4W9ZA

Crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
MVPKADLTIKATGKQWYWSYAYPDNGKFEFDSLMAQDKQPRLLGVDNEMVVPVNKVIRVQVTGADVIHAFALPAFGVKIDAIPGRLNETWFKAAKTGMFYGQCSELCGKDHAFMPIAIRVVEDKEFASWVETAKKKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the periplasmic domain of subunit II of cytochrome oxidase (CoxB) of Bradyrhizobium japonicum
rcsb
source organism Bradyrhizobium diazoefficiens
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 2
total genus 33
structure length 138
sequence length 138
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4w9zA00
1HAWA 4YSCA 3QJUB 5B1AB 1NIFA 2YAMA 4A2EA 2I7OA 3NJNA 3FT0A 5D4JA 3NYKA 6PAZA 4KNTA 2LLNA 2CALA 2PCFA 3NJKA 1FWXA 1IBYA 1W6LA 2PPDA 2PPFA 1NIBA 1SHWA 3ABGA 4AKQA 2GB2A 1PNDA 2PPCA 3BQVA 2IWFA 4E9QA 3SBPA 3FU9A 2J56A 1A65A 3OQRA 1L9TA 1E5ZA 1V55B 5F7AA 3SBRA 2GC7C 4BXVA 1JVOA 1NWOA 2FQDA 5B7FA 2BHFA 2W8CA 1PLAA 4M3HA 5I26A 1WAEA 5AFAA 1JERA 1AZRA 1R1CA 1JXFA 2XX1A 2DWSA 4HCFA 1MZZA 3SQRA 1NIAA 2XV2A 1PCSA 1PF3A 3QPKA 3NT0A 4HALA 5LDUA 1ASQA 2VN3A 3MX0B 2IWEA 2YAFA 1ZIAA 2Q9OA 1KBVA 4DP2X 1NIDA 4GY4A 2IH8A 2XXFA 2VW4A 2XV0A 3FSWA 2TSAA 3H56A 1AS8A 2XVBA 2HX8A 2EINB 1KBWA 1OCCB 2VM4A 2PP7A 4DPBX 1AIZA 2XXGA 3X1GA 5A7EA 3ZDWA 3FPYA 4DP7X 1A4BA 2HZHA 2Q5BA 3TBBA 4YSRA 4HIPA 1NIEA 4YSAA 5EHFA 1SF3A 2QPEB 3NSYA 5PAZA 1ZPUA 2MRYA 2JXMA 6PCYA 3T6WA 1PZAA 4W1TA 1TU2A 3IEAA 2CJ3A 3CZUB 4YSSA 4F2EA 2DY2A 1BXVA 1PLBA 4HZ1A 2Y69B 3CG8A 4UAHA 2HXAA 1NPNA 2UXTA 3ZIYA 3ABKB 3FU7B 4DP4X 1GY1A 2UX7A 2XYBA 2VW7A 2ZONA 4YVUA 3X1FA 3N55A 4AX3A 4BWTA 5I6MA 1SDDB 1X9RA 3EH4B 4E9VA 2IDFA 3OMNB 1L9SA 2YAQA 4KOBA 2JFCA 4DP1X 2FQEA 1IUZA 2PP9A 3TU6A 1SHXA 2BP0A 4P5RA 1A4AA 3X1BA 4E9YA 5I5JA 3QJQB 3RYMA 5AKRA 1E65A 1ILSA 2A3TA 2CUAA 3FU8A 1KYAA 4YSEA 2I7SA 1PZBA 2FT8A 1AOZA 1AACA 3UADA 2XUWA 3FS9A 4KOCA 1MZYA 1CC3A 2P80D 2AZUA 1JXDA 3T6XA 3NP3A 4BDVB 1NTDA 4G70B 3L45A 5D4IA 3UACA 4L0PB 2B3IA 1OCOB 4X4KA 3C75A 3ABLB 3WIAA 2HRHA 1PMYA 1JXGA 3H4FA 3WI9A 2VW6A 3NJFA 2GIMA 1J9TA 2YAEA 1FA4A 4AZUA 3NP4A 1SFDA 1ASOA 1ASPA 2J55A 1NDTA 2UXGA 1JVLA 2AANA 1AG6A 1SNRA 1NWPA 2QDVA 2FT6A 1JZIA 2IAAC 2XV3A 4AKPA 1AQ8A 1SF5A 4PAZA 1J9RA 1AG0A 1KV7A 1XB8A 1SDDA 3S8FB 1GY2A 2IDQA 1NICA 2FQGA 1HFUA 4GXFA 2RACA 3NJJA 4DPAX 2QT6A 4EF3A 5AZUA 1CUOA 2YAPA 3IBOA 5I6PA 4Q8BA 2IDSA 3NSFA 3QJRB 4G7SB 2HRGA 2FT7A 3NSCA 3TA4D 2DYRB 3KW8A 3WNJA 1KCWA 3S3DB 2YXWA 4WTQA 3QJSB 4YSQA 5B1KA 2IDUA 4KO6A 3SBQA 1AAJA 4A2DA 4DP9X 1T5KA 2FQFA 3EHBB 3WG7B 4BXSV 2AZAA 2DYSB 4ZK8A 5I6LA 5I28A 2IWKA 1OCRB 1ID2A 1YLBB 3ASNB 2WO3B 1PNCA 1L9PA 1RZQA 3PLYA 1SFHA 4A66A 3EH5B 1IC0A 1WS8A 1JZFA 3X2QB 2BP8B 3BVDB 3G5WA 5I5MA 2XWZA 3OMAB 4NB7A 1MDAA 3TBCA 3WKPA 1DZ0A 1BQRA 1ET7A 1E5YA 4E9TA 1ZV2A 2YQBA 2ZWNA 2BZ7A 2VMJA 3PXLA 1I53A 4E9SA 3FSAA 3KW7A 2HLEB 3IE9A 3CDZA 4F2FA 2GC4C 3FYIB 1N70A 3N2JA 1TKWA 7PCYA 4WKXA 3CVCA 5ANHA 3AG1B 2EILB 2X88A 4KO5A 1OE1A 2PPEA 4KO7A 2YAOA 3X1NA 1MG3C 2JKWA 4KNSA 3T9WA 2OJ1A 8PAZA 2FTAA 1WA2X 5TK4A 1OE2A 3GDCA 1BQ5A 4NAJA 3EF4A 5B1BB 2QPDB 2XX0A 2TSBA 4M4RB 1NPJA 2EIKB 4YSDA 2Y1AA 2R7EB 3T71A 3H4HA 2WSDA 1MG2C 1J5DA 3FSZA 1GS8A 2GHZA 4UANA 2QDWA 2BP8A 3PAZA 3CVBA 1EZLA 3JT2A 4DP8X 5IY5B 1J5CA 1W6WA 4YSPA 2BP0B 3FU7A 1AZUA 1GSKA 1ZIBA 4A67A 1ZDQA 3FYEB 3U25A 2CCWA 3AG2B 2PCYA 2CAKA 4BK5C 1WS7A 1PZCA 3NJIA 5I5IA 4DP6X 2YAHA 2IDTA 1BYOA 1TEFA 1UATA 4QLWA 1QLEB 2VM3A 4E9RA 3OD3A 1BAWA 4HCIA 3UAAA 1SJMA 2OV0A 3V9CA 3HEIB 5E9NA 2HX7A 2DWTA 2YXVA 5F7BA 2R7EA 2BZCA 2BWDA 4HAKA 3T6ZA 2X87A 3UGEA 4GP8B 3EH3B 1HAUA 1J9QA 4K9JA 3PAVA 4DP0X 4AI7A 5I6KA 1AZBA 3GXUB 4A2HA 2H47C 4G7QB 1OE3A 2BWIA 4P5SA 2BW4A 4BWUA 4KNUA 1GR7A 3CDZB 1V10A 3QQXA 4NERA 2W88A 1OV8A 3OM3B 2CBPA 2VSMB 3FQYA 3PCYA 5B7MA 1WA1X 2BW5A 3QJTB 3AW5A 1ADWA 3NJGA 5D4HA 3WNIA 1JZGA 4G72B 3PPSA 4ENZA 1KGYE 1J9SA 1OF0A 4DP5X 2UXFA 4HHWA 1CYXA 1RCYA 3S3CB 2MTAA 2EIJB 4A68A 3UABA 4QKTA 3DTUB 4DPCX 1KDIA 2BO0A 4N8UA 5B7EA 1XB6A 4E9XA 1ZDSA 1L9RA 1BXAA 1DYZA 3IN2A 4N4YB 2DV6A 1EHKB 2GI0A 2PLTA 1JZJA 3D12B 2ZOOA 1F56A 1AZNA 3TASA 2B08A 2AVFA 4UF7C 3AZUA 3MBWB 1E30A 2N0MA 3FQ1A 4RH4A 4HHGA 4YSOA 1X9UA 2XU9A 2FWLB 2PP8A 1AZCA 4GP5B 4E9WA 1GS6X 1XMEB 1GS7A 1L9OA 2HX9A 2H3XC 7PAZA 2I85A 4CSPA 2XLLA 1JOIA 1V54B 3NJHA 1KCBA 4JKNA 3OMIB 4HCGA 5B1JA 4JHVA 3S8GB 1ET5A 4JHUA 3X1EA 1BQKA 4YSTA 4YVNA 3UAEA 1PAZA 4TXVB 5PCYA 1URIA 3FSVA 1GYCA 3DKHA 3WKQA 4FAAB 3PAUA 4F7KA 4A2FA 1A4CA 2VSKB 4YSUA 1AS7A 3NSDA 1OCZB 1ILUA 1QHQA 4W9ZA 1NZRA 9PCYA 1M9WA 4GP4B 2J5WA 4G71B 2NRDA 1A3ZA 4BWWA 1IBZA 2YARA 1A8ZA 5FC9A 4PCYA 4Q89A 3NJMA 3V9EA 1ET8A 3AY2A 2H5UA 1TEGA 2J57A 1CYWA 1FFTB 1ETJA 3IN0A 3AG3B 4MFHA 4A2GA 3QJVB 4G7RB 4YL4A 3ZBMA 3GYRA 4AKOA 5TK2A 1GW0A 1E67A 4KO9A 2FNWA 2EIMB 4BDVA 1AANA 3ASOB 3HB3B 1AS6A 1IKOP 2ZXWB 3CVDA 1OOWA 1BYPA 3DIVA 3S3BB 5I6OA 1NINA 1B3IA 3ERXA 1KDJA 3NJLA 3FQ2A 3T6VA 2OCCB 3ABMB 1W8EA 1XB3A 1QNIA 1N68A 2UXVA 2PPAA 2GSMB 1BXUA 2IH9A 1CURA 1M56B 1PLCA 4GYBA 1BEXA 2P80A 1M57B 2UX6A 4FA7B 1AR1B 1L9QA 1RKRA 2FJSA 3AG4B 3ZX1A 3FPXA 5B3SB 1WA0X 2GBAA 1JZEA 1JZHA 3JTBA 5I6NA 1VLXA 2E86A 1RZPA 2AFNA 4CSZA 1PY0A 2WO2B 5B1JC
