2GHWB

Crystal structure of sars spike protein receptor binding domain in complex with a neutralizing antibody, 80r
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
244
structure length
232
Chain Sequence
b'EVQLVQSGGGVVQPGKSLRLSCAASGFAFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRSYYLDYWGQGTLVTVSSGGSETTLTQSPATLSLSPGERATLSCRASQSVRSNLAWYQQKPGQAPRPLIYDASTRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQRSNWPPTFGQGTKVEVKSGLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike glycoprotein
publication title Structural basis of neutralization by a human anti-severe acute respiratory syndrome spike protein antibody, 80R.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Virus/viral protein/antibiotic
total genus 61
structure length 232
sequence length 244
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ghwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ghwB01
2ZKHL 3MRPA 5GISH 1GH7A 3QIWA 4JFXA 5IW1A 4HQQL 1H5BB 3ZMRA 1QNZH 3MUZ1 3ARRA 5DEFB 3DO3A 4KRNA 2DL9A 1KELH 4M8QB 3B9KA 4RA0C 4KK9C 4BH7B 5D5MA 2RJMA 1BZ7B 2IG2H 3G5VB 1BQHB 5FUOL 1A4JB 1KIRA 3MR9A 1UXWB 3K80A 1A6AB 1EO7A 4YEEA 2FWOB 4HKZA 4NSKA 4PLJD 2V7HB 3VCLA 4BQCA 1DBJL 2ENYA 3QNYB 4KJWC 1AFVH 1SYVA 5D1ZB 5IP4A 1JI2A 4JGJA 3U7YH 3P4LA 1ORSB 2WK2A 2DS4A 1RZ7L 4YDIH 1CFSB 3QIBB 1L4IA 4K2UL 2NLJA 4HEME 4NO5A 2BY1A 1GZQB 4O58H 2CIKB 3HAEB 3B9EA 4D8PB 3VMNA 5AAWA 3FCTA 1XIWC 4YK4B 3WIIH 1GSMA 3QUMB 2WQRA 4X5XA 4U6HA 1LO4H 2HKFH 4NN5B 4YR6B 1LGVA 4D3CH 3HC0A 5I1CL 1O5DT 3L5HA 3LHPL 1OQOA 4L3EA 4YQXL 4LHUB 3BH8A 3FO1B 2F15A 3GZKA 4OIAA 4KXZH 3VFVB 5I1GH 3AB0C 1N7ML 5IB5B 5D6CB 1FO0A 1G7IA 1MY7A 3G6JB 4HWZA 4R2GB 3B83A 3EDKA 4I3RL 3D85A 4PJ9C 5KS9E 1G9EA 3C5ZA 5I8CA 3GDBA 5BO1H 3HZVA 3RVVD 3MV8E 2BVPA 2LQRA 1T22A 4QTIH 3W0WD 5KOMC 3T65B 2IAMC 2HKHH 2APTA 3S7GA 1I85C 1BP3B 4KJYA 4WWKC 1LO0L 5IV2A 3MRBB 4XVTH 1YYML 2ITCA 3VDBA 1CZ8L 2CLZA 1N6QH 3NA9H 1SY6H 1A21A 4C56E 1UWEH 5BRZA 4P9MH 1G7JA 3QUYA 2NXZD 1UACH 4P3WA 1MHCB 4XPTL 1HH6B 2XZZA 2NNAB 3PP4H 5D2NA 2B5IC 1I7TA 1FG2B 2G2RA 5F7YC 2R2CA 1ZANH 2AV7B 3IT8D 1P2CA 2PCPA 1TVHA 4OFPA 4JPWH 1I1AB 4XMPH 3MOQA 4PJBE 3HUJA 4CADA 2E6QA 3FB6A 4RDQF 5IVXB 1ADQL 3H3PL 3QQ9D 2RGSA 3CIQA 1G9ML 5E70A 4HF5L 3D0VA 3O4OC 4EQ3A 3EAKA 4MJ6B 4OCXH 2FX9L 4XT1C 1OGAD 4U1IB 5L8JB 2IBGA 3CXHK 5GS2D 1L7TH 2UY6A 3MFGB 4PLKD 3LZFL 4WI7A 5GIRB 2EH8L 4PJXB 1DVFC 1AD9A 4KMTH 4EN3B 4PJAE 1MCOH 3Q2CA 1TTFA 2BSTB 4R90L 1RUMH 1KLGB 1LP9E 1F6AB 4HKBB 4ZO9A 3H2WA 4RMRA 2EKSB 3QJFA 5C6TH 1GGTA 4GG6A 3DUUB 1SEQL 2VDKH 3L5JA 3RGVC 4PB0H 2VIRB 1GGCH 3BHBB 4P46A 5D93B 4Z78A 1AQKH 3U46B 4MNGA 1O7SA 2VUOA 4O2EB 4YPGA 3T0DA 1NBVL 2B39A 4I77L 1KULA 3MZTA 1INQB 1PZ5A 2QLVB 2IBBA 4AEHL 5CSZA 2AJZA 3N1FC 3EYOB 5I1HH 4BM7A 2JK5B 3EOTH 4OB5H 2DL2A 4X7SL 5E1AA 5H94B 3VH8A 3O2WL 3KWWB 4PRIE 1IAOA 2X4NA 4P9HC 1GGBL 3AS2A 4YGAB 5IB4B 5KS9B 1I1FB 3AB0B 4BFIA 4ODBD 3M17A 1BQSA 3DV6B 4CU7A 5CJOL 1JMXA 3CNKA 4NO0B 4PTTB 2VAAA 2AJ3B 5IEKB 3PWUA 3FAWA 3IXAB 3LKNA 1CGXA 1KTLA 1KT2B 1KTKE 1MAJA 4Q7DA 3BX7C 3FZUC 1YPZA 5D72H 3TIDA 2YPLD 1EVUA 1S78C 1FJ1A 2ZCLL 2AEPH 4OGAD 3B9AA 4Q9RH 4GKZA 4TOYL 3D69B 5SX5K 3TFKC 3AM8C 1RUPH 2EE2A 5IOPB 3JWDH 1O0VA 3SJVD 2WINA 4HUWB 1UZ8B 1NL0H 2D2OA 3C2SA 2VXUH 1NGYA 1UJ3A 2QQNH 3PWVA 4WWKB 5F21B 1F02I 1QO3B 1J1PH 3EO1A 1WC7A 15C8L 4LCYA 1TCRB 3QZWA 1F4XH 4I8DA 3GSRB 3VFPA 4I2XB 4M3JA 2CKBH 3GSXB 3ZKXC 4OZFG 3KPOA 4HUUA 1AGCB 1K9TA 5LXGL 1U42A 3JSSA 3IJSA 3JUYA 1U8QB 4XVSH 2VRAA 4PJBB 3PGFH 5BW7A 5T1DL 4ZSOA 2Q8AH 4EUPB 1B0GA 5ENWB 1LDPH 5FHAH 3ZDYE 3HMXA 1LMKA 4YDLC 2MMXA 1EGJL 3EUUA 4QRQB 4S1RH 4Q2ZB 2IF7A 2OTPA 1YNTA 2DLFH 2DQCL 3VXNA 4BUGA 8FABB 2A77H 1I1YB 2GK0B 4M7JH 2Q7YA 3O3AA 4PJAB 5KVGL 3NFPA 2IQ9L 3U7WL 3DETD 4Z5RB 4FXKB 4M1GL 2DDQL 1BJMA 3GSOB 1IEBA 4AG4L 3VMPA 1BZ9B 3ZE0F 1LP9B 3OJDB 1DVFB 4MXVF 5DD0H 4NQED 4LHQB 4Z77B 4YWGL 5D2LF 3WIFA 3S8WA 3JTTB 3RY6A 1YC7A 3WHXB 5GJTL 5FEBA 1NCBH 1Q72H 3T1FB 3SGEH 5ISZE 1BGXL 5FB8A 1U8LA 5D71L 1LK3H 4HS8H 1HHKA 1QSVA 4YH6A 3RGVB 1UXSB 4Q6IA 1AQDB 1FL5B 2EYSB 2E27L 3BO8A 4MXQD 2OJZL 4OZFH 5LG1A 4Z95H 2PW1A 1MRFL 3RAJH 4H1LA 2J8UF 3S9DB 5C3LD 4JM2B 4PRIB 4JRXA 3G6AA 3LQAC 3LS4H 2VXSL 3ZE1F 4F7TA 4UI2A 5D1XC 1OAUL 2E6JA 3HPLB 4HDIA 4FZ8H 4WY7H 1IC7L 3QXAA 1YEGH 3QEGL 1B2WL 5ADOH 3MLUH 3HPJA 4WJ5B 1KPRA 4JFYB 3MBED 3OAUH 5EUKA 1JRHL 2BERA 4KK5D 5C2BH 2ITDB 5AG9A 3F6IA 5I66B 3MRRB 4OF8A 1MCDA 2IH1B 4E42B 3RZCD 4OSUH 2XZQH 1S7UA 1NEZB 4LLWA 4JZJB 4N0YL 2OL3B 1IC5H 1P84K 1V7MH 3KAAA 3H9SB 3BWAB 1F4HA 3IJHB 4BZ1L 1OAXH 3AU1A 1C5CH 4Y7MA 4JO1H 1V3LA 2RHEA 3EJYD 4XCCH 4MD5B 1FNEB 1CE6B 3T2QA 4MCYA 2V7NA 2D3VA 2F54D 2H26B 4OCWH 3HE6C 5CEZL 4YHNA 2ERJC 2B1AH 5FYLD 4OV5A 3P73A 4GXUN 4RGOL 2F74B 4APQB 3VWJA 3VD9A 1FV1B 5SWZD 1CR9L 3R4DA 3FQNA 1BJ1J 2A6IB 4UDUB 3EHBC 4L1DA 3IU3B 5TE6H 4O2CA 2KQMA 3MLWL 3WJLA 3PNWB 4JG0H 3EYFA 5B4MC 3UBXB 4DGIH 5DEGA 3CCHA 3U6RA 1ADQA 1E27A 3KPQB 3UC0L 4WI4A 2V9TA 5BXFA 1OSZA 4XPGL 1K6QH 2PTTB 5SWSD 3X17A 2RCSL 4ZPVA 5GRJH 1MCWM 1MCQA 1QYGH 1ZWIB 2W60B 1NGPL 5C07E 3IFLH 1G1YA 1IKNC 5DLMH 4X6EB 4PFEA 