4W9ZA

Crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
b'MVPKADLTIKATGKQWYWSYAYPDNGKFEFDSLMAQDKQPRLLGVDNEMVVPVNKVIRVQVTGADVIHAFALPAFGVKIDAIPGRLNETWFKAAKTGMFYGQCSELCGKDHAFMPIAIRVVEDKEFASWVETAKKKFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 2
publication title Crystal structure of the periplasmic domain of subunit II of cytochrome oxidase (CoxB) of Bradyrhizobium japonicum
rcsb
source organism Bradyrhizobium diazoefficiens
molecule tags Oxidoreductase
total genus 33
structure length 138
sequence length 138
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4w9zA00
3BQVA 1HAWA 1JERA 4GYBA 4A2EA 3TASA 2Q9OA 1ADWA 1E67A 4K9JA 1OE2A 3V9CA 4DP4X 2DV6A 2TSBA 2I7OA 1A8ZA 1BQRA 2RACA 3ABMB 3S3DB 5I26A 2BP0A 3WIAA 2X88A 2XWZA 3NJGA 2YAQA 2JKWA 2PPAA 1YLBB 3JTBA 2H3XC 5B7FA 1IBYA 1MZZA 1CYWA 1FFTB 2CALA 4YL4A 3FQYA 1ID2A 2LLNA 3T6WA 2IH9A 3FU7A 4BXSV 3WG7B 4E9XA 7PCYA 4BWUA 1KYAA 3S8FB 1N70A 1HFUA 1AIZA 3FT0A 3T9WA 3FQ2A 4YSPA 4FAAB 1NIFA 3ZIYA 1E30A 1NTDA 3IEAA 3PLYA 1BXUA 4UAHA 1RZPA 5I6LA 2IH8A 2DWTA 1RCYA 5I5MA 1BQKA 3WNIA 1TEFA 4Q8BA 4QLWA 4Q89A 1OCOB 2YQBA 5B1BB 2CCWA 2IDUA 4YSOA 2MTAA 2BZ7A 4DP2X 1JZEA 4YSTA 1NINA 4HAKA 2DWSA 3DIVA 3QJSB 4YSQA 3S3CB 1RKRA 1AQ8A 2BO0A 1PAZA 2FWLB 1GY1A 2BZCA 2FT6A 2PLTA 3N2JA 2PP7A 2EIMB 1NWOA 2XV0A 1ZIAA 1TU2A 2N0MA 4KNSA 1OOWA 4E9YA 3NSDA 1UATA 2AFNA 3QQXA 5IY5B 1L9TA 3CVCA 1JXFA 3D12B 3X1NA 2XUWA 4RH4A 4QKTA 1BEXA 4HHWA 1OCRB 1M56B 4ZK8A 2HRGA 2FQFA 3OQRA 2VN3A 1V55B 2J55A 4HIPA 1OE1A 3NP4A 5I6PA 3ASOB 1W6LA 4DPCX 3EF4A 3X1GA 4BXVA 1E5YA 5F7AA 4GP5B 4EF3A 2R7EA 4DP0X 3AG4B 1A4AA 2BP0B 2PP8A 2VM3A 3NSCA 2HX8A 2YAPA 1WA0X 4G71B 3KW7A 1FWXA 2YAHA 4L0PB 1SFDA 3KW8A 5PAZA 2GIMA 1ET8A 3PPSA 1J5CA 1IUZA 3OMAB 3AY2A 3QPKA 1XB6A 3FU7B 2YXVA 3ZX1A 1GYCA 4KNTA 1VLXA 3SBPA 4DPAX 3H56A 4CSPA 4YSCA 1NIDA 2FT8A 3SQRA 1X9UA 4BWWA 2EILB 2MRYA 2CBPA 1N68A 1CC3A 1L9OA 2YAEA 3QJTB 5B1AB 1NZRA 2QDWA 2XU9A 2FNWA 3FPXA 1SDDA 2HZHA 1QLEB 1ILSA 2X87A 5LDUA 2CUAA 1ZV2A 3UACA 5D4IA 1EZLA 3V9EA 1OCZB 1IBZA 2DY2A 2VW7A 4NAJA 5PCYA 1DYZA 1TKWA 3FSWA 1KDJA 2IDFA 5I6MA 4JHVA 2JXMA 2QT6A 3FPYA 2DYSB 1GR7A 2HXAA 2BP8B 2VW4A 4F7KA 4A67A 5B7MA 2FT7A 1SF5A 2PP9A 2W8CA 1R1CA 3X1EA 5TK2A 5B1KA 4KO9A 1RZQA 2VM4A 1ILUA 1PNCA 1AANA 2FQGA 5TK4A 3CVBA 1JVOA 2AZAA 4KO7A 4G72B 3PCYA 5I5JA 1JVLA 3T71A 4CSZA 2IWKA 2HLEB 2J5WA 4F2EA 4KNUA 4G7QB 3QJRB 2ZWNA 3AZUA 2YAFA 2UX6A 4PAZA 3NT0A 1ZIBA 5B1JA 1SF3A 3SBQA 2R7EB 2PCYA 1JZIA 1X9RA 1OCCB 2WSDA 2WO2B 2XXGA 2ZOOA 5I28A 2XVBA 1V54B 1AACA 3X2QB 3QJVB 2ZONA 2NRDA 2FTAA 4M4RB 3OD3A 1QNIA 5AZUA 1AS6A 3NJKA 1MDAA 3S8GB 1V10A 3NJLA 1JZHA 1GS8A 3WI9A 4BDVB 4HCFA 4KO6A 1PZAA 3FSVA 1PLCA 2EIJB 2BP8A 1JXGA 2QPEB 1GS7A 3ABLB 2UXGA 2YXWA 4HCIA 1QHQA 1GS6X 1OF0A 4ENZA 9PCYA 2H5UA 1GW0A 3PAZA 4AI7A 3DKHA 1JXDA 1SDDB 1DZ0A 4HCGA 4DP5X 3ABKB 2BW4A 1F56A 4MFHA 1L9SA 2BW5A 2GB2A 4G7RB 1CYXA 4DP9X 2IDQA 3ZBMA 2OV0A 2GC7C 3QJUB 1AZRA 3C75A 2JFCA 1MG3C 2IWFA 3PXLA 4GY4A 3WKPA 1ETJA 1T5KA 1IKOP 1XB3A 3AW5A 3OMNB 1KDIA 4W9ZA 3EH5B 3JT2A 1NPNA 2AZUA 2BWIA 5ANHA 3H4FA 2PPFA 2FQEA 1PY0A 4G7SB 3FU9A 3CDZB 1JZFA 1J9TA 4F2FA 4FA7B 5EHFA 4A2FA 4BDVA 5I5IA 5A7EA 3FSZA 1EHKB 1BAWA 3AG2B 3NP3A 2IDSA 4E9WA 2GI0A 4GP8B 1NDTA 4KO5A 1NICA 1ET5A 2XX1A 2OJ1A 3FSAA 4A2GA 2VMJA 1NIEA 4YSSA 3TBCA 3PAUA 4YSUA 2I7SA 1JZGA 1KBVA 2IWEA 3NYKA 4DP6X 2HRHA 3TA4D 4NB7A 2Q5BA 1NWPA 4YSRA 1W8EA 1J9SA 3GDCA 1L9QA 3ERXA 2TSAA 2FJSA 2GHZA 3H4HA 5AKRA 1AS7A 1B3IA 4TXVB 1AG0A 4YSDA 1WA2X 1E5ZA 4AX3A 2CJ3A 4P5RA 3BVDB 1KCBA 1BYOA 3UABA 4E9SA 1PZCA 1ZPUA 4JHUA 1ET7A 1WS8A 7PAZA 6PCYA 3NSYA 4UF7C 4HHGA 3CVDA 5FC9A 1SJMA 2B3IA 2PPCA 1I53A 5I6KA 3CDZA 3HEIB 1HAUA 1GY2A 2CAKA 4X4KA 4DPBX 1XMEB 1OV8A 2UXFA 2GSMB 5I6OA 2E86A 2VSMB 3FYIB 4E9VA 1L9PA 3IBOA 2H47C 2YAMA 3UADA 4YVUA 3GYRA 