2C3HA

Structure of cbm26 from bacillus halodurans amylase in complex with maltose
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
SGLTIYFKKPDSWGTPHLYYYDTNPKVDEPTWSEAPEMEHYEGDWYTHTIEGVESVRLLFKDRGTNQWPGPGEPGFFRDQDGWFDGEWHVDRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate-binding module
molecule keywords ALPHA-AMYLASE G-6
publication title A Structural and Functional Analysis of Alpha-Glucan Recognition by Family 25 and 26 Carbohydrate-Binding Modules Reveals a Conserved Mode of Starch Recognition
pubmed doi rcsb
source organism Bacillus halodurans
total genus 14
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16738 CBM26 Starch-binding module 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c3hA00
3ULUH 4Q9RH 4IIQA 3MLYH 4JB9H 1U8HB 1T5XB 1JNNL 4X6DA 1U8IA 3KLHD 1UXWB 1U58B 2XKNB 5I74C 1ADQH 4UNVA 4QRSA 1UA6H 4NWTL 1QQDB 1BZ9B 3I75A 1G7HA 3JZ7A 4PGBA 2DBLH 5EWIH 3TPKA 2GCYB 2ZNWA 1BFOA 4Y89A 3BDXA 1O5DT 2BNQA 1YNKL 4FQ2L 2NR6D 4GXUM 5K9OA 2Q7NA 1AO7B 5FA4A 4YLQT 4GMTL 2IAND 1XGQA 4H25A 3GK8L 2V2XA 2NXZC 1CLZL 1P2CB 4OZFB 5HVGB 1PG7X 4QXTB 1NMBL 1I7ZA 2BFVL 4F7EB 1CFNA 5EIQA 4ODHL 3V4PH 5TQ2H 4ZOEA 3OAYH 4P5MA 5D7JB 3QI9A 3MYZA 1MJUH 3CVIL 4PR5B 5DJ0B 1OAUH 1CDBA 4TULH 4PGDB 4XWOD 1LILA 1Q9KA 1QHPA 2MQ0A 3SDCC 4MNGA 3RJQB 3S34L 1MHCB 4JFFD 4P48A 1CL7I 2FL5A 3ZLQC 4Y4FA 2N56A 3QG6B 5FUOL 3KAAA 4ZAKB 4GBXA 4K7FB 2F5BL 4MNQE 5ICXB 4WWID 1P4IH 4K7PH 1JPFB 3V6ZA 5MEQB 4TPRH 4F37K 4OZGA 3L5HA 1WWBX 1YY9C 2VLRE 3QUMB 1T5WA 4K3HA 4JFDE 1BIIB 3LCYA 4XCYB 3VGHA 1RAMA 1DBML 4ZS6D 5GGUA 4JAMA 1Z9OA 3PL6B 4XNUH 3NIGE 4ODTL 3WS3B 4I5BB 1M6OA 4Y8AA 3RL1A 4JDVB 1F3DH 4RZCB 1MWAL 1PKQA 2VE6B 5D7KE 5L2JA 2DDQH 4UNUA 3MOAH 2BERA 1W72B 1LE9B 3DGGA 1DN2A 3O4LA 4KTEH 2BY2A 1FZOB 2BMKA 1NFIB 5A2IH 3PHOA 4H20L 4JE4B 2XIDA 4TSBH 2FX9L 2EH8L 5EA0H 4KVNL 1IAOA 5E1AA 2DQHL 3GJEA 4HWNA 3QUZC 1KBGL 3DIFB 4RDQF 1ITBB 4M8QB 3MJ9L 2PR4L 4XC1H 2J4WL 5C8JB 3AGVA 1DQJA 3GMNB 3NZ8A 4GRLD 3ZHKA 1NAMA 4HZAA 4BQCA 3RY4A 4Y19E 2G60L 4O51B 2GITB 1WICA 3T0DA 4EUPB 1QFUL 4ZFZA 1HK6A 3M17A 1A5FL 3T08A 5EU6B 2A6IA 4G6FD 1KJ2B 4DWHA 3U46B 4XPHL 5F7HA 3BP5A 3TJHC 2HT3C 4PJXF 1ZT7B 3TN0D 2Z35A 3RY6C 2P46B 1EV2E 5F3HB 4LU5L 2VRAA 2X44D 4JO2H 3Q1SL 5MHSD 1Q1JH 3MV11 3ILQC 1T4KB 3LN5B 2AEPH 2AQ1A 2IALA 4J2XA 1P4LA 3F8UB 5T1LA 5E4EB 2ZUSA 3T09A 4NGHL 5DQDL 4XPAH 4GKNB 4PRDA 5DQJA 5ETUA 5EU5A 3SO3B 3RDTB 1FGVL 5DRWB 5DDHB 5EO0A 1IEAB 1T3FB 3DYPA 3MRNB 3W9DB 4OCYL 4J1UB 4QRRD 4WDIA 1AO7E 5FDWA 3QRGL 4X99A 2FR4A 3P9LB 1ACYL 5I66B 3OAZK 1HE7A 4LLWA 2RGSA 2A6JB 2Z91B 5EO1B 1MHPH 1YA5A 4M3JA 5DHXB 3PV6B 1JE6A 1NPUA 3MRLA 3VH8A 2OTUA 3OR7A 4MAUH 4I0PD 5FYKH 3KPOA 1JWUB 2P7TB 4QLRA 3WSQL 5IB5B 1JJUA 1DBJH 1PGRB 4Q9QL 2Z31A 1P4BH 1HH9A 2HJKB 4GKOA 3OKEA 4PJ9D 2X4SA 1J0KA 3MR9A 4JFXB 1V7MH 2XPGA 2Z0BA 4PY8I 3NAAL 1BQHG 3K74B 3O6KL 4OTXH 5GGQL 3V6OC 4XWGL 3O8XA 1BFSA 2DMBA 1KN4H 1N5YL 2EYTB 2ED7A 1OTTC 4WTZG 4XVJH 5DFTA 1CDGA 4OV6F 2FB4H 4ONHB 2EDKA 3FT3A 4HUWA 3TWCH 4P49A 3S5LA 1UH3A 4LIQH 5CGTA 3WJLA 1BBJB 3BEWB 1MCLA 4TRPL 1BAFH 3HB3D 4EN3D 3DHMA 1TJIL 3VG0H 5B38G 4MNQD 1FFNA 3RUGB 2AGJL 4X8JB 2NY1D 2RCSH 3QZWB 4HMCA 4J3VA 1CU4L 4G80B 3UC0L 2VLRD 3BP7A 5FOBA 3M8OH 4KVCL 4Q9BA 4UQ3B 4JFDD 4XMKL 3KJ6L 1CXHA 3LN4B 5I1JH 2DBJA 4JM2D 4L4VE 5DYOA 4DVRH 1F4YH 1XGRA 1QLEH 3MA7A 2A1WH 2B1HL 2IMNA 3WIFB 1A7RH 3LDBB 1FFOA 4CADA 2V2WA 1P9MA 1ZSDB 5D7KD 3HAEH 3PWNB 5BZDA 2HFFA 1ZT1B 1FAIH 1QR1A 2FX8L 3BDYH 1MH5B 3L3HB 2YA2A 1CG9A 5CUSL 1BBDH 3QEHA 4HAGA 1S7QA 1NFKA 3NVQA 2MMXA 4ISVA 3DOSA 5DO2C 2H45A 1IGCL 2IG2L 1G7IB 2WLYA 4URTB 2EXWC 2OLDA 3PWLB 5EU6E 3BPNC 4YK4C 4BQBA 3CNKA 3B6SA 4M02A 4P5TB 5FUCE 4Z7QF 2FX7H 5FGBC 2IC2A 5I8EA 1AIFA 1RHHB 4QF1A 1AXTH 3JTSA 4JCLA 4FQIL 1LE5A 1G7LB 3ZDZF 2MCG1 1X5HA 1JFQL 1I7RA 3IJHA 4MCZB 2JB5L 4O02H 3VXTA 4LAJH 4OLEA 1UM6H 1AGCA 3C6SA 2UWEB 3PWPA 3MJ8B 3BSZH 1IKFL 1ZHKA 3RQ3A 1H3GA 1B2WL 2W9EL 3CAFA 4PJXA 4U3XA 5CSZA 1S7RA 3TIEA 5JHDA 5JPNA 4OF6A 4F3FB 2H3NB 3KR3H 4Y16B 4D9QD 3NGBB 3X14A 4QOKB 2VDLL 1QO3B 1PSKL 2AJYH 2LFGA 1NSNL 1DDHA 1KJMA 1A6PA 4KI5F 2Z4QA 2A77L 5CHNB 2DTSA 3I3EA 2X4NA 3U0PB 2CLZB 2ESVE 5CZVL 3LKSB 3NPZB 1DANT 1J8HA 1RJYB 4YFDB 5HI5C 2FIKA 3U36B 4G9DB 5KSAC 3O6ML 1UWEL 3VXQA 1HHKB 3UYRL 1AO7D 2ZOLB 3AAZA 5EZJA 1VDGA 2XOTA 3CMGA 3WO4B 1TJHH 2B20A 5FKPB 5C86A 4IMLA 3K2UL 3VXRA 3GMLA 5AG9A 1OAYL 3BXNA 3MTRA 4WI4A 5IHLB 3IFPB 3VD3A 4Y5YA 4JKMA 2W9DL 1CR9L 5D93C 5HI3D 5E95B 1YMHB 1DSFH 2MPAH 1NMAL 4CU8A 2HFTA 2CR3A 1KPRA 3DXAB 3GRWH 5DC4B 3W5NA 1A7QL 2Y07H 1K8DA 3AS1A 1LDSA 4IIQB 1OQXA 4X6DB 1U8IB 1YNLH 3IFLL 3HNTH 2CR6A 4ZAKD 4IRJA 1ZVSA 1HSAA 3RUGE 5J12C 1FCGA 3ULUF 1SEQL 5DEGA 3HC3L 3QR2A 2YD2A 4QRSB 1A47A 5JORA 3HNSL 1SJHA 4D0CA 3I75B 3FMGL 3G6DL 5EC2A 1G7HB 2FD6L 4PGBB 1AHWC 4B7LA 4P2YA 4XCCH 1PLGH 1BFOB 2ZCKH 4ODSH 2BNQB 3MZTA 2DQUH 1HQ4A 2XWTA 4NN6C 5K9OB 1DL7L 2JB6A 5FA4B 4MNHA 3N06B 1XGQB 4KKAD 2ORBL 4H25B 3VXPA 2V2XB 1KEML 2JLLA 2B2XH 1WV7T 2HTKC 2VH5H 3GSRA 2OZ4A 4DUVA 2ADGA 1I7ZB 2OM5A 4L4VD 1CFNB 5LQBL 4POZD 2FHBA 4P99A 3R8QA 3QI9B 