4W9ZA

Crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
MVPKADLTIKATGKQWYWSYAYPDNGKFEFDSLMAQDKQPRLLGVDNEMVVPVNKVIRVQVTGADVIHAFALPAFGVKIDAIPGRLNETWFKAAKTGMFYGQCSELCGKDHAFMPIAIRVVEDKEFASWVETAKKKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the periplasmic domain of subunit II of cytochrome oxidase (CoxB) of Bradyrhizobium japonicum
rcsb
source organism Bradyrhizobium diazoefficiens
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 2
total genus 33
structure length 138
sequence length 138
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4w9zA00
2H3XC 3TA4D 1RCYA 1GS7A 3EH4B 2HXAA 2FJSA 1GS8A 1JXFA 1NINA 2PPAA 1BQKA 2BP0A 2UX7A 2I7SA 4CSPA 3FPXA 4GYBA 2P80D 2CJ3A 5AZUA 1IKOP 2I7OA 4YSUA 3IBOA 2IWEA 3AG2B 1BXAA 4HAKA 1GS6X 1AOZA 4KNTA 2UXTA 4NERA 3SQRA 3U25A 2YXWA 5B7FA 3WKPA 1RZQA 5I5IA 1OV8A 3HEIB 2QPDB 2XLLA 1XMEB 3FU9A 8PAZA 2VSMB 3FQ1A 1ZV2A 4YSCA 4JKNA 1X9RA 1RKRA 4FAAB 2YAMA 1PZBA 3GYRA 1GW0A 4M3HA 5B7MA 1NPNA 4KO6A 2EIJB 2TSBA 2QDVA 3FS9A 2Q9OA 2P80A 3QJUB 2BWIA 2UXVA 4YSAA 2BW4A 3QJQB 3X1NA 4YSTA 2XX0A 2WO2B 1MZZA 1BXUA 2DYRB 1A4AA 2WO3B 5I6LA 1E5YA 1EZLA 3TBBA 6PAZA 4HZ1A 1PY0A 2X88A 4E9TA 4DP2X 4UAHA 3X1BA 4AZUA 3FQYA 1AIZA 1AS7A 2FT7A 2EIKB 4BWTA 2IDTA 1KCBA 2N0MA 1MDAA 2UXGA 1NPJA 3T6XA 5I6NA 4NB7A 4BXSV 1SHWA 1GSKA 1HFUA 3ERXA 1J9SA 2XV2A 1AACA 2A3TA 4YSDA 3QPKA 2XXFA 3X1FA 1ET8A 1JZJA 4BWWA 1FWXA 1RZPA 4GY4A 1PCSA 7PAZA 2XXGA 4BXVA 1PAZA 2ZXWB 4A68A 2PPCA 4GXFA 1ASOA 1TEGA 1CUOA 2BWDA 1L9TA 3GXUB 1B3IA 5A7EA 5B1JC 1BEXA 1JERA 2HZHA 5D4HA 4AKQA 1VLXA 5D4JA 4DP6X 1AS6A 6PCYA 4A67A 1ADWA 2R7EB 2CAKA 2HX9A 1AZCA 3IEAA 1KCWA 2HLEB 1HAUA 1BYPA 1A65A 1NIEA 2HRHA 1OF0A 5B1JA 2PLTA 2VW4A 1SDDA 4G72B 1GY2A 3UAAA 3ZBMA 4QLWA 3X2QB 3PCYA 2VW7A 3SBRA 1NZRA 4HHGA 3G5WA 1WAEA 1AS8A 2JXMA 1ASQA 2JFCA 2FQEA 1BAWA 1WA0X 2FT8A 3H4HA 5B7EA 3WNJA 2ZOOA 4DPCX 5I6MA 2PCFA 4HCFA 1NIAA 4ZK8A 1AR1B 1BXVA 1PF3A 1AG0A 4DP1X 3PLYA 4BWUA 2DY2A 4P5SA 3WKQA 1TKWA 4F2FA 2CCWA 2W88A 2PP9A 3PAZA 1QLEB 1A4BA 1JXGA 1WA2X 2YARA 1OCCB 1URIA 3X1EA 1WS7A 4DP9X 2CUAA 1J5CA 1FA4A 4YSOA 3DIVA 1E30A 4FA7B 2YAOA 4RH4A 1DZ0A 3NSFA 5B1BB 1AG6A 2GI0A 2PPDA 3UACA 1J5DA 2ZONA 1NICA 2CALA 2PP7A 1L9OA 3OD3A 4G70B 4L0PB 2TSAA 3AW5A 3DTUB 5PAZA 4DP5X 2GC4C 4EF3A 1XB6A 4N4YB 1OCZB 2E86A 3UABA 1MG2C 4DPAX 2YAQA 3T71A 2GBAA 1N70A 1J9RA 4G71B 5ANHA 4WTQA 1ZPUA 1OE3A 2UXFA 4G7SB 4W9ZA 1WA1X 1MG3C 5AKRA 3NSDA 3FPYA 5TK4A 3AY2A 1IBZA 3JTBA 1AZBA 3FU8A 2PPFA 2PCYA 3HB3B 5EHFA 4E9QA 2AFNA 5I5JA 1X9UA 2BO0A 1W6WA 1A4CA 3NJMA 3T6VA 3AG1B 5I6KA 3FT0A 1L9RA 2H47C 2VMJA 3FSWA 1NWOA 3SBPA 2FQFA 4YVUA 2QPEB 3FU7B 3OMNB 5I5MA 4E9YA 1YLBB 3FYEB 3FSAA 5I28A 1KBWA 1L9SA 2WSDA 3KW8A 2R7EA 2XV0A 4Q8BA 4A2EA 5F7AA 1ZDQA 3NP4A 1ET5A 1JZHA 3T9WA 3H56A 3NP3A 4HIPA 2AZAA 5I26A 1QHQA 1I53A 2VM4A 1JOIA 3ABMB 2NRDA 1ET7A 3EH5B 3NJFA 4W1TA 3UAEA 4CSZA 1CC3A 2FQGA 4UF7C 3BVDB 2XVBA 1XB3A 1AZRA 1A8ZA 3MBWB 2XX1A 2W8CA 1ILUA 2XV3A 3ZIYA 4G7RB 1ZIBA 2DV6A 1ZIAA 4E9RA 2QT6A 4A2HA 2OV0A 1JZEA 3L45A 4PCYA 2B08A 2IDSA 3V9CA 3MX0B 3FYIB 1IBYA 2J56A 1BQ5A 1CURA 4N8UA 4A66A 1NIFA 1WS8A 3X1GA 2PP8A 3H4FA 2AVFA 2CBPA 4F2EA 1IUZA 4E9WA 3QJTB 2XWZA 1J9QA 1JZIA 4F7KA 4M4RB 3EHBB 1ETJA 5I6OA 2XU9A 1JVOA 3ABLB 3ZDWA 3D12B 2EIMB 2IH8A 2J55A 3S3CB 4DP7X 2FNWA 1W6LA 3AZUA 3OMIB 3RYMA 3T6WA 2UX6A 2AANA 1KGYE 2OCCB 1OCRB 1NTDA 2VW6A 4YVNA 3ASOB 2J5WA 3SBQA 3QQXA 2X87A 2I85A 4KNSA 3NJHA 3NJNA 4ENZA 1V10A 3JT2A 2DYSB 4GP5B 3S3DB 3KW7A 1AZUA 3ZX1A 3OMAB 3OQRA 2BP8B 1SDDB 2AZUA 3AG3B 1KBVA 1SHXA 1SFDA 4DP4X 4Q89A 4WKXA 3PPSA 2FWLB 2GC7C 3FU7A 4AX3A 1AAJA 1JZFA 2IWKA 4BDVA 2B3IA 2JKWA 3NJJA 4KOCA 1A3ZA 2DWSA 4TXVB 3PAVA 3IN2A 2IDFA 1OE1A 3DKHA 1JXDA 2LLNA 3CDZB 5F7BA 1KDIA 3C75A 3NT0A 2YAFA 4A2FA 2VN3A 4JHVA 1ZDSA 3CVBA 3CG8A 3IE9A 3NJGA 5B1KA 1PMYA 1MZYA 1PLCA 2IWFA 2BHFA 3NSYA 1EHKB 5B3SB 3GDCA 3ABKB 3NJKA 2IH9A 5B1AB 3OM3B 7PCYA 1UATA 4YSSA 3FSVA 3WI9A 3TASA 1AQ8A 4P5RA 4MFHA 3NJLA 1SF3A 1SNRA 5IY5B 1SJMA 3EF4A 1PZAA 1AANA 1N68A 2EINB 1ILSA 1GR7A 3BQVA 2EILB 1JVLA 3S8FB 1KDJA 1QNIA 1NWPA 1W8EA 4DP0X 4KO7A 1PNDA 2BZCA 5TK2A 3N2JA 4E9XA 1M9WA 2FTAA 1J9TA 2VSKB 2BP0B 2IDQA 1XB8A 4K9JA 3CVDA 5E9NA 4KO9A 2HRGA 1OOWA 2MRYA 1NIBA 4HALA 1KV7A 2H5UA 1BQRA 2OJ1A 2XYBA 2GSMB 3IN0A 1NIDA 4E9VA 2Y69B 2FQDA 4KNUA 1L9QA 5D4IA 2YAPA 1NDTA 5LDUA 4NAJA 2BZ7A 3TBCA 2HX8A 3WNIA 3PXLA 2VM3A 3T6ZA 2Q5BA 4BK5C 3FSZA 5PCYA 2GB2A 4UANA 2YAEA 1E5ZA 3NSCA 2YXVA 4E9SA 4KO5A 2BW5A 3WIAA 1V54B 1L9PA 2IAAC 1CYWA 2Y1AA 3QJVB 4HCGA 3NYKA 1PLBA 1TEFA 3ASNB 3QJSB 1IC0A 4YSRA 1F56A 1KYAA 4YSEA 1SFHA 4BDVB 1TU2A 5I6PA 5AFAA 4A2GA 4G7QB 3UADA 3FQ2A 4GP4B 4X4KA 1OE2A 2XUWA 3CVCA 9PCYA 2MTAA 3CDZA 1PNCA 3S3BB 4KOBA 2DWTA 2J57A 1E67A 2ZWNA 2PPEA 4YSPA 4YSQA 1SF5A 1ASPA 1T5KA 4A2DA 1GY1A 1R1CA 2FT6A 1DYZA 4PAZA 4HHWA 1CYXA 2IDUA 5FC9A 4GP8B 3EH3B 1V55B 2GIMA 4JHUA 1FFTB 4QKTA 4AI7A 3QJRB 1M57B 3WG7B 2GHZA 1OCOB 4DPBX 2BP8A 1HAWA 1JZGA 2QDWA 2RACA 1E65A 3PAUA 4HCIA 2YAHA 2HX7A 1PZCA 4AKOA 3CZUB 3AG4B 4YL4A 1ID2A 3V9EA 3UGEA 1AZNA 3ABGA 3S8GB 3NJIA 1GYCA 3TU6A 4AKPA 1PLAA 1M56B 3N55A 4DP8X 2YQBA 1BYOA