1AOZA 1AR1B 1ZDQA 1ASPA 3S3BB 1AZNA 1KV7A 4AKQA 4A68A 4E9TA 4KOBA 1JZJA 1OE3A 4NERA 4GP4B 2P80D 1SHWA 4A2DA 2QPDB 2VW6A 2XLLA 3WKQA 1CUOA 1L9RA 2UX7A 2Y69B 2YARA 1J9QA 3NJNA 5E9NA 3NJMA 1IC0A 2A3TA 3G5WA 1KBWA 4A2HA 1BXAA 4HALA 4YSAA 3NJJA 4AKOA 2HX9A 4GXFA 2XYBA 4E9QA 3QJQB 4N8UA 1JOIA 4WTQA 1PLAA 1A4CA 1AG6A 5D4HA 1A65A 4JKNA 1URIA 2I85A 2PCFA 1W6WA 2J56A 4G70B 3T6ZA 5B3SB 1XB8A 3AG1B 1SNRA 3T6VA 2B08A 2J57A 3OM3B 1A3ZA 2Y1AA 2OCCB 4P5SA 3ZDWA 2IAAC 4UANA 3EHBB 4E9RA 1NPJA 8PAZA 1AZBA 2AANA 4BK5C 3UGEA 2W88A 1SFHA 3IN0A 1MZYA 1J5DA 3UAAA 3NJHA 1WA1X 3TBBA 1E65A 4WKXA 1CURA 3FS9A 3FQ1A 5B7EA 3AG3B 4A66A 4YSEA 2XV2A 4HZ1A 1SHXA 3IE9A 5B1JC 3RYMA 1M57B 3NJFA 5D4JA 2P80A 2DYRB 3PAVA 1FA4A 2GBAA 2UXTA 4M3HA 2AVFA 3TU6A 2PPEA 3MX0B 4AKPA 1KCWA 1MG2C 3WNJA 1ASQA 1BQ5A 2UXVA 4DP1X 1PF3A 2WO3B 2XX0A 1PMYA 1AZUA 1AZCA 3NJIA 2YAOA 1NIBA 1AAJA 3MBWB 5I6NA 2PPDA 1NIAA 4AZUA 1GSKA 2EIKB 2XV3A 3SBRA 3N55A 2EINB 3CG8A 5AFAA 1ZDSA 2IDTA 2FQDA 4PCYA 3NSFA 4W1TA 3L45A 5F7BA 2QDVA 2HX7A 3UAEA 2ZXWB 4YVNA 6PAZA 3EH4B 1J9RA 1BYPA 1PZBA 1WAEA 3OMIB 1M9WA 4DP7X 2BWDA 4KOCA 3FU8A 1PLBA 4DP8X 1A4BA 3GXUB 3HB3B 3T6XA 1PCSA 1TEGA 1BXVA 3U25A 1KGYE 3X1FA 2XXFA 3CZUB 3ASNB 4BWTA 1PNDA 3IN2A 2GC4C 3ABGA 4N4YB 2BHFA 3X1BA 3FYEB 1ASOA 3DTUB 3EH3B 1WS7A 2VSKB 1AS8A
chains in the Genus database with same CATH superfamily
1S9WA 4ABWA 3IVKB 1UT2A 4JO3H 1UD2A 3OPZL 3ZKMD 5IJKA 3EYQC 1TVHA 1WFIA 4GYBA 1BZ9B 5BUGA 4YBHA 5ICXA 2Z0BA 2ROYA 4QXGH 2VJ0A 1E67A 3KVDD 3DO4A 3OAUH 4L3AA 2EYRA 1AGBA 1P7KB 4OUOA 4R7NB 3CFEA 5ENWB 3X14A 1G7QB 3U4BH 4HEPG 2R27A 5E2WL 3N0PB 3QFGA 4PQXA 2APSA 3FKUS 3RAJL 4G43A 4AYDC 5ITBL 5F7DB 1F3RB 3S36L 3RDTC 1YEKL 4N2DA 4QHNA 3H9SA 1AXIB 3L3DA 3MXWH 5D7KE 4EAEA 4ANKA 4OLVL 1UOKA 2CALA 1P2CA 2BOBB 2ENQA 3SKUD 3DXAB 5IBLD 5IP4A 5F6HJ 1L0QA 5CLXA 4WGVB 2ZXBA 1H3PL 2LU7A 5JDSA 4N0FA 2Q86B 1MEXL 2DMKA 3HG1E 4LCWD 4OZIE 2AF2A 4RFEB 5LGHH 3WHE0 1QSFD 4ZUSA 5CKAA 5CHNB 2C7UB 5D70L 2DWTA 2WNWA 1RIUL 3DPBA 1DUYA 1MIMH 1DVTA 4Q8BA 5EF1A 3IVKA 1I3UA 1OCOB 3O6ML 4MA1B 4O2CA 3TWCL 3UDWC 3ORJA 4HWBL 4IYKA 2WXRA 3VFRA 4DP2X 2K3TA 2QADB 4X4YB 1JGUL 1G94A 1RFDL 1DN0A 3VGEA 1NH6A 1N64L 3DVIA 5ENWA 3R18A 1C16B 3V4VH 1G7QA 3VSVA 1P6WA 2ADIA 1BZ7A 4GMTL 12E8H 3GSXB 1E43A 3ARRA 4OQTH 4PN6A 1JPFB 5E2VH 1CR9H 2OCJA 3B9AA 4RRPA 2KS0A 5FLUA 2YD9A 1FFPB 1B4TA 4XMLH 1NMAH 3VYPA 4JLRB 3BWSA 2DYPA 3ZT5A 1YNKH 2ZWKA 3IKKA 3KPSD 1AGEA 4WFHD 4ZD3L 1W0YT 2ADGB 4MZIA 1WD9A 1M56B 5FA3A 4H1LB 5E94B 5C3IA 4JRXA 4NQCA 4EOWL 2PMZA 1NCOA 5CZXD 3NUKA 3RGVB 4GG6E 3FTWA 1I9JH 4KKCC 2X9WA 5EU4B 3ZSSA 4ZNEE 3BIKA 3KPMA 4Q0XH 3HMXA 1MJUL 2OSYA 1LEIA 2J2ZB 4AC4A 5JQIB 1SLXA 3KEDA 4OCRH 4Y5VC 5BV7C 5CBAB 2IF7A 6FABH 1E28A 1NGPH 4YDIL 1CGSH 2W94A 1X5FA 2DD8H 4KC3B 2XJLA 4XX1G 2FJFA 4B97A 2WYIA 1BFSA 4GMSL 4U1KA 2NY2B 5IBUB 3J8F7 1UT9A 5E2UL 2CO6B 3MV8B 5HDQH 5JORA 1JK8A 4K73A 4QRQA 3QI9D 3VH8A 2LABA 3SBPA 3CH8A 3CV5A 3QEQB 3GSXA 4FJZA 4TPRL 4MD0A 1JPFA 2BY1A 5L4JA 2MQGA 4LPUA 1UFUA 3TPUA 1KPRB 2OAAA 2XN1A 3MJ9L 4JLRA 5GJSL 3NGBC 4TMPA 3T5WA 3U9UA 2ICWI 4QT5A 4G8EA 5TDOB 1CF8H 2XG5B 5TF1H 5E94A 3FU6A 5IM7A 1SDDA 3PNWB 5K1NA 2CUAA 2OR9H 1ZVSA 3BPLC 1D5XB 2DY2A 2YEQA 3OHXC 1A5FH 3RLSA 3TIDB 4QRRB 1AMXA 2D8KA 3L3HB 4IRSA 2W07A 3SDAC 3SDDC 4YHYC 2V2XA 4KUZL 4LEOA 2ILLA 3K4DA 3PWUB 4JHVA 3TN0C 1NFDB 1JL8A 1OSZB 1ADQL 2XY1A 1OT2A 1NSNL 1WSST 1ZVHA 3X11A 3GXPA 2DJMA 3HMWH 1E9OB 3KH3A 4HIHA 1CL7L 5IVZA 3WMPA 2CO6A 4R84A 3CXDL 1EVUA 2FX9H 1U8CA 4QOKA 1CD0A 2D31B 4PBWD 3KWTA 3CFUA 2J5LC 5IFJB 3MOQA 3MLRH 4R4BA 5DDHA 5AYUH 1KEGL 1E8ZA 3QEQA 5FUOH 3VTAA 3JVFC 3VWJB 1UWXK 5T3ZH 3WIIL 4R2GB 1C1EH 4PMEA 3C6LD 1CDBA 2WW8A 4JPKL 1F8TL 2JIXA 3EJRA 2ZWNA 2UX6A 1PY4A 3WTTA 4LRNL 5TDOA 1BFOA 5B1JA 3V0VA 1CPUA 4NKOA 3CSTA 3QFJA 5HDBF 4HKBB 2VLRD 4QO1B 3HBQA 