chains in the Genus database with same CATH superfamily
1T2QL 3I9GL 4Y4KA 4N2GA 5DC4B 1OZTG 1MJJB 3H0TA 4HQQH 5EU5B 2X7LA 5DJYA 4GLRI 1NKGA 2ZOTA 3POCA 5C0AD 1TZIA 3EJZD 3V55A 2SEBB 2NQCA 5F7EH 3F65A 2FJFB 4TTGA 4XVUD 5HYSA 4P0DA 4PJEF 5ICYB 4LEXL 4M9PA 1SOQA 2VLRE 5EU3A 2F54D 4A7UA 1WCQA 4I3SL 5B38A 3GSNL 4PCTA 4LGRB 4HIXL 2GB2A 1PNDA 4R3SA 4XX1E 1PKQB 1R3KA 2R2EB 3ZZQA 3FU9A 1J9CT 3FB7A 1V55B 1Q94B 1HQRA 1W0VA 5HHQA 1IAIH 3THMH 3QXDA 2HT3D 4UQ2B 2BHFA 2W8CA 2J71A 3WFDL 5DHXB 3O2WL 1O0VA 3IU4L 3WELA 5F7DA 4I5BA 3AJ7A 3X3GL 2Z7ZA 1M1XB 4ZOBA 1H15A 1W0YT 4M03A 1PD0A 1R5IA 4OLXL 5MEOA 1HHGB 3BESR 3OR7A 4ZXBB 2WP3T 1AC0A 1KBVA 1IC4L 4PB0L 1ZLEA 1HWWA 2NR6C 5JYMA 2JQZA 1N6QL 2D0HA 3FSWA 4IRZA 4M7LT 5AYUL 2E75C 5CHNB 2M1KA 2BHZA 3GEWB 4C4KO 2HX8A 3SDAC 1ZTXH 5EBGA 4QCIB 3M1BB 3R1GL 2D03L 2Y2TA 5ALBH 3X1GA 2ATPA 5GGRB 5DTFB 1HWGB 5DJDA 4WUUD 3IGAA 2KZ1B 2HKAA 2J8UB 3GBLA 3L6FB 1PX8A 4R5XA 4YSRA 3ZQXA 4G7VL 4JQXC 4IKNA 4PRID 5IVXB 2FECL 1T0NA 1MCJA 2J25A 2PYFB 3C5XA 5CJXA 4CADA 3LKRA 4N2KA 3HMWL 1PKQE 5AVVB 3VH8B 4M5YL 1NGQH 2VDMH 3PXHA 4A55A 1AKJB 2XQYK 4PRDA 3LMJH 4MXWL 4UQAA 4TUOB 3F7PC 1YNLH 3MRHB 4P5KA 3RWEA 3TF4A 1OL0A 3B34A 3BWZA 4G6KH 2KKQA 4I9WD 3FU7B 1R47A 3FBKA 1R5VB 1P6FA 1P7QB 3QORB 1O7VA 4GUOA 3BVWA 3BDYL 2NMSA 2B0SH 3BQUD 4ZNEE 5DEGB 1TQUA 4GIOA 3K6OA 4WKZB 4Y5VA 3EKCA 1QR1A 5TPWH 1Y0LA 3QDGE 5AUMB 2H2SD 1DR9A 4WUUB 3VSUA 2YKLL 4G8GE 5HHVH 1XZ0B 3VRIA 4KXZH 2H41A 3TNMB 2VXQA 2A3TA 3GMPB 4IMLB 1UB6A 3DSFH 4LVOB 3QEHB 3HAEB 4ZW8A 2XPGA 5IOKA 4RGND 1L4IA 1AKJD 2OS7A 4NS0A 5EG6C 4KKAD 1C1EL 4MNQD 5DJ2B 4BH7A 2NY4D 4GG6E 3TBTB 4TUKH 2J6WA 4MA8L 4L0PB 2DL2A 1Q72H 1SM3H 3HZMB 4HMEA 1XHHA 1D5XA 3MDJA 4XN8A 2HRHA 1E8WA 3JVGA 3B3BA 1QLEH 3KPSA 2AS5M 1PBYA 4F9PA 2IQAB 5E2WL 4GPVA 2Z92A 1ASOA 3RL2A 1NDTA 4PP2A 4AEEA 1D5RA 5GS0L 1LWJA 4N25A 2WV3A 4ZMWA 2Q76A 4D0BA 1DVYA 1JRHL 2OFQA 4ZUSA 1BQHG 3FQRB 4PGCB 2FX9H 5F88A 5KYXB 4KDVA 4HIJA 4LL9A 2AC0A 3I9PA 3TVMD 1HJBC 3U46A 1KJ3H 1VAHA 1U3HD 3J2PA 4NJ9L 4NBZB 3MRMB 1O7SA 4XMKL 1F1GA 1EFXA 5AZUA 3EJQA 4ZAKD 5HDBB 3RL1B 5SWQB 5FDWB 4W9LC 3SGJC 4CMMB 5DRXB 2ILLA 4OGQC 4EJ1C 2N7SA 2YN3A 5BV7H 4MB4A 3I6SA 4YDIH 4ZFOL 4K2UH 3RWJA 4B96A 1TQCB 2YXWA 3IKCB 4Z7OB 3LKPB 4OLZL 2DJSA 5A16B 4BFIA 4IJTA 1TITA 1UM4L 4EUPG 3C5JA 4Y4HB 3SE3C 1UG9A 2ZP9A 4XH2B 4BGLA 2APXA 4HJUA 4KRMB 4U2YA 4BXSV 4KK9C 3GJFA 2IWKA 1ID2A 3DIDA 4KZEL 4TVPE 3WD5L 1UTDA 2VC2L 2CLVA 1PNCA 1T5XA 3ARTA 4NUMA 1KCKA 3RWJB 3BIBX 4RLDA 1LMKA 4CRPA 2VOTA 1H6EA 1KXQA 1MW1A 3V9FA 1XWVA 1KGCD 4BCZA 4JY6B 3SDXE 2VDPB 4X0NA 2W60B 2K78A 5FHAH 5IK3B 1JHKL 2WANA 3N6YA 2AQPA 1A7RL 3DV6A 3HS9A 4K3JH 5L88L 1UKQA 4G8FB 2QHRL 1UB5A 1C5BH 2YQBA 2ZWNA 1MCEA 3QSKB 5SWQA 2HPOA 1I8MA 1EAOA 1SY6H 4IEFB 4KKCD 4NQVA 5E5MA 4P4RA 2FCBA 1OAYH 3DK2A 3MRNB 4NZ8A 1NBYB 5I17A 4KVNH 3PU7A 5E70A 1PQZA 2X6VA 4X7FC 2Y24A 5INCB 3FUKA 4YNYA 2WWMC 1RPQA 4JUSA 5AB9A 3DRTA 3IVKA 1RSYA 3GSOB 1GPOL 1TTAA 3INOA 5ALCH 3UROR 2VITB 2ZCLH 4DGIH 3V6FA 1OAKL 1YPZE 5CSGA 2EO7A 2BHUA 2R29L 8PAZA 3X13B 1WA2X 3QQ9D 4G7YH 2OX5A 1IEBA 1HL9A 5BO1H 4GSDH 3B7RL 1C5CH 4U1IB 4KQ4L 1CLOH 4U0RC 4XBPB 5SWZD 4EN3A 2QPDB 3CUPA 4L1TA 5DLLA 5L7XL 1XSIA 5DQ9A 2EIKB 1I9RH 4MKTA 4P5MB 2EEDA 4GMTL 2EKSA 4LEOA 3PHQB 4K07A 3VD9A 1EJOH 1KGJA 1NM9A 1LQSR 1OB1A 2C4XA 2D3NA 2OL3A 5CJQH 5GPRA 5DVKA 4A6YL 1NCCH 4PWGA 4JQIL 5DJZB 3RVTD 5E1AB 2XWDA 1J5CA 5HYSG 3CFQA 3NIGB 4DF9A 3KL3A 4EUPB 2CCVA 2RALA 5SWZA 3ARDC 4MS8D 2E0PA 3VFRA 1LP9A 2AI0H 2YBGA 4HS3B 4IS6B 5LGJB 3CFDB 3EUUA 5A2BA 3RZCA 1BVOA 3WXWL 1OB1B 3L9RB 1T4KA 4ZMZA 1WFTA 3CDGB 3HE7B 4X6FB 4HOXA 1H5BA 1P7QA 3IDXH 3QORA 4KVCH 1BYOA 4ZG1A 1FZMA 4JM2D 4NLHA 1AIFB 3RFZC 5SWZB 3VFRB 1IGYA 2GSIA 1Q9OA 5EU7E 3R06A 1WAPA 2HWZL 3HC4L 2IGLA 3BZDA 4QXUH 1LO3L 2VSDA 5SWSD 3BSZA 5EOCH 3WAKA 2RA1A 1D5ZA 3MV8D 2X70A 4NYLA 4WWKB 4NAQA 2QBWA 3SBWA 3EUDA 3KPSE 3V95A 3QVAA 4HT1L 2EDLA 4K9JA 4U3SB 3T04D 2H0FA 2OMNA 1NFDA 4Z7VE 3TN0A 2KERA 2ZX6A 3TURA 1QFWH 4FQQA 4LSRH 4W9HC 2E59A 4DEPC 1NPUA 2WZ5A 4O9HL 2YD8A 5TGBB 1U3HC 2GG1A 5ALCL 4I0KA 2JWYA 5AKSA 3RIFK 5FYJH 3HE7D 3D0VA 4D9LL 1G7JA 2F53A 3QZLA 5F93C 3NAAL 5EUKA 2W88A 4JM2B 2VSMB 4M5SA 2CR6A 1PZ3A 3TONA 4C56A 3T0DA 5HDQL 4LLWA 1JPEA 1PLGH 2BY0A 1A64A 2P52A 4OD3H 9CGTA 1JNJA 2EYTB 1T22B 3RUGA 1EJ6A 4UIKL 5F8RC 1RZJH 3C60B 5IVZA 5BVPH 3TF7C 3TYFA 2VDNB 1TQCC 3GGWA 4K0OA 1WT5A 1RCYA 3GBNH 3M88A 1XEDA 2YRBA 2N4IA 4GKNB 4X9BA 2VDNH 1JGLL 3UABA 2VZUA 1KB9K 3R06B 4HKJA 3SE8H 3NCFB 3G6AB 2JKIS 4ZPTB 5SX4H 5EDSA 4RFOH 5GS3A 2MQ3A 4L8BA 3LHPH 3MNVA 4N2OA 2YUXA 3ZKXB 4XP6L 3HRPA 4E36A 3QUXA 2BIPA 2I26N 3EDJA 4YHPB 1A9BA 1U21A 4BK8A 2ID5A 3LKPA 4D9RD 3ESUF 4OV5B 4BZ1L 1I85C 4HHGA 3MO1A 1FH2A 4DKFH 4GAJL 35C8H 1NFAA 1TSHA 4H1LG 5KAQG 2X3AA 3I6GA 1ZANH 2CO6B 4WJ5B 3ROOB 1LK3L 1XMEB 2V37A 1RL1A 1CIUA 5JIDA 1LL1A 4OZIB 4U49A 4NZDA 1LO4H 1LWRA 2O5ZH 1BZ8A 3PWJA 3OMIB 3VXNB 1QX1A 4JKKA 5FKAA 1U8HB 3GUTB 2RQ8A 2PMZA 2JKRM 5GS0C 1ZJAA 4FADA 3U82B 1H6FA 1FE8H 5TE7H 5B39A 4OTXH 3S3JA 1H3VA 1Y18B 1BG1A 