chains in the Genus database with same CATH superfamily
3FT2B 2WMPB 5E24E 5CN2A 2W0PA 2FZ3B 5LBVA 2VH5L 3TGXA 3B1UA 4HIHA 5HYIA 1E4KC 4IHOA 5IVNA 5D93B 2R0KL 3OWEA 2EQDA 2ZOLB 2J44A 1VKXA 1DQTA 1KEGH 4J4PC 4I0KA 5E8OA 4LPXA 3AXLA 5JPMC 2EDBA 3RHWK 1AYRA 2OR7A 1OGPA 2QELA 3P3RA 2VXUL 4JG0H 4K94C 1T7ZA 4PY7B 3IDXH 3GXIA 3EXLA 1KT2B 1QRNA 3THMH 2KH2B 4MXQC 4BELD 2PN5A 4AW7A 4MHHI 1GHFL 1PZBA 1T3FA 2GTWB 4FQCL 4POZD 1F4HA 4LNVA 3VFRB 3TBTA 5LB1A 3S37L 4U1IA 1IKFL 2ICEC 1H0DB 3CFQA 4UILL 5AEAA 3HN3A 4WJ5A 1LD9A 3QJQB 2DWDB 4G9FA 5DA0B 2M83A 3P0YH 3QDJE 4OB5H 2ERJC 1NCGA 4I0PA 4O2CB 3RPIA 3F7YB 4XC3L 3WENA 1QHPA 4NPYA 3QIUC 3TXAA 5D9SB 4HZ1A 1PY0A 4FKKA 3QCVL 4O51A 4PJDA 4L3FA 1X4YA 2CJTA 5EU5B 3PWPD 4GQ9H 1PLGL 5JR1H 1HHKA 4PTUA 3IJ7A 3JWDL 1IBGL 2EIKB 4BWTA 5E5MA 3GMMA 3CSYB 5I6NA 1CICD 2Q8AL 4KTGA 1MFMA 1YUKB 1J9SA 1XIWB 4KZEL 3QUKB 4EI5C 4Q0XH 3RZCB 1R3HB 2ZQKA 1H3PH 3L08A 4GQRA 4K23H 3P3SA 4IBZA 5T5FA 4OCWH 5EN3A 2Z64C 1FWXA 5BO1H 2NY4D 4R7DA 1TZGH 4RIRB 4Y2DA 1KYDA 1PAZA 5C0AE 5EG6C 1P4BL 5F7EH 5EEXA 2A9AA 4WFFE 4L4JA 4XC3H 2AEPL 1SOSA 3HI1A 2D2OA 5IQ9A 1A14L 1GC1H 1LGVA 2VLJB 3VYOA 1UC6A 2DBLH 4Z9KB 5AZEH 1PBYA 3GLEA 3TEXA 5GZOD 4O58H 2ED9A 3T2NL 2BSEA 3C2AH 4JRYB 4OKVB 1UOVA 1RZIA 4ZW7A 1ZGLP 5JIDA 3AM8C 3LNHA 4N2KA 4L8DA 3NOIA 4YXHL 3BD5A 4NUJA 1L7TL 1NL0H 2OTUA 4N6QA 1VDGA 3OB8A 4GEIA 4A2MA 1U36A 1HHJA 4Y16B 1TTRA 2VNCA 1U8MA 1Z5LB 4MXWL 3L13A 4K07A 4APQC 2JIXA 1IQWL 3O8XC 4YX2L 1MVFA 4OCRL 4XI5D 4U1GB 4ZK8A 4Z23A 1K4CB 4AIEA 4JRLA 1S4IA 1RZJC 3M88A 3OXRB 4CVWA 3ZIMA 4R4BB 3WY2A 4HIXL 3SDAD 1J87A 1JGVH 1NUDA 4U1NA 4U6XA 4R97C 3QXTA 1NEPA 5HHXL 1SYSB 5CF3A 3MLZL 1VPOH 3NA9L 2YLKA 3DECA 2EH8H 5E6IB 1OHZA 4W9FC 3VG0L 3KCPB 3UACA 3I6GA 4OGXH 1P5VA 2DM3A 5PAZA 3D09A 4GRLB 4PJ8D 1FNSL 4AQ1B 1T66C 2ZSWB 1V7MH 3Q2WA 4P57A 1MG2C 4PW9A 4R0LC 1O6SB 1W2KT 1GRWA 3QO1B 4KK5D 4WUKH 3HR6A 5CMAB 5BV7H 4P06A 4M1GL 4FG0A 5DQDL 2A73A 2A9DA 2F2HA 1T1ZA 4YZFE 3QUMB 2F7IA 4I5BA 3QUKA 1NDGB 2D7OA 1DLHB 1MG3C 2VABB 1F1GA 3TCLA 3JTBA 1CZ8H 3UPRB 2H2SC 4P4KA 4DTGL 2PCYA 3HHSA 2XN2A 4FNSA 1UURA 4HEPG 3D08A 3TN0B 4QJ5B 2MCPH 1W6WA 5F93C 3MA7B 4NGHH 5D9SA 5J56B 5L7XL 3V6BR 3M1OA 2MNJB 1L5GA 1OT4A 4YLCA 1UD4A 5KJ7E 3KPSE 4QTIL 4N0YL 1ERNA 4I77H 4TNWK 5TE6L 1ZWIB 1E9OB 1YLBB 4TUKH 4KH9A 1U8IA 2H32A 3VXMD 3VDAA 1JZHA 3WE6B 1WHOA 1F4XL 1HYSD 1MREL 5I0XA 3A0OA 5E2JA 1CFSB 3NJFA 3WFBL 1DLFL 3WJLC 4JN1H 1N4XH 4B9FA 4YBLB 2BVQB 4JQIA 5HPMB 3L5JA 1LO0L 1TO4A 5GRJL 2HRPL 1GXEA 4TQIA 2WVSA 5C07E 4RFNB 2WQRA 4M4RA 3ZTNL 1JN6A 2GEEA 2ZUUA 4YK4B 1B0GA 1UM4H 5I18H 2BOBA 3WFDH 3L3IB 1ZT4B 3QH3A 3IMTA 4UM9D 1JZEA 1CDYA 3FU5A 3NESA 4LDLB 3IGUA 4M1CD 4NO3A 4NENA 5CILL 2EVJA 2IXQB 3LKRA 5CCHE 1AR2A 3GIVB 3JYCA 2WZPD 3LQAH 1OL0A 3QC6X 2WCSA 4M1CC 4QHPA 5HHXH 2G75B 4EOWL 3K6FA 4MD0A 4LVHB 1UXLA 3MUZ1 4TRPH 4Y4KC 4X80H 1KG0A 4QXGH 1SN0A 2IC2A 2I5YH 4QHUA 3KLLA 3SOTA 4W9EC 3QISA 5CJXC 3BVNB 3AU1A 4NM8H 1S9VA 2HMID 4Z0BH 3RY5A 5G4MA 5L9DL 1E90A 2AEIT 4FTVD 4D0BB 3SKJH 1U8JB 1EO5A 1QMUA 2XWBB 1KGYE 3MRHA 4JDTH 3QCUH 3R8QA 3T0EB 1K5NB 3ASOB 1JGIA 2GJRA 1QSZA 1C16A 5CUSH 1KN4L 4OFYD 5B3NA 4G6MH 2IQ9H 2JQAA 4GKZB 1J5IA 1JD9A 1DQQB 1IBHA 4O00A 2RH0A 3LHAA 4ICXA 5FGCE 2E7BA 2UY6B 1J12A 1DN0B 3FQXB 3VXUB 2F58H 2O61A 1RULH 2GBVA 3Q8BA 2IJ0C 1BM3L 1EWHA 3FB5A 4X7SH 2Y9RT 2ZP9A 3QDMD 4HPOH 4TYUA 2NXZD 2ZUVA 4KV5E 2JTYA 3DHPA 3FT2A 3N1QC 4NC1C 3ECQA 5TGBA 1HHGB 1WCBB 3TJHD 4U6HB 5GXBB 3IDYC 4JKKA 1NGYA 3DK0A 4PR5B 4V1DE 1UOWA 2N59A 1GGIL 5CUSL 5D7KD 5J1AA 1JHKH 2JE8A 4G3YL 4WUUE 3IMRA 2BVUA 2UY7B 3BHBA 4DPRA 1OM3L 4G8IB 4RSYA 2CXGA 3FO9A 5B1KA 4WO4B 1QKZH 4MDJA 4EXPX 1IEHA 5CP7B 3H3KA 3KPMA 5D1XB 2YD4A 2N7SA 2IPTH 4OFVA 4WI7A 1P7QD 1TTUA 4HSCX 5BV7B 4FRWA 4LBEA 3CSBA 5CWSA 5EU6A 2RMNA 5AL0A 3UFIA 3MOBH 4Z6AT 3MGTA 4ERSH 2C26A 3MLTA 5FGCB 1T7YA 2HT3C 1T83C 3KAAA 5IY5B 1U8JA 4OJFL 1KJ2L 4Y88A 2HLFC 5DDHB 5GSVA 4OTXH 3BQVA 2MMXA 4ZZFA 4GG6E 2HRLA 5TF1H 3BUDA 4IJTA 5IOKA 1P4IL 1JPFA 3ULVD 2YN3A 5FIEA 4AEFA 4NJ9H 3WGUB 3FB8A 4RRPG 4IEFB 1CFSA 1VFUA 4H25B 2O26U 5I6XC 1F2XK 1XX9C 2DW5A 2VLKD 1AOHA 1G7MB 2XZCL 5AZEL 4LCYB 2NSQA 4J1UA 4H8WL 4K9JA 4DSYA 2MKLC 1MVYA 3BZDA 1R33A 1X7QA 3QJFA 4TUJA 3RKDC 3BKCH 4GSXA 4PJFA 1PJ9A 4EUPA 5CSGA 5GRYA 1INQB 2DYPB 3QH3B 3L95A 4L4TA 4PRAA 4DVRL 1UT2A 2MEJB 2XHNA 4KV5F 3F6IA 3P0VH 4OLYH 3K81A 1FVEA 1HXMB 1G7QA 1W0VA 2HX8A 4PFEA 5CEXA 5K69A 1LEGB 3UTTD 1F8TL 1U8OB 2BNQA 1B4JL 3TFKC 2KZWA 4PJ5D 4ELDA 3E7JA 4UANA 2IQ9L 2GTZB 4Y9GA 5J9PA 4KZDH 5JOPD 4ODSL 1WZAA 3V0IA 1E9PB 4NWUH 5C08B 1XSJA 2Y1AA 1RZ8B 5GS1B 3QXAB 2F74B 4MKTA 1O9ZA 1QSVA 3FKUS 2EYSB 4O51B 3ULVH 1MCDA 3BEVA 2R2HB 2V5SA 3HPLA 5AZ2H 3CN1A 2WXOA 4HJSA 1WAPA 4F8NA 3ZE2B 4EI5D 1JF1A 3LRSB 5A2BA 1BOGA 1E67A 1WV7T 1FZOA 4TUOB 2WAQA 2W59A 3FN0L 2X53A 1QZ1A 4HWZA 1T5KA 2HFFA 2YMOA 1CICC 1BVLA 4ZX4A 1WAAE 4OFKA 4LCCC 5L8KB 4E42B 1HOCA 1EXUB 1INDH 5DUMH 2G30A 1M71A 1TZOA 5GS1A 4GP8B 2DF3A 2VQ4A 4AEIL 4DW2L 2F5BH 4N6RA 1SUHA 2XWTA 4JDZA 4OZIE 2N1KA 5HI4C 5INCA 1Z3GH 4TMPA 