2GHWB

Crystal structure of sars spike protein receptor binding domain in complex with a neutralizing antibody, 80r
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
244
structure length
232
Chain Sequence
EVQLVQSGGGVVQPGKSLRLSCAASGFAFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRSYYLDYWGQGTLVTVSSGGSETTLTQSPATLSLSPGERATLSCRASQSVRSNLAWYQQKPGQAPRPLIYDASTRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQRSNWPPTFGQGTKVEVKSGLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/viral protein/antibiotic
molecule keywords Spike glycoprotein
publication title Structural basis of neutralization by a human anti-severe acute respiratory syndrome spike protein antibody, 80R.
pubmed doi rcsb
source organism Sars coronavirus
total genus 61
structure length 232
sequence length 244
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ghwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ghwB01
1A7NH 2AK4E 3FT2B 5E6IB 4GKOA 5FM5M 3L3GA 2GK0A 1A9EA 3TV3H 3X11A 3O6FD 4Y7MA 5H35A 3BN9C 3V6FA 1U8IA 1DFBL 1I1AD 3UTSB 2IFFL 3QXDB 1C5CH 1N64H 1CZ8H 1FYTA 1IRAY 2DM2A 3OR7B 2DBLL 3SGKA 5CGTA 4YX2L 1QFWM 5FYKL 4XBEH 1NDGA 3MYZA 1KJ2L 3CLEL 4P4RA 1RZJC 3PXJA 4I18B 1BM3L 1EGJL 4WUUE 4NZTH 5DJYA 3WNLA 3SDAD 3F7RA 8FABB 5ITBH 2NY5C 5D96C 3DROA 3T0ED 3MA9L 4R2GB 1MCWM 1I8LC 2YD3A 3B3IB 4QHNB 3BPCB 5EPMA 1FFRA 3CZFA 3FB8B 3K4ZA 3QFJE 2IBZY 3HCVB 3OF6A 1CK0H 2KBGA 1J05B 4ONFL 5FGBA 4ODXA 4EI5A 1Q0YL 2HFFA 3IDIB 5DHVA 4DUXA 3H9SD 4HIJB 5D1XB 4LHQB 5FDWB 3DSFH 4K7FB 5BMFL 3C08H 1KIQA 4M9PA 2BRRH 3KYAA 5CFHA 2HT3D 4TQEH 2ED8A 4JZJA 4YO0B 5CUSL 5AEAA 5HPMA 5D1ZD 3OV6A 2W9DL 2VSDA 2Y9RT 3UXFA 3SPVB 2IG2L 1U3YA 3RU8L 4KRMB 3S34H 1N5AA 2R8SH 4MJ5B 3FOMA 2CRYA 4LPCA 4K2UH 3V0WL 4MXQD 5BZWB 4PJ5E 5FO8B 3WUWG 3HFML 4JFYA 1ZEAL 3PDOA 4QCIB 1B3JA 1UXWB 2WIIA 1QHPA 3QUZB 3DRTA 1XIWB 4KROC 1WF5A 5LCVL 5DUML 2G75B 3TPUB 4Z7UE 4OIAA 1AFVL 3MRGA 4UDUB 3SE3A 4JRYE 2BX5A 3QDMA 2I07A 2X10A 4L9LB 4UINL 5AD0B 2W0FB 3MOAL 4PP2A 5LGKA 2V17H 1DBJL 5SWZD 3IDYB 1GXEA 5BQ7B 5C08A 4F3FB 5FK9A 1BJ1H 4XPAL 2KQMA 4PG2A 4WO4A 3W2DL 1MPAH 1HDMB 4AIZB 1KLGB 1EHNA 3QWOA 3QIBC 5CMAA 4E5XA 5BS0B 3VXPA 3ARZA 3I50L 5FYKH 1R5WA 1T2JA 3TBTA 2IH3A 4YDLC 1KIRA 1DSFL 4YC2C 4XVSH 4HKXA 2CIKB 1I1YB 2J4WL 2FEDD 1EGJH 4NQVB 5CJ5A 1D9KC 5MENA 2VZUA 5JW4R 4WU5A 1JHTA 4FFVD 5B39G 3MA9H 3EYSL 3LPFA 4E42A 3ZKXC 1KT2A 4R8WH 1E0OB 1NGPL 5JR1L 4YGVB 2LABA 5H94B 1X5XA 1OHQA 4UIKH 4CMMB 1KJVA 3FONB 3VXTA 1AXSA 2GIYA 3BUYA 3THML 1E4KC 1JNLL 4LCWE 4NZDA 4PP1D 4PTTB 4X6DA 4ONFH 3BFOA 3VRLF 2EDBA 4YBHA 1Q0YH 5FYKE 1EMTH 3LN5A 1BPVA 4HEME 1X5FA 3LEVH 2BP3A 1RURL 2BNQD 3RWEA 5IT2L 1FHGA 2AEPL 1XZ0B 2MKWA 4PGBB 4WJ5A 1I8LA 1XF2B 4FS0A 2EZ0D 1GZQA 5ICYA 2QEJA 2LFGA 5HI4C 2VH5H 4Q9BA 4RIRB 1EZVX 4EVNA 4RA3A 3P2TA 3HFMH 5EOTA 3IFLH 5IFJB 2IANE 3CH8A 1NEUA 3MV8B 3UX9B 1MCIA 3SJVA 1PVHA 2X4OA 4P23C 2D7PA 3SQBA 1UM6H 5CBEA 4HWBL 4K3DL 3P73B 4QKXB 4QTHA 1K9TA 1OT1A 1MLCA 3MRBB 4MQ7B 2OR7A 4K3EL 5IQ9A 2ZOLB 5HDBE 5B38B 1UEMA 2A0LD 3P77B 3MOAH 4FTVB 2X9XA 3W82A 4HFUH 3QWRA 2HJKB 1ZT1B 1QOKA 3VXUD 1VGKB 3DMMC 2PO6D 1DR9A 3L7EA 1T1YB 5DHYA 3ZSTA 1VB9A 5IMKB 2QTEA 1Z9MA 2IMNA 3ZDXE 1IE5A 3I50H 1G6RL 5HHMD 1OAZL 4PJGA 4BZYA 1FCCA 1F00I 1FFQA 2H32B 2X2YA 3RWJA 1P4BH 1WBXB 1PKQE 4GRLD 1RIUL 4MCYB 3P0VL 5FO9B 4Y16D 3VDCA 4OLZL 1IAII 1UADC 2RFXB 5HY9A 3DURB 4LSUH 3EYSH 4NZJA 3TA3D 2XXCB 3HE7B 3EYUH 2VABA 1NGPH 3BKML 4NJ9L 1JNNH 3QEQD 3VDBA 1CVRA 1XF4A 2ZWLT 4X6CE 3QIBA 1EVTC 1JNLH 1ORQB 2XKSA 3GB7A 4E41A 4NKOA 1SJHB 4HX1A 1P7HL 4QHLB 5LGHL 1J0YA 3V0VA 4M7LL 2PYEA 1MCSA 5IFAH 4E0RA 4LEXH 3N1FC 3MYJB 1D9KA 4OLXL 1RK1B 1MFAH 3BWAB 3WO4C 4D0CB 4K7PL 4S1DC 4GRWF 4XX1G 4MB5A 4F33B 4HK0B 3GSRA 3X17A 4JM4L 3V4VL 3RZCC 4OM0H 2DB8A 4Q6IB 3J8F7 1JBJA 5IOPA 4H25B 4L3CA 3QUKA 3BISA 4MMZC 2C5DC 1E4KA 5DD3H 2DQEL 5I0ZA 1HHGA 3L3GB 5CWSA 2GK0B 3X11B 5H35B 2BVOA 3UZEA 5I30H 1G84A 3EJZC 3FZUD 5FECA 2EDOA 3ARDC 3WKNA 3R8QA 3JBG7 3VI3E 5E8PA 1KUMA 5JA8B 2WQ8A 1TNMA 5ADPH 4RGMB 4HCRA 5T1KA 4R3SA 1CDCA 1BVLA 1NDGB 1T0MB 4P4RB 4V1DE 5J8OA 4GLRI 4YHZL 4KKAD 3TWCH 1MFCL 1NAMA 2DKMA 2RR3A 4HH9A 3UBXI 2EXWD 3F7YA 3SO3C 1BD2A 2NY1D 4HJJL 3O3BB 5GS2H 4PS4H 2VDQH 4KUZL 4MVBC 1G7HA 4S10A 1HXYB 1OAZH 4PV8B 4P23A 5EPMB 4UOW0 3CZFB 1HZHL 1GHFL 5ANME 4QHKI 6FABL 1GC1L 5IHUL 4NN7C 1CICC 2PNDA 1VESA 4HIHA 3GSVA 1QSFD 1N6UA 4EI5B 1M7DA 4HDIB 2N1KA 2HFFB 4ELMF 1PDKA 5DHVB 4Q9CA 4RGNB 3RX5A 1DEDA 3DMMA 4M3JA 3WSQH 4JKWA 1NMCC 3BKMH 5FCSH 3U7WH 4X5LA 1I7ZB 4JZJB 5HPMB 2BSTB 3KLHD 3BVNA 3QJHB 2JB5H 3PL6C 4M7LH 1AD9A 1T83C 3O4LD 5LQBL 3ULVC 3FOMB 1HWHB 3ZKQD 4DW2H 5F3HA 1VFBA 1R6VA 4UUJB 2X4UA 2VXUL 4JFYB 2VDMH 4PYHA 3PDOB 5IP4A 4WI2A 1T6VN 3QI9D 3V4VH 2WIIB 2YPLB 4MQTB 3DRTB 1AGEA 3QXVA 1B6UA 3NAAL 3MRGB 4XB8A 3QDMB 2I07B 3W9DB 3QUXC 1M71A 2ZG1A 4GXUM 4RGOL 3EHBC 4JO3L 3QUYD 3T2QA 3QH3A 2DM4A 1EUUA 4U0QB 2E9WA 2ICWA 4YFDB 5C08B 2VDRL 5FK9B 3VXRE 1EFXA 1QLRA 4L8CA 2X1WL 4P46C 3QFDA 3QWOB 5CMAB 5F88A 3QO0B 4E5XB 3VXPB 3LN9A 5F6HI 3RZCA 3TBTB 2EIDA 1KIRB 3LEXB 3KPQA 4L29B 4MZ3A 4XVJH 4HKXB 3OJVC 3B5GA 1KC5L 