1V5JA 2XZCL 1FG2A 3CK0H 4P46B 5J1AA 4XZUA 4LSQH 4M6NH 2DKMA 2YC1A 4TUOA 5KS9E 3UJJH 5A43C 3D85B 1QFWI 4FXGA 1DJSA 1Q9KB 1JZ2A 2VKXA 1JRHH 4LCIL 4NZUH 3MRJA 1EEZA 4MNGB 4O4YL 3RVTD 3LH2H 3MOBL 5E2JA 1AC6A 3JXAA 3R06A 5HHNA 2FL5B 4EI5A 4Y4FB 3TO2A 1NGQH 4GBXB 4NJAL 2IQ9H 2Z8VC 3U4BH 3RRQA 1U3ZA 3V6ZB 5EU6D 2UWEE 2GJJA 5CMAA 1YYMH 5JLZA 5CSGA 4OZGB 4QHKI 5JW4N 4JM4H 4ZXBC 1T5WB 4XNMA 1VCAA 2J8UF 5GGUB 4OD1L 4JAMB 4JO4L 2WBKA 2JK5A 5F9OH 1ONQA 4OQTL 3G08A 2G5RA 4M5ZH 4PV8A 3TM6A 5TPWH 1M6OB 3RL1B 3ARPA 3MV8A 1RUKL 4IJ3B 4HZLA 2CXKA 4J4PC 4KGJA 1NUFA 1PKQB 2IEPA 2WP3O 5L2JB 1RUQL 1OQOA 1WCBA 5F1OB 4Q9CA 3RVWD 3VWJA 1VERA 3DGGB 4GS7C 3DETD 3O4LB 1R0AL 1YEGL 5I15H 2BMKB 3PHOB 4M4RA 1CE6A 1IAOB 1TETH 5E1AB 3ZDYE 3GJEB 1T6WA 4JQVC 4OF3A 5MI0B 3WN5A 4EKXA 2D7TH 4J3WA 3ARGC 1MCHA 4OGXL 2ESVD 1DQJB 3NZ8B 3H9SA 2CK0L 5BQ7A 3HI5L 5JW3H 1I9RH 4U6XA 4EEEA 5BV7B 1NAMB 3N9GH 5DD3L 5KAQF 4HV8A 5TJWK 4JFEA 4ZFZB 5AUMA 3M17B 3AVEA 1X44A 2BVUA 2A6IB 3T0EC 3F5WA 5C2UB 1CIUA 5J3HC 2QADD 2PYEA 3LVEA 3V4VL 3BP5B 3FFDA 1C5DA 1RK1A 4RMVA 1FDLL 3PXHA 1S78D 5E2TH 3DX7A 4NNPH 4X6DE 2R2BA 2Q8BH 4KUCD 3EGSA 1PX3A 4M7JH 2ARWA 3WE6A 5CBAA 1QD0A 3LV3A 2XNAA 3MLUH 2IALB 1P4LB 5T1LB 2DQTH 4FG6C 2OI9C 3IDYB 3RWHA 1KCVH 5LCVH 2JJTA 1ZLUK 4PRDB 5DQJB 2WQRA 5ETUB 1IBGL 5EU5B 2BNQE 2A0LD 5EO0B 4XH2A 3HZKA 4PLJD 4WDIB 2OXHA 5FDWB 4UBDD 1GJIA 3QWQB 4X99B 5DWUL 2NYYD 2FR4B 4H5SA 2J3SA 1CXIA 5GJSH 4LLWB 1B0WA 1PX4A 2K7PA 3SBWA 2QQQA 1ADQA 5IWLC 3V4UL 5DD5L 5SX5H 1MFBL 3MRLB 4F7PA 3VH8B 2OTUB 3OR7B 4WU7A 1KB5H 1R3HA 2N4IA 1HNFA 3KPOB 5C0AA 3ZO0A 2DLFH 3GSNH 3LKOB 2AK4D 4XC3H 2YK1H 1IGIH 3MFGB 5D71H 2P43B 2Z31B 1OP9A 9CGTA 1HH9B 3OKEB 4HCRL 3GI9H 4MNGE 4K3GA 4M3KB 2X4SB 1AFVL 3TT3L 4TN9A 1KB9K 3MR9B 2VN4A 4WI2A 5EBWA 2XPGB 4BM7A 1WWWX 2X9YA 1QSFA 3H7LA 1D9KD 2VERN 3O8XB 1NUDA 5CEZH 1UQSA 4M6OH 4CL7A 3A6BH 2EDJA 1ZLSL 3FT3B 4HUWB 3MLVL 3GSQA 3ZE1F 1GVIA 5C0CA 4Q6IA 3S5LB 4R4BA 4OZGE 5I8OL 2XN9A 3WFEH 2AABH 4G6ML 3JSSA 2DB8A 3HHRB 2A9ML 2ZUUA 4GQ9H 1MUJA 3IDUA 4E41A 3RVUD 2EE6A 4Z0BH 3GBML 4ZYKA 2J88H 4O9HL 3HMWL 2L7UA 3BP7B 1PKQE 5F6HJ 5JNYA 5FOBB 1W2KT 5I75C 1IARB 2I5YH 4LCYA 1IM3A 2J8UA 3MNZA 3TFKC 4EI6A 3TBWA 3O4LE 1XGRB 3MA7B 4PRHD 2ATKA 4RAVA 4PJGF 3C60C 3LRSA 1D6VH 5JOPE 1ZEAL 1INDL 1FFOB 5C0JA 3QXDA 4CADB 4PP1C 2V2WB 1HILA 3RIFF 4LLVA 3F7RA 2ADFH 4OLUH 3QAZC 3DV4A 2HFFB 1QR1B 5AZEH 1CG9B 5GRUL 3QEHB 1S7QB 1F3DJ 4W4OC 3L5JA 4ISVB 1MPAH 4PRPE 4JY5L 2BHYA 4GXUN 3WFDH 1LD9A 1RZGA 3MGAA 4HJ0C 3STZA 4ZUVA 4MB3A 4CMHC 3B6SB 3EOAA 2OP4L 5I8EB 2V9TA 3ARDD 1AIFB 4QF1B 3JTSB 1LE5B 1L0QA 3IFNL 1AGEA 1EJOH 4LCCC 4QHKJ 4Y4HA 1I7RB 3IJHB 3VXTB 1AGCB 3C6SB 1R5IA 1NC2D 5LG1A 3PWPB 1KLFA 4GAJL 2BNRA 3UDWA 4HJJL 1ZHKB 5GS2H 2E8YA 4WTXA 5DD0H 1U8OA 4W6XB 3GO1H 4PJXB 4KKLD 1S7RB 4FP8H 5CSZB 1ZA6A 3TIEB 5JHDB 5JPNB 1NCCL 1EAJA 5HVWA 1K4DA 3CDCA 3X14B 3BZDA 3BJ91 5KW9L 4R2GD 1JF1A 5E7FA 1KCKA 1DDHB 4ZFOL 3O9WC 3O45A 5D6DC 4N0YH 4WO4C 2Z4QB 3S4SA 2GT9A 4DTGH 2X4NB 5FYJD 3ARUA 2VDKL 3GJFH 4Y5VA 2JCCF 3VFGL 1EVUA 1VPOH 1J8HB 3ZMRA 2BNQD 4I3SH 1JZ3A 1T1WB 3W81A 2P47B 1X5YA 2FIKB 3VDAA 2B5IB 3VXQB 2NQCA 2E9WA 5EZJB 3O6LL 4IMLB 4WGWB 5IB4A 2BJML 2P48B 3VXRB 3GMLB 5FECA 3BXNB 4MCYA 3CMOL 2PO6A 3ELAT 1IGFL 4HLJA 1GSMA 4KKCD 2V5YA 2NY3D 4LLMA 4Y5YB 1L7TL 1NEZG 4XCEA 2BP3A 5IHUH 3V9FA 2WUCH 4PJ5A 5ANMA 3B9VA 4EDXA 2KPNA 1CK0L 1DQDH 1KPRB 3OZ9L 4AL8H 3KLHC 3MLTA 1I1YA 4D0BA 1FL6A 1BWWA 4KKBD 4KHXL 1K8DB 4K94L 1GHFL 4YDIH 1A6WH 3N50A 3OKNA 4GBXD 4IRJB 4X7TA 1ZVSB 1P84J 1HSAB 4ZD3H 4YR6A 4CBPA 1SMAA 1MFDH 1YDPA 5DEGB 1TPXB 2K7QA 5JORB 1SJHB 3WYRA 2W0FA 4XVTL 2NR6C 4D0CB 5E1HB 5TGBA 4HF5L 3ULVE 5EC2B 3EYFA 2CKBH 3MRPA 2F19H 4G8EA 1UJ3C 2H41A 2OMNA 4WUKL 2IH1A 2AJ3A 2F54A 3GEWB 4JPWH 5BO1L 1FLTX 1HQ4B 2XWTB 2X41A 3HI6H 3X13A 3A67H 2DN7A 3FFCA 3I50H 4UDUA 2JB6B 2F58L 4YDLC 3BMVA 3VXPB 3TO4A 1UACH 2X6MA 4YWGL 2QBWA 3GSRB 1AGFA 4U7KA 2ADGB 3QHFH 1OT2A 2EDWA 3CIQA 3WCYA 4P57A 4XWOC 5C2BL 4M03A 5F7LB 5B39A 4HT1H 1Z5LA 1TMCB 4PJGA 5L0QC 1FG2B 5JOPD 5J1AB 4XZUB 4P4KD 2YC1B 4TUOB 3CGTA 5HI4D 4DK3A 1NMCB 4IOFD 5MERA 4FXGB 3MRJB 1WZ1L 1K5NA 1EEZB 5E2WH 2G9HA 2ERJC 2OSLA 4LVEA 5IQ7H 1J86A 1H5BA 2BK8A 2R23A 1N7ML 3R06B 5HHNB 1A7OL 3WXWH 2NXYB 3AROA 4EI5B 3TO2B 3HAEA 1CLCA 2VLLA 4PRPD 25C8H 1OSZA 1S5IH 2APVA 4K94C 3PWPE 1SM3H 4XP9H 1GGYA 4UIMA 4ZS6C 5CMAB 5JLZB 3U2SA 1ULVA 1YPZF 1E4JA 4IOIA 2RIKA 4XNMB 4HD9A 4PJXE 1OP5K 2KDGA 3TIDA 5E6IA 1FE8H 4FZ8L 2Y7QA 1C5BH 1AY1L 4RA0C 4XPGL 1NANH 4NFDA 2R29L 1T2XA 3MXWL 1HOCA 2JK5B 1ONQB 3SE4C 5IMMA 3MV8B 3S35H 3Q5YA 3BKML 2GIYA 4HZLB 1EEQA 1BD2A 3EAKA 2YUXA 4J3UA 5C0FA 4Y5XA 1REIA 2IFFL 3CLFL 2X1PA 1WCBB 1N6QH 4QTIL 1D5XA 3VWJB 1KNOA 1J8HE 4LFHD 3NCJH 5D8JL 1JNHA 4TVPE 4UUJA 1CE6B 4GRLC 4OUUA 2QQLL 2Y36L 4PD4K 2QEJA 2DQJL 2CJUH 3WN5B 3VXRE 2JCCA 4DGIL 5ACZA 3H9SB 2YN5A 3WIIL 5BQ7B 4U6XB 2EE3A 5GGSA 1YEEL 4HXAL 4APQD 3U0WL 3IJSA 4HV8B 4JFEB 5HDBE 3QDMA 2FDBP 5AUMB 1J87A 2WUBL 2D0GA 3TN0C 3QHTC 3GHBH 3F5WB 2Z31D 1OGAD 1MF2H 2C4FT 2BZDA 2PYEB 3KXFA 4LOUC 3PDGA 3H3BC 3U9UA 3JV4A 4U0RB 5HYQA 3FFDB 1C5DB 