5DSCB 2VM9A 5F7DB 5B3JE 3V7MA 3C08H 3WN5B 4DKFL 1IFGA 1DL7L 1HC1A 1RVFH 2FH8A 3FUMA 4LVNC 5AAWC 5EZLB 1JUFB 2X3BA 3ZDYF 4L8SB 4AXWA 4N8CH 5K1NA 1JP5A 1E6JH 1QWNA 1WGVA 2E56A 5KOMC 1LEKA 4GINA 4FG4A 3SN6N 3FTSA 1CD0A 5J1AB 1AQMA 4DVBB 4GRWF 2PPAA 3MNVA 3T2OA 1CD1B 4S1QH 1OGSA 4UZSA 2J71A 1P9MC 2NQDA 3M8OH 5F9OL 3VXSE 1X5YA 4B53A 1XL6A 3ESVF 4X6DE 4Y8DC 2F7OA 3DARA 3BKMH 3GEWB 3MLRL 4FDWA 3FQXA 1CGXA 1EANA 3CZKA 5T1LB 4BIKA 3U25A 3UZQB 3V6FA 3OXSA 2OYKA 1OV8A 3JWDH 1YYML 2UUDH 4O02B 3QZWA 3NUKA 4JCLA 4MJ6B 1NMBL 3S48A 1P1VA 3F3HA 2FIRT 3GYRA 5DS2A 1F8TH 3QIUA 4QGYA 1ZHKA 4S11A 5INDA 3FS9A 3PP4H 1XXFC 5F0MB 3KXFA 3QJUB 4P23C 4PJHF 1CBVH 4YSAA 1YEDB 3ZE0B 2CO3A 5BJTB 5C0RL 3C5XA 3PY9A 4FABL 4PJBF 3BZ5A 1KIUA 2ZTBA 2Z7UA 2VDRB 4MD4B 4UOW1 4WU7A 2X6AA 3ZU8A 1CIDA 4NNYB 5T33H 3RBGA 1GC1L 3ILPB 3O0RL 1S9XB 4Z7UF 3X1BA 1TTBA 1R4XA 4GXUM 3U1SH 2BVOB 3ZQ9A 2R8SH 1TMQA 1XIWD 4D8OA 4IOIB 1X5FA 5I17A 5DD0H 2JQMA 2BC4B 1TVBB 3O9WD 1T7WA 1PFOA 4WWKB 5L8LB 3BAIA 1RUPL 3CPLA 3TZVC 4BRVA 3GEFA 1KBGL 1FBIH 1RD6A 2F7PA 3E6HB 4TL5A 4XO5A 1RK7A 3N6YA 4MMXB 25C8L 1FN4A 3CXDL 4ABVA 1JVKA 1PCSA 2XWJB 4Y2NA 1Z9OA 2F53A 3WHXA 2BOBB 4P59L 1FDLL 4BSJA 1U58A 5EZOH 2JI1A 2CCVA 3L5XL 1GGYA 1I3UA 1T7XA 2W60A 4LCCA 2FAUA 3PWNA 5GGRA 4GO9A 3QFJB 1GAFL 3OKNA 5D4JA 5B38G 1LDPH 1OLZA 3EHBC 3NDYE 2RGSA 3V55A 5KBDA 4OGYL 4MAYD 3HE7A 3EOAB 3RI5F 1NCCH 5GQBA 2HG5A 1T1ZB 2HN7A 3ZSSA 3IEAA 3WTVA 1YEHH 2X1PA 3OC8A 1R3IL 3ZT5A 5D7IF 2CSPA 4U7SA 4DN4H 1PJWA 5DZLA 4QRQB 2HVBA 3GXPA 4AH2A 2VITA 4PWJA 2OSXA 4D0CA 2I25N 4Z3HA 1WVZA 2K3TA 4ZNEE 4KDWA 3UJIH 3L3HA 3AREC 1NKOA 3PV7A 4QYAA 3H3BC 2ROYA 4WGKA 4I18A 2DTMH 1FFQA 3FRPG 1WA0X 3LQZA 1E8XA 2D9CA 2PCFA 4RLDA 4YFLF 1PL3A 3ETBJ 4OZHE 1NBYB 2AK1L 4PM1A 1KV3A 1IX2A 4DP1X 4YDKH 3K6IA 4FXKC 2AJYL 3TT3L 2WXHA 4U6YB 1P9MA 4P5SA 3I2CL 3K74B 3MHZA 4DGYL 1EVUA 2A5UA 2J8UA 4RFNC 1QPPA 2XA8L 4GKNB 4DP9X 4HU8A 3UZVB 1TJMA 1BSIA 3GMNB 1AGBA 2X4SA 3W39A 1FA4A 1D2PA 5DUPL 1ZV5A 4GKLA 1C8QA 4N5UA 5DCCA 1FNEA 2A83A 2GAZA 5FUCC 1BMWA 3DGGB 3GIZL 3NSFA 3IS0X 4IHOB 4B9KC 3WIFA 4AEEA 5C9KA 3KVQA 2YGOA 1CDCA 2PPDA 2QADD 3EGSA 2VMDA 4KGLA 4NPKA 5TDOA 3ZKNC 3OVUB 5FO9B 5CGBA 5ADPL 3OAUL 4C47A 4JPKH 2PNDA 1M2OA 5CSBA 1YRKA 3TN0C 4HETA 1FL3B 3I50H 5ANHA 3QUZC 3OGCB 3OPZH 3Q6GH 5FKAB 4H0HB 3LXBA 2HT2D 3B2MA 3NEXA 3I3DA 1ZWIA 1A7RL 1F4YL 4X7DC 4BGDA 4JFOB 1UEYA 3DNKA 5TK4A 5MHSE 4YGVA 2X05A 4FGMA 3SODB 4DESA 2B16A 4FYTA 3NN8A 4IW4C 4HEMA 5HHPA 4WFHE 1CFMA 2XNAA 1YEDA 5DUBA 2H9GB 4X5LA 2DI9A 3CC5B 3U4BL 4Z7AA 2Y06L 4OLYL 2FIKA 1CO1A 5IHZB 1K4DA 4A6YA 5KYNA 1NKGA 4UQBA 4JFFE 4XMTA 2R0LL 5HHOB 5KBPA 4YVUA 2OTWA 3PL6D 2ICWB 1KC5L 4UQIM 3KPTA 5I5MA 2P43B 2Q86B 5ALCL 1TZGL 2YPLA 3FSAA 3PL6C 3KW8A 2YHGA 4JREC 1P4LA 2KLSA 4YK4C 3TV3L 3HS0A 5F7MC 5A2LH 4AW4A 4OKVA 5E5MB 3QG7H 2VM4A 1JOIA 4HWBL 4JVUA 4R84A 3MRMB 4W1TA 5FM4A 4JFDB 4NNPH 3N06B 5FPIA 3DRTA 1D5ZB 1TXKA 4GO6B 4HUKB 3SQBB 4Y7OC 2HYMA 3KBHE 4R4FH 1FYTB 4O4YL 3U7YH 4AIZA 3TO2A 3QEGH 2Y06H 5D7JA 2FEEI 3UEZA 4UM9B 4CMMA 4L4TD 4MD5A 1O7SA 3HPLB 3KBFA 4Y2DB 4EN2A 3VX0A 5ELIA 5BVPL 3DVGA 3SKJL 4S2SA 4TSCH 3TH3T 4P5TB 4JQXA 3KBEA 3QUXC 4DW2H 4R4BA 4LGPB 3VGFA 3VX1A 2LU3A 4HG4K 3MGOB 3GMNA 4FMFA 4X50A 2WBXA 1CURA 4GKNA 1UB5A 3UOAB 3O2WH 4FQJL 4KMTH 3VSUA 2CBPA 1PIGA 1FG9C 4KRPD 3QDGD 3ZTJG 1QBLH 4LP8A 3AAZA 4PBDA 1YEKH 3G6DH 1SLXA 4M7JH 4Y16A 4WTZG 1ETJA 1RIHH 1CFVH 3EO9H 1TVHA 4O4YH 1QEXA 3D39E 5AVWB 4PREB 5J1SC 1DVFA 1FNSH 4GAJL 3L4VA 2VLKE 1BGXL 3QK0A 5EN2A 4XNQB 4ZNEA 3MRGB 2OK0L 4QOKD 4QGTA 3QJFB 3LJ3A 5BUGA 3ARDA 1SLUA 5F21B 5MI0B 3BEVB 3F62A 3R4RA 3VFWA 4AMWA 1D5XA 4B0MB 5FKAA 4IMKA 4QO1B 4HUUA 3BIAX 3ISRA 4HYTB 4LDEB 4NHCH 3A47A 1HK6A 4DK5A 2MHAB 1F1AA 2G0KA 32C2A 3PJSA 3PHOA 4M8QB 5KJ4A 5A6MA 5CKAA 2JCCE 3B2XA 4PTTB 1XZWA 1MAMH 3IDYB 4NCC1 1OP5K 2YRPA 4I3SH 4KHXH 3EGSB 5J9PB 3T1WA 4JQVA 3GTTA 5GGTA 3GSVA 1HDMB 4KFMA 2YBGA 3KYKH 5IVOA 1UT1A 1GGBL 1KB9K 2GAZB 2R1WA 3LEVL 2JVUA 3WNNA 1J1XL 3AS0A 3JTTA 1AQDA 3TPUA 1RPQA 4AX3A 4MAYC 1T5XB 3BAEL 1UWEL 1HQRB 1UYWH 1ORQA 3HBZA 4H2AA 3KGTA 3CX2A 3VGBA 43C9A 5J3HC 2DWEB 1CE1L 2E9JA 3L3DB 1OE1A 2VCOA 2IANB 4XPAL 5C70A 2M1KA 4YHKL 2A9CA 3K2UH 5F7BA 3WXWH 3V4PA 2VDKB 5SX5H 1R17A 3QG7L 5LBSH 3TYGL 1A3LL 4A2FA 4Y7MA 1U8HB 3MUGB 1E28B 3CX5K 4EN3C 5DQ9A 3V0VB 5IM7A 4I3SL 2DICA 4HCRH 1BVZA 2GJ6A 4WGVB 3RX9A 3SZKC 1CVSC 5HVFB 5DA4A 1GJUA 3TVMC 3CXHK 5F3HB 3F7PC 4AYID 4CMMB 4QNPE 5DS1A 4TNFA 5SX4I 3MACL 4GRLA 5I6XB 4NO0B 4YHMH 1A6PA 4IIQC 5FFGA 4MWFA 1SF3A 4JO3L 4OJAA 3VTTA 4YHYB 5IGXH 1LO0H 1MHEA 2KDYA 2VZSA 3FZUC 3H1ZA 4N85A 5DFVD 1DJSA 1NWPA 1ZHKB 4RNRA 4B9CA 1AD9A 4MCZB 4YMPA 5I1EL 4LCVA 3WY4A 1D6VH 4OF3A 5HDQL 3KG5A 1DCEA 3I9GH 1PY4A 15C8H 4E9XA 3ORJA 3L7FA 5AYUH 1HILA 1FH2A 2CR6A 4B95C 1NCCL 2R1XB 3CWGA 1CGSH 2N0KA 4EI5B 4PGDA 3IWUA 1NIBA 4R97B 1NC4B 4A6YB 2OJ1A 2C9VA 4TOYL 2YD2A 3ARRA 1KGCD 4WHDA 5IR1B 4XP4L 2FQDA 5MERA 5JHMA 1L9QA 4S10A 5I17B 3I75A 4Z7QF 1UKSA 5E2UH 4M7LH 4F58H 3FAWA 4QHNA 1KTRL 2BSSA 1X6LA 2AJXH 2NY2D 1DSYA 2V3EA 4Q6YA 3FN0H 3SDDC 3WNIA 3D0LB 4JL1A 4GMSH 