1PKOA 4YHZH 1IGFH 4TSBL 1IGIL 3BZDA 5MENB 5CEXA 5D6CA 3QDJD 4DKEH 2AGJL 2F74A 1AI1L 1JHTB 1KIUA 1MEXH 4TPRL 4KUZH 4E42B 1DANT 1U92A 1KT2B 5DMJB 1XAUA 1RY7B 2UUDH 3ARDA 1EJ6A 4P2YA 1KJVB 4ORGA 1AXSB 3BUYB 6FABH 1A6ZA 4JN1H 5T3ZL 5GJSH 2YUVA 1GOFA 1R3KA 3OKOA 4GG6A 2D0GA 1FNAA 3QDGD 1C8PA 1NBYA 3LN5B 3FFCE 1FZMB 4M48L 5DC4B 1DLFL 1RZIA 4HZAA 5HGDA 3RWEB 4LLYA 2BJML 5D96B 4PJIF 4WJ5B 4ONOA 1M6OA 1I9EA 2PKDA 5I19L 2EYRA 5SWSD 1GZQB 4U1GC 5ICYB 3N0PB 1JGVH 1FORH 2A2QT 1K5NB 2C7UA 4HS3A 4KJPD 1CXIA 5CINL 4Z9KB 1CICA 2O26U 3GSXA 1LO3L 1Q9WB 4EVNB 5DRWA 3RX8A 3KDMB 3T0VA 2VXUH 5EOTB 3GMRA 2FIRT 5BRZD 4CAGA 3L3KA 3H3KA 3SJVB 4UOW1 3U36A 4C4KT 2V5RA 3MZGB 3FMGL 3NTCL 5CBEB 4QTHB 1MLCB 5IQ9B 4MNGA 2Y7QA 2HKFH 2C1OA 3IU3B 5C07D 4RNRA 3RX7A 3PL6A 4HIXH 1T83A 2KPNA 3FO0L 3MUGA 1VHPA 3RVVC 3VGHA 2A38A 4JVUA 2PXYC 5DHYB 3ZTNH 5D7LA 2VDRH 1M7IA 1MCPH 1OGAA 3BEVA 4WW2B 2OS7A 4Z0BL 5C0RH 5TDOA 2NW3B 5ACLA 4FHBD 1H3WM 3B9DA 1WBZA 4U1JA 5DMGD 4AG4L 3RWJB 4TSBH 1IGIH 3WIIH 2EKSA 3KLAA 2FSEA 1AR2A 1AKJD 3QUXA 5HY9B 4LLUA 1FVEA 4HFWA 5GGRB 4NKDA 2VABB 1N6VA 2QBWA 4JFED 1G7JB 1YEHH 4P46A 4IDJH 4PRDB 4X99A 3BMWA 4JHBA 5GRUH 4NBZB 1QFWH 3MLPA 3ZYOA 4WU7B 4LP4A 4E41B 5C2BH 4NKOB 3HLAA 3ESVF 2UWEA 4WWID 4YDLB 4HX1B 5C2UB 4YC2B 5C0DA 5D7JD 4I3SH 3V0VB 3KYKL 4DZBA 2CUMA 2PYEB 4E0RB 2CPCA 3T3PE 3MRFA 2Y6SC 5I8EB 5JZ7D 1HH6A 4Z7OF 4CGTA 2BJMH 2AI0L 2HA1A 4L8CB 3IKKA 2XTJC 3D3VA 1AJ7H 3GSRB 4LSTL 2FX7L 5IOPB 1FQ9C 3QXTA 5DJDB 4L3CB 5C0GB 3HPJA 3VWJC 2C3VB 1LO3H 1FZJA 1G9NH 5T3ZE 4WI3A 5I1HH 2IEPA 1BLNA 1HHGB 5CWSB 3K3QA 2QKIA 1H15A 1IARB 4BK5A 3QQNA 5FECB 5IHLB 3TCLB 3QR2A 3FMGH 3NTCH 3O6LL 4FOMA 3ARTA 3FB7B 2GITA 3MSPA 5T1KB 5SWQB 4ODVL 3D6GA 5HYJA 1BVLB 4RBPK 3DRQA 4U6XA 1U8MA 1NC2A 5JW4N 3BKYH 1NAMB 4HH9B 2GQHA 2NW2B 3U4EB 1JTPA 1BD2B 1WJ3A 3LSOA 4MD4A 5TDPB 1G7HB 3SDCD 3PWPA 4RMSA 3VWKC 4OKDA 3T3MF 4P23B 4MDJB 1P9MC 4G3YL 1CLZH 3GSVB 3KS0H 1M7DB 2MQ0A 5D1QC 4MSWB 4F58L 4NC1E 2R0KL 2QADC 4QTIL 5KVDH 4F7PA 4XP6H 3NFNA 3HNTL 1FBIH 2PXYA 3ARUA 4JQIL 2XWTB 2ED7A 4KRPC 4PGEA 2BY1A 5EUOF 2R29L 5DK3A 3BVNB 3EO9L 1XGRA 4U1SB 3RKDC 3Q6FB 3VGAC 3CSGA 1B2WL 5BVJB 4X4ME 3HR6A 4UQ3A 4ZDHA 3UAJC 2A6KA 3MGOA 1VFBB 5F3HB 2DQCL 5C0EA 4ONGH 2HTKD 1J7VR 1U2CA 2I24N 2X4UB 2FECL 2ZPKL 2QSCL 2PETA 2D7OA 4ZUWA 2YK1H 35C8L 1DQTA 2FX7H 3F6IA 4B5EA 3BHBA 1E28A 3LB6D 2ADIB 3KPSA 1NGXA 3LKRA 4DQOL 4HWZA 2IBZX 3LEYH 4OCYH 4BQ6A 2GHWB 5GGUA 4DK6A 1TLKA 1Q9LB 1N0XH 4ZUVA 1C7SA 2XRAH 5IB4A 3FJTA 2DJ4A 4QXWA 4ZTOH 5KANI 1IAKA 2ICWB 4CDGC 3C6LC 4M5YH 4JKLA 1EFXB 1QLRB 1UEYA 5E2UH 5FM8A 1CGWA 3WO4B 4Z0XA 2HMIC 5F88B 1IEAA 1KV3A 2YUWA 2JE8A 1UYWL 3RZCB 4XPFL 3DX8B 4WI5A 1AO7E 5IMOA 2VTFA 3KPQB 4I9WE 1T1WA 3PNWA 1TVHA 4PTUB 1BHGA 1EEUA 2XACC 4WTZA 3VWJA 4CRPA 1SY6A 1PZUB 5DI8A 5EIVA 4Q9QL 5I6XC 5CEXB 5D6CB 3M8OL 5C0IB 2F74B 3DVGA 1AP2A 2HN7A 2QHLA 1U92B 3NH7L 3ARDB 4CN1A 1A7RH 1EV2E 4ORGB 4K07A 2XN9E 3T2NL 1A6ZB 2Q7YB 4G3YH 3OKEA 2EE2A 1R3KB 1FE8L 3OKOB 4WUUA 4GG6B 1IBGL 4GUPA 2AXFA 2XOTA 5DRXA 3MBXL 3BIAX 4JLRB 2BOCA 1D5IH 3OR6A 4OCXL 1RZIB 1JF1A 3HNTH 3UROR 2F5BL 5HGDB 1WC7A 2UVFA 3SO3B 4NHCL 3TP4A 1G7PB 1MCHA 1QLFB 3B9KB 3HZYA 3G6AA 1OTSD 5JHLL 3EO9H 3VWKA 2Y07L 1JHKH 4MS8D 3QFJA 4Z7NF 2YEZA 1P7QD 2EYRB 3HRZA 4XHJD 5D2LE 5A16A 43C9A 4FQCH 2C7UB 2BZDA 1CICB 3GSXB 1P9MA 3B4NA 2H2PD 5HHPA 2C1PA 2ZPKH 5DRWB 4XTRC 2QSCH 2ICCA 5D1QA 1WBYA 3UTTE 4DVRL 3GMRB 1J11A 1NC4D 3L3KB 1PG7W 2FDBP 4PJAB 4IDLA 3U36B 1NMCB 1YYLL 1NLBL 2ZP0T 3MV9D 4DQOH 3PIQB 1J1PH 3HC4L 4LCYB 1RV6X 3ULUD 1JPFA 4I3GA 4MNGB 2HFGL 5DQJA 3G04A 1TJGH 4PJ5A 4MA8L 1JWSA 4R96A 1WZ1H 2WUCL 4I0PC 4Y5XC 3I9GH 1R5IA 5D7LB 1OGAB 3BEVB 1ZANL 4N90D 2ICES 4O51A 5J56B 3QNZB 4XNXL 4TNWF 1IAMA 4XPFH 5B39A 4JDZA 1WBZB 4C59B 4JRYA 1MIEL 4G9FE 3RGHA 4U1JB 3MLYH 3V8CA 3HC3L 2A9NH 1LE5B 2VDPH 2EKSB 4G6FD 3UC0H 3VXQA 4Q9QH 4OZHE 3KLAB 3QUXB 3M8OH 4JHAH 4J4PC 5E6ID 3WUZA 3NH7H 4Y4HC 1IVLA 4HFWB 2ZCLH 4NKDB 5IMMA 4M4PA 1JVKA 3C6LA 4H0GA 4P46B 2XZAH 3UTSD 2JELL 5J1TC 5EFIA 3LKPA 3HLAB 4XWGH 1QLEL 2GKIA 5C0DB 1R24A 2E7LC 1OWWA 4OCXH 1DBKL 2HH0H 4OSUL 3ZHLA 1U8OA 1HH6B 2MQCA 4KV5E 4NHCH 5J57B 2EIZB 3QXAA 4K7PY 3D18B 3AS0A 4PJDE 4HS8L 3D3VB 1YMHA 5JHLH 2Y07H 1S9YA 1X6LA 4K3JL 4R2GD 3ZSSA 4KZDL 3CJJA 4H8WH 1ZLSH 2FBJL 5BV7L 3HPJB 1TZHA 4XC3L 1RJZA 3X3FL 2OTUA 1GAFH 4MCZA 3P0YH 4XP1L 3KWWA 4P59L 1BLNB 2ZNWA 4PD4J 4DVRH 2IGFL 4HD9A 1QRNE 3QPXH 2QKIB 2IBBA 4JDTH 3LMJL 3KYNA 3MGAA 3H9HA 3SGDI 4OLWL 3EGSB 5ERWA 5J0BA 3KAAA 1YYLH 3PJSA 4GXUN 2E6QA 4MB3A 4M02A 4YFLI 3R1GH 1TVDA 2HFGH 5D4QA 4ALAL 5J6HB 1NGZA 1FPTH 1I9JH 1INDL 4ZTPL 4U6XB 5DJ0A 1ADQH 1NC2B 2CIIA 2WUCH 4IM8A 3BZEB 4YQXL 1XCQA 2F58H 3EKCA 2IANA 3WFHA 4Y5YC 3WXVL 4TNWK 2YRPA 2XKNA 2DMBA 1MCKA 4OFDA 4KRNA 3LSOB 1O7VA 4MD4B 4YDVA 3LY6A 3CNKA 2R0WH 4MAUL 5EG6C 1VA9A 2NZ9C 5I75B 1ETZA 3EOAA 2HT2D 4GFTB 4KU1A 3QUZD 4BZ2L 5L8JB 5I1CL 2IMMA 1XIWD 3D39B 4CU7A 3ZE1E 5L8LB 4KI1A 4WGVB 1GGIH 4MLSA 1A7BA 1OTTC 4F7PB 4I0PA 3BDXA 4Y2OA 5HYEA 4Y5XA 3OKDB 5E70A 5FKPB 5LVEA 3MXWL 3R0MA 4ZMAT 5D2NE 5TQ0L 3WLBB 3BKJL 4HMDA 5HI5D 1XGRB 4G8GB 3DV4A 4LSRL 1PKQA 5DRZB 