4L5FL 3FOMA 4X6DB 4R0LB 3UPCA 5C8JA 2QSCL 5ESAB 3IGFA 3MJ9H 2PW2A 1UA6H 4X7DC 2AJUH 5F7UA 3HPLB 1KPRA 1E2ZA 2Y1YA 2HMIC 5KBNC 1NAMB 1YNKL 2ICEB 4FNLL 4L8SB 4POZD 1UA7A 1JZ6A 4P4RB 1YNTB 1KCSH 1ORSB 2XBZA 1CFNB 5D7IF 5EU6D 5HHPB 5EOQL 1JGVH 1YA5A 3AG3B 3E6HB 5F72S 2EAEA 4LF3A 1DVFA 1LD9B 1BD2D 2Z7YA 4NGHL 4PJIF 3JWDC 1OWRM 2VXQH 3SKOA 1OP3H 4MNHA 4UT7L 4L4TE 4QO1A 2V5RA 3VYNA 5HHPA 5EO0B 3WY4A 1BAFL 2X4RA 3DETC 3T0EE 4UTBH 5CEYB 4PVNA 1ADQH 2DWEA 1TTRA 4X0KA 5JZ7C 3ZHNA 4DFHA 4H4NA 3IYLW 2OCCB 5ID1B 1FFOB 2D7MA 4M8VA 5HHME 3VWKA 4IOSA 5DHYA 2CA4A 2A9CA 4P2RD 2CK0L 2QVMA 3GI9L 4WUUA 3RAJL 2OI9B 5EU6B 1QSEB 4AIXA 1L6ZA 3GKWH 3UMNA 5CEZH 1L9QA 4YBLC 3WJJC 4ODXA 2WN2A 1Q9WA 1DQVA 3EZJB 2OMXA 3MRFA 3MLSH 1HSBB 3TLRA 1XF3B 4LSTH 5T3ZL 2XZZA 2VDRB 1AGDB 5KAQF 1JTTA 4K15A 3NN8B 1MHCB 1PG7W 4MJ6A 1HDMB 1KIQB 4WSGA 1GMEA 2WCPA 1P53A 3UIYA 3Q43A 1P7BA 2NPLX 1MUJB 4K73A 2FO4A 3CFMA 1HSBA 2I7OA 3NJNA 3QUYB 2I24N 1FPTH 3MTXA 4WF7A 3F04A 2WPGA 5ICZA 1T1ZB 5I9QB 4FQPA 5F1IA 1BQHA 2LLNA 4AEHH 1NH6A 4JREC 2FYYA 4UV7H 1INQA 1JRHI 2QQNH 5EU6A 1QFWM 5G4MA 1EZUA 1JHLL 4P2RB 4RFNC 1K8DA 3ARDD 4MS8C 5ISZA 4PJHA 1ACYH 4JFYB 2Z0UA 1G9NL 2Y5EA 2RJMA 2YPLD 4HMCA 3O6LL 3OQRA 4HZLA 2VZTA 1NCDL 1ZXQA 2CA3A 4ZBJA 1DJXA 4FFWC 3JXAA 2F15A 4LLVA 3K1KC 2B20A 5B7FA 3X17A 4EN2A 4UUJB 2XN9E 3TBVB 5HHXH 2YPVA 3H7BB 4G6JH 3RURA 3II3A 5K1JA 4HH8A 5IM7B 5JW4N 2V2WB 3IETB 3IFOB 1A6VH 4KROC 2ZP0T 3GTTA 1XT5A 1FVDA 3D7PA 1KLFA 4MJ5B 5IMMB 5JXAL 3SKUD 3KPMA 4FTVE 4ENED 3FONA 1RURL 1O6TA 5JHLA 5M94B 4EDWL 4GY4A 3FO0H 2WAQA 1CR9H 2CCLA 1OM9A 2IH8A 5DK2A 1NDGB 2ITDA 1H3XA 1GZHC 3OPZH 2MNJB 1IILE 4EE2A 3Q3GA 2CK0H 1OCCB 2R0KH 1QWNA 5CCGE 1YDPB 1MJJA 2WWOA 2YPLB 1A7PL 4DK6A 4HK3N 5FB8B 2CO2A 5IB5B 2EDBA 4OCSL 3HG3A 4XP5H 1J8HD 3QEQD 2IV9A 4PTUB 1L7IL 2EDRA 1VKXB 3HC0A 5MEND 3MGAA 4R4BB 1PZAA 4W1TA 1EA9C 4XGZB 1F8TH 5FGSA 5AAPA 4MJ2A 3T1FA 2K4WA 2V3FA 2R69L 5TF1H 1NPNA 3K74B 1RP9A 2OR9H 2FUTA 1NCNA 1BGXH 1WBZA 1G84A 3RAJH 4AL8H 3QXWA 3RGHA 1UWXH 2J1YA 4H26A 5TQ2H 4N2MA 3T4YA 1O6SB 1GHFH 1CS6A 5GRXG 2IDFA 1G5AA 1WAAA 5AW6B 4LSPH 2PP9A 1WE5A 2WNXA 1XH2A 1YO4A 3JVGC 2HVJA 1MIMH 5F96H 4D0DA 3U4AA 3OR7B 3OZKA 4MAUH 2NNAA 4ZXBA 4XO3A 1BZ7A 3SKMA 4WEUD 4GW4A 1E9QB 3FT3B 5E1QA 1HEZA 2C8NA 3TPUA 4EIZC 4R7NA 1F1DA 2AZUA 4D3CL 3LKSA 2D7PA 5DURB 4MDIB 4LMQI 5AENA 3L5IA 3ZU8A 4ZFOA 4O2FB 4LAQL 4U6YA 4XNZC 4XC3H 1MFUA 2AKRA 3OKKA 1FA4A 3MRQB 4NZFA 3V5HA 1MHHA 1W15A 2KDGA 3DUHA 4JPWH 2NY5H 4XBGB 1SNRA 4NPJA 3UCQA 1F97A 2VQUA 5DJAA 3DYPA 4JCMA 2MJWA 3WNPA 3VXQB 2MH4A 2H1XA 1KV7A 4APXA 1T21A 2VYRE 4TUUA 3KCPB 3PQYB 3DI3B 4N24A 1D6EB 5GGQH 1GYUA 2FQGA 5JDSB 5J13B 5I15L 1ZTXL 3D07A 2F8OA 2WKOF 1U8IB 3GO1H 1B2WL 3RHWK 1XBDA 5IW6B 5CR1A 3W37A 4HG4K 1QR1B 4PJDB 3GMRA 3IKCA 4NZTH 3D34A 5FGCB 2BIMA 4IBUA 5IKCA 3LAFA 3QP3A 2HAZA 2OZ4H 1RZGA 3IDUA 1UYWH 5ISZD 5GGTL 3P40A 2AAAA 2ADGA 3BP4B 3HI5L 1BSIA 5DMKB 5JOFA 3FF8A 1A6PA 4PJHE 1HQ4A 4ZK8A 5I6LA 2BH0A 2FJGB 4Z8FL 5E1IA 3EJRA 4PRIB 4ZW7A 1T21B 1IQWH 4JFSA 3S0PA 2VDRL 2ZYRA 2H0PA 5I71C 4BHUA 5KSVB 3Q8CA 5AALA 3P4MA 5EPMB 4DEPB 2L0DA 2BC4B 4G8EA 3NZHL 1VJSA 3CE1A 2CIKB 3MBWA 3CVHL 5DUJA 3N42B 3BVDB 4ZAKC 1UGNA 1UWXK 3VACA 4E42A 4M6OL 5I5MA 3DA0A 3WKNA 2A74B 5E23A 2YK1H 3ZHKA 3AQYA 4PV1C 4R7VA 4X7CC 4P2QE 3VFNA 1IT9L 4F7CA 5EN2B 4E9SA 3NSJA 1WTGT 2A6KB 1F90H 4G80A 2KHAA 3P0VL 1UZGA 4A6YA 5KSUB 4XWGH 1PQZB 5LBSH 2XSKA 3ATDA 4G82A 1IJ9A 3TFBA 3N2JA 2WBJC 4OQ1A 5C2BL 1A1OB 1MJ8L 3QWQB 1WF5A 2W9EL 4PTTB 1AD9A 3SGDI 2R29H 5I8CA 4HWZA 4JG1L 4LOVA 1IAOA 1I1AD 4BH8B 5AEAA 2QR0B 1CDBA 3OAYH 1PKQA 1R3KB 2OI9C 3OKEA 4FLOA 5IBLC 1BQUA 4ZW3A 1JYVA 3ZKND 1RZJC 2A6JB 4LGSB 1HHHB 1T83A 3HOGA 4QRSB 3KDPB 2OR8A 4KK8C 5CLYA 5AZEH 2R7EB 1A3RL 2P9RA 2BPBA 2I07A 5F9AC 4F7PA 5IFAH 5DQDL 2G2PA 1JAEA 1E3XA 1OIOA 4YE4H 3GMPA 3H8NA 2Y3AA 5LNGA 1GGTA 2K6ZA 3WL9A 3VE0B 3MOBL 2EUWA 1I3GH 1ZDQA 3CSTA 4KI5F 1XSJA 3UG3A 3MLRL 3VMNA 4WI7A 2BSRB 5KBLA 3QNFA 4J12A 1J1XH 4BUQA 1WH0A 2F1BA 3QDJA 1FVEB 3KNBA 5DDHA 1ETB1 1AMYA 4UIKH 3BFQG 3RIKA 3G08A 3U2SB 3ARQA 1Z0NA 4NP9A 3NOIA 2R1WB 4U6HA 1KLFB 3H9SD 2NZ9D 2OV0A 2P45B 4K3EL 4V1DA 4DN4L 3F8UB 5JW3L 4HSCX 1FCGA 2HX7A 1ZHLA 2DWTA 5BZWA 4IGBC 4Q9BA 4WSKA 2EXTA 5DD1L 1PD1A 4JO4H 5F7BA 3SDCB 1KLGA 3M1CA 4TQIA 3RGVC 4OT1H 3T6ZA 3NCJL 5HTSA 4ANKA 5D1QB 2FO8A 4OUUB 3QZWG 1T0MB 4HX1A 1U8LB 5J6GB 5BZDB 4O58H 3OAWA 2BNQB 3APMA 4OF7A 5JQ6L 1JGDA 3CXDL 3VXTB 2NY4C 1OF2A 4G7QB 1CVSC 2AQTA 4LU5H 2XQBL 1PU0A 4Z3TA 5IROD 2ZCHH 4BWUA 4KNUA 1NMCC 2X1WL 4QI3A 4OJEH 2J8UF 2R59A 4M1CC 1MWAA 4KNQA 4OZHA 3PCYA 3QRLA 1FFPB 3BH4A 3WD5H 2XFXB 2PO6D 3OKDA 5K59E 3D50A 1TVHB 1HYSD 1MHHB 3HJEA 4ENZA 2VXVH 4U1GB 1OF0A 1J10A 4ACTA 1DQMH 2BJML 4AM0Q 1K2DA 1K8IA 3DRQA 1L3NA 3LQAL 1NDMA 1XXFC 1UT2A 3SDCD 2QZQA 3MROA 4V1DE 2BVOA 2Z6FA 3BD4A 5B7EA 4J39A 1MRDH 2EABA 2G3MA 3HE7A 3O9WC 3TBTA 3NSXA 4N9OB 4MSWA 4ZQKB 4N4YB 3EGSB 3RG1C 2PLTA 1PY4A 1AYRA 1FGNL 1JZJA 1NAMA 4FQIL 4H8HA 2ZCKH 4L8SA 4LSVL 3MLRH 5E99L 3T0WA 1P6AB 2C7UB 1YMMA 4FTDA 1BZ7B 2RB8A 2B08A 3LRLA 2AVFA 2H3NA 1W0WA 4N2DA 4XX5A 