4W9ZA

Crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
MVPKADLTIKATGKQWYWSYAYPDNGKFEFDSLMAQDKQPRLLGVDNEMVVPVNKVIRVQVTGADVIHAFALPAFGVKIDAIPGRLNETWFKAAKTGMFYGQCSELCGKDHAFMPIAIRVVEDKEFASWVETAKKKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 2
publication title Crystal structure of the periplasmic domain of subunit II of cytochrome oxidase (CoxB) of Bradyrhizobium japonicum
rcsb
source organism Bradyrhizobium diazoefficiens
total genus 33
structure length 138
sequence length 138
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4w9zA00
3H4HA 3U25A 1WAEA 2IDFA 3NJHA 4HAKA 2UX7A 3RYMA 1B3IA 1ET5A 1T5KA 3PPSA 1NWOA 3N55A 3ZX1A 2IDSA 1AZBA 2P80A 2B3IA 2E86A 2XV3A 3CVCA 5PAZA 5A7EA 3NP4A 4YSRA 2PPEA 1V10A 3BVDB 3DIVA 3NP3A 3PCYA 4YVUA 3H56A 1N70A 3UACA 2PP8A 2QPDB 5B7MA 1MG2C 3FU7A 2BWIA 1L9QA 2TSBA 3ABGA 3WI9A 1AZNA 2CCWA 3IN0A 3T6WA 1HAUA 1JXDA 4YSSA 1PAZA 2UXGA 3OMNB 3MBWB 2QDVA 3ABMB 3GXUB 1RCYA 1NDTA 3DKHA 4YVNA 7PAZA 1BYPA 4A2DA 3S3DB 1PZBA 1OE2A 4KOCA 2YAHA 5AKRA 1SHXA 1IBZA 1L9OA 4F2FA 2DV6A 3FQYA 4YSQA 3JTBA 4HCGA 4Q8BA 3NJKA 3QJSB 4PAZA 2XV2A 3AG3B 1KBVA 2P80D 1WA1X 1PNCA 1J9TA 4A2EA 1HAWA 1SNRA 2BP0A 4KNTA 1BQKA 2XX1A 5I26A 5I6PA 1SDDB 1XB6A 3ERXA 4ZK8A 2GB2A 5PCYA 1KDJA 2FTAA 1W6LA 1OV8A 2VW4A 2XVBA 3EHBB 4HIPA 2YAMA 3X1EA 3TA4D 4QKTA 5I28A 4G7QB 1GS8A 1V54B 1A4CA 4JKNA 3EF4A 4DP5X 1ZV2A 1W6WA 1AQ8A 2GC4C 2XV0A 2IWFA 5IY5B 1CYXA 1IKOP 1KCBA 2BO0A 1EZLA 1ZDSA 2XLLA 3AG2B 1SFHA 2Q9OA 4KOBA 1AZUA 3T9WA 2HLEB 2N0MA 3PLYA 3X1NA 2EIJB 3NJJA 1ILUA 1IBYA 2ZONA 3FSZA 3V9CA 4E9TA 2H47C 2A3TA 2VN3A 3FSAA 3X1FA 2AFNA 1SDDA 2X87A 1BXVA 4NB7A 5I6OA 1OE1A 1MZYA 4HCFA 1IC0A 3N2JA 3EH4B 4A68A 3S3BB 2GC7C 2J5WA 1MDAA 1BAWA 1E5YA 3S3CB 4HZ1A 3CDZA 4DPAX 1YLBB 2DY2A 2QT6A 1VLXA 1DZ0A 1CYWA 3X1BA 2XUWA 1URIA 1J9QA 4A67A 3EH5B 5TK4A 1A3ZA 1PLAA 3PAUA 3FQ2A 3FPYA 1AS6A 1BXUA 1RZPA 1AIZA 4JHVA 5FC9A 3ASOB 4YSCA 1WS7A 3BQVA 3HEIB 4DPBX 2XU9A 2IDUA 2WSDA 4KNUA 2EILB 1KYAA 4Q89A 1ET8A 6PAZA 2BZ7A 4DP2X 4BDVB 4AKQA 3NSDA 2HZHA 1IUZA 3OD3A 4F2EA 1SFDA 2WO2B 2PCFA 3AY2A 3H4FA 4BWWA 4DP4X 5I5MA 2QDWA 3ABKB 2VM4A 3S8FB 2IH8A 5AZUA 1KBWA 2YAPA 4AKPA 3NJFA 1ADWA 1J5DA 2XXGA 4KO7A 1QHQA 5B1JC 1UATA 2BZCA 1JZEA 4E9WA 2DWTA 3NT0A 5B3SB 1NZRA 3T6ZA 1OCRB 2CALA 1SJMA 4A66A 4M4RB 2LLNA 1ZPUA 3FSVA 4A2FA 1CURA 2PP9A 1PLBA 1JERA 1ZIBA 2J57A 2R7EB 4AI7A 2QPEB 1W8EA 2PCYA 3NYKA 3IN2A 2J55A 4GP5B 3V9EA 5AFAA 2PPFA 4HCIA 1A4BA 2YAOA 1BQ5A 4UANA 2W88A 4UF7C 4FA7B 3AW5A 5I6NA 3UAAA 5D4JA 4BDVA 3MX0B 1MG3C 1M9WA 1JVLA 1ZDQA 2AVFA 4P5RA 2GHZA 1WA2X 1BXAA 3UADA 4E9RA 3SBPA 2DWSA 1NICA 1RKRA 3OMAB 5F7BA 3WNJA 1J5CA 1E67A 2HRHA 1OF0A 2ZOOA 2YAEA 3FPXA 1L9TA 2H3XC 1I53A 1A8ZA 3ABLB 1DYZA 3SQRA 3TU6A 8PAZA 2GIMA 2HXAA 2PPDA 2FQFA 3FSWA 4L0PB 2R7EA 3FYIB 5F7AA 3WG7B 4KO5A 1PMYA 3QJUB 4DP1X 2HRGA 3ASNB 2IDTA 1WS8A 1GS6X 2DYSB 4UAHA 2FQDA 1JXFA 1XB8A 4PCYA 2PP7A 2AANA 4G72B 4E9XA 4F7KA 2B08A 4TXVB 4CSZA 2BW5A 3HB3B 3IBOA 4AKOA 2BWDA 1X9UA 4KO9A 4WTQA 2MRYA 4NAJA 5I6KA 3ZBMA 3NJLA 2I85A 2OCCB 3NJGA 1ASQA 1GYCA 1M57B 4YSUA 1HFUA 1BYOA 1SF3A 2NRDA 1ETJA 4YSTA 1JZFA 4AZUA 1ZIAA 2FT8A 4AX3A 2UXFA 1PZAA 3WKPA 1L9RA 5B1JA 2TSAA 4GY4A 4YSAA 2VW6A 2I7OA 2X88A 1ASOA 1AZRA 1AS8A 3IE9A 2RACA 2CAKA 1NIAA 5D4IA 3CG8A 3FS9A 4EF3A 1N68A 4JHUA 2H5UA 2VM3A 1JZIA 4N8UA 3KW7A 2BW4A 1A65A 2YXVA 1RZQA 1FFTB 2MTAA 4DP8X 3QJRB 3DTUB 3NSCA 1JXGA 1A4AA 1GW0A 5B7EA 1KV7A 3FQ1A 5LDUA 1PLCA 4GP8B 1QLEB 4BWTA 4G7SB 3GYRA 2YAQA 5B1AB 4E9VA 2OJ1A 2EINB 3QPKA 6PCYA 3UGEA 2HX7A 4G71B 4GYBA 1SHWA 1OOWA 2CJ3A 4YL4A 4DP0X 1J9SA 2BHFA 9PCYA 2XWZA 1AACA 1NIFA 3ZDWA 1CUOA 2IDQA 4N4YB 4KO6A 3OM3B 3WKQA 2AZAA 2PPAA 3FU7B 2EIMB 5E9NA 4KNSA 1AG6A 3OMIB 4NERA 3GDCA 3PAVA 4YSOA 5ANHA 4YSDA 3QJVB 3FU9A 1E5ZA 1QNIA 2HX8A 4BXVA 3CVDA 1KCWA 1GS7A 1OCOB 4BXSV 2FT7A 4MFHA 1BQRA 2ZWNA 1AANA 1XB3A 3NSYA 2UXTA 3CVBA 4G70B 3X2QB 1NPJA 3AZUA 4K9JA 4DPCX 2IWKA 1R1CA 2YAFA 1GY2A 2VMJA 3PXLA 2UX6A 2BP0B 1JZJA 4A2HA 1F56A 4W9ZA 3NSFA 4DP9X 5I6LA 1MZZA 1PY0A 1NIDA 2XXFA 2FWLB 1AG0A 3X1GA 2FQEA 2FQGA 2VSKB 3D12B 3FU8A 3CZUB 2UXVA 2PLTA 3JT2A 1AZCA 2GSMB 3QQXA 2Y1AA 4YSEA 1TU2A 5D4HA 3PAZA 3ZIYA 3EH3B 3TASA 5TK2A 1E65A 7PCYA 1FA4A 2FNWA 4G7RB 3FYEB 2DYRB 1OCZB 2W8CA 1E30A 2AZUA 3G5WA 2YARA 1OCCB 1NIBA 5B1KA 3T6VA 1NPNA 2HX9A 1JOIA 3IEAA 3TBCA 2CUAA 2CBPA 4WKXA 2OV0A 4E9YA 2FT6A 1ASPA 1ET7A 5EHFA 4W1TA 1PNDA 1JZHA 3T71A 1PZCA 1XMEB 1NTDA 3SBRA 3UAEA 2GBAA 3NJMA 4A2GA 1KDIA 3CDZB 2BP8B 3QJQB 4HALA 2IAAC 3C75A 3WIAA 1ILSA 1JZGA 4E9SA 1J9RA 3TBBA 3T6XA 2FJSA 4GXFA 4RH4A 5B1BB 3SBQA 1ID2A 1NWPA 3L45A 5I5IA 2WO3B 3NJIA 4ENZA 5I6MA 1PF3A 2JKWA 3S8GB 1EHKB 2IWEA 4X4KA 1TKWA 2I7SA 3NJNA 4GP4B 2VW7A 3WNIA 1NINA 2JFCA 1OE3A 4HHGA 4DP7X 1PCSA 1NIEA 1AAJA 2EIKB 1CC3A 1M56B 1V55B 2XX0A 2BP8A 2YXWA 1AOZA 1BEXA 1AS7A 1WA0X 1L9SA 3KW8A 2GI0A 2J56A 2PPCA 2IH9A 4BWUA 2VSMB 2ZXWB 4M3HA 1KGYE 1L9PA 4CSPA 1GSKA 4DP6X 4E9QA 1X9RA 3OQRA 2XYBA 2YQBA 4YSPA 5B7FA 2Q5BA 1AR1B 3AG4B 3FT0A 2Y69B 3AG1B 1JVOA 4FAAB 2JXMA 4BK5C 5I5JA 1FWXA 1GY1A 3UABA 1TEFA 3QJTB 1TEGA 4P5SA 4QLWA 1SF5A 1GR7A 4HHWA