1RK1B 4WV1A 3T0XA 5I30H 3O0RL 3JTTA 3DX7B 3RWCA 4X9BA 2R2BB 3HRZA 1P6FA 1RQ5A 3EGSB 4J6RH 3MPCA 5F96H 3WE6B 3WDIA 1II4E 5CBAB 3LV3B 2XNAB 3K1KC 1U0QA 2UUDH 1JL8A 1YECH 3RWHB 4DEPC 1ED3A 5IG7A 2AW2A 5DUMH 3WUWA 4ENED 2WBJD 3GRWA 4UINH 3WFCH 1VACA 3V79C 4OJFL 1VFUA 2AI0L 4XH2B 3EJZD 2BHUA 3HZKB 2EKSA 3EJJX 5K33A 4H5SB 1XCQA 4OUOA 1HDMA 3B83A 3ULVD 2Z8RA 1N5AA 3DVIA 4BZ2H 4HIEA 5CZKA 3MJGX 3S7GA 2EDLA 3RNQA 4GOSA 3BH8A 4F7PB 1FNSL 1GPOL 3BZEA 3I2CL 1MNUH 4WU7B 1R3HB 4PJ9C 4KY1L 5C0AB 1T2JA 4M7KL 1SJEA 3MLWH 3EDFA 5F7WC 4NO0D 1IAIM 4Y7MA 2E6QA 1DFBL 2DQCH 2X09A 2IF7A 5EBWB 1QSFB 3RAJH 4XVSH 5L8LB 4FQXA 5SWZA 1E6OH 3L3JA 1JGLL 1UQSB 2AJVH 2FIRT 1JGDA 3ARBA 3HB3C 2X1OA 5IROA 4C58B 5CFHA 4EN3C 2HH0H 3BI9X 5T3ZH 3GSQB 5C0CB 4Q6IB 2IPTL 4Z7QE 1RUPH 1YEJH 4NBXB 4R4BB 4JFZL 2XN9B 3DLQR 4OD3H 4R0LC 1AD0A 4LLYA 2NY1C 3ZDZE 5EIVA 3RWGA 4JHZA 1LNUA 1FH5H 5HPMA 2BRRH 3S37H 1MUJB 4WWKA 4Q6YA 4YHKL 4E41B 2DQGL 1AR2A 3PWPD 5CJOL 4JM2C 5C09A 2HWZL 4HLZH 4GQPH 1FIGH 4ZYKB 5BMFL 3ME0A 5JNYB 1CGSH 5HHMB 4PLNC 3ARED 2AV1A 4LCYB 3QFJD 1IM3B 2J8UB 3MNZB 4EI6B 4PG2C 3TBWB 3QCVH 5EOTA 5ILTL 1JTOA 2DQIL 4P9MH 2ATKB 4RAVB 3LRSB 1H0DA 2IAMD 3FRPA 5C0JB 3QXDB 1EO5A 2ZKHH 1NBZA 4KI5E 1HILB 4LCWA 5JUEH 4LLVB 2XWJA 1FIEA 4WTZA 3L5WA 4D9LL 4NNXA 3DV4B 4NN5C 5GS0L 5I1GL 3I6GA 2YPLA 2X70A 1KCSH 4L3EA 3F58L 4A2MA 1JGVL 5K9QG 2P45B 1RIUL 3WEXA 4FQHA 2DOCA 5FIEA 1LD9B 1RZGB 4M6MH 3STZB 4ZUVB 5I9QB 3TYGL 3L7FA 1ZMYA 3VFVA 3EOAB 4RFEA 1RFDH 2PYEE 3VXRD 1QFWL 1KPUA 4MQ7A 3G04A 5DQ9A 1H9VA 3ZYOA 1AGEB 4Y4HB 5HYEA 3SKMA 1JNLH 3SJVD 1LMKA 3RU8H 1A0QH 5JW4Q 1R5IB 1F97A 3GMMA 15C8L 1FNFA 4HMEA 3NA9H 3RJDA 5EU3A 2BNRB 2JJUA 4GAGL 2E3VA 1A21A 3EFDH 3F7PC 1U92A 4RMWA 4OFYA 5JW5A 1U8OB 4X7DC 4NQDA 5DC9B 1ZA6B 3B43A 2BY3A 3PDDA 1MSPA 1CI5A 1K4DB 5F7DA 4IRJD 2FECI 2GKIA 4R4FH 5C3LD 3IETA 3ULUE 1JF1B 1ERNA 2VISA 5L88H 1ZA3A 1OTSD 1B88A 43C9A 3O45B 3MO1A 1SBSL 1ZHLA 3S4SB 2GT9B 1CTNA 1W72L 4OCXL 2EDYA 1XR8A 4Y5VB 3QA3A 3G9VA 4D2NA 4PJFF 3D9AH 4YE4L 2HYMA 5J06A 3EYOA 3BQUA 2CSPA 5KVGL 5CJQH 5C0AE 1T21A 1IQWH 3TZVA 3S36H 4EOWH 5T5FL 2VNCA 5GS0C 1P7QA 5HI3C 3QO1A 1RHFA 5IB4B 1NCDL 1FL5A 1ORQA 5JXEC 5FECB 1AR1C 4YXKH 5HYSA 3E0GA 4MCYB 2Q6WA 2PO6B 4LLMB 3CX5J 1VFMA 2D0HA 4XCEB 1JYWA 3ZDXF 2OXGA 3O2WL 1GAFH 4PJ5B 5F9JA 4M5YL 3VD7A 5ANMB 1HEZA 4EDXB 5C0RL 4MAYD 1FN4A 4GMSL 1BJ1H 3MLTB 1IFHL 1I1YB 1KB5A 1FL6B 1NUNB 1PVHA 5C0CE 4D0BB 5I76A 2R0KL 3GSNA 5DVLA 2VQUA 2Y6SD 1J0HA 4CMMA 1OD7A 4F7CB 3AMKA 1DANU 2AJXH 2HKHH 3OKNB 4NZTH 4X7TB 2HT2D 5KVEL 4YR6B 4E41E 2CMRH 5CS7A 3SCMA 1YDPB 5F7EL 1EHXA 1NL0H 2W0FB 1CLYL 2D7PA 5DMIL 5TGBB 1IT9L 1BEYL 3EYFB 3BFOA 3MRPB 5HHME 2JJSA 3QT2A 3RWEA 4NO3A 4CVXA 2J8UE 2IH1B 3OTTA 2AJ3B 2PN5A 4KKAC 2F54B 4AEHH 2XZAL 4FRWA 3RY5A 2YOCA 3QCTL 4YBQC 2LAGB 4X98A 3X13B 1VEOA 3KPTA 3FFCB 3BZ4A 4UDUB 2P8MA 3AY4A 4IMKA 4POZC 4PGCA 1RUML 5ALBH 3CXDH 3Q6GL 3TO4B 1X5ZA 5BVJA 5FYLE 5IV2A 4PJHF 1MCNA 1AGFB 1YEIL 5IMKA 1QRKA 3FO9A 2YWZA 3VWJD 2FSEA 3BP4A 4MB5A 4P57B 4Z95L 4XPBL 2W91A 5C0GA 3UBXG 5B39B 4FMFA 1Z5LB 3RVTC 4PJGB 2XG5A 5FB8A 2OJZL 4M43H 3C6LD 5AAWA 5MERB 1NANI 1U6AL 3GGWA 1K5NB 2G9HB 3LD8C 2OSLB 3X12A 1H5BB 2R23B 5D7SL 2Z93A 1CFVL 1YNTB 4KH2A 3V0VA 5FUCC 4F33A 5IFHH 1IEBA 3PQYB 3HAEB 5EO9A 5JIHA 2PXYD 4OI9A 2VLLB 5DJAA 4R8WL 5E5MA 1OSZB 2UZIL 5F97E 2YWYA 4MA7H 1ODAA 4HPYL 4TTDC 3NN8A 4UIMB 1OTUD 2BNRE 4DK6A 3ZZ1A 4OLZL 3U2SB 1HZHL 4PP2A 4F8QA 4IOIB 1H8SA 3PGCA 1SQ2N 1NEUA 3TIDB 5E6IB 1IKNC 2C26A 3SO5A 4XPFL 5EDXA 4ZUTA 1JPSH 4LSVH 4ZS7L 1HOCB 3P0YH 4K23L 5IMMB 3DETC 1QYGL 4FFWD 4RGNB 2VDOL 3IDXL 3LEYH 5I1CH 2P42B 5DUPH 5C0FB 1S7TA 2XZQH 3GM8A 4Y5XB 2NY7H 1H3PH 4I3GA 5EBLA 1CDHA 3MNWA 3NCMA 1D5XB 1KNOB 1GC1H 1IAIL 4LQFH 5KJRH 3WFZA 1J1XL 5E5RB 1JNHB 4UUJB 1EHNA 1UWGH 2DD8H 1ZLVH 4OUUB 1I3VA 1ZS8A 3DHJA 3BGFB 2YUZA 1G9NH 1NCWH 1KIRA 4XTRD 2ENSA 3TH4T 5CJBA 3ABZA 3H3PL 2JCCB 2XQYG 5ACZB 4PJFA 2VXUL 2YZ8A 2E7MA 3K8KA 1OHQA 2QADC 2JTDA 5GGSB 4LPWA 3DTXA 2CH8A 5EZOH 4NPYA 3S88H 3IJSB 2E27H 3K4DA 3BIKA 5C0AD 3GJFA 4PJ5E 3QDMB 1IRAY 4G6JL 3W5MA 3D5OF 1YYLL 3TT1L 1S78C 4AG4H 1EO8L 5FYKE 3KXFB 4YQXH 3U9UB 2D4FA 3JV4B 4PJAF 5HYQB 1I3GL 4X7CC 4WV1B 3JTTB 3GB7A 3BT2L 3RWCB 3HRZB 2XTJC 3BKCL 4MA3A 2UV3A 3HR6A 2DYPA 4OZFG 2A0LC 3ZE1E 5C0CD 1IJ9A 5KANI 1R24A 1A02N 1ED3B 5IG7B 5KOMC 4OFDA 4PLJC 1A14L 4UBDC 3VG9B 4TNWK 3WUWB 2NYYC 4HBQA 3QB7C 2F54E 3GMRA 4LIQE 1VACB 3BGMA 3QPQD 3TJEH 1KEGH 5IBLD 1Q0XH 3CD4A 5C3TA 4ODUA 2E7LA 3C09C 2EKSB 3MLSL 3FFCE 1G1CA 2F5AL 1XCQB 4IOSD 1HDMB 4HULB 1N5AB 3SQOL 5HHMD 4HIEB 4MVBD 3C08L 1MI5D 2Q76A 4LHUA 4ZOCA 3RNQB 3KLDA 3BH8B 1HCFX 4WI7A 3BZEB 5EZIH 2CKBA 2R9HC 2DL2A 3HE7C 4PJGE 1EZVY 1FV1A 3O2DL 1TLKA 4LRIC 1WBXA 1SJEB 5EOCL 1D9KC 4ZSOA 4BFIA 3P11L 4AYFA 5FYLD 4PJHA 4PPTA 3H9HA 2VXSH 5HHVL 4WY7L 3MUHL 5L7XL 1GOHA 4FQXB 5SWZB 4YHMH 1NAKL 5EIIA 3HG1E 3L3JB 3MV9E 4JN2A 3ZT7A 1JGDB 3ARBB 2GK0A 4HS8L 3GMPA 3PP4L 1L7IL 3QUYD 4M93C 4RSVA 4LDOB 5F9WB 3RVUC 1AD0B 3DNKA 4LLYB 3OBAA 3PF2A 3RWGB 3GI8H 4NUGL 1LNUB 4XP6H 3X3FL 5HPMB 3QIUA 4WWKB 3OMZA 2O61A 4LVNC 1LHZA 5E9DA 3D2UA 