3BN9C 3CSGA 3VW3H 2WUCL 1FFNB 4X4ME 3C5JB 1CICD 2JJSC 3ULUF 1JK8B 1MIMH 3D5OF 4KMLB 1A6UH 3CMGA 3MLSH 4Y8DC 4DUVA 2Z93A 5E9DE 1KIUA 4X6FB 2AQ1A 3U9UA 1RZJC 3HRZA 2G9HB 5DQDL 3DX7A 2ICWI 4KK6C 1MCRA 2XTJC 4JLRA 2P48B 3FQRA 4LLQB 4OLEA 3ZSSA 1IM3B 1T6WA 2H8PB 4UILL 1RJYA 4B7LA 3WFDL 4JB9L 1R6VA 3NACH 4GRMA 5FF6A 3NCCB 1EZVY 5FOBA 5T3ZL 1FO0H 2EE9A 2HLFD 4BFGA 4Y4FD 4TVPD 1LO2H 4P5TB 4XBGA 4X7EC 1J0KA 4XTRC 5ESVB 5HGBA 4OZHA 5TDPB 4Q9QH 4OQTL 2ZOLA 3MODH 5CHNA 2GSIB 5CJQH 1CD9B 1BX2A 3CGTA 3L3GA 3VFGH 1FGNH 2C3GA 2I27N 5LKNA 4Y19D 1UCBL 5AD0B 2GJZA 4LEOB 4BH8B 4FQHA 3MA9H 5L88L 1HH9A 1AP2B 4F80A 5E00A 5CIPA 5I1EL 1KJ2L 4Y5YB 2P24A 5DJZA 3LN5B 1QVOA 2EIZA 1MHHB 3O0RH 1MFAL 3OG4B 5F9WC 3H9HA 1DEEB 3NTCH 1QLEL 4YFDB 3SO5A 4U1GC 1CBVL 3DXAA 2C3VA 3SKMB 2CLRA 2EDTA 1CLZH 4KY1H 1VERA 2O93L 4NZRL 2V2XA 1G7LA 2OK0H 1BAFH 1I8IB 4HJGA 4KRPD 5E1HB 3CZFB 4KVNL 4PRDB 1U3YA 4H0HB 3JV6A 1WGOA 1PKQA 4NO2A 3FT3B 1ERNA 4JFFD 5KVFH 2UYLB 1IT9H 2AJVH 3AMKA 1HCFX 2ERJB 2VN7A 3B2UC 4L8DA 4JAMA 5IESH 3VFTB 5DWUH 5ANMA 1M1SA 4Z7UE 5GGQH 3VWKC 4M00A 5IVXF 4HZAA 1I9IL 1QQDB 5F7EL 4WI6A 4XWGL 1TVDA 1YA5A 5AYUL 1X7QB 4L8SA 4ZQKB 4QY8A 3RTQC 2XV6B 4LLYB 2K9UA 2Y5EA 4GW4A 1FNSL 4Z76B 1FNGA 1JV5B 2Y4SA 3CZJA 4NQXA 3VFSB 4LRNL 2XA8H 2GHWB 4NM4L 4PJXF 3MUJA 4U7SA 2AABL 2DQFA 4X4YA 1EGJA 5C07B 1JPGB 2DKSA 4YDKL 5DK2B 3MRNB 2H3NB 4N8VA 2W9EL 5MEQA 2BCKA 1IE5A 4ZAKB 1NJ9B 5I75C 3RHWF 1G6VK 3U9PH 1T1ZB 5E2TH 3SKUD 3TBWB 2E7LC 4JCMA 3CUPA 3SKNB 4DZ8A 3WS3B 1RVFH 4YC2C 5IROC 2R23B 2DYPD 2IBZX 3QG7L 1W0VB 2VQUA 3S36H 4FN0A 5FAAA 3V6ZA 4HIEB 5E9DB 3B8YA 3R06B 1TJHL 3PWPA 3QDAA 3X12A 5IBTL 1LEGB 1F6LL 2XQYK 2E7CA 2VITA 1KENL 4HH9A 4AL8H 3CX5J 1FFPA 4IRJA 4LCWB 2LVCA 4G8EB 4LMQE 4HJJL 2Q1EA 3DJ9A 5H8DA 2BHZA 5DMYA 1QACA 4WV1A 1RZFL 1FC1A 4L29B 4KC3B 4ELKB 5K9OB 1NBYB 4MJID 3B4NA 4X9FA 5T1MA 4M6NL 1K8DB 4WI9A 5KS9F 3BT2H 5DFVD 3MCKA 1MJ8H 5EIIB 5C70A 1QFWH 4L9LC 1H8NA 1MJ7H 2EEBA 1J8HE 3MREB 5IJKC 2HH0H 2OMBA 2EXWD 1D5MA 2XFXA 3DOSA 5F3BA 4LCUB 1DBML 5ICYB 5E6ID 1FZOB 1NC4B 3RVVC 2A6JB 1MCHA 1G7MA 4WFHD 4MJ5B 4QRPE 4KUCD 3L3KA 1CFVL 3H0TB 3QI9A 3U0TA 2EDXA 5CZXD 3DX9A 1YEIL 3MLRL 2B7DT 5DT1L 1AC6A 4TSCL 2Y36L 2HJFB 3BKJH 3RL2A 1Q9WB 4PV9B 2NW3B 4LFHD 1HYSC 2DMCA 1W8OA 2E9JA 4N9GA 1FSKB 3N9GL 4JFZL 4WUKL 3L3HB 5F6HJ 1ZLSL 2VDPL 1KSRA 1VHPA 2Z0BA 4PJBF 4H8WC 4PJDE 1C1EL 4DGYH 3L5WB 4ZS6D 3OJVC 2EXYC 1KCRH 5FGBC 2NQCA 4JKPH 1Z9SA 3D87B 5DMKB 2VXTH 5JHDE 4XPFH 4YLQT 3HMXH 3V7AG 4EXKA 4MD0B 1V3KA 5E5MB 1AXTL 1M71A 4EDWL 1OSPL 2UUDH 3UJIL 3Q6FB 1HOCA 4HQQH 4QRSA 4PJAF 2MJWA 3ARTA 2YR3A 5E24E 3BPNC 4PLKC 2NY3D 3H9YA 5C0RL 5DRZB 3DGGB 5IGXL 4PJ8A 1LP9F 4UBDD 5JXEA 4AZ8A 3ZYZA 3RKDD 4H0GA 3VFRB 4X8JB 1RY7B 2EYRB 2XKSA 3D9AL 3U4EB 3S36X 4FXGB 5FUOH 1I7RB 3JZ7A 5I73B 5IMKB 2VO5A 4YBHA 4UOW1 3P9LA 2DQGL 3DMMD 1DBJH 4LLMB 2BVQA 1J05A 3MV9D 3WMSA 4MNHB 3PXJA 5HI3C 1A14L 5H2BB 2E8ZA 4H1LH 4K2UH 4JM2F 1MFEL 2ZUQC 4RMUA 5C0BD 1IC4L 5F89A 1AGEA 1R24B 2VH5L 5LQBL 2P5WA 4J8RB 2FD6L 3WS6C 3O11A 3ILQD 4TNWF 5LBSL 3GJEA 3MRJA 2X4QA 4ODXB 5KSUA 1ZGLM 1TJIL 4U33A 5I1CH 4UT6L 3CK0L 3LHPH 5C0AE 2XKNA 4LSDA 3WDIA 5TGBB 1MSPA 4BA8A 3QJHA 3IAGC 1U58B 4X6DB 1C08B 1N7MH 3RNKB 4Z7VE 1IVLA 2GK2A 5GGUA 1YNLL 1A5FL 4C83A 1ZHLA 1DL7L 3P4NB 1MAML 4TNVF 3LCYA 3OKNB 4OQTA 1QSEA 3O9WD 5ESAB 3W0WB 1I3VA 1WBYA 1P9MC 3LH2L 4LKXB 4M43L 2RFXA 2D0HA 1B4RA 4L4VE 2COQA 4M48L 4G9DB 5CAYB 4IIQA 4MAUL 4NRXA 3OX8A 3SKOA 3QO0B 2V9RA 1IAKB 1KJ2A 1KGCE 3IDMA 5F7MC 4QF1A 3P9MA 2NY5C 1T1WB 4GKSA 3ULUL 1G0DA 2BY0A 1LO0H 3QUML 5FYKU 2NXZB 3SDXB 5K9KA 1CZ8H 3EFFA 5C0JA 1I9RL 4H88L 1U41A 3JXAA 1EEZA 3CFJB 1OOAA 4JHZA 3K2UL 3HR5B 4G8GA 2C7UA 4WU5A 4XPTH 3HG1E 3S5LA 5D7LA 3BEVA 5IVZB 3JWNC 1NGQL 5T1LD 4YHZL 1T89A 3O41A 5HYJA 3IFNL 5FOJA 3OL2A 1OGAB 1WCBA 1ADQH 3H3PH 1G9MH 1Q0YL 4HF5H 4P5KA 5JTWA 4AM0A 3QEQE 2B2XL 3MZGB 2FX9H 2F8OA 3PWJB 4HV8A 4AK1A 5J89A 4HMCA 3OGOE 4D0BA 2FYYB 1NLBL 5EU4B 1EEYB 3EW3B 1XGTB 4YDVB 3LB6D 3LZFH 4MXWL 4AH2B 2EH8H 3V8OA 1PQZA 4KGJA 3I75B 1MCJA 3EDFA 4R90H 3U2SB 4LP4A 2ZUTA 3GI8L 3VRJB 1K2DB 1FZMB 4YHIB 3B5TA 5HDLA 1HHIB 4F8TA 4NQCE 2Q76A 3FRPA 1SEQH 4FG6C 2PYFA 4MXQC 5JOFA 5AG8A 1AHWA 5JW5A 3HB3D 3V79C 2MQ3A 3MNZB 1KACB 3CVHA 4RNRA 1GOHA 4BQ9A 1ZS8B 1NBVH 3IRPX 3AY4A 4I77H 1RURL 4JDVB 1CU4H 2X9WA 3BP4A 3NA4A 3ROOB 4AEHH 3DRQA 1YY9C 3QDJA 3FB8A 4LLUB 3RIFF 3AXLA 1AKJA 1MCIA 4I48B 4X7SH 1F3JB 5E08L 3O2WH 3FT4A 4WI8A 2VDML 4Z7VB 4Y5XB 3IAQA 5TDNA 5LWYL 1GGBH 4NQDA 4UUJA 5EU5B 1MI5E 4KK5C 4XCNB 3VRLE 5FO7B 5CJOH 4ZYKA 1IAIM 5HHPA 5CIPH 2A0LD 3ZKND 5KVDL 3RZCC 2YPLB 2B1HL 2ZNWA 1FVEB 1CG9B 1HKLH 3GIZH 5IB2A 3OKDB 1OWWA 4BKLB 3MGOA 4QTHA 1YY8B 2G75B 4ZO8A 1VFAB 5DD5H 5EDXA 3SJVB 3PDOB 4HFWB 1QHPA 1MWAB 4PRPD 4TOYH 1Q9LA 3BVNB 4ETQA 3TBVA 4NGHL 5D2LA 3IDNA 4QXGL 2DWDA 2I5YH 4MQ7A 4JO3L 1JE6A 15C8H 1J87A 5HJ3B 2F54E 4JVWA 4NKOA 3U36B 4IDJL 5C6PB 3N1MC 2OXGA 3MRKA 5IB1A 4CVZB 4EI5A 5LXGH 4AEIL 2IMNA 3UTSD 1DQLL 2NYYD 1HDMA 3NABH 5SWZE 1RJLA 3PQYA 4OGYL 4Y5VA 2AQ2A 3D25A 3TBTB 4LDLB 4NP4L 4PJEB 2J8UA 2WIIA 2CXGA 5HHOD 2X1QA 1OAQL 3H7LA 5T1DH 1NLDL 1TPXC 