chains in the Genus database with same CATH superfamily
1ZS2A 1DQQB 4OUOA 2BDNH 1EAPA 1P0SE 3O3EB 4HXBH 1HNYA 2UX7A 3QZNA 3DJ9A 5HI4D 1ET5A 3GHPA 1E5CA 2IOMA 3VFNA 2IOOA 1FLRL 3ALWA 3MJ6A 4YSRA 5LLIC 3BI9X 2YFOA 2ZUUA 4JPVL 1VHPA 1KV3A 4HLJA 4KZDH 3BYTA 5K39A 4AENB 4AIEA 1AI1L 2VWEC 4OCXH 3BRDA 1NBZB 5IQ9B 1ED3B 4PMEA 2ZX5A 3WTUA 4OBSA 2FEEL 3EYSL 4LFHD 3KLQA 1HJCA 4TUJA 1HZLA 3FOLA 2HUHA 3UP6A 4JJ5A 2PXYC 3HNVH 2NY7H 3T5WA 3LSOA 3ARDA 3MBWB 4X9YA 4AMXA 1XF2B 1FAIH 4OF8A 2WVSA 2EADA 3B9KB 1XIWA 3PWJA 3JV6A 1NGXA 5ESVB 4YXKL 3MRFB 3UMTA 1EUTA 2VXUL 2WCSA 3FFDB 3QJSB 3WGVB 3LCYA 3AG3B 4KTGA 3LB6C 2E5EA 3C5ZC 3GBNL 4NFDA 5I0ZA 3CDFA 4TUOB 3ZMEA 1U8IB 1CDBA 4DQOH 1WEJH 3BPCB 3SZ6A 5IMKB 4KZ0A 3KZ8A 3I85A 1CE1L 2VDNB 4IIQC 5DS8B 4CMMA 5FB8A 4U33A 2YAMA 2E7LC 5SX5K 4ICXA 1V54B 2HT4C 4ZJ9A 3CMOL 2ESVD 4APQB 1TZAA 1OF2A 2Y0SA 3D39E 3RGVA 1P1ZA 4N0YL 5C0ND 4LU5H 1WBXB 5H35B 5LG1A 3ABZA 5BS0D 3G9VA 4ALAH 2J71A 4PSRA 5C8JA 3RPKA 1MFEL 5I1DB 1TIUA 1ZDSA 1T2QH 4L1SA 2BVOA 4JFED 4L4TB 1I1YB 4QXGL 4MQSB 3W56A 2N0MA 5J89A 5AKTA 2MCMA 1AKJD 3FSZA 2KLTA 4E9TA 4PGBA 4R7NA 4F1SA 1HK6A 3ZKMC 2PO6B 2BVPA 4PR5B 5AEAA 4HKXB 4JZJB 5EN3A 2Q76B 4Z7VB 3MPCA 4UT6A 4WHDA 5GZNC 2YGPA 1MFDH 4G7VH 1BVLB 4GG6E 3EH4B 4B3VA 4Z7IA 1R0AL 1MHEB 3FCBA 4PRID 4O5LL 3CK0L 2GC7C 4WI0B 2K9FB 4U05A 1LK2A 5B21A 1HOCB 4OJAA 1UXSB 4QRQA 1ZHLB 3LH8A 1B0WA 2NLJB 3GSOA 3RZCB 3ZYOA 5D5MF 2V9UA 1ZY9A 4P9ML 5K1NA 3Q5TA 1RJLA 2ZXAA 4AGQA 5DZJA 5DF0A 2VDKB 5E8OB 4JM4H 5CLZA 4X8JB 3G9AB 1P7BA 3DXAB 3O3BA 5INDA 3GO1L 3LN9A 4RWHA 6PAZA 2EUZA 2EDYA 4JZOA 3SDCD 3VO0A 3IETA 4GQZA 4IU3B 4QRUB 3T8VA 4OIIL 3W3BA 2VM4A 4HOZA 1QFWL 2AJZA 2AHIA 5B39A 1N7MH 2ZF8A 2XXGA 2J1WA 2Q10A 4PFEA 2X4NA 4ZUVA 4GO9A 3CZEA 3KWTA 3NVQA 4Y1AD 5E51A 4Q6IC 3EOTL 1T21A 4ONGH 5CP7B 2CDEA 2CKBA 1J11A 3X13A 4X0KB 5K59E 3O2DL 2OP4H 1JYNA 2IANE 1DEDA 3TYFB 2WXFA 4LP8A 3V6FB 3HAEB 5L4JA 2PCYA 5KEZA 4YFLI 4J1UA 5ACLA 1JHLH 2ADIA 1DVFA 2AV7A 1O9VA 2YAOA 4UANA 1FZKB 1LJMA 5H2BB 5LN4A 5I6NA 5GGRA 1I1FB 3MXVL 2ED6A 1JVLA 5B8CC 4P5RA 5BS0A 2ALAA 4J3OC 3S96B 3V0AC 3P4OA 2JKIS 1QNZL 2R83A 2A5UA 1B2WL 1KCKA 5FYLL 4M1DH 1ZLUH 4PS7A 1LQSR 4CNIB 2EEFA 2H3XC 3DK0A 2AMGA 4HIJB 5SWSA 3U7YL 1B4RA 5FUCC 1OP9A 3OXRA 3RWEB 5DZAA 1Z9MA 3BQUC 2AXJA 3PY9A 4KO5A 3M7FB 1W8OA 4NO0D 3O41A 4LGSB 1PMYA 1GC1C 3BAYA 4PRIA 2G3XA 4X7EC 1ACYL 3F7RA 2J8UA 4EUPA 2GITA 2Z4TA 1T1ZB 1R4XA 4CJ1A 5DD1H 3DSFL 3CN1A 2AANA 3SBWA 1MELA 3VGDA 1MRCL 5L2JA 3QNFA 2WOYA 1YEGH 3MNVB 3BZDA 4P5TC 1IM3A 1K8DB 1EBAA 3VXUD 4KO9A 4ONOA 3DX8A 3WMPA 3WIHA 4EXPX 4GAFB 3GMPA 2BZDA 3TPUB 4HCRL 1YNKL 5I30L 5C71A 3MRRB 1X44A 4YEFA 1NMCC 5ADOL 1TKWB 3KM1A 5IROC 3IGUA 4P2QD 5MI0B 3HZVA 5SWZE 3JUYA 3U46B 2M2DA 2FZ3B 4X6FB 4LP4A 3A67L 2VZVA 3D87B 4MD4B 3RGBA 2NW2B 3UJJL 4JM2A 2FL5B 2QADC 3UFIA 3CHQA 3VM5A 1A7PH 4FXGB 3PGFL 5AKVA 4PJ9D 2HFGL 3VM7A 1LDPL 3L9EA 3MLTA 5E08L 5H94A 1A7NL 2DJMA 1F8TL 3PV6A 1K8IA 1F18A 1QPKA 4G8GB 1N68A 3JWDH 4NZUH 1W91A 3CFCL 5FM5O 4OCMC 5GIRB 1ZK5A 4KI1A 4U6TA 2QVKA 4GEIA 3WUWA 4DEPC 5ALCH 2MTAA 1GA2A 1S3KL 4L4TE 3KDMB 4L3CB 3EDKA 4N6RB 4DZ8A 3GB7A 3X11B 2C9AA 1KV7A 2IXQB 3FQ1A 3MCLH 1IJ9A 4H5SA 5I2IB 5B1AB 3UAJC 1FH5H 4Z7VE 1AQKH 4XCFH 3RX5A 1H3PL 3UGEA 3FO1B 1CIUA 3QIBB 5DD0L 3CFKA 3NEEA 1OAJA 4XBEL 3H7BA 4NRYB 1CD9B 1MFVA 2ICWB 4RDBA 2UYLB 3OL2A 5IEHA 1NIFA 5I18L 1UCBL 3Q1EA 5C0GB 3B5HA 3PNWA 5EOTA 3MR9A 4ABUA 3VX0A 4QHNB 4UILH 1HQ4A 1E4HA 5F3FA 2PR4H 4WHYG 3BP6B 3IKCA 2ARJQ 3C9NB 2R2BA 3G5XA 1DQJB 4V1DD 5F44A 3T4AA 1OCWL 3FONB 3GZOA 4G5ZH 3BUYA 4NO0A 1ZGLP 3DHJA 4IK7A 1H6TA 1ZVNA 4HFWB 4A39A 2J6EH 1W0WB 2YHGA 1H3TA 1MAKA 3RWDB 2X6BA 3S4SB 3AMKA 4YWGL 3UC0L 4AYEC 1LP9A 1UZGA 2IPUK 4J6IA 1QFUL 4NHCL 4F8TA 4Y19D 3VXUA 1THCA 3UZQA 4WO4B 2UZYA 1PFCA 3U79A 4A2HA 3ULVH 1HJBC 3BESR 1F56A 5FW7A 4N0CC 3EDFA 5I6LA 4NQXA 5FHAH 5FAAA 5HPMB 4ABVA 4NUJB 2CJUH 4FFVD 4JFVA 1HE7A 2X42A 4OD3H 2C9SA 4BH7A 5JHBA 3BAEH 5DJXA 4GPVA 3OKEB 5DJCA 1ERNA 1N2RA 1T4WA 5DJZA 1DN0B 3HJ0A 4K8RC 3CC5A 4ZFQA 1QSFB 3DSNA 4KTDH 4N2FA 5IMOB 4NAMA 2X4PA 1U91B 4I8DA 2F68X 4OFDA 2G60L 1E65A 4M6NL 1FDLH 2C9XA 2FNWA 4QJ5B 1U8LA 1QFWM 3DDGA 2QSCL 3GIZL 3QWNA 4MDJB 2MKLC 1E30A 3MAWA 1F97A 4ABWA 1PYWB 1AGEA 2CUIA 1SRDA 2VYRE 4JFOA 1A22B 1CWVA 1WHOA 1F13A 3ULVF 1PJ9A 4KQ4L 2WLIB 1OGTB 1KT2A 3K7UA 5F7YC 1S9KC 3WENA 2WVVA 3PFUA 4F15B 5EIIA 3CIAA 4HYTB 5J3HD 2ZCKL 3ARFC 3FO0H 3MV8A 4KFMA 3ZR6A 4KKZA 5B3JE 2Y7QA 3GSNB 2A1WL 3K8LA 1HHGA 1RZ8B 4IKIA 1QRNE 2NNXA 4RETB 1CXFA 3SE9H 5K9OB 3SSGA 4UIKL 1BZ9A 4ENED 1MHCA 4X7FC 3BUQA 1SMOA 3BPOC 5DHXB 3SGKC 3TT3H 3BAJA 4NQDD 4K2UL 5IUCA 4GAGH 4PG9B 3TBBA 2WB7A 5C9KA 3BSZH 5C0EA 1E3XA 1Q38A 4N6QA 3NJIA 4NUGL 5DUBB 4H44C 1GXEA 1GSMA 2R29L 1E8XA 4Y9FA 3E1ZA 3MLSH 2P42B 5BQ7A 5EFIB 2I7SA 3BUPA 2FK9A 1PBYA 4JANB 1EEZB 4X83A 4TQHA 2C3XA 3CXDL 1WF5A 3FMGL 1T2XA 4ZOAA 2FBJH 2IPKA 2EIKB 3LD8B 4RZCB 2IAMB 3VD1A 3D9AH 1WA0X 2X9ZA 1ES0B 3L3IA 4BQ6A 1HXYB 4ZAKA 4BFGA 1HHJB 4FNUA 1GOHA 2PTTA 4M93C 4F9LA 1GSKA 4IKJA 1T1WA 3EFOA 3TNMA 4CVZB 4HT1H 