4UF7C 2F58H 4K7FA 2AK1L 1MVYA 2VLKE 5I8EA 2K0RA 1NLBL 1IGJA 4FX5A 4X4XA 1BZQK 3GEFA 4M9OA 1GJUA 1KGXA 4WFEE 1EANA 3BEWB 1GS6X 4B9JA 3D08A 4OLYH 1IGMH 4AUYA 4DGUA 3RKPA 1N6VA 4K23H 4DGIL 1F4WL 1HZLA 2D03H 2XLLA 3WTVA 3BZEB 1IE5A 2VQTA 1M2VB 1OW0A 5HGGS 1XH3B 1EWHA 1PSKL 2Z34A 3IBEA 4QGTA 3IRZA 3KLAB 3BEWA 4Q58C 4P5TC 1QVOA 4FXGB 5F8QC 3AQXA 1BJMA 4H0LC 4OM0H 3F12B 3CLFL 2EC9T 5F3BA 3PDOA 1BLIA 5F96L 3GIVA 4OLWL 3UTTD 1MI5D 1ZAGA 2FZ3B 5TE6L 3QDME 1A7OL 4L1HA 3IFNH 1DQDL 3EHBC 4NKQB 2CDFB 7FABH 3UP1A 1GJWA 3OG4B 3ILPB 1NUGA 3FW6A 1ZHNA 2BHYA 1SBBA 1P9MA 3O6KH 1INDH 3AY2A 4NGHH 4UI2A 1P4LA 5EUOF 4PJBA 3MZGB 5JA9A 5EV7A 4MZIA 1THCA 4OJYA 5KVFL 4ODTL 2LABA 1SN2A 3QHTC 3C08L 5HI3D 1NCJA 2DRUA 1WYJA 2FLRT 2FH6A 3P9LB 3QIWB 1QUNA 5DLML 2FYYB 3MV01 2BVYA 3GBNL 4BDVA 4Y8DC 5FS5A 1AR2A 4HJGB 4JZOB 5DUML 5HHOA 4CNIA 3VXMA 3ES6B 2RFXB 5FCUL 4CU8A 1VRSA 1AP2A 4LQFH 1B3IA 2E8ZA 1M7DB 5F6HI 5HGAA 3MZTA 1XB3A 1BFOB 4WFFD 2NQ3A 4MXQC 3RWGA 1TUPA 5JHDA 5ITFA 2F1AA 2GBAA 5EBLB 1YAZA 1KTKE 2P7TA 1PY0A 4HWNA 4IOIA 3VJ6B 3FL7A 4GW5B 3JQOB 5IJDC 4D2NA 5C2BH 3O3BB 1UCBH 3A67H 3ULVH 2IANE 4FL4C 4M93B 2YSTA 1FGVL 3P0VH 1UM4H 3VMPA 3B9DA 4CILA 1I7ZB 1RUMH 4O2EB 4H25A 1SEBB 2MPAL 1CD8A 5BRZA 1S2EA 4N68A 1Z9SB 3DSNB 5BV7L 1O9ZA 4KNTA 3V5HB 4ONGH 3FOLA 3V4LA 3PABA 2XIIA 4HMDA 2YUZA 2CKNA 4YFDB 5T1JA 3S37L 3PJSA 4AIOA 3LB6D 2DM2A 1ETZA 2WVVB 3EBHA 3S4SA 5IHZA 1A65A 3UYPB 2XN2A 1GYVA 4J3OC 2AJVH 4UZGA 5CEYA 1RK7A 3D69A 2GFBB 1E6OL 1X7QB 4OB5H 2DWEB 5CU9A 2ITFA 5F7EL 3L3GA 3PUUA 3BIAX 1MFAH 3T2NL 5MERA 1E6JL 4KQ3H 2O30A 1SMDA 1QBLH 1ETZB 1IEBB 4LASL 4F7MA 1W72L 3T6QC 2VN3A 4WTXA 4BIKA 4U33A 2ZOWA 1C5CL 3I85A 3EYSH 3KPRE 3TT3L 3MODL 3FRUA 2YR3A 3KPPB 2GJ6B 4F5CE 5AUMA 2DQHH 4OGXL 4O2EA 1JPGB 5D7JD 4C57C 5LGYA 1RUKL 4M1DH 4QOKD 5KVFH 1O9WA 3WENA 5IJKC 5GGUA 1U8OA 3U4EB 4Z7UF 4AEIH 2QZ5A 4HGMA 4AENA 2PWHA 3OHXB 4R9HA 4YFLF 4TRPL 2X4UA 1SF3A 5E9AA 4UQBA 3A0OA 3MXWL 3TEXA 1KIPB 3ZDZF 4L8CA 3JTTB 5DS2A 2CXKA 2PO6C 4PWKA 2Y23A 2L8AA 4P5TD 4PJIA 2BIQA 2KI6A 3U0WL 3LNFA 4HU2A 4I18A 1YYML 4UT6A 5E2JA 5IVXE 3IDXL 1FL3B 4JO3L 3BQUC 4R4NC 1YAIA 4DP4X 3WLBB 1ZS2A 4ODHL 4XMZA 1OP4A 1XSKA 2CHWA 5ADPL 3C6SA 4G8IA 4D7PA 5I73B 2WZPD 1OAZH 1PDKB 2IEPA 1TSRA 3TESA 3O4LB 3STBA 4CSTA 3L3JA 3BUYB 2XWBB 1HQ4B 2BIIA 2J8UA 5IMMA 1A4AA 5IUSA 2EH7H 4X5WB 1D2PA 2YRLA 4YIQA 4R97B 5F44A 3ZGIA 4D9QD 1IVTA 3QIWC 5AKVA 1XGQA 1ED3A 3MACL 4KUZL 4P5TB 2WCSA 4PHZA 2ZKHH 2XJLA 3QUYD 1UYWL 4A39A 2V5SA 3ZDXE 4HWBA 4ZYKA 2NX5B 1RERA 3BAJA 3EGDB 1RUKH 4M1DL 5D4IA 3ZE2B 3BAWA 3VFPA 4BHUI 3LIZH 5K59F 4FCHA 4PG2A 1AVAA 4DO5A 5KWYC 1XGQB 2IGTA 1RI8A 3ILQD 4YGVA 4LIQE 3PWPE 1J05B 2DM3A 1GSMA 2YAEA 2EUZA 4N1EA 4EPSA 2BNUA 4AEHL 2XWBA 3QI9A 1JVLA 3BUQA 4WEBH 2AANA 4YHZH 3KYKL 4HV8A 5D5ME 5C8JB 1UWGH 2YXMA 1OANA 5J9PA 4KQ3L 4XCYB 4PAZA 1ED3B 3CZFB 5C7ZA 4YH6A 4S11A 3D87B 5F89B 5CLWA 1JF1A 4RMUA 1KTJA 3C2AH 1M2VA 1TYEB 4RFOL 4DN3L 2JIXD 3U9WA 1FQ9C 1Z9OA 3BUYA 1A7NH 4DPAX 1WP6A 5E5LA 3SPHA 3AT8A 5JORB 1ZT1A 5AL0A 5HJ3A 1NFDF 1F6AA 1MCIA 3VM7A 4PJXA 4MASA 4WTQA 3HA0A 4ZMVA 3F58L 1XDTT 4JFVA 4PRIA 3R4RA 2A77H 4EIUA 4LARL 3WG7B 3DARA 2DYSB 3ATBA 3FQXA 4S0HA 4JDZB 1YEKL 2ARWA 3CSPA 3GMMA 3GTNA 3QUZA 1BVKB 2Q87A 4PGCA 4UM9A 2AEQL 4JEGB 3RUGF 1I4FB 4G1MB 5I2IA 4EI5C 1I7UB 1M6OB 1X5GA 5JNYA 1CU4L 5AYQA 2A6IB 3K4AA 5I8OH 1JZ4A 1N3NA 2VE6A 1H0DB 2F54B 2X40A 4R4FL 3WKML 5TQ0H 4U3XA 3LV3B 3UZEC 1RVFH 1RZFL 3U6RA 4PJXB 1I7TA 2JJSC 4JO2H 4X8JA 2EEFA 3O8XA 1KJ2B 5JIHA 5BS0B 2CQVA 1SPDA 5DF0A 3I74A 1MEXL 1WQVT 3ALWA 1KJ2H 3PXLA 1T7YA 1KN4L 1WFOA 4LEOB 1KCSL 5D2LB 1IBGH 5ANMA 1J8HA 2BSTA 3CK0L 3L4CA 3RPBA 2HLEB 1KB5H 1EK3A 5K9QI 4BZ2L 3IE9A 1U8NA 5DRNB 4IMLA 3GLDA 2C9QA 4MLSA 4LCYA 3SCMD 3ISWA 2YAOA 4FQCH 5C09A 1PS3A 2FSEB 4X9HA 2NY2D 4KK5C 5AAWC 3X1NA 3DOSB 4F92B 1KTLA 3PP4H 3IJEA 1IFHL 4AYEC 5E2UL 5AW1B 1OAQH 1WEJL 3IJ7A 4S10A 4NKMA 2XT1B 5JDJA 2W38A 3PL6A 3VXPB 1IC4H 1MSPA 4XAKE 2BRRH 4QPEA 4M4RB 5J6HB 2AEQH 2D7TH 5JIKA 2MMXA 2XTSA 1BHGA 1JWUB 2B4CH 2IWGA 3CX2A 3X11B 3D1MC 5JUEH 2YKLH 1NBZA 4W9KC 3PJLA 3KVQA 3MLXL 3ZKQD 3VTTA 4ZS7L 2CDGB 3CVBA 4WRLA 1NOLA 4P2QD 3VXRA 5IJBC 2ZCHL 5FF6B 3BVNB 4YC2C 5DYOB 3SCMB 4ONGL 2CCWA 4QF1B 3EOTL 1KACB 1BZ9A 3LXCA 5JQ6H 2GJRA 3LTVA 4U4IA 4I1NB 3O0LA 1ZV5A 5GJTH 2KLRA 3SJVA 3FT2B 3GHEH 5B3JF 2ZOKA 4LLYB 3PREA 4NSKB 5CZVL 2EZ0C 3TS8A 4UTAA 2CGZA 3PRZA 1N6UA 3ZW3A 3HEIB 3AXHA 5E5UB 3UJTH 4YDVA 1JWUA 3WIIH 3RX8A 4TMPA 1EXUA 1NBZB 3LD8C 2LU7A 2IF7A 1KXVC 4LLWB 1UXSB 4DW2H 4F9LC 3GINA 3MRGA 1IAOB 2YOAA 2Z1PA 4M7KH 4FZEH 5C0CE 4TNVF 4DHLA 4YDLC 4XZUB 1GL4B 3P9LA 2BVUA 1NCAL 2F53E 5I6KA 5J1AB 3VD4A 1A02N 3QQNA 1BA9A 2GT9A 5TQ0L 2LU4A 2J4WH 4L4VD 4ODWA 5D7LE 5J3HD 4N2CA 5I71B 1XV8A 3AS1A 5L2JB 4HS6B 3EJYC 1MI5E 4ZO7A 4HULB 3ULVF 3MYJB 1DDHB 3HUJF 2WINA 5GS2D 3SOTA 3K71B 3FRPB 4XOBA 3TWYA 1KGWA 2AGJH 4FFZL 2EADA 3RA7H 2BRRL 1FNLA 2E8YA 4KXDA 4EUPH 4QHLA 3NESA 4HS8L 1U3HB 4ZO6A 4YHNB 3BAXA 1NGZB 5I75B 4DPCX 3RGBA 5GGSY 2XYCA 4ZAKB 1E3FA 2A6DB 2CO6A 4NN5C 4WJ5A 3ROOA 1ODAA 2BC4A 4RQQA 5EZLB 3WUWB 2VO5A 1JF5A 