2JLLA 3DROA 3G5YA 3DBXB 4L5FL 5EBWB 3UP1A 4DKFL 4WO4D 4OCMC 3L3JA 4U3HA 1EGJH 3QUZD 2YWZA 5JQHC 1DQTA 1XGPA 2DQCH 4LF3B 4ODHL 5DJ8A 5DZLA 1TJGL 3MROA 2IFGA 4NQEB 5ITFB 5KVGH 1DUYB 2CIIB 2IQ9H 3U7WH 4M1GH 2DDQH 3QWRD 5INDB 2YMXL 3ECBA 4J3WA 2R29L 5IBUB 4AG4H 4I0PD 4LVEA 4L3ED 4OF3A 5L2JA 5IMLB 1VEMA 3EOYG 3PGCA 1BF8A 2IPUG 4YWGH 5D70L 1NC2D 2J12B 3O2VL 4IJ3C 1CICC 1FYTD 2ZJSL 4I1NB 4WFGD 5GJTH 5GS1C 2YEZA 5AZEH 2EDLA 3QQ4B 2R2EA 1HHJB 4U2ZA 1BGXH 1ORQA 4J23A 5EU3A 2EO1A 1TLKA 5D71H 5I9QB 1CGVA 2MTPA 4KMQA 4BQBA 1ETZA 3SBWC 3C8KA 3QO1B 5HYSG 3GGWA 4YBQC 3UPRA 1QA9B 2VLJD 2E27H 4YGVB 2OJZH 1QRND 4BELD 1D9KC 3I84A 5I76B 2HLFC 3JBG7 3X13B 2BNQD 3EJZC 4UMGA 2FH6A 5FGCE 5HY9B 1HIML 1OAUH 4TVPE 1ITBB 1CLCA 2CLVB 1H5BA 4AIXA 2YK1L 4GOSA 1IC7H 3MBEB 3B43A 1IM9D 3QEGH 1B2WH 1J18A 4Y19E 4M8QA 4RZCA 4CUCA 5I1KL 3BP7B 1CFNB 4BH7A 2VSDA 2N7AA 1MUJB 3RZCB 1JRHH 5LJYH 3EZ8A 1BZ7A 2XNAB 3G5VA 4CGTA 3GUTB 1BQHA 1A4JA 3CFCL 3TA3C 3X3FL 1UXWA 1A6AA 2AAVA 2FWOA 1FCGA 2VLLB 1OTTC 4QRTB 4N0YH 2O26U 3DYPA 5DZOA 5CCKL 1U6AL 2KBGA 4FOMA 2XYCA 4GSDL 3QNYA 4Q58C 5D1ZA 2QQKH 1DR9A 1UB6B 4JKKA 4LCCB 2FEEI 1ORSA 3VA6A 4BZ1H 3WIHL 1A6VL 2MFNA 2F54B 1CFSA 2XWJB 4H5SB 1YEKH 4DFIA 3GFUA 1GZQA 4JKMA 2CIKA 3HAEA 4X8XA 4CW1B 4D8PA 2R4RL 1AO7E 1EZVX 5CEZH 1UC6A 1J0ZA 3QUMA 1DLFL 4RGOH 4X0KB 3SO3B 4YR6A 4ZUSB 3VGAC 3QDHA 1CR9H 5A2FA 4H20L 2LFGA 4NWUL 1MLCB 4LHUA 3OR6B 1YJDL 1PJ9A 5DRWB 3FO1A 1HEZB 3VFVA 2VKWA 4PRBB 1OAKL 3MLWH 4IOFC 5IB5A 3V0VB 3ZHKA 1JF6A 5D6CA 5EBMB 1MIEL 5FGRA 1ZHBB 2X9YA 5SWSB 4AENB 4PD4J 3L3IB 4Z7WE 3S97C 3QXDB 3UC0H 4OFVA 2HFTA 2WV3A 4XPGH 4KTDL 5ACMA 4LARL 5F7UA 2RCSH 4X9GA 4FQXD 5EOCL 4MA1B 1NGPH 4L9DA 5FK9B 4IJ3B 1CICB 2D9CA 5I0DA 5IR1B 4J3UA 2WUCH 5C0FB 2EEAA 3WV0A 1JHLL 3BSZL 3MRBA 5DUPL 3DO7A 1WICA 5DQDH 1RUKL 1X6LA 2SEBB 4YFLI 1MHCA 5FGCB 1HH6A 5I71C 1MY5A 1MELA 2NNAA 4MJIE 4Y4FB 1FG2A 1JYNA 2AV7A 4X6DF 4UILH 3WFDH 4JB9H 2EXWC 1T03L 1I1AA 1DFBH 2ENSA 5T3ZH 5AYQA 3V7MA 4Y19B 2ZCKH 3VFWB 5LGHL 5IVXA 1PFCA 4OQTH 4YHKL 5EZIL 4D9RD 4DEPC 3L5XH 1AGDB 3GJFK 4MJ6A 1DSFL 2HA1A 5B3NA 1UCBH 2BVEA 3MNVB 3MRIB 4U1IA 1A1OB 4F2MB 2HTLD 2X7LB 1QBLL 5GIRA 4PJXA 4EN3A 1X44A 1RIVL 1UKTA 3KHQA 3CPLB 1KJ2H 5I1EH 3NGBC 4XVUD 2BSTA 1RAMA 2FHCA 4NZJA 1MCPH 1MFAH 4PG2C 1KLGA 1CK0L 1ZLVK 2WBKA 3AFLA 1QLEH 1G0YR 4HKBA 4RISL 1CBVH 2EKSA 4ZOAA 4KRPB 3SDXF 4ZXBC 4ZTOL 3DUUA 4NZRH 1T7XA 1N59B 4JFFB 5LGJB 4PJGB 2VIRA 3MRDB 1MCFA 4ZS6C 3BHBA 3BUYB 4HK3J 1NBQA 4KVNH 3WLWC 4GBXC 2FECI 1F8TL 4O2EA 1INQA 4JRYD 4S11A 3JTSB 4XH2B 3EYOA 1WWBX 3KG5A 1CTOA 4BSWB 2JK5A 5H94A 5BV7L 5ECJE 3KWWA 5F7EH 4XWGH 5AYUH 3CMOL 3B8SA 1RZIA 4HG4J 4UBDC 1I1FA 3OMZA 1FNSH 2P8LA 4K94L 4NO0A 4LRNH 2HN7B 4PTUB 4PTTA 2Q86B 1WISA 2AJ3A 4NM4H 2P42B 5IEKA 2J6EL 4NIKB 3IXAA 1F3DH 3HNSL 4EXPX 2AABH 1KT2A 3H3KA 4YDKH 3DMMC 2W9EH 4WNQB 2FJFB 2DYPB 2NY6C 4KROD 2HFEB 3GNML 3D69A 2MNUA 4YPJA 3SGDH 5IOPA 4PGEB 5HVHB 4HUWA 4U49A 1UZ8A 3RQ3A 3QG7H 4ZUUB 1I85A 3CVHH 2FJGB 1TJHH 3DYMA 3DHJA 4J3TA 1QO3A 5TH2B 5IBTH 4MB4A 1C7TA 1TCRA 3LEXA 1KENH 1P6FA 1BFSA 5KSAD 3GSRA 3ILQC 5CS7A 5D9SB 4I2XA 4YHYC 3GSXA 1II4E 3TYFB 5C0BE 4MJIB 1AGCA 3BXNB 4HJJH 4X6CB 3BDXA 4M1DH 4Z7VF 1U8QA 1RZFH 1ODAA 5I71B 4GAGL 2VZUA 3JWDC 4PJBA 3UTQB 3BPOB 4M6NH 2IWGA 1T2QL 1JPTH 4OFDA 1TQCB 5DI8B 1YEHL 3OF6D 4EUPA 1I8KB 5E6IB 5ENWA 3T4YB 4DZBB 1S9YB 4ZUWB 5JNYB 1AGFB 4QRQA 4NWTL 4Q2ZA 2R2BB 2DIJA 1DBMH 8FABA 3VXUD 2D7PA 2GK0A 1I1YA 4PJAA 3S37X 4Z5RA 4FXKA 3O3DB 3GSOA 1CFVH 1BZ9A 3DRTB 3U1SL 3OJDA 1DVFA 4QHKJ 3S35L 4Z77A 1YEIH 3RVXD 3MLRH 3JTTA 5DT1H 1KXTB 4P4KC 2Y36H 4TSCH 2JCCE 5C0CD 3T1FA 1X5AA 1L6ZA 3SOBL 1IL1B 1MCEA 3KPNB 1S5HB 4R7DB 2XY2A 3RGVA 1UXSA 1UADC 5J1AB 4OJFL 3N9GH 5IG7B 4OZIE 4JHWL 4JFZH 1AQDA 1FL5A 4WUKH 2EYSA 3WIHA 1MNUL 3KR3L 2LU7A 1ZLSH 2VDPH 32C2B 4HFUL 3HI6L 2LE9A 1C1EH 4PJEF 4ZUVB 5HYIA 3FB5A 4JM2A 4PRIA 5J7CC 4WENB 1IGIL 1HN1A 2X4TB 4YHLL 1GIGL 2YD8A 4XP4L 1PAMA 4J4PC 4M7LL 1QEWB 3LN4B 3QT2A 1AXTH 1BEYL 3IDJB 2NY3B 3HPLA 3TZVC 4LAQL 3UJIH 4XP6L 3R8BB 1JGEA 1VEPA 5JW4Q 3MYJB 1XF3B 2BXYA 4WJ5A 5C0RH 4JFYA 5IGXH 2ITDA 3UXFA 2FX8L 2CDGB 5I66A 3MRRA 4P57B 3D9AH 5I16B 1X5JA 2IH1A 3DMMB 4E42A 4HWUA 3ZKQD 3MV9B 4J2XA 4W68A 4R6UA 1NEZA 1A3RL 5C7XL 3GMOB 4JZJA 1NCTA 1KPVA 2J3SA 3IAPA 2DQGH 3H9SA 1WJ3A 3BOVA 5J8OA 3BWAA 3L3DA 4U1NB 3IJHA 2VDOL 1A14H 3DWTA 3LIZL 1KN4L 5C0BB 3F12B 2X4SB 3QG6A 4G5ZL 4MD5A 1CE6A 1DEDA 1HWGB 4NQUA 2CRYA 4X7CC 3DX8A 1MFEH 2H26A 4P4RB 1IC4H 1BVKB 3WFHB 3NOIA 3GMPB 2VH5H 3C8DA 2F74A 4APQA 5BS0D 5LQBH 4CL7A 3TBSB 3T04D 3CSPA 4LHUG 5TFSL 1FV1A 5J12B 5LBSH 1XGQB 4F33B 2A6IA 3V5HA 1M7XA 4LMQI 3KS0J 1TJIH 1JPFB 4UT6H 1MJJB 1X5HA 3IU3A 1RI8A 3U79A 1JWUB 4FFWC 4FFYL 4AQ1B 4KTYA 3ZE2E 2BSRB 1NKOA 3PNWA 2P45B 1ZA6B 5DVMA 2H2PD 4MHHG 5EU7C 3O9WB 5DJ0B 3UBXA 1YNLH 1A5FH 1FNFA 1DL7H 1MAMH 3D18B 3QDME 3FFDB 3O3EB 3QIWC 2PTTA 3IF1B 4TQEL 1ZLWK 5JDJA 2JCCB 3CDGB 3LH2H 4M43H 3T4AB 1ZWIA 2W60A 2XQYG 4NBYB 2YN5A 4OFIA 4NRZA 4GRLD 1J11A 5SX4H 3BUTA 5J1SC 4MAUH 3B9KC 4F7MB 3O6KL 3SPVA 3RWGB 4D0CB 1J9CT 1ZT1B 4OZIB 4FQCL 3HAEH 3L5IA 3P11L 1FFNA 3C5JA 1I9JH 4KZDH 2ESVD 