1WP6A 5BS0A 3DX2A 5DJXB 3G6JB 2V17L 3MRCA 1DTUA 4NZRL 3MUGA 2OZ4H 3FFDB 1KJMA 3GXNA 2DL2A 1XCXA 1PLGH 1RSFA 2Y25A 3L3KA 4XXCA 5I1IL 5JR1L 1QFWL 1A7PL 2EDXA 3KDMA 4JDTL 5DMJB 5FWQA 3P30H 4S1SL 3QJVB 4AE0A 2LU5A 3B9KD 2DIBA 1IVTA 4PJGF 5EU7C 5I15L 2Y6SD 3RIFF 3LKOA 2V5TA 1XBRA 1F4AA 1SLWA 4KKLC 5C0AA 1BDYA 3BC9A 1NGQH 4WNQA 4F7CB 3IU3A 4EO5A 2BNQB 1DVFD 1XH3A 1UVQA 2CXKA 3T8VA 4FYSA 4YFDB 3UXFA 1OAZL 2AK4B 4M00A 1KACB 4UV7L 4EIUA 3W39B 4JKMA 4U0RC 5LXGL 2ZJSL 1A3RH 43CAB 3IFOA 5DHYB 5JW3H 3OZ9H 3TO4B 2RHEA 3GLZA 3ALWA 2EUXA 2IDUA 3CFTA 3KPQB 4FI8A 2ZUSA 4WW2B 32C2B 4IMLA 1V55B 3L3OA 4KKQA 4IM8A 1WICA 4CADB 1MUJA 2OSLA 2EADA 2K6YA 5D55A 5BZDA 4A7SA 1CD1A 5GJSH 1U33A 4DPBX 3G5VB 3O81A 3ZYIA 2Y07H 1F4YH 3PAUA 4UIKL 1RZKH 2EIZB 2W9EL 3AM8A 4XN7A 4NZ8A 1WUNT 4Y1AD 3X3GH 4KUZH 3AG4B 5EOQH 1ID2A 1U8NA 3HAEA 4YDMA 5I1JL 2ADFH 3HNVH 3DJZA 4LAQH 4HJEA 2O6CA 3ZR6A 3QWQB 1A7QL 4IYKA 3SQRA 4NUGL 5TFSL 1KXTB 5M94B 4TPRL 2B5IB 1A3RL 1R3HA 4ZMLA 5HDQH 1NINA 1W15A 2FHFA 1KC5H 1N7MH 5I8CA 3SPGA 4HT1H 4YE4H 5FW8A 3KPMB 1IKOP 2VQUA 1LK3H 2EIZA 3UJTH 1USZA 3QUXB 1M6OB 1D2OA 1VEOA 1DSFL 2Y07L 4HJGB 2H2SD 2QTEA 3B56A 1IMHC 2YXWA 2AEOA 2YD5A 4L1TA 5G5DB 1HIMH 4HOXA 5FO7A 1RPUA 2EC9T 2L4OA 2IADB 3FU9A 3QO0A 2MPAH 4M29A 5K39A 1LO2L 3VG0H 1MEXH 1ZS2A 2BSSB 2R2BB 2L7QA 1E3FA 3RURA 1U30A 2EIJB 3K71B 1U92B 4L8CA 2QEJA 4J6RH 1OTUC 1WZLA 4RGMC 3N04A 3QUGA 1W72A 5TQ2H 4CUCA 1RP8A 1SYSA 2F19L 3MU3A 3VM5A 1OSEA 3DXAA 4U31A 4QKXB 3QFDA 3UPRA 4M1GH 4PGDB 3OKLB 5EMYA 3ZDYE 4XZUA 2WO2B 1MW0A 3L5XH 4YHYC 2AKRA 1P2CA 3EGDB 3SD5A 5AAPA 4NN6B 4KQ4H 2G60H 3A6CH 1KCBA 1FVEB 1HXMA 3MRFA 3RLSA 1PYWB 4Z7UB 3L95B 4L4TB 1SHWA 3IKCA 1GSKA 2BH0A 3IT8D 5BS0E 1HKLL 2B1OA 1AIFA 4PP1C 1QA9B 1AY1L 2ZJSH 5GIRA 3QPQC 3FT3A 5FB8B 1ONQB 1JAEA 4ZMVA 4OIAA 1WITA 5HTSA 4X0KA 2F19H 4DQAA 4LL9A 3MRDB 4X5RA 1G5AA 4BXVA 1YECH 3B6SB 3GMLB 3O41A 4GXFA 1M05A 2X5PA 4EI5A 5KS9A 1FCGA 4IKKA 3R1GH 4YDJB 1BEXA 2VO8A 3A23A 3FU0A 3QARA 4YDKL 5DMKB 3AVEA 3DHJA 4Z7NE 3VSVA 1TCRB 4X8CA 5D7KE 1ADWA 2QHRL 2WLJA 4IGBB 3ZKXC 1P7QB 5H4YA 3BAWA 4YHIA 5IESL 5FLUA 4WO0A 3SO5A 4PJCA 4LPCA 3S2AA 2YEZB 2F6AA 3TVMB 1EEZB 3PABB 4YFEA 1CQYA 4OH2A 1CT8B 2PLTA 2VW4A 1SDDA 4NZUL 3HN8A 4JPIA 4Z7UE 3UZVA 1QVOA 5T3ZD 2R1WB 1TJXA 4WUUD 3VXMA 4BH7A 1YECL 3OAWA 4ANKA 2AMGA 4L48A 5DSCA 4W4OC 1WAAF 1QRNE 2C4FU 5LNGA 1UZ8A 1HN1A 2JKSA 3DVIA 2YRLA 4ATWA 5GRUH 1HQ4B 1WZ1L 1NFDB 1V3LA 1WC7B 2EO9A 3P2TA 1CICB 5SWSE 3TA3B 1MWAH 1O0VA 1FVDA 1JS4A 1HIML 3SGDH 5DO2D 4U0RB 1FZJB 3PJSB 4WEUD 1URZA 3H9SA 3GMOB 5IJVA 4KY1H 4S1RH 1U92A 4L8CB 5DJAB 2CO4A 3BKML 1BMZA 3X1EA 4LKCA 1DQMH 1FZOB 4U3CA 5ALBL 3W0WE 2WK2A 3WL9B 5TQ2L 3VXUA 5K93A 4L2YA 1DZ0A 1VGEL 4FXKA 4JO1L 4L4VA 4K5PA 3ZO9A 2EC9U 3O6KL 2FUTA 3B1TA 3K5SA 5BO0D 3ZKMD 4JBSA 2PP7A 3G6AB 3FSOA 3AW5A 2XA3A 3QORB 1YDPB 3JYBA 4U1LB 2E86A 3EGDA 1H6TA 3K72A 2WLLA 3WLBA 5GGRB 2DI7A 2QR0B 2EXSA 4X83A 4YAQB 4DPAX 3GRWL 2VR4A 3KPOB 4QRUA 3P0YL 5TDPB 4PJCF 1BFOB 2HH0L 3GSNA 4TTGA 4Z5RB 3H0TA 4MXQD 1WEJL 4C56B 1IBFA 4XN1A 4X9HA 1TLKA 1MFAL 2XIIA 5KBLA 1DDTA 3IGKA 1OSPH 1FN4B 4XOEA 1AZBA 1SOXA 1MFVA 4CU6A 2WB7A 4XAWL 3ME0B 4NQCB 4G59C 3CHSA 5ERWA 3FH8A 3V6OA 1T0PB 3RZWA 3NCJL 3GHPA 1DVFB 1GZHA 3FT0A 3LKQB 3V7AG 5IFHH 3DVNA 3RL2B 2DKUA 4OI7A 2EE0A 2QMKA 3SBPA 2OFQA 4Y8AA 3LNDA 5SWSA 4WU7B 4IOIA 3MC0A 4P3CH 3V5DA 4BQCA 4JFYA 5ESVB 3LZNA 2XQYK 5DJZB 2PWDA 1KBWA 2WSDA 2VN6A 3EJQA 4NNYA 3ARVA 3II1A 3TCLB 1UQSB 5LWYL 4PH8A 4JL2A 1NAMH 3PWLB 2WTPA 5ESAB 3O2WL 4FQJH 2GTZA 2FB4H 2VXQL 4FXGC 3DRQA 3EH5B 4LRNH 2FQGA 4LKXB 2DPKA 3CMGA 3DMMC 5AZ2L 7TAAA 4F8TA 5T1DL 4R90L 3MBWB 1KY6A 4MASA 1FSKC 3SE3C 2WLIB 4A37A 1HCFX 5JW4M 4XRCB 2B1AL 1N59B 5CJOL 1VGKB 3VI4A 2CIKA 1OF2B 5KBMA 1T03L 3CFNA 2AJUL 4WTXA 4ZSOE 3VXSD 2IAMB 4QHKI 3DMMA 5CZVL 3ECBA 3BUQA 2GIXA 4MA8L 1FUNA 1L6PA 3MJ8B 2V2XB 3DROB 3QDGB 3EUDA 5I73C 1I1AB 1S6NA 3DBSA 3B2PA 4AITA 5D70H 1DQML 1I3VA 3WEAA 1IC5H 2VDLL 1CCZA 3HKFA 2AVFA 4B9ZA 2NCMA 4XP6H 1A66A 3HRZA 4ORGA 4FADA 3U1PA 1JGLL 2UZYA 3DX6A 3STLA 4YPGB 3D12B 4PJDF 2WZPA 2Z4QA 1R0AL 2VDPL 3HN5A 4NYLB 5E9DE 3W2DL 4X5WB 1HEHC 4MQXD 2UY6A 4I88A 4IGBC 4PW4A 3T6WA 5AG9A 4RMSA 3NA9H 1PZDA 3BAEH 4MB3A 3QWNA 5A2CA 5J6HB 1ZLVK 5C2BL 3M45A 3TCXA 1MIEL 3SDCD 2HJKB 4M43L 4FHKA 4JY4B 3FJTA 4F80A 1IQDB 3C6LA 2NY5C 4OZ4B 3RTQC 2DM2A 3MV7A 2XVLA 2BP5M 4Y5VC 2P49B 3DYPA 4ZUSA 4KQ0A 2TRHA 4CILA 4AV4A 3M86A 1FLTX 4O2EB 3D0AA 4BGLA 3FTWA 3VWKC 4YZFF 1DO5A 2C4FT 2EYSA 2BNUB 4BFRA 4ZFGL 2PF6A 5GS1C 2R2HA 2WXRA 1LWJA 5G4NA 1RERA 2YD1A 1JXDA 2LLNA 4L3AA 4MRCA 1CXFA 4RBPK 1OAXL 4FF9A 4M7ZC 1SMOA 2Z91B 3BN9D 4R7XA 4XPBL 4JKPH 4UYPA 3TIEB 1T21B 1QBBA 5LBSA 3CVBA 1E9PA 1BJ1J 3EDKA 4N2EA 4NKDB 1JGVL 5IF0A 5C0AD 4OF7A 1B2WL 4TVPE 3B9DA 1B0GB 3F58L 3KPNB 1UATA 4PGBA 4WK2B 5SWZD 4PJDE 1NUFA 4PS4H 4UQDA 5KZCD 4PBVC 5J1TC 2VSCA 4WHCA 1LMKA 4S0HA 2FEEL 3K2KA 1H3UA 4FCAA 5CR8A 4NN7B 1JVLA 3SGKC 1YN6B 3MYJB 1HX0A 3KWTA 2YS4A 3UH8A 2MHAA 1C1EL 2V17H 2XTJB 5C0JB 3D7PA 1KGJA 3II2A 3U0TA 4KH2A 4LSQH 2CO7B 1NCIA 1NCDL 1UXWA 2ADIB 2VXQA 2FTAA 4FNPA 4R2GC 