4KXBA 1VB9A 2Z4QA 1FAIH 2FIKA 2F74A 2GIYA 2FAUA 1KBBA 1AZNA 1J0ZA 2NUTB 3IJSB 3U30C 1S7SB 4G8GB 1AY1L 4Y4HD 2BSCA 2G0LA 3DGDA 5EEZA 4K5NA 3EXLA 4PJGA 3QDAA 4ZFZB 2Q86A 4UINH 3AGWA 3IS0X 5F1KC 1O6SA 4YSOA 2WQUA 3IPFA 2EKSB 3HVNA 2WLHA 4BFIB 2XU9A 1AZCA 2XWXA 5GRVL 2HTLD 4OTXL 4AYGA 2D0GA 2R56L 4MDRA 4JDZA 4Y4FA 1S7SA 3Q8FA 1M1SA 1JOIA 1T6WA 3NJHA 1KCBA 2WWNA 1CTOA 4M8RA 2WLIA 4JFFE 1ZK9A 4XVSH 4Z78B 1RZGB 2JB5L 1U92B 1YHPA 4JRXA 5DR5L 2AQSA 2FLMA 5DFAA 3I02B 1TZOA 4GAFB 1CL7H 4Z7VA 5A2JH 3ZDXF 4AMWA 1NA8A 4F37K 5FYKD 2ZX7A 1NDMB 5C2UB 1A9BB 1QWHA 4HPYH 1B4JH 5CEZD 3IGAB 4UDUB 3FCGA 2WNGA 3U1SL 4JFFA 8FABB 2IGFH 4N8CL 4DK3A 4ANUA 2ZNWA 4G71B 4S1DD 4XMWA 1XD0A 1OSYA 2BNRA 4NO2A 5C0BE 3S34H 2R27A 4KHTL 4AGQA 3H9YA 5D1QD 2YJLA 2FL5B 3OR6B 4XPBL 4WZ9A 3ULVD 5HHQB 1MXDA 2UVEA 2P8MB 5C0RL 1W72B 2AKRB 4LP4A 1KC5H 1VFBA 4ZDHB 4G7RB 5D72H 5BRZE 4IRJB 3B2XA 4KAQH 5E8EA 5LCVL 3H3PL 3MJWA 3OJDB 4KO9A 3WTUA 1ZTXE 4OF6A 4S1RL 5D1ZA 5KS9A 2HJLA 2VRQA 1CFBA 1VEOA 4NC0B 1MJ7H 2FEDC 3GI8H 3TH2T 1PL3A 2WUBH 2VDQB 1XAKA 4JM2A 3U2SA 3ARGB 3WFEL 1AXTL 4XPAL 2G3XA 3HG2A 4HWBH 1IB5A 1UUNA 1T4KB 2JMRA 2YUVA 3RDJA 3SPVA 3UBFA 3WEOA 1NSNL 3CC5B 1B9KA 2AABH 3L5WB 4KY2A 3MOAH 1KDJA 4GKSB 3T6VA 1RVFL 1RZFH 5D7IE 3U0TB 3OXSB 1CN4A 3FNKA 4F8NA 4J1UB 1T2JA 4M5TA 2ICWB 5CCKH 4U4BA 1J48A 5B3SB 4BK5A 4NKIL 3DC0A 1MDTA 1IC7L 3TCLB 5EIIA 4QF1A 3QXTA 4QXVA 4JRWA 1FYTE 5T1KB 1MLCB 4F15B 3HN3A 4Q4EA 3OL2A 3K2KA 4CVXB 3FB8B 1CDUA 3EO1B 4L23A 3ARGD 3L5WA 4X6FA 4QTHB 1ZGLB 1WSST 3T09A 2FNBA 2IOIA 4JANB 1Y07A 3OMZA 4PGEA 1OZUA 4TN9A 3BFWA 1GRWA 5I0VA 3IXTA 4J3XA 2ENPA 1RZKL 2MQCA 2WBJA 4M02A 4KRPD 1IQDA 3L3OA 3U7AA 3W38A 4UTAL 5CWSB 1NIBA 2CHXA 5IB5A 2PPCA 5IEKB 3SBPA 3STLB 1I1AC 5LJYH 1FNFA 3V0IA 2R1YA 3Q13A 4Q2ZB 4EDWH 2GC7C 1F58L 2C5DC 1AD9B 3KL0A 5SV4A 5DRZB 4M93C 4FYTA 1VPOH 1FNSH 3APNA 2GABA 1T2QH 4DQOH 3KJ4B 4WI8A 4Z3EA 3T2LA 1M42A 3ARBC 5JW5A 3WIFA 2DWSA 2MOQA 1MI5B 2N1TE 4UT6L 1JZ3A 1QSFB 4EQ2A 4FABL 3C60D 1ZSDA 4HALA 3NFPB 2H9GA 4JK0D 3K2UL 1ZIAA 3LY6A 4PR5A 4Y5XA 5CCKL 4LKXB 1ORSA 4X6DF 2ZG1A 4FE9A 4PS3A 1TF4A 4Y4FD 1OAQL 3ZHFA 5FM5M 4DKDC 1LE5A 5TDPB 3UTSB 4GI6A 1KF9B 2HFGH 3Q6GL 4WW2F 4F2MB 1KB5A 4YE4L 2R69H 1N5AB 4OFVA 1HL4A 2DQFB 2DZEA 2Q5BA 1A0QH 3JV6B 4O02A 4Y1AE 1LK2B 3DO3A 1XCQB 3GXPA 1I1FA 2YD5A 4ZMQA 4YSAA 5C9JB 2YQ3A 4Y9FA 2EH7L 2YMTA 3IFPA 3P69A 5E7BA 2WUBL 1AHKA 2GK0A 3IDJA 2WXNA 3CPUA 4L4TB 5TFSH 3U4BH 4IOFC 3SE9H 2JXMA 1H5BB 4LOUC 2X9XA 2VMDA 2CJ3A 3CZUB 5JHLL 2WLMA 4KMLB 4ZFZA 2IG2H 3MV9A 3IJHA 4U6HB 4P23A 1TVBB 1FG9C 3S35X 1HTYA 1N67A 3MRMA 1RXLA 1C8QA 2HFEA 3X1FA 5TDPA 3UTSA 4BWTA 5I6MA 2HH0H 1WCBB 1PG7L 2H6PB 4UIMA 4Y4FB 5MP6H 3EH4B 3FUNA 1A6TA 3T0ED 2AJXL 3OMNB 2IH1A 4OCYH 3MSPA 3L3HA 1RUML 3LS4L 5HDBE 4N6RA 3LPOA 1FNEB 1SYVA 4BEIA 4X9IA 3RYMA 4O51A 4OIFA 3T8XB 2VERN 3FUIA 4L4TD 4ODUA 3FU8A 4LSUH 4PMFA 1J5OL 2KZWA 2CKBL 3VXMB 1R3LA 4PBXA 2ERJC 4DQOL 1AOZA 5C08E 2P80D 1CFNA 1LEGA 2UUDH 3C8HA 3ZDYE 3F58H 1P5UA 4JN1L 4QHPA 3S3SA 1J1PL 1DJWA 2YBRA 3B2VL 3GGWB 4J3OD 4NO0B 4YGVB 5T1MA 3O2VH 2JLPA 1H3TA 5FOBA 3RVTC 4HJJL 4AY0A 3LB6C 4JZNA 1J9TA 2FL5A 3GI9H 3KDMA 3GNML 5LO7A 1N26A 3F84A 3T0EB 5C0GB 3JWNE 1ASPA 3DV4A 1TENA 2VZ3A 4M48L 2QTEA 2X4SA 5K9OB 1EAJA 2NY3C 4ZD3H 3FB6B 1T1XB 2CPCA 4HF5H 5CP7A 1AQDB 4G11A 2QGBA 1ZPLA 3KHOA 1SDDA 2AJZA 4YWGH 5GGTH 4E0RA 2AJVL 2Y3NA 3BQUA 3N0AA 3AMKA 3A3YB 4HKXB 1UEYA 2B1AL 3KL5A 3PFQA 3PHAA 2MNUA 1DLFH 4MCZA 4PWFA 1SXCA 3EYQC 1M05B 2NY1B 1VFAB 2WK2A 4FQJH 4I3GA 3TCLA 3TIDB 4WWKA 1JZDC 1MNNA 4MA8H 3P4MB 1B0RA 2P42B 5DT1L 4MBRA 4LCCC 2VUKA 4NWUL 5D7JB 2VL5B 2I25N 3I50L 3RWHA 4Z7UB 4LSRL 4YBHA 3WNJA 1KJMA 4IKIA 5B1KA 3JZYA 1S3KL 1BWMA 1NBVL 4X6DE 1DQML 2BJMH 4BZ2A 5HJDA 5I30L 2YHGA 3DOHA 5I28A 3D2TA 3ASNB 1I7UA 4TLSA 1GKEA 4R4BA 3X11A 1C8PA 4K5PA 3AVEA 1DQLH 4IS6A 4DZBA 5LGJA 1L9PA 2BP3A 3QXUA 5T3ZH 5D9SA 5DK0B 3MCG1 1RJYA 2YEVB 4NQXA 4M4RA 1ACXA 4OGZA 1WUNT 4OZGF 1MCFA 3HI6H 1U8IA 3NA9L 43CAB 4ZMXA 1J11A 3JV0A 3PIQA 4FHBD 4JN1H 4NJ9H 1P84J 5FV2A 4EQ3A 3PWNB 4KI1A 4NHUA 4NQDA 1ZV2A 2AQNA 5KVDH 4YHNA 2XTJE 1F3RB 4XCCH 1ORQA 4RSYA 2CD0A 1C5BL 4WI0A 5EC2B 1WLHA 3HLAA 4F2FA 1YJDH 2V2WA 2ATPB 5GGRA 3CU7A 5INDA 1G1KA 1X7TA 5IFHH 3VD0A 1OTSD 4GG6B 5ANHA 5D96C 1DFXA 3G5XA 5JIQA 2PPEA 2P5EA 5DT1H 3V4UH 3FN3A 4NKDB 3K8LA 3SZ6A 4H5SB 4IRSA 2CG9X 3Q2WA 1J5IA 2G60L 5BPPA 2BINA 1KFAL 3S97C 3GSUB 5ID0B 4GSRA 3QUZD 5H4ZA 3NCBB 1Z5HA 1MHEB 1PX4A 4MAYA 4NAJA 5BJTA 5EZOH 1G7MB 2AV1B 3EBAA 5DVMA 3QO1B 1D6VL 2V8LA 2NQDA 2DH2A 3PWPA 4J3OH 3AFLA 1BECA 2MHAA 2QSCH 3FSZA 1S7WA 4KTEH 4MD4A 1ROCA 2E9GA 3SE4C 4ONFH 1G7QA 1Z3RA 5C0AB 2BP8A 5LQBL 5BZWB 5IEKA 1FE8L 5CEZE 3U6RB 3LNDA 2BOCA 2LTQC 5F1SA 1DLHA 3Q8EA 1OARL 3UAJD 3P4OA 4A67A 1DEEA 5C86A 3UG5A 2GHWB 1KXTB 4NKIH 4FHJA 1ESOA 4ILDA 5LKNA 4F57H 3ALXA 2QPUA 3E2HB 2PWEA 2EDDA 1YNKH 3CLEH 1JK9A 1AI1H 1B3JA 1V3JA 4PJFF 1AO7D 4OD2A 5K33A 4NNXA 2YN5A 3LH8A 3KVPA 2J8OA 2ADYA 4OZFB 4OCWH 3SKOB 3JWOL 5KYWA 3MRPA 1MRCH 2F9BT 5IOPB 4GMTH 2IFFL 5DZPA 1LEIB 3WUWA 5FOJA 2ATAA 3I3BA 1TVHA 4HAKA 1S9YA 5CP3A 4AT6B 