3ULUH 2FX7L 1JK8A 4X7DC 4ERSL 5D5ME 3QUMH 5FYKD 4X6FA 3TLRA 2G9HA 5L8KB 4H88H 2OYPA 1U8MB 1X4XA 3K2UH 4IMLB 5DJ6B 3UTSE 4LLQA 4ZODA 4P23D 5JW3L 5T1LB 1IM3A 4P3DB 3FFCD 4N8PA 2H8PA 5J6GB 4RX4D 3KJ4C 4LPVA 5DVKA 4HJ0D 4R4NC 1WFOA 3K3QA 4OCNC 1NGQH 2N4IA 4NCC1 4P5TA 4YHZH 2MKWA 3DTXB 2OTUB 4L3CB 5ESVA 4RFOL 5TDPA 1REIA 1G6RB 1ITCA 2GSIA 4IRJD 5A43C 1Q0YH 2B20A 4OKVB 5CMAB 3RU8L 3NZHL 3B9DA 5H35B 4OKDA 2B2XH 2JE8A 4LEOA 5AD0A 4BH8A 3SCMD 2VLRD 3Q5OA 5FGSA 3UJJH 1AP2A 4F7CB 4E0RB 4K55A 1NLBH 5A2LH 2IEPA 1UT9A 1PG7L 4MXWH 4L3EE 2BVUA 2J6EA 5IQ7L 4Y5YA 2IH3B 4AJ0A 3LN5A 5CINL 1MHHA 4EQ2A 1DEEA 3ZDXE 5FFLA 3GI8H 4WFGE 3BH9B 2I26N 3C5ZC 3SKMA 6CGTA 2IPKB 5L2KD 3EYVB 4WEBL 4JJ5B 5B8CB 1ES0B 3IS1X 4LNVA 2WLZA 3TVMD 4ORGB 1I8IA 1WWAX 2HWZL 3CZFA 4PRDA 2J5LC 2Y5TB 2DBLL 4DQOL 1V05A 3CH1B 3FT3A 1HHHB 2CDEB 2UYLA 4P0DA 2VLJE 3HZKA 4MQXD 4HK0B 1FNLA 4ZFFB 1IQWL 1RURH 4M1CD 3VFTA 1ONQB 3B5HA 5EOTB 5ESQB 4KV5F 4WDIB 5FA3B 2BNQE 1QQDA 5MERB 3BQUD 1MVFA 4PJCB 5E08H 1IMHC 2Z8WC 4ZQKA 4RMVA 2VDMH 3ARWA 1FVCB 3QUYC 4LLYA 5LWYH 3WLBB 2ZOKB 4Z76A 1JV5A 1KCLA 4YXHL 3VFSA 5D2NC 4LDOB 4MS8C 1BOYA 2H45A 3CFEB 3QPQC 4TYUA 5I30L 5GRVL 1NPUA 2L0DA 5TQ2H 5KVDH 3TT1L 2FGZA 2B1HH 4GAJL 1F45A 5EULV 5C07A 1JPGA 5BQ7B 3MRNA 4L1HA 4PRPB 2H3NA 1A6WL 5JUEL 4MAYD 2CPCA 4KI5D 1NJ9A 4ZAKA 1JNLL 3BJLA 4PJIE 1T1ZA 3TBWA 1JNHB 3HUJE 4ZO7A 5TPWL 3IKCB 1Q8MA 3OJ2C 3SKNA 5B3JF 1ULVA 3WS3A 3P0VL 5DD3L 4PJGF 4PGZA 2R23A 4DWHA 3RPIB 1W0VA 2AEIT 4HIEA 4NGHH 5E9DA 5EUOB 4WUUD 3R06A 4QXGH 1TMCB 5IVNA 4IHOA 1QR4A 2DTMH 2WBWB 2JJSA 1LEGA 1KIRB 3QCTL 2DJ4A 3RVTC 4TTDC 2J8OA 1Q94B 3QFJD 4I0KA 4LCWA 3UTSB 4G8EA 3TWCL 5DD1L 3QIUD 4AYFA 1EMTL 1CFTB 1XMWA 4N90E 1OL0A 5I2IB 4IDLA 1KEGL 4IDJH 1A9BB 5T5FL 4AEIH 1TNNA 4L29A 4ELKA 5HHOB 1DQLH 5K9OA 1NBYA 5D4QA 4PBVC 4P3CL 4MJ2A 1GHFL 4Y16D 3FO9B 5JZ7D 4P46C 1K8DA 4NP4H 1INDL 4E5XB 4PRNB 4GG6E 2NY1C 4WO4B 5EIIA 3K0WA 1OAQH 3AS1A 3QUZB 5BOZG 3MREA 5HHXL 4L5FH 1QKZL 4U6HB 4DKFH 4U3CA 4MNGE 4LCUA 5ICYA 2E9BA 1FZOA 1NC4A 3VI3E 3S6CA 2A6JA 4I0PB 4ODHH 4MJ5A 4J3OC 3BISA 1TJGH 1MWAL 1BIIB 3C09B 3H0TA 1NC2B 2YMXH 2PXYD 1FYTB 2R29H 5ITBL 2HVKB 4XZUB 3MA7B 3D2UD 1G7IB 2DN7A 2HJFA 5D70H 4PJFE 2YXMA 3O2VH 5FIEA 1Q9WA 2YA1A 3LY6A 2ZJSH 1LE5B 4PV9A 3BPLB 2NW3A 3SKJL 4LAJH 4XB8A 3N0PB 2BC4B 1HHGB 2VLJB 5T3XD 4X6CF 5DA4A 1SHMA 1QRNB 2J5LB 3L3HA 2W65B 1NMCC 4PG9B 3T2NL 1IAII 5K9QI 3L5WA 5IKCB 5DMIL 3PDGA 2BNQB 3Q3GB 3KXFD 1QHOA 1UJ3C 5DMKA 3W5NA 4EUPH 3QH3B 4KKAD 4YIQB 2CLZB 4XCEB 2BX5A 3DV4B 4MD0A 3V5DB 3BDYL 1IM9B 1CQYA 2EECA 2NY0D 4KUCF 1HIMH 2MPAL 2YD1A 3K4DA 4NZTL 3Q6FA 5HHME 2B8OT 5EG6C 2DI9A 2YK1H 4D9RE 4ZMAT 4JQXA 1QFWM 4R26L 2PTUA 5DRZA 3DGGA 3PG2A 3PABB 4DAGL 1UWXH 5BW7C 1TVHB 4XVUC 4PJIB 3QDGD 3VFRA 1OAYL 2ZG3A 4X8JA 2EYRA 3U4EA 4WGVB 2DQDL 4FXGA 3LD8C 2OM5A 3CFCH 4ZSOE 1I7RA 2VZVA 5IMKA 5FKAB 2CKNA 4TSAL 2DM3A 4LLMA 1U6AH 5JDSB 3MV7D 4MNHA 1U3HA 2FR4B 2V5TA 5HVGB 3N1GC 3WIHH 4GG8B 1A6VH 1AD9B 2EDKA 4P2CG 5H2BA 4ENED 4LLAA 2FCBA 4OBSA 3RY6C 5I1DB 1S7VA 5F71A 2IJ0C 2R4RH 1R24A 4UT7L 2BK8A 4X7TB 4P2RD 1RK1B 4JRYE 4JQIL 4G43B 1OTSD 3FQTB 1QZ1A 4OLVL 4H20H 4KTEL 4R8WL 1YJDH 5TGBA 5JW4N 3UBXG 1U58A 4X6DA 1OAKH 1C08A 1PZ5B 4OF5A 3BD4A 5GHWL 3RNKA 2F8VA 2V5RA 3SN6N 1MIEH 3P4NA 1ND0B 4QHUB 1DBKL 3OKNA 5AZ2L 2Y6SD 4B0MM 4FQXB 1XEDA 4YZFE 4KROC 5J0BA 5ESAA 3W0WA 4LKXA 4PJFB 3BI9X 4LARH 4BFIB 1CD0A 1EPFA 4N0UB 4G9DA 5K9JL 4K23L 5EOCH 2YOCA 4NQDD 2GT9B 4BQ6A 3QO0A 1IAKA 3EO0B 5FYLL 4PIRF 5KSAC 4K7FB 1T1WA 1EIBA 4LVOB 3TIDB 1JHLH 3BSZH 5DUPH 2EDJA 3SDCD 3SDXA 2VYRE 3OWEA 4GKZB 3ARVA 1VSCA 5IFAH 4OI8A 1JCKA 3CFJA 1BF2A 4IRZL 3HR5A 2HT2D 1RUKH 3MV11 3T0WA 3TO4D 4JFPB 3DX6B 1FHGA 1CDYA 3RI5K 3VXRD 4QHNB 3EO9L 1BJ8A 2VC2L 3QNZB 5IVZA 1FL6B 3GRWL 1T03H 4UOJA 5DMGD 5LGHH 1OGAA 2YHGA 5HYQB 1PG7W 4YHKH 5EZIH 4GXUM 3SDAD 1QBBA 1FVDB 5I8OL 3A6CL 3P77B 1DSFH 3VXUE 2JCCF 2W59A 3PWJA 1SJHB 2DRUA 4L8CA 1BQUA 3RVXC 2FYYA 2NXYD 5EU4A 1EEYA 4YDVA 1XGTA 1QBLH 4AH2A 3WJLC 2E7BA 4KI1A 4Q6YA 3LD8B 3LEVL 4OCRL 1E4XI 1RIVH 3I75A 4OZIF 3U2SA 1OARH 2CRZA 3QAZB 3VRJA 4GW1B 1K2DA 1CK0H 3GIVB 3NIGE 3ARXA 1FZMA 1G9MC 4RISH 4YHIA 2W9DL 5GRWA 2APFA 4ORZC 1HHIA 2FRGP 3WXVL 4ZTOH 1UGNA 2BSED 3MXVL 2YD9A 2EDEA 3OKOB 1U8OB 4QOKD 3MNZA 5F88B 3F7VB 5GPRA 1A22B 1GVIA 4JRYB 2C1PB 1YEFL 1ZS8A 2P46B 4ZOCA 3QHFL 1F8TH 1DQQB 2DLGA 2BVYA 2X41A 4LIQL 2E6PA 1A0QL 4JDVA 1KJ3L 2XN9D 3C9NB 2EDNA 5FB8B 2L7JA 4G6KL 3ROOA 3TCXA 5FDWB 2BJML 1HHKB 2Z8VC 4LLUA 3Q1SL 3WO4C 1X5IA 2OI9B 3LKQB 4I48A 1F3JA 4MMZC 1B6DA 1LO5B 4Z7VA 4Y5XA 4WFFE 3TEUA 2C1OB 3CMOH 3OAYH 1MCBA 4O2FB 1EA9C 2BRQA 5EU5A 5C9JB 2GY7B 4WVRA 3CSBA 4UQ3B 2ZUXA 5FO7A 3NPSB 4RWYL 4K94H 4G42B 5C9KA 2J6EH 4W70A 2YPLA 3FAXA 1W8NA 1FVEA 3TESA 3QCUL 5D8JL 3HNSH 4KROB 1CG9A 1KCSL 4F57L 3WUZA 4LOUC 2OXHA 3OKDA 5F72S 2CUMA 4BKLA 2X42A 1YY8A 2G75A 2C5DC 1VFAA 3SJVA 3PDOA 2XPGB 3U4BL 1MWAA 2QHLA 3HNVL 1A6ZB 3GNMH 5DK0A 1FLTX 4L3AA 4OZHE 2PYED 4KZEL 2AERT 5EUKB 4LCIL 4LQFL 5MI0C 4V1DD 4J3VA 4ODVL 4Z7QF 5TF0A 5KSAB 4FNLL 3S3PA 1S9KC 3IDUA 4U6XA 2ADJB 4Z18A 3GM8A 3OJMB 5I15H 2Z31D 4PY8I 2XACC 3QB7C 1YN7B 