3CVIL 4S1QL 3IU4H 3WD5H 5EIQA 3BISA 1JVOA 5F9JA 4BK5C 2EEAA 3GRWH 4UT9L 4U1JB 1A4KA 2HSIA 3PWPD 2QJDA 5G4OA 5DZNA 5DJYA 3VGEA 2C1OB 1WPCA 4H1LG 1MJ8H 2V5TA 1WAEA 1M7DB 3LEYL 3F65A 1LEGB 4IBLT 4OVVA 4G82A 3FN9A 4M48L 1D9KD 4OF0A 5KSBA 4E42A 1UZ6F 5I71C 5EC1B 1LE5A 2Y24A 3LZPA 3QORC 1KYUA 4PJDF 5AYUL 2A6IB 3UACA 3HAEG 1KIQA 2E4FA 3INUL 3TFKD 1RUPH 1ZVHA 1MG2C 4JDVB 4WSGA 4FQQA 2TSBA 1C1EL 2GEQA 1XHHA 4I4WB 3U4BL 1OAXL 5D1XB 3NA4A 3T6WA 4BKTC 1AXSB 3PQYB 1PKQB 4UM9B 3CPLB 2YPLD 3EGDA 5HHVL 4M7LT 4NQED 3SY0A 3DMMC 3H3KA 3NIDB 4NM4H 4L3AA 1ANUA 3DKHA 5KBMA 3RNQA 4KAQH 3V6OA 3N06B 3SDYL 2V17H 4BH8A 1CDHA 5D96C 1MEXH 5CIPB 3OKDA 4NQDA 1S7TA 3IXTB 1FIGL 2DV6A 3TBYB 3WFEH 1D5BA 1I7UB 1Z9NA 5HYEA 3WL9B 1T5XA 3K72A 1H3VA 3U48A 1J9TA 4YDIL 4LOUC 2NY6B 5I1HH 4TL5A 5JIMA 3PPEA 3ERXA 4LIQH 4U7MA 4PVNA 2OMWA 2UY6A 5IFJA 3BSHA 3OHXC 2OYPA 1A4CA 3DUUB 5CUSH 4AYFB 4DP5X 3RL1A 4UV4H 1LO0L 5KG9A 1AE6H 1Q72L 4J7RA 2VR9A 3F6IA 4XO3A 3TYGL 3K81A 3WE1A 5ICYA 1WBZA 5L88L 3SDAD 2Y5TA 5CJ5A 3BC9A 4PJ7B 5DWUL 4L48A 4MNQA 2UUDK 1QSFE 5MEQA 5EF3A 1DTUA 1WRFA 3MBEC 4G1MB 2W0FA 4EVNA 2HG5A 1KCVL 1PVHA 4HD5A 3CZFB 4BFEA 1MY5A 3LRSA 4PWJA 2AFNA 4OKVB 1KTJA 1KTLA 2QVTA 3UBHA 1OE1A 3FXIC 3Q6GL 4G80A 1ZE3C 1I3RA 2BMKA 2FX8L 3QJFA 1IX2A 5T1KD 1TVHA 4IHOA 2PETA 4CC4C 1G1OA 2WXQA 2Z91B 4HSQA 4P46C 4S1DC 5IB2B 3LXCA 2B1AH 1MNUL 5I75C 2FSEB 4HZ1A 2UZXA 3CDZA 3NACL 5CJBA 1VB9A 5FHBH 4DPAX 1VLXA 1DZ0A 3HC4L 1WWAX 2VXTL 1HWGB 2NY0C 1RIHH 5FF6B 4XP9H 4QRRD 4P23D 5TF1H 3RDTC 1GGYA 4XP4L 5DC0A 4KMLB 4L05A 4JHVA 3VXTB 5IVZB 3V5KA 1CFVL 4ZXBA 3LNGA 3IGAA 4HC1H 4JPKL 3R4DA 2WSDA 3DURA 4DKTA 4MAYD 2EH8H 4K3DH 4Q89A 1U92B 4UUJA 2JH2A 3G6JF 3Q06A 1G0XA 4YNYB 2H1PH 4GAAA 4X7SH 4X9BA 2D3VA 1HDMB 2ZPKL 4QCIA 4Y88A 2BIIA 3HMXH 3WHXB 2AMUA 1J5HA 1I1AB 3HI1B 5AZUA 2DQHL 4X5WA 2UWEB 3ULUE 4GSXA 1SN2A 4A63A 3L3KB 5C09B 5E5MA 2V2XB 3MLWL 4LL9A 1UATA 3OWRA 3BWAA 4EDXA 2OI9C 5D70H 5MENA 3J8F7 3MNZA 3VI3B 1QBMH 3M8OL 5EZIL 3MACL 2YBRA 3ZKSD 1U8KB 3VDAA 2CSPA 5GGUB 1UEMA 4OAWB 4NCC1 4A2FA 4HUWB 1NCDL 2DQJL 4Y0GA 3WSQL 2N7SA 3MUGB 4HKBA 4XE0A 1S9XA 4QYOB 5DLMH 1E0OB 4WK4B 3BUIA 5GHWL 4L3FA 4YK4C 1A6WH 2QPFA 3FB7A 1KIRB 1OM9A 3OKLA 5FYKE 3MX0B 3MZGB 3CDCA 4GFTB 4B53A 4WWKB 1JK8A 1G9NL 1ZDQA 3IF1B 5IBTL 3I6LD 3SDAA 4HBCL 4L8SB 2VO5A 4I9WD 1F3DH 4E9RA 5DQ9B 4DIXA 3Q8AA 3VH8A 1RIVL 4LASL 4XOCA 1F3DJ 4WQOA 3VNYA 3KPNB 1J5CA 4IOSD 3HMWH 4ZTOH 2K45A 4BFOA 3NSJA 1I85C 2CA4A 2X70A 1DYZA 2ADJB 1VKXA 3OV6A 1PZSA 2AI0L 4YUEL 4P5KB 2GCYA 3QFDB 3NFPB 4G8EA 3V4VB 5HJGA 3IRZA 5CHNA 3WG7B 1NFDA 2XWBB 2A4CA 1FRGL 3POCA 5D1XE 3BIAX 1O6SA 3PQYE 1PKQE 4OBRA 4AIZA 4G6KH 4JO2H 1GYWA 3VGBA 4PCYA 4TSAH 5F1KC 4P2YA 1NOFA 4RMTA 5DZOA 1LNUB 4K3JH 3WFCL 2G75A 2PWFA 1KYOJ 4P23A 5EV7A 5FOJA 3VXPA 1U42A 5LDSA 2WBKA 3QXAB 3RX9A 2ZXGA 4UQ3A 3NJLA 2XN9B 4BJLA 1P5VA 2NUPB 3FFOA 3LXBA 3NJGA 4ZYKB 2WXOA 1RPKA 2WYHA 3K2IA 3U0WL 3HC3H 1F0LA 1Y6NR 2CCLA 1NQBA 3QHFL 5DD5H 3GPSA 1O9ZA 4JY4B 4GNKB 4H8QA 3VWKA 2P46B 1PKOA 5C2BL 1NPUA 3O4LA 4YSAA 1YEJH 3UCQA 1YECL 3AREB 4AVIA 4FX5A 4IRSB 5F6IB 3ORJA 2IBBA 5AW5B 3G6AB 4WW2B 5GRJH 4DUVA 3CFIC 5MHSD 2VDNH 1X5ZA 2HJKB 3ZUCA 4XPAL 1ZCRA 5CGYC 4PJ7E 1I8AA 3L7FB 1MJJB 3H9HA 1EZUA 1MCOH 2DWYA 2J20A 4PY8J 5CZKA 1AHWA 4JPIA 3EXLA 1HEHC 2WPGA 2IGFH 4QTIL 5CZRA 2W07A 3NK4A 4UCFA 5E2TH 3ARBA 1HESA 2ADYA 1FHGA 1N6UA 5EN2B 3NDZE 3HNSH 4U7KA 4U1SA 3QNZB 2EXSA 2HT2C 3DIFA 1HL8A 3RLSA 2R4SH 1G9HA 1KJ2B 3OJMB 4DKFH 2X4TA 1MCJA 3BAXA 3OZKA 4Z7OB 3PL6D 5T3ZH 1EFXB 2I26N 4Z7NE 1IM9D 5LQBH 1A9BB 3FU7B 3VXSD 3KBEA 3Q0HA 3D48R 4JG9A 3VYPA 1R3KA 1WITA 1FGNH 2XFXB 2C9UA 2XVKA 5DQDH 4N85A 1KBGH 4HS8H 1Q0YH 4B9KC 3O3DB 4KDWA 4AG4L 1QNIA 2VDOL 1JVKA 4XXDA 5J12B 1DFBL 3THMH 2YJLA 2FT7A 1UD2A 1JPFB 3EH2A 1T66C 2LAGB 4PJAA 1SLVA 4B5ZA 1IKNA 1YN7A 1WFJA 3LKNA 1T6BX 3N1PC 3HR5B 4WNSA 5E1QA 3L3GB 3D3VD 1V7NL 1SLWA 2VDKH 3ELQA 3WJLA 3NGBC 4UNIA 4TN9A 2EC8A 4Z0XB 2N56A 3E1F1 5HI4C 1JNHB 5CJXC 3HKFA 3AAZA 5IF0B 5CEYA 1EHLL 2OJEB 3DPDA 4Z7VF 2H3NA 4UDTA 1YC8A 2W91A 3P2TA 4FNLL 4FXTA 4OV6F 1ZA3A 5D9SA 2WM0A 2Z35B 3HLAB 2AQRA 2C8NA 5E6IB 1LO4L 1OGSA 1RHHA 5IK3B 5AOLA 1INEH 3WS6A 4ZS7L 3UTSD 1DUYB 3VTAA 3X1GA 2ZYRA 2YD3A 5LBSH 4XRCA 4EMZA 1A6VH 5D93B 1WP6A 3GRBA 1LO2H 5F0MB 1DQIA 1AY1L 5D71H 2EE6A 3CSBA 5C0IB 5F72S 4K71B 3V5HB 4BSWA 2COQA 1AIFB 5HYSB 2FX9H 3NK3A 3PAZA 2YD6A 4XXCC 4DN4L 1L5GA 3T0EE 5HXMA 2BFVL 4G7RB 4HV8A 4XAKD 2EECA 3G5ZB 3OMZA 3IDXL 3DTXA 3O6LL 3EDDA 3T4YB 5CU5A 3VA2C 4M03A 2X3AA 4H8UA 1E4XI 1WGOA 3WEXB 3ISWA 5D5MA 1SXNA 3WEAA 2AEIT 2C4XA 1EO5A 1TEYA 2GK0B 1M71A 3DHUA 5D55A 1XF1A 4NKMB 3FKUS 1IBBA 4OT1L 4ELKA 3R1GH 4NI6A 1E5UI 1HZHH 1MAMH 2QKIA 4NNXA 5KN5B 2GUYA 5JMRA 1W72B 3ESNA 4UMSA 1NBVL 5BRZB 4MA3A 1HQRB 2DEXX 4QRPA 1U8HA 1A21A 1HC1A 2B8OT 5KOVC 5EO0A 3UYPA 1EXUB 2OMZA 3KVQA 5C0NC 1IM9A 4W9FC 1JZGA 2JV6A 4JFFD 3T8XA 35C8L 2FSDA 4D9RE 2EABA 2V8MA 3CQQA 3L4XA 3OX8B 3PAYA 4JAMB 5D7SL 2VKXA 3LPPA 4GXFA 5B1BB 2IDCA 4NIYE 3HE7A 4D0BA 5C0AD 2M26A 4KTEL 4LVNB 4JQIL 2MQ0A 4ZO8A 1QEWA 4ENZA 3ZT6A 5I6MA 1VF5C 3LN4B 1FFPA 3L4UA 