1QSEB 4HGWB 4ZFOA 5FYJL 1XBDA 3IPFA 4TSCH 3Q01A 1D5XA 5GGRB 5HI3C 1UFGA 2AXJA 1WBZB 2NDFA 1IAKB 1YAIA 4NJAL 3SCMD 1GS8A 5BRPA 1J8SA 4L4VA 2M26A 4Z0XA 2V17L 1MCEA 3A67L 3OX8B 1KYUA 3B4NA 2F5AH 4M5YL 2NXYD 1UURA 1WITA 3QCUH 4RA3A 5BQDA 1VGKA 1X4YA 1QRKA 2E7DA 3MA9L 2ZCZA 4JDZA 3BAEL 3PAZA 1N6QH 5IFJA 3BZ5A 3ZDYB 1NM4A 3ABKB 4HJGB 3TXAA 1MWAH 1ZT7B 2UUDK 3HE7B 1GGUA 4AQ8C 4BFOA 3EHBD 2WYZA 4OZGF 5DXWA 3W0WB 4DWHA 3J27A 2P5EA 3IDJA 4TVPD 4F8PA 5IEKB 2XN0A 4UT9H 1DQMH 3NBNA 1LEGB 1OT1A 4LSQL 4ZAKD 4YLQT 2DQEH 5CINH 2DI7A 4NZJA 3EFDL 4FERA 4QO1A 1QSEA 4W9ZA 3ZMEA 4BH7A 2JK5A 1F4AA 2AZUA 2BWIA 4WNQB 3EF7A 3RPKA 1W80A 1PY0A 3JV0A 1M7IA 1IAKA 3MLVL 5ACMA 4O02B 3S88L 3INUL 3RWHB 1T2JA 2O61A 3BT2L 4TULL 3ZHFA 2ZD0A 3LHPL 3KS0H 5I30H 1TSRA 1N5YL 3I6LE 1ZCRA 1W91A 3V2AR 3WFZA 1RH8A 4KO5A 1INDH 4OLXL 1OP4A 4NKDA 2XX1A 2OJ1A 2EDQA 3DMMB 3Q0HA 1JWUA 4LE8A 4UQ2A 2AQPA 1CLYL 3HFML 2VMJA 3PWLA 4PLJD 2WANA 1D5IL 2QGCA 4HJGA 4I89A 5GRJH 1O6SB 3DROB 1S5IH 5B1CA 1EBAA 4C47A 4G2AA 4UOZA 1CB4A 2NQCA 4U3HA 5JPMB 1WICA 1X5KA 5L0QB 4G9DB 4K7PX 3H4HA 3HBGA 5FWRA 5IJVA 3I9GL 3N50A 4MZ2A 1BVNP 4MNQD 3TT1L 3K2UL 2LFGA 4EMZA 3BN9C 4E9SA 4PYGA 2VABA 1U4FA 4JDTH 5CKGA 2DMHA 3CSYB 5FGCB 7PAZA 3ZHKA 1KBGH 2G5RA 1NBCA 4WNQA 4UDTB 2O6EA 1ID5I 2X4TA 1X5JA 2NZ1A 2ZSVB 1SM3L 1Z9SA 5AW7B 1KCSL 4WI0B 3EFFB 3HEIB 2BM3A 4U1NB 3LEXB 1IVTA 4MCYA 3A6OA 4IRZH 1V3JA 4GRLD 3F12B 4L3FA 1B9ZA 1OQXA 2C9QA 3VE0A 3IJHB 3QEHA 4FNQA 3FW6A 5AW3B 1SEBB 5I1AA 4WUUD 3CHXA 1I85A 3HS0C 4I18C 5HJ3B 1A7PH 4LSSH 1VESA 1DBKL 3GFUA 5I1CH 3VD2A 1SUHA 3BGMA 1HZLA 2GCYA 2X6BA 4DGWC 3BPCB 4NNXA 3MXVL 1NAKH 2ZG3A 2Y69B 5E9DD 4ETQB 2YARA 4JL1A 5ICYB 2AXFA 4KXAA 4A2HA 1BVOA 4I3RL 2XTJD 5DD5H 3NJJA 4XRCA 1RZJL 3FN0H 2H4EA 1E5BA 2HJFA 1IAIH 4MSWB 4BFNA 5JDJA 4YGVB 5DEFA 2A77L 5F1NB 2RB8A 5HDOA 5C07B 1A65A 4KVPA 1ZV5A 5B3SB 3WXWH 3ARTA 4JBSA 1AI1L 5A2FA 1XDTT 4MLSA 4PS4L 5F96H 4UANA 4F91B 4PWEA 3QARA 4EI5D 4RMQA 1Q9OB 4U1NA 3LEXA 5JLZA 1X7TA 1OM3L 3PL6D 4WKXA 5HHNA 3GSRA 3B43A 1UCTA 2IQAB 2J72A 1JI1A 1Z3RA 4IGBD 4F1ZA 3CN3A 5DRNA 3AB0B 2JJVA 2BDNH 1O75A 1Z9NA 2E5EA 4NN7C 5C0DB 3A21A 4CADB 1I8LC 3O41B 3IJSA 1NMCB 4UQDA 4I9WE 5A2BA 1MI5E 1ZSDA 1NQBA 1T21B 5ICUA 1KCWA 3IU4H 4L5FL 4XI5D 4XAWL 5E00B 1KJ2L 4NKQB 1CDIA 4FEIA 4FQ2H 4CBPA 3BPCA 3O3BB 4BHUI 2R2EB 2EADA 3QR1A 3VXRB 2R1WA 3FUNA 4PJIB 1VFMA 1UCBL 4G1EA 3E3QC 2HKFL 3RUGA 4QRSB 4FE9A 2CA4A 3ZO9A 1YJDH 4G6JL 5E8DH 3IKCB 1IL1A 2WUCH 3IDNB 1L7IH 3R4DA 5J1SC 2KDGA 1NM9A 1N59A 2FH8A 2EO1A 3CHQA 3LN9A 5AFAA 2JJSC 1IM3A 2IMNA 2QDVA 3SGEH 4YVNA 3JTTB 4F9PC 5DJAA 4GKZB 2AW2A 1KSRA 1AD9B 5FK9B 5IEHB 3QNZA 5L8KB 2AJXL 2ZCLH 4LOVA 1IB5A 1MJ8L 4P2RE 4ZTOL 4HHAB 1JYVA 3RWIA 3N04A 3MRCB 4HUUB 3T6XA 4DNLA 3STLA 4YL9A 3VAEA 2AJYH 4R0LC 5JHLH 2UYLB 3IETB 4UU9A 3WNKA 1AR1C 2LV4A 3INOA 3LPWA 3O45B 2HH0L 4HMDA 1J18A 3A24A 3NG5A 4R90H 1RPKA 5GISH 1E27A 2AVGA 2YGPA 3BKJL 3D3VE 3O41A 5HDWA 4CADA 2FRGP 1O5DT 3SGJC 5CEZE 1OEZW 1MFCL 3LNIA 2MCPH 2YPVH 2COQA 5C92A 5JIHA 3UBXA 4AGMA 4FXGA 3I6GA 5I71C 4JHZA 2DDQH 4DETA 5DEJA 4WLCA 4GRWF 3TFKC 4WFEE 4K7PL 4UIKL 3FCTB 4RZCB 3RVUD 3D2UD 4G6ML 4PJIA 5GS1C 3BMWA 2WN2A 1W9XA 3II3A 3OF6D 3MJ9A 8CGTA 3FT3B 4M7KH 3L2NA 4QCIB 5EORL 1UXWB 4XHJD 4FI8A 2N59A 3ARFD 1QRNA 1BAGA 3QNXB 4J1UA 5CEXB 3DIFB 1A02N 1FYTA 4PJBF 1I3GH 3AM8C 1WGOA 2YGQA 3TBTB 3LZFL 3H7BB 1MZZA 1F11B 3ABZA 4FQLH 1EHAA 1QLFA 3ARWA 3PFQA 3SKMB 4G7VH 1EXUA 4B9YA 5AD0A 3LEVH 4MS6A 3QCTH 1I9IH 4TQ8A 5DRZB 7PCYA 3KLHC 3AREA 2EYTB 2P52A 2XETA 3WBDA 1BHGA 2NY1D 2EEAA 2YPLA 4LSRL 4X9BA 5FLVA 3HZKA 3BUQA 2R0ZH 2IO5A 4WW2F 5B38G 5IUCA 1INEH 1R75A 5F9AC 5JUEH 3PLYA 2IJ0C 5AENA 4NP4L 2NQ3A 3FTUA 1YUHB 4NNPH 1WAPA 2FIKA 4G8FB 1U8HA 1R9FA 1TCMA 2RH0A 1NOLA 1UYWL 1HKLL 4PP2A 4QLWA 5FYKD 3FO9B 4NWUH 5EUKB 1RZKC 1OF2A 5HYIA 1NEZG 