4I48A 5BS0D 3JV0A 1V3KA 3QCVL 5E6ZA 3B8YA 4ZDHB 1DBKH 1VADB 4OSUH 3BP6A 1PLGL 1EH9A 4HT1L 1TJHL 3GMLB 4J4PA 4CNIA 3CMGA 4ZUWB 1JJUA 1D6EA 3STZA 4X6CA 4N1HB 4NNPH 5DJZA 2O5XL 2B20A 4Y4HA 1E28B 3H0TA 1IM3B 1TETH 2IWGA 4K3JH 4H26A 2Y5TA 3LRSA 4XNZB 3KPSB 5BV7H 3O2VH 4HWZB 4HUXA 1OARL 1WCBA 4X83A 3X3FH 5IF0A 4P3WA 1HQ4B 2RBLA 2F8VA 4ZUVB 2QQLL 2QQQA 5IB4B 2E7LA 1N4XL 1XGYL 2P42B 2FX8L 3IDMB 3QNXA 4Z0XB 4ENEC 1Q0XL 3U4BL 1IEAB 4PJXE 2XTJB 3MRPB 2K1MA 2AK4B 5HYFA 1LP9E 4ALAH 2FL5A 1GOGA 5F7NC 4MNQE 3PNWB 1CT8A 4OLYL 3VWJB 3TO4D 1NKOA 2RGSA 1FP5A 3QT2A 3WXVH 1C7TA 5DI8B 1ZXQA 2I9LA 1DUZB 4JQXC 4WFFE 2YRLA 4XNQA 4X7FC 4ZODA 5KVFL 3DVGB 1AP2B 1U6AH 2HN7B 3UPCA 1J9CT 4MAUH 1YY8A 4K23H 3MV8D 4UT9L 2ESVE 4QXUL 1YMMD 4V1DA 5BO1H 2PUQT 3UPRA 1MQKL 1XF5A 4K94L 4WUUB 3CFKA 2QV2A 1DEEA 1JF6A 2AXFB 4GBXB 3K4DA 3OR6B 4HXAL 1JF1B 4KXZI 3WLWD 4Y5YA 1FH5L 3EYQC 4DEPC 3MXWH 3MBEC 1J5OL 4FQPA 4KKBC 5DVOA 1TQCB 5TQ0H 3WUWB 3BKJH 5ANMA 4QRRD 2FHCA 3VWKB 4LU5L 3QFJB 4LSRH 3OKNA 3VD5A 5A16B 3EDEA 4L8SC 5ECJE 4MZ2A 2XIDA 4L3EA 43C9B 3BZ4A 4PB0L 1NMBH 1PQZA 4WTXA 4PJBE 2D7TL 5HHPB 4HT1H 5D1QB 1TJHH 2K7QA 1JL8A 3TGXA 1WBYB 1HSAA 4U7SA 2XPGA 5T5NF 3NCBB 3O45A 2QADB 1A4JA 5DK2A 2O5XH 3AM8C 4ODWA 1FIGH 3O3AB 1PJ9A 5JIKA 3LOWA 4NPYA 2A1WL 3HE7D 4KRPB 3EFDL 4OCRH 5AYUH 5TQ2L 3F6LA 1JPFB 4YHOL 5DQJB 3DBXA 1HQRB 3G04B 3VGAB 4XPHL 3VFRA 3VH8G 4PJ5B 3NZHL 2QQLH 1JWSB 1MWAH 1XGYH 2LVCA 1R5IB 2Y4SA 4RFOL 5C09E 4MHHG 4OD3L 4GO6B 3U4BH 5ITFB 3FOLB 1CLYH 5HVHB 3KNBA 3STBA 5EULV 5I17A 1IGCL 3HE6C 4U2YA 5JQ6L 3RL2A 4Z7UB 2NY2C 2UZXB 5B39B 4H1LG 4JDZB 4JRYB 3DYOA 4XVUD 5FUZL 4X5WA 2CDFA 4OLYH 4UBDC 1RUAH 2EH7H 3VXQB 4Z76B 4M43L 3RRQA 5GRJH 2OLDA 2WWMD 5KVFH 4JKPH 3VXRA 1Y6KR 1KTLA 5IB1A 1J8HE 1QSEE 3INUL 4PGCA 5CJBA 4UT9H 5I1EH 4MJIE 4OZ4A 4ZXBB 4K94H 4LSVL 1NGYA 4RZCA 2XA8L 5JNYB 4X9FA 2DBJA 3QG7L 1FFNA 3MNZA 4HUMB 5IVOA 2YBRA 1VPOL 3FQNB 4W4NA 1U8OB 4Z95H 1BOGA 1FH5H 4NQXA 4JQXA 1XF1A 5IJVA 3L3IA 3TH2T 1J5OH 2DWDB 4OCSL 2ORBL 1EBAA 4MDIB 3QZWG 1YMHB 1S9YB 3B2VL 4UMGA 5E4EB 4JO2L 4LCWB 2FATH 5AAMA 4NO2A 1ZLWK 2NTSP 3IJYA 1TZHB 4NNXA 1RJZB 2OTUB 4GQ9L 4MCZB 2D7TH 1KCRH 5FFLA 2VLRE 1L7TL 2H26B 3OF6D 5HHNA 4DUVA 5I8OH 4EI5D 3KYNB 4NQTA 2R9HD 3BJ91 3TYGL 3H9HB 4WEMB 4U6VL 1AHWC 1U41A 4MMXC 1F3DH 3PJSB 4RGND 3MBEA 4U1LA 3O6ML 3EFDH 4KDTC 4YHOH 1TJIH 1TVBA 1RZFL 3S4SA 4XPHH 3GKWH 5E08H 4L8SA 5DJ0B 5K9KA 2VE6A 2X4QA 4PJ9C 2CIIB 4U1NA 1G9NC 3P0GB 3HNSL 3QP3A 2BVQA 1KJMA 1XCQB 3QHZL 2IANB 3WFHB 2ITCB 1OGTA 1RUMH 3IDNA 4RFOH 5B8CB 4OD3H 4PGZA 3ES6A 4QHMA 3A67H 2YD6A 4YDVB 4R90L 4AENA 5JQ6H 3EJYC 3AM8A 2BHUA 3MJ9L 3AAZA 2OQJA 1H3PL 4LHUG 4AEIH 2X4PA 3EOAB 1AQKH 3GSUA 5HGBA 2YPLD 3DUSB 1T7VA 1LEIA 4NC1C 3DUUA 4M1CC 2Z91A 1KYOJ 3Q1SL 2XWBB 3ARFC 3RA7L 4QEGA 3QDMD 3HMWL 2I27N 3QIWC 2NY6C 1F58H 3INUH 3MREB 4Y5XB 4G6AC 5C08D 2EXYC 3Q3GA 3HE6A 3U2SB 3MODH 1Z6JT 2D31B 2QHRL 3H6JA 1C08A 1W8NA 1PKQB 2X1QA 3ZYIA 5FGCE 1W72L 2AJZB 3UDWC 1VPOH 4KTEH 4C56A 3ZL4L 5J7CC 3RWIB 5JW3L 5IVZB 2A83B 2J6EL 4HUUB 3ARYA 4CNIB 1D6EB 4OCSH 2ORBH 5MEND 4X6CB 1KEMH 5DJZB 5KAQF 3ALWA 4Y4HB 1OAKL 3UYRL 3G6DH 2I5YL 3H0TB 1G0DA 1DTUA 1X44A 4JO2H 4H26B 2Y5TB 3LRSB 2R4SH 3HC0A 2OXGA 4X98B 5DTFA 1WCBB 1NCAH 4Q2ZB 1BQHG 1A4KA 3CFDA 2FBOJ 2OSLA 3WN5B 1WSST 1MRCL 3D1MC 3TYGH 4U6VH 1X4XA 4KY1L 2K9UA 1U36A 3QNXB 1YQ2A 5DD5L 1RZFH 3SDXF 4MJ4A 4QXTA 4JCMA 4RRPG 1JGEA 1FL5A 4PUBL 3LS4H 1H9VA 3GGWA 3QHZH 3ZYZA 1OP5K 3MNWA 5ICZA 3NCFB 2I9LB 5J11B 3K2UH 1Z9OA 4NRXA 1G9EA 3IDXH 4OAWA 1JZ2A 4AQOA 1VFAA 3QHFH 1RFDL 4JN2A 5HHQB 1GH7A 3K46A 4R7NA 4H0HB 1YY8B 1AHWA 1OAQL 1S5HB 1D5BA 1H3PH 4LLQA 3S9DB 1JMXA 3SJVD 4V1DB 3UPRB 4RDQF 1XF5B 2JCCF 4KDTA 5GXBB 5F9JB 4NKQB 3CFKB 1CGSL 4PGDA 1DEEB 4LIQL 3Q1SH 3RA7H 4PJ9A 3IXAA 3HMWH 4HPYL 4IRJC 1CFTA 1P2CB 2VSCA 2XZQH 1KFAL 3QWRD 2IFGA 1M4KA 2E7MA 1A3LL 3BEWA 1NGWA 5ANMB 4EQ2A 3FN9A 2QHRH 4OCNC 1QBLL 3OKNB 4JANB 2FGWL 3BZ4B 2VWEE 3RJQB 2XY1A 1PQZB 1TIUA 3PQYE 5AG9A 3ARFA 5GGTH 1HSAB 2XPGB 3EYVB 1FSKC 4PLNC 3QIWA 1CL7L 1DQLH 1SBSL 3OQ3B 1OAKH 3TJHD 4ODWB 2I5YH 4DFIA 4NCC1 1MVFA 5CJOH 3KXFA 3JUYA 4OCWH 4YBLC 3P3YA 4X4MA 3GMNA 2DDQH 4PRPE 4XI5D 2AQ2A 2ARJQ 3DBXB 3VFRB 1A6VL 3OMZA 4PBXA 5GJTL 3UDWA 4E41D 1MRCH 5B3JF 1KB5L 2YC1A 4M7KL 3V5HA 3EUUA 5E5UB 1T20A 4FABH 4OQTA 4GAFB 2PYED 1NCTA 2DL9A 4P5MB 1YEEL 4C83A 3RL2B 2D0FA 3V4UH 1ZHLB 5FHBL 3E3QE 1CWVA 2NY4B 3W5NA 3GEWB 4ZYKA 3MRMA 3VXRB 4QT5B 1KTLB 5IB1B 1RHFA 5GS1C 1RFDH 4CVXA 2EO1A 5HSFA 2VZ1A 1FAIH 4UAOC 5D8JH 4ZFOA 4U6HA 1OAQH 1QYGL 3S35L 2CSPA 5J1AA 4DGYH 1YEIH 4JKMA 4M3KB 1AO7A 1ZGLA 4B41A 4OZ4B 5DK0A 4HGWB 3JXAA 1NGYB 4R97C 2FECI 4LIQH 2OL3L 5DS8B 1FFNB 3MNZB 3DPBA 4OM1L 2VIRB 5T1KD 4HPYH 1P4LB 5D71L 2D3VA 4LPXA 1BOGB 4NQXB 2H41A 4QRUA 5IJVB 3L3IB 4NQDE 4D8PA 2XTLA 2BDNL 4YUEL 1A3LH 4FNLL 3TIDA 4I2XE 3U48A 1A1OA 2XN9A 1BD2D 4ODBD 1F4WL 3MZTA 4OFKA 4NO2B 4KUCD 5JUEL 2FGWH 2W60A 3WE6B 3P9LA 3FFCB 3U1SH 3FN0H 4P23D 1S78C 1I1FB 2DLTA 5E2WH 1J1XH 3NA4A 1LK2B 3KPPA 3WNOA 2AJSL 4LIQE 3VG0L 3JV6A 3LIZH 1CL7H 4P9HH 3ISWA 4IRJA 4OJFL 4EDWH 2OP4L 4JHZA 3RTQC 4XBGA 5KVGL 2HLAA 4DEPB 1JCKA 