4DZBB 4AT6A 1CI5A 1UH2A 3VG0L 5CCKL 2XN9E 1C5BH 3BFQG 5F88A 1BQUA 2VR8A 5HHMB 2KT6A 3QI9B 3OZ9H 3N5AA 4OD2B 1IEHA 3FOMB 1URZA 3T0WA 4F7TA 5KJRH 1ZGLB 3GBDA 1AGDA 1AAJA 1IEBA 4QXVA 2BNQD 5KVEE 2PYEB 2XZQH 1KEGH 4Y89A 2EXTA 5AW8B 2E6JA 2DQTL 4ODXB 4WGWB 1Y6KR 4NNYB 2F8OA 2CGRH 3X12A 4GRLD 2E9BA 1IGML 4OF7A 3SBWC 4XNMA 3VD5A 4ABQA 1P9MA 4CSPA 2CBMA 1E9PB 3AFLA 3VWJD 5B3JF 4Y7OC 5JORA 3ZKXC 3NBNA 2F53B 1NCAH 3SGEH 4G9FA 4NQCD 4ONFH 3HUJB 3CV5A 2V2TB 4FAAB 1G1KA 2QR0B 1E2ZA 3CZJA 4YO0B 2EYTA 1VGEL 3T3ME 5AVRB 2NY7L 2YK1H 1U8NA 2YA0A 5HDRA 5FKPB 3CVHL 3M6DA 2WKLA 3OLGA 3QUZD 2LE9A 4JREB 3RY4A 3SKNA 4BV1A 4EF3A 3TBVB 5TE6L 2BLFA 3SDCC 4K7FB 5ID0A 2Q2LA 5EZOL 4IKLA 3V0DA 3APDA 3JWOL 4OI9A 5FGCB 5A7EA 2EDWA 3BXNA 4WY7L 3UBXI 1A1MB 2CGZA 4KI5F 4Y2DD 3GJEB 3ZZQA 1HZKA 3UOAB 3TESA 2LAAA 3MRNA 3OF6D 3QDJA 4JFQA 4ERSL 3OTTA 1Q0XH 3I9AA 1WEJL 4AXWB 2W9EH 2CO6B 4LCIL 5D7JD 1RUAH 1DDHB 1HAUA 3IJ9A 4Y16D 3R8QA 3UTZA 1DQDL 2DTML 1AKPA 3DDFA 2OZ4H 5LKNA 3K6IA 1MREH 4L9LB 4AL8H 3HTLX 2AJ3B 1BEYH 2ICWJ 1JRHH 2VN4A 4LEOA 5MEOA 4FABH 1LHZA 1DVTA 2XZAL 1YPZB 2A4EA 3SD5A 3KGTA 1XL6A 1G7PB 3ML8A 4MSWA 4DO5A 3EJJX 2VDLB 3H6AA 1SHXA 1GH7A 1SVCP 4NLAA 5AG9A 3N41B 3MLRH 5L7XH 1I3GL 4JO1H 4JRYD 1CR9H 4Q8BA 3Q2WA 3BH8B 3H9SB 3S2CA 1WA1X 2NX5B 5KVMC 2WWKT 1TSRA 5T1LB 1LTXA 2LOEA 4PB0L 2EJ1A 4X5XB 4XNYH 3WNMA 3FUMA 4H8HA 2L4OA 5I6PA 2J2ZA 4LK4A 4BFFA 3CBKB 2PNDA 5I1JH 1R5WA 4RIRA 5A2KH 4YDLC 5ESAA 2MKWA 2JWYA 5L9DH 2NQ3A 3NJXA 4ZG1A 5IOKA 2W92A 4L4VD 3COOA 4OCWH 4JKNA 4PJBB 2VQ1A 2LU7A 3HNTL 2J1ZA 2Z31A 3BGFB 4MJ6B 3U9UB 3MLPA 4ZMAT 3UPRB 4TNVF 2P44B 4JN2B 4NKOA 3ILPA 3PXHA 4WV1A 2YRLA 3JV0A 3V4VL 2OM5A 5CN1A 3UTTA 4NJ9H 4GSUA 3NIGE 4CVWA 4GRLA 3ZIMA 2ZAIA 3X3GL 4IGBB 2XXCB 3T9WA 2Z92A 1IV8A 4FLHA 4B7LA 3KLAB 5ICZB 1ILUA 1GPOH 2ZONA 2ENPA 2BNRA 1LD9B 5DHVH 3DARA 4CMHC 2OTPA 1BOGA 3MRBA 4TL4A 4M5SA 3WIFA 4KVPA 4FFZA 2OMTB 4IBZA 1MLCA 3RBSA 5AAMC 5IUSA 1XF4A 4JFDA 4DTGH 4ORGA 3C5JA 2ZUSA 3DI2B 1G9MH 1DSYA 3LH2L 5JOEA 1MFAL 1E9QB 5EBMB 2KBGA 1DQML 3KPRE 1EXHA 1NC2B 1NAMB 3FB8A 3DI3B 1HCFX 4OTXH 3RL2B 4Y2DA 1N7ML 4IIQB 2ZXCA 4PJ9C 3V52H 1BWMA 1YMMD 3X3FL 5HYJE 4ZW8A 3VX1A 4JZNA 2W5PA 4GSDL 3RIFK 3UZVB 4C54A 4CC0A 4MHHG 3BQVA 3HEIB 2YUZA 2FDBP 1JSYA 2R56H 5I1EL 3T0VA 1L3NA 4OGYL 1N19A 3VXME 1GHFL 3S97C 2BS8A 2V7HA 4I1RA 1IUZA 2XRAH 3CSPA 2PCFA 4P9HC 1OTTD 4Q6KA 3ZSTA 2IH3B 1T03H 4OJYA 1HINH 2XPGB 1TCRB 1A3LL 4PRPE 4JVUA 4KO7A 3K6FA 2J1XA 4WJG3 5B1JC 2BZCA 5KVDH 3GSUA 4HJIA 2PYEE 4KK9D 4TVUA 2DWTA 5IMMB 3FT9A 3BO8B 3U36B 2GJPA 1NZRA 2P1YA 4DAGH 5ACZB 2Y2YA 4A66A 1N9PA 2P47B 3RWFB 4BBWA 3F64A 1KJ2L 1KZQA 4HBQA 5HHQB 2AK4B 1XBDA 4QR7A 2B2XL 4UT7L 2QPEB 2JCCF 3IN2A 5JHLL 1YEIL 1XGRB 4EIBA 2XWJB 2F53E 3QCTL 4LO9A 2NSQA 5EZJA 2AGJL 3AW5A 2KYIA 1J8HA 1CTOA 3HUJE 3D5OF 1N12A 5C6PB 2D03H 3MROA 4PJGB 3F12B 3MOBL 4AVKA 3MA7A 3Q13A 5HJ3B 2NSXA 2VZ1A 5BVJA 2CLRB 4LSPL 4MJID 3K46A 3ZE1F 2ADGB 2HVKA 3ZDYE 4FA8A 2FWUA 2MWCA 1A6TA 4UV7L 1GKOA 1H19A 2D7NA 3ZRSA 2CK0H 4XCYA 1KJMA 2ZT9C 3VE0A 2VSCA 4EIUA 4K3HA 4H88L 3F00A 4ZMQA 3V0HA 1E28A 2XPYA 3FSWA 3FO9B 4NRZB 3S8WA 1USQA 4F9LC 3T65A 1E4JA 3FYIB 3ULUF 4YE0A 4BINA 4RMWA 3U7WL 2NYKA 5B38B 3ATAA 4FFVC 3EFFB 2V9RA 1FORH 5HVWA 2CMRH 2HLAA 3VNZA 5KS9A 3ARVA 2EDOA 4TQPA 4Q6IB 1WS8A 2WNGA 1A7PL 1TF4A 2PWHA 4N2KA 5L8LB 2EAEA 5CLYA 2F2HA 2B59B 4E9XA 4W6WB 3DYMA 1YPZE 3LNDA 3Q9PA 1SVZA 5KANI 3ECUA 2ZWZA 5JXAH 5HHOE 1E5AA 5LAXB 1F42A 1SM3L 1KB9K 3ASWA 1JTOA 3V5DB 2VE6B 3FB6A 5TE7L 3ZYZA 3IDJB 5E4OA 1ZTXH 1X5HA 5ALCL 3ZBMA 1MHPL 3IDYC 4DVBB 1ZV9A 3HC2A 5BUAA 4F37K 3H9SE 2HKFL 4HFUH 3TZVB 3QG6B 4X9GA 3LH9A 1GAFH 7FABH 1FJ1A 5DMKB 5CIPH 2AV1B 3GMLA 4CL7A 3FUJA 1N59A 4AX3A 1B0RB 1AQKL 5J3HC 4XCFL 3BPNB 2G2NA 4OCYH 4P49A 1PY4A 5FM5M 1TZHA 4YHOL 5FYLD 2J5LC 3FQWA 4Z77A 3K3QA 3TBTB 3BD3A 4UINL 1VCBC 4RGNB 5GS0L 1OQOA 2CAKA 2OSWA 2ZYSA 3SDDD 4BFKA 2VRQA 3E6HA 4ENEC 1NUDA 2A9NL 2VWEE 9CGTA 2H2SC 3BPLC 5GRVL 3MV9E 5FLVA 5E03A 1JUFA 4QT5B 1G43A 1JF1A 1I8KB 4PTTB 4BRVA 4N90E 2EXWD 4HU2A 5FA3A 2EYSB 1A4AA 5IQ7H 2NY1B 1OK0A 3NIDF 4M6MH 3PP3H 1OSYA 2R4RL 4WU5B 3D39D 6PCYA 3MXWH 1G7HA 4IOIA 1IKFL 1FYTD 1FFNB 4LSQH 5GISH 5EOCJ 3QQ9D 4I77L 4OLEA 2ED7A 1EJ6A 3PDOB 4QPEA 3QPQD 5GZOC 2RGSA 1NMCB 2OMUB 5CP3A 2NUTA 1YAZA 3B56A 4HGWA 3WKQA 3BEVB 1OB1A 3B83A 2APFA 4IMKA 4E0RB 3VYNA 1Z5LA 1NCWL 1DE4A 4YX2H 4G11A 3RRQA 2WIIB 2XPZA 5FHAL 1ZLVK 3LV3A 3RWCA 1NDGB 5FECA 2JJVA 1Z0NA 4G3YH 4URTB 1TNMA 2DS4A 1XGTB 2CJUL 5ILTL 4KITB 2Z93A 1HEZA 3CN4A 4X4XB 4Q9QL 5JXEA 2CHZA 4UMGA 3DV4B 2E7HA 2UXTA 1DUZA 4KKCD 4IW4C 1U3NA 1UJ3B 3O9WB 3VJ6B 4PJ7F 1MW3A 2FUTA 1BFVH 4DEPB 2VC2H 5ISZE 3Q8FA 3QQDB 4JCWA 4WJ5A 2PW2A 2XTJD 4RMSA 4KXBA 4R7XA 4YIQB 5BJTB 5I8CA 3EH1A 3RPBA 5DRXA 1S8DA 1HXMA 2JQMA 4FTDA 5D1ZD 1D9KC 2BK8A 1CL7I 3AUVA 3CGTA 4HF5L 2A9MH 1BGXH 3HPLB 3Q3GB 3MODL 3RWIA 5FXCH 3TFKC 4POYA 3P30L 2VXQH 4L1BA 3VXNB 4D9QE 1ZD6A 4XCEA 1X5KA 2FQEA 3IFPA 1A64A 3PE9A 4AGPA 5F3HA 4D7BA 2AK4E 2N1KA 2QGEA 2Y6TE 1B4TA 1KLFB 4AJYV 3M17B 3MLXL 5GJSL 4JFZL 4FD0A 5I8OL 4EI0A 3TCXA 4LMQI 5SX4H 3BH9A 