4YSTA 1FNGB 5JXAL 1GOHA 1JZDC 3I02B 2ZSWB 3QJSB 3MROB 4N0RA 4DQAA 4E41A 3VXOB 3U0PB 1EANA 3LIZA 4B5EA 5KTEL 2EIZA 3LMJH 35C8L 4N1CA 1DFXA 3CDCA 4OZGA 2BZCA 4UUJB 2OI9B 4RAHA 4IOFD 5ABDE 1K5NB 3N2JA 5IBTL 5FUCE 5HYJD 1PQZB 3H8NA 3MCLH 4MRCA 3A6CH 5GZOC 4BFBD 4TOYH 2BIOA 3MAWA 4U1MA 1KG0A 4Y1SA 1XD0A 2AV7B 2EDTA 3GI9L 3RVWD 1ZEAH 3HS8A 4RH4A 2X3CA 1XL6A 2CLZB 3HE6A 4XBMA 2YN3A 4ZUWB 4ZK8A 3GM0A 3IDXH 2FQFA 5DRZA 3UYOD 5IFAH 3U2SB 3L2MA 4PGDB 2WC7A 4JY6B 3EYFB 5I6PA 2VDQH 1V3MA 2W65A 2IGFH 2HTKD 1T7WA 4G9FA 1XGYL 1QQDA 4AVIA 4TUJB 3KLQA 4FNUA 1FG2B 1KY7A 3GSNL 5C0CB 2A1WL 3FUFA 1D5BB 4I77H 4UV7H 3QDGB 3MV9B 4PGBB 1AGDB 3KW7A 5E2TH 3TC9A 3RNKA 4YDLB 1UUNA 3I02A 2ZSWA 1CFQB 3L4ZA 3O0RL 4X0KA 4C54A 2DRUA 4O5LL 2Y3AA 1KPUA 5IQ9A 5AZEH 3UMTA 5E99L 3VXUB 3A23A 3HLAB 4PJHA 3TVMB 1HJCA 3MRQA 3CHPA 2XWJA 3BSHA 4YBQD 1GGYA 3ZSTA 1TZOA 4Y4KD 3PAYA 3D9AH 2BY2A 4P2RD 2FATH 1CFTB 2CLZA 1JK9B 5EBGA 1P4IH 4YGAB 2FNWA 4WI6A 3DURB 3CN2A 4POUB 4Y4HD 1AQHA 4P2CG 5CMAA 5HDLA 1IIIA 4P2OA 4H25A 2QFRA 5GS0H 3D25B 1P7BA 2CUHA 3E3QE 3QQ3A 3QUXC 2AEPL 4OZFB 5HJGA 3S3PA 1SJHA 2WWNA 1DYZA 1FZMA 5CEZD 2FUQA 2SODB 2R1YA 4KXDA 3KCPB 2L3BA 4CL7A 4AY0A 3HC3L 5EOTA 1T20A 3C5ZB 5ACZA 1G6RH 4URKA 4W93A 2QVKA 1ECZA 2IAMA 4XVUD 1KBKA 4JAMB 3E38A 4HX1A 2YPKB 1H9VA 4Y2DB 3QDGA 3MV9A 4WFED 2CK2A 2HVJB 3ELAT 4ONGH 1P5UB 3BE1H 4PRDA 4QYAA 5E9AA 5FA4A 4AOFA 3KR3L 4ZO6A 1WFOA 4BZ1L 3ZUCA 1JSYA 2W8CA 4KK6C 5ABAA 3JYBA 3QG7H 4WSJA 2NLJB 1AC6A 2ZUWA 2VAAA 4TM9A 3ML9A 1FL3A 3DX9A 3COOA 3MRGA 4FI6A 4M1CC 5TK4A 2NXZB 2J3SA 4I13B 1JVOA 3HLAA 1E4WL 3DVGA 3PCYA 4XPTL 2HWZH 1UXMA 4BK5A 5F7KC 4OCWL 2C9RA 2L0DA 1HYSC 3R0MA 4PJ8A 2X1XR 1U8PA 2ZTBA 5DHXB 5I1KH 4G7QB 3PIQB 4MJ2A 1TPXB 5IROA 2XXCB 1CK0H 3BKML 3H6JA 3SQBA 5I1LA 5DD6B 5FM8A 1KNOB 4ETYA 1AQKL 2JKJA 4FG2A 4G5ZL 2XWXA 3MREB 1U8IA 5I8OL 4GLRI 4GAYB 3GJFA 4XR8C 3QIUB 4PJDF 2IQ9H 3LS4L 5IESH 1ZANH 3BSZL 3SY0B 1XEDA 4UBDC 2APTA 5CJ8A 2NY0D 5BO1L 2X2UA 5HHOE 2FGWH 1UM4H 3MLSH 3DX7B 3WEXA 1QABA 3UAJD 2XG4B 3UZEC 1EZVX 2YJQA 1I1AB 5BMFL 5CCGE 2E8ZA 2WMPB 3DX2A 3BUPA 4PH8A 5D7IF 4ZRGA 1CDYA 1HNFA 1UWGH 2YXWA 3D33A 4W70A 2FSDA 5DZAA 3VFTB 2D7TL 4LSDA 3FCSB 4N20A 3B1TA 2NLJA 1GW0A 3QEGH 1YNTF 1T66D 2NY7H 2VL5A 1DZ0A 3N91A 3MKGA 3MGAA 2O5ZH 5CWSB 1CICD 3GIVB 4MJ5B 3HC0B 1FSKC 4LCYB 4Z6AT 2KBGA 4HD9A 2ARWA 2XVKA 1X5IA 3BSGA 3BRFA 1DBMH 3S96A 2X7LB 3VXME 1QI4A 3IMSA 4GG8B 2PW2B 3QE5A 2WKGA 3MRFA 2ZNXA 1U8JB 4Z7OF 1QZNA 1KIUB 3MOBH 2ZZUT 3OAWA 3VQMA 4EUPA 5CN1A 3QBTB 1XB3A 1JGVH 5GGSY 2XPYA 3BQUA 3LH9A 4PRNB 1RJYA 2DM2A 3EOTL 4CC0A 1NPNA 3OR6A 2CGZA 5ANHA 2WLZA 5FW6A 1JF1B 4TSAH 3PWVA 5AOKA 5GRVL 4ANVA 1TTAA 4PR5A 3QO1A 2E9BA 4N2GA 3VI4E 1LMKA 3CPLB 3ECWA 3D69A 2Z1PA 3CLEL 1DP0A 3D0VB 3FOMB 1KJ2A 3TYFB 5C0AA 1WC7B 5IVXF 2VDLH 4M7JL 3FSAA 4GIPD 4MNHB 4O2FA 5C0BA 1EFXD 3SDXA 4C4BA 1ND0B 1MHPL 2D4FA 1KCLA 3NYKA 3QH3B 5DJ6A 3B9KA 3ARDB 2L7EA 3GNMH 2VWEC 4HZAA 4N0CC 2W0KA 4LCYA 5K39B 3MLPA 4BUQA 3V0HA 2BNQA 1U3NA 4M29A 2WXQA 3I9IA 4HFUH 4RGNE 5I75B 1QTSA 1PW3A 3G5YB 3FN9A 3OXSB 5EEWA 3HVDA 4BGDA 3VXNB 3PGCA 3VWKB 3W9EA 5IB5A 4NO3B 3MRRB 1NCWL 1GW6A 2RQEA 2YR3A 1WS8A 2P5WA 4PRNA 3QAZC 2WK2A 4V1DA 3ZHDA 3QCVH 1A6VH 3CX5J 4RBPK 2ZYIA 2A74A 4JGMA 4KQ3H 1SOKA 4I7ZC 1NAML 2L04A 3DSFH 5AKVA 5IHUH 4OFPA 5EU6E 4BGLA 2I60L 2A6KB 3RNQA 4DTGH 2Z31C 2F19H 1FUNA 3QK0A 4NO2B 4OM1H 1SN5A 5EU7C 4GG6F 4LSUH 1RZ7L 3WLBB 4N3UA 1DVYA 4ZXBD 1QFUH 4PLKD 3BP4B 2G5BA 3LNGA 2A9AA 3NH7H 2R23A 4KHTH 5IHBA 3T04D 2Y36H 4JY4B 1TTRA 1ND0A 3GI8L 2E76C 4V2CB 3NFNA 5FDWB 3UTZB 3TURA 1JZJA 4HLEA 1OE3A 3IGAB 4F7PB 3UTSA 4JM0A 3A4FA 2DQMA 3EJUA 4CNIB 4G7YH 4QXUL 1FCCA 1MAJA 4HFWB 1K3ZA 4DQOH 4KV5F 3JTSB 4PB0H 4C4KO 5KSBB 1D9KD 3G5WA 5L4MA 3WN6A 2ITDA 5B8CC 3OXSA 2BY0A 1EERB 4JM2A 4OGQC 3VXNA 1F2QA 4NO5A 1S6NA 3PU7A 5JW3H 4MX7A 