3GSUB 2CO6B 5HJ3A 4K3EL 4KXZI 5FO8B 3RUGF 4JGUA 3U36A 3CFKB 4PJCF 4QYOB 5JPMB 5J3HD 3AGVA 4POZC 2EDWA 1QTYT 2HT3D 4GAGH 3TBTA 4R96B 5DMJB 1H15A 4PR5B 1TQBB 3LKSB 4PJEA 1M05B 1T2QH 4UZGA 3TNMA 4OZ4B 1JHKL 2H2PC 3QPXL 1JGLL 5SV4A 2E9IA 1YEHH 5A2KH 2H6PB 3DBXA 3VXUB 5EBWA 2BY3A 4HSQA 4QO1A 5JOPD 2IAND 1PKQE 3TJHD 4NWTH 3HLAB 1MCCA 5EIQA 4LF3A 4F3FB 4F37K 1T4KB 4NQEA 5ITFA 5KSBB 4L8SC 5LAXB 5ANME 2CIIA 4GRLC 2ED7A 3D39D 5INDA 1T1YB 2DOCA 3U1SH 5IMLA 1CE1H 3QEHB 3S35H 5C0CB 5EUOF 1FIGL 2P44B 1OLZA 4LHJB 2EE3A 4HH8A 3CCHB 3U6RB 1KOAA 4FFVC 1OP3H 3QQ4A 3BIKB 1HHJA 1OSZB 3SOBH 1XR9A 1U8KB 3OKKA 3UZEA 1ZV5A 4OM1L 3ZTJH 5DJ2B 4I9WE 2D7NA 4B5EA 4OJFH 5DZNA 3QO1A 1R3LB 4K71B 1QA9A 1MNUH 2UWEB 3KR3H 4YGVA 5E03A 5CJ5A 5EORL 4HFUH 3HI6H 1TZGL 4HJ0C 5I76A 3GMLB 4PY7B 3MJGX 4ZTPH 1F97A 3X13A 3FFCE 2EDQA 3ZT7A 4OIIL 3KYMB 1CD8A 4YHLH 4IRJC 4PGDB 5E8OB 1GIGH 1M7IB 3P3YA 4G6AD 3PWPE 4XP4H 5HY9A 3MC0A 1NUGA 3IETB 4XPHL 1I8LA 5DXWA 1K4CB 1BEYH 3QRFM 2CLVA 2Y23A 4BZ2L 4LAQH 1E0OB 3SCMC 3MBEA 3KPSD 3HNTL 1OTUD 5FYJL 4XI5D 2YN3A 1CFNA 3BP7A 4X98B 3TJEL 4KKNA 1WZKA 2VLRE 1MUJA 2VQ1B 3LDBC 2LU3A 3RZCA 1RIUL 1KG0B 5KTEL 1KN2L 2WBJD 4LQ1A 1HNFA 2FX8H 2XNAA 5KG9B 3GUTA 3SDYL 2D7QA 2HVJB 4OZHB 2W91A 1F4WL 3MO1B 5GRUL 3FQWB 3HA0A 2CH8A 2VLLA 5C7XH 3BESR 4QRTA 2K1MA 1EXUB 1FFOB 3VXOB 2Q8BL 3DI3B 1UB6A 2VTFA 4LCCA 5MI0B 3INUL 2JIXB 3KDMB 2VDOH 4KKBC 1F90L 3LIZH 1KN4H 2XWJA 4FFZL 4H5SA 4UIKL 4XPAH 5CGYC 4AT6B 4C58B 4G5ZH 4M1CC 5BS0B 3P40A 4RFEB 4CW1A 4XC3L 3HE7D 4N0CC 2C3VB 4C54A 5CEXB 3ZZ1A 3WFCL 4UIMB 4X0KA 3MJ9L 4ZUSA 5TFSH 2ARWA 4FQ2L 4JGMA 3GHEL 1MLCA 2J8HA 5DRWA 2R9HC 1HEZA 5EOCJ 2VR4A 4PRBA 4FFYH 3PGDB 4ODWB 1MF2L 1VPOH 3V0VA 2ZUWA 4PJIF 5EBMA 1DQJB 3GRWA 4XWOD 5I19L 5ACLA 1ZHBA 2GJ6D 3S35X 3U0PB 5SWSA 2FEEL 2AGJL 3RVWC 4AENA 4OCSL 3L3IA 3QXDA 1CLYL 1KYOJ 2B0SL 4GRLB 1CN4A 4Y2DD 4KHXL 4TQEH 1Z3GL 1X5KA 2J88L 3D48R 3LS5L 5FK9A 2X1PA 3KYAA 3O6KH 2ESVB 4LPUA 4E41D 3DSNA 5IR1A 3LQMA 4IM8A 4WUUE 4FQCH 4LASL 5C0FA 3P11H 3QIUC 5D7IE 3VXTB 3NCJL 2XXMB 2FX7H 4ERSH 5TF1L 5KBNC 1R3HB 4P23B 1J5OL 3GKZA 3FFCB 4PGBB 2SEBA 1LWRA 2DI7A 4GLRH 1T7YA 1E28B 5JW3H 4Y4FA 4HXAL 3P4MB 2BNUB 2VITB 4IRJB 4X9HA 2A6DB 2C3WA 1D5BB 5GS3A 2ICCA 1ZAGA 4MD4B 2D03L 3WN5B 2NPLX 4Y19A 3VFWA 4RFOH 3SCMB 2VLRB 2Q87A 2GEEA 1AGDA 1ZEAL 3C6LD 2C9AA 3RU8H 4PJFF 3MNVA 3MRIA 1A1OA 3SGEI 1P1ZB 1UH3A 4F2MA 4JN1L 1R0AL 3QP3A 4Q9BA 1A7QL 1XF1A 2X7LA 3G5ZB 3CLFL 5HHQB 1PG7H 3KPLB 3CPLA 5IQ7H 5L2KB 3FTGB 5CINH 4KQ3L 3TVMB 2AJUL 2KH2B 3RNQB 5IUSA 2OLDA 5T3ZE 4WEBH 4JPVL 4XNQB 1CI5A 1N59A 3MUGA 4JFFA 5LGJA 4PJGA 4H8WH 1QSEE 3MRDA 4XMLH 3BUYA 5T3XE 2HWZH 3OKLB 4IIQC 4UV4L 2DBLH 4DQOH 4Z8FL 3UX9B 1P4BL 5F6HI 5JW4R 1E6OL 3KXFE 1IQWH 3BQUB 1WWWX 3JTSA 2MCPH 4XH2A 4DW2L 2GSGA 1S7RB 3K2MC 1MVUB 4BSWA 1G6RL 1JTPA 2P7TB 1IGTB 1P5UA 1FG9C 5GS2H 5CUSL 4LK4A 2H2SD 5CD5D 3U0WL 1CDCA 2F58L 4YXHH 1SM3H 4BZYA 1SEBB 2Q86A 2HN7A 4PTUA 5F7DB 3T0VA 3ZHLA 1SVCP 1TIUA 1VFBB 3T0BA 4HWBL 4RA3A 1TDQA 4MAYB 5I30H 1FP5A 1T89C 3TT1H 3GHBL 4KAQH 3QDGE 2NY2C 4JJHA 1WEJL 2ZG2A 1A6WH 3I3BA 2FJFA 4WNQA 3RIAF 1TCMA 3ZKSD 5JUEH 1JNLH 2DYPA 2HFEA 3WKNA 4WUUB 4X6BB 3L7FB 5GZND 2NY4D 1ED3B 5D7IB 3P0VH 4PGEA 4ENEC 4JY4B 4ZUUA 3PDDA 4NRYB 3QFJB 2FJGA 2VERN 5TH2A 3QIUB 2ZCHL 5D9SA 3TYFA 4MJIA 5DD1H 1EMTH 4Y16B 4CVUA 3BXNA 3O6FD 4X6CA 1KEGH 5IHLB 3QRGL 2WANA 3UTQA 1AHWC 2ADIB 4P3CH 1GHFH 3V4VL 2WNGA 2NZ9C 1INDH 4KJQD 5DI8A 3ZT5A 1I8KA 5E6IA 3AY4C 3DPBA 3T4YA 4DZBA 1S9YA 4ZUWA 5HHXH 5JNYA 1QKZH 1GL4B 1PG7X 2R2BA 5EC1B 1JWMB 1O7VA 5KSUB 2DLTA 5F3HA 2PXYB 2DQIL 1Y6MR 3O3DA 1MWAH 2WQ8A 3D2UB 4M7ZB 3DRTA 5DDHB 3DI2B 3ZTNL 1FIEA 5D7JD 1ACYL 4NQDE 4BSVB 4B7IA 2W92A 4RGNC 4WTZA 1CTNA 4O5LH 2CMRL 4FTVD 1IL1A 1D7FA 1DJSA 4JR9L 4L4TD 3SKJH 1MCLA 3KPNA 1S5HA 4RGNE 2X89D 2HT2C 4R7DA 5EOQL 5J1AA 1BZQK 2YZ8A 2VISB 5IG7A 3KXFB 2DMKA 3T2NH 1I8MA 1UG9A 3SKOB 32C2A 2Z4QB 4G6JL 4GXVL 5DMIH 4ZUVA 1L0QA 1YEEL 4GKSB 3ZE0E 2NY0B 4MXVE 2FHBA 3VXRE 3EIFA 5D2LE 2VZ1A 5K9KB 3IKKA 1T20B 3QWOB 3SDAC 2BFVL 1QEWA 3BDYH 3LN4A 1NGXB 1EEZB 3IDJA 2MPAH 4NZTH 4NN6C 4EI5C 1W0WB 4RBPH 2PUQT 5KSBF 3MYJA 2DI8A 5EU6D 4Y5VC 3QDGB 4R26H 1EHLL 2WUBL 5DO2D 5I1AB 4PUBL 3RBSA 2XTLA 4DAGH 1BVLB 5DUBB 4HXBL 4MSWA 1PD6A 3PQYE 2CDGA 4P57A 3V4UL 2J8UE 2DQDH 2R0KL 3K4ZA 5I16A 3DMMA 2OBGA 3MV9A 3MV7B 4P5KB 3FN3A 1LEKB 3GMOA 1R3JB 4AM0B 2DKMA 4ODTL 1F5WA 4TSAH 3MNWB 4B53A 3ZE1E 4YFEA 4KK8C 1ZE3C 4WIQA 3MRQB 2UZXB 5C0BA 3F12A 2UWEF 3CXHJ 1J1XL 3ETBF 5KW9H 3PHSA 3P4OB 4K7PL 3LV3B 4P2RB 4X7FC 1A02N 4P4RA 4WHYG 4PS4L 5L0QB 1BVKA 3WFHA 1VCAA 2V9QA 3GMPA 4UT7H 4PJ7B 1QPPA 3TBSA 2I24N 1XGQA 4F33A 5CKAA 4OLVH 1JPFA 2EYTA 1MJJA 4KTEH 4HUXB 4R8WH 1AY1L 5BJTB 4EZMA 1JWUA 2NR6C 4OBRA 2VDRL 2BSRA 1KFAL 1CDGA 1V3MA 5GHWH 3O9WA 5DJ0A 4I4WB 1KLFA 4G3YL 4QRUB 4PD4K 4OZHF 3D18A 3VFUB 3DVGB 3TNNA 2YD5A 1DBKH 3FFDA 3O3EA 5AZ2H 4IBLT 1YMMD 3SEPA 2PR4H 1AR1C 4NQDB 3IF1A 3WE6B 1H5BC 2JCCA 3CDGA 3T4AA 5T33L 1ZMYA 2WAHA 4DVRL 4XP5L 3PV7A 5K9JH 3WDJA 1RJZB 4K23H 4WEUD 3KGRA 4F7MA 5HHPB 3RWGA 4D0CA 4KHTL 1WWCA 2CD0A 2IALB 3EGSB 5FYLH 2X4OB 3SDCB 3W11D 2D7MA 3E0GA 4RFNB 