3SDDA 4PJGE 3KJ4C 1KOAA 4MLSA 2P8LA 1U33A 1RURL 2XA3A 4QWWC 5DD6A 3EBGA 5IT2H 1NKGA 4KUCD 1S7WA 5D72H 1Q8MA 4PBXA 4WFGD 3D2UA 1CTNA 4C58B 1XGUB 4NJAL 1UVQA 5C0DA 2VERN 4JFUA 1FZJB 1JOIA 1MRDL 1MQKH 2VDLL 4MD5B 3TEUA 1MWOA 4FQXD 1MUJA 2DQGL 2NW3B 2GT9A 2VLRD 2Z7YA 3C2AL 1RUML 3P9LA 4GBXD 5IWLC 3EKCA 5DR5H 4ZMYA 5I1AA 3GDBA 4FF9A 2HTLD 2Y4SA 3D39A 3GM8A 4PCKA 2H7WA 1TTGA 2WLLA 2UWEF 1F2QA 2K1MA 1B0GA 2DBJA 3CFEA 3IU3B 2B1OA 4H0GA 2VIRA 1T3FA 3P73B 5EU3A 3VMOA 4HCRA 4YPGA 3VI3F 3L4CA 4KZEH 4RAUA 1EVTC 1U3HA 3C75A 1N6QL 5CWSB 3OHMB 1INDH 3QS3A 3SDAC 3MLUH 1BD2B 3L3DB 4OCSL 4RH4A 2P7TA 3VFMA 4MMZB 4AEFA 1AQMA 3SPVA 4CDHA 3LKSA 3TCLA 3SPCA 5D1QD 5FKAB 2WN2A 3HFML 2YC1A 2F8XC 4HISA 3M88A 1WBYA 3DV6B 3BDYL 4GG6A 4J39A 1M9SA 2ZCZA 1FV1A 2KL6A 2VISA 4FQHB 4Q4IA 3KLLA 2DQFB 4CAGA 4RGOL 5CBEA 3V6ZA 4N3TA 2YMOA 1D6VL 2Z8WC 2FRGP 4XMXA 1L6PA 3WIIL 1WYJA 4HPOL 4LSTH 1FVEB 4UOW1 3VACA 4PBDA 2NNRA 2B39A 3KEHA 3D4ZA 5IHUL 5KAQF 4RGNE 1ND0B 1AJ7H 3ARFB 5FUCE 1YN6B 5TFSH 4ZBJA 1GYUA 4JRFA 4WIQA 4PRDA 3VXQB 3TF4A 1KTDB 3QFJB 4LHJB 3MRCB 3BVXA 3HB3D 5JLZA 3LMJL 5IW6B 4MA7L 1U3ZA 3SDXA 2Q5BA 5E8EA 3FT0A 1CGUA 1I1CA 2R39A 4L8DA 2B9BA 2GJJA 2J72A 3VRLF 2YR3A 2PYFA 2YD4A 1V3JA 2DD8H 4XPTL 3D4CA 4NFBA 3BPOB 4MAYC 5DDHB 3UG3A 2HG0A 2E3VA 3SE3A 5GZOD 1ITBB 2FGZA 2GKIA 1SF5A 2W60A 2ZX8A 4J12A 1FL3B 3RY6C 2CNYA 3LZRA 5D7IE 5EORL 4AOFA 1F4AA 1BF2A 4KAQL 3D8MA 5IB3B 5E24E 4JVWA 2VXSL 2V17L 1MRFH 5BO1L 2KLRA 1ZLSL 1NWOA 1ZSHA 4MXWL 4WI7A 1MEXL 3LZFH 3IXAB 4HG4K 1AZBA 3CVCA 4GXVH 4DESA 4NP4L 2LFGA 3NP4A 4HOXA 1CE6B 4B9FA 5EF1A 4P5MB 5C0BB 3GC3A 3K71B 4OZIE 1AD0B 1CS6A 1EZVX 2IANA 4XMKH 2F0CA 2JQZA 2X0WA 4KXZI 3SE4C 4HUXA 2WXJA 4XVTH 5B7MA 3MUJA 4NXSA 5CLWA 3WXVL 5I1HL 4FQXA 4HEME 5CJQL 5CEZH 4LOFA 3GSWB 4KVCL 4KDTC 5B3NA 2CRMA 3KPSD 4P2OD 4G43A 1JI1A 2EIZA 1AHWC 1YO4A 2EIEA 1NDTA 2Q1EA 4WW2F 4M93B 3DRTA 1XR8A 3BAWA 3MRJB 3FQTB 5I15L 1FO0L 4PY7B 2JKTM 1THAA 1IB5A 3IMUA 3RGHA 1L0XA 4EDWH 2DLEA 1N64L 4YSQA 1GGUA 4X2UA 2IQ9H 3UXFA 5BMFH 3FCTA 4DJMA 2P80D 1PNCA 3GSQB 5B4MD 1CFMA 2OR9H 2WZPD 4KNTA 4A2LA 1RJZB 1XTLA 1ZMYA 1XB6A 4G8IB 4J2QA 3LEVH 1TDQA 2GB2A 4L3ED 3AY4A 4ZUTB 2XG5B 5A2AA 4XMUA 1DEEB 2DDQL 2EE2A 3BLKA 2FB4L 3CFDB 3EF4A 1IAIH 5I71B 4Z7OF 2FUQA 3ISYA 3TTSA 2CHNA 4FMKA 1EA9C 3V4LA 2FHCA 3NQIA 4I2XB 1NSNH 5ESVA 3KR3L 1G6VK 2UZPA 4X5RA 3MMEB 1AZUA 3QFGA 4GIAA 1YEEH 3FFDA 1DVZA 3E8UL 1ZT1B 4FCHA 3HRPA 4FTVE 5E6RB 5F89B 5HDOA 3KWWA 2CD0A 3KWXA 4J3OG 4NZDA 1Z9PA 1UXMA 2M1KA 3L3HA 4B9JA 2VR3A 1U4EA 5IMKA 5SWZA 2DM4A 1D6EA 4N0RA 3QUMB 1UA6H 5ERWA 2JKNA 4HC1L 3S2AA 5DS8A 1ZHNB 4LLAA 3CMGA 4OU3A 4TSCH 4Y9CA 5D96B 5LCVH 4LKXB 1BAFH 5L2KD 4K7PH 3SKMA 4K3DL 3G6DH 4HCFA 4UYQA 1IC0A 3OR6B 3L1EA 3TA3D 4PLKD 2DWDA 4FI8A 4XVSH 3OKKB 3REWB 1ZT4A 3HMXL 3NZHL 1WBXA 3SODB 5H35A 2IIJA 1ZVYA 4ZW6A 3TN0C 4XPGL 5EEUA 3DGGB 3BN3B 5CEXA 4Z7UE 3NA9H 4LL4A 3HA0A 3TJPA 4Y7MA 3OB8A 3X1BA 2R29A 5AAWC 4RBPH 4L4TA 2L0DA 1I1YA 3TGXA 3DTDA 4U0RC 4YDJA 1UYWL 2W9DL 3OHXB 5D7LB 4S0TD 1A9EA 2VOTA 5IQMA 5DJDA 1BD2E 1UB5B 2PO6A 4IYKA 4BFIB 2HP4A 3QCUH 3MJ7B 5HGHA 5ENWB 4AM0B 2XWRA 2Y1ZA 2DI7A 4Q52A 3T1FA 5TD4A 2XNAB 3RE0A 1CDCA 2VJ8A 3SB3A 4MDRA 1GC1L 1QRND 4F3FB 3V4UL 2VABA 5H37H 3ZDXB 4Z7QE 1HHIB 3LKPB 1MHEA 5FM8A 2AJXL 5F0PB 3MBEB 4G83A 4A7GA 3O3AB 3S88H 3RVXD 1KBWA 4JS7A 4OFKA 1QWUA 5T1JA 3SZKC 2X4OA 5JOPD 4TNVK 1CU4L 2Q86B 1UXSA 5ANMA 3TM6A 1FFQA 1QFWI 4ICWA 2NLJA 4R7DA 4ETQA 4UQAA 3PL6C 4K7PX 5FO8A 1XSOA 2WZPA 3MNMA 4UT9A 1YNLH 4JDEB 1CFNB 5AL0A 2W0PA 5FW6A 3CH1A 5GRXG 3KYMA 4P46B 2EXYD 2J57A 4X8JA 3VVVA 5J0BA 1T7VA 3QFJE 4W4NA 3BZ5A 3VFSA 4F9PA 1LE9A 1Q9OA 5I75B 5DJ0B 3GI9H 3T2PA 4B9ZA 4MDIB 1I9IH 1GOFA 3ARGD 3QJZA 3GLZA 1T1YA 4QRUA 2EO7A 1DLHA 3RDTB 3ZTNL 1BMZA 2XIIA 3GXFA 4HUVB 3WO4C 3L9RA 2DM7A 1JNJA 4LGRB 1V27A 3MRHB 4H1LA 2IG2L 1OF0A 4PV9B 1Y0LB 4K3JL 4RLDA 2F7RA 5I66A 2NTFB 2O61B 1I53A 3ABLB 3TU6A 1CFTB 5C0BE 2FBRA 3C09C 4OJEH 4X0KA 4ZZFA 1JPST 1MI5B 3L6FB 3RVVD 1P9MC 5L2KA 3HAEA 1U8OA 3HC3L 5FCUL 5LO7A 2O1AA 1F86A 4M5ZH 5EO9B 1EO8H 2WBJD 4LHUD 3TA3A 2OI9B 4R4FH 3TH2T 2QVMA 4PWHA 5EUOB 1TVDA 2ODHA 4DF9A 3E2HB 3NRQA 4HX1A 3SGDI 5T1DL 1MHHB 2HKHL 4X6BA 3P0YL 1UA7A 1IQDB 1HNFA 1LO3L 1PD6A 2B08A 2BW5A 4TXVB 3S96A 3MYJA 1RUQH 2P5EB 1EGJH 5A6IA 3LDBC 2E56A 2WKGA 1X9UA 4PYHA 1GGBL 1DQKA 4YK4B 3HUJF 1JGEA 4OLYH 3UPCA 3AJ7A 4HIJA 3B7YA 3PJSB 2OCCB 5ICUA 2ALWA 1L7TL 2GJ6E 4R8WL 5ABAA 3K5SA 2CDFB 2MMXA 5ELIA 3RWEA 2F08A 3I74A 2OMVB 1UQSB 2GTWB 2IGFL 4EI6B 2Z1KA 3TP4A 1QRNA 1IGFH 2ZCHH 1TZOA 4UOW0 5CSZA 1W0VB 5GGTH 3DBXA 1RK0B 3UDWC 4X8XA 3O6FD 2P49B 4I85A 1QHPA 4OLVH 3L95A 1SOSA 1MCBA 2DLFL 4GO6B 3UYRL 4DKFL 5J4MA 4Z0BL 3VQ2C 1FFOA 1R17A 2I27N 3MNVA 5E2UH 3DO7A 2EEDA 4JW3A 1NL0H 4I2XE 2VH5L 4MX7B 1RZQA 1E2VA 4UNTA 5GS2D 1FFTB 1FGNL 1JI2A 5T3XE 4DP8X 4XVJH 1OAKH 1ECYA 4Y9GA 4MNGB 1QTSA 3GIVA 3C87A 1AGFA 1FZOA 2HLFD 2YAQA 1YPZF 2Z4QA 1DVXA 3FRUA 5C3LD 2WYTA 4G71B 3P0GB 4OQTL 5D1ZI 4L23A 3N41F 4WCYL 1E4KA 1BP3B 2PCXA 2AQPA 2ZKHL 3ZDWA 4KO6A 3NFNA 3Q44A 5K39B 1CFBA 5E9NA 1N5AA 4RGMC 3DX3A 2I9TB 1KGCD 4CKQA 