4JFDE 1KYOK 5D2LA 4U1LB 2GTWA 3DJ9A 3DVFA 2X89A 3C2AL 3KHOA 1K4DB 2OI9B 1JHLH 3FT3B 4H8WC 1GOHA 1JK8A 3CFCL 5IB5A 2EDXA 5SX4I 4L8SB 5K9KB 2I9TA 1KB5H 3BDYL 4U1NB 1AGBB 5EZIL 2BVQB 1KJMB 2IQAA 3D25A 3GSOB 4PBVC 5KTEL 1QNZL 1OGTB 5EZOL 2V6HA 3ES6B 3AVEA 4QHMB 1ZWIA 4WWKC 3V6OE 4AENB 1UWGH 4JCLA 1J0IA 1ZT7A 4KK6D 3X13A 2VLME 2B0SH 2OQJB 3ZE2F 3ULUF 2YPVH 2X4PB 1MCNA 3GSUB 5DJ2A 5FHBH 4OZFG 3L5WA 3HS0A 2AJXL 4JZOA 1LEIB 2H45A 3DUUB 1BZ9A 2Z4QA 4HUVA 2DQDL 4JFPA 3U7AA 4JHWL 2V2XB 3ETBF 4KK5C 1JNHA 5D2NC 5IMLB 3S35H 3GUTA 4LFHG 1TPXC 1X3DA 2VC2H 1U9KA 2CRMA 3SEPA 1T7WA 3JWDC 2EDQA 2F9BT 4G9FA 3MLRH 3MOBL 3ELAT 3Q3GB 3HE6B 1EFXD 4MA7H 4S1DD 1C08B 4Q74A 4OZHA 1IC4L 4ZFGL 2B5IB 2BHZA 2Z92A 4J3VA 1NDMA 4OM1H 3RZCD 3IRPX 4HJ0D 4YDKL 3NGBC 1T21A 3BGFC 3V5DA 2BDNH 2RIKA 4LF3B 3QQ4B 5GS1A 4OUOA 1ES0A 3AREC 1KBGH 1F4WH 2NY0C 3V2AR 3MGTA 5JUEH 4N0FA 3HC0B 4OFIA 1ITBB 1MLBA 2K3TA 3P30H 3EJZD 5DTFB 5DFVC 5TF1L 3ARDD 2AS5M 3AB0B 5KS9E 3VXME 4QRTB 1S7TA 4WI6A 3ARWA 1A4KB 3CFDB 2OSLB 2Q76A 4PJDA 4OJFH 3CZJA 3OKKA 3RNKA 2OP4H 1S8DA 5KVGH 4X6BA 1RQ5A 3SE9L 3C2AH 5DURB 2ADFL 1CDYA 3CFCH 5AUMA 3B9KD 4QXTB 2YSSB 4MVBD 4DTGL 5TH2A 1JGEB 1FL5B 3BDYH 3QIUC 1Q9OA 1BMGA 1QRNA 3GGWB 2AJYL 3MNWB 5ICZB 1QNZH 5KTEH 3QB7C 4U6YA 5K9QI 1X5JA 4NRXB 1CICD 1E4XL 5KJRL 4OAWB 1OT2A 1A1MA 3GMPB 5FF6B 5C8JA 4PV9A 1VFAB 2YR3A 4JN2B 3ZMRA 2F53A 2EDNA 4GSDL 4HUKB 3LRGA 1MAMH 1D5BB 4WFGE 3RTQA 1SVCP 3W9EB 1PG7H 5I71B 4LPTA 5C0JB 2V2TA 5CLWA 5C0BE 3OZ9L 3LH2L 3STLA 4PGDB 3NBNA 2EH8H 4OV5A 4RBPH 3WJLC 4PJ9B 1J0KA 1CYGA 1CFTB 2LU3A 1KTRL 3FFDA 3ULVD 5FUOL 1SYVB 4AEEA 5EOQL 5ABDE 4WWKA 4JZNA 2H6PA 5BW7C 5D7LD 5HXMA 1OGAD 3SDYL 4PB9L 2PN5A 4M4RA 4K3GA 2ENYA 4KGJA 1N26A 4ZFGH 4HAGA 4EOWL 3S88L 4YDKH 1D5ZA 1NBZA 4OF8A 2PTUA 1ADQA 1LO4H 1JGLL 3ARFB 3VI4F 2Z31C 3F7QA 3E6FA 1I9IH 3DI2B 3QIWB 3QUXD 5D2NA 2NY6B 4F7EB 1MFDH 5EBLA 1JTOA 2P44B 1A3RH 2DLFL 3MUJA 4L5FL 3FAXA 4BSVA 4P46D 1BEYH 1EJOH 3GMNB 4M6AA 4FQQA 3FO2B 2X09A 1V7ML 3JV4B 2YC1B 3V5HB 1JZ6A 2DD8H 1T20B 4MHHI 4FQ2L 3SE9H 1P4IL 1QA9A 3BQUC 5F89B 4C83B 5EUKB 2DIAA 3D3VD 4HG4J 2BNRE 4QOKE 4LMQI 1QFUH 2F8OA 2AJYH 5J6GA 3BIKA 1OB1A 4ZUTA 4P9ML 4ZYKB 1ZA6A 2CDEA 1E4XH 3MRMB 3SKJH 3QEUB 1FNLA 5K9OA 5D5ME 4Z7OE 4FG6D 4CVXB 1MH5A 4PJXA 1Q94B 1EO8H 1T0NA 5D7IE 4U6HB 5J1AB 4U7KA 1ACZA 1ZA3A 1LP9A 1MCBA 2MCPH 3TVMC 4S1QL 1AO7B 4U6TA 3ZHKA 2P5ED 4U1HB 4X9IA 1BF2A 4MNQA 5DK0B 3LH2H 2R1XA 4D9LH 5C9JA 5BOPA 4AK1A 2YD7A 4APQC 2XQBL 1S7QA 2MWCA 4NRZA 3QIUA 5DMKB 2HTLD 4U3CA 2V2WB 3TO2A 4QRUB 1YNLL 2J12B 5LXGL 2LE9A 2VAAA 4D8PB 3VFUA 5EOQH 4CVWA 5INCB 3I6LD 4XCCL 3RBSA 2IPKB 1A1OB 2ESVA 2XN9B 1EFQA 3ZKND 4PB9H 3T8XB 5LGJB 1HXMB 4Z7WA 5C1MB 2CRIA 5DUBB 4EOWH 4BM7A 4I3RH 1K4CB 5HJ3A 4OZIA 1NGQL 5E9DA 1JGLH 2UZIH 3D39D 3WJLA 5JXAL 1R0AH 1QVOA 4FZ8L 1VGEL 3T77A 4IRJB 3M1BA 4XBGB 3MRRB 3IJHA 3RVVD 3KPOB 2DLFH 5D2LB 5D7SL 4BH7B 2GTWB 4CVZA 5DVKA 5BW7A 4JE4B 5IB5B 4N8VA 1MVUA 1JK8B 5LG1A 1CE6B 5INDA 1FCGA 2QL1A 4PJBA 3RIFF 2HJLA 3CC5A 4G8GD 5T5FL 3UTTB 4KK8C 5D7KE 1D5MA 5F7FA 4S2SB 3D25B 3I3EA 4JFOA 2W0LA 5CEZD 4LASL 3GMOB 1G7QB 2NY3C 2Z31A 1P4IH 5FOBA 5HDLA 1XH3A 5EZJA 4OZGF 1ZT7B 5C0NC 1YA5A 1U2HA 1FNSL 4TVPH 5EUOE 1TZIA 5DJ2B 1DBBH 4UU9A 1H0DA 3HS0B 3TBWA 4YBLB 1EERB 1JUFB 1BZ9B 2Z4QB 3KPSD 4Y19E 4HUVB 4RQQA 4P9MH 4JFPB 1Y6NR 2ZUUA 3QUMA 3WFDL 3ILQD 2RCSL 3DVNA 1JNHB 2NYYD 3GUTB 1KJ3L 3FCTA 3JWOC 2HYMA 1MHPL 4S1QH 4ZAKC 3I75B 2Y6SD 2J5LC 4G9FB 3BQUA 1B4JL 4HKBA 1CDGA 3QZWA 1N0LA 2XTJD 4OZHB 1WV7T 3OJ2C 4LCCB 2Q86A 1NDMB 4TVPE 2AK4D 4N5ED 4LBEB 1J8HA 4G80B 4TUOA 4K9EL 1QSEA 5EORL 2Q8BL 5LXGH 3EJJX 1FYHB 1T21B 2QQKH 3GFUA 1MWAA 1YPZF 5DC9B 1ES0B 2NXZD 4MJIA 1MRFL 3MJ8A 2H1PH 2E7HA 2ZUXA 3MV7A 4WI8A 4LP5A 3QWQB 3TVMA 4IOFC 2XY2A 4DCQA 4RFEA 4BQ9A 2X4NA 1S7TB 1RIVH 3OAUL 1T2QH 2MNUA 4APQA 2Q76B 5DQDH 1WEJL 4FZ8H 4PJDB 4UDTA 5CHNB 4GBXD 3G9VA 3OKKB 3RNKB 4X6BB 1QR1B 5EU3A 4O2CB 2IPTL 1YJDH 2FZ3B 1BOYA 3JSSA 1H3TA 3RBGA 3BP5B 1TMCB 3G6JF 1NJ9B 3I2CH 4DJMA 3ZDZF 3VWKD 1JPSL 3E1F1 5D6DC 3QFJD 1HEZA 1Q9OB 1QRNB 5JW5A 1RUPL 3NIGF 5K59E 5J12C 3DETC 1A1MB 7FABL 5C8JB 4PV9B 4W68A 5D1QD 2ARJB 4WIQA 3NACL 3RTQB 2QADD 2V2TB 3IAPA 4Z7NE 1KCUL 3LV3B 3MR9A 2DLIA 4KRPD 4OV5B 3RKDD 2RCSH 1F4YL 1U91B 4HC1A 2YD4A 4JG0L 4PJ5D 1KJ3H 3N1GC 4YHIA 4BQCA 2IQ9L 3FFDB 1MHPH 2IALA 3VJ6A 3RIAK 3BOVA 2H6PB 3FTGB 4TOYL 2ATPA 2VWEC 3OSKA 1U3HB 2A6JB 3O41A 4Y5VB 4HLZH 3ALPA 3CVIL 3CDGA 4JRYD 3MRNA 4K9EH 3RKPA 3DLQR 4QF1B 1NBZB 5F6IC 5CSBA 3MA7A 3DGGB 5JMRA 1O5DT 2D2OA 2DKUA 3E6FB 5L9DL 5F97E 4POYA 1JGDA 2Y36H 1NUFA 4P3DA 3O3EB 4Z5RA 4AEFA 4HG4K 5D2NB 2H3NA 1FYTE 2WBJC 3B83A 4KHXL 5EBLB 4CN6A 1TPXB 4DKFH 3VDAA 3CFEA 4Q0XL 1JIBA 4ZAKA 4JG1H 3VG9C 1RZJL 1BAFH 3BSZL 1PSKL 4A6YH 2W0PA 1CIUA 1YECH 2HMID 1UVQA 4ZXBD 1NANI 3RDTC 1ROWA 1WEJH 1KOAA 2NY5L 2X1OA 3LQAC 5DWUL 1SJVA 1DQDL 3NGBB 1I4FA 3BGFB 1OAUH 1BBDH 1Y6MR 1QA9B 3GJFK 3C5SB 3E3QC 3AREB 3OJDA 3L9RB 4KHTL 2ID5A 5HYQA 1DL7L 1QSZA 1E6OH 1GCFA 4LCWD 3BIKB 3GMMB 1OB1B 5F9OH 5FYKD 1CFQA 4WENB 1RSFA 4R4BA 4EXPX 4XMLL 1JYNA 1ZA6B 4FXKA 5K9OB 1TCMA 3TCXA 1MCOH 5GGVL 4NWUL 3MLSL 1MH5B 