1N4XL 5IB2B 3OKMB 3TO4B 2E7HA 5A16B 4UNTA 1QFWI 3EYQC 5J3HC 3AUVA 4F58L 3OBAA 4FZEL 5D1ZC 1U8MA 3VXRB 4HMEA 4IRZH 2FL5B 4IMLA 5DJ6A 2LABA 4F8QA 5JMRA 2Z91B 4RAUB 5T1LA 4P3DA 2YXFA 5J6GA 4NKMA 2HJLA 3EO9H 1IC1A 2VC2H 2A9ML 1XF2B 3GRWH 3SDAB 1JTTA 1WTLA 3TT3L 3ULUC 2GITB 3DTXA 2OTUA 4L3CA 4YK4C 4HKXB 25C8L 2VR5A 4YHOL 1G6RA 2AV1B 2AEWA 1T5XB 4NN5C 5JOPE 4N5ED 1EHNA 3FONB 4OKVA 4XXCA 5CMAA 5HI4D 1EBPA 2NXYB 5I8OH 2VDNL 5DYOB 5H35A 5HDBF 5EO1B 1HNGA 1KNOB 4F7CA 4E0RA 2A1WL 4OCLC 5F96L 2UZYB 4HWBA 3LEVH 3KNBB 2IH3A 1YQVL 4OCRH 4LPWA 2DLEA 4R2GC 4K3GA 3BH9A 2IPKA 3EYVA 1A7OL 2W9DH 3BP6B 3C60D 4JJ5A 4QOKB 5B8CA 1ES0A 1H8SA 3MOBH 3ORJA 1BFOB 4MWFB 3WXVH 4U6VH 1CYGA 12E8L 2Y5TA 2IPTL 5FYJU 2XN9B 4RAHA 1HHHA 2CDEA 1YEFH 3R0MA 3QHFH 4LIQH 2GKIA 3DHMA 4HK0A 4DOHB 1A0QH 4ZFFA 5F6IB 1KJ3H 1ONQA 3OV6A 5EOTA 4G6KH 5ESQA 4ZFZB 2BJMH 4WDIA 5FA3A 3RUGA 1JTOA 3Q1SH 2XXCB 1X5YA 4PJCA 5ILTL 4HG4K 1C5DB 2AW2A 1FVCA 2YD3A 3HS0B 1A6TB 4S1DC 3WLBA 2GFBB 2ZOKA 5M7QA 4QWWC 2EDYA 5F1IB 4YNYB 2WBJC 2OZ4L 5FXCH 2CGRL 2I07B 4RWYH 4XRCB 5FCUL 1I7ZB 5D7KD 4NFBA 1JF5A 3CFEA 1BFTA 1I1AC 3GB7B 3H3BC 3PP3H 3QCUH 5BQ7A 4PRPA 1KCSH 4F57H 2PYEB 3ARBD 2YUWA 1CGYA 1L9NA 3DLQR 1DN2A 1R5WB 1JNHA 1HSBB 4V1DB 4LSTL 2JTDA 3IKCA 2ORBL 3HNVH 4RZCB 5IVXE 4ONFL 4GRWE 1QG3A 3RPIA 3WYRA 3NIFF 2Z31B 4QCIB 5IFJA 3MRFB 3H9ZA 4LCIH 4LQFH 5EUOA 1T83C 4ODVH 4OF7A 4FNLH 4EN3C 1CDUA 3UROR 1FC2D 1Q94A 5IQ9B 1T5WB 4K7PY 3UTSA 4TUJB 3KJ6L 4PJXE 2FEDD 1CFTA 3IJYB 4JDZB 5C0ND 4PLNC 5I2IA 1A9BA 5HYEA 4MZ2A 2X1XR 1B90A 1UM5L 5HHOA 1P84J 1N3NB 5FM8A 3FO9A 4XHQA 1U3HD 5D93C 4E5XA 1I1CA 4GS7C 4PRNA 4XAKE 1H9VA 5EA0L 4WO4A 3BGMB 1JHKH 2IANB 3QPXH 1JGLH 3QUZA 4M6ML 3RVUD 2JB6B 2P8MB 3PWLB 4KI5F 1OW0A 4UAOB 1C5BL 1TVBB 2AS5M 2HT4C 3D39B 4L4JA 3QWRA 1NMAH 4I0PA 4QKXB 3CD4A 1BIIA 4LFHG 1JJUA 4DVBB 1NC2A 4G6FD 1KIPB 1FYTA 3EDJA 3R1GL 4WTZG 5D7IF 4B50A 2HVKA 4F7PB 4XZUA 3MA7A 3LSOB 4U1MB 3QUXD 4WHDA 5EO0B 1FIGH 2FLBT 2P5ED 3ZKMC 5EO9B 1NDMB 1OQXA 1LE5A 4E41E 3BDBA 1BJ1H 2DMBA 2BC4A 4CRPA 1HHGA 5BVPL 1D5ZB 2VLJA 4I3SL 4OM1H 2EH7L 2OCFD 4G80B 3B6SA 1BHGA 3JWOL 1QRNA 5IW6B 4D9QE 4PG9A 2W65A 2XWBB 1KBGL 4TPRL 1T2JA 1TFHA 3SE9L 3OB0H 1EEUA 5IKCA 5EORH 2BNQA 1RK0B 1TZGH 3Q3GA 3GBNL 1N2RB 5DSCB 4QLRA 2FSEB 1CL7H 4LRIA 4IEFB 3KLHC 4MLIA 3QH3A 2QR0B 4M93B 1HXMB 4YIQA 4OIIH 5JIKA 3ARFD 3DO7B 2IPUK 4XCEA 1MLBB 2A9NL 3DV4A 3V5DA 4ZUTB 1IM9A 3KPSB 3O45B 3UMTA 4XPHH 4XBEL 2DICA 4ESKA 4RAVA 1BD2D 4MB5A 3RWEB 1UM6L 4BZ2H 4U0RB 4I2XE 4XCFL 3HNTH 1BREA 2WBJB 3FQXB 2BP3A 4HUNB 2JJVA 4OLXL 3PABA 4W4OA 3U83A 4PJIA 1RIUH 3V2AR 3IGAB 5KTEH 3O8XD 1KN2H 5FUZL 1N6VA 1U93B 1YZZA 3SDYH 5MEND 4GRWB 1CVRA 1IAIL 1F4WH 1ZSDB 5GRUH 2YPVL 5FKAA 3VG9B 1XFPA 1HILB 1JZ3A 1PY4A 3K46A 5JDSA 1UWGH 4NQVB 5C0IB 5J6HB 2FR4A 3WXWL 3INUH 1XR8B 4GG8A 4YE4L 3HE7B 1F90H 1NMBL 2YD6A 4UIKH 4FFZH 5I1DA 1FFRA 3BRGC 4XC3H 2DLHA 4S1SL 4X4XA 4R0LC 4X7TA 3WFCH 1RK1A 1EJOH 4G43A 3T2OA 1XCTA 3FQTA 1QFPA 2H2SC 2YD7A 1S8DB 4FQ2H 4HIIB 5K59E 2R1YB 3GHEH 4ZFOL 4GS7B 3OZ9L 3QWQB 2GJ6B 1I4FB 4JM2C 3RL1B 3BIBX 1U8IB 3EYSL 5I19H 3S4SB 1EUTA 1ND0A 4H25B 1N8ZB 4QHUA 1X3DA 1E4KA 4XP9L 4Y2DB 2AGJH 4DFHA 5BZDB 4LVNB 1GAFL 4FQXA 4OCSH 5T5NF 5A3ID 1CLYH 2BDNL 2B0SH 3DVNB 5GZNC 1IBGL 4PJFA 1RZIB 4KHXH 1EERB 1Z3GH 1U8PB 4N0UA 1YJDC 2P8LB 4UTBL 4E41B 3EJJX 5C09D 2J88H 2UV3A 4UDTB 1GXEA 2GT9A 3ARZA 4JY6B 4BFBD 3LS5H 4FQLL 3RWHB 3EO0A 4CJ0A 1A64A 4K7FA 5JIIA 3D3VD 5E94B 4IRSD 4LASH 1R3IL 5JHLL 3TH2T 1YDPB 2G5RA 1LD9B 1MCSA 4PJ7F 5TF1H 4JZJC 4HPOL 3P0GB 1P5VA 3ARQA 1J5OH 3R8QA 3R0NA 4JFPA 3A6OA 3DX6A 4UINH 1FNAA 4HS6B 4O02L 4QHNA 3H9SE 3MSPA 4U6YB 1U95B 3QNZA 3LEXB 1FL6A 2J4WH 3MFFB 4UTAL 2AI0L 4G8FB 1WVZA 3C6LB 1U36A 2D03H 5F8QC 1IGJB 1KEML 4APQC 1HKFA 5HYQA 3CVIL 2R1WB 2F5AL 3LMJL 1ZEAH 1FVDA 3FT2B 3P77A 3VXSB 4DGVL 2CK2A 2VR9A 1SJHA 4PB9L 3BKCL 3UDWC 3DIFB 4JN1H 1R0AH 1A7QH 4MQTB 4PJ5D 4M3KB 4JFHD 5D7SH 3CLFH 7CGTA 4F9PA 1UEYA 5B39G 5IBLC 5FYKL 4P48A 5JA8B 3KLDA 2EC9T 5CD3B 3FHQA 3UPAA 1KF9B 4GW1A 3GIVA 5BZDA 1VGKB 2AJUH 3I2CL 1MOEA 3REVB 2WWMD 4JPVH 4WCYL 5DD6B 1U91B 3KPRD 3OKOA 1U8OA 2PKDA 4UV4H 5F88A 3F7VA 4JRYA 5FECB 2C1PA 1KB9J 4Z8FH 1DQQA 1P4BH 1XF5B 1I9EA 4PP1C 1NDGA 1QRKA 3C9NA 4R0LB 3D1MC 1E6OH 5FDWA 4EI6B 1P4LB 4DW2H 1DBAL 3LKQA 3FMGH 1JRHI 1G6RH 3GKWL 1LO5A 1T7ZA 2PO6D 2R15A 4MDJB 4KU1A 2C1OA 2FATL 4O2FA 3V4PL 5CUSH 5C3TA 5C9JA 2VN4A 4UQ3A 3FB5B 3U0WH 1G7HB 2F58H 3C2AL 1T66C 1H3PL 5EU6E 1A2YB 3MRMA 4LSRL 4G42A 4HWBH 5IF0B 2IMMA 4Y1AD 4P5TC 3ME0A 3GHBH 4X99B 3VI4E 1WEJH 2NY4B 3PWNB 5BV7C 1JGEB 1JYWA 1X4YA 4M5ZL 3TM6A 2XPGA 1QNZL 1A6ZA 4KRLB 3SE8L 3SQBA 3BZ4B 1S9XB 5KAQG 1MFCL 1LDSA 2O5XL 4K94C 4XNXL 1U92B 5KSAA 4U0QB 2ADJA 4L8BB 4Y5YC 3GSWB 2ZCHH 1F3RB 1J0HA 3O6FB 5CP7B 1YN7A 5CZKA 1RULH 3GSUA 3ARDB 5FO8A 3I6LE 1KPVB 5KN5B 1QLFB 3CFKA 5T1KD 4WI2A 3L3DB 3WL9B 1MFNA 1AFVL 1IGML 4QYOA 5JPMA 1M7DB 1PYWB 2VXQL 1MH5B 1N5YL 3OF6A 3QRGH 4R96A 2YBRB 4PR5A 3LKSA 3QG6B 5A40E 4YDIL 3V4VH 1M05A 4MNQD 1A3QA 4OZ4A 1KJVB 3DX8B 5HDQL 4XGZB 1JPST 2YPKB 2H6PA 3VXUA 4ZS7L 3V95A 4Y2OA 3VD3A 5KANI 3HLAA 1X9QA 3MLVL 4F3FA 3V5HB 