5F7FA 3RKDD 4WUKH 5IB3A 3FU6A 3NCCB 4OIAA 5KSAA 4PJGE 4F3FA 2XTLA 1NMAH 1DVFC 2X12A 3HHRB 3RNQB 4TV3A 2DB8A 4J4PC 5KOVC 3LQAH 2W0PA 2I9TA 2IDCA 3T3PF 3ZDZB 1VGEL 2PW2B 3UC2A 4ATWA 1TQTA 2XG4B 5BS0D 1T03L 5FW6A 2YBRB 5D93B 1GR7A 3HIZA 4AQOA 4AT6A 1T1XA 3NVQA 2V8MA 1QBMH 1AO7B 4MGXA 2O93L 3ZRCC 1S9WA 1SEQL 5CJOH 5ABDE 3NJXA 3KYAA 5HYJB 3BP6A 4R97C 4LMQE 4EI0A 2XICA 5D7SH 1WGOA 5C0IB 2A9NL 4QWWD 3ROLB 3MNWB 2CNZA 1G7HB 3HG1E 3P11L 3PQYD 4IW4C 2X4QB 3ZKXC 2WVUA 2ZT9C 1V3MA 4N5ED 3FT2A 2VDLB 2I32A 4L1DA 5FA4B 2HLFC 4P3DB 1DYZA 4XVSL 1B90A 1JGLH 3MLVH 1Z32X 1N8ZB 1BLNA 2CLRA 3FCSA 1EEZA 5G4OA 4B97A 2LFGA 3BKCH 3N40P 4GO6B 4TUKL 2XC8A 5H35B 2YXFA 4P46C 5ISZB 2JH2A 2EDHA 3DROA 2Q6WA 4HUXB 1KCVH 3L5XH 4LOFA 1TMQA 2F7QA 3WFBH 2CIKA 3MBWB 4MRCA 1KXQE 3MLXH 2PCPB 2UZIH 4RH4A 4IBLT 4R83A 3L9YA 3VM5A 5DCCA 1H8NA 4KX7A 4P9HL 1EVUA 1WZ1L 2ZWKA 1U36A 2R9HD 3JBG7 5F70A 3SDDD 4HJ0D 1CJYA 5D72L 2WBWB 1BQSA 3KWWB 4MNQB 1FLRL 2NY4B 5I1IH 5J11C 1LK3H 3HN5A 5E6ZA 4FYQA 4O2CA 5E8DL 4JHVA 1IAMA 5FHAL 2GSGB 3DOSA 4QYOB 1E43A 2APBA 2FJHA 2QFRA 3MACH 4KUZH 4P23C 1I9IH 3KLQA 5PCYA 5E8OA 5IR1A 4ODSH 4YHKH 4KI5D 2GTZB 4ZSOE 4NZUH 5BMFH 3PAUA 3MA7B 4X4MA 3U1SH 3QAZC 4ATTA 3VMOA 1QR4A 5HGAB 3CFKA 3HLKA 3VSTA 3L3KB 4HD5A 1NGPH 2PETA 3N43B 3WY1A 4L4VA 3TVMB 1G9MC 2IXQB 4AE1A 5I0YA 1ORQB 1ACCA 5DLMH 3O8XC 5CZVH 4BWWA 3GM0A 1JPST 2YARA 2Q10A 1IZJA 2A6KA 2E9WA 5I1JL 4YBLB 1NJ9A 4UM8B 2Q8BH 5BOZG 1MCWW 2MKLC 1FFTB 3V6OE 2VSCA 2AK4E 1IGIL 1KTRL 4UNUA 4X8JB 4L4VB 1P1ZA 3TVMA 1FJ1A 3EGXB 1ZOXA 1XL4A 3EYVA 1K6QH 3B1UA 1YY8A 2OAAA 1H5BC 1DVTA 5DJCA 1XGYL 2ODHA 4BFKA 2Y5TA 1S3RA 1NEZB 2DEXX 4P48A 3HMXL 1E8XA 1RP8A 1DJHA 1V3LA 1ACZA 3RJQB 2LE9A 3CFCH 5M7QA 1CDIA 4K71C 2EDMA 3ABMB 1IGYB 1AQKL 2NNAB 4BSWB 3PJSB 2WIIB 1JNLL 5DHVH 3KGTA 4JE0A 3FQXB 4FJ6A 3TN0D 3W56A 1B9ZA 3K0WA 2R2HB 5K5YA 4NUGH 4XCFH 3BDYH 3V4PA 2OMUB 4JRXD 4JG5A 5E00A 5T8IA 3ULVC 1AR1C 4I87A 4HUWB 4L18A 2WB1A 4G6AD 4AH2A 4QT5A 2Z1KA 1QHOA 3ZXAC 1Q1JH 3HJ0A 3MRPB 2DOCA 3Q1SH 2VLKB 5IQOA 3VH8G 4M5YH 5DJZA 1PJ9A 3LDBC 2MCAA 1SBSL 4C59B 2EDKA 3UEQA 4M3JA 4V2CB 5FYJE 1FDLL 1CLOL 1R24B 1UH4A 5E00B 5C0NC 1A1NB 1RK1B 3CZKA 4HCRH 2VIRB 3NYKA 4M6NL 1R33A 2WXIA 4NO3A 5CKGA 3L4UA 5KBKA 2G60H 1QFPA 1EGJH 2A83B 3BPOB 5EU4A 5DYOA 3RB7A 4K3DL 3SCMA 1FWXA 3D25A 3U4EA 4FI6A 3CCHA 4F91B 3V4UL 4OLVL 5GZNA 2X9ZA 1KWGA 2OJEB 4CDHA 2GIXA 1SQMA 5E6UB 2YZ8A 4PG9A 5L4MA 2VH5L 3ULAB 3EYUL 4FA6A 4OUUA 5F7MC 4C8XA 4ZOEA 3S48A 5JW5B 3NPZB 1OSEA 3ZMRA 1QLRB 3G6DL 3RTLA 4R7NB 3QCTL 2X28A 4L3EB 2PTUA 2Y0SA 2GITB 2PO6B 4KVCL 1HNGA 2QLVB 3VFSB 2JB5H 3ZE1E 2WTRB 2RD0A 1QFOA 1MCDA 1RUAL 3SO3B 5TDOB 3TYGL 4JKLA 1N10A 2B14A 2YAFA 4N6RB 4PS8A 1FFPA 3G9AB 3H42H 5FK9A 4DP2X 2QLYA 3OWEA 4GKZA 4KRLB 4XNBA 1W8NA 3GLZA 2PKDA 3OXRB 4YHYB 1OARH 4I2XB 5IF0A 2K6YA 4WWNA 1I3RB 1RK1A 5JLZA 5LBVA 1IIIA 2DQUH 2EINB 4G6FD 4XI5C 3RVUD 1KBWA 3WBDA 2EYRA 2CRMA 3K6SA 1L9NA 3ME0A 4MX7A 5KJRH 3HZKA 3K81A 4YPJA 2WQRA 4JO3H 1JSYA 1U4FA 2KLSA 4WDIA 3D25B 4IOSD 2PNDA 4P57A 2QPEB 2GJJA 5D2NE 4DGYH 2ROXA 4MYPA 5HHXL 2JJVA 2UWEB 3HMXH 3PWVB 2VDLH 1PEWA 3RNKA 1SUHA 1E50A 2WSPA 3GRWL 4HK0B 4LP8A 1KYOJ 1KXHA 2QHLA 4R7DA 5SWSB 2HUHA 5I8KH 3TEYA 3FBQA 3GSWB 3Q1EA 2VQ4A 4WWKD 2OTWB 3QDGA 4Y1TA 5E4EB 5I1CH 4HLZG 3PHSA 1QRKA 1FI8C 1ZSHA 3HAEH 2CZNA 4NI6A 3FO2A 5T5FL 1ML0A 1CFTB 2OR7A 3L13A 2R4RL 1V5JA 1BD2A 1SDDB 2AJZB 4TSCL 5ITFB 4XMUA 1NANI 4NKOB 3LVEA 4G6FB 4XO5A 4LDEB 4ZFFB 3QWRD 5DRWB 2Z8VC 4X5QA 5D71H 5F9OH 5I75C 4LPUA 5T1KD 3IGUA 3ARGC 3AADB 1WITA 3NFPA 4KU1A 5D7SL 3TBYB 3X3GH 1A14H 1JUFB 2HJLB 1ILSA 3GTVA 2ED9A 2UZXB 5FW7A 1JWMB 3GFUA 3D85A 3WFDH 1A7PH 4FXKC 3D05A 1A4KA 4MS6A 3UADA 1E4XL 2DDQL 1NCWL 3LZNA 2XFXA 1G5GA 4FLSA 4EZLA 1LHZA 1ZLSH 2Z7WA 3TFKC 3CHQA 1YEHH 3OAUH 4X4KA 4L37A 3ABLB 4U1NA 3RY6C 3KZ8A 5L2JA 3L1OL 3BH8B 3D85B 3VQ1C 2VW6A 3S6CA 2B9AA 1T04A 4N22A 4LB8A 3NP4A 1Z3GH 3ZL4H 1JDAA 1HIMH 4TVPH 2J55A 3KM1A 3FB6A 3VD5A 3DX8A 2X1PA 2Z31D 1MRFH 4A7GA 1J8KA 5I30H 1BOGB 1J1OH 2IBZY 1Y1DA 3H2WA 1I4FA 2XZCL 3O2DL 2FX8H 4G1MA 5I2IB 4M7JL 2VISA 3SDXF 2JKNA 2FEDD 3CXHJ 4DVRL 2R51A 3K2IA 3ILQC 5JQIB 1ODUA 3NJJA 3Q8AA 2QT6A 4IOIB 3VJ6A 1WZLA 3IBOA 2NY2C 3HRZB 1BAGA 4BZ1A 3W9DA 3WFCH 3MUJA 2JE8A 3B2UC 2NNCA 4Y5VC 3OC5A 3EYOB 1B6UA 2F1EA 5E7FA 2XBDA 3DJZA 2VN5A 3KYOB 3NABH 3PGCA 4I13B 4YR6A 2EIBA 2DYRB 2IVFC 1LEIA 2ADFL 1V05A 3TNNA 3VX0A 1T0NB 1LDPL 1MKFA 2IDUA 2CJSA 3OLEA 4JFDA 4LSQH 1T7ZA 3VD1A 3QW9A 4LIQH 4DP9X 2FWSA 3U9PH 1F5WA 1KBGH 1F4YH 1BEYL 1NCCL 4N90D 43C9B 4AK1A 4NLAA 3F85A 4ZMPA 4E68A 1MEXH 2I07B 4N90E 1U8MB 1YYCA 3QXVA 2BVPB 4U6XB 3D4GA 1DLHB 2C9VA 4ZFGH 1HXYA 1GZPB 5I1DA 1DFBL 2YGOA 5IMLB 4K9EC 4R6UA 3K6NA 3KPLA 1UXWB 4HEPG 4PRBA 1S7WB 2R4RH 4MD4B 2WGXA 4K4KA 4IBZA 4WFGD 1EZSA 3OAUL 1KTLB 2ZQKA 1BF5A 2NR6A 4M43H 5LDSA 4LPVA 2E6QA 3FTZA 4FCAA 3PNWA 4ANWA 3BW9A 5EOCL 5MEOB 3KW7A 5HHVL 3PL6B 2WAHA 1WDAA 2CHNA 1LK2A 4GG6F 4EZMA 5BQ7B 3LN9A 2VZVA 2GC4C 2JLLA 2VN4A 4I5BB 1RUQL 3NIDE 2V9RA 5A7BA 3VXMD 5B3NA 3M8OH 2X2HA 4KXAA 4KAQL 3HZMA 3S35L 2EILB 1WD8A 1CGYA 4M4PA 5CNHA 3W2DL 