4N2HA 4Y4FC 4DO6A 5FF6A 2BP0B 2VKXA 3JWOH 1K85A 2WVUA 1JGLH 2VDKH 4Q6IA 2VOTA 2PETA 1YEGL 3OZKA 4MNQD 4MS8C 5B39B 2XFXB 3CFBA 4L3ED 1KJVB 3HC2A 4UTBH 2GSMB 3ARSA 2EDQA 1H8OA 3L5HA 5DMIH 3WSQL 1MQKH 4HKBB 5D71H 1L6ZA 4X80L 4HX1B 4M4PA 1KGUA 2YAPA 3HS9A 1NANI 4N68A 3BKYH 2VZOA 4LIQH 4EMZA 4G7YH 5PCYA 1MCBA 5KTEH 2GUOA 3IFLH 4G8IA 1MLCA 2R39A 2W0LA 3L7EA 1NFDE 2E74C 4HFWB 2D7PA 4MJ2A 3O4LB 2VXSH 3QAZC 4JM2F 4RRPA 5D1XD 1A22B 1L9PA 4OFDA 4IMKC 1N6UA 2XN9B 1NGXB 3BP5A 1AC0A 3SDAA 3ASNB 4FFZA 3H2PA 4KVCH 2ADYA 1KYAA 1DO6A 4YSEA 5KYXB 2OR8A 3QUZD 5D96B 5E94B 1D5BA 5IR1A 1S78C 2YWYA 2QSTA 5I6PA 1F6AA 2VDRL 4G7QB 1RZGB 1SY6L 2NTFB 3UADA 4JN1L 3FQ2A 2Q87A 2VZ1A 3N1MC 2E5EA 4XNBA 3K6SA 5AW0B 5LAPA 3DOSB 2ZUWA 2YBRA 1OP5H 1UUNA 4XNXL 2QADC 3NJVA 2GEQA 3BKYL 1G6RH 2F54B 3BXNA 3CGTA 4DZBA 1DQQA 3Q9PA 4NQVA 5DZVA 5JHDB 2ZYIA 3C8DA 2DQFB 2NDFA 2BNRE 1UZ6E 5GS0C 4I8DA 4E68A 3APFA 1A4KB 2OBGA 5ACLA 2GCYA 3L9YA 3OC5A 1JHTB 1PG7H 3QJZA 3C09C 4K3HA 2G2NA 4PJHA 1R6VA 2EDYA 1QSFB 2JCCF 3UBXG 2JIXB 1U8KB 2CLVB 1QAWA 3DMMD 5H35B 5HJGA 2Z4QB 4GMTL 2CDEB 4JHWL 3N0PB 5E6ID 3FOLB 3DOSA 3OLGA 3Q3GA 3TLRA 1OP4A 1WQVT 6TAAA 4DN3H 4LEBA 1E9QB 3CSGA 3SY0A 5JDSB 3ZY7A 3C8KA 3U4KA 3MOQA 1PDKA 3W3BA 3KLAA 3W37A 1J9CT 2YQBA 3G5YB 5HI3D 1MCNA 3BP7A 3T77A 3N43B 3IMWA 3OZLA 4GRMA 3MFGB 4KHTH 4OU3A 1IVLA 1HL9A 5D2LA 4N28A 4KWUA 2FBJL 2I7OA 1GMIA 3MRIB 1A7NL 4C57C 1GS6X 3BUYB 3OX8B 4YHZH 3FQ4A 1WLHA 5C6TH 3IDGB 4F1ZA 5CJQH 5BZWB 2KC0A 4FKHA 3FQ1A 1LEGA 4HKXB 3E38A 4JKNA 4HULB 4HUXB 3U7YL 4PJ5E 2F1AA 5JQHC 1D9KD 4X6FA 3VVVA 5ECGA 5C0BD 3L1EA 1P5UB 4KO6A 2WOYA 4NN6C 5DVPA 3VXOB 1ZSDA 2P80A 2QLVB 1IFRA 4Y19B 5IK3A 4BINA 4P2OD 4XP4H 3QZPA 1WIOA 4M61B 1SZNA 5D7IA 1G7JB 3QBTB 4LP5A 1FO0B 1UZ6F 2ZG3A 4NQSA 4MMXC 5C0JA 3TF7C 5BZDB 1U6AH 3NFNA 4U1HB 3RVVC 3KPSD 1OEZW 4F3FB 5I1GH 1A4AA 2AK4E 5FYLL 5GZND 1DBBL 2QGEA 2JWYA 3HC3L 2OYLA 4FNLL 5D1QE 1GZPA 4ZUWB 4H8PA 1CN4A 4WUKL 5L4JA 2V33A 1IGTB 2N0MA 3SKNA 4YDVB 3A22A 4ZXBD 3KPLA 1AGEA 2B3RA 4DCQB 4HIIB 1GGTA 2ZWYA 4K4KA 4WUUB 5GSVB 1AZZC 3Q5TA 1C12A 1NGWB 2VN5A 3NCFB 1Y18A 5DO2C 1MHCA 3V0EA 4LCWB 1UGKA 4N2OA 3HPJB 4ADIA 3T4AA 4AYBA 5KVFE 3D07A 1SEQL 3HHSB 4F3FA 1S78D 2CNZA 4UQ3B 2XTSA 1OW0A 4U7KA 5C2BH 4F27A 5E8OB 3FUHA 5HHOD 5GRUL 1A6VL 4ETQA 1UM6H 1IAKA 1JERA 1ITBB 4FL4C 4HLJA 4IRJA 4N0YH 4AKQA 4YHOH 3B34A 4W6YB 5BOZG 2XZCH 1IBGH 4RDQF 4UQ9A 4IS6A 1II4E 5AVQB 4A67A 3O3BA 2VUKA 1Y7VA 1A7QH 2WYTA 3U2SB 3RY4A 4RFEA 2Q8BL 2XWRA 1NIEA 3OJMB 3RGBA 2HRHA 1C08A 4G7VL 4JPWH 1E40A 1H3XA 1RU9H 3EFFA 3KPRA 3C6LB 4IHBA 2ENPA 4G72B 3R0NA 5FYKH 3RIAF 5ICZB 1JZ7A 2C3WA 2LV4A 2IVFC 1QLFA 4JFDA 4CMHC 4F8PA 1BQLL 2F15A 1NGZA 2E27H 3FN9A 4MJIB 2V2WB 5DVOA 3MSPA 4ZTOL 1TTCA 3S88L 4J5VA 3E3QC 1YAIA 3LN9A 3GUTA 4HUVA 4DGIH 5AUMA 5GGTH 1LE9B 5D7HA 3O4OC 3NZSA 4PJGB 4PRNB 4X8GA 1BZ7B 3SGJC 4EDWH 1SYVA 4RISL 4CSSA 3EBIA 1XCTB 1K5NA 2QFRA 1L0QA 1W0YT 1S7QA 2XBTA 3LTVA 3N41F 4OD1H 2B9BA 2P5EE 5B38B 3HFFA 1NM4A 2D2CC 2EDMA 4NAQA 4X6CF 2HA1A 2WMPA 3V5KB 2BCKA 3KLHD 3QUZA 1G4RA 4Z7NF 4MA1C 2BRRL 3BZ4A 5FHAL 1G9NH 4ORGB 3VI3F 1OAYL 3ECWA 2JJUA 4PP2A 3PNWA 2GCYB 2YSTA 1DFBH 4ANWA 1DN0A 4Z0BL 5C0ND 1ZY9A 1KCVL 5BVJA 4G8GD 5IQ9B 4W70A 1NCHA 1UD8A 3CBRA 2X41A 4PJAA 4QHMA 4DERA 5I1LB 1YJDC 2MKWA 3NAAL 4HJUA 2IANA 4IKNA 1H9VA 1KIQA 1JNLL 2J6EL 1BIHA 3KXFB 3B43A 1P53A 3MRQB 4OF5A 1AY1H 4P2YA 1BWMA 5L8JB 4R26L 4BE6A 3GJFB 2C1PA 2EZ0D 4LF3A 5I24A 4XXWC 4ELKA 1ACXA 4AQAB 3P40A 3MA9H 3QQ4B 2HJFA 1X9UA 5D5ME 3C60A 3NJMA 4XT1C 1Y1UA 3AG1B 1E4WH 4PJBB 5HHVL 1L9RA 2VMJA 3RHWF 2LQRA 4X8XA 1HHKB 4PTUB 1FQ9C 3L9RA 4ACTA 2ISDA 5E8EA 3FU7B 1U3JA 2R0KH 1CXLA 1Z9SA 1NAMA 3CDGA 4Y2DC 2R7EA 1EAPA 5JIKA 4K3JH 1JHLH 2Y2TA 5L2KA 2YLHA 5CU9A 1XFPA 4AK2A 5HYJD 2ED8A 1M42A 4HIPA 4ZFQA 5FDWA 3KNBB 3PXHA 3SYPA 2ZF9A 3MGAA 4OV6F 1RU9L 4U1IB 4UF7C 4Y5XA 1COBA 4YR6B 3BVDB 4F8LA 4J2QA 3T4YB 4UM8A 5HGAB 3PJNA 4Q6IB 3FB6B 2J1YA 2EKJA 1Q9WB 5KN5B 5FF6B 1MVUB 1A6TB 1KGIA 2O5XH 4HK0B 3F05A 3U7WH 2XV3A 4MMZA 1ZE3C 1T6VN 2HAZA 3DUUB 1WUZA 3F7VA 5C08D 2HT4C 2Y7QA 3U9WA 5EBWA 4AWJC 1UXMA 4E41B 3V2AR 3V9CA 2B08A 3GBNH 3QHFL 3SDXA 3U7AA 5L2KD 1V05A 3EH1A 4OZFA 3UBXA 1DVXA 1WIUA 4E42A 4PGZA 5CEXB 3QIWB 4N5ED 3IJ9A 3AUVA 3OAYK 3FB6A 2W80C 1YC8A 2OMWA 3A4EA 4PJIA 3VU2A 4D94A 1HE8A 2BSRB 4J23A 5CEZH 1ZGLM 2VJ8A 3KPRD 4F7KA 3I2CH 5D7JB 3PQYB 4RGNC 2F54D 3H6AA 4F58L 3GB7A 5A3ID 4OZIF 2M26A 3MV9E 4DP7X 1G0DA 3MUY1 4HJ1A 4ZMAT 3C9NA 4C58B 2NXZC 1ZSHA 5E6RB 1AHKA 4QAMB 1QLRB 3WAJA 2AANA 4XMKL 3U6XA 4G5ZH 2XZQH 1NFDA 3IFOB 3NACL 4WWOA 4X5QA 5DHYA 3CMOH 3DK2A 5DURB 2VABA 3T1FB 3HMWL 5I1CH 3ZMNA 5C0IB 3QUMA 3RVWC 2WIIB 2LE9A 3BDYL 1XF1A 1IGIL 3RVXC 4F9LA 5GSRB 3WS3B 1AQKL 2C9XA 4ALAC 1BFVL 5JZ7C 1FC1A 2OL3A 2VERN 3UYRL 3Q8CA 4ELKB 5HDBF 1SDDB 3R18A 3V52H 1MWAB 2A9ML 4HZAA 1GGUA 1K3IA 3AQYA 1LILA 3MLSH 2EDLA 4QRRD 3ISYA 2WY3B 2NUPB 4TUJB 5GS3A 5CP7A 3BH8B 3LN4A 2X12A 5HHMB 5K9OA 3UTSD 2PYEB 4RETB 3J07A 5BUAA 4KJQD 1U91B 4GSDL 2JKWA 5D7EA 5AVXB 1P1ZA 3NCWA 4LHUG 5AAMC 1Q9LB 1JGDB 3S36X 4AC4A 3IFPB 3KWXA 4HBCL 4AC2A 5BS0B 4OVVA 