4MLSA 1T4KA 5KSBA 2DQIH 1S7TB 5LAXA 4XCYB 5D7JB 4RMTA 4P5MB 3PL6D 2F5BL 1NGWB 4BJLA 1T1YA 5C0GB 2DM7A 2DTSA 3QEHA 4JFED 5C0CA 2YD4A 4FTVB 3ZTNH 2XZAL 1ACYH 4L4TB 1VGEL 1J86A 5DRXB 3O3UN 5C1MB 3BIKA 4JFOB 5E8EB 2CMRH 5IVOA 4PLOB 1KLUB 1OF2B 4JR9H 1U8KA 4ZAKC 5BO1L 5DJCB 4QEGA 5DJ2A 5EOQH 2AP2A 4NRZB 5KJRL 4EIZC 1R3LA 1K4DB 3C6SB 1X6NA 2UWEA 3TCLB 3SPVB 4G6JH 1KC5L 4HIJB 4GXVH 4GAYB 1BM3L 4CDGC 1T7VA 3PE9A 5E99L 1ZVSB 3GMLA 4PY7A 1YEEH 5GS0D 4YEFA 1FL3B 3KYMA 1LQSR 4PGDA 5E8OA 1M7IA 3UZVB 4IOSD 3O6ML 5HI4C 1FCCA 2W1NA 3IETA 5F93C 2BFVH 5EU6B 1K4CA 4CAGA 4WW1B 1CDJA 4LCWE 3TPKA 3T77B 4P2OD 1EHLH 2WUBH 4PUBH 4X98A 3L7EB 2VQ1A 1KG0A 1RZKL 1ZANL 1FDLL 5CWSB 4HXBH 3LOWA 5HD8D 5KG9A 4MDIB 3V4UH 2HVJA 1J88A 2R0KH 5T3XL 5BV7B 3MO1A 4N68A 3FQWA 2B4CL 4PRAB 3X11A 5IHZB 3U4AA 3E8UL 4ALAL 3MRGB 4U31A 4ODTH 4P2QA 1EXUA 1FFOA 4JKWA 3T3MF 3VXOA 3LKPA 4U6TA 2DWEB 2JIXA 3KDMA 1HE7A 2GTZB 4M61A 4M6OL 5D96B 2OP4L 4R4FL 4AT6A 5GJSL 4MYWB 3ZYJA 1J1XH 3N06B 4TUOB 5BS0A 1Y0LB 4KK9D 4RFEA 1NANH 4U1JA 4PS4H 2EC9U 4JN2B 5CEXA 4WHTB 4DUXA 3I02B 1SJVA 4N0FB 4KDWA 4UIMA 4N9OB 3NMEA 1A1NB 1UENA 1FSKC 2GCYB 3H42L 1J0YA 1DBBL 3CLEL 3IYLW 3HZKB 3PGDA 3GBML 4ODWA 5FCSH 3VH8G 2VDRH 1DQJA 1KFAH 1YMMB 4HK3N 3BAEL 3GMNB 1OD7A 3UTPE 3U0PA 3SGDI 5D7KE 4G3YH 1G9NL 3NCBB 2X4UB 3ARBC 4GRWF 3MRCB 4WTXA 2HMID 2VB5A 1XCQB 1XIWD 3VDCA 1KCVL 4GRLA 2WSKA 4XNZC 1BMGA 4PP2B 5T33H 4DVRH 1JGVL 4JQXC 1ACZA 1A47A 1Y6NR 1J8KA 1KPUB 4ZOEA 1JNNL 1WSST 2ESVA 3J8F7 4KHTH 1CD1B 5ID0B 4KKLD 4PLJC 4K3JL 1N4XH 1N0XL 3VXTA 4DTGL 3MV8D 5I73C 4PJ9D 4Y4HD 1R3HA 4XNYL 5DJXB 2AK1L 2VZTA 4HKJA 4JREB 4P23A 4D9LL 2QKIB 4F58H 3FFCA 4PGBA 4FZEH 5JIHA 4RX4A 1U3HC 4AIOA 3QZWG 1E28A 4R7NB 4IHOB 3U48A 4GW5B 3PV6B 3P4MA 2BNUA 2IAMD 3JV4B 4WW2B 5EZLB 1LVEA 3RVUC 5JA9A 2A6DA 1JIBA 1D5BA 2A9MH 4MD4A 3WN5A 2ZUVA 3Q6GH 4C56D 25C8H 5IW3A 2WP3O 4QXWA 4YHOH 3SCMA 2VLRA 2O61B 4EVNA 1JWSB 4O9HL 4UB0L 5J11C 4PV8B 5B38B 3DYOA 3ZHDA 2VDNH 1P1ZA 4I5BB 4MA3B 3WFEL 3QUXC 3G5ZA 5JW4M 2CXKA 5HHQA 2A1WH 3KPLA 2XZCL 3SE4A 5F96H 3BD5A 2VLKD 5L2KA 3VFNB 1YQVH 2YUVA 3C60B 1NFDE 3FTGA 2P5EE 3UTTD 4X6DE 3FN9A 4EBQL 3TVMA 4NCC2 3UTOA 1MRDL 1PEZA 3RNQA 5DF0A 1A7OH 4KGLA 2ADFL 4XNQA 2OS7A 2G5BA 3KYOB 3O4LD 3QR2A 3OKLA 1IQDB 4S0TD 3X14B 12E8H 2IPTH 5FYJD 4UV7L 3W0WE 2X5PA 5I1LB 4LGSB 1QBAA 1WQVT 3BQUA 4Z7NF 1K5NB 1TNMA 1IAMA 1IEAB 1S7RA 5DFTA 1MVUA 3MJ8B 4HS8L 1KTDB 2NXZC 2P7TA 2XQBL 1IGTA 1UB5B 3OTTA 1B0RB 3RHWK 4H1LG 1CXEA 4MQSB 4NO3B 1JMZA 5ILTH 4OD3H 4QRRD 4FMKA 3SDXE 5GGRY 5GRZA 1T7WA 1SEBA 2OZ4H 3V5KB 2CGRH 3CU7A 5F7DA 5FCUH 5IEHB 1VFBA 1VFUA 3QQ9C 2A38A 4MAYA 2Y06H 3ARBB 2ZKHH 3LS4L 4G6ML 1HSAB 3FOMB 3CX2A 5DJAB 4XNZB 4X5LA 5BMFL 4HUVB 5MENE 2A6KB 4YDJB 1P7QD 5A2JH 1YEGL 4WUUA 4X6BA 3L7FA 4LSTH 1ED3A 4YBLB 1OGAE 5D7IA 4ONFH 3VGEA 4RSVA 1IKFL 4JY4A 1Z5LB 1RPQA 4NRYA 3QFJA 1DANT 2YS4A 3G04B 5ICXB 1ZTXL 3V0AC 3QIUA 2R69L 3EFDL 5K59F 3TPUA 3BFOA 2A83B 5FUCC 3KJ6H 4Y16A 3K8KA 1IC5L 1UYWL 4NOBA 3FZUD 1U3HB 3SGJC 1NAKL 1S78D 3S88L 3BGFB 5FUCE 4R9HA 1RZ7H 2ADIA 3ABZA 3TFKD 1EH9A 4Y88A 4HUMB 1S7VB 2PETA 4HLJA 5EA0H 3MMEB 4HCRL 3GK8L 2QL1A 1E4JA 4CMHC 4M6MH 5GSVB 4P49A 2M1KA 5SX4I 5EC1A 1JWMA 1XGRB 5J11B 4G6FB 2PXYA 3A6BL 3MGTB 3HZYB 3QXUA 4YQXH 4Y5XC 2OTWB 3D2UA 1NFDB 3QUXB 2F19L 3ES6B 2P5EB 3RWIB 4ZOBA 5TE6L 5DDHA 3IU4L 3R1GH 4P2YA 3WSQL 5TE4L 1L0XA 4BSVA 5MEOB 3BKYL 3UAJD 4I3RH 4RWHA 4OGAC 1WITA 3D3VE 1FAIL 4N8CL 1DE4A 5BVPH 3WHE0 2YPLE 4PBXA 4I3SH 1INEL 2VISA 2EH7H 4FQQB 3MUY1 3KXFA 3JWOH 3VD4A 2WP3T 3FB7B 5FM4A 1T04B 4XBPB 2Z4QA 1KBGH 4TPRH 3SE9H 1YYLL 1ZOXA 3SJVE 5HHNB 1UWXK 2X1WL 4MHHI 3VE0B 2I9TB 2ICWB 3ARFB 1EFXD 3GBNH 2X9XA 5I1IL 2Z8SA 2AVGA 4GMTL 5E7FA 5ISZD 2AK4D 1IGYB 4S1QL 7FABL 1YYMH 2YKLL 3F7PC 1BD2B 1DCLA 3W82A 1T20A 3QWOA 2A9NH 4M03A 3MLSL 3T0AA 1NGXA 4KDTC 2MQCA 3HFML 4XBEH 3IDYC 1W0WA 1NGZB 1T1XB 5E4EC 1H3TA 1UM6H 4XCFH 3QDGA 3O8XB 1YNKL 5I1AA 3VG0L 1W72L 4HGWB 4WHCA 2BOCB 1W0YT 5MENB 1BVLA 5ERWB 2F8XC 1E4WL 2LAAA 1A7RL 5DUBA 1P7KB 3FOLB 5IHUL 4MVBD 2EIDA 1DUZB 1B9ZA 5FUZH 4PJEE 1HI6B 4JFHE 3LKOB 3VJ6B 3MV7A 4ZPTB 1IAIH 3DETC 4TNWK 4BUHA 1LEKA 4YUEL 1R3JA 2YPVH 3KLSA 4NUGL 4PGJA 4Z7OF 3HZMB 5MEPB 5D1XD 4KPHL 3MNWA 2VABB 4L8CB 3MRQA 2APXA 3WXWH 4YE4H 4NQEE 3KPRE 1U8JB 1NMBH 1VB9A 4NN7C 3P4OA 3LV3A 3MLZL 4P2RA 3TV3L 3NTCL 4MB3A 4TNVK 3CC5A 1RIHL 4S1SH 4U1KB 4PJ7A 4HS3B 1HQRB 5L9DL 2PO6C 1WT5C 5I9QC 4DK6A 3W9EB 5E56A 3VDAA 3WFBL 2AJYL 1BIHA 1Y18B 4HUXA 4XXDB 3OZ9H 5BJTA 4NKIL 2QQLL 2C3XA 3T0ED 3VI4F 1F42A 4CBPA 1IT9L 3SHSA 4CMHB 2QSVA 3BGAA 1I3GL 5FHBL 1CQKA 1MPAL 4I4WA 1U3ZA 3EYSH 4QRUA 1X5XA 5F7WC 3VFUA 3T08A 3DVGA 4XP9H 4CKVX 3HE6D 3LEYL 3U30B 1GAFH 4ELMB 1I8LC 5C09B 1FBIL 3WE6A 2BDNH 4ZDHA 4OI9A 1IBGH 3MBEC 2XI9A 1KB5B 1EV2E 3MXWL 4UTBH 1RJZA 3EHBD 1EAPB 5F1NB 1ZHNB 3D3VB 4IRSB 2CO7B 3GMQB 4FQLH 4N8VG 5HPOA 2IALA 1PSKL 3EGSA 5HVFB 2X4OA 3SDCA 2Y1VA 3HCVB 2YRZA 2M26A 5DC0A 3OKMA 1R3IH 5B4MD 5JHLH 3I6KB 1ZA3B 5L7XL 3TO4A 1WZ1L 2ZCLH 2DQUL 5A16A 1WIPA 1JHTB 2VLMD 43CAB 4HPOH 5DK0B 1U9KA 5E2TL 3EJYC 3VXRA 1R5IB 2FL5A 3CU1A 4LCCC 2Z91A 1H3UA 1PGRB 4RAUA 4U6XB 3FO0L 