1CBVL 3RDTC 3ZSSA 4PB9H 3VXME 3BLPX 1SUJA 5GHWH 3GS7A 5AAWA 1MHPH 1EHLH 4PWHA 4QOKB 1WUZA 2DI8A 3S34L 5HHNA 3LQMA 2BVTA 1D9KC 2KUTA 1BQ5A 2PXYD 2GBUA 5D6DC 1V27A 4M5ZL 2AEPL 2NY6B 2HJKA 3MCLL 4HHAA 2GUOA 2IV8A 5E08H 3LRMA 1T0PB 1YEWA 4NYLB 2Y9RT 5I1GL 4XN4A 5GSRA 4LCVA 3V6ZA 1BPLB 2C1OB 1IFGA 1CT8A 3IWUA 3T0EC 1MVUA 4U7KA 2OTUB 4JM0A 5ADPH 4H88H 1J0JA 4GG8B 4JFOB 4S0TD 3B9AA 2ZUQC 3CLFH 3KJ6H 3T4AC 2B8OT 2LVCA 3UGXA 1F2XK 2Z9TA 5HY9A 4D0CB 4MA7L 1Z9SA 4ZFGL 5DUBA 3KWUA 4GMSH 1MJ8H 4ZQKA 1FHGA 5E8NB 3VH8A 4V2BA 5F7KC 1QFUH 3MRKB 3HFML 1TEFA 4ABWA 4GG8A 4JFOA 3WV0A 4ISVB 4E9RA 3FB8A 3TVMC 1KOAA 3MX0A 1WZKA 1EAQA 2I9LB 4PY8J 3SDCC 1YPZF 4AQ1B 2WXFA 4ZNCD 2PTVA 3OKOA 2V9UA 1UM6L 4YBQD 2XWTB 4Z6AT 4FNRA 3RFZB 2O6EA 5DZAA 5DJAB 1GTNA 3TC9A 4L3CA 4AYBA 4N28A 3GXNA 1YEDB 1XF2A 2NY0B 2NXZC 1DFBH 4NQQA 1AZBA 4RMRA 1LO5A 2HG5B 3QULA 3HG5A 4JO8A 4OKVA 4NBYB 2JB6B 1JF1B 4KZDH 4YDMA 1AQHA 5JO5A 3N50A 4NM4H 1D7BA 1CE1L 1GZQA 3PNRB 3DMMC 2ROYA 5E5MB 1HZHH 3ATFA 1AC6A 1JGIA 1OSZB 3HG1A 2DLIA 3HVDA 3CDZB 3O3EB 3UBXG 1TJGL 4Q56A 1XCWA 3PGFH 1JGUL 2DLHA 3IMSA 1TCRB 1J8HB 1J0YA 2BSTB 3B9VA 3MQIA 4B53A 2WOBA 3QJTB 1QEWA 4PJBE 5INCA 2J5LC 4LBEB 3WDJA 2E74C 3OHMB 2WZPA 3UMTA 1R0AH 1Z1WA 2BSDA 3MNMA 4DNLA 3JYBA 2MTAA 4HA1A 4JDEA 4NENB 4HPOH 1GGIL 2BO0A 5I76B 5IVNA 2OXGA 3FT4B 4AMKH 5D9SB 3MRLB 1B2WH 2ZUXA 2NY0D 2DQUL 5I0WA 4PV8A 5I23A 3IMRA 3JYCA 4PJ5A 5F3HA 3NIDF 1MAJA 3CD4A 1MRDL 3TBWB 4AW7A 5FLVA 1WC7A 1F1AA 4X4YA 4GBXD 4B60A 4Y9EA 1JGEA 1U3YA 4K9EH 4P46A 3HC4H 4ETQA 4Y4HA 1VZHA 2A83A 1CB4A 1YEGL 1RZ7L 2ZXBA 4HSQA 1M9SA 5HD8C 5E1AA 5HDWA 5AD0A 4NOFA 5F6HJ 3U1QA 4E9WA 1JV5A 3LQZB 5HXMA 1KB9J 5LVEA 3C5JB 1HHJA 7PAZA 5DURD 4E41E 3OZLA 1AFVH 3GUFA 2B39A 3KXFA 1NEPA 2CO3A 1FC1A 1DVFB 1LD9A 3P73B 1CVRA 4YHIA 2CIIB 3FZUC 2ALWA 2I60H 1RMFH 4BA0A 2HTLC 3S5LA 4TSBH 3ECWA 5E94A 1E8ZA 1SMAA 1GYCA 4GBXB 5KVGL 3HBPA 1TZHA 5C6TH 1IRAY 4B3EA 3DURA 3QQDA 4BV1A 5BCAA 2K7QA 3DSFL 1XIWA 1R0AL 4A2FA 5CEXB 5KS9B 4HIJB 1MF2L 1AS7A 1ZLVK 3K80A 4RMTA 2X6CA 1ILUA 5LBSL 5AOKA 1SJHA 2O6CA 1CZ8L 1F02I 1P5UB 1A8ZA 4FD0A 3Q9QA 4FFTA 2UUDK 1G9NH 4OI7A 4RNRB 4HP5A 1AR1D 2H5UA 3G04A 3IDIB 2C9RA 5EC1B 3UDWC 3MKGA 1BBJB 4UV7L 5DD3L 3DVGB 1DVFD 5CSZB 3IU3B 5J5EA 1U8JB 3B56A 4XVJH 3N42F 3TA3D 2JKSA 4I8DA 5KSUA 4A6YB 3HZVB 1JFQH 4HH9A 5D7LB 1XR8A 5FO7A 5C0EB 1MCQA 3BGFC 5CZXC 2CRZA 3MTRA 3VSQA 4RNRA 4RFEB 3SDDA 1X7QA 3CH1A 5I1KH 4LIQL 1XMWA 1AS6A 5C0CD 3L3GB 4AK2A 3I84A 2RMNA 4PJ7E 5I74B 1DUYA 1NAKH 5KYWB 4JW3A 3CN0A 4PRPE 1F90L 1CCZA 2ZXQA 1UACL 4PGDB 2UXVA 3N91A 4W9JC 2LOEA 5GJTL 4FQXC 4OIBA 3BVNA 1GGBL 4PREB 3QIBA 2ADGB 2W92A 4P2RA 5HI3C 1UGKA 4UU9B 1NC4A 1YJDC 3BAYA 2Z64C 4TNVK 1AR1B 3WDHA 3FO0L 3ZX1A 3QH3A 3A4AA 3W82A 2Q1EA 3QR1A 3LIZL 3RZCB 1UXSA 7FABL 3QYNA 4WW2C 4RRPG 5HY9B 2HRPL 2AEOA 1JIBA 3GMQA 1XF5B 2EDOA 5FO8A 4BD4A 1IM9A 4JN2B 1G7MA 3MNZA 5FA3B 3TO2B 3LS5H 4X99A 1QLFA 1HAWA 4AQEB 4I7ZC 3T08A 5DC0A 5C6TL 2MHAB 2YD9A 3GM8A 1ERNA 4CBPA 4R7DB 1A4JA 1YN7B 1CLZL 3EOAB 4KITB 5EEUA 1ES0A 2J4WL 4ADGA 1B2YA 1KGUA 4PMEA 3V5KA 3ZIMA 2CRYA 1JG9A 3A6BH 4R26L 4WDIB 3SDDB 3UTZA 4CVUA 4WK2B 5ANME 1PGRB 4IBSA 3NJKA 1F4XH 4P57B 5AL8A 1L6PA 4JPVL 5ETUB 2LVEA 4YN3A 1UADC 3Q3GB 3FCBA 1EDYA 2EDWA 3BQVA 4PRPA 3VGAB 3MOBH 1SN5A 1D5BB 3LXAA 2EXWC 5JOEA 2DQDL 1GOGA 2QELA 1YQVL 3EDDA 3VDBA 1NGQL 4ANXA 3TH3T 2AV7A 3VQ2C 5HHMD 3MLWL 3L1EA 4TL5A 4XBMA 1UKTA 3F7VB 3MRCB 4NRZA 3IF1B 4GKNA 2YA1A 5DMGD 1DSFL 1TIUA 3CQQA 5TDOA 4Y2OA 5C0FA 4HS6A 4PV9A 3SQRA 4MAUL 3RUGB 5LDUA 4J4PA 4TSCH 1SXAA 3OKEB 3RWDB 3A4EA 3T0XA 5T5FA 3VWKC 2EUVA 3TBYA 2BNRB 4NO2B 4X98A 4I85A 1GOFA 2ARJQ 2P5ED 4I9WE 2XV0A 3T4YB 3NCJH 4Z95L 1KCRH 2B16A 2EUXA 1NL0L 2F19H 1KTDA 1LVEA 4KVPA 5BZXA 3SDXB 4LVEA 5H2BA 1TEYA 2HZHA 4XPFH 4B9KC 4HIPA 1KZQA 1IL1A 4R96B 3ZQWA 5DGRA 4XAKD 2E9JA 1FNGA 4G8GD 2VIRA 1GIGL 3L4TA 1NGWA 4GH7B 2WC7A 3ARUA 4Z78A 3LZLA 5KJ4A 4R90L 3W5MA 2DY2A 2H2SC 4PJ5D 1G94A 4R84A 4GKOA 3AWEA 5F21B 5KVMC 3CN1A 1FYHB 3P73A 2WYHA 4JZJB 4PRHA 3B5TA 1FNGB 4XPHL 3GSXB 1TQBC 3N04A 4YHPA 5K93A 5FO2A 3FDWA 3U0TA 2EVFA 1QD0A 4DK5A 3WY2A 5IGXL 4QTIL 2CLZB 2BNQD 5CJ8A 4YDLB 2JCCB 3M6DA 4QHUA 4KHTH 3Q5YA 1HCZA 4AYDC 4XP9H 1S78C 3BZ4B 2CM6A 1BMZA 3E3QC 3MV9E 4UTBA 3HRZA 3RI5K 1RZJL 2IGFL 3GSNA 5BVPL 5DEJA 2X4OA 4P5RA 2X9YA 4NN6C 3QJQB 5C0GA 4JDEB 1A6VL 2Q3ZA 4YSEA 4QDGA 2FWUA 4OKDA 2R15A 3BGFB 3V0GA 5IVZB 4RX4D 2APSA 2XY1A 1RIUH 4L8DB 3PXJA 4PJ5B 3MJ8B 1CC3A 2G30A 2NDFA 5IZ7A 1XGRA 2BVQB 1VIWA 3GMRB 1O6VA 3VB8A 3G6AA 4NN7B 4Z95H 4O5LH 3UACA 4QHLB 1FRGL 2Z4TA 1AKPA 8FABA 4OCXL 4EIBA 3CVHH 4F7MB 1BYNA 4QAMB 3E6HA 4ZDHA 3BHBA 2YD4A 1L5GB 3NJFA 3UPRB 3WJMB 3QA3A 2FBOJ 4KUCD 1OP3K 2A9NH 5E6IB 1BPVA 1P1VA 4IRJD 5CN1A 4RRPM 2UXGA 5EWIH 5ACLA 1IIKA 4XVUC 1Q9KA 2OKMA 4ZTPL 3T5WA 3LKOA 4XWOD 4KGLA 1WIOA 3VXSA 4L3FA 3QS3A 2HT4C 3QCUL 5JW4R 1XB8A 1AGEB 3S8FB 4MHHI 3WNNA 2BP5M 1DBMH 1HFUA 5D2NC 3HUJA 5D1XE 4PVBA 5L0QB 3APCA 4O2FA 1CUOA 2YAPA 1I3GL 1KGCE 4QTIH 1XF3A 1GKOA 5DWUH 5A6MA 1JHKH 4NHUB 4GXUN 4ODTH 4AVKA 1SEBA 1X5IA 3JT0A 4FQXA 4KKAC 5JXED 3BKYH 4FQ2L 