1LNUA 3P54A 5KANI 2WHVA 3L1GA 1LP9B 3MRRA 1ZJAA 2OZNA 2A6JA 3AG1B 2Z9TA 2B4CH 3BD3A 2NY4C 3P1VA 4FQCL 4RLDA 1JVKA 3P4OB 1F0LA 5DJDB 2A9ML 2NY6B 3VX0A 2FZ3A 4ZMAT 5DJZB 3QUMH 3QUZD 4GAAA 5AOIA 2VLJE 1GGTA 5TE6H 4Z7QB 1K8DB 3VCLB 3FQ1A 2YA1A 3GSNB 1R3LB 3WE6A 5IMOB 4H1LG 5C09E 2VE6B 3J2PA 1HSBA 5M7QA 1IC7L 2X89A 4X6EB 1A22B 3SE8L 4JRYA 1PSKL 4OLYL 1FA4A 2DQUH 4XGZA 4AC2A 2OS7A 2WOYA 3UC0H 3TH4T 4HS6A 3UTZA 1JHKL 3IGAA 1IC1A 1BQ5A 1NBYA 1X6LA 4XTRC 1KFGA 2XYCA 3B5TA 1VJSA 4W4OC 1KLUA 3WIHL 1E3ZA 1JMXA 4CVWA 4XAKD 3ZMRA 4NUQA 3II1A 2G0KA 3B9EA 3VXMD 5F2FA 2FECI 3MBWB 2LTQC 1ZLWK 1UB6A 2H0FA 2X0WA 3F7YB 1V7NH 4K3EH 5IBUG 1LYQA 1PZ5B 4C56B 1IBBA 4DEPB 3TF7C 3FUEA 1K9TA 3CG8A 3V4PA 5FB8B 3IMWA 4OF5A 1KFAH 3ILQC 2A73B 1KOAA 2HB0A 1U6AL 2ATKA 2H6OA 5BS0B 2I25N 3KPRA 1OB1A 4NFDA 2VXTH 3B8YA 4W9LC 2H6PA 1TZHA 4TNWF 4EVNB 2QSCH 2J1WA 3V6OA 3ENEA 3K8LA 4AT6A 3EZJB 1UOLA 4DP8X 2J6WA 4KMTH 1NL0L 2PNDA 5SWSE 5KYWA 3GSNA 4B9ZA 4HJSA 2NSQA 2SEBB 1PNDA 1M9SA 3BVVA 1CF1A 3KPSA 3SKJL 4ZX3A 3OG4B 2ARJQ 5IB3A 2DL2A 3EOAB 2E7BA 4X6EA 5L9DL 4PU2A 3CMOH 4MAZA 4FQXC 2WN3A 2Y1VA 5J9PA 2RIKA 4Z7VA 1HNGA 2VDKB 4CMMB 4DAGL 5KBMA 3ULSA 4ZS6D 3CDGA 1FGNH 3GUFA 5LBSL 4ZSOB 4HF5H 2OTWB 4Z3FA 3F05A 2PYFA 5EOQL 3NACH 1BBDH 2OTPA 2Q9OA 2N4IA 4HPYL 4PG2A 1DE4A 2CIKA 2IDCA 1JNHA 4QEGA 1GHFL 2GBVA 5D1ZC 4UB0L 1USQA 2RACA 4PJGE 5EC2B 3QNFA 1HHGA 3U7WL 5LAPA 3D18A 4KVNL 2E74C 1KN4H 4Z76A 2JNZA 2X88A 1LO0L 5ANME 1WIPA 2FBRA 2DTSA 1DQLL 5CLWA 4HUWB 4W9EC 3FFCE 5D5ME 4HK3N 4UTBL 3X12A 1IBYA 3B83A 4XCNB 5CGBA 3KL0A 1H8LA 5HGDB 3EJYD 1QW9A 1OK0A 2WBJA 2OX5A 2X4RA 3FU7A 1KB9K 1SZNA 1TJGL 3P2BA 2EXYC 3QDMB 5DJ2B 3RWGB 2VWEE 3UPRB 2MKWA 1R24A 5GS2H 1QBML 2FBOJ 5BV7L 5HVFB 5GGRY 3EOAA 3U1SH 2N1TE 1IGCL 1F4HA 2NW2A 3E6FA 3LSOB 5IQ7H 3ZIYA 2XKNB 4HEMA 1PYWB 4MXWH 4U49A 2JB6A 4J3UA 1HS6A 1RCYA 4MNGB 3PGFH 3WEAA 1BQKA 3F7KA 2WUBH 4W9DC 4B9KC 2WXPA 3REWB 3V5KA 1FFNB 4XOAA 4UTAL 2AEWA 2BFVL 4UQ9A 1GVIA 2MTAA 4RWYL 1P5VA 4B7LA 1YNTA 5FO8A 4HBCH 1P9MC 4L29A 4QAMB 3BRGC 3WNNA 4Y4FB 1H8OA 2GTWA 1ORQB 1SVBA 4Q6IB 1DCLA 1E4XL 4WSKA 4DK3A 1A7RL 1DLHA 4NBXB 5EU7E 1RUMH 4XCFL 4YAQA 5IY5B 5AAMC 1L9TA 3BSZA 3O2VL 4AK1A 3EO1A 3FAWA 5HGDA 2XUWA 2R59A 1VDGA 2JF1A 4ACTA 2DQTL 3EBAA 3PWPE 2FYVA 3UTQB 1R3JB 5C09D 4HKZA 5CUSH 5L6YH 4Q9RH 1R17A 2GUOA 1UWEL 4FQHB 1G4MA 2AJSH 2GJJA 4IBZA 2WYHA 4QF1A 4WU7B 1ZTXH 3QNYA 1HI6A 2KT6A 3HG1A 2AGJL 3FU5A 1I9RH 4OZIA 3MRLA 4LLMB 5HVWA 3UJIL 4BZ2H 5EO9B 4PBXA 3REWA 1LDPH 2H8PB 3FHEA 1ICTA 4I4WB 4JZOA 2IPUK 4Y1AE 5F8RC 3FL7A 1MCJA 2V7NA 5CJQH 1SBSH 5BW7A 1UB5B 4H1LH 3PQYD 4V2BA 4RMUA 4LLYA 2GW5A 1DO5A 1F4WH 3R1GL 4LSTH 4XN5A 5D71L 2X2IA 5JW4Q 4NQXB 3TF4A 2H1XA 3KGSA 4BCXA 4XNDA 4QJ4B 1JZ4A 1OAZH 5CP3A 4ADIA 3VRLF 1KJVB 1XGTB 2K45A 4HP5A 1WZAA 5JIKA 3MR9B 2CBPA 3WD5H 5EIIB 3QJTB 3EIFA 4MXQD 5EU5B 1M71B 1NAMB 2C3HA 4A7GF 1XO8A 1A9BA 4JKLA 1DQTA 2V7HB 4FG6C 5SWSD 3MCYA 3I6KB 3M1OA 5DQ9B 4NPYB 4PD4J 3ZGHA 1FCGA 1O9ZA 3APFA 2DPKA 4FQHA 2VW7A 4ZAKA 1KZQA 3T0XA 5AQ0A 1LXMA 5D7JB 5F9JA 4GG6A 3IB4A 4IRJD 3BLKA 1ZT4A 4WTWA 4XP1L 4YO0B 5T1KB 4ZNEA 4J5VA 2RFXA 5EO9A 2VSDA 4KX7A 3CFBA 1GR7A 2ALAA 5KVGE 3EHBC 3TX4A 4EDXA 1S7TA 1ZOXA 3FT2B 5GGTA 3JWDH 2YBRB 4A7QA 4WU5A 4WWID 4L8CB 3TO4B 1CO1A 2O5XL 1MKFA 5BVJA 4KKBC 2J4WH 2IH3B 4FS0A 4IU3B 4ATWA 1Z5LA 4R7LA 1IQWH 4NQXA 3WXVH 2DLFH 3X3FL 1JVLA 4KTYA 5CGYD 4XVSH 5EO1A 2OJEB 1F45A 4OJAA 3FFCD 4PRID 1K72A 2LU5A 1PX4A 3LKQB 1LK2A 4JM4H 5DMIL 3D4YA 1ED3B 3L16A 1Q9WB 4CJ0A 4H8WH 1E2VA 3I6KA 1YMHB 1YEDB 1HCFX 1MPAL 5KUMA 4JPVL 1QR4A 5ISZE 3N41B 3CHRA 2I9LA 4IEFA 3V7AG 2AHIA 5DK0A 4G42A 3RRQA 4X98B 1MDAA 5I66A 2K9FB 3BZ4A 3BUIA 3AXIA 5HVHC 3DETC 3C5JB 3UG3A 3KNBB 3BPOC 1GZHA 1I1CA 4F2MB 4XT1C 2XSKA 5E4OA 2X41A 4D8PB 2PO6D 4TNGA 3WFEL 4LFHG 4XZUB 3VU2A 2PR4H 3GMMB 1JWSA 4ICWA 1H6FA 