5I6XB 1DANU 1GZPB 4O02H 1MHPL 4JANB 4MGXA 3UTZB 1XF2A 3SDAA 4UTAH 2AI0H 3BN9D 2GITA 4OZGB 4HKXA 3B5GA 5FYLE 2AV1A 1KEMH 3IDYB 4I13B 3SO3C 3CVIH 5E4EB 1T5XA 2F5AH 3FONA 3LMJH 2LU4A 5DYOA 1H15B 4PJ5B 4Q97A 5EO1A 1KNOA 2ZP0T 4KK6D 3OG6B 3TNMB 2XTJD 2CR6A 4PB9H 3BKCH 4ZNCD 4HC1L 4XC1L 2IC2A 5CJXA 1QFWL 4R97B 1NBZB 4NHUB 1M6OB 1MEXL 3KNBA 1OY3B 5FYKH 1JFQL 1NFIB 3FKUS 3RIFK 5I0ZA 2W0FB 3BP6A 2Y7QB 3KPRB 2ED8A 3IFOB 4QOKA 4XTRD 3I2CH 1BFOA 4MWFA 5SWSE 3OAYK 4A2MA 1Q1JL 4WCYH 3AVEA 4URTB 4FHBD 1DQDL 3F62A 4NN7B 4MA1C 2XN9A 3GSVB 5C08D 1JUFB 3B3IB 1WIOA 3RBGA 1UEMA 2FGWL 4WW2F 5JORB 1CFQB 4J6RL 1G1CA 2PO6B 1KCUL 1XR9B 4ZFZA 3OKKB 4Z6AT 3QHZL 3IDXL 1PEWA 1UKSA 5C0EB 1DBAH 3LQZB 4CNIB 1KJMB 3GKWH 3LN9A 3EDDA 2AXGB 4Y0GA 1C5DA 2EDRA 3HS0A 1A6TA 2FATH 3V4PH 3BD3A 2GFBA 3CXDL 4HAFA 1GGIL 1MRFH 3KPTA 3MOAL 5F1IA 2VJXA 4YNYA 2I07A 4Y4FC 4G7VL 4Y1AB 4HCRA 4XRCA 1I7ZA 5HD8C 1H3PH 5H37H 4NC2B 1KXVC 4HBCL 4LSRH 2VXSH 3GB7A 4HGKC 3B2UD 2D0FA 4LIQE 2PYEA 4IOIB 1CDIA 3VWKD 2BNRD 1R5WA 4UU9B 4KV5E 1HSBA 4V1DA 4M5ZH 5D1QD 2CJUL 3K1KC 4S2SB 2O5YL 3SE8H 2ILLA 3RTQD 4BK5A 2Z31A 4QCIA 3MRFA 1MFCH 2N56A 3AMLA 2O5XH 2NTFB 4XNXH 2APBA 5IQ9A 5T1KB 2YD2A 3OAZH 1T5WA 4AEFA 4TUJA 1SBSL 5KANG 4I18B 3IJYA 4KRPC 4JDZA 4X9BA 1MQKL 4MNQB 1IGMH 1R5VB 2GYSA 2VXQH 1N3NA 3QXWA 1V3JA 1N5YH 3MCLL 1W2KT 5B3JE 3BGMA 2IANA 3IXTB 4JFFE 4PJGE 5HDQH 4OFYD 4LPYA 2JB6A 2P8MA 3PWLA 1OP3K 4ZS7H 2HMIC 2EIEA 2BVTA 3RWJB 5E8DL 1TVBA 3D39A 3NCFB 1CCZA 3PL6B 1CGWA 4OAWB 3MLVH 2I25N 5DJDB 3EBAA 4JFEB 4U1SB 4DVBA 4NOFA 1AGBB 1U8HB 1KIPA 4RDQG 2F5BH 1W72A 1N26A 3STBA 1U0QA 1URLA 1HQ4B 4F7PA 1J8HD 3LSOA 4U1MA 5EO0A 4KKLC 2XZAH 5EO9A 4U4BA 1NCWL 1NDMA 1VGEH 4HPYL 4HLZG 1TETL 2FIRT 4LKCB 4Y4HC 5GGSB 1D5IL 4QRPD 3KS0H 3E2HB 4WU7A 3ILPB 4LBEB 1D5ZA 4G80A 1AJ7L 3WNLA 1DN0A 5IW6A 1MAKA 3OGCB 4MA7L 4JO2L 3UBXI 2XWBA 5KJRH 2JJTA 5HVHC 3I9GL 1KC5H 1BM3H 1C7SA 1RK0A 2FIKB 3UPCA 1N2RA 3VU2A 5DSCA 4NNPL 1ZK9A 1B0WA 2FSEA 2HRLA 5E99H 3CJJA 2QR0A 1HXMA 2P43B 5KOVC 1MLBA 4ZUTA 3KPSA 3O45A 3CFDB 3B9VA 4P2OB 1HYSD 2NW2B 1IARB 3O6MH 3S5LG 2WLYA 4G8IA 1WAAE 3RWEA 3OHXB 5DFVC 3CSYA 2WBJA 1NFDF 3FQXA 1YQ2A 3BPOC 1J12A 3SGKA 5F1KC 1VKXB 4X4ZA 4X6CE 5C6WH 1TQCC 3BE1L 5JHDD 1RZKH 3IGAA 1FDLH 5T5NG 3UJTL 2EXYD 5E6IC 1WFUA 3SY0B 1U93A 1F6FB 5T3XH 2VLKE 1ZSDA 2B4CH 1HILA 1ZHKB 3E8UH 3UTTE 5CZXC 4HLZH 4ALAH 1JNJA 4NQVA 4WFHE 5C0IA 5J6HA 5L88H 3RWDB 2DQHL 2XG5A 1T83A 1K8IB 1XR8A 1F4YL 9CGTA 4M6OH 3HE7A 2OP4H 2RIKA 3O4LE 4R4FH 5GJSH 4OUUB 5FYJE 1S7XB 3CAFA 3FRPG 1F4AA 3GSQB 1Z9MA 3Q48A 2VZSA 3QULB 3V6BR 3BZFB 3MUGB 4JHAL 1S8DA 3H42H 2FBJL 5JPNB 4HIIA 4O00A 2R1YA 1DBBH 3KYKL 3CLEH 4K8RL 1FGVL 1OPGL 2QQQA 4QRRE 5HI3D 2GJ6A 1F58L 1I4FA 3QQ3B 3GBMH 3MLXL 2P47B 3RL1A 3HC4L 3OKYA 5HI5D 4U1HB 1CU4L 1U8IA 1XIWB 2GSGB 4NKDA 3LKRB 2E7MA 3BAEH 3S4SA 2QSTA 4H25A 1N8ZA 1P4IL 4Y2DA 1G9NH 1I9IH 1OGTB 5HHVL 5C0AD 2NY3C 3DVNA 1KCVH 3WJJA 1V7NL 1ZLUH 4XX1G 1U8PA 4E41A 1JGVH 5DC4B 3RKDC 3MYZA 3N1QC 4HC1A 4UDTA 4JY6A 4HIXL 1H3VA 1JNNH 2K7PA 4CU6A 3RWHA 1T6VN 3MV8B 4PJ9B 1EAJA 4Y4HB 5E94A 3W9DB 1HWHB 1RV6X 4K3JH 1YDPA 1N0XH 5TE7L 1HKLL 3GIZL 3BW9B 1LD9A 2ZUYA 4DTGH 1PZUB 3HMWL 5DD5L 4RRPA 4L4VD 4XNYH 2AK1H 2BOBB 3ALPA 4D9LH 1SVZA 4DN4L 4X5WB 3MV9E 2IAMB 3NFNB 4KUZL 4RQQB 1KGCD 3Q5YA 4ZFGL 1HYRC 1WUNT 4HS6A 2I5YL 4U6YA 1U95A 4PRHD 4C56B 1AXSA 3MFFA 4G8FA 3C6LA 4D0DB 5IB3B 1IGJA 3ELAT 2R1WA 5J12C 2FJHA 4ELMF 3FT2A 4OD2B 4KKCD 3VXSA 4O9HH 4UB0H 1UZ6F 3NABL 3HG1D 1N0LA 2X4RB 1BQLL 1HINL 1NCAL 2B5IB 2VLKB 3DIFA 3WFEH 4P99A 1C12B 2V2WB 3IB4A 3UTTB 3TYGL 3UAJC 4EIGB 2XZCH 2ZSWB 4WEMB 3O9WC 3TP4A 2D31B 5CD3A 4TN9A 1P53A 5F3HB 2V17L 5IIEB 3O4OB 4OF0A 4EBQH 1VGKA 3O4LB 1MRDH 3C8HA 3QEQD 5E0QA 4NUJB 2C4FT 3REVA 1JZ6A 2ADFH 5DD6A 1U91A 1WFNA 2ATPB 3DUHA 5FECA 4UV7H 1QBML 1QSZA 1I7UA 1XF5A 3THML 3G9VA 5GRVK 4R0LA 2QADD 4LDEB 4EI6A 5AZEL 1P4LA 2OJEB 2AK4E 4OZGF 4QRRB 4NQCD 1BLNB 2XQBH 1HCVA 5DGQA 3WNKA 3WNMA 4MDJA 3QA3B 1I8MB 1X5ZA 3STLB 4K9EL 5DQ9B 4FG6D 2C4XA 1H0DB 1G7HA 1BPVA 4AMKL 4MVBC 4FABL 1A2YA 4O51B 1CIDA 1IRAY 5IF0A 4QHMA 1P7QB 2DB8A 4X99A 4G6MH 4EDWH 1OSPH 3PWNA 4M9OA 4W4NA 1YY9D 4QNPF 3ULVF 3MBXL 4XMKL 5BMFH 3KPMB 1U2HA 4YX2L 4XXCC 1MI5D 2Z35B 4OUOA 5C71A 2EDBA 3LB6C 4CVXB 3BZ4A 1BQHG 2Q3ZA 1S9XA 2MOVA 3ARSA 2G60L 3FO2B 5EFIB 1IKFH 4MSWB 5I74C 1C16B 1P69B 1U92A 3D0LB 4KVCL 1ZTXH 4L8BA 1VADB 4M8VA 2R69H 5DVNA 3GSWA 4PGCB 3EFDH 3O6FA 5CP7A 2J2ZA 3NFSL 3ARDA 5MP6L 3GSNL 3KLAB 5KN5A 4M4RA 1QLFA 3D6GA 1DDHB 3LAFA 3WL9A 3HB3C 5B8CC 1UYWH 4LU5L 1M7DA 1PYWA 2OQJB 2QQKL 3EZJB 1GOGA 3HAEG 1NAKH 1MH5A 3S88H 4P2QD 3T0EC 3ALWA 3BIAX 2AXFB 1YN6B 2YBRA 4PY8J 2YA2A 2JIXD 5JXAL 1OP5H 5JOEA 1YEKL 1KJVA 4XGZA 4HCRH 2YPKA 1OB1B 3T0EE 5GRXG 3GK8H 4YHML 2X70B 3S98A 4Z7QE 2NX5D 2FD6H 3ZKXB 5DA0B 1EDQA 1YMHB 1BVZA 3QEUB 3SDDD 3WUWB 3H7BB 2EYTB 3A6BH 2V5MA 3CK0H 3UYRL 1S7TA 1T0NA 3UDWA 4ISVB 1SQ2N 4XCYA 5D7JA 4EJ1C 4P5MA 3RUGE 3VGBA 4OGZA 2F19H 1NGWA 3LVEA 5C0GA 2A0LC 3ZKNC 1RD6A 4LEXL 4PJCE 3IU4H 1I3RB 3WSQH 4FTVA 4N1EA 2ZUSA 2H9GB 5TE4H 4L4TA 4YDLB 4YJZL 4ONGL 3K8LA 5DRXA 1EX0A 3BKYH 2DQTL 3TNNB 2X89A <