4U1NB 2PTUA 3NT0A 2OKMA 1TQBC 1Z32X 2YAFA 2XG4A 3B83A 4XN5A 4BJLA 1ZA3B 2VN3A 3NIFF 1YMHA 5JIIA 3IE9A 2J88L 3B7UX 1MAKA 3D85A 4X7TB 3EJYD 1PLCA 3X13B 5AAWA 5C7XH 1G9EA 3MJ6A 2OQJA 2P52A 4PJBE 2UZYB 3DX6B 3TVMD 3OG4B 3GDCA 4EXKA 1XF2B 2H2PC 4I48B 4LLUA 2O5XL 4YSSA 4WI5A 5KOVC 3WI9A 3W9DA 4L3CB 1BLNA 2B1AH 3ZL1A 1I7ZA 4NNPL 4Y5XC 2WOBA 1Z5HA 2YPKB 1SJMA 4BCZA 2Q20A 4JPVL 1K6QL 5HYSB 4TQHA 3FU6A 1ILSA 2YRZA 3C09B 3QEHB 4Y0GA 5T5FH 2ZOWA 4PIBA 4WV1C 2XN9D 3H7LA 4D2NA 3FO9B 4G5AA 4V1DD 3WKML 1SN2A 4LESA 2MOVA 1SBSL 5E4OA 5JQ6H 5SWQB 3TJEH 1QRND 3GSRB 3CQPA 3CFKB 2X4NB 3QFDB 1M9WA 3MNWA 4AYGA 3GMQA 4L8BA 4QRAA 1QW9A 4NO0A 2B5IC 2IDQA 1I8KA 1S9VB 3CFCH 3KGUA 1I8MA 3WNOA 2QPUA 1XZ0A 2NW3B 4XMPH 1JK8B 5FM5M 4AENA 4FI7A 1HSAA 2ZG2A 5HYJE 1BBJA 3CVHL 3U6RA 4IS6B 4F7MA 3NBNA 3OF6D 4HGWB 4LEEA 3QO0B 5DK3A 2VQ1B 5DJ8A 4MLIA 3UTTB 2FECI 3MRRB 5AWNH 4Y1AB 1AD0A 4PJ7E 4Q52A 5KG9B 1ZK9A 3S37H 1IKFH 3QDGE 5JQ6L 3NSCA 4BFBD 2XPGB 4MCMA 4NQUA 1YNLH 4DETA 2D4DA 1PCXA 4L5FH 3WIAA 1M3JA 3BIKA 1ZJBA 4AQZA 2OXHB 3PHQA 1D5IL 1S5IH 1YY9D 3UCQA 5E6UB 1AHWB 1P84K 2DI8A 2HP4A 5D6DC 1HWWA 3B7YA 3RIKA 4JO8A 5JPNB 4H20H 4M9PA 4D9QE 4J28A 1N5YH 3TNMB 1E7UA 5C6WH 2BC4A 3MCKB 3UROR 5EOTA 4PN6A 2HFGL 3MLUH 1IAOB 2NR6C 2AC0A 1L9NA 1AR1C 1B4JH 3JT0A 5EUKB 4Y89A 1SM3L 3L1OH 3O8XB 4NKOA 3LOWA 2DYPD 3VXNA 3PWUA 4AUJA 4RDQG 2UYLB 4AJWA 3JWDC 5GS0H 2QKIC 1MFDH 3D9AL 1N0LA 3Q8FA 3RVUC 3SHSA 4GXUN 2GHZA 4JLRB 2JMRA 1I3RA 4TN9A 1VSCA 1X5JA 3IFNH 3SQOL 1D9KB 3BVTA 3VRLF 2VZVA 2I69A 2ALWA 5GGVH 4NSKA 3LY6A 1KY7A 4RBPH 5T1MB 4KXBA 3JVFC 1BAGA 2FGZA 4HCRL 3ZHFA 3VD4A 5EC1B 2DZEA 3ARBA 1S9YA 3N41B 3GZPA 5D6CA 3X14B 4JRXD 5JYLA 5FFLA 3QZWB 5CINL 1F45A 1PIFA 1ZA6A 2HFGH 2J20A 3GMPB 1IAMA 1T0NA 4FL4B 4BQ8A 2YA2A 1CG9A 1B88A 5FAAA 5D1QB 3W0WA 1X7SA 2XFGB 1JWMB 1L7TH 4ZUTB 4P3CL 4ZMPA 1P0SE 1Q38A 2D0HA 1MJJA 2WXIA 5JHAA 4JZNB 1NCBH 2GPZA 5HI5D 1JK9A 1J0YA 1YQVL 3OKOA 2DIJA 4MXWH 4FN0A 3LV3B 1QATA 3L3GA 2YD0A 3NZUA 5CHNB 3WOVA 3ZYJA 4FQ2L 4XMPL 5IQLA 3MV9A 3UTQA 5B7FA 1PDKB 3ULAB 1RZQA 2Z3FA 5BRQA 5I5IA 2VE6B 1WPCA 2XLLA 3KYOB 2DKMA 3QGVA 1P7QA 3WFZA 4FG6D 4FAAB 4X7CC 2Q9OA 1OQXA 4XMLL 3HUJF 2APFA 2ZPKL 2XJLA 3US0A 4OQTA 4Z0XA 4L37B 4NBYB 5DEJA 3QQNA 5F7WC 1X5KA 5IROA 4LSPL 2Q7NA 4MBOA 4PLKD 2X3AA 4HJTA 2W65B 2GVYA 3S35H 4FD0A 5CGTA 3MRJA 4LLQB 3OAUH 4WU5B 5ITFB 2Z35A 5IHZA 5K9KA 4XXDA 3VFMA 4WFGE 5ENWA 1AI1L 3K6SB 2I07B 5C3LD 5HHQA 1RZGA 1QKZL 2O4EA 4U6VL 4M7KH 4I77L 2Q7AA 2QTVA 4K3EH 1WBZA 5E4EC 4WFED 3W11D 4KJYA 1GHFH 2JF1A 3PGDA 1SOKA 1UACL 4R0LB 2APSA 2GITB 1P69B 4YXHH 5EDSA 4P3WA 4OJFH 2Y22A 3MJ9L 1BM7A 4EE2A 4MMYA 4JFTA 4RGNE 5I1DA 2H3NA 3FHQA 3N5AA 1QACA 1N2RA 3ZDYB 5LWYH 3G9AB 5FO9A 1ASOA 3O3DA 3CVIH 1NCOA 1W0WB 1FPTL 2KERA 4P4RA 1H3VA 4OLVL 4XBEH 5I19L 4UWQB 1KPVB 2ZUTA 3L4XA 1ZT4A 4LVHC 3TT1L 1CFTB 4AZ8B 2VZUA 3RGHA 4AM0Q 4TULL 2VERA 3QFGA 3LKSA 3I6KB 3JWNG 5DYFA 3UTPE 3D25B 5JOEA 2V2TB 4R96A 3QAQA 3CXFA 1K2DB 1T4WA 3BSZH 7CGTA 3UAAA 1AQHA 3NFPA 3ZO0A 5EO1A 1CGTA 4Q4EA 5IB2A 3QUXA 3UC0L 3RVXD 2EIBA 1UB6B 2FX8H 4HHGA 3S96A 3VQLA 4QRRB 3KLQA 2JXMA 2OTPA 3WJMB 5IFJB 5BUPA 1DP0A 4M8UA 2BM3A 4AL8H 1UCTA 1T2JA 5FOBA 3VFWB 2OMUB 5E6IC 5EWIH 2W9DL 5LGYA 1TEYA 2ZKXA 2J88H 3KE0A 4YE4L 3BAXA 3N43F 3O9WC 5DD5L 2G9KA 4L1DA 4OKDA 3TBTB 3V10A 3NK3A 5C0CB 1VFAB 1KJ3H 2VAJA 3WIHH 2FR4B 5TDNB 3GBEA 3ZDXF 1B0IA 1NUGA 5T3ZH 1TETH 4H7VA 3P9MB 2NZIA 3HFMH 1CFQA 1OP9A 2IQAB 4J3XA 2Q6WB 3IXAB 1NDMB 4X6CB 2BSTA 1F11A 1UZGA 2EUWA 3L3OB 3OKKB 3AXLB 2EXYC 3CVHB 4HPYL 1OD7A 1NCNA 4PRIA 4EF3A 1BV8A 2EXWC 1TZAA 5DJYA 5HHOE 1A0QH 2AEQH 4P23D 3UGXA 2VXVL 2OK0H 2BINA 3SE4A 4XVJL 2IV9A 1I85C 1AGFA 1J0KA 2WVVA 4JFDE 4LL4A 1QYGL 4F33B 4ZFFB 1ZPUA 5E5RB 5C07D 3GBLA 4Q9RH 2DH2A 1JCKA 1WA1X 4B41A 4F57H 5D1XC 5I82A 4JVPA 3CFUA 3LQAC 3L1GA 1XGTA 2VMFA 4ZMZA 3MLWH 5FX3A 1KIPB 5IEKA 1MQKL 3HNVL 2D0FA 2AFNA 3QR0A 1KNOA 4M6AA 1J8HB 3ULUD 5IW3A 1R46A 5I1DB 1PX3A 2VXTH 2ZCHL 5EIVA 3SOBH 5I6KA 2WV3A 2YQ3A 3PV6B 3U7WL 2V4LA 3UCRA 4I4WB 1H5BC 4I2XB 2HTLD 4PGJA 1QI4A 2R1YB 2QPEB 2VQ1A 4U2ZA 4JQIH 1LE5B 3LS4L 4JKWA 1ZLDA 1WBZB 2NSMA 5JNYB 3LPOA 2BXYA 2DWYA 5HHQB 1OGAE 1U8LA 4GSRA 4HW6A 3EYQC 3BPNC 5FYJH 4R9HA 3RVTD 4H0IA 3UAEA 3BCDA 4J3OF 3MRNB 4XPTH 3ZDXE 1KEMH 4HUMB 3V5HB 4K8RD 1USQA 2EDHA 3NIDE 4NUJB 3FTZA 3D1MC 4QY8A 5I8OH 1NMBH 4PS3A 5BMFH 2D7TH 3L17A 4ZYKB 4HIEB 3LHPH 5DHVA 5A2FA 3ATEA 3GJFH 4PS7A 3MNZB 4K94L 3X11A 3WDJA 3HG1A 1IQWH 2VUYA 1OQOA 3HAEG 1YMMA 5IQOA 2QT6A 1SJXA 3KPPB 4KRPC 4L3EE 4LSUH 5DZ9A 3WJLA 2F53E 1A9EA 1EUUA 1MHEB 1QSFE 4ZFZA 5BRZA 3UYPB 4A1RA 4JFED 1JXKA 1PEWA 4FLRA 4B3VA 3NEOA 5F3BA 2R69L 1I1FA 2FR4A 1KBBA 1FZMA 3ROLB 4NJ9L 4R8WH 1XGRA 4O5LL 4YZWA 5ILTL 2XWZA 1A2YB 5IT2H 1J9QA 4FJZA 2G4GA 4RFEB 1RHFA 5DS8A 4M4RB 4UINH 1SVZA 2X4TA 4JREB 4S1RL 4ZX3A 5BMFL 2HTKD 3IGAB 1S46A 3M07A 4I9WE 3VVWA 4F37F 5ICYA 3K0WA 2D8KA 3C5ZC 3WTYA 2XZAH 3ZE0F 1ICTA 2EYRA 4NBZB 2LGNA 4Z7QB 4JM4H 3IDJB 4L2LA 3RVTC 3EYQD 2DEYX 2J5WA 4Y5VA 1EXHA 5TE7H 4GMSL 2VB5A 1HQRA 2VIRB 4LNRA 5E8NB 3QNYB 5DC0A 3RTQD 43C9B 4BKLB 4N24A 3VWJB 4JMXA 