2BIHA 4AMKL 5C6WH 1VACA 4KITB 2H5UA 4GO9A 1LWJA 4JRLA 1OK8A 4ODVH 4IU3A 2OMYB 3MHZA 2BW4A 4R7DB 5J4MA 4NZTH 2CCLA 2GYSA 4XODA 5KW9L 1HE8A 4CMHC 3RWDB 2UZYB 1TDQA 5F21B 4OJDH 4AEIH 2IPUG 4CU7A 1GAFH 2GC7C 5ALBH 1DJWA 2UWEB 1VIWA 3HG4A 3PWPD 3QG6A 3C8HA 1BEYL 4HJ0D 1JCVA 1OGAD 3PXLA 4P57B 4LHQB 3TEWA 2VLKB 1B6UA 1IKOP 4ODUB 3ZYIA 2Q8BL 1VFBB 4MKMA 1F4XH 3TA3B 4OZ4A 2GK2A 4YFLI 3IPEA 2FH6A 2EDOA 5KYXA 3QHFL 5I8CB 1U2HA 5LAXB 4FA7B 2YRZA 3T0AA 3RL1B 3C5JA 2J88L 1M05A 1XF1A 3NP3A 4ZMXA 1EEZA 1UADC 3WIHA 1XAUA 5HI4C 3QEUB 1NICA 4Y1AD 4IW4C 5JHDE 2HA1A 4L4TE 2KERA 3TBVA 7TAAA 4BFRA 2XFXB 4ODXB 3B3IB 3DOIA 4N8VA 3LD8B 3L5IA 2WTOA 4Y16C 3RDTA 5BZWB 2FX7H 3WY1A 4GSXA 2IEPA 2UY7B 1DEDA 3PGDB 4JFFD 1MIEL 2F18A 5I1HL 1NWPA 4PBDA 3N42B 4JMXA 2WVVB 5TDNB 3B37A 2OXHB 3ZDXE 2Q10A 2IPKB 5KEZA 1IO4C 4YR6A 4AYEC 3L3IB 4O02H 1MNNA 4Y5YB 2ZPKL 2WWMC 3O8XD 3WHXB 3VYOA 3QVAA 1WA2X 3RTLA 2VGLM 3L3GA 2WM0A 4WV1C 1BYOA 5I1JH 1QR1B 2R0WL 1A2YB 4IGBC 4F24A 5E6ZA 1ET7A 4IKNA 4UI2A 4XWGH 1SXNA 4WEBL 5T5NF 5CZKA 4MB3A 1SRDA 4HG4J 3UDWA 3HN5A 1GMIA 2VNCA 3ETSA 2DBJA 4JY5L 3W37A 1CYGA 1SHMA 4XBPB 3RL1A 4HXBL 2K8QA 1ZWIA 4WO4C 5CN2A 3Q2VA 2XBZA 3GKZA 4HAFA 3O0LA 4FLQA 5LBSA 4S0HA 5EUOE 5LO7A 1CFNB 1EGJH 5AWNH 3UADA 4OLVH 4MJ6B 4Z9KB 3DARA 3S37X 2R2HB 4Z7UF 4HC1H 3KYKL 5FYJU 4DW2L 4RFOH 2H6UA 3PGDA 1JPTH 1H3PH 4R4NC 2QKIC 3GLEA 1CUOA 4YXHH 1Y7VA 5EF0A 2WVVA 4L37A 3F7PC 2MEJB 2IPKA 3QXTA 2JI1A 4L1LA 7FABL 2ESVE 3FRPB 4DGYL 4XMUA 3BPLB 3ZE1F 4E9QA 4A6YL 3IDYC 1RSFA 3ZN6A 1QWUA 2I85A 3SDAB 3SDDB 4DGVH 4YHYB 3DX1A 4Y5VA 2Q7NA 3TN0B 1FZOA 4YE4H 3HZVA 4GI9A 3H9HA 3ARFA 4PRPB 3APMA 3UIZA 2XKSA 3C2SA 2GITA 2VDOL 4OR1A 4QNPE 3P40A 4N90D 4OGXH 3HPLB 3OKKA 1B0GA 2ODIA 1PGRB 2Q6WB 4N9GB 3NJHA 5K9OB 1PCXA 4Y9CA 5DJ0A 5LG6A 5F7WC 4ZYKA 2WIMA 1A6ZA 1H6TA 2W60B 1HX0A 2WB7A 2X10A 2R29L 4MAYD 5HHVH 4DUVA 4YSEA 1PKQB 3NPSC 4M5ZH 3NJFA 3IF1A 3ZE2E 1NKGA 1N8ZB 3PAVA 3V0EA 4UQAA 3K74B 3VXTA 4NKIH 4PRHE 4C4UA 3T0BA 1NCAL 4N8CH 5K59F 3BEVA 5TGBB 4NXSA 3TU6A 3O6LH 1DANU 3KPLB 4X42A 3QUYC 1BM7A 1Z3GL 5LQBH 4O2EB 1A4KB 4ABVA 1RJZA 1N19A 5F89B 2FEJA 1CWVA 1OTTD 4LP4A 1CDGA 2IBZX 5FHAH 5JR1L 3DO7B 3AT8A 2JQZA 1SMAA 2EDKA 2FUTA 3VG0L 4C8XA 1OHQA 2EINB 2WQAA 3OHXA 4AYFA 4IOIB 4HKJB 1UM6H 4JE4B 2EEDA 1M6UA 5EIVA 3C5SA 4R5XA 2OQJB 4HJIA 1NANH 3UAEA 1A6PA 3TN0A 5C71A 2UZIH 2CIIB 3V8OA 1BYPA 4N0UE 1MCWW 4HMEA 3SPVA 5DWUL 3HPLA 2VIRA 5KYYA 4FG4A 2EVGA 5EDXA 3T3ME 2KH2B 1R0AH 4UM9A 4LVNC 2CJUH 4NRZB 3UFIA 3OKDB 1YECH 4L4TD 3DWTA 5FAAA 4DFHA 1CE1L 1RZKL 4U3CA 3O81A 3ARGD 4N4YB 2WP3T 2WXOA 2XQBH 3QFDA 5FOBA 3X1BA 4QJ3B 3ATAA 5TGBA 4FNLL 4OZFG 1YQVL 3ZKSD 3QXWA 3QZWB 1YYLH 1H19A 3TYGL 5T3ZE 4O2EA 4LLVB 3BQVA 2F1EA 1RZIA 3OJDB 1JERA 2ED6A 1MI5A 3NJXA 1USZA 3NZHH 5IQNA 4TRPH 3ROLA 2WOBA 5SV3A 3OC8A 2WLIB 4IKLA 5HYSA 1YEJL 3O3AA 5D7EA 4NKMB 2XIDA 3FCBA 5L7XL 1F6FB 5HGHA 4U6VL 1NSNH 5JOFB 4MTMA 2G75B 2WQRA 3QXAB 2J1KA 4NEHB 1FZKB 3PUCA 3SJVB 3ZU8A 3LKOB 4X7CC 3G6JE 1YJDC 5IKCA 5CFAA 2IH9A 5GHWH 2JCCB 43CAA 4YXKH 1EAOA 4D2NA 1MCLA 2RQ8A 1DQQA 2CRYA 4R3SA 5CU5A 4FP8L 4UAOB 4BWUA 3WIIH 3EDJA 3K8MA 2BOCA 4DKEH 1MHEA 2L7UA 4G3YH 4DN4H 1NIFA 3E1ZA 1F4YH 4XNYL 3TIEB 1NTDA 3VD1A 4Y19E 1RZPA 4LIQH 1II4E 4P59H 3POCA 4GQQA 4OUUB 3VI4F 4UT7H 1FGVL 1GZPA 3MGOB 2AITA 2WWKO 4Q9QL 3D3VA 1YZZA 3TCLA 1YEGH 4H20H 4L9LC 5C08B 3D0LB 1U8LA 1YPZE 2V33A 3TZVB 3B5GA 5IGXH 4L8DA 4YSQA 1RKRA 1JHTB 1U91B 4NC0B 4NRXB 4XX5A 4U1JA 1P1ZB 1FZJB 4ZFGL 1NFIB 3BYYA 3N1FC 3FB6A 2YMXH 4MVBD 3A67H 3LKSA 3E2HC 1UATA 4IHOB 2Y6SC 3SJVA 3U2IA 1MRCH 4JFDB 3BZFA 4LSPL 4WTZG 1SQMA 4ZX5A 1J0JA 4HJEA 4JCMA 2GAZA 1Q38A 4KXBA 2XN9D 5CLZA 4IIQC 1OXYA 5IOPB 3BRDA 5E5MB 3LNFA 1J8HD 1HSAA 3MC0A 2WKOF 3JYCA 2J1XA 3ILPB 3OSKA 5I1EL 3BZEB 3VD5A 1U92A 3LQZA 3TIEA 4N0YH 3IFOA 5DMGC 3VRJA 5JNYA 2J73A 4OUUA 