15C8L 1BGXL 3MREB 4J23A 4ODXB 1INDL 2E7HA 2UV3A 43CAA 3CPLB 1RUQH 4AQEA 3EJZC 3MBXL 3CZJA 4XPTH 3CVHB 3KPRA 4FS0A 1HS6A 1AGDA 5AVRB 5DHYB 1IEAA 3UTTB 3QISA 4Z7OE 5CBEA 4Z7QF 3QFJA 1IKNC 2H0EA 3FMGL 5MEQA 4ACPA 4NM8L 1UCBL 2AERT 2O5YL 1NMCB 5HVHB 2WM0A 2JXMB 4N2NA 3QUHA 2VXUL 1PDKA 3QQ4B 3CSYB 4KY1H 4F7EA 5JHDB 3D4CA 1YEEL 2XPZA 5KVDL 1TT6A 4QJ4B 4QRTA 1IC0A 2UWEE 1KIRA 2PR9A 1HEHC 1JZFA 1WIUA 3UEZA 1CDYA 1YYLL 1HI6B 1MXGA 3TJHD 1I1RA 2EE3A 2VXQL 2XNAA 5DMIL 4LZKA 2DLEA 4AL8L 3VFOA 3DJ9A 1OTTC 2MPVA 2ZG3A 3O4OB 1MLBA 3FQNB 1VADB 2BCMA 4WO4C 1IM3A 1A5FH 1K4CB 1L7TL 1CLYL 2WLLB 4D7BA 4AUUA 3NQIA 5J0BA 1YNTF 2DQCH 5HVWA 2ENYA 1I53A 3Q01A 4Q9CA 2AEPH 3FH7A 4Z76B 1JZ2A 1G4MA 2IH3A 2H32B 3BAEL 4CVWA 1IM3D 1TOXA 4AL8C 4TUJB 2DBLH 1TKWA 1QSFD 4PJ9A 2Q2LA 3QZWB 5KYXA 2WD0A 4FLRA 5H8DA 1J87A 1FAIL 1OGSA 1VFUA 1E9PB 2J1ZA 4GLRH 2X88A 1R3JB 4B7LA 5I82A 3NA4A 3MLSL 4HIIA 1UH2A 1T0OA 5DD3H 3DX0A 4MXQD 2JKWA 4ERSH 3WTXA 2JV6A 4PJ8D 2BX5A 4UNIA 1HWHB 3ZPDA 1IX2A 4JQVC 2K6WA 3UTSD 3H53A 3IETA 1NFDB 3F7QA 1G4RA 5BNXD 4WHYG 4TKWA 2XRAH 2VJXA 4PIBA 3JUZA 4R0LA 3WN5B 4IDJL 4LSDA 4P3CH 2IBZX 2VLME 4U1KB 2IG2L 1NCUA 2EDJA 5DHDA 2WSDA 3AM8A 4TSAL 3FQNA 1NLDH 1M71A 4MLIA 4QOKE 1IM3B 1K4CA 1QTPA 4OZFA 4PI2A 4TPRH 3EYFB 5DO2C 1CI5A 2VLKA 4ZQTA 5GJSH 3W0WB 1T20B 1W6WA 4I1PA 4RIRA 4HDIB 3CN2A 1DBBL 3FQUB 4UQ3B 4NN7C 1HH6B 5JW4M 4X8GA 1L9MA 2Q7NA 5AOLA 1WS7A 3RFRA 3V7AE 3D3VB 3NJIA 3TBWA 1QA9A 1A6ZB 1D2OA 1OCWL 2NW3B 3LRSB 4DP6X 3PE9A 4GW1A 4X9GA 4M3KB 3HCVB 4RBPK 5KW9H 5HGDB 5I16A 4QLWA 5IMOB 1ANUA 3FT4A 3LNGA 2WCGA 1KNOB 3P0YH 4IRJA 4JGMA 3MA9L 3MNVB 4Z0BL 3TOPA 2AXFA 2DMKA 3TA3A 2O5YH 2IIJA 3Q9PA 5CKAA 4AIEA 2OP4H 1SOKA 2PW1B 2YMXL 2EDXA 4MXVF 2P44B 4L9LA 5AVTB 3MJGX 3SPCA 3QCVL 5JA8B 4NPYB 3GS0A 1P4UA 5HHNB 1FIGH 2R39A 1ACYL 5JO5B 1B0IA 1CR9L 2CUIA 2ESVB 4MAZA 3MGOB 4OQTA 1E4WL 3ZYJA 3BFOA 4WI3A 1Z66A 4ZS7H 3T1WA 3N40F 2HT2D 3LZRA 4P5SA 4X4ZA 3QRFM 2Z0BA 4N2FA 1WK0A 1XF4A 4XBEH 1XF1A 4XP1L 4L3EE 2VDOH 2VLJD 3SE3A 3W0WE 3LKSB 1BVNT 3N85L 3SDCA 4APQB 3PL6D 1EHNA 2DWXA 3T2PA 3PPSA 3HLAB 4DP5X 1FP5A 1X3DA 2FGZA 4HKZB 5IP4A 5INDB 3PS6A 4M8QA 1U8LA 2I60L 5G5DA 5J6GA 1FG2B 2JKTM 4X83A 4J3SA 3REVB 3V7MA 5EF3A 1IEHA 2OL3L 3CXFA 5EO1B 3B43A 2MOVA 2YSSA 5IGXH 2CUMA 4YXHL 3RWFA 4HS3A 5FHBL 3FU5A 1FCCA 3BPLB 3BRFA 5JMRA 2ZOOA 4LLQB 1NCHA 4NQXB 4X80L 1L7IH 3MA9H 4Y1AD 1G1CA 2PXYB 4L2YA 5F9DC 2ZX5A 2HT3C 3MJ9L 1S7QA 1ZHKB 3B7YA 3RWHB 2NY6D 3NCYP 4APQD 4UBDC 3MFFA 2BDNL 3AAZB 4Q0XL 3S2CA 1YZZA 4GXVL 4XP4H 3RBGA 3WSQH 1W16A 5HYIA 4IBVA 1HKLL 1F58H 4HXAH 3P77A 3QI9D 5ECGA 2PCXA 3ZO9A 4JFXA 4NUJB 1WRFA 3EGXA 4JY5L 3JTSB 5ESQA 4J4PD 3ARVA 6CGTA 3GB7A 4EI6A 4XE0A 5DO2D 2MTPA 1TU2B 2VDLL 4LSSL 1IGJB 2WYIA 5CUSL 3KPTA 2CO7B 4G42A 4XBPA 4EN3B 1YEKH 1EIBA 4PJ9B 1A9VA 2Q7YA 4WTWA 2O5XL 1QKZH 2X3BA 5EBMB 1QBLL 5AVZB 3WY3A 1ZVSB 3ZHDA 2A77L 1FORH 2EJ1A 4LLQA 3T3MB 2AAVA 1J8SA 5CIPH 3TJEL 3FTGA 3N1MC 4J2QA 1ZY9A 5F7DB 2ZTBA 5D5MA 2JIXB 3K71A 3BKYL 3H85A 4HWEL 4Q89A 5I24A 1KUMA 2V2XA 4BZYA 1CO1A 3QI9B 2P5WE 4RAVB 4UQCA 3ULSB 4PRBB 3QJVB 3RNQA 3A6CH 3VGBA 1UHVA 2ZXCA 4RMBA 1NANH 1BM3H 1Y7VA 3TTYA 5DHMC 1GW0A 2L4OA 2WWKT 4MJJA 5AG9A 4ZPVA 2BNQE 1X5MA 1ADQL 2VXUH 5ETUA 3PNWB 2YGQA 2EIMB 1TNMA 1YPZA 2K3HA 3VXUA 4D0DB 2O26U 4NRZB 5LHDA 3Q05A 5IQ7L 4O00A 2BDNH 4Q0XH 4PJ9D 2VDKB 5EBWA 3SJVB 1A1MA 3CSFA 3I75B 2J88L 4OV5A 1IARB 2NTFB 5DJYB 1SYVB 2N7AA 3NCEB 1Z9PA 2AJXH 1CL7L 4ZTEA 2NUPB 3ESNA 4UQ3A 3CLWA 3T8XA 2HTKC 5BZZA 2F08A 3OKNB 5FUOH 2Q3XA 4G8EB 2J6EA 1Y1UA 1BXUA 1CXIA 4O9HH 4C47A 3IJYB 1EJFA 2IAMA 5D1XB 1HNFA 2YFOA 4FULA 5TDNB 3SGJA 4Z7OF 4L3CB 1A6AA 4A38A 1ZVYA 4B9FA 2HN7B 5IBLD 3RU8L 1J5HA 2F8IA 4FFYA 3ML8A 4X99B 35C8L 4HC1A 4X4XB 5DRXA 2EE0A 1E27B 4DERA 3F3HA 4DEUA 1VKXA 1ECYA 4TQPA 2W0FB 5J06A 4PJ5E 4RVBA 2IADB 1IQWL 1SDAB 1YSOA 2E4FA 4NQCA 3QJUB 4XNXH 4UT9H 1EPFA 1QFHA 5HGDA 5I16B 1DO6A 1B4LA 1I8IB 4Y0GA 2ITCB 2IJ0C 3K4ZA 1OD9A 4BYHA 1HT6A 2XN1A 2XWJB 2H26A 5FECA 1HCYA 3RWGB 4JKWA 5L2KB 2DTML 4R8WL 5KVFE 1KYFA 2Y07H 3KPPA 3ZJAA 3GXFA 1OT1A 1OAUL 4P2QA 3BE1L 1XR8B 2NY2B 3HRZC 1H8LA 4Z7WB 5D1XD 3I75A 1D3CA 1FVCB 2XWRA 2A9AA 2BMKB 1OXYA 1BXXA 4F93B 1U8NB 3K46A 2A6DA 5E2VH 5HYJE 4Z77A 4FL4B 4MNHB 1G7PA 4M3HA 4FP8H 1ZGLP 1E9QA 3VRJA 4IGBD 1QRNA 1XF4B 2X09A 2XX1A 5HYJD 1RIHH 3FTYA 3N43F 4PS4L 3GK8H 4QTFA 1Z5YD 5BQDA 3AB0C 5FWQA 1SYSB 4AYFA 2JQMA 2VR4A 2XKUA 3K5SA 4P2QB 1YMHA 3WDIA 1REIA 2VW4A 5HVGB 4HG4J 4NRYB 4U7MA 4YEEA 1G7LA 2TSAA 4Z0XB 5DRWA 2GFBA 3JWOC 4L4VE 5FECB 2PP7A 3FO2B 5DEFB 1ZS8A 3A47A 1WO2A 5A7EA 3TA3B 3G5VA 1H8OA 1VGKA 1I8UA 4G6KL 5GSVB 4DP7X 3KPNA 4K8RC 3ZTDC 4IIQB 5CMAB 4XNXL 2ATKA 2J7LA 3MRDB 2R1WA 4KTDL 1P7HL 4F8OA 1CDGA 3BT0A 4MB3A 5GSRB 2F7PA 3IDYB 4HIEB 5C0CB 3T6WA 1ONQA 3LN5A 5A2FA 3B2DC 4CGTA 2FJHB 4WU5B 4ZZFA 5D71L 4G1EA 3K5RA 4NO5A 2NTSP 4XNMB 5GHWL 5LNEA 4OD1H 4CVXA 3Q0HA 4OFIA 4F8TA 1B0WA 5BVJB 5HI4D 2KPNA 5ELIA 1D6EA 5JDSA 3W39B 3KPQB 1N4XH 5KG9A 1AGEA 2GKIA 3ZE0E 1SHMA 1SLVA 1WZ1H 4UCFA 4AV0A 2Z93A 3RZCD 4N0UB 1JD9A 1C1EH 1L6XA 1NCTA 3LSOB 1NC2A 4BQ6A 2FQEA 3L16A<