1I8KA 2LE9A 2X9WA 4RBPK 5C09B 1A3QA 5FYJL 5C6TL 1U3HA 1D5IL 1YPZB 4JFOA 1BD2E 5IMLA 1NCBL 4S0SD 2EIBA 3MRIA 4EUPG 2AV1B 4R97C 2WP3T 3H7BA 4LPVA 4HBCL 5EOTB 4UT7H 5IVOA 1H3XA 1MY5A 2V17H 1JIBA 2F9BT 3QIBA 4KHTL 2CGRL 3CFEA 1H0DB 1E4XH 2OR9H 3ZKSD 1NBZB 4KRNA 4LCWB 3L1OL 5E6YA 2UZXB 4M7LL 2XWJB 3L5WB 1FFQA 4D9RE 4NNXB 1JGEA 3OXRA 3TH3T 3HE6C 2JCCE 1Q72H 5LXGL 5I1EL 3I6GB 4NRZA 2YPLB 2X70B 3L3DA 4LPCA 2YKLH 4L3EB 4XP1H 4Z6AT 3ARDC 3UJIL 3WEXB 3QDME 4FQHB 3LQAL 3OB0K 1T1YA 5LBSH 1B4JH 1TNMA 1U2CA 1YEFH 3L7FB 3LQZA 3VFVB 4RFEB 3IDMA 3KXFE 2GTWA 1KPUB 3KPPA 4MQ7B 3STLA 3G04B 5DQ9B 1X7QA 2PO6D 43CAA 3SKMB 3GKWL 1EEYA 4PJ5D 2V5MA 4U49A 2FGWL 4K2UL 3LHPL 4KKLC 3FONA 3GMMB 5EU3B 1Q0YH 5FYKD 1QSZA 3O2VL 4F9LA 3INUL 3VFRA 1F4XL 4PJAA 4F58H 4R2GC 1U92B 1EAPA 5JW5B 4NQDB 4JZJA 1A3RH 4NRXA 1R3KA 3TCLA 5HD8D 3BKJH 5F7DB 1OARH 3LEVL 3IETB 2AK1L 2QQKH 4G7YL 2VISB 1YZZA 1ZA3B 1X6NA 1LO0L 4NP4H 3MO1B 1TIUA 4TSAH 3T3MF 1ZHLB 1JTPA 1GOFA 4ZPVA 2XY2A 1CGXA 1IAKA 4W68A 5IFAH 1XR8B 3QA3B 1RI8A 3OX8A 1EIBA 1UM4L 3REWA 3ALXA 3BH9A 2F54D 3SDYL 4GXVH 4LP5A 3EYOB 1U8JA 3BQUB 1JV5A 5I1HH 1K6QL 2C5DC 3L3IA 3VXOA 2CIIA 3TZVB 4KKCC 5DVMA 2NY3C 3RI5F 1P7QB 3MJ7A 2Y4SA 3QO1B 5BV7L 2XXCB 1FL5B 1ORQB 4DKDC 2FO1A 5HYSB 3EYVA 2Q6WB 4E5XA 1BX2A 1F90L 3LQAC 5MENA 3QZWG 4KKBC 4NWTH 2WWKT 3FO2A 5SWZE 4PB0L 2NY0D 32C2A 5F9JB 3DMMA 1J0IA 3IDJA 5IVXF 4QRQA 1HEZB 3U6RA 1FN4B 1NGPL 2LTQC 1F8TH 1KB5B 5ITFA 5I76B 4FQ2H 4R6UA 4PUBL 5IEHA 3GSNB 4CMMB 4D94A 4UT6L 1KOAA 4GMTH 3LS5L 3JUYA 4WVRA 3GK8H 1N4XL 3HG1D 3MV9D 3KHOA 5KZCB 1CLZH 1XAUA 5TE7L 4UIKH 1NMBH 4OI7A 3SCMB 5C09E 4ODHH 3EOYG 4KAQL 4Q97A 3MRGA 4UAOC 3CVIH 1FFPA 5IBTH 3RWEB 4NO3B 2CRMA 4CVXB 5E6ID 3RTQD 1XGPA 2MSPA 35C8L 1U95A 1EHLH 4PJCF 1WEJH 4X98B 3WMSA 1HYSC 5E8OA 3D25A 3BZ4B 1JP5A 4NHUA 3AM8C 4PGCB 1K4CA 4I8DA 4LCWE 1BD2D 2ZJSH 1QBBA 4KMTL 3BWUC 5BVJB 3IDIB 1UB5A 3CSGA 5FUOH 1PY4A 5IV2B 1T89C 4P4KC 4UB0H 5IMKB 4P0DA 4CN4A 3FO9B 4IOFC 5HYJA 2FSEB 3BP4B 3O6FD 4HXBH 2YPLE 4TQEH 4JQXC 4L3EE 5E70A 1KCRH 3SDAA 5FB8B 3NFSL 1V3KA 4CU7A 3AU1A 2ARJA 3EJYD 1ZVYA 5MP6H 1DBMH 5FKAA 3GGWB 4D9RD 2FGZA 3HLAA 3X12B 3ZYIA 3KNBA 4ODTH 1C1EL 4CGTA 4N8PA 2Z93B 4HX1A 4LRNH 3V0VB 4F33B 1QVOA 1IEBB 3OGCA 5EO9B 4N1HB 3CDFA 1MWAH 4KROB 4YO0A 1S7VA 5DFVD 5E5MB 4HK3N 4YPJA 1U8PA 4MXQD 5ERWA 5TF0A 3T0BA 3NN8B 2FJGA 1CDUA 5EB9A 5D1QA 4DKAA 1IMHC 4PP2B 4H20H 3MGOA 2P24A 2QLVB 4GO6B 1G7MA 3QWRD 3PGCB 4KVNH 4P3WA 4P2QD 4L1DA 2DLHA 4ZUTB 4ALAL 4IDJH 4BQ6A 3ULVL 1MIEH 4DW2L 4ELKA 1UH4A 2X1XR 1S7TB 1A7PL 4MYWB 1MCEA 3CLEH 1QFUH 3PHQA 5EBLB 2AQ3A 3MNWB 5IGXL 1F00I 1A5FH 3EIFA 3NPSB 3TEUA 1HQRB 5C70A 2AXJA 4XPHH 1ZS8B 3EYSH 2PTUA 1CGWA 5L6YL 1G6RH 4APQC 1KIRB 4CVUA 5K93A 2OS7A 3DRTA 3Q1SH 4PJFB 1F45A 4Y4KA 5ESAA 1RIVL 2KBGA 5JPMA 2R56H 3KJ4B 5HDOA 4JKWA 2WV3A 4PJ8A 2XA8L 3DTXB 4NPYB 4F80A 3JWOL 3BIKB 3GJFB 4NGHH 5DQDH 1F58L 4Z76A 1AGBA 3H42H 5ID0A 5HTSA 2LVCA 1RU9L 3BOVA 1U9KA 3AB0B 1E6JL 1CYGA 1FGVH 4BZ1L 1JHKH 2DWDA 4OCYH 1I75A 2NY4D 2IH3A 4U6HA 1CQKA 1ACYH 3GB7B 1T03L 1AD9A 4HUUA 3UTSA 5SWZD 2X10A 4MA3B 4MD4A 4PV9A 5IVXA 1Q94A 3ARBD 2DYPB 4ENEC 1YC7A 2WBJC 3RBGA 1IGYA 3ZTNL 1F13A 3K4AA 1R24B 2NY5L 5CEZE 5T1DL 2L0DA 1GL4B 4KXZH 3EJZC 5EZLA 3WSQH 3ULSA 4UI2A 1FNAA 1MCDA 3VGEA 3ULVC 1CDYA 4ETQA 3GMRB 1BJ1J 4UT9L 3TBYA 3BGMB 4C55A 4RWYL 2HKFH 1U8KA 2QSCL 2QSQA 4ODUB 4WI9A 3CVHL 12E8H 3G9AB 5C09D 2HG5A 3NAAH 3O6KH 4RFNC 5GGQH 3T2OA 2E6JA 3RGVD 2C4FU 2AJSL 2VZUA 4WEBL 2Q76B 4LHUB 4BUHA 5HHXL 3MACH 1MVUA 1MFEH 5D1XA 4PJCA 4JPIA 2CKBB 2QHLA 1FV1B 4M48L 1DQML 4TRPH 1WBXB 5KTEL 2H1PL 4OFKA 2NY2B 4ZSOB 3OAZH 5IJVA 1TJIH 4BFIB 3N1FC 2EC9T 3KPMA 2EDOA 2H8PA 3H9HB 4PJHB 4G6KH 3UPRA 2Q7YA 4S1QL 2AGJH 2Y23A 2YPLD 4OM1L 5DZOA 1GXEA 1T22A 1Z3GL 2ZSVA 3WDJA 5E03A 3RHWK 1CU4H 3UC0H 1S9XA 5EIIB 4KK8D 4JN2B 4KVCH 2GK0B 4XMKH 5K59F 4YBLC 1J5OH 2FYYA 3GMPB 1ZANL 1GZQA 1CLOH 3B9KA 1E4XI 3QNYA 4Z18A 4P2OC 4W4NA 5HDLA 2VLKA 1ITCA 4MD0A 3O41A 5ENWA 3QIUB 2XACC 2O61B 3QEQE 3AREC 3OXSA 5E9DB 2NY5C 3D2UB 1MCSA 1I8KB 2CO6B 1TZHA 4BSJA 5EBMA 2VLMD 4MJIA 5CUSH 3V52L 4HIXL 1U3HB 5T1MA 4JFOB 3PGDA 1DVFD 4ZPTA 5IMLB 2IG2H 3FHAA 2IAMC 3MRIB 3D18A 1KYOJ 3TNMA 2VR9A 3H7BB 5JZ7D 1JYVA 3KLSA 4MGXA 4L29A 4MHHG 3QIBB 3CFEB 4J8RA 4FQIH 1CE1L 1JFQH 3SDXF 1I9JL 1FC1A 4LMQI 1I1AA 2FJHA 4RMUA 4WHYH 4YDKL 2EH7L 2JB5H 1JGEB 3OXRB 4OF7A 2HN7A 4X6FA 2OTPA 2KZ1B 4PJFE 2VAJA 2I60L 4NRZB 3L3DB 1CICA 1UFUA 4P23A 1IKFH 4KZDL 5B8CA 4IM8A 2PTTA 1JHTA 2W9EH 2VN7A 4XBEL 1T1YB 1A6UL 3LQZB 3FO0L 4C56E 3IDMB 2GTWB 3KPPB 3STLB 3S3JA 2VDLH 4M00A 1PSKH 1X7QB 1NSNH 43CAB 4YC2C 1IQDA 2IADA 1EEYB 2M2DA 2ICWA 1G7JA 2ICWJ 2AQ2A 3I9GL 4IS6A 5CZVH 3FONB 3FQUA 2VZVA 4JDTL 3PE9A 3U7WH 2EDDA 1JTTA 3VFRB 2AVGA 3VH8G 1UWEH 3BZFA 4PJAB 5IJKC 4AEEA 3UYRH 1EAPB 4PTTA 3GBNL 1OTSC 1XIWC 5CP3H 5IOPA 4JZJB 5KSVA 1PG7W 4LEXL 4NRXB 1R3KB 3TCLB 5LWYL 2GFBA 3QEUA 4LK4A 4DUXA 5EORL 3K2UH 5KZCD 3ARFD 4U1HA 4F57L 3SCMD 4LGSB 5FHBL 4KMQA 3WS6C 3DVGA 3SN6N 3U79A 3WXVH 5GISL 4ZPVB 1SVCP 1IAKB 4L1HA 1G9ML 1QBAA 4KDTC 3OX8B 5KVDH 3REWB 3BH9B 5D1ZA 5FEBA 2X4OB 2EO9A 