2BSSA 4PJXB 1VKXB 5IEHB 1SJEA 3DYPA 1A6AA 4IOIB 5IW1A 4LSPL 4XP4L 5EO1B 1CTNA 1KENH 1FLRH 1LP9B 5A2KH 5C6TL 5KSBF 3TN0C 2VZ3A 4MNQB 1B0RA 3HR5A 2BXZA 2R1XB 2V9TA 4AJ0A 5BV7B 5C9JB 1NFKA 4NJAL 1H3UA 1KNOB 3RAJH 1CFBA 1S7QB 1F4YH 5D6DA 4NRZB 1V3LA 3QIUB 4O5LL 4IEFB 3MLZL 3TO2B 5KSUB 2O61A 3VGDA 5HHVL 3VFUB 2D9CA 2IAND 4TOYH 1LO5A 2E8ZA 2ESVB 4DN3H 5HI3C 4NNYB 5T33H 4AZ8A 2W65A 5CGYC 3CVIH 5DMIL 1BZQK 4N5UA 1GGBL 1FNHA 1I8IA 3QQ3A 2YN3A 4ODTH 5DFTA 5DZLA 5HJ3B 2NNAA 5E9DB 3C09B 1UWEH 2VQTA 1QVOB 3VH8B 4DOHE 3T77B 3BP7A 3M1BB 4URTB 1BFOA 5DMYA 1JPTL 2VOTA 4WW2F 3IJHB 4O02H 5KSVA 5FV2A 2FJHA 4Q0XH 3GHBH 4FZEL 4NP4L 3VFSA 1CI5A 4CVZB 1PSKH 1QP1A 3BZFB 3O0RL 4WGWB 1MVUB 2FEEL 1IKFL 2VISA 3PQYA 3GSWA 3N06B 4PJBB 1A7QL 4QY8A 3CC5B 3U0TB 2NY5H 1V7NL 3T1WA 5DWUH 3V7MA 1DQDH 4M6NH 2YZ1A 2YD1A 2UUDK 4P49A 3V6OC 1XEDA 3RUGF 5KOMC 3VGBA 1WZMA 4FQLL 5EOCL 1CD8A 4P9HC 2CGRH 2Z31B 5FOBB 1G7IA 3KJ6L 3BPOC 4B7IA 1XH3B 5EZJB 2WBJA 4KHTH 5I1GH 4FP8L 4PRPA 4G5ZH 3NPZB 4IMLB 4Y4HD 4LQFH 4X6DE 1H0DB 4QRSA 2NX5E 5IWLC 2VLLB 3K80A 1E6JL 4RQQB 4YZFF 5IHBA 2P5WA 1J8KA 4WDIA 1CVSC 5C09B 3RDTA 5DXWA 1NMAL 3DVNB 3WNPA 5IV2B 1ZLVK 3TZVC 4ZO8A 5I8CA 5GGTA 3BI9X 4HCRL 4XP4H 2VKWA 1YN7A 1CXHA 2WNGA 3FCTB 5C6TH 2MHAA 1L4IA 4Y8AA 4MJ6A 5A2FA 3BQUB 5FYLH 4YR6A 4HKBB 3QZWB 5GS0H 2VZSA 1KELL 2Q86B 4RMQA 1OVZA 3NPSB 4L3AA 4O5LH 4M61B 5GSVA 1J8HB 4TUOB 3O2WL 2ZKHL 1JI2A 1QSEB 3MLZH 4F7MA 2JB6B 3MMEA 3RVWC 1KGCE 1MWAB 2J3SA 4BZ1L 1TFHA 1A3QA 4MJIB 4X8JA 3GO1L 3MJ8B 3PHOA 3DX7A 2RB8A 4IHOA 1K8IA 5F7YC 2C3WA 5DMIH 3QNYA 3TN0A 2X7LA 3VFVB 4OF6A 3PXHA 2ZJSH 1GGBH 4PPTA 4RFEB 4U1MA 2X4NB 2W9EH 3LN4A 4RA0C 5FYLE 1ACYH 4V1DD 1RPQA 4N68A 3V95A 4CW1A 1N3NB 2GFBB 2PW2A 5FYJL 3S3JA 1A5FL 3N9GL 3JV5A 4UDTB 4I2XA 2J8HA 1JPTH 3EOBB 1ERNA 1ZMYA 3W0WE 2CK0L 4WEBL 4KUCF 3RHWK 3FAWA 4PJGE 4POZC 3O0RH 3NIDF 4XMKH 1ZLWH 1G7LA 1RULL 1YUHB 4HQQL 1IC1A 2VLRB 4YPJA 3CPLA 1HEZB 4LHUB 4OT1L 2NZ9D 2Z0BA 3T04D 1ZK9A 4YHKH 5H8DA 5F6HJ 3X14B 1UM5L 3L5HA 5KVEL 4KDWA 4JFDA 1XGPA 3RVTC 1CXFA 3PGFL 4FP8H 3IT8D 3PWNA 2FR4B 3LQZB 1OTTD 4KKLC 1CFSA 2M8XA 5TJWK 5DD1L 4LSSH 5GS2D 2C3XA 2VUYA 3MR9B 5M95B 2DM3A 1F90H 4ELMA 3CK0H 3VE0A 1NMAH 4OFPA 4PJ8C 1IQDA 4X80L 2EC9U 3IFOB 3V6OA 4XC1L 4YHIB 2XZCL 3RP1A 1RVFL 3PUCA 3C8DA 1CDIA 2CH8A 3K0WA 2IALB 2NY3B 1P1ZB 3BAEL 2D7QA 4UIMB 2ATPB 1HYSC 5J3HC 4MXVE 1T3FA 1S9XA 2MJWA 1CFVL 1KELH 2ZZUT 3KPTA 2GT9B 2APVA 3CDGB 4HBCL 4D3CH 5IWLA 5C6WH 4OI8A 2AV7A 3O2WH 3MRNB 3IDUA 1DBMH 4KJYA 2RHEA 3HMXA 1AIFB 4UV4L 1G7MA 2NY4D 3UJJL 4KVNL 3X3GL 4BZ1H 1BQHB 1JGDB 1YY9C 4P3DB 3V4PL 4Z5RB 1CBVL 1A7PL 2H3NB 3VXRD 3TZVA 3AS3A 5AWNL 1BQSA 5MEOA 5JXED 3SGEH 1NSNH 5FGCB 2J5LB 4NC0B 4OD2A 2F54E 1KCSL 4ENED 4ZS7L 1UVQB 4F7CA 4W4OC 4P5TB 5FYJH 1F4AA 3QJFA 1A5FH 1OP3H 4GAGL 1I4FB 4Z78B 4JRXA 2GW5A 4NBYB 2YD2A 2O5ZH 3TFKD 5I16B 1F5WA 3OJDB 4Q58C 4F9LC 1A0QL 5DD6B 3VXMA 2YHGA 1RULH 4TSAH 5HGHA 4N8PA 4POUB 4OT1H 3DNKA 4GG6F 2OMBA 2GJ6D 4RX4D 5B4MC 1P6AB 4AQ1B 1CFQB 3VXOA 3QDJE 5A3ID 3FFCD 4LGRB 4FXKB 1X7QB 1UM5H 3DIFA 5GISH 4M62H 3PGFH 3ULSA 1SJEB 5FYJE 3WDIA 1A6AB 1DBAL 5IW1B 3GBNH 4CL7A 1MF2H 5IR1B 4OFVA 3VCLA 4JFFE 1JYWA 3ULVL 5EA0L 3RWCA 2VR5A 5DEGA 1MAJA 3DX9A 4X0KB 3VGFA 2GSIB 3EOTH 3MUY1 1NAKH 4XZUA 3D2UA 2ZUQB 4QXGL 1OP5H 5EZLB 1PW3A 2CJUL 1A6TB 3ARRA 4PJIA 5J12B 3GNML 2HT4D 3BAEH 1LO5B 3L95A 2YS4A 5CP7A 4PJAF 4FFWD 2P1YA 4PY7A 4V2BA 4OGYL 1NFDF 4EQ3A 1OAXH 4HBCH 1MJ8L 4DK3A 3QQ3B 3KG5A 2NNAB 4JFXB 4UV4H 1T4KA 3X3GH 3G5VA 4PJ8A 1K3IA 2X5PA 1A7PH 5KG9A 1CBVH 4N0YL 2NXYC 3BP7B 5AWNH 1BFOB 4XNMA 4DAGL 3I6KA 3LRHA 3D85A 3N50A 3MCKA 3SBWC 2NPLX 2Q1EA 5CZXC 5ID0A 2VISB 1JF5A 3PQYB 2K7PA 4HWUA 1E4XI 3HE6D 4QY8B 5D70L 2ENSA 3ZDYF 2EDKA 4GAGH 4PRAA 3RWDA 5DJXA 1A14L 2R1WA 4UBDD 5F6IB 1YNKH 1ZSDB 4WNQA 5GIRA 4JY6A 1XR8A 1GPOL 1FZOB 1G7IB 3NIFF 3WNMA 3WNNA 2WBJB 4PRPB 5L6YH 1M05A 5DR5L 3UYOD 3VG9B 4QRSB 5IBLC 5I74C 1CR9L 3L7FB 1KPUA 2B2XL 1S3KL 4Z7QE 5DJ6A 2PTVA 4N0RA 4WDIB 4W4OA 3S37H 5EH1A 3RDTB 4AY0A 3QCTL 5F9WC 3BW9A 1DBAH 3P9WB 5FYKU 6CGTA 5MI0C 2J88L 1ITCA 4PG9A 1IM9A 2MHAB 1SYSA 5HHOE 5E95B 2BNRA 4TSCH 3L3JA 2ATKA 4F9LA 4YR6B 1D5XB 2L7UA 25C8L 5DURD 5E2TH 5KSAC 1A6UH 3EYFA 5F8RC 5GSVB 2D03L 5T3ZD 9CGTA 4F7MB 4WFHE 1A2YA 4O58L 2NR6C 5CILH 3PHOB 3DX7B 2A9ML 5GGSA 4D0DA 1LD9A 4IHOB 1K8IB 4OGYH 4BH8A 2OJZL 5ISZE 3QNYB 4PRHD 3TN0B 1EXUA 3O6FC 5DQ9A 3RPKA 3S3SA 1I1AC 3FB6A 4YXKL 5T1LA 2CLRA 2OZ4H 3UO1L 4NQDB 3OG4B 2VDNH 2PW2B 1XGUA 2GEEA 4X4XB 4I2XB 4N0YH 1NCDL 2DQGH 3AFLA 4JFZL 1N6QH 4JREC 2AJUH 2E8YA 1RMFH 5FO7A 5CEZL 3MLVH 1RU9H 3S37X 3HZMB 2DL2A 3SDAC 1GYAA 2JCCE 3R4DA 2VQUA 2JK5B 3NABL 4MA3A 1JV5A 2MSPA 5F7LB 4G9DB 4HUWA 1LQSR 2DQFA 4M1CD 1FVCA 1BIIA 1GPOH 5IG7A 4JFDB 1XGPB 3BPLB 4JFQA 5D9SA 3WKMH 2E7BA 3ARFD 5DUPL 1YJDC 3I85A 1CFSB 3QIWD 1NFIA 2DQIL 4PLJD 2NY6D 4GAJL 5DR5H 5ESAB 2UWEE 2Z8VC 3SBWA 2B2XH 3VFNA 4G6AD 2IC2A 4NOBA 3RWFA 1DN0B 1QBBA 2HT3C 4NM4H 4NM8L 2AQ3A 1IQDB 1J0HA 2ZCKL 2Y06L 2J88H 2FD6L 5CJQL 3L3OB 5EBMB 5JOEA 3REWA 5EUOA 1A22B 1J88A 4GQPH 3BPOB 2P43B 1T3FB 2ZUVA 1S9XB 25C8H 4Y19A 1MCRA 4AH2A 1B0WA 4EBQH 2QQNL 4HPOH 