4JB9L 3MGOA 5H35A 1GYUA 2BP0B 1A3RL 2M8XA 5KSVA 3WL9A 1GGCH 2VDRH 4HUKB 2V5SA 3FT4A 4IBYA 2ZX9A 4XNUL 4YXLL 3KLAB 1BIIB 3UTOA 5B39B 3CZFB 4XX1E 2P46B 2W59A 3V0WL 4UQIM 3UTTB 4GT0A 4NRXA 2R2BA 3S88H 3LOWA 4X6FB 4GQZA 1NMBL 5F3BA 4LARL 3LHPH 3VU1A 2OYKA 5FHBH 1TQTA 4P5TC 5I2IB 4PUBH 5HHXL 4DPAX 4YSCA 1E4KC 4N2LA 4FCHA 3RJOA 4JRFA 4K94H 1WZ1L 2R2CA 2HT2C 3BGFC 1UG9A 4NHUB 1PTZA 5DC2A 3TNMA 3HZYB 2EZ0C 1CICA 4JO2H 3T09A 5F3FA 2NT1A 4ORZC 4K8RH 3K0YA 4M1DL 5IG7A 4GBXC 1JI2A 2O6PA 2W0PA 4OBRA 3RBSA 2XT1B 3K6OA 3WENA 2HN7B 1RUAL 2Y06H 4NN7B 5JMRA 2NNAA 5EU3A 1R34A 2C9SA 4M7LL 1T0OA 3G08B 1FVEB 4LPCA 3HS0A 4I18A 3VFUB 3ILPA 4TSBH 4HPHA 5E24E 1P53A 1RZGB 2LOEA 3IFLL 3CLWA 4XPBH 1JV5A 4NAJA 3VI3E 1P1VA 3C08L 3IJYA 4HIEB 3VDCA 4LGRB 3UYPB 3JVGC 1ROWA 1W72L 4KK9D 1HXMB 1TU2B 3FPYA 1E3FA 4J3SA 5SV4A 3UXFA 4H2AA 1KIPA 2YWZA 3IDUA 4YDKH 2BS71 1D6VL 4JFQB 4YPGB 3O3EB 1IZKA 4WSGA 3IAGC 2XVLA 3CSBA 1YMMB 2NR6D 1AH1A 4PVMA 3QZMA 5B1KA 3Q48A 3CAFA 1REIA 1R6VA 1NBZA 4X6FA 1WT5A 5DT1L 4OM0L 1C7SA 1F58H 4HUNB 1A0QH 4XH2A 5ERWA 4FNRA 3UJJH 2AZAA 4CSZA 3ULUD 1MCPL 2IWKA 3SKNB 4OZFH 5I8KL 4NZ8A 3RVVC 1Q1JL 3SKOB 4U6YB 2BSDA 3BP7B 1NC4B 3KS0J 3WY4A 3DX6B 1FL5B 1YHPA 1I1YA 1S9YB 2FNBA 3GGWB 1DBKH 2VDOB 4XCCH 5SWQB 4XP4L 4DVRL 2ZG2A 1AFVL 1X9RA 1I8LA 1XF5B 2ZICA 3KL5A 3VFUA 4F8LA 2I9TB 1RZGA 5L2KE 1TLKA 1IEBA 2KZKA 5DQJA 1QLRB 3DECA 4L4JA 3UG4A 3RURA 4PWHA 1JJUA 4X4ZA 4Y19D 3KBEA 3T8VA 1VB9A 3NJKA 4OKVB 3N43F 1EJ8A 3WV0A 3FTSA 3GUTA 4GW4B 4KJQD 4ZDHA 1U58A 1JYXA 2OP4H 1PZAA 2WGXA 2OJZH 2Q20A 1LWRA 1HWHB 4YHNB 3J07A 4LDLB 1RK0B 4M48L 1I7UA 3DBXB 3O6KH 4YPGA 5DURD 5GS0C 3DGGB 2R9HD 3N85L 3DOSB 3WMSA 3FQNB 2JJSA 3GSQB 1O0VA 5CCKH 5J06A 3O11A 2WZPA 5C0ND 4GUPA 4F9PA 2H26A 3IDGB 4Z95L 4RISL 4A6YA 4LEXH 1MHCB 3K6DA 5EPMA 4XBEL 4G7RB 2IDQA 3BP7A 1BD2B 1MLBB 2HMID 4P9ML 1AY1H 4HXAL 4R0LA 3DX6A 3F7QA 4MA7L 5F72S 3RTQD 1C08A 4UNVA 1HH9A 5HDRA 3LN4A 4HSAC 3T0EC 1MG3C 1T1ZB 3HZMB 5GRVK 3WKPA 1T5KA 5SWZE 5TJWK 1ZHBA 5CIPH 4PJEF 1IGTA 2WLMA 5LBGA 3SGJA 1MRDH 1BQLL 2R29A 5GRYA 2ITCB 2R69L 4NZRL 2XJKA 5LBVA 4M7ZC 2DQIH 5EHFA 5C0EA 5GS1A 1QOKA 4LLAA 2B59A 5HGAB 1X5MA 4G80B 4OJEH 1I7ZB 1TNNA 4NUJA 5CILL 5HHOA 5KS9E 4YHNA 1RK0A 3DBXA 3RJDA 2AQ1A 5HI5C 3O6FD 2E7CA 1D9KC 3QUZA 3DOSA 1LO4L 3BYTA 4A2GA 5FV1L 5D2LF 1CXIA 4WI9A 2F54B 4L8SB 3MRHB 2VISA 4Z3TA 1BIHA 2AXHA 4PJ9D 3ZZLA 5ADPH 1EUTA 4X9IA 4ADGA 1MLBA 4LU5H 1FFRA 4AQ1B 5CNHA 4NUPA 4XZ4A 2OR8A 3L7FB 1IAMA 4I0PB 3MLZH 3ATEA 3MV7B 4Z3JA 4GFXA 1JYNA 4HT1H 3WIFA 4P5RA 1E90A 3ZZSA 3NFPA 2VM9A 1V7ML 5E2JA 3SDCB 1F6AA 3N44F 2FO4B 4JHUA 4XMKH 1MREH 1NBVH 1OTUC 1OZUA 5IB4B 4XO8A 5KSAD 1GY2A 1PIGA 1IKFH 2EE6A 1T4KB 5D1XD 1OALA 3KYNB 5HGAA 2JELL 4DPBX 4KGLA 4YDJB 3S35H 4X6DE 5I9QC 3I84A 1S78D 4RMSA 1S7UB 3WKNA 5EH1A 5C0GA 3MJGX 4J3VA 3S3BB 5AOZA 1FH5H 1E6JH 3BUYB 4OIIL 4KTEL 3CVHB 4WCYL 5C7XH 2IG2H 1JRHH 4DGIL 2P80D 1DSWA 3S34L 1T1WB 4Z78B 2C9UA 4CW1B 4Q9BA 5JQ6H 2OMZA 2OSWA 3Q1SH 3QIWC 2YA0A 1TCRB 5KVGL 2H32A 3G6DH 2OM5A 3VX1A 4AM0Q 4FFYL 1QVOA 5F7EL 1DR9A 4TKWA 3QUXB 1JOIA 4O00A 2PYED 5C8JB 1URIA 4OV5A 4JUTA 1W6WA 2FO4A 4BJLA 5L2KD 1WYJA 1N9PA 4OZHB 2CBTA 3N1GC 4P46B 4A1RA 2GT9A 4JE0A 3DRTB 4FFWD 3DUHA 3TV8A 4QHMA 2OCCB 4R97C 1THAA 4K2UH 3BFOA 3KYNA 1MZYA 3UAAA 1WA1X 4Z7WF 3GD1C 2J8UF 3WKML 5ESQB 2PW1B 2I07A 5EU6A 4J3OD 4HIXL 5DO2D 5B21A 1YY8B 3MSPA 3DX8B 3GSOA 4JFPB 3EGXA 1EAPB 1M57B 4QWWD 1GJIA 2BJML 3GI9H 2VQTA 4OCYL 3NZUA 1NEPA 1TQCC 3BT0A 2D2CC 1RPUA 1NCDH 2CDEB 1ZT1B 5CGTA 1T1WA 5GGQH 1QFWI 3QJZA 4KROC 2FYYB 2XX0A 1CLZH 1XGPB 1TCRA 4LLWB 1PDKB 1XR8A 1KLFB 1I7RA 1XGYH 2FSEA 3P73B 3OJVC 3UMNA 4BD4A 1TVDA 4IJ3C 3N55A 5DLMH 1CDJA 3QUXA 1EJOL 2X4QB 3T8MA 2CHXA 1MCFA 1EJFA 4EQ2A 3L3KB 4XVTL 5F7BA 1AO7E 4R5VA 4X7EC 1J9RA 3DRTA 3AQYA 1UA6H 3V0AC 3IS1X 4JUSA 1NGYA 3BAYA 3D5OF 