3QNXB 1U8JB 1A7QH 1JV5B 1I8LC 3S5LG 3L3IB 3TYFA 3V0WH 3VXOB 2CIIB 2E7CA 1Y18A 4AM0A 4U1GB 1ZGLA 3MJ7B 1QEWA 5DT1L 5JHLH 3IFLH 3I3DA 4PJHE 3U7YL 4LSUL 4MAYC 3EYVB 4E5XB 1SEQH 3EFFA 1BX2B 2B4CL 5DK0A 5MENB 3HNSH 4ZUSA 3ESVF 3FMGH 3FO2B 2FD6H 2Y6SC 32C2B 3DMMB 3IDJB 4NJ9L 4QRQB 5DD1L 3U6RB 1M05A 2VMFA 5ITFB 2HT2C 2AXGA 4ERSL 5IEHB 1BOYA 1QFOA 1HKLH 1DL7H 3L5XL 2E7BA 3FQTA 1AI1L 4QRPD 4OLXH 2D9QB 2ORBH 3LKQA 5ESQA 1N59A 1KEMH 1NLBL 5E9DE 4OF5A 4BZYA 3S8WA 2DM2A 2VL5A 4YX2H 5EUOF 1S3KL 1MQKL 4OD2A 2H2PD 3MRGB 2XZCH 5D96C 3L3GA 1FFPB 2UYLA 4L4TD 1FAKT 5IB3A 1XGPB 1RMFL 4G9FA 4K3JL 1U95B 5J13B 4LCIH 4RDQG 3QEQD 3ZSTA 2V7NA 4O4YH 1MCWM 4U1NA 5E8OB 3D25B 1G9MC 4HFWA 5T3XH 1K4CB 1X5AA 4X5WA 5T1KA 4JJHA 1UB5B 3TA3A 2VABA 4EQ3A 3C6LC 1CXLA 2ZUVA 5HYJB 5EH1A 1J0JA 3P4MA 4K7PX 4MA1B 5D7LA 1CT8A 3SDAB 5F6IC 4E9LA 2CXGA 3AU1B 3DYMA 4TSCL 3CSPA 4G43A 3SDXA 2ARJB 3O3DA 4RMRA 3M1BA 3VXSA 2PXYC 4OD1H 5FKAB 1HHJA 4JO4H 1FZJA 4U3HA 3HLAB 2IPUK 3KNBB 4OQTH 3UPAA 4TUKL 1HHGB 4HX1B 1E4KA 1QVOB 1RUKH 2BDNL 3OGCB 2NLJA 1CD8A 5I6XC 1T1ZA 3S96A 5TQ2L 1FP5A 3VI3F 3MNVA 3BPOB 4JHBA 4YO0B 1S7VB 1D7FA 1RUQH 2X05A 1MJUL 3MUGA 1U8PB 2NW2A 5ERWB 1OAUL 4C56D 3O3AA 1YEGH 5IBUB 4TULL 5D1QB 2A38A 4L9DA 3MGOB 4PJAE 2P24B 1G7MB 2YUVA 4PIRF 4ZFGL 4FFWC 2ZUQB 4ZTOL 1F5WA 3FTGA 3OQ3B 1IC4H 4OGXH 2DYPD 4AK1A 2CK0H 4OIIL 3HI5H 4ELKB 5I73B 5DD3H 4LP4A 2X4RA 5F71A 3FQXA 3PHQB 4YHLL 1KLUA 4XTRC 2DWEA 4F37F 2LVEA 2AXFA 1FVCA 1IC1A 2R2HA 2R0LH 4XNUL 3VMPA 4HQQL 5FYLL 1FDLH 4NQSA 5ALCH 3DSNA 3NIDF 1YMMA 3DRTB 2YEZA 4LHUD 4Y4KB 5ESAB 5JPMB 2VLJA 1TCRA 3SDCA 2DDQL 5JW4R 2VJXA 3Q48A 2X4QA 3MOAL 5MENE 4PJ8B 1MCPH 3HZVA 1WWCA 4X7EC 4FZEL 5HGAA 3QDJA 4JHAL 4Z76B 1AGBB 1FBIH 2NY2D 5ID0B 4DFIA 1J1OL 2ZP0T 3QUXC 5GRWA 2WW8A 3LY6A 4F7MA 3C5JA 4MD5A 2DWDB 3FB5A 2IH3B 4U6HB 4QEGA 5TF1L 1EGJH 1AD9B 3H2WA 4HUUB 3UTSB 3ZE2F 1SJXA 4MD4B 5JMOC 4PV9B 2ZG2A 5IVXB 1Q94B 4AEIL 5I18H 2BCKA 5SV4A 2M26A 1FCCA 2R2EA 1IGYB 2M8XA 1MFBH 3QPQC 5IBLC 3CJJA 3RGHA 2KQNA 1MJ8H 2H32H 4LSRH 5EZLB 3ULSB 5T3ZE 1RPQA 2APFA 4ETQB 5GGTL 3TBYB 5BS0D 4MVBC 4LPTA 3MOQA 3KYKH 4HCRH 4X7SL 4NZRL 3TT3H 4M61A 3FB6A 5EUOA 3QDHA 2HG5B 2W9LA 3OL2A 1Q1JL 2R15A 1XF4A 2AEPL 1CFQA 3R0NA 2J12B 4IRZH 5EPMA 4X6BA 2WQ8A 1ZLUH 4HK0A 4HWBL 2NW3A 3ROLB 2DMKA 4R7DA 5HYJE 5B22A 4ZTPH 1ZLSH 1MVUB 1QPPA 4XPAL 5D1XB 4PJCB 5BVPH 4JPIB 1OPGL 1J18A 4R90H 3BYYA 5I8OH 3VGAC 4H88H 2EZ0D 4L3CA 5F1IA 2A9MH 5IJVB 3W11C 1TQCB 3KPMB 2H8PB 3UPRB 4X4XA 2Q7YB 2XKSA 2GSIA 2VR5A 4K71C 5FK9A 4CVZB 4XNYH 5CGYD 4F7EA 4WW2C 1T22B 2ZSVB 1MHPL 1N64L 3GBMH 3QUYC 2GJZA 4O9HH 2BVYA 4FFVC 1S9XB 5CILL 4I18C 5FYKL 1A6TA 1EUUA 2Q8AH 2FJFA 1X4YA 2FYYB 4WFHD 1DBJL 1F02I 1GZQB 3B9KB 3QNYB 4QXUL 1AKJA 3GDBA 2VLKB 1INDH 5INCA 4MD0B 3O41B 5ENWB 4HIIA 1V7ML 4NT6A 4OTXL 2LABA 3OXSB 3FRUA 5FGCB 4MMXC 1TZHB 3VGBA 5EBMB 1VA9A 4XVJL 3SKJL 2P8LA 4MJIB 5C07D 3LPGA 1MWAA 3GUTA 3L3KA 5T1MB 4N9GA 3PGDB 4ZPTB 3V7MA 3OF6D 4XPTH 3D18B 4JY5H 3TNMB 2APXA 3MBED 1ZT4A 1CFBA 1BAFL 2YD6A 4RGMB 2GI7A 4L29B 1MRFL 3VG0L 2HRLA 3ZL4L 4J8RB 2A2QT 3WS3A 1P5UA 3T3ME 2RCSL 5H37H 1I1AB 4LVHC 4XCFL 2HN7B 4X6FB 5DJCA 3M8OL 5CD5D 5LVEA 1M7XA 4Q0XH 4GAJH 5I1JL 1FZOA 1CICB 3BEVA 2P5WA 3B3IA 3PIQA 4HJJH 4P23B 5B8CB 3V6OA 1QLEL 1YC8A 1KF9B 2PTTB 1JHTB 2A1WL 3HFML 1MLCA 3E2HC 5CZXC 4Y0GA 3MLXL 3PG2A 3LS4H 1G6RA 1IQDB 5MEND 1FAIL 2IADB 5IT2L 1BQUA 2ICWB 3UTSE 1G7JB 4P3CL 1BBDL 1GIGL 5IVXE 2VDKH 4NSKA 4OB5H 1PFCA 1NGZA 4IS6B 3VFGH 3FQUB 4KKNA 5HD8C 1RJLA 4P2CG 1R3IL 1MIMH 4Y1AA 3BZFB 3T2QA 5BOZG 4V1DD 4AIOA 4PTTB 5IOPB 3R8BB 5KSVB 1AXTL 2YUWA 5DMJB 2WANA 3WFBL 2GFBB 3QEUB 3SKUD 3WLBA 2BJMH 4U1HB 2BVOA 4PYGA 5FF6A 3DVGB 1AJ7L 3CMOH 1A9EA 1IGFH 3RKDD 1FLRL 1IGMH 1LP9E 4K9EL 1SEBA 5T3ZD 1RY7B 2ITCA 5D1ZB 5FYJU 3OZ9H 5SWSA 4PJCE 3MCG1 3RDTA 5C0BD 2BHZA 4KHXH 5HVHC 4K94H 3TYFB 4M1CC 3MRNA 5I0DA 1GHFH 1Y18B 2WBWB 4AM0B 2AJYL 4GFTB 1ZGLB 3UPCA 3D3VD 1QEWB 3LQMA 3IF1A 3KPRE 2NY0C 3FB7A 3UTPE 5HYJD 3LZFH 4JO1L 4L8DA 3EFFB 5FGBA 1X5JA 5DK0B 3O3BA 4ZUSB 5C6PB 4PGEA 4G6AD 3SDAD 4HF5H 5IM7A 4XNXL 5E8DH 2V9QA 4WUKH 1LO2H 4KGLA 1M05B 5K9JL 2C3WA 1JMXA 2P5EA 5JW4M 4U05A 5BO1H 2AXGB 1TJHL 2HJKA 2VSDA 4WUUA 5GZOC 1PBYA 2CQVA 3H6JA 3V5KA 2J6EH 3FQTB 4H0HB 2PNDA 2VLKE 5FOJA 2F58H 1IZJA 3O4OC 3LKQB 5ESQB 1LK3H 1N59B 4WFFE 3RP1A 5HHOD 3RTQC 2MPAL 3DUHA 5C2BH 2VL5B 5GSVA 4MJIE 4PRIA 3VMNA 3SEPA 4BFEA 4OD2B 1L6XA 4DZBA 3GRWL 2K9UA 3L3GB 5C0DA 2UYLB 1RUAL 2Y07L 5IB3B 4G9FB 4Z7VF 3OKDA 4K3DH 1HI6A 2V7NB 4MDJA 1PD6A 4U1NB 3O6FC 5KSAA 1N7MH 3SQBA 4HFWB 4K9EC 1NKRA 5J1TC 2DIAA 4X5WB 5T1KB 2ZUYA 3TA3B 5KAQG 2VABB 3JV6A 3EJYC 3SE8H 3P4MB 5D7LB 1CT8B 1PLGL 5A3ID 2LU7A 2UZYB 4ODSL 2HMID 3OV6A 4G43B 4Z7OF 3SDXB 3O3DB 3QWOA 3CFJA 3FCTA 3M1BB 4FZ8H 3VXSB 5I1LA 4XPGH 1HHJB 3PWNA 5TDNA 2R29H 1FZJB 4ZNEA 3MXWH 7FABH 2B2XL 4MXQC 1TQBB 1EFQA 5EULV 4LLAA 5J6HB 4NM8L 3C8KA 1M4KA 3BKMH 3GMQA 4Q58C 4M9OA 2NLJB 1T1ZB 3S96B 3MNVB 2VDMH 3S4SG 5CKAA 2IFFH 3CLFH 4QXWA 3CK0L 2DS4A 2NW2B 4QTIH 3RWJA 2E9IA 4M6NL 3QCUL 3O3AB 1MAJA 2Y5EA 5I74B 4PJDF 2Y36H 2X42A 3LH2L 3BMWA 5F9AC 3UTSD 4ODVL 