5GHWH 4XNYH 4M00A 1KPVA 3BN3B 2VAJA 1KB5B 1G7MB 2FWOA 3MFGB 4M5ZL 4O58H 5F7KC 5AAWA 4R4NC 5DYOB 3VRIA 2IAMB 2B7DT 1JP5A 3EO1B 4QWWD 2A9MH 3KPRA 1CXEA 1S7VA 2NY7H 4KJQD 3TZVB 4NT6A 4NQEA 4Y8DC 5ICXB 1IGYA 5ACZB 5MEOB 5GZNC 1LGVA 1VACA 1FN4B 2GUOB 5HYJE 1U8NB 4LDOB 4YBQC 1XR9A 1YDPA 4XNUL 4HW6A 3PGDA 5KSAA 1IL1A 1OF2A 4KQ4L 3QJFB 3Q0HA 3DX6A 1AE6L 2IADA 1OCWH 1N64L 1SEBA 1CZ8L 4YPGB 3RWHA 3PWPE 3U30C 3LDBC 2R0ZH 2ZUWA 4XPBH 3N85H 2YKLL 2X05A 1F13A 5KS9B 3VXMB 2XN9D 4L4TE 3CUPB 1S7SA 5J89A 5JA9A 2VL5A 3HB3C 4NZTL 3O6FA 3NABH 1DVFB 1BFVH 3RNQA 5ITBL 1I1AA 2P7TA 1YEKH 1B9ZA 5ADOL 5GGVY 3U46A 3ULSB 1QFPA 2VDLH 2W38A 4PJEE 5DUPH 1IKNC 2ADGA 2BOBA 2DQIH 4IRJD 1U93A 3VCLB 3MCLL 5FUCC 1CK0L 4GRMA 3O9WD 3RWCB 3DYMA 4HS6A 1RK0A 5DEGB 3O6KH 3SDAA 4NM8H 5E56A 3DVIA 1GGYA 2VDKH 2ZCKH 3BJLA 2Y06H 2EZ0C 3UTTD 2FD6H 4NRYA 5E8EA 2ILLA 3SY0A 3QPQD 3L95B 5CAYB 3T65A 5C0BB 3U0PA 3S34L 4CU6A 3AS2A 4O9HH 2R8SL 5F7HA 5SV3A 3VGGA 2QQNH 1LE9B 2L7JA 5M7QA 5L0QC 5F7WC 1T4KB 4G8FA 4Z7VF 3G5VB 2EDFA 3OGOE 3MLTA 4PJ8B 2EEAA 5KG9B 4AEHL 3WHXA 2GAZA 1JYVA 2QR0A 2Q3AA 3OL2A 3I6KB 2C26A 2P8MA 3MCKB 4EJ1C 1XCTB 5GGQH 4Z7UF 3BESR 5ID0B 4YHPA 5ESVA 4NFCA 3NFPA 1JZ3A 2V17L 5MERA 4XNUH 1U8HA 4KQ4H 4JPKL 1IQWL 1RZGA 3QA3A 4PRAB 3F7PC 1AE6H 3L5JA 3FRUA 4XH2A 3RWDB 1MY5A 1FNGB 4RWYL 1MPAL 2Z93A 1FNEA 5GIRB 4JY6B 2AJVL 4LNRA 4LAQH 1CFNA 2YKLH 2DWEB 1XGQA 5DFWH 4GRLC 4XVSL 5J1SC 4RISH 1M05B 2G5BA 4KMLB 5JIHA 5EO0A 1F4XL 5CP3A 3TA3C 1KPUB 3BYYA 5DJ6B 4NGHL 4EIGB 4HGKC 4OF5A 3MLUH 2WP3T 5EIIA 5ADOH 1Z2KA 5C9KA 2JLLA 2LV4A 4R8WL 3QISA 5EBGA 4WTZG 4UIKL 4G7YH 5HD8C 4PG9B 2MKLC 5J13C 1C16A 2BNRB 1H5BC 2M2DA 3MCLH 4QOKB 3GSNH 1EMTL 3TYFA 5FGRA 4S0TD 3DV6A 2P47B 5M94B 4A6YA 3OKMA 3LEVL 3Q5TA 1FGVL 5D5MB 1HN1A 2OCFD 2LTQC 5D7IB 1QRND 4L4VE 1IC5H 5DSCB 1KN4H 3QRGL 4RAVA 1HOCA 4M03A 2ZG3A 5I1AB 4Q6YA 4OCLC 4D0DB 4X9BA 1LD9B 4XBPA 1ZVSA 3VD4A 4ONHA 1IKNA 2VH5L 1AD0A 3SCMC 3RTQD 1L0YA 5GS0C 1Z0MA 5I66A 5IKCA 5KN5A 1M7XA 3FZUC 3FB6B 2BNQA 5DEFA 4GW5A 5T1LB 2CLRB 3VFTA 3IFLL 1NPUA 1XGUB 3JTTA 4AEHH 1KULA 3KLDA 2AQ1A 1UM6L 4UQ2A 1IAIM 3BIBX 2B1HH 4NZUL 3MRKA 2XI9A 5FO7B 5EWIH 1N7MH 3T2PA 1RHHB 5ILTL 4Y4FC 4HFUL 4GMSL 2NY1C 1G9MH 1U3HD 4JPKH 2PW1A 1IQWH 4U0RC 3VFOA 4LVNC 3BKCL 4RWYH 4S1SH 3SE8L 1DUYA 1FVCB 1BIIB 5JW4M 2AJVH 4JFQB 3K2MC 3RVXD 5CJ8A 2NXYB 5BOZG 1TCRA 1P4BL 5JQHC 3U4AA 1F4XH 3VXUA 5ID1B 2PTTA 1INEL 4NGHH 3GI9L 4LSUL 1X5IA 3RWFB 1ZGLM 3RWGB 4PY8J 3PABA 3EYUL 4KI5F 1JNNL 1ZVHA 1ODAA 1S7WA 3REWB 4X6CF 5EUOB 2BVTA 3CU7A 1AQDA 1AGCA 2NX5A 4NKMA 4J23A 2XQYK 4GRLA 4Y19B 3LKOB 2XWJA 3ARED 4AH2B 2B1AH 2W1NA 4MQSB 5IFAL 5IQ7L 4LEXL 4YK4C 3VXNB 4KRLB 2G9HA 5I74B 1GZPA 4J1UB 1FGVH 5C0AE 2ADJA 3TA3A 1MFAL 1KPVB 1RAMA 5FM4A 3GHEL 5DFVD 4P2RE 2FWOB 4YFLF 2HRPH 2MQ3A 3OG6B 5HGAA 2IF7A 3QRGH 4P99A 4OM0L 3P11H 5F9WB 3ARPA 2FEEI 1S7VB 4KWUA 4NT6B 3V79C 5MI0B 1IGYB 2NLJA 1VACB 2XICA 3LD8B 1H5BA 2LAAA 1YEDB 5DD3L 1F6AA 2BERA 3QUYC 5E0QA 4NN6C 4MNQD 5MEQA 1YDPB 4FQXC 5AZ2L 1JPGB 2N56A 3PGDB 1IL1B 1OF2B 2CD0A 4MGXA 5I30L 1C5DB 2IADB 1I3GH 2YUZA 4WFFD 1AR1C 2Y72A 1SEBB 3RWHB 2W9LA 1S5IL 3QIUD 1IAOA 4NZUH 3VI3F 5ADPL 3S98A 5EU6E 3NCCB 1GIGH 2VXVH 5ILTH 4IRSC 3HN3A 2ESVD 4GMSH 5IB3A 1S7SB 4U3HA 3TWCL 4PRBB 1XFPA 2VL5B 2BSRA 3SCMA 2ITDA 4OIIL 5IB2A 2J1KA 3RNQB 1LILA 3G5XA 3BKCH 3PDGA 2P7TB 3IFNL 4PLKC 1J10A 4PS4L 2VDQL 3SE8H 3AU1A 3W0WA 3U46B 2WBWB 4OI9A 1JN6A 1U8QA 3BD5A 4JREB 2ADGB 2BOBB 4EDXA 4UV7H 2WQRA 1X5LA 1YMME 5KW9H 1U93B 3HAEA 3H42L 4OLVL 5DHXB 4GRMB 4Y4KC 2X1PA 1SMAA 1INEH 4Y4FA 4HS6B 3GI9H 4X9GA 1S9VA 4QNPE 2MTPA 3VXSE 4JY5L 3WSQL 1U8KA 1C1EH 4HIIA 3U7WL 4XP5H 1PY9A 4R0LB 2R69H 3IVKA 3LZFL 3SGEI 2CR3A 5E8EB 5A2JH 1H3GA 2C3HA 1I8KA 3PV6A 3SY0B 4QRRE 2JB5L 1T5WA 3T65B 3T09A 2APBA 2Z31D 3U0PB 1FRGL 1QSFA 2Z8WC 3MRJB 5IQ7H 1I85C 4DW2L 5TFSH 4M93C 4F7TA 1CGXA 3MROB 3GHEH 2VDML 3D69B 4G8IB 4KKNA 3MLTB 5HDOA 1OSZA 4OB5H 2GJZA 5C09D 3WHXB 1CXKA 2E9JA 2GAZB 2QR0B 2F15A 4RCAA 2VXTL 4OZGE 2P8MB 1Z3GH 3O4LA 3QRFM 3WL9A 5ESVB 3NFPB 3IDJA 3BQUD 1A9EB 5AZ2H 2V9RA 1U8HB 1OSPH 1H8OA 3RVUC 3V6FB 5A40E 4TUJA 1JPST 1U8IB 3GIZL 1JMZA 3FRUB 4XH2B 4D9RE 1FYTB 4LVHC 1S5IH 2Z93B 4JPWH 1FNEB 5HDQL 1J8HD 3DHMA 2X6MA 1QSED 2DQTL 5DMGC 1CFNB 1XGQB 1ZHNA 1IGMH 1CXLA 2F54A 4QHUA 2J2ZA 2ICWI 4A2MA 3FQUA 4XVJL 3UPAA 4MJID 1P5VA 1I7UA 1IGFL 2AEWA 2G5BB 5F72S 3WV0A 4OIIH 5DJYB 5EO0B 3PDDA 3QUYA 4DKEL 3VD7A 3DROB 1MEXL 4FQXA 3IFNH 4GMTH 2DTSA 4D94A 2GI7A 3A6BH 4N0CD 4P57A 2V5SA 3LKQA 1QHOA 3M17A 5D93B 1YPZE 4M8VA 4JN1L 4F2MA 3U30B 5GJSL 2X4TA 3GJFH 2DQJH 3H42H 3LDBB 4OLVH 5D72H 3WFBL 4X9HA 1KTKE 1PYWA 1FDLH 4ODXB 4JJHA 3CVHH 4L3EE 3DV6B 4IRSA 3DSNA 3OAZK 3QDJA 4A6YB 3OKMB 4W70A 4JY5H 2B8OT 3IS0X 3DHJA 4OBRA 2HFTA 1KIQB 2JKXA 4TTGA 2VLRD 4LHUD 3LZFH 3NCJH 1HOCB 1PX4A 3PWJA 4JFFA 1FRGH 1DQJA 4XBPB 1ZVSB 3QDGA 1JGVL 1N5AB 1FORL 1AD0B 5F8QC 5I9QC 3TIEA 2VDOH 1CE1H 3G6JE 4UILL 5H2BA 4Y4KA 5I66B 1AY1L 3ZDZE 5IKCB 1NLDL 2X9WA 5KN5B 3TESA 5TF0A 1YN6A 5DEFB 4GW5B 5ETUA 3UZQA 5ENWA 1JTTA 5DVNA 3NIGE 3CMOH 4KK8D 4UQ2B 2VXTH 2LAGB 2N7BA 4RFNC 2HKFL 1UKQA 1WTLA 1GL4B 2NY3D 