 4JCLA 3V6BR 3VWJC 3QUXA 3HMWL 3JUZA 2DDQH 4LSUH 2R39A 1INQA 1EMTL 3WNLA 5BZDA 3DO7A 5MEOA 1WLHA 1GGBL 3OHXB 5ITFB 4MZ2A 3H3PH 1SBBA 5DC0A 1KJMA 4HKZB 2ZG3A 3TV3L 4P2QD 5HGAA 2X41A 5C2BL 2HJFB 5J9PA 4ZAKC 4LCWA 4M3JA 3VXTA 4ZFGH 2G60L 3WD5H 2NY6C 2DL2A 4Y1AD 4KRNA 2AGJH 1F11B 1XCQA 3LRSA 3PWUA 3L6FA 3MRQB 3GSOB 2HMIC 4P5KB 3BO8A 2J6EL 3OKDA 4LEOB 5HI4C 1YQVL 3EZJB 5MENB 3B9VA 2B5IB 2X4UB 4HIIA 5I19L 3B9KA 3GMPA 1SEQH 4HS8L 5IK3B 2QADC 2BY1A 5CCKL 1IAMA 3QBTB 3BHBA 3T8XA 3U6RA 3DBXA 1S7TB 4YZFE 4IRSA 4LU5H 4Q9BA 1MOEA 3Q6GL 1AHWC 5GSRA 3RWJB 3SE3A 1G9MC 4WHYH 2GTWB 4L9DA 4F7EA 4WJ5B 3EO1B 5BV7H 1XF3A 4XWOD 4ZUWA 3IDGA 3KR3L 4YXLL 1UACH 3TBYA 1PY4A 2WNGA 5KOMC 4F8QA 1G7HB 4B7LA 3ARDA 1WCBB 3GHEL 3RTQD 3QQ3A 4N0CD 3TN0D 4APQD 4JFDE 5SX5H 1H5BA 4PRIB 3OX8B 2ORBH 1FO0L 3UPRA 1JPST 3U36A 2CLRA 5GS2H 1GOGA 1J8HE 4ETQB 4I77H 2GJ6B 4LSVL 3BH9B 4A6YL 4HWZA 4RWYH 3W0WD 2A6JB 4XPTH 1B6DA 1JFQL 3IDNB 5D9SA 5I8KH 1JWSB 4P59H 4KAQL 4KXZI 4GFTB 4P4RB 3SGDH 1MCWW 3KPSE 4BA8A 4OD3H 4AEEA 3L9RB 4XAWL 5ACZB 1C08A 4LIQH 4FA8A 1OARH 4OV5B 3D2UB 2AXJA 1RIHH 1PG7W 2DBLH 3ROLA 3TESA 1EXUA 1WFUA 5ENWB 4YHIA 1QR4A 1NH6A 5ECJE 1FLRL 4H25A 5IVZA 1C12A 4KK9C 5I76A 4YHKH 1KN4L 1U3HD 1S7QA 3QEQA 4HZAA 2EKSA 2AI0H 1CK0L 5B8CA 2WW8A 3AREB 4LHUA 5HY9B 4KMQA 5DJYA 4J6RL 1BZ9A 1YMHB 5TDPB 3DVIA 1QKZH 3U30C 3ZTJG 1U9KA 1XCTA 2CRYA 4U05A 4AZ8A 3GI9H 5F1IA 5JHDA 3F7VA 3ARRA 4W4OA 3WN5B 1OAXH 1T3FB 2AEWA 2IH3A 3TJEL 5J6GB 1IGCH 1U42A 5C1MB 3U0PA 2XA8H 2XRAL 3QT2A 5J8OA 2VC2L 4EQ2A 5AZEL 2VIRB 4KWUA 1A7QH 1MFCL 1RIVL 3ZSSA 5IEHA 1MH5B 1P5VA 1TZHA 5L2KD 4Z7WF 1F2QA 2KQNA 1UQSA 1U92B 4FTVB 3TYFA 3UO1H 3V52H 2IADB 1QUNA 1RZ7H 5J13C 4MX7A 5HD8C 5EIIA 5IFAL 3BSZH 3CFJB 4N9GA 1P4BL 5EOTA 5FDYA 3VXUB 2RIKA 3UYRL 