4PJ9C 3BH4A 4GP5B 5EU3A 5JOFB 4BSWB 4NKIH 4WLCA 4W9IC 4KDTA 2WUCH 3BWUF 3AG3B 3FFCA 2HJLB 2N4IA 4EEEA 3MUJA 3THML 1GYAA 4F15C 5GGSA 2UYLA 3LCYA 5L88L 3EFOB 3VSTA 5IMKB 4FQXB 1LEIA 2Y72A 4FXTA 2OI9C 2ORBL 2CK0L 4L4VE 4MB1A 5B21A 3BLBA 5SWSD 2CO6A 1IEBA 1S5HB 4BZ1A 1TQCB 3OKMA 1EDYA 3ESPA 5IMMA 4L18A 2X89A 2WLLB 1EO8L 2WZ5A 2CDFA 4TSBH 4YO0A 4PWGA 3WMPA 4NO5B 1BAFH 2K7PA 1U8OA 3RX8A 5CMAA 4ZZKA 4ISVA 5E2TH 4Y19A 1D5RA 1SVCP 1L7IL 4G6ML 3MVSA 2DDQH 4XO8A 3D50A 1DBKH 1FF5A 3CFEB 4XCYA 1QEWA 4JHBA 1TVHB 2CK2A 4U1JA 4Z8FL 1P5UC 3PGCB 4H8UA 4XXDB 4R2GB 1MLBB 4Y9FA 3UG5A 3IDGA 4WW1A 4EBQL 5KUKA 3CFMA 4NC1E 4KUZL 3UBHA 5EBLB 2BHYA 1FIEA 2C5DC 1FL6B 3O6KH 3O2VH 3QWOB 3SDCB 3RL1B 4FKEA 5E5LA 1UD6A 4LHUB 4XPGL 4C56E 3S8FB 2IGTA 3AXHA 2WINA 2VC2H 1FZKB 1KIUB 4FLOA 1XGRB 5IWLC 2ESVA 1JWSA 3RWJA 1WH0A 5DK2B 2K3HA 5GGUB 3KWWA 2VSKB 4U3XA 1ES0B 4PWHA 1KXVC 1QWUA 3SQBA 3EYVB 5C09B 5LVEA 1J0JA 1ZKAA 4AVIA 2RTTA 1GJWA 4J3TA 1C9SA 3LV3A 4TLSA 5ESQA 3FOLA 4MNHA 4NUMA 2Z35B 1VCAA 1TCRA 2Y69B 1NC4D 4RAHA 5DHVB 2CA4A 1H15B 5E8EB 5HGDB 3MV8B 3OTTA 5JW4Q 1QTYT 2FSEB 1F41A 3UC0H 5L6YL 3T6ZA 4K71B 4DJMA 4JZJA 4J6RL 2D73A 3BDYH 3NPZB 2E4FA 4UT6L 1T1YA 3IDNA 4A6YH 3APNA 4XP5L 4NFDA 3T65B 2J3SA 2EDNA 1A6AA 1CGSL 1MXDA 3IFNL 3SQOH 1F3JA 1HINL 3GXFA 3I6LD 2O61B 1JV2A 4BDVB 2R9HD 1TU2A 4ZMTA 1M9SA 3HS8A 5TQ0H 4U1MA 3LKPB 4XWOD 2P45B 1AE6H 1MCJA 5SX4H 5AALA 3QJOA 1ZEAH 4NC0B 2CM6A 4OGAD 4ZJ9A 1S7TA 1JNJA 3V6ZA 1NMAH 1ZTXE 3L2LA 4A2DA 1M1XA 4NT6B 2BIOA 5T3XD 1JGUH 3VG9B 1LO3L 1CU4L 1B3JA 1H5BB 1U0QA 1LL1A 4XCNA 5IHUH 2PO6B 5D8JH 2HWZL 3CN4A 4QPEA 2VR6A 2AXGB 4QOKB 3QJRB 4RRPM 5DQDH 1RPKA 4F37K 2QV2A 5DJ6B 1PFCA 4MB4A 2OL3B 1A1NA 1JZGA 2H8PA 3FBKA 3MROB 4JY6A 3TZVB 4KUCD 2BJMH 2XKSA 4O02L 1XR9A 4D9QD 3LXAA 3ARPA 5HDBE 5TQ0L 2ITDB 4FQ1H 1UG9A 3MNDA 2X1QA 1QPKA 5FS5A 5EO0A 1KWGA 3VXQB 5LGHL 1M56B 3O6MH 5IBTL 4U4BA 1MCRA 2V7NA 4Z7WA 1EUTA 1NDMA 1AP2B 3T0WA 4NN5B 3VXNB 4ABQA 3B37A 2XTJE 4JJ5A 3ARQA 3JWNH 4XMLH 5EH1A 4GAGH 1JXFA 2FLRT 1X44A 1UJ3A 3HB3D 3QWRA 4CSPA 3L4TA 3F6JA 3JV4B 3AQXA 4TUKL 3EJUA 3TBSB 4LARL 3BZEA 3L3HB 2Y6TE 4BFNA 4JGNA 2E47A 4MNQA 4OD2B 5DZNA 3V6OE 1AOZA 1EHXA 1JNNL 4P5KA 2KBGA 4ZDHA 1I1RA 4Z95L 1WZKA 2BNRA 4GSUA 3B9AA 4NRXA 4AK1A 2W0FA 4JN2A 3IJEA 4KXAA 1I8LA 3VI3B 2HG5B 5T5NG 4OZHF 1GGBH 3LEVH 2AQ1A 2YD6A 5I30L 1GW0A 2AGJH 5GHWL 3V4VH 4B9GA 4Z3JA 5B7MA 2TSBA 3DXAD 4TPRH 4HG4J 4N90D 5FW7A 4BQ6A 2EP6A 4Y4FD 4ZD3H 3IXAA 4FMVA 1T66D 4K55A 4H25A 3WUZA 2K6WA 5HDOA 4LCWA 4PJEB 2HLAA 5L0QB 3SDDA 4NUPA 4B9PA 4TQEL 4KZ0A 2DYRB 3F7LA 1NBVL 2VDOL 4CVXB 3K1KC 3NFSH 1E5YA 4DZ8A 4KZCA 4F2MB 4F2ME 2Y7NA 4ONHB 1FNGB 4QAWA 5HGGS 1JNHB 1BD2A 3G08A 5FHBL 1ROCA 4XXWA 4TRPL 5JOPE 1RJZB 4P07A 4MDIB 1WFTA 2OA9A 4WDIA 4M93C 3TWCL 1HFUA 4NZFA 1DBAL 1UWXH 3TF4A 5JA9A 2WBJD 4YDNA 2A3TA 2WQVA 3FTXA 1Y6KR 1HEZB 4B96A 1UWFA 3STZB 1PU0A 2E6JA 2CBTA 4NDMA 3IK2A 4ADGA 1TJHL 3HLKA 1RZ7L 1HE7A 2HJFB 5LQBL 1HHHB 5DMGD 1TQCC 3P3TA 4AQ1A 4AYMC 3LKPA 3RUGB 3P69A 3I3EA 3IPEA 4W68A 1W16A 2IG2H 3CIAA 3VFNA 4F5CA 2FJFB 3L2MA 2A99A 4NFCA 1U3HB 1YVLA 4G1EB 3D9AH 4QRRE 3CFJA 1EHLH 1IFHH 3ULVE 5BPPA 1YQ2A 2EE2A 2D31A 3NZ8B 5F1NA 4Z76B 5KSBA 4WHTA 2C9RA 4NQDA 3AWGA 1MHHB 3F6LA 2KQMA 4R5XA 4XO4A 4F5CE 5KWYC 1EBPA 1DJXA 2BZDA 5DD6B 1XEDA 1GY2A 1FIGH 5DJCB 1DUYB 2X4PA 2X7LA 4XMUA 3VWJD 3GPSA 1H6UA 1KMGA 3SDCC 2CRZA 4HEPA 4FFWC 2OMZA 1LP9E 2VE6A 2GUYA 4FQ2H 3PAYA 4UT9A 1E43A 2YXMA 1AR1B 2OL3H 2XWBA 1AG0A 3D39A 2CIIA 3SPVA 5CEZL 5D93C 2NNCA 1KTCA 2X6VA 1NCBL 1VFBB 4J8RA 4QCIA 4RAVA 4XMVA 1G7IA 3WJJA 1PY9A 2XQBH 4K2UL 1JXGA 5EU4A 1WA2X 3JUYA 3PWJB 3D2UD 3DYOA 1KELH 2F54E 3REWA 5CCKH 4JZOB 3UBXB 1DUYA 4YSOA 5J11B 3FC8A 1T0NB 2HT3D 2GJ6B 1R47A 2ZCKL 3MYZA 1MFUA 5IVXB 4HJ0D 3DJRA 4PY8J 4Y5YC 3QG6B 1N0XL 4MD0B 3HNTL 3UTZB 3OKLA 1YAZA 2F61A 4G70B 4U3SB 3CMOL 2YZ8A 1J88A 5IUSA 4KRNA 4PB0L 2ZOTA 3TP4A 3M1BA 1IZJA 5CBEB 1RIVH 4P2AA 5EIIB 2X6UA 3BLKA 4K71C 2AK1H 2W81C 1Z1WA 3LKQA 4G71B 2NY0B 4OQTL 2BIIA 5I0DA 5FKPB 3CH8A 3MREA 2XWEA 5DHDA 3ZHLA 3AMLA 2IADA 1RH8A 2P42B 5LGJB 1RIUL 4N22A 2ZX6A 1TSRA 4ISVB 1WDAA 5C9JB 2PPFA 4OV5A 3CVHA 1E4XL 1SJVA 1S7XA 4DVRH 1H3TA 3DX7A 4OT1L 1TZIA 3GZQA 2QVFB 1WGOA 1IAIM 1T2XA 3H53A 3KPOA 1KENH 3FUNA 3FONA 4UAOC 4HLZH 1REIA 4YDLC 1YEWA 1BQHB 2MNUA 2YRBA 2ZWKA 1OALA 4FQXA 2JSFA 4HX1A 4JKLA 2BVPA 4HK0A 3EZJB 4E9YA 3MBXH 1BD2B 2ARJA 4QXUH 1R19A 2FBJH 1W0VB 5I28A 3S2CA 2YKLH 1GTFA 4PI0A 1ND0A 3QXDA 4NWTL 4P9MH 2EAEA 2FCBA 5CJ8A 5FCSH 4ABUA 1J18A 5F7HA 2EEBA 5T1KA 4BZ1H 1AKJA 2WWOA 3GM0A 3P1VA 2QZ5A 1ZHBA 1JZ2A 5LCVA 3UTZA 5IFJA 3VFPB 4MQ7A 1CD9B 3EH2A 5CGYD 5F89B 5D7LA 2DTSA 3IBEA 4DEUA 4DHLA 3O45A 1BBJB 5L9DH 3T8MA 1ZIBA 2AAAA 2WAHA 3ARUA 2NXYC 2XCMC 2Y24A 4LSRL 1X5LA 1EPFA 2CRIA 3INUH 4Y4FA 4OZIA 3UZEA 5ABDE 5DZOA 4UUJB 1G7IB 3RRQA 1WFIA 1IBYA 4JEGB 1BQ5A 3BQUC 4QTHB 4R5VA 3X1GA 4DUWA 3CE1A 3V4UH 4AGOA 2LU7A 3GSRA 5A6IA 2VLLB 3SYQA 5DUPH 5E6IA 2R9HC 4PCTA 5I8EB 3LEXA 1SQMA 4BZYA 1DL7H 1RVFL 3KWWB 4EIGB 3S5LG 3FRPA 2EC8A 1FFOA 4NQDD 5DD5H 1RHHB 4OJYA 4JNXA 2D3JA 4GNKB 4DFIA 1J1XH 4NXKA 