1AHWA 2A6DA 2MJWA 3FTGB 5F7MC 3QIWD 3VG9C 1AXSA 2HVKA 1WZLA 4GW4B 4DGIH 1K85A 3WIIH 1U42A 5JO5A 4HXAH 3U0WH 1TJGL 4DVBA 4LHQB 3Q0HA 3FQXB 5D5MF 3DUUA 4KPHL 4OT1L 3DURB 4OM0L 1OP5H 1KLUB 2WUBH 2NXZB 4KRMB 2UVFA 5CBEA 3VWKD 3ZKND 4UV4L 1ZV5A 1FVCB 2AXFB 4HMDA 4DQOL 4KTDL 2XV6B 2R2HB 5CP3A 1EO7A 5F9OL 4NQSB 1C5CL 4JY4A 4S1RL 3U0PA 1YMMB 2YEZB 4HC1L 3KHQA 2VLJB 1TCRB 2MQ3A 3SDCB 5DLML 5D1XD 2BVTA 2X4QB 4M1GL 3VD4A 4ONFH 1LO4H 3HZVB 4H1LH 3MLPA 5I15L 1X3DA 5HGAB 2NY4C 5IF0A 3QDJB 3PWUA 1F6LL 2BSED 4Q2ZA 2VWEE 4N9OB 1TETL 3KPRD 2H9GB 3QP3A 3QSKB 1W0VA 2D7TL 4F7MB 1KULA 3C5JB 4OJFH 4MD5B 4XXCC 2AI0H 1PJ9A 3FB5B 5FUZL 3VGFA 4ZXBA 5JW3L 1I9RL 5E00A 2HTLD 2PKDA 3V6BR 4EJ1C 2GHWB 4NQUA 2BCKB 2VO5A 4GLRH 5K59E 2R2EB 3ETBF 5L8KB 5IK3A 1J0YA 3B9KD 3I2CH 4QGYA 5B39G 4KY1H 2VLKD 4J4PA 1OW0C 4DGYL 4G9FE 4RX4D 3DO3A 2Y9RT 2X4PA 3RGVC 5TE6L 4HGWA 4P59H 4N68A 4M61B 3FB6B 2YD3A 3OJMB 5EUOB 1A3LH 5GRYA 3CCHA 1XF4B 2VDNL 4N8VB 1CFQB 4JRYD 3KPLA 3MLUL 3P9WB 5GRJH 4EVNB 3HAEG 5EPMB 4X6BB 1JGLH 4JQVA 2NW3B 4HK0B 3ARGA 1LEIA 4Z7VA 5DA0B 4R7DB 1VENA 2W92A 2R0WL 3WFHA 5D7LE 4X5LA 1I1RA 2IPTH 1OL0A 2COQA 5HXMA 4DN4L 4JFZH 1FORL 1RK0A 4NQEA 4L3CB 3SDXE 5F1IB 5C08A 4JO3L 1A8JH 3VXSE 3PXJA 4U6VH 1TZGL 4KK8C 4X4XB 2GSIB 5FK9B 5GJSL 1Z9LA 4W6WB 1V7NL 3OSKA 1GRWA 4XI5C 2DQGH 3STBA 2B0SH 3T0EA 5CJOH 1CICD 1T0MB 2GJZB 4P23D 5BMFH 2Q1EA 4P46A 1KB5L 2QHRH 3VXNA 2Z8WC 3V6FA 1A6TB 2FJFB 3B9EA 5E8EA 5GJTH 3D85A 1T6VN 3FQNA 5ILTH 1IGIL 1AKJB 2ZPKL 5D71L 3VFPA 3GI9L 2GW5A 5INCB 3QDGA 1LO5A 4HIIB 5F9DC 4NT6B 4PJIF 1DVFC 2CIKA 2LU4A 5I1KL 4OQTA 2PYFA 3FRUB 5GS0H 1UWXK 1NBVL 4XXDA 4M6OL 1XR9A 2P8LB 5JZ7C 1CWVA 1MWAB 4PB9L 3GUTB 3L3KB 1HHHA 4EDWL 4N9GB 4PJDA 2EC9U 3UO1H 1RIUH 2VDPL 3MRFA 1NGYA 1HWHB 1B90A 3WFEL 1ZT4B 3TYGH 1TVHA 5D7IF 1QFWH 4R4NC 4KFZC 3G5XA 2GJ6A 4MQXD 3B9AA 1PG7L 1CFTA 2OX5A 1P5VA 4OFVA 1G7QA 2ZG3A 1EA9C 4MXVE 5D5MA 3J7HA 5DURB 4CDHA 1YMME 3ALWA 1X9QA 5DJCB 3B2VH 1B9ZA 1NLDL 2VLJE 15C8H 1NDMA 2I5YL 3BEVB 2EE2A 2P5WB 3B3IB 5DK3A 3E1F1 3PIQB 4MLIA 1PKOA 4MSWA 3NOIA 3QDJE 4NFBA 5AYUL 1D6VL 3WUWG 1MLCB 3FQWA 3D0VA 2W0PA 2J7LA 1T83C 3C2AL 1NGXA 2BSSA 5EBGA 1G6RB 2I27N 1NC4A 2YPVL 3AC0A 4OCXH 4OLVL 1VKXA 4HIJA 4NSKB 2ZOKA 3U48A 1MPAL 1NGZB 3RVVD 3VXUA 1RJLB 4YE4H 4LNVA 3WFDL 1FSKC 4Y1AB 4LKCA 3SGKA 1RJZB 3ARFC 3KYNA 2VB5A 5KVGH 5H94A 4NC1C 1I85C 2V9RA 1L4IA 3D6GA 1BECA 1L0YA 1NCDH 1VFBA 3WLBB 3EUUA 2BVOB 3HR5A 5FF6B 1JNJA 1EGJA 1A9EB 3GIZH 1QRNA 3NFNB 1OM3H 3C60A 1NCTA 1YUHA 3HTLX 4KQ3L 1YY8A 4M5YH 4NUJB 1MRCL 1SEBB 1TTGA 2ITCB 5C0RH 5DD0L 5SWSB 4JGMA 5IFJA 3KPSA 2H32A 2R0KH 3FHQA 3HI1A 5E94A 1N26A 4CDGC 5IW6A 4I13B 4AMKH 2O5XL 4F9PC 4W4OA 1CN4A 4K3EL 2A9NL 3IF1B 4N0YL 4HCRA 3FB7B 1DN0A 4YEEA 3S3PA 4ONGL 5KVEH 3BPNB 3V2AR 4DTGL 5BJTA 1QZ1A 4L8DB 2D03L 1K2DA 3O3BB 3LMJH 3S98A 1CLYH 1VPOL 4PGEB 5CJXC 5DMIH 4DJMA 1IT9H 3BD5A 4LCCA 3I6KA 5IM7B 4FFYL 4OCSL 2R8SL 4KWUA 3LKOA 2NZ9C 3GSVA 1O7SA 2P5EB 3DSFL 4ZO8A 1OAXL 4WUUB 1A6VL 3QCTH 1DLFL 3T3PF 1ZTXH 1E27A 1WAAF 3V5KB 3VFTA 1EFXA 5E6ZA 4I2XA 1H8NA 4UDTA 1RUMH 3FRPG 3VI3E 2H2PC 1AQKL 4PBVC 1UC6A 1YEIH 3ZKXC 3RZCD 1QBML 4GAFB 5GSVB 4XPBH 4PRIB 3VRIA 3PJSA 1DQDL 1NDGA 4G8GA 2GUOA 4DZBB 3O9WA 2OJZH 5D6DA 5C0DB 4WO4A 4EIZC 4X4ZA 4U33A 4Z5RA 4MA8H 3VW3L 3EO1A 4PJIA 4KTYA 4HUMB 3OKDB 1U6AH 1HI6B 4MDJB 1KB9J 1J88A 1CTOA 4EIGB 4ZD3L 5KSAB 2VR4A 1FYHB 2C4XA 4S2SB 3UZVB 1MFDL 3TBTA 2IBZY 1P69B 2YD8A 4GW1A 3LRGA 3JV6B 2CKBL 1LDPH 4ZMAT 1QP1A 3KLAA 2I9TA 4BKLA 3G5ZA 2F8OA 5D7IA 4JPWL 4OLZH 1HZHH 3V6OE 1YN6A 1O0VA 4HWEH 4Q7DA 2QQNL 5D93B 3QWOB 3HI6L 3CFJB 3FCTB 3HC0A 4JRWA 4XPFH 5I1LB 4HUVA 5TDNB 2VLJD 3EZ8A 4K23H 4LGPB 4JZNA 4XNZC 4XAWH 2DQEL 3QHFL 2VDOH 4HPOL 3C8KB 3TV3H 3GMQB 2J5LC 1OB1A 7CGTA 2NPLX 4ODXA 3RWJB 5IUSA 4DCQA 4PGJA 5J12B 4DN3L 2CKNA 1P53A 2HT4C 2MOVA 1I7UB 4Y2DD 4BK4A 3AXLA 4KJQD 5E2WL 5IQ7L 1YY9D 4Y19D 4BH8A 1AHWB 2A6DB 3ZE2E 1UJ3A 2IANA 3H3PH 3CXHJ 1N0XL 1AXSB 2HVKB 4BSWA 2DJSA 4LASL 4ZFOA 25C8L 1GGUA 5HYSG 4NN6B 5I1IL 1MCCA 4HG4K 5JO5B 3VD5A 4XNQA 1SM3L 3I84A 2VXVH 2BXYA 4DVBB 4EQ2A 2VUYA 3DUUB 1IM9D 1WSST 2D31B 4G6JH 1FRGL 1YYLH 2W65A 1QSEA 3T4AA 3W2DL 5CBEB 4G8IA 5SWSE 4PRBA 3AS3A 4HKXA 2B7DT 2P4AB 3SE3C 4OGYH 5FV2A 2DJUA 4JFFA 3T2NH 1DEEA 3BT2H 4JY4B 4GLRI 3BKCH 4YEFA 3LN9A 1T1WA 3IJYA 2KKQA 4BQ9A 1WIPA 4FA8A 1JZ5A 2R4SH 5IF0B 3PWUB 4O2CA 5F1NA 1BQLL 1A14H 4Q2ZB 4E42B 2P5EE 1FL3A 1S9YA 5E56A 5DEFA 1LK2A 1W0VB 4RAHA 4JM2F 4FFZL 3MLSH 4ZXBB 3NIGF 5D7JD 5E00B 3LSOA 2HT3D 3SQOH 4KQ4L 2DM4A 5C0ND 5JQHC 4TUJA 5IK3B 3ORJA 4PRIE 3SE4A 3GHBL 1AKJD 4L8SC 1WAAA 1KIQA 3O2DH 4LSSL 5JA8B 3L3OA 2BSTA 5EOCH 3T04D 4X4YA 2X4PB 1NUGA 4HGWB 2J6EA 4GS7B 5HHVH 4J6RL 4EXKA 3CCHB 3D1MC 4H26A 5F96L 5HGHA 2BXZA 2QJDA 3KPLB 1CQYA 1BLNA 3ARGB 4HS8H 2EZ0C 4Z7VB 1LEIB 4PGZA 1C12A 3TVMC 1KC5L 4PBXA 5DUML 3WFHB 4EXPX 3PL6D 3IAPA 1L7IH 4UINL 1INQA 5DRXA 2IWGA 3WFCL 3F6IA 5CGYC 3RIAK 4C4KT 3O11A 4NQEB 1RK0B 4YHIA 2MCPH 4NUGH 5C08B 4L5FH 2R1XA 3X3FH 3PGFH 1MCOL 3JUZA 1JYNA 3S37X 1FNGA 3UJTH 1ETZA 3TN0A 2APBA 4ZNEE 3T0EB 1OAZH 4YAQA 4BZ2L 3ZKQD 3QQ9D 4OGAD 1WT5C 