3HBQA 4KQ0A 4GRLC 3BVNA 4TUJB 3FOLB 4JJ5B 3QJVB 3GWJA 3LSOB 4PJBF 3FU9A 5D7LE 1NAMH 3VWJC 3AS2A 2IXQA 2ZG1A 4BXVA 4PJHF 3EDEA 2F19L 4I3GA 2VR7A 1OCOB 1SDAB 2WBJA 3SCMD 2QKSA 4AEIL 3HI5H 1RJCA 3UX9B 2IGTA 2C4FU 4YR6B 3JV6B 2CR3A 1NGXB 4JKKA 1NPJA 1TJMA 2DPKA 4X98A 2IWKA 3QIBA 4HQQH 1MJ7H 3K1KC 2AVGA 3QUZC 2QQNH 1CK0H 3NDYE 5KW9L 2WAQA 3ZDXE 5E9DD 1MIMH 2UYLA 2R2CA 4FMFA 2UX6A 5C0GA 3SYPA 4Y2DC 3MV7B 4R2GD 1FP5A 4QHNA 3B7TA 1KY6A 1SXCA 2LVCA 3BN9D 4CMMB 4I18A 1E4WL 2DIBA 4OFQA 4B0MB 3MU3A 2B4CC 4KY2A 1OF2B 5D7JC 3RGVB 1P1ZB 3R18A 4Y16C 3GXTA 3K6DA 5C07D 4BHUA 2GBTA 3DO4A 4C83B 4HFWA 2GSMB 3QQXA 4YHML 4GQPH 5C8JB 1X5LA 3K80A 2Y1AA 4O9HH 1MCPH 2BVOB 2QHRL 2QLYA 4I9XA 5FUOH 5F1IA 1H8NA 3M45A 1FQ9C 2Q2EB 4B95C 1ZJBA 3EIFA 4TVPD 5AWNH 4PGBB 4R7NB 3P69A 3IE4A 4P59L 1G7LA 2BVPB 1OCCB 3QH3A 1JDCA 5TQ2L 5JHDB 4Z3IA 2YPVL 2DQIL 3W1ZA 3QG7L 4DO4A 1IC5H 4AV0A 4WKXA 4HWNA 1JV5A 3QNXA 1ET7A 2BSSB 4ZOCA 1MI5E 1NEZG 3CD4A 1DLFH 1C16A 5C0RH 1UHVA 1AC0A 1F1AA 4X7TA 1ZLWH 5I1IH 4YE4H 2DLTA 1LK2B 3VD7A 4H2AA 3A5VA 3B2VL 3RFRA 3BAIA 4E2OA 5GS1C 3LRMA 4GS7C 5ECGA 4ZT1A 3U2SB 1DN0A 3QJQB 4QRQB 4JM0A 4P3DB 2MCG1 5LGKA 1SOXA 2XKSA 4R5VA 3GSOB 1ACCA 2XV6B 1U91A 3N1QC 5EUOE 1WK0A 2HVJA 5BVPH 1WWBX 4HJSA 3TL5A 1RJLB 2MQGA 1MFCH 3WELA 1BMGA 2FJSA 4R26H 4HD9A 2P5EE 4JKWA 4H8VA 4PG2C 1AGBA 4PMFA 3O3BB 5GQBA 2O6FA 4TQIA 2GY5A 2WLIA 1OGTA 1NCAL 2NXZD 1EHKB 4WFED 1WCQA 3IETB 1Z5YD 3W57A 3LKQA 2X0UA 2DQUH 2HH0H 4TLKA 5B39B 4I0PD 1KENH 4ZTEA 3ZDZF 1RZ8A 2CH8A 3ROOA 2BXZA 2X4NB 4MZ3A 3B1TA 3I6GB 1N3NA 5E9DA 4ZUVB 4Z9KB 3GHEH 3X17A 2H1LM 2FVNA 5DMYA 1T21B 2CDEB 1RJYB 2IH9A 4L2LA 2I69A 4PG9A 4V11A 3X13B 2MH4A 5I76B 3FQNB 4J1UB 2ADIB 3NTCH 4WUKL 1AZZC 2J25A 5CINH 5TPWH 1NKOA 4IOFD 2AXWA 1KCRH 3GLEA 3HG1D 5BS0B 2MIZA 3NFSL 3FCUB 3MLZH 4HHWA 3EBIA 3P4OB 4ODTL 3O6KL 3JTSA 3H42H 4ONHA 3OAUL 1Z3RA 3WFBL 1OTTC 4RZCA 3B34A 1QATA 2IAMA 4TYUA 2AJUH 2WWKO 5JA9A 5IJCC 1A4JB 3EO1A 2AAVA 4XP1L 1R6VA 4Y8AA 1FGVL 2AQQA 1IC1A 1CDUA 4KK9C 4EOWH 4I48A 5T5FH 5DUML 4J3OF 3B1UA 2JB6B 2NY4D 5B1CA 5C70A 4TVSa 3OAZH 3O41B 5I1JL 3EYFB 1JXDA 1WHPA 1U6AL 2WANA 3KH3A 3L5XH 4QDGA 4PRIB 4XN9A 3OMNB 1O75A 1OGPA 1QMUA 3BVWA 3ABMB 4UIMB 2GITB 4OZFG 4P2AA 1JPEA 4FMVA 4FZ8L 2HFEA 1EEYA 2PABA 1D2OA 2OCJA 3BD4A 1M7DA 1IM3B 1RZFL 2YAHA 4XPBH 3U0PB 1LEGA 3RVUD 3ZKXB 1CXKA 1UWEH 3DX8B 3F7QA 3JZYA 4LPUA 2XBZA 3HKZA 5DJ6A 1H5BA 2P52A 5ALBL 1J8KA 4WZ9A 4XXWC 3EJZD 3NCEB 4XGZA 4EBQH 1NMAL 2R0ZL 2A6IA 2BP0A 2ZP8A 1QPPA 1V5JA 4IMKC 3HZVB 5I8KH 5HDWA 2F54D 4I4WA 3MV7E 3A0OA 3ILQD 3PJLA 4JFHD 4JM2B 3DHMA 1AR1D 2HB0A 3MGOA 4DTGL 2CUHA 2R51A 4OB5H 1G9ML 3CXHK 3K6OA 3MLTB 1W16A 1RY7B 1CXEA 3PV6B 1GJIA 5F7DB 3L81A 2FJFA 2VZUA 4Y1AB 2F15A 2EACA 3WUWB 5KBPA 4OZHF 3TBYA 1IC4H 1SGKA 1I7UA 2OMYB 3WL9A 4DZ8B 2NY5H 3GB7B 3O8XD 2O6CA 1T22A 1WFIA 2DJ4A 4QD2E 4V2CB 2E7MA 4H5SB 4XP6L 3HZ3A 4PGCA 5F0LB 5DUJA 3F7VB 1E8YA 5JHDE 4N5UA 5A40E 1OP3H 2RQEA 1DBMH 3EYUL 3HG1A 4PHZA 3CFKB 1J0IA 2YRPA 5IMLA 3H7BB 4AYFA 1SJVA 1WTLA 3DX1A 1DO5A 2YKLH 5EWIH 4IRJA 5LGYA 5IEHB 5FIEA 5D8JL 1D7CA 5GRUH 2DL2A 1KB3A 4JQIA 1JPTL 5EOTB 3MR9B 1M2VA 1V05A 5A2FA 1EVUA 1HQ4B 2FJGB 2X1XR 4LEXL 3RIAF 3SDDC 3BP5A 3MNWA 2EDJA 4CN1A 4YDLB 1A3QA 1AYOA 3HPJA 4IDLA 4DGIL 2R2BB 3G5XB 1WC7A 2GTZB 2N3JA 2G4GA 3FU6A 4LF3A 4K94H 1WS7A 4YSCA 5DJAA 4TULH 3BUYB 3CZFA 4NO0B 3ZO0A 3ZMNA 4U3XA 2EXWC 1JYXA 3ZOAA 3LPOA 1UA3A 1BBDL 1WUNT 3V4PL 2BVTA 3EBHA 3FTUA 4AEHH 5DRZA 3ZE2B 2Z8SA 5DO8A 5HD8C 1LP9B 5I5MA 1WZKA 3Q8EA 1MW1A 2Z3FA 3KJ6L 3CFMA 3VXUB 4CMHB 2UZYB 3D09A 4K23H 2GSGA 3UO1H 1ADQL 1JCVA 2FSEA 2HRPL 2Y7OA 3D07A 3P3TA 3FFCD 1JZEA 5GXBB 3QPQC 2CK0L 2J44A 2G3NA 2ZNWA 2I32A 4N25A 1QW9A 1JGDA 1S7XB 1D5MA 1ZPUA 2XWTA 4PVMA 4NGHH 3CVHA 5IVZA 3IS0X 1KJ3H 1T2JA 2YS4A 2VAAB 5DJXB 4LDCA 2YLKA 5DJCB 1M7UA 1N2RB 1RZKH 4H7VA 4HCIA 4NNPL 5DJZB 4AQEB 1BQ5A 1CQKA 3CC5B 2ESVE 4PJ9B 3AABA 3DSNB 1JFQH 4YNYA 4F8LA 3SQOL 1S7RA 4ODVH 4G6MH 4ZX6A 2JELH 4KKCC 1PAMA 1U8LB 5E4EC 5BS0E 1CZ8L 4U2YA 3S3PA 5L8JB 3B2MA 3QB7C 2X3BA 1AGEB 3KD4A 4JFEE 5JXAL 2XTJC 4XNZB 4Z5RA 1S7SB 1D5ZA 4LEBA 1ACZA 1OSZB 3DIDA 1ZTXL 4OCLC 2Y2TA 2WVVB 5AOMA 5EIIB 5F8QC 5FUZH 2Q6WA 4UYPA 4BHUI 3IJSA 3MJGX 1CVRA 3CSGA 5D1ZC 5GGUA 1VSCA 1DZBA 5E99L 2CZNA 1T7YA 1QKZH 4GW1B 2H1XA 1CMOA 2Y7QB 2WUCH 1X9QA 2RD0A 4FNRA 4YHKL 2YZ8A 3KCWA 5AW3B 1KELH 5AOKA 1I7TA 4DETA 4PRIE 3MX0A 4G6JH 2WK2A 1BZ9B 4K07A 1MHCB 1VESA 2IOIA 4M7LL 3T0EA 2FGWL 4KKAD 2AQ3A 2FWOB 2O5XH 5A6LA 2PMZA 5DQ9A 4OFVA 5C0EB 3IBOA 5IGXL 1CBVH 3PWVA 1XGQA 1JAEA 4GW4A 3KPNA 2BSRB 3JWNC 4ZQKB 4V1DB 5HVGB 2WWOA 3ZKQD 3AQDA 1YZZA 1PEWA 2ADJA 2XKUA 2EKSA 3F7LA 5BQ7B 5EBWA 1FNGA 1RZJH 3T0AA 3NFPA 5JYLA 4AYSA 3V4VA 5FX3A 4FQXC 1OSPL 3FRPG 3HI6H 4GBXC 3KS0J 2GFBA 1A3RH 2P8MA 1IAOB 3WTYA 2YD9A 4RCAA 2HTLC 1PGRB 4JJHA 5GRVK 4GY4A 3C12A 3NIFE 1JE6A 2VW6A 4LSQL 4N8PA 4XC1L 5CJ8A 5CO1A 2E7BA 4P3CL 2QLVB 5HYFA 3G08B 4J27A 4HVBA 1PIFA 4JHUA 3GZPA 1T1WB 1MLBB 5ESQA 3TNMB 1A65A 4Y1AE 1OGAD 3FJTA 4N9GA 4O4YH 3VD4A 1UKTA 3QJRB 4RISL 2XN9A 3F6LA 2NUPA 4IBTA 3ZL4H 5HYQB 3D6GA 1HOEA 1A4KB 5D1QC 