2PR4L 4PP2B 4F37F 3QO1A 3U9UA 4HIXL 1IMHC 1I85A 4JJ5A 1U58A 1G1CA 3GIZH 4ZOBA 1MFBL 3VFOB 3ZTNL 4Y1AE 3SDCC 1MCPL 4DOHB 3JWNC 1WITA 4WO4B 2COQA 5HDQH 5C0RL 2DQTH 1AGFA 5A1AA 1R5WB 2IH3B 5E7FA 2ERJC 1EIBA 4KVCH 3A6OA 3BXNA 5ACMA 3WIIL 2VLJE 5GRZA 4IMKC 2GY7B 4J2XA 4WU5B 3VFWA 3FL7A 4MQXC 4OLUH 5EC1A 3PABB 3G5ZA 4P5TD 5TE7L 1YEHL 4IDJL 3VXTB 2QLVB 1FFPA 5GRUL 1QFWL 1S9WA 3WFBH 4X6DB 5C2BL 1AGCB 2NX5B 1WWCA 2XG4A 4UTBH 3TNMA 4I3SL 2XWJB 3BD3A 3RY4A 2G9HB 3AC0A 1JZ5A 3T3PF 3HTLX 5J9PA 3LB6C 4JFEA 1U95A 5HGAB 1AJ7L 4JPIA 1LDPH 1BIHA 5HHOA 1ZLVH 2ICEA 3NMEA 2NQCA 1H5BB 4UILH 1F6AB 1G9NL 5I1HL 1AY1H 3OAYH 1NLDH 1JE6A 2E6JA 5MEQB 2NTFA 1WQVT 4DZ8A 1MJUH 2X4OB 2XXMB 2L0DA 2LTQB 5E5MA 5MHSE 1WFTA 1IAOB 2EEBA 2CLZA 3JZ7A 5ISZA 4NUJA 1FO0A 1SEQL 3SDXA 5KSBE 3DETD 2PR4H 4U49A 1Q1JL 1NCBH 5IB3B 2SEBA 3BKYL 2VR4A 1PEWA 3SCMB 2ITDB 3R0NA 1MFBH 2UYLA 3L7EB 5IB2B 2HRLA 3G5XB 1KTDA 3DOSA 3S4SG 3AU1B 2XFXA 3W0WB 5JTWA 3AROA 4FN0A 4PRIE 1M1SA 4PJGB 4YH6A 4KZEL 1JN6B 1NCWL 4KROB 3BRGC 5KBNC 4JY4A 1IAIL 4EDXB 4LOUC 3PE9A 2JCCA 1CLZL 3T0AA 4OQTL 5TE6H 4C56E 4Y4FB 1WVZA 3IS1X 1S9VB 2NY1B 4QO1A 5KVMC 5KVDL 3WFEL 2PF6A 4Z6AT 4XP6L 3PQYD 1FBIL 2VL4A 4U0RB 1OTSC 2OZ4A 3SDCA 5TE7H 4LVNB 1XF4B 4ZQKA 3IVKB 2X4RA 3QIBB 1I8KB 3PV6B 3GB7B 1S7XA 3W11D 2R23A 5DC0A 4K71C 4IMKA 1D9KB 4PRPD 3U6RA 4ONGL 3JVGC 4ZFOL 2O93L 1CTOA 5C7XL 2YK1L 2WINA 2V7NA 3ZKXB 1F11A 4Y88A 1OSZB 3RUGE 4KJWD 2Z35A 4LRNL 3WIFA 3E8UL 1BVKA 1MNUH 4HXBL 2DN7A 3HRPA 3RDTD 4J6RH 3QUKB 5I1IL 2X70A 3LEYL 4OCYL 4R9HA 4L4JA 3VU2A 3WL9B 1F42A 1MRDH 1MHHA 1BP3B 1N0XL 3IDJB 3MLXH 4RMUA 1HE7A 2BVOB 1MQ8A 1BJ8A 2XRAL 4ZTOL 1I9RH 4O4YL 4YK4B 4TUJB 5JHDE 4M5YL 3SDDC 3GKZA 5E2UL 3DO3A 5E8PB 4BELD 5EDXA 1QTYT 2A74A 2DLHA 1SEQH 4R3SB 1H8SA 1ZHNB 1MHCA 2F54B 4QHUB 1CGYA 1I1RA 4HV8A 1FGNH 1K3ZA 2B39A 1Q1JH 4HBQA 3F7YB 4KK9C 4L8DA 3B8SA 3TN0D 2H8PA 4BUHA 5E03A 4FQXB 2HJFA 4NHUA 2KH2B 4LCIH 3BRDA 4P57B 5E1AA 4KZEH 4NQDD 1NCWH 1A7RL 2WANA 1CDJA 1IAIH 1AGDA 1ZHBA 2E3VA 2WWKT 2VZVA 3E0GA 1OWRM 3NZ8A 4EN3C 4F2MB 4L4TA 2X4TB 3HNVH 4HIHB 1PYWB 4OQTH 1PGRB 3WEXA 4I18C 2JJUA 4IRSB 1FFOA 3QDJB 4HH8A 5HI3D 1D5IL 3WFEH 5DJ8A 2QSVA 3DMMB 3MRHA 5CGYD 3X12A 1A64A 4XAKE 4NQCE 2R0LL 1T1ZA 4PJEA 4R2GC 4TRPH 4IRZL 1NQBA 1JHKL 4JFFB 5F1IA 1DQJB 4JFDD 2ZSVA 1AD9B 1LNUA 3KXFE 4FQCL 4KH2A 3CH1A 4JM2F 3TPKA 3TIEB 5GZOC 4NQSA 2P8PA 5F1NA 3C9NA 1I3RA 4G6MH 5H2BB 1KLUA 3NIDE 4Y4KB 3S36X 1R5VA 3FQWA 3U79A 1UZ6F 4LFHD 1MCFA 5C7XH 5ETUB 2BK8A 4GW1A 4BK4A 4LRNH 5IVXF 5ENWB 2WW8A 3E8UH 4HXBH 3ZO0A 1BBJA 5I1IH 1AGEB 3IAQA 4CVUA 3O4OC 4CMHC 3TBYA 1J1PL 4JFHE 4BQBA 3O2DA 2VLMD 4HKZA 1M71B 1TJGL 3U9UB 5L7XH 2W07A 3WDHA 3OGCA 4WHTA 2G60H 4O4YH 1WZ1L 4JJ5B 1A47A 3QH3B 2X9YA 1URLA 2VR9A 3I9GL 3JVGA 3QFDB 4GLRH 3BMVA 1WICA 3S5LA 4KPHL 3H7BA 1DZBA 4X7SH 3MLYL 3D9AH 2IAMD 2DI8A 3BXNB 2A9NL 4WHYH 2VDPL 4Z77A 3A0OA 5IFHL 3UC0L 1NBQA 3IF1A 5IEKA 4BJLA 4U05A 3L6FA 4JHAL 1G9MC 3VFWB 3O8XC 4P0DA 3ZT7A 3IDYC 5EC1B 2ZCLL 3G5ZB 3SDDA 5SX5K 2XZAL 3QAZC 3FO9A 3NN8A 1S9WB 3RVWD 4XWGL 2FO4A 1WIPA 1LMKA 3L3DA 3Q2CA 1NBYB 4WI9A 3TNMB 3OXRA 1L7IL 2HH0L 4TTDD 4TYUA 2CO7B 2R0LH 4LLYB 4NOFA 1ZOXA 1DVFD 1U95B 1M6OB 4IRZH 4JPIB 1MFEH 4PJDF 1UM4H 5HHOB 1PZ5A 3QXDA 2R2CA 1E27A 1HIMH 2ICEB 4H8WL 1ZLSL 1KCVH 4HS3B 4EN3A 4NN7B 1FIEA 1GAFL 4Z8FH 3P0YL 2R2HA 4YHLH 1T7ZA 1F6LL 1CN4A 4DGVL 4I18A 3UP1A 3WXWH 2Y25A 2NTFB 3QPXL 4POZD 4U4BA 4JDTL 4DZ8B 1BECA 1W2KT 1I8MA 4L4VA 4HSQA 1MCWW 8FABA 2ZG2A 5J06A 2ZCHH 5F96L 5DGRA 4YAQA 3R1GL 5ISZB 3B3IA 4WHYG 2Y7QB 3TO4C 4O00A 2C1OB 4RNRB 3BPCA 4WFGD 5BXFA 4MD5A 1FPTL 1I9JL 3PL6B 5FB8A 3VW3H 4FQ1L 3MUGB 3RVTD 1ADQL 5C0BD 4ODHL 4YFEA 2F58L 3IGAA 3GSNA 2UYLB 1RZKH 1M7IB 4PLOB 5FA3A 3IDIA 4NFBA 5TDOB 4HIJA 5DF0A 3JWDL 4KPHH 4HLJA 3MRDA 2R0WL 5BZDA 1OL0A 4PJ7F 4JY4B 4TNVF 1BREA 4PJ8D 5T1MA 1F3RB 4QRQA 4LLDA 5IFHH 2P48B 2JCCB 3SKNA 1NFDE 3FT4A 4RFNB 3NFSH 2FSEB 5ALCH 2FH8A 1KXQE 2JJWA 4X6FA 1IEBA 5SV4A 4I0CC 3ZE1F 1DN2A 4MJ5A 1GGIL 1HYSD 4LLUB 1J87A 4PRNA 1FVEB 1LO2L 5J3HD 4JGMA 2B4CH 4OGXL 3BE1H 5FO8A 4GJTB 4G7VL 3QG6A 4X99B 4ZQKB 4A2LA 2X4RB 3WIHA 1UXWA 3V5KA 3TBVA 2UWEB 1S7XB 2ERJB 1JYXA 4TUKL 5HVGB 1L7IH 1LK3L 2G75A 4KFZC 5E2VH 4DZBB 5H37H 3TPUA 3ZT6A 1P69B 2V7HA 1PX3A 4P4KC 4UDUA 3MRFB 4X7EC 1HH9A 4ZPTA 5AZEH 1S7RA 2W0FA 1CQYA 2C9AA 3NCEB 4YXHH 3ZDYE 3Q5YA 1CU4H 3O8XA 5TE4H 4JR9H 4NNPL 1R3IH 4AIXA 1F11B 15C8H 5HGGS 2Z35B 3WIFB 1TETL 1BVKB 1VSCA 4JGUA 3RQ3A 1K8DA 3O2VL 3VFGH 4AIZA 2KUTA 3GZKA 5BS0A 3NIFE 4M6OH 1HNFA 4M1GH 4XGZA 1FZJB 3F8UB 3NOIA 3X14A 1CD9B 3FQXA 1MHHB 3V8OA 5C0AA 4DGVH 2BNRD 1D6VH 2CIKA 1I1YA 4QOKD 1H15B 4P2RA 3PWUA 1P6FA 4GS7C 4TVSa 5D1XD 5MP6L 4AL8L 2F53E 5F96H 5B4MD 2YPKA 1GSMA 2A74B 3F62A 4XVUC 2EC9T 3H3BC 2GITB 2DIBA 4U1GB 4CMMA 5HYJB 4I13B 3DRQB 1U8MB 4FQ1H 4Y2DC 4ODHH 2YN5A 3K1DA 4UNUA 3UMTA 4D0BA 4L8DB 3WNKA 3T0WA 2HJFB 2V5MA 1UA6H 1U6AL 2BVYA 3JWDH 1HI6A 2XT1B 3PWPB 5E1AB 5EU6A 3TLRA 5T1LD 1I7RA 3PGCA 4K23L 3EZ8A 3RJDA 1XZ0A 1RJLA 3T1FA 1ZHBB 4BSJA 4AMKH 2P5EE 3NZ8B 5BO1L 4L4TB 3S97C 1MSPA 2BFVL 3TO4A 1XMWA 1QFHA 1MUJA 2N7AA 1FFOB 3U9PH 1LO2H 4RIRA 5DJ8B 3NFNB 