3S3CB 1WG3A 3KPPA 4ICWA 5J3HD 2P24A 4PJAB 4QHMB 3WN6A 4ZX6A 5ADPH 4NIYE 2UX6A 2J2ZA 1ZHNA 1SEQH 3MJGX 2CM5A 4KX9A 5CEYB 5IKCB 4HC1L 1FL6A 4JQVC 1W9XA 3GXMA 1EHNA 2FL5B 4O2EA 1E0OB 2HKAA 2A9NL 1G1YA 3HZVB 2N56A 2VLLA 1U3HA 1UWGH 5EZJA 1PVHA 4KNSA 3UL4A 3VFSB 4A7GF 4JFEA 4Z7OB 2P8LB 3IDIB 3U2SA 2VXVH 4OLXH 4P2RA 1RY7B 2WQAA 4N86A 4Y2OB 5DUBB 1ZJAA 3BZFA 3G5ZA 3IDMA 5B38A 1BPVA 5HHPB 2BNQE 3CFDA 4JPSA 1BYNA 4LDOB 2FO1A 2PYFB 3BH9A 4FQHA 1RXLA 4JFZL 2VLMD 3T8XA 2ITFA 3PDDA 5CEYA 2GC7C 2QFPA 4EN3B 3PGFH 4R26H 2PWFA 5HDBB 2ENQA 2EZ0C 1IM9B 4PUBL 4U1MB 3QDJB 5I66B 2RD0A 2APBA 4WEEA 1OK0A 2UWEA 2X9XA 1BHGA 3MQIA 2Y36L 2CD0A 4N0CD 3CDZB 4P9ML 1S7WA 3RE0A 3NPSB 1W72B 1VFAA 3ZQWA 5JW3L 1MFBL 4PEEA 3D39D 1VEPA 4NCDA 8FABA 2WTRA 5CLZA 1K5WA 1OPGL 3ES6A 3EOBA 4FQQB 2LU4A 3RFZA 1IARB 1JDCA 1E8YA 4KXZI 4XP1H 3IMVA 4GMTH 1YY8B 1Z6JT 1HNFA 2VDML 5IROD 4XHJD 1Q9LA 2E7LA 4A63A 1I8UA 1EJOH 4P5RA 4HH9A 4HJGA 4W9GC 3DTXB 2RALA 1IEAA 4CN1A 4ODWB 1OB1A 1SMDA 4U0QB 4NO3B 3UTPD 1KDJA 2W0FB 4JN2B 5AKVA 3LHPL 1AO7A 4HXBL 5IW6A 4N8VB 2QQLH 4B3EA 5F2FA 2OM5A 2B77A 5TK2A 2ZE0A 1IC7H 1WRFA 4ODTH 3KYMB 1JMZA 3DBXA 4DUXA 3ZDZE 3GGWA 1OXYA 4J3BA 4CN6A 5DS8B 3DRQB 3O8XD 4ONHA 1SJHB 2IWGA 3IF1B 2CGZA 3CVDA 2XVKA 4OM1H 4CVXA 4DZ8B 1CMOA 5E4AA 1W0WA 2ZCZA 3NIGE 3BUYA 3OX8A 4OIBA 3HC4H 1PQZA 3L2NA 1Q90A 1EK3A 1BZ9B 2X4UA 5DRXA 4MMZB 2SODB 5IT2L 3ZL2A 1IGYA 4E9VA 3MOAL 1Z9LA 5E8DH 4PY7A 1NDTA 3IPFA 1K8DA 1UKTA 4NAJA 3WAKA 1KJ2A 5JYMA 5DD1H 1U8IB 4ZT1A 3RILA 2VM3A 1N67A 5CNHA 4ODBD 4NAMA 4JANA 4YXKH 4ZTPL 1D3CA 5KZCB 3WHXB 4ZMNA 2FO8A 4PRDB 5FDWB 5LCVL 3VXOA 1XEUA 5I8KH 2PR4H 5F1IA 1L0YA 4WY7L 4EAEA 2QVTA 5CLXA 4NOBA 1CYWA 3U48A 1B0RB 2AQSA 3B5TA 1DDHB 2VR7A 3KYKL 4F7EA 4TLTA 1PD6A 4LLQA 4WU5A 4XVTL 5ITFA 1MCWW 4O02H 4F9LC 3CLEH 1HEJC 2W65A 2GG1A 1IEBB 2ORBH 1N10A 1E3XA 2VLKB 2FL5A 2CHNA 3U79A 3ILPA 4X6EB 1N64H 1QTPA 1XO8A 2CCLA 1ECZA 2C34A 1NA8A 2PPEA 3DV6A 5IJDC 5KW9L 5TFSH 4HPYH 4AGMA 3VGEA 2WHVA 5CKGA 1Q9OB 2W94A 1GY1A 2WXLA 4ZXBC 5BRZE 3LDBC 5LBSL 1CE6B 2VWEE 4PAZA 2BNRD 3B5HA 2WJ7A 2HKFH 5BCAA 1FZMB 3ROLA 1YPZB 4XX1E 3Q05A 3DBXB 1F3JB 2GT9B 4GW1A 3R06A 4X98A 5FUOH 2ADGB 4OZ4A 4U3HA 5L4IA 1U2YA 5F1SA 1DSFH 2CIIB 3B9KA 2YSSA 2IO5A 3FQWA 3T04D 1R5VA 1HHHA 4L8SC 3H9SB 4U1SA 3VFMB 3FQTA 4E5XA 4AKOA 2EDOA 4A7VA 4P2OC 1Z0MA 4YWGL 1E42A 5D1ZC 1MRDL 1VA9A 3JV0A 2DJSA 3PHSA 5I2IB 1E27A 1Z3RA 3QEHA 4FHJA 4V2BA 1PLAA 5EUOF 5CR1A 3N55A 3D8MA 5E6ZA 3B9KC 3LMJH 1MHHA 1GS8A 4JDVA 1AFVH 5DI8A 3CUPB 3Q7JA 5C92A 3Q1SL 4UQCA 5HYJA 1YEFL 2FIKB 2YK1L 4PJFE 5AW1B 2Q6WA 3UPAA 5C86A 2YKLL 3GZKA 4GUOA 3ULUC 4NSKB 2AI0L 1PG7W 4P2QB 1BXAA 4NX0A 4ZMWA 1OHQA 2OQJB 3WXVL 1ID5I 1BFVH 2CO2A 4IBVA 1E4KA 3DOIA 3L8QA 4OUUB 2BRRH 1TTFA 3V4VA 3BMWA 3TWCH 1UENA 2OLDA 5CLYA 1JE6A 3KJ4C 4WSJA 3TO4D 2GYSA 4KROD 4AYSA 3WTSA 4G2AA 2C9AA 4HFWA 1C08B 4KJWD 1BF2A 3QULB 3TA3C 2HPTA 2UXVA 5I16A 1C5CL 2ZIDA 1S7XB 2XQYG 5I1IH 5EO1B 5IB2B 1KGCE 4F7EB 2CJUH 3RNQB 2WN2A 1BEYL 1HJBC 3VRJA 3EYVA 3WIFB 4GAYB 2JH2A 1QFHA 4LCIL 1RK0B 3L5WB 2B15A 1XIWC 2WVTA 3KPNA 1ES0A 4UIMB 1NJ9B 1BVNP 4FULA 4QXTA 3GUTB 2X1XR 4Y9BA 4FOMA 3W0WD 2NX5E 1PD1A 2UXGA 5KYUA 4JY5H 1UQSA 3FRUB 4UINL 1I9RH 1CFVL 3B2UC 3EO9L 1K8DB 1YEJH 3BCFA 5T1KB 3ULUH 4LHUA 1AP2A 1AACA 1MI5E 1OSPL 2XV2A 4NKOB 4HPHA 1X5ZA 2WLKA 4JO4H 4DK3A 1DQLL 2XXFA 4H1LB 1JZJA 3T0EC 4XNMB 5IEKB 3OJDA 1T20A 1GGCL 3F7YA 3QG6A 4EN3D 5FA4A 4KROC 1WWWX 4I3RH 5AENA 1D7BA 1NJ9A 1HU8A 2ZXWB 2NW2A 5FYJU 3L48A 3QPXH 1DDHA 2V3DA 2CJSA 4GO8A 4PYGA 3TZVA 2AJ3B 5IFHL 1I8MB 1DBBH 2HZHA 4GH7B 3SCMC 4I1NB 4DP6X 4G8AC 4HLZG 4NKMB 5IHUL 4FQ1L 1AHWA 4XOBA 3WJMA 5CIPH 4P23B 5I74C 1W72L 2HX9A 3LRKA 3W1ZA 3O4LD 5LGHH 3C5ZB 4DQOL 3SE3A 4NT6A 2WSPA 2HJKA 5B8CC 2TRYA 2FB4L 2VXQH 4YHPB 4MXVF 1T5WB 2NY6D 2E6PA 2L04A 1G9MH 1P7KB 3WFDL 2Z92B 4U1GC 1U4FA 1KFAL 3D06A 5B1CA 4LB8A 4H1LG 4YDZA 2IALA 1UA3A 3VRLE 4A38A 3QZOA 3DPBA 4UM8B 3LNFA 4FXKB 5CINH 4PRID 1ULVA 4ZFOA 1KPVA 2PYEE 3AS3A 5FW6A 1JPSH 5LNDA 1WFMA 2WKLA 3CFJB 4KTEH 4UM9A 1A1NB 3MROA 4JY6B 4GW4A 4GBXA 2Q10A 2BY1A 5GRWA 3AREA 5JOFA 3ZKSD 1MW3A 2I5YL 4XCEB 3C6SA 3P4OA 1GZQB 2ZXBA 2Q2LA 2F7QA 4Y5VB 4ELME 3NSXA 4Q74A 2V2XA 1D7CA 3DROA 3DDGA 3WFCL 4BDVA 2PTVA 4M56A 4JZNA 3ZHKA 5ADOL 2XG5B 4QT5B 2GI0A 1KJ2H 3QCUL 5D1QA 1NC2D 2D4FA 2E9IA 1WWBX 3MLUL 4AQAA 4PWEA 3U2JA 3GI9H 4JVWA 1LMIA 1JTPA 2I07A 4NZDA 3TURA 2DRUA 5B22A 4IBYA 3P54A 3OKEB 1BFSA 5TH2B 2PMZA 2VLRE 1E8WA 3NACH 4MJID 2A9MH 3S34L 3PQYE 5FXCH 4MJ6A 4RWHA 4JUTA 5E1AB 3BPCB 4FFYL 3U0PA 2WIIA 3VXUD 2AABH 2EACA 2NZ9C 3MCG1 3WN5C 1XGUA 1WTLA 3EG9B 4PMFA 4LL1A 5GS2D 1VADB 3MAWA 2GKIA 3O41B 4ES9A 2CPCA 1ZLSL 2BO0A 4E41E 2C7FA 4GBXD 2C4XA 2R4RH 3HZ3A 1F5WA 4G1MA 1G7HB 2BY3A 1FL3A 2GIYA 2QL1A 2Y5TA 1JG9A 4HIJB 2Y7LA 3FSWA 5JW4R 3DUHA 2JELH 3LIZH 4JGJA 3WKNA 3CH1A 5T1LD 5K9OB 3P4MB 2AJUH 4UB0H 5DRZB 5EPMA 2NUPA 2WGXA 1DBKL 4MA1B 1EHAA 4XC1L 3HBGA 5C7XL 5I1AA 2BNRB 1R3LB 1BZ7A 1OP3H 3ZZLA 2XXMB 1E5AA 1P4BH 2NT0A 4ZBJA 3RFZC 4PJ7F 3DX8A 3N42B 5FLVA 1MH5B 5I26A 1HEZA 1JWSB 4UOQA 3IJHA 1YO4A 4AGLA 4ELMF 5KSUB 5D7SL<