4HXAL 5DJYB 4PRHD 1VCAA 3DGDA 5TGBA 2XWDA 3NCCB 3H0TA 1K85A 1OOWA 4UZGA 1OW0A 3EHBD 2VC2L 3EDJA 5KSBB 3CLFH 3IDYB 4MJJA 4ZS6D 2XJLA 3G6AA 1KIQB 4UU9A 1YQVH 2IFFH 3W82A 4FQQB 3N9GL 3CZGA 4PP2A 1TJGH 1CLOH 3MJ9H 2NT1A 3L7FA 2MFNA 1MJJA 1OM3H 4JJOA 2D7TL 4XN7A 2J5LB 4YSDA 1S6NA 3EGDB 1HWHB 2VXQL 3HB3C 4OW6A 3SY0B 1OP5H 2BY3A 3S37L 3AQXA 1GS7A 1BWWA 1OQXA 1UKQA 3QYNA 1BQRA 3RNQB 2VTFA 2KC0A 2D3NA 4GAJH 4BH8B 4IM8A 4BKLA 4XP5L 4GH7B 3BPLB 3M46A 1T89C 2OXHA 4OIFA 4TOYH 1R5IB 3OKDB 1KLGB 1S7TB 1WIOA 2YOAA 3ET9F 4K9JA 4NQDB 1R1CA 4DPCX 3LHPL 3QNZA 2X4QB 3ZE2E 1ODUA 5HDBB 1T5XB 1UURA 3EO0A 1KJ2A 3K72B 3M1BA 3UTQA 1Y07A 3B4NA 4ES8A 2ZUYA 3VXUE 1JZJA 1X5JA 5IHHA 5AB9A 1A9BA 5JHLA 3QZOA 1CD1B 1MCWW 4CC1A 1SPDA 5D72L 2MQ3A 2R0LL 3SY6A 3EJTA 2OMWB 2UY6B 5F7LB 3D30A 5IB1B 4YHPB 3QWOA 5IFJB 3O3DA 5GPRA 4ANKA 4P2QE 2K3HA 3QUXD 5IHWA 3RL1B 1EK3A 3HRZA 2WN3A 1TJHL 2Y06L 4NOBA 4MKTA 2I5YH 2VSKB 5ICYB 1WBZB 1J5OL 4P2OC 2C3GA 4RA0C 4G2AA 4TUKH 4ISVA 3ULVD 4MNQB 5MEQB 3L3GA 1RAMA 4MRBA 1IVLA 4Y4FD 5EB9A 3EH3B 2CRYA 3MCYA 5IR1A 1BVNP 1INDL 4Z0XA 5EU5A 2YWZA 1XGZA 1JNHA 1OCZB 2HG5B 5AW9B 3QEUA 5IF0A 3LRSB 1OARL 4KFZC 1AXTH 2DMBA 1KTLB 5F6HI 3II2A 5B4MC 2CDGA 2Z35A 3HLAA 4G80B 1I3UA 3QEGH 5EF0A 1R75A 3QJFB 4DSYA 3VD0A 2OV0A 1TVHB 1NANI 4IHOB 3ZDXF 3TWYA 5BRQA 2E7DA 3TV8A 4MS8D 3G04A 3KYKL 4ZTPH 3UAEA 2ZWKA 2VZSA 2UZXB 3EJSA 1D9KB 3CDZB 1WZAA 1YAIA 3BVVA 4QO1A 1KXHA 4PB9H 4RMUA 3V5HA 1XH0A 1JDAA 2IAAC 2WV3A 2E27L 4JHZA 1IGCH 3VMNA 4CRPA 2P8PA 4LCCA 1OALA 3V5KB 2AW2A 4ZXBB 1TT6A 3IGAB 4TF4A 3RHWF 3ULSA 3DURB 2OK0L 4NBYB 2YPLB 3O0RL 2BSEA 4V1DE 4UUJB 3WEXA 4GAYA 5FA4A 3CBJB 3FU5A 1P4UA 3G3LA 3VGFA 4WNJA 3WFDL 1R19A 3KJ4B 4BGLA 4LXFA 5IM7A 3KPRA 3MOQA 3BKYH 3SPHA 1QZNA 4XX1E 1IFHL 3BH4A 1OE3A 1PCSA 2ZXQA 1COBA 5KN5A 5DD3H 2BY0A 3LZNA 1RMFH 2BRRL 2D9CA 3QXUA 1MRFL 1P53A 4PLKC 4EDXB 1QFOA 5MENB 3TVMA 5HYJA 1L9SA 3L2NA 4JRXD 4Y19E 4GXVL 4N86A 2YBRB 3S35H 1MWAH 4YS4A 4KROD 4NCC2 4JAMA 5HJDA 4HWUA 3UBXB 4U1MA 4UTBH 4HKBB 1X9LA 1S9XB 1GGCL 1PG7H 1TETH 4XVTL 5JW5A 4OLXL 2Y69B 4X6CF 3VXMA 1DBKH 3KM2A 3LN4A 3OKLB 3N0AA 2Y1YA 4I0KA 4JHAH 5EUOF 4DZBA 4Q56A 4FP8H 1VFAB 4HS3B 1KXQE 1JK8B 4U7SA 4OGXH 1M1XA 3SDAB 4GINA 3FOMA 3U6XS 2H41A 3FU0A 4TNWF 3BKJL 4PRPA 3VH8B 1B4JL 2XOTA 3VXRD 1YJDH 5C0CD 5LXGL 1PPIA 2PYEA 2JIXD 2F58H 4JR9H 1VEPA 2W94A 2XV3A 2DQEL 5BNXD 3RVXC 3E0GA 1J1PH 2OJZH 2X70B 4HKJA 3EGSA 4NNYA 4LNRA 5KSBE 5KUKA 1A7RH 3PCYA 1VKXB 2H0JA 4XMZA 4JE0A 5TE4L 3I6SA 2GCYB 3BWZA 1E9PA 4S1RH 2NZIA 1J1XL 4UBDD 3ZTJH 5CHNB 3II3A 5HI5D 3VMPA 1A14H 3I84A 1WT5C 2F53A 2QFPA 2BFGA 5T1KB 3I02B 1O6SB 2V2TA 2HT3D 2EXYC 4AIZB 3OB0H 4YL9A 3S35X 1IAIL 1L3WA 7PAZA 3P1VA 3KAAA 2C9RA 2CRZA 5F9OH 1K4CA 2LU3A 3ARGC 1PG7X 3K1DA 2G75B 4QRRB 4P23B 4B7IA 5CJOL 4HJJL 4F2FA 3HS8A 4NQDE 4ZX5A 3PIQA 5LGHL 4B9IA 4NC0B 4UQ3B 3VFUA 1TTFA 5HDBE 4C57C 1P5VB 3APFA 4UI2A 1QEXA 3ELAT 1TNNA 4P4KD 1BQKA 3IDGA 1OWRM 1HILA 2Y1VA 1CVSC 1KDJA 4MQXD 4K7PL 4XZUA 1DVQA 5EEZA 3G6DL 3U9PL 2C4FT 2APVA 2YQGA 4L9LA 4RNRB 2GAZB 2GC4C 4U1IA 3DWTA 2WBJC 2IVFC 4P9HL 2VZTA 4U4BA 1HS6A 5HHOA 2JJSC 5IY5B 1G7PA 3AXLA 3CZLA 5F71A 4PWEA 2BO0A 1MSPA 3LS4H 4LARH 2Q9OA 4ZNCD 3NA9L 1Z6JT 2Y36H 4OZ4A 2HLEB 3UGXA 2VDRB 5AYTA 2EIJB 4F8PA 3BH8A 3SYCA 4XX1G 4O2FA 4XB3A 4HETA 1AHWB 3MUY1 3BE1H 1VEOA 2QVIA 1ZEAH 1N8ZA 2W07B 5E00B 5IJKA 3ARBB 2X87A 1CGXA 3LQZA 5BW7C 3IMTA 5I6OA 5J8OA 4I18C 1OPGH 3AT9A 4XMPL 1UWXK 6FABH 2BIPA 4U1SB 1XSIA 3PWPE 5CFAA 3EW3B 1NDMA 3DIFB 4FE9A 3GMRB 3U9UA 2QQLH 5HHXH 3UPRA 1U8PB 2X4TB 2FAUA 5FFOA 3RI5K 3N85H 4X4ZA 5GGQL 5C0CA 1H3WM 3JYCA 4NLHA 1RIUL 4M62H 3QSKB 1NAKL 3O6FC 3MV9A 5DT1L 1XX9C 2I60H 1NKRA 1MPAH 3RAJH 3V0WL 1PLAA 2PXYA 3KLAA 5I24A 2CCVA 3AROA 1FL5B 1JCKA 4JO5A 1LD9A 4XXDB 2R2HB 4BFNA 1JYWA 1YSOA 3KWUA 1SHMA 4N68A 3UJIL 2ZKXA 3PXJA 2YPLE 4PJAB 3WN6A 1NCJA 4NQEE 5ACMA 3LKNB 2BZ7A 5AZ2H 1LEKB 2HLFC 3T0BA 1JZDC 1TZGL 2P3YA 3KCPB 3C5ZA 1NC2A 1P7QD 3C5XA 3OPZH 3KL0A 2IH8A 2A6JB 2P48B 3HE6D 5E94A 4X42A 4TRPL 3AAZB 3C6SA 1TPXC 4NZFA 1IFRA 1ADWA 5CEYB 3TEXA 2CR6A 2H3NB 1ZS8B 4UDTB 5D9SB 4IIQA 1ZA3B 2KDGA 4XHJD 3T6ZA 4J5VA 3NZ8A 1FPTH 2ADFH 1MCQA 2E7LA 4MHHI 1IIKA 1YEKH 3TH3T 4ZX3A 1RUKH 3UZVA 2CLZA 4G9DB 2PP9A 4HU8A 3WYRA 5KVGE 3I50H 4ODSH 1W8EA 4KNQA 2KS0A 2WHVA 4IJTA 4HLZG 4DOHB 5AFAA 1QI4A 5AW6B 4UQ2B 2Y7NA 4BSWB 5ISZA 4N2HA 2CKBH 4ZNEA 1MG3C 4Y2OA 3SCMC 5ABDE 1QASA 1L5GB 1I9RH 4OLUL 2IH3A 2FHFA 2V8LA 1NCGA 4L5FE 4HV8B 3UADA 2RCSL 5TF0A 2XPGA 3DTXB 1N10A 2CBOA 1TCRA 1XD1A 5F7BA 5IJVA 2A77H 2EO1A 3P11H 4PLNC 1EGJL 4RZKA 3EYQD 1UD3A 2QQQA 4N2DA 4OZGB 5IMMA 3S0PA 4C4KT 3BO8A 1DJHA 4FQ2L 4PJCA 3CSYB 4N2NA 4BK8A 1M71B 1UD4A 3RWFA 3FO2A 4R2GC 1UM5H 1WICA 4WI8A 5C6WH 2MPAL 2IADA 5HHQA 3BN9C 4PCTA 2A9CA 2LR4A 4ELKB 3K5RA 1FO0A 3PG2A 1EAQA 3K2UH 3LIZL 4NNXB 4L0ZA 3L1GA 1XGRA 4PJFB 4N87A 5FDWA 4PLOB 1DVUA 1JNNH 2ZCHL 1U8HB 5EO0B 4H8WH 2OMZB 3FF7A 4OGAD 4PJGA 4AYGA 3ASNB 1IM9B 4RFOL 1UWGH 5HJ3A 4ANXA 3GS0A 4IKNA 3T8XB 4PTUA 1ZVSA 4HOWA 1XXFC 3QJHA 3UJTH 3U9WA 2OS7A 4RWYL 4D0BB 5E2UL 2MRYA 4QRRE 5BUPA 3UTPD 1QEWB 