4OGXH 3MRHB 3X12B 3EZJB 2PXYB 4G7VH 5T3XH 5E94A 5L2KE 1T1ZB 3RY5A 4PJEB 4H88H 4PGEB 2AEIT 3MV8A 5GQBA 3M07A 1YMMA 4ERSL 4D9QE 3PP4L 5F1IB 1UXSA 1QR4A 4TUKH 3ARQA 1LK3H 1LNUB 3CH1B 4MQ7A 4UQ3B 2A6KB 1NMBL 2NXYD 3QUML 3MGOB 5F1NB 3C9NB 5B38A 5C0EB 3VXSA 1I7TA 2ARWA 5F1OB 3FQWB 1N5YL 1ZT1A 5CZXD 5D7KD 4C55A 1VGKA 1FIGL 3BHBB 4M6MH 1V8HA 1KN2L 4QRRA 5HHXH 4OFYD 1NGXB 3LKRB 1YC8A 5T3XE 1HKFA 4OCRL 5AYUL 5GGUB 4G6JH 3MCG1 5JDJA 1BWMA 4XMPL 3HG1E 4G6KL 1WBXA 4WHTB 4N1CA 4OI7A 1MWAL 3BDBA 3K8LA 1IAKB 4K71B 4P4KA 4WRLA 4Y19D 1KACB 3EIFA 1NEZA 5MP6H 2JF1A 4AL8H 1CLYL 1ZLUK 3S5LB 4OZGA 4JAMA 3H7BB 4QRPE 1VENA 5IMOB 4MXWL 1T1WB 4X7CC 4XPGH 1TVHB 3MLWH 2OTWA 5K33A 1ZS8A 5IBTL 1RUAL 1ORQA 2EH7L 4Z77B 1T22A 2DQUL 5IEKB 3IF1B 4JQVC 5GRJL 3L6FB 3CCHA 2GK2A 4JKPL 4HF5H 5CGMA 4TVPD 4ZS6D 1RI8A 3FN3A 4XXDA 1BVZA 1RK1A 1SVZA 3MFFA 4YNYA 3SDDB 5I1EL 3BUTA 5LAXA 3FO9B 3NN8B 2JJTC 3B43A 3OKEB 2OR9H 2BFVH 3P4MA 5F70A 2FO4B 4GUPB 4Z7WE 3L3DB 5DRXB 1TQBC 5GRVK 3OXRB 2NR6D 2BOCB 3U0WH 4Y2DA 4OZIE 2FB4L 3OPZH 4FTVD 1V5JA 4PJHE 5E9DE 4Z95L 5DO2D 3LAFA 1WC7B 1CLCA 1UGNA 3HZYB 4LRIC 3G6AB 1YPZA 3V7AE 4ERSH 1BQLH 1UC6A 1PZ5B 4N8CL 2YEZB 3HRZB 1E27B 1SM3H 3PP4H 2FATL 1T03L 4JPVH 3B6SA 4YWGH 4EN3B 3QUMH 2VLKE 3QSKB 1EX0A 2R2HB 4FFZH 4HC1L 1KCRL 2C1PB 4S0SD 1N5YH 1T0MA 1EA9C 2R4RH 5I8OL 1LO0H 1UJ3C 2BY3A 5F71A 4L4VB 3RPIA 1I8MB 1KN2H 1PFCA 5DRNA 4W6WB 1MI5E 1MIMH 2M26A 3O3BA 4YAQB 4HEPG 2R2EA 1HXYA 4XMPH 1TJIL 4G6KH 4M7ZC 4PV8A 3G6JA 5BXFB 3CX2A 5E08L 3GKWL 4MD5B 1OM3H 5FB8B 3V7AG 1YEGH 2YRZA 3GJFA 3QBTB 4XPTL 2E5EA 4R96B 3WS6C 5GRWA 3CVHA 3EW3B 3IGAB 3GSNB 2CKBL 1RZ7H 4P3CL 1RUML 4HDIA 4WUKH 5FA3B 1CLOH 4KAQH 2DLGA 4NN5C 4N8VG 3JWOL 4O51B 3A67L 1ZTXH 2A77H 4DGIL 3HUJF 1UCBL 2D7MA 3MRDB 1J0ZA 1C5BL 5C6PB 4MXWH 4AEIL 5BZDB 1AQKL 3O4OB 5CZVH 2YD8A 1I7ZA 4QRQB 5T1MB 4CMHB 4JO4H 5IBTH 5LBSH 2BSTA 4LLDB 3QJHA 1UACL 3SKNB 3FT4B 2DQUH 4X6FB 1IEBB 4K8RL 4Y1AA 4EIZC 3EDJA 3CDFA 4PRNB 1VCAA 3P4LA 4TULL 5B21A 1F58L 5CD5D 4UUJA 3MRCA 5IMMB 2J8UE 3C6LB 4WW2C 3QG6B 4Z7VE 3WJJC 2DTMH 4PD4K 3DTXA 3MV7E 3MODL 2YPLA 5EFIB 1FYTD 3V5KB 1EHLH 3LKPB 3TBVB 5C0CE 3WYRA 2VLJA 4ODSL 4R4ND 43CAA 1LDSA 1ZAGA 5DA4A 4KTEL 1R24B 4JO1L 2V7HB 4J7RA 2FB4H 1UWXK 3W9DA 5I6XB 5GZND 1HH9B 4KTDL 4ZPTB 4NZRL 4JQVA 3TJHC 1S7RB 1AH1A 3QXAB 1XGTA 2X42A 3S7GA 1YNTA 4BFBD 3O8XB 3LKSA 1KEML 4YBQD 1DFBH 3G6DL 4N8CH 2IFFH 5KANG 1T03H 5F9AC 2R4SL 4FMFA 4XI5C 32C2A 1K8DB 2DBLH 5F3BA 1A8JH 3QAZB 3QO0A 1WWWX 4YX2H 2KDGA 2JJTA 4XGZB 1NCAL 4LPVA 3DO7A 3AXLA 2IH1A 3KWWB 4HC1H 4IS6A 2I26N 1ND0A 1KJ2H 3LEXA 3FQXB 4P2QE 3CLEH 4L29A 5C0AB 4BUGA 1CGUA 5JW4Q 4YE4L 1DQML 1BM3H 3ROOA 3MO1A 4P2RB 3PWUB 2CQVA 2YD5A 5ERWB 2AXGA 4OCMC 3HB3D 4BA8A 3EFFA 4LRIA 2YPKB 3U82B 3IU4L 3S3PA 1NGZB 4LLAA 5ALBL 1Q9KA 4X5XA 1UB5A 4XPTH 3BH9A 3LS4L 4YJZL 3H3PL 2CKBH 3UTPE 4P3CH 4D0BB 5F7UA 1HWGB 2XKNB 3K2UL 1FZMA 1QO3A 3IDXL 3JWOH 1QFWI 1XF3A 3QHFL 1HI6B 4DGIH 1UJ3A 5BMFH 1MJ7L 1UCBH 5EU6B 3GK8L 1I7RB 3PGCB 4LSDA 1C5BH 1ETZB 1EVUA 1RJLB 3T1FB 5KSBA 5CUSH 1JZ8A 1UACH 2W9DH 5DT1L 1ZV5A 1B4RA 3TO4B 1U3JA 4L1DA 2IG2H 2MMXA 1MUJB 3QHTC 3RU8H 4K8RH 3QEGL 1K5NA 4LKCA 3WS6A 4I0PB 1Q9WA 4TULH 3V0WH 2MPAL 2GJJA 2XZQL 3KDMA 1HYRC 5E94B 1RUKL 1ZEAH 4PRIA 3VGEA 3LCYA 4WO4D 1YMMB 3DV4B 4ODSH 4I48B 1UXSB 2EDWA 1L9MA 5DUMH 5LCVH 3G5YA 4ZSOE 2XQYG 2ZUTA 4JO1H 1AFVH 1OP3K 2EDLA 1QBML 3MOQA 3BP6B 4HULB 3IU3A 3VXSB 1I7TB 3LQAL 4KTDH 4UINH 4NZRH 2ZOKA 2OBGA 1NKRA 5GGTL 4PFEA 3STZB 1DBJH 1DQLL 4XPAH 4QRRB 4WW2A 3HI5L 3BN9D 3W2DH 3WJJA 3VFPA 1FZKA 5CJOL 2NW3A 1U8PA 4HUXB 5DZOA 5IF0B 4OCWL 2H9GA 2DDQL 3SGDH 3L5IA 1DSFH 4PJCF 3UCRA 4YDIL 5JOPE 1JZ7A 4W6XB 4YE4H 1L6ZA 2J4WH 1DQMH 3GIVA 4NBXB 4U1IA 2NX5D 4XX1E 2VQ1A 4P4KB 4FABL 1UH3A 4U2ZA 1Z9SA 3RUGA 1NEZB 4KK6C 4YIQA 1WAAF 1MJJA 4KI5E 4OZGB 5GGRA 5JR1H 2YMXL 3IU4H 4JAMB 3TJEL 2FL5B 1G7JA 3V4UL 4PRDA 5ALBH 1CT8B 4LPYA 2OTWB 3THMH 1ZS8B 1Y18A 3VRLE 3EBAA 3ARVA 3H3PH 4WU7A 5HD8D 1KCKA 1T22B 4YHML 4XNQB 2WP3O 5JHDA 3CCHB 5CIPH 5IBUB 2R39A 1FAIL 2EE6A 4XXDB 1MJ7H 5D8JL 5I8EA 1RURH 3GK8H 2UY6A 5IT2H 3MUZ1 4GS7B 2AEPH 4YNYB 3MFFB 4ZFFA 4DGYL 1AXTL 1YEIL 1KGCD 5LAXB 1UG9A 5JO5A 4R7DA 1OW0C 5DT1H 3P4MB 3NA9L 4HJ0C 5DJDA 5C0GA 3IETA 3QEGH 2C3VA 3DXAE 4M7LT 2HLFC 4Y2DB 4XWOC 1ZT4A 2MPAH 4Y5YB 5FYLD 4NSKA 1RUKH 1A9BA 3SCMD 5GS0D 1E4JA 1YPZB 3NCYS 3TCLA 4ZPVA 4HWBH 4K3DH 3B6SB 4L3EB 3W0WD 3FB7A 4K3EH 3UTQA 3U1SL 3FN0L 4EKXA 1Q38A 1QBMH 4KROD 5SWQA 3LQAH 3KLSA 5E2WL 1J1XL 4D2NA 3W81A 3OAZH 3LIZL 3O45B 4NQCA 1A4JB 4P9HL 5DK2B 3PHSA 3RPIB 4EDWL 2NW2A 1U0QA 4Y4FD 2WLYA 4WI7A 3U4EA 4PJFF 3HI5H 5DRNB 4NPYB 4XP9L 3B9KC 1N8ZA 5TDPA 2EYSA 1HSBA 1T5XA 1G6RH 2R2EB 1JHLL 5DGQA 2UZYB 3G6JB 3QIBD 4YDIH 3EDDA 4N0UE 3HMXL 3GJFB 4MDJA 4GRWH 4P2OC 1RIUH 3CVHB 2MCG1 3P0VH 4U1KA 2P5WE 2BVUA 4CU8A 4MSWA 4OLZH 3WMSA 1D9KD 3KNBB 3NCYP 4MNHA 5I17B 4RMWA 4BQ8A 1UWGL 3BRFA 4PGJA 2YMXH 3TJEH 4NJ9H 2B0SL 2YPVL 1KLFA 5E7BA 2XWTA 2AABL 4X5WB 2CDFB 3B5TA 4U1SA 3Q6FA 4YHMH 5LGHH 3CXHJ 5BVJA 4Y1AB 3O11A 2GYSA 1RZKC 4DKDC 4OLXH 5E2JA 4GRWE 3MRCB 3GSQA 2VC2L 4PGCB 3IFPA 4K7PH 1AXTH 5IW3A 3MLRL 3DTXB 4JM4H