5FYJH 1MFCL 4PY8J 5C6TH 1D5IH 1EPFA 4POUB 1MNUL 4WJ5B 4FQCH 3VXNB 3V6FB 4OCLC 5L2KA 5TH2A 5E8EB 1OTTD 2APTA 2QL1A 1F3RB 3FQNB 3IU4H 3P4LA 3N1MC 3VFPB 4KHTH 2YA1A 2CGRH 4F15C 3SGJC 2OI9B 1LO5B 2FWOA 3DWTA 3FT2A 3QDGB 1VGEH 1YJDL 2OMBA 4JG1H 4QRRA 2CIKB 5INDA 3RAJL 1WISA 3P73A 5FGSA 1GOGA 3WHE1 2PYFB 4JZJC 5LXGH 3W0WA 3MBEC 4XXDB 1XR9B 1UH2A 3FAXA 2VQTA 1HIMH 2WM0A 5T3ZL 1G1YA 1HHHB 4PTUA 4PJDB 1JZ7A 2EO1A 1Q9WB 1RUPL 3MRFB 3H9YA 1NGYB 3LQAH 4OD3L 4NWUH 1OY3B 1TVHB 1FH5L 5GRXG 3TBSA 2BRRL 3G5XB 1JUFA 2GJ6B 4NRYA 4QOKE 5CD5C 5BZWA 4RBPH 1CFTB 3B5HA 1J7VR 4PJ9A 4G3YL 3GKWH 1G7QB 4NN7C 1FIGL 2MNUA 5D5MB 4B50A 5SV3A 3VGDA 5IHZA 2FGWH 4N1CA 3LHPH 1F4WL 3CSBA 1NDMB 1G0XA 5C6WH 3RDTD 1JF5A 1MVFA 3O2VH 3INUH 3QCVL 1F4XH 4MSWB 1QTYT 2B39A 1WFNA 3MUY1 5DO2D 3NACL 4OLWH 2AAVA 3FQWB 3D0VB 2X4UA 3QPXL 2W60A 4EN3A 3LEVH 2AK1H 1ZXQA 1NGXB 3PHSA 1WZKA 2AV7A 2BSSB 1ZGLM 3TPUA 3KDMA 4R0LA 1NC4B 1KCSL 3CDYA 1KTKE 1VKXB 4HIJB 2ZOKB 3OB0H 3VXUB 1UM4H 2KL6A 3CUPA 4LHUG 3V5HA 3DXAE 5ITBL 2P5ED 4JFDA 3DGCR 4X5XA 4H1LA 4M6ML 5L9DH 4LKCB 3KYNB 2DRUA 1YJDC 4JM2A 4NOFA 1K6QH 3QDAA 5FYKU 5H94B 3L5IA 2D0FA 4PD4J 5JQ6L 5K9KA 3S36X 4FQPA 3RKDC 1VFBB 4PG2A 2G75A 3HR5B 3K8LA 1L9NA 3UAJD 3RU8L 5E5UB 1A0QL 4KV5F 1CD1A 1QRNB 3EDDA 3C60B 4M9PA 1YUHB 2YS4A 2X89D 4WI8A 3V95A 4PB0H 1CBVL 4LAQL 1YY8B 4H8WL 4QO1A 1SY6H 4Z7VE 1PEZA 3ARRA 1A7BA 3QAZB 5IFJB 1KACB 3KPSB 2H32B 1U41A 3HI1B 4OFIA 5E94B 3U0TA 5IW6B 4PUBH 1F3JA 3SKOA 5ADPH 4NQEE 4R4FL 4YHYC 1IE5A 5C08E 5L88L 3LS5H 5EG6C 4C54A 1DN0B 4CMHB 3T0EE 2F8VA 5BJTB 1R3LA 4OZIF 2V2TA 5T3XE 1K2DB 5C0IA 4N8CL 3D9AL 4LCCB 3I6KB 3VXMB 1PZ5A 5HGBA 3BRDA 4Z7OE 3ARQA 4JKLA 35C8H 3GSVB 1S7XA 4DAGL 2BSRA 4EOWL 3BPOC 4EBQH 1IGJB 1JGUL 2K1MA 1E27B 3VFTB 1EFXB 2IFGA 2WWKO 4I2XB 2XQBL 4X9HA 4CJ0A 1UGNA 4UDTB 4RAUA 5ADOL 2EDEA 4HH9A 5IVZA 4KMTH 3OKLA 2EECA 4XCNB 1OAKL 3HZMA 3QJHA 1GAFL 1QA9A 3MLRL 3HC4H 3VRIB 4P5TD 1MCQA 3PJSB 5FAAA 1NDGB 4G8GB 4PJDE 2R69H 2GUOB 3O9WB 4WO4B 4Z5RB 4WCYL 4PLKD 3FN9A 3CU7A 3EO1B 4NKOA 4PJIB 5AZ2L 2BNUA 3PWVA 1DE4A 1GGCH 3ARSA 5JOFA 2FATH 2UVEA 3OJ2C 2AJXL 2AJUL 5BRZA 2GJ6E 1C1EH 4H8WC 4JPVL 4YBHA 2CUHA 5A3IC 1KUMA 1P7HL 3R1GL 1DBKL 2HFGL 3GZKA 3TBTB 3ARZA 2CRIA 2HRPH 4DZ8A 1NL0L 5D5ME 4LPUA 3PNWA 4GW1B 3WJJC 3VCLA 1IAII 4IRSC 3E8UL 3KLAB 4KUCF 2I9TB 5I71C 5JXEA 4BKLB 3G5ZB 5D7IB 3RA7H 4Y16D 1XF2B 1KCUL 4XB7A 4MXWH 4PG9A 5F88A 2NY6C 4QOKD 3LKNA 1YN6B 5J8OA 3BKYH 5ELIA 4AIZA 4KI1A 2R39A 2MHAA 3HC0B 2B1AL 3D87B 4JJ5A 3ARVA 3T4YA 5IKCA 1URLA 3CXDL 4HUVB 3EO9L 4HSQA 1G6VK 1C08A 5TFSH 1GZPA 5D2NA 3ULVH 4DW2H 4JDZA 4UTAL 4JZNB 4LDLB 3BPLC 2YSSA 1OB1B 8CGTA 2QV2A 4ZO9A 1A7PH 1RVFL 1WLHA 1FC2D 1FO0L 3QG7H 3ROOA 4ODXB 4M43L 1ZWIA 4MZ3A 1DEDA 3VXUE 4D8PB 1TNNA 2GEEA 5HHPA 1PAMA 4DCQB 4X9IA 1WIOA 3QIWC 1HH6A 1EUTA 5I16A 2I26N 3AXLB 3DVNA 2XT1B 4BH8B 5L6YH 3ISWA 1WF5A 1UJ3B 5IFHL 2IANB 2YXMA 3DVFA 3QQ4A 4BSWB 3CFDA 4ZFOB 1N6VA 3DXAD 3VWKC 3ZKNC 2VIRA 1QRNE 4MA7L 2ZCHL 4XX1G 4XNQB 2XA8H 1JYXA 5CKGA 3DX8A 4YDLB 5AYQA 5DFWH 5IW1A 3DROA 6FABH 1F58H 4J4PD 2W65B 3T4AB 1QSEB 5DJYA 4J7RA 4G8IB 5J9PA 4PRBB 4YDVA 3KPSE 5IB2A 1E6JH 5KS9F 3MJ6A 4HKXB 1I8IA 1TTUA 4FXKA 5EN2A 1GGBH 4HW6A 2ADIA 4JFFB 1DEEB 5CIPH 1T03H 4JG0L 5SWQA 1NGWA 4M8VA 3LEYL 5I1CL 4LVOC 3U30C 4Z8FL 5DUPL 3ARGD 2H2SD 3IAQA 3FL7A 2FZ3A 2CK2A 3ZTNH 5TE4L 2ERJB 3IJYB 5HVFB 4Z78A 4LQFL 1GC1L 2NY5H 5T1DH 4O2CB 4HS3A 2DD8L 5F1NB 5JR1H 4LSPL 5A16A 2A83A 3CFCH 2HTLC 1FL3B 1S9YB 3NH7H 5DEFB 1LK2B 1NCWL 2QSCH 4OZIA 4JQIL 3CVHH 4U1LA 5T3XD 4I2XE 2BY1A 4LF3A 1VFOA 1CF8H 3SE9L 5D70H 3QI9D 3LSOB 5LAXA 3TP4A 5AWNL 4P46D 1IKNA 4NQXA 4TUJB 2E27L 4WEBH 1A7NL 3D85D 4HLZG 3BE1L 3BO8A 1H3UA 5DA4A 1Q9LA 4AG4L 3FOLA 4G8GE 1KIQB 5IB1A 4Z7NF 4YQXL 5FHAL 3L3OB 5KTEH 2H1PH 2BSTB 4F7CA 4Y4FD 4ZOBA 5F8RC 4PJIE 4X4YB 3P0VL 2DI9A 4S1QH 2DQDH 4RGMC 1U8MA 3K4ZA 2KZWA 3MRDA 4H26B 5HGHB 3MYJA 4OCWL 2C1PA 2HAZA 4DKEL 1BLNB 2XTLA 1C12B 4HKZA 2ADJA 1U91A 3KS0H 3WHXA 1YQVL 3ECBA 4ORZC 5D7IE 5DRXB 1INQB 5IBUG 5J11B 4JANA 3E3QC 3O11B 5J7CC 4YHIB 4TNWF 1CGTA 2J8OA 2R1XB 1TVBA 1PW3A 1FNGB 1ETZB 1JHLL 3TN0B 4NDMA 4A6YH 4YAQB 1JBJA 3MV7A 3O4LD 1U2HA 1QKZL 4RISL 3QNZA 5DMGD 4F8TA 3CSYA 4NKMB 3MUZ1 1AGDA 3WNKA 1OAQH 1J1PL 2WLZA 1I8MA 2JELL 5L2KB 5TH2B 3W9EA 1HHIA 4M62H 4OKVA 4ZO6A 1JF6A 1MFNA 1XZ0A 2VXSL 3G6JF 1S9VA 1YNTA 2FWOB 3FT2B 5GRVL 1OWWA 4DEPB 5IESL 3PQYA 1I9JH 1NC4D 4QRRB 4UZGA 4W70A 4YDKH 5INDB 2EH7H 2IANE 3P73B 4ETYA 3NCYP 4CNIA 2CPCA 5E08H 5D72L 3W0WB 1J10A 2I60H 1GGTA 5GS1C 4QXGH 5LGHL 4PTUB 1UVQA 1NCNA 5HYIA 4L9LC 1QSEE 5JHDE 1A6UH 3GI8L 2EDRA 1KTDA 2AK4A 3TBSB 1AH1A 1JUFB 4NRYB 5B4MD 5BZWB 1RURH 3PP3K 3HE7A 3IT8D 4PJ9B 5GHWH 5T1LD 4JFFE 4LRIA 4QWWD 1WBYA 5IHZB 4J3XA 4YXHL 3HS0A 3I02A 1DQLL 4RMTA 4YHZH 2XKUA 3KPSD 5KS9A 5KVMC 3VFUA 1EX0A 2VC2L 3JWDL 3QEGL 5DJ2A 4LEXH 2OR9L 5LWYH 4OFPA 2X4UB 1BM3H 2W60B 5EORH 4EN3B 1VHPA 3CH1A 4O2EA 2Q20A 3RVVC 4F57H 2AV7B 3DPBA 3LIZL 3TPUB 5T5NF 1HXYA 5IR1A 1Q72L 3KDMB 4R0LB 4YUEL 5A1AA 2NY1B 1FGNH 2QR0A 5GISH 4RWHA 2YKLL 2DICA 3CUPB 3V5HB 1UXSA 4JFDB 1R5VA 2GYSA 3AUVA 2EDQA 4X5XB 