4EUPH 1FFPB 4AT6B 3RFZC 1ASQA 4XVJL 1OAKL 4Q4EA 5F88B 1M57B 4YHLH 1NCBL 2XT1B 4NRZA 5KYUA 5H8DA 4YPJA 3WO4B 4EZKA 1ZIAA 2CJSA 1AGDB 3LRHA 3WIHH 2G2RB 3ALPA 1IEBB 5FYJH 3D4GA 3D3VB 4A7SA 2NNAA 1JWMA 1FN4A 4G1EB 4PN6A 1HU8A 1BF8A 2Q8BL 3ZZ1A 1P7QA 3SO5A 3G5VA 3HE6A 1BDYA 1ASOA 1X7QB 3HHSB 1GKEA 1AZRA 2EDFA 3P0VL 2VUYA 4ZMTA 1IAIM 5JW3H 4NN6C 3C09B 4YHZH 3DX6B 4MWFA 2WCPA 5SX5H 3B9KD 5LAXA 4P04A 4QRFA 3KW7A 1YYLH 5JORB 2JK5A 1WD8A 1JZ3A 1EJ8A 3UTSB 4G9FB 8FABA 1EMTL 1U8NB 3V7MA 4GP8B 1QLEB 4XMLH 1CGYA 3HMXA 4X5LA 5I8EA 4ATTA 2WQSA 1JWUB 4BQBA 5B8CA 4WI3A 2YWYA 4LQFH 5KVFE 4J2XA 5DMKA 2AV1A 2NXZC 3QPKA 1U3YA 2DWXA 3S5YA 5ID0B 3HG3A 4Z18A 1B0RA 2DTSA 5IOPA 1LK3L 1SHWA 2KDYA 3LDBB 3AU1B 3PWNB 4ZX4A 3T2NH 3I6LE 1ROWA 3QPXH 3BXNB 2FIRT 4HQQL 4I9WE 3KPOA 4YBQD 4POUB 1MCIA 5F96L 3DNKA 4I0PC 1WFNA 4M43L 4DH2A 3UBXG 4APQD 1CUOA 1BAGA 4OCRH 1SEBA 3QDJB 3Q05A 3QJOA 4E5XG 3KLDA 2PR9A 2J43A 3BQUA 2P5WD 4PS4L 2V2WA 2W80C 4K5OA 2J88L 4UB0H 4JM2F 3QDHA 5KBLA 4Q2ZB 5E6UB 3UTZB 2X2YA 5BZDA 3CN0A 2DI9A 5MEOB 4LEOB 5KJ7E 4HUCA 2ZXEB 5C86A 4ZPTA 5D7IA 3X14A 3DLQR 4WU5A 1Q1JL 3NSYA 4IOFC 4MSWB 1YUKB 2IF7A 4P5TA 2AJYL 5T3ZD 1BCIA 2MJWA 1KEMH 1FFNA 1L9MA 4JFFB 4LDLB 3WHE1 4ZMPA 1BQHG 4FZEL 4N2EA 4OZIA 3PDOA 3CZSA 4I3SH 1OP4A 3N1MC 2NY3D 4LSRL 2OMUA 4L5FL 4RAVA 1OKEA 2WIMA 5AWNL 3MBXH 4KWUA 2NSMA 4WSJA 1XF3B 4HEMA 3QGVA 3MOAH 1UOWA 1RZ7L 4EI5D 2J2ZB 2E59A 2XXFA 4K3EH 1R5WB 5EA0H 4GI6A 4RIRB 2WIIA 4A6YL 3QWRD 5ESAB 5DHYB 1KG0A 3RZCD 4RDQF 2R1WA 1C7TA 1IC5L 3N44B 2NY4C 3WBDA 4GMTL 3ZHKA 2EDNA 4NKOB 3LRGA 1DLFL 1XV8A 2FQGA 3QXVA 4W81A 4WFHD 4WV1B 2IBZY 1EDQA 4RGMB 4G8FB 4FDWA 5IFHH 2E4TA 3DXAD 3DETD 4XNAA 1TU2A 1J05B 4FG2A 4GRLB 3QQDA 3OJDB 4FXLA 5A16A 4NENA 3DA0A 5MHSE 4G42A 3VWJB 2BNRB 3EFDH 5BJTA 4GRWE 2H0PA 3RVUC 3QEHA 1RH8A 4AYDC 3KPMA 2B0SH 3MRBB 2OAAA 4FG0A 3WIFB 3S34H 4R26L 3UAJA 4MZ2A 4GT0A 3T6VA 4D0DA 3RDJA 4KHTH 1BZDA 3RA7H 3EJZC 2BNUA 1KPVA 4I13B 5E5LA 4OZGE 4XH2A 1XF4B 1YEHL 4JFDB 4AMKH 4ORGB 3C5JB 3ZE2F 3QUZB 4IMLB 4NN7C 1PSKL 1LP9F 1QI5A 1PNDA 1YEFL 4L4JA 3U1PA 3ILQC 4I3RL 3FB8B 5JQ6L 1R3HB 3A4FA 4RQQA 1AR1C 1YY8A 4XAWH 4PJFE 1NC4D 2IMMA 4Y2DB 3IMWA 4HULB 1S5IL 2YMXL 1PDKA 2P45B 4FTVA 1NJ9A 1ORSA 4I89A 1KCUH 5A6MA 2Q0ZX 3VXSE 3VGAC 2P5WA 3W5MA 3S6CA 3CHXA 3ISRA 4C56D 2X1QA 1Q9KA 5I5IA 3O8XC 2QL1A 3KHQA 4MD5A 1ZA6B 2HWZH 3GKWH 3QIUD 2NW3A 2V7HB 2BVUA 5CINL 3ZR5A 1RZIA 4ODWA 2IMNA 4GP4B 5AYQA 4F8OA 4L9DA 3N04A 2JFCA 5IW1B 1F6AB 2Y2WA 4WTXA 4ALAC 4YHNA 5KVFL 1W9XA 5D2LB 5EOQH 4Z7UA 1V55B 1A7OH 1DBJH 1E90A 5AENA 3GI8L 3D3VE 3H42L 3GSUB 1PZ3A 1IQWH 1O7VA 1DJIA 1JGUH 4FKKA 5CWSA 2HJLB 4TQEL 3RNKA 3N50A 3TLRA 1X5GA 4EI5A 1KGYE 4L8BA 3MKKA 3MCKB 4K7PY 1XGYL 3P9MA 1X9RA 2E9WA 1M2OA 3QWRA 4FG6D 4OQTA 3MJWA 4EOWL 4ANWA 4L4VB 3VB9A 4GS7B 4UNVA 3UTSE 1SJEA 2DKSA 5EZJB 1J8HB 3ESVF 5I5JA 4DGVL 3FHAA 3DV6A 3MROB 4KI5D 2EE9A 4YGVB 4FQHA 3FU3A 2X2JA 4KBPA 1TO4A 2HVKB 4AQ1A 3ECQA 1A6TB 4ORZC 1T5KA 2BHYA 1MKFA 4M00A 4XCYB 1DVYA 1FVEA 2QPSA 1XSKA 4XVUD 4XAKE 2F5BL 2D3LA 1ONQA 1WFMA 3L5HA 2EZ0C 2QPDB 4NM8L 3ARFA 1EBPA 3KPTA 2EDXA 3T65B 1IC7L 1KTDA 3QFJA 4JPWL 3MRCA 4G8GD 1SDYA 1RXLA 2UVEA 1VIWA 1DCEA 2ZNXA 3WNPA 4R0LA 2HLAB 3U4AA 2QDVA 2ZCLL 3KPQA 4PJXE 5KS9B 5DDHA 3UMNA 1MNNA 4OB5L 3RY5A 4JN1H 1FL3A 2R8SL 2CLVA 3HZYB 1DJYA 4AE0A 1YMMB 2H0FA 1J0YA 1T6VN 1UGNA 2UVFA 2N0KA 3Q2LA 5KANG 5C7ZA 3FB6B 3IXAA 3JVGC 4JFFE 3NJKA 2DB8A 2WJ7A 2XV2A 1CE6A 2AF2A 5FO2A 3SOTA 4P5MA 5C0BA 2BERA 2PW1B 1FNLA 1A6ZB 5E7BA 4LMQE 4JLRA 5C0AE 3DC0A 1FJ1B 1NCNA 3GMLB 3QIUA 4JQVC 2D73A 5DZLA 1L0YA 1N59B 3NG5A 1OV8A 4WWNA 3GSWA 1DBML 3GQFA 4NKDB 3ZTEA 1TZHB 3FQWB 3LS5L 4Z77B 2DQDL 4YXLH 4FI7A 5KSBF 1HSBA 3SN6N 3AWGA 4X7CC 43CAA 4TUUA 2DW5A 1JHKL 1VEMA 2XV0A 3ZU8A 2BNQE 4D3CH 5TDOB 2X7LB 3MRJA 2YPVA 2H26A 3FQTA 3E6HB 4GXUN 5FWRA 2FNBA 1JNLH 4U1HA 3ZTDC 3LNFA 4WDIA 1F4XH 4KKAC 4KOBA 5IIEA 4QXWA 1E4XH 1JF1B 2NYZA 3X1NA 5FA3B 2GJ6A 4AJWA 3NPSC 4KRNA 3FSAA 1ROCA 4JB9L 2Q87A 4K94L 2IH1A 3VXOA 3TOPA 4NQCE 4ADIA 1BM3H 1CGVA 5HJBA 3IBEA 5KJ4A 4ZUTA 2XG5A 1GZHA 4IOIB 4MJIB 1NUFA 4M1GH 3RU8H 2O5ZL 1NM4A 5HDBF 4YEEA 1AFVH 1CGWA 2ORBH 3K74B 3QORA 3ZVVA 1F3RB 1NCOA 1L9NA 1NEZA 4HGWB 4PCSA 1XSJA 4I2XA 1Z5LB 3UO1L 3DX2A 1DE4B 3M1CA 3MMEA 2QMKA 3LV3B 1PJWA 2AK1H 3GSVA 3RWCB 2MQCA 5FECB 4HJUA 4C8XA 1AS6A 3CHRA 1AIZA 1HL4A 1QZ1A 3DMMA 4NGHL 5F2FA 4MMYB 4JG1L 3SYAA 1X5FA 1EAOA 1A7BA 1RL1A 1VFBB 3DOIA 4NZ8A 1P5UC 1WAAA 2JCWA 4FXKC 4RESB 2X10A 1QAWA 5G5DA 4R97C 1KIPA 1ZHNA 4JFTA 1A6UL 1DJGA 5F7WC 1A66A 5I6XC 3T04D 4BDVB 4LZKA 3OR6A 2B5IC 2PW2B 4ELME 1JFQL 3HR6A 3ZTCC 3S98A 5BV7H 2QDWA 1C12A 4ODVL 5KUMA 3O2VL 5I8CB 1NMBL 1QLEL 3LYRA 4KHXH 1Q4NX 3JWDC 4AEEA 4NSKA 1JYVA 3EHBC 3O4OB 1J5DA 2E0PA 1E43A 4JRYE 5D2LE 5DVPA 2C3WA 3CX5K 1TTUA 4ZS6C 4J8RA 4FFYL 3EYOA 5ADPH 1BZ7A 4Y2NA 3ME0A 3FH8A 3OHXA 4JVPA 5I0DA 1T4KA 4PRBB 4LCCC 3IFPB 5F9AC 2IALB 2AEPL 3ARSA 5F3HB 1ZT7A 3VFTA 1TCMA 3WKMH 2J55A 4PV8B 1MAJA 1WZLA 4L4VE 4UF7C 3O2WL 5C6TL 2ZQKA 1MOEA 3IJYA 3SDDB 1CLYH 1S7QA 1M9WA 1Z2KA 3FAWA 4G6JL 5CLXA 2AVFA 1ZJAA 3V10A 2P8LB 1KSRA