3VFGL 3BT2H 1T5WA 4PJDF 2EYRB 1M71B 4V1DE 3SE8H 4UDUA 1AKJD 1QYGH 2ITCB 3D3VE 4UT9H 2PO6B 2PXYA 3T0XA 5D1XD 4YHMH 3QQ9C 2KQMA 1HHIA 6FABL 4U6HA 1JUFB 3PWJA 4ZQKA 1UB6A 3G5ZB 1HYSC 1QFWI 5EU7C 1NGWB 3VD4A 4EZMA 4TVSa 4Z7WE 3GBML 1N3NA 2HFGL 5GJTL 5BRZD 4MNHB 1IAKB 2HLAA 3EFFB 1DP0A 4UTAH 4V2CB 4WFHE 2IFFH 4G6FD 5EA0L 4DGVH 3BPNC 4JO1L 2FJHA 5EN2A 1CN4A 2ZKHH 3VXRD 1RZIB 5FYKD 4M6NL 4XNMA 5GSVA 4Q0XL 1YYML 2F58L 3BIBX 1FLTX 3QUYB 3B3IA 4LVHC 2R0KL 5GHWH 1E4XI 4R7NB 2V17L 5JXAL 4TVPD 4NQSA 4MNQE 3TWCH 3QEHB 3O3DA 1HXYB 2HT4D 4XC1H 1Q94A 2GCYB 4PGBA 4Z7VE 4J3UA 1Q0XL 4KI5F 4CU6A 1J1XL 1CD0A 4ISVA 4E0RA 1CGVA 1NC2B 4Z78B 5CBEB 5ID1B 43C9A 3LHPH 4Q9QH 2DICA 3CSBA 4XNQB 5E8NB 1OAYL 5FCUH 1HWGB 5FYJL 3W81A 1ZHKB 4XCNA 4PBWD 1FSKB 4BFEA 1UEMA 4EUPH 3RY5A 2XZZA 1HDMA 3SO5A 4HGKC 4FP8L 5E2TH 1VESA 3SBWA 4NKOA 3FQRA 3KYOA 5CZKA 1CE6B 4U1NA 3GSQB 3QUZD 4I8DA 1I8KB 1GXEA 1NANH 3KPLA 1PQZB 1OP5K 3O2DL 3MRDB 3DX8A 3VG0L 3TO4B 5DEGB 3QIWB 2FEEL 1TTGA 4KI5E 4RISH 1MCEA 2GUOA 1MCKA 4JFED 2W9LA 3A67H 3IFLH 4JN1H 4ODXA 1KJ3H 3FQUA 4M7ZB 4K3GA 3S36X 2ESVE 3K2MC 5I8OL 4GMTL 4PJ7B 3BPLB 3D85A 4ZXBC 1U8LB 1QD0A 5ICYA 3H6JA 1H8OA 5BVPH 1I1AA 2YS4A 1XGPB 1MI5A 2OX5A 3OKKA 2XWJB 3VGFA 2BCKA 3BZEA 1ODAA 4FS0A 1WK0A 3MROA 2BMKB 3RWIA 4KQ3L 1SJHA 3GGWA 1NL0L 5FYLD 4J4PD 1YNTA 2NYYD 5DS8B 4XWOC 4WGWB 4Z76B 5EC2A 1EGJA 4R6UA 3UJIL 1N59A 4LGPB 1YN6A 1JK8A 1FPTL 3OTTA 3BRFA 1HH6A 2H32A 2MFNA 3CVHA 4U4BA 1MJUL 4NT6A 3X3FL 3S98A 4N0CC 1DVFD 3TN0C 4APQC 2B0SH 1ZANH 3MYZA 2YA1A 1C5CL 3ALXA 3BZFA 1SEBB 4F9LA 3MLVH 1FORH 4UINL 3CCHA 4J12A 4OLYH 1S9XB 4DAGH 1U58B 3CSYA 2IAMD 1QACA 4NO5B 3TCXA 3R1GL 3H8NA 5FYKH 3OAYH 3IDUA 3MA9H 2MHAA 4WW2C 4RFNB 3TIDA 1MFDH 3MUJA 3MRHA 3U9PH 4ORZC 1T1XA 2ADIB 1KEMH 3ZTNL 