4H1LB 3UMTA 1QLFA 1SYVA 3B4NA 1YEFL 4JM2B 3T3PE 4ESKA 1WAAE 1EFXD 4HUXA 1OP3K 2ZUXA 2RHEA 4PRHA 5K9KB 4J3SA 2AP2A 3O8XD 5DT1H 4R26H 3U7YH 3RNKA 2G75B 4UTBL 4YJZL 1CDIA 4F2MA 1CD1B 5ISZA 4G8GD 2V7HA 3O9WD 1Q0YL 4WO4D 4NO5A 2W1NA 1HXMB 1MCFA 4NJ9H 5DD1H 5HHQA 3TBVA 2OQJA 4NN5B 5HGGS 3HE6A 1A3RL 3O2DA 4ERSH 3U0TB 1RZ8A 1F3JB 3SKOB 1OARL 4QY8A 4OZ4A 3L5XH 3RBSA 3B8SA 2QQKL 4IEFB 2XQYK 1AI1H 3ARDA 5EOCJ 1SJVA 3HNVH 4I0PC 3VFSA 2RBLA 1DCLA 3FN0L 1R3LB 2V2TB 3JWDC 2EXYD 4TVSa 5MHSE 5C0IB 2K3TA 1NC2A 1BPVA 4GXVL 4WI3A 2X9XA 1PZ5B 5HGBB 4WGVB 3WNOA 4U31A 4CN1A 2OL3L 1RMFH 5L2KE 1S7XB 4K3JH 2BSRB 4YGVA 4G42A 1XGYH 3RZCC 2WIIA 3MBXL 2ITDA 3E6FA 5ICZA 4RAUB 3MCLH 4HH9B 5IVZB 4QRRE 3OKLB 2GAZA 1KXVC 4TOYL 3SHSA 3HZMB 4NCC1 3QJHB 3W0WE 3BD4A 4K7PY 1QA9B 5JDJA 4H0IA 1F8TL 4JR9L 4TSCH 4A2LA 3G6JA 3FN3A 2R0ZL 2EDHA 2VOTA 4X6EA 3JVGC 4NKOB 4KK9D 2BNUB 3PWVB 1DE4B 1MAML 2DTMH 3VJ6A 1RULL 5JOFB 5M7QA 5BRZB 5CAYB 5FV1L 2FBJL 1FVEA 4TUKH 4UIKL 3MV8E 3IRZA 4GKSA 2BDNH 2ICCA 1YPZA 4DZ8B 3PNWB 3VCLB 1QSED 5JHDD 1DBAH 1T0PB 4DKFL 5IBTL 5AEAA 4LLQA 1FVDA 4KUZL 2BVEA 3VFWA 1KFAL 4PG9B 5F88B 4MWFA 4HH8A 4PJ7F 3LKNB 4BFGA 4M1DL 1EHLL 3V7AE 4RQQA 4LEOA 1WEJL 1KENL 4AIZB 4ZFGH 4QTHA 2MHAB 4JJ5B 4ZTOH 1C16A 1WK0A 4OZHF 3T4YB 5IKCB 4JGJA 4GH7B 5DSCA 2ZJSL 1DBBH 1C08B 1GZPB 3H9SE 5D2NB 4OIIH 2EIEA 1J8HD 4JDZB 4JFQA 4UB0L 4TVPD 3U4EA 1Q38A 2YSSB 4HXBL 1T80A 4U0QB 4TQEL 4Y2DC 4JFEE 3HCVA 1KCRL 1I1FA 4KJQC 2RFXB 3T0AA 3ULVF 3ROOB 4YHLH 1ZWIB 3WIHL 2YPKA 5HHPB 4FQQA 4XHJD 3D69A 3H3KA 5SX4I 5MP6L 2P44B 1HH6B 3DRQA 5I16B 5F93C 1MREH 1A2YA 3DVNB 4HQQH 5FYLH 1TXKA 2W0KA 5D6CA 3UTQA 5FM8A 2F8XC 4LRNL 1I7TA 4D3CH 3QQ4B 1OLZA 3CFDB 1FPTH 1EMTL 2H26A 1T7WA 4U4BA 2VIRB 3QUML 4L4VB 3DX8B 1JPTH 5IW1B 3AM8A 3DROB 2G5BA 4FZEH 4YXLL 4JHAH 2XICA 1M7IA 1CDJA 3M07A 5DJYB 1ZK9A 3FZUD 1J1OH 1T89A 4P4KA 5J9PB 5IB2B 4YDVB 3SOBH 4FQ1L 4E0RA 1I8IB 4FXKB 3WL9A 4IDJL 4U7MA 1LWRA 5EN2B 1KCLA 4JQXA 2ADIB 1X6LA 1MIEL 4K8RD 5TF1H 1FZMA 4UILH 5SWQB 1NGWB 4JVWA 4LARL 2AEQH 4PRNA 2HLAA 3BISA 4WTWA 4AEIH 1IAMA 1ND0A 4UQ2A 2FZ3B 3CLEL 3NCEB 4PRPA 3LD8B 1N2RA 4Z78B 4N0FA 1RIHL 4ELMF 2RB8A 1SY6A 3WNNA 4HHAA 2V5SA 3S6CA 4HS3B 5GXBB 3LKRA 4O58L 5A16B 2A83B 5D7JC 1KIPA 3EYSL 5GGTH 1G6RL 2JKXA 5C0NC 1Y6NR 3P30L 1FYTA 4NZRH 4X7SH 4OZIB 4U1LB 2EKJA 4LOUD 4D9QE 4LF3B 2HP4A 1QSFE 1IC7L 5GGVH 3HN3A 2R56L 5LAXB 1D5BA 4NQXB 4HWBH 1KJ2L 1I9IH 5L2KD 3VFOA 1LO3L 3BO8B 3H42L 1OPGH 4ZAKC 1Q9LB 1ACZA 3FOLB 1RD6A 2OK0H 2XN9E 5IB1B 5DMYA 1UM5L 3NIFF 4U2YA 2NXYD 4EI5D 5EU7E 1JHKL 3K46A 1U8LA 3VRJA 5BRZE 3WKMH 3ZYJA 4JHWL 3W0WD 1B4RA 5KSBF 1U8MB 3MRDB 2ESVB 3PL6C 2VZOA 1B6UA 3MYJB 1N64H 2C1PB 1JK8A 5JIPA 5CILH 5J6GA 4GSDH 4APQA 5HBBA 4S10A 4HKZB 2ADJB 4RRPA 1U91B 5HDBF 4C83A 1AXIB 3GSUA 3WHXB 3ECBB 5EOQL 4QXUH 4JANB 4B41A 2HKFL 1OGAA 2QADB 3QQ9C 2DI7A 4OGAC 5BW7C 1V3JA 3TF7C 3MV8D 12E8L 1TVBB 3PV7A 3IDIA 1XF5A 4NDMB 3D48R 5D2NE 3MV7B 3SKJH 5TQ0L 2PW2A 3QNZB 1MFAH 3MACL 4P3DA 4PJ7A 1MFEL 3WD5L 3CSYB 3ARXA 1AGDB 1GGIL 2B8OT 1T7ZA 1I8MB 2HJFA 2XTJB 4KI5D 3N1GC 3W9EB 4XMLL 4OZHA 1HHIB 1T0NA 1SBBA 4OKVB 1MRFH 2WBJA 1IEHA 4OCNC 3H9SD 3ZL4H 1T7YA 4G6KL 1XZ0B 5EC1A 1S9VB 5F8QC 5HPOA 1BVLB 4XRCA 2Y1VA 3N85H 4JFED 4XCFH 1OSPL 1WUNT 2IBZX 1MEXH 4CNIB 4XB8A 1IL1B 3OAUL 3CU1A 3RHWF 2PYED 3C09B 1J5OL 1LQSR 1UVQB 2NX5A 1CLOL 1DR9A 3HFMH 5E4EC 2WNGA 5KVFL 1NFDF 1X5KA 4L8CA 1KTDB 2AK4B 3TNNA 2QSVA 2VSCA 4NO0A 4BA8A 3MLXH 3RVWC 4KV5E 5DUBA 1LGVA 2X5PA 3SO3C 3HE7B 3A6CH 3RDTC 5IT2H 3P3YA 5CWSA 2G2RA 4P3CH 5GGSY 1D9KB 1GIGH 1WBYB 3HS0B 3I02B 1IZKA 4LQ1A 1QR4A 5KS9B 1HQRA 4QRTA 1R3IH 5E2VL 3VFUB 3MRRA 3ULUD 2JIXA 5FO8B 2VDRL 3BHBA 5DJ2B 4H0GA 1SHMA 2O26U 3WFBH 4ACPA 4BK5A 1UG9A 3HMXH 4ZNCD 3CH1B 4O2EB 4OZIE 2O5YH 3GBLA 2YN3A 1AJ7H 5IR1B 4M93B 1HXYB 5CIPA 1XMWA 5ACLA 4P2OA 5CCKH 1DP0A 2N7BA 2QR0B 3DBXA 4ELMA 4N8VG 1FLRH 5ANME 4K9EH 1OOAA 1KJ3L 4LVNB 4KRPB 1BIHA 1UXSB 5IW3A 3AREA 1YEKL 1R5VB 3QFJA 1QLFB 1SYVB 3UAJC 3NFPA 2EEDA 3NABL 4HUXB 3IYLW 2GQHA 4RFOL 4PRHB 1QSFD 1SYSA 3T1WA 4FNLL 2IAMA 2OR8A 1H8OA 5CINL 1MHEA 4R97B 5DVOA 4PLOB 4R9HA 4XMPL 3CVHA 4Z77A 3RNKB 5FFLA 4S1SH 5TDPA 5AD0A 2YD1A 4JO1H 4F2MB 3V5DA 5ISZB 3U7WL 2V7HB 2XN9D 3H8NA 2EEAA 3UTTA 4NO5B 4HKJA 4XNXH 5HHQB 3BN3B 2AERT 3TBVB 4TNVK 2OQJB 5T33L 1WTGT 3HE6B 5K9JH 5BRZD 1KPVA 1HINH 1P7KA 3QHZH 1RZ8B 3C8DA 4E41D 5A40E 1CZ8L 5KSBA 1IILE 4QY8B 4OZ4B 3MCKA 3ARDB 3GKZA 4KZEL 2CLRA 3EDJA 3LPWA 3VFSB 5GS0D 3WXVL 4KRLB 3LDBC 3M45A 1U8QA 3SJVA 3MV7E 1OCWH 2MKLC 5JXED 1AR1D 5KVDL 4J23A 1NC2B 2YMXH 4M7ZB 1MCKA 3QQ3A 1RUAH 1TZIA 3V0WL 3DX9B 2XTJE 4FABL 1CVRA 3KS0J 3X11A 3OJVC 5JHLL 3TLRA 3F12A 4YGVB 4X80L 4G42B 4FQJH 1KLGA 2A6KA 2WIIB 2ITDB 2VDQH 3E6FB 4P5TC 3VFMA 5ICZB 4R2GB 5IJKA 3PQYE 3F7VA 1NCAH 2VTFA 1RZJL 5A2JH 1XIWA 2GAZB 3WNMA 4A6YA 4W81A 4FOMA 4PLKC 4B7IA 1TVDA 3L9RA 2FNBA 3P9MA 4QGTA 3WS6A 1OLLA 4NBYB 2ZSWA 2ED9A 4GW5A 2X40A 3G6JB 4Y4HD 1HKLL 2ILLA 4X6EB 3SY0A 3LRHA 5I19L 3VJ6B 3HUJF 4GRMA 4OLXL 4KDTA 2AK4E 5F6HI 2OCFD 4J3TA 1FVEB 1CFSA 4YBQD 4RGNE 1I8LA 1R5WA 2BNRD 4O00A 4GKSB 4JGUA 4NM8H 4Y16C 1B0R