4LCWE 3ZE1F 3QNZB 5EZLB 1JYNA 4G80A 2WZPD 3E0GA 2D03L 2LU4A 3PWLB 5IB4A 5ERWB 3VXOA 1UWXK 5E4IA 3NGBB 1NBZA 3VRLF 2YD1A 3DSNA 3MLPA 5DTFA 1U3HC 1XF5B 4ELKB 5MEND 1HSBB 4FXKB 4HWUA 1UA6L 2DQTL 1LDPL 4FNLL 4DKDC 1FZMB 2XTJE 5IT2L 4DKAA 3TH4T 5GIRB 4NNXB 4JVUA 4MNGA 3LQMA 4G8IB 1ZTXH 4R90L 3U0WH 1I7ZA 5F96L 3ZE1E 3V8CA 4PS4H 4WUKL 1RFDH 3VG9B 4YHNA 4F7CA 3ULVE 5B21A 1T1ZB 2K7PA 3KWWB 2R9HD 3BPOB 2VDLH 4YDIH 4TSCL 4DCQB 4M1DL 2HFEA 3CDFA 4PRID 2BP3A 5J1TC 3VRLE 2VLKA 3C9NB 5FHAL 4J23A 3TFKD 3T4YB 4HS3B 4HHAA 3U82B 2P5WA 3HMXA 4LQFL 1I9JH 4OB5H 1TCRA 5EBLA 4YXKH 1NCBL 2BSRB 5D71L 5T3ZL 2GJ6D 1AQDA 5E8PA 3SGEI 4R0LA 4RFOH 4MXWL 5FYLH 2P24B 2QQLL 2UYLA 5DJ0B 3G6JB 3FMGL 3QJHA 1QFWM 2O93L 5D1XC 3WJLC 4FZ8H 1XGTB 5C7XH 2A6IB 1UB5A 3SY0B 3V2AR 3D2UD 1UJ3B 4G3YH 3QEQE 3BMVA 3MBXL 3V8OA 4MHHI 3IXTB 3NCCB 2RCSL 1LE5A 1CDUA 1U8IB 5A16B 5BS0A 4GG8A 4L29A 4U1SB 4DN4L 1N0LA 5DFWH 4W68A 1AFVL 2Q8AL 2XT1B 5I1AB 2CR6A 3I6LE 5KSAB 1IZJA 3ARED 5B3JE 4L9LC 1TZIA 2E27L 4NJAH 4Y5VB 2PW2A 2AK1L 5EOQH 1B0GB 4DZ8A 5EH1A 5ALBH 1A9EB 5IMKB 3VE0B 3Q3GA 4QXUL 5DJAB 1CFQB 4OTXH 4HGWB 1AGBA 2HT4C 2Y1VA 1UM6H 3G5XA 1F6AB 4XMKL 1DBAH 4LEXH 3N85H 4XBEL 3UTQB 2JB6B 3INUL 1P4LA 2J8UF 4OFYD 3HZKA 5DD1L 4U1LB 2EC8A 1A9BB 5FCSH 4CW1B 3N50A 1AP2A 2Z8RA 1M7DA 1HNFA 3JV6B 1FL5B 1W0YT 5IBTH 1B2WH 1T83C 5E8OB 5GRUL 4EI5A 3VXUD 3QJFB 5C9JB 3LKSB 1OQOA 1OD9A 1MJ7L 1VEOA 2P5EA 5TE6H 1BFOA 1UVQB 1NCCH 4U2YA 3QUZC 1U8JA 4KPHH 2CJUL 2PO6D 1JJUA 5HHOA 1RHHA 1KOAA 5D8JH 1KCKA 5DJ8A 3S35H 1HYRC 4OFPA 2J1KA 5EUKB 1KLGA 4UUJA 1O7VA 1DUYA 1J86A 5LWYL 4QHNA 4U1GB 5SX4H 2VERN 2K9UA 4ZFZB 4UIMB 2BSSA 4GAYA 5E95B 2PTTA 3BWUC 4QT5A 2AEQH 1NCUA 4GRWE 3DECA 1DQJB 4LHUG 4MAUL 4NQUA 2V5SA 2QL1A 1PSKL 1UCBL 4Y7MA 4LSRH 3ILQD 1CR9L 2DYPB