6CGTA 4FTVB 2R0LH 1N10A 5DK2B 2VERA 4NO0B 1O9VA 4NSKB 5EIIG 4XNQA 4ONFL 2BOLA 4OD1L 3HB3B 3L1OL 4WHCA 2GKIA 3FQUA 3PWJA 2NUTA 1W72B 2PW1A 2XXFA 2I24N 1R3KA 2B4CC 2YK1H 1KJ3H 1RUPH 1NEUA 2GC4C 3DVNB 2VLJA 2OYLA 3D8MA 1U42A 4AENB 1JPGB 3AU1B 1MF2L 2OZ4H 1FSKB 4JN1L 5EC1B 4EN3B 3UYRH 1QASA 4OGZA 1KC5L 1NCBH 2IAND 2NYYD 1J1OH 4LL1A 2BVYA 3QHZL 3T0EE 3U7AA 2EH8H 1AS8A 4F7TB 3EJSA 3QRBA 4JMNA 5D2NE 2A6DB 3U9PL 2IFGA 5D7LD 4JO3L 2CZNA 1F1AA 3IGLA 3NCYP 4LLWA 3OXRB 2H3NA 2JI3A 4XMPH 4QXGL 3OAUL 4MJHA 4LPVA 4NCDA 1ONQA 4PS3A 3U4BL 1CXEA 3VNZA 1E2WA 2Q3XA 4GUCA 1HQRA 4U1LA 3QB7C 3L3KA 4XB8A 5E1AB 4U2ZA 3KYOA 1RHHB 2JKWA 2NYKA 4ANUA 3BWAB 1F3JB 3JZYA 2HVKB 3UZEA 3IDIA 4FTVA 4LHUA 1OVZA 2VDKH 3MXWL 5DK2A 1DSYA 3G5VB 4NO0A 5E8PB 3T6WA 2AK1H 2VSCA 1R3HA 1XWVA 2HLAB 5DWPA 1M1SA 1RVFH 1Q9KB 1HFUA 2OXGB 1U3HC 1V3KA 3BAXA 3DVNA 4JG0H 4FAAB 2QZQA 2YSSB 2YEZA 4AENA 5SWSA 4CBZA 5HSFA 3IEAA 2V37A 5LGHL 5I1GH 1KPVA 3EKCA 5I17A 3CZNA 1MOEA 2DQJH 5T1DH 3O9WB 4G59C 1MIML 4JN2B 4Z7NF 2WLNA 1FHGA 2ZOUA 1AKJA 2A6IB 4LMQI 1RJLA 4HAKA 4Y9BA 1PG7W 4GRWB 1XGZA 4MMZC 4PGCB 1LEKA 2YRBA 5KZCD 4HBQA 1U4EA 3EW3B 2DEWX 4RAVA 4YZWA 2NTFA 4NQSA 2BPBA 3FUDA 4HIQA 3V4VL 2Y9RT 4Y8DC 4Y2NA 4KJWD 1BMWA 3VXSB 2HJLA 2I69A 3C6SB 1BGXH 5A7BA 12E8L 3BAJA 3NSDA 3VNYA 4OQTL 4PJGA 1G5AA 1NCJA 3AWEA 3BWAA 1F3JA 3LQAH 5MERA 5E2VL 1CR9L 2Z31B 2G3MA 3HUJE 4YIQA 4QDGA 4XMLL 5ANMA 1NMAL 3X1NA 4DN3H 2X4OA 4H44C 5E8PA 4IRJC 1UH2A 1FNSH 4PJBB 1MVUB 1YNKL 4JVPA 3HG0A 3FFCA 1OCRB 3GIZH 4A7SA 4FXKB 2X4PB 5D5MA 3HTLX 1WZKA 4G83A 1QUNB 1QFOA 3IMUA 1GIGH 4R26H 1TJXA 5SX5H 5DQDH 3NP4A 1I9JL 1RZ8B 3EF4A 3VYNA 1XGQA 4JFHD 4Q0XL 4KKLC 5GZND 3NIGE 5F7AA 1MCWM 2RCSH 3LRSB 3SYQA 4ZOCA 4Q14A 3MCKA 4OCRL 3LPPA 3SN6N 3MUGA 4GQ9H 1Q0EA 5IVNA 3HBZA 3LB6D 6FABL 1NGPL 5D1QE 3UL4A 2XWTB 1CGSL 3QUHA 5EZLB 2XTLA 2DD8L 3MFFA 4DF9A 1Q94A 3WJJA 1NLBH 1M42A 4P5KA 2A0LC 4BCYA 4DEUA 3AY2A 3VFNA 4NN5C 4GI6A 5HDQL 3ASWA 3MJ8A 2NY4B 3ZX1A 4B7IA 4WUKH 4QRUB 5JIMA 1F90L 1ZHNB 3P77A 1MCSA 2CR6A 4MD5B 4X9GA 5MP6H 1ZLVK 3H2QA 5DRXA 1MFMA 1BOYA 4HOXA 4CDGC 2XWBB 4XPGH 2Z31A 4JL2A 2XZQH 2CH8A 1ZSHA 3Q1EA 1WCBB 1MVUA 1Q0YH 2DF3A 5FECB 4GNKB 1CF8L 2FWOB 4HH9B 4ODHH 1JWMB 4ISVA 5TF1L 3WFCH 1MW2A 3WTSA 3V9EA 5J1AA 3PWPA 2CG9X 3CFJB 2OR9L 5PCYA 2MQCA 1A1MA 5F9DC 2UZXA 1MY7A 1A5FL 2DIJA 5AVYB 2HTLC 2PN5A 5CR1A 3M07A 5B8CA 4HUMB 2QADC 1YEWA 2OMUB 3HHSB 4PJFE 4QHUB 1K4CB 4OBSA 2CO3A 2VMFA 2W91A 1VADA 1FNHA 3HMWL 1KTDB 2WINB 2JQAA 1AQDB 1G7MA 2XBDA 4EKXA 3CC5A 1WAAF 1YSOA 4F80A 4HJ0C 4M6NH 1J05B 2FQGA 3E80A 4Z77A 3KWWA 4Y1AA 1QSFB 2X40A 5J12B 2ZX8A 4IKKA 1XIWD 2MIZA 4PLOB 5AYUL 5I5JA 4LAJH 5FUOL 2M1KA 3MTRA 1NUNB 3OKNB 4H8UA 3WNOA 2FEEL 3QDJE 5T3ZL 4KJYB 3T4AB 1C1EL 5H8DA 3VGBA 1FL6B 4PRAB 3QULA 1Z6JT 1WWAX 3SBQA 3P9LB 4P4KD 3RGVC 3MLXH 4F8TA 3FRPG 2WO2B 4X7FC 3QS3A 2ICEB 4X8JB 4AUJA 1HK6A 2Z91A 4LNRB 3GXTA 2LAAA 3MJ6A 2VXQA 4Y9GA 4QRPD 4W4OA 4ZTPH 3LKNB 4TSCL 2XCMC 5KVFH 1KGXA 4I0CC 1MUJB 2CO4A 1V10A 3NJLA 4N5UA 4RWHA 4BDVB 1RIHH 1URZA 4MA8H 1K6QH 3NA4A 4QYOA 5JZ7D 1BOGA 1JXGA 1K4CA 4BV1A 3ZQ9A 3IMBA 2F5AL 3QCUL 2Y1YA 4L3EB 5DC9B 5EOCH 1GS6X 1PL3A 2A9MH 3PDGA 3VGHA 5BUAA 3S48A 1GYVA 4N85A 1RMFL 1VEMA 3C09C 4W81A 1N6QL 1ZPLA 5DUPH 3HJ0A 5AYQA 5A3ID 5KVDH 5DR5H 4OU3A 1Y07A 4L8BB 4CGTA 3F85A 1A1NA 1BQHB 2WAQA 3JWDC 1MWAL 4HD5A 1OARH 4ZMYA 4XHQA 4BSWA 2VZTA 1C8PA 1TFHA 4JKPH 5C6TH 3BHBB 1TJHH 5SX4H 3P9LA 4UT9L 1QX1A 4XNMA 1DQML 3R06B 1T2XA 2CXKA 4FQXA 3ULUF 1G7LB 3SZKC 4D9RD 4DPRA 2DQEL 5IMKB 5CINL 3QI9B 1CIUA 4Z7IA 4CAGA 3G6JF 1CXLA 2PPFA 4OIBA 1BM3H 5IW1A 4PJDB 4U6TA 4F15C 4O9HH 2VITA 1AMYA 3G5ZB 3RE0A 4H8WC 4L9DA 5ISZA 2MOVA 2FB4H 4BDVA 1LGVA 2GQHA 5A7EA 2BLFA 5MENE 3H9SE 3TP4A 2ITFA 2GI0A 3LNHA 5FFOA 5I30L 2Y0SA 5D1ZA 2ICCA 2BS8A 4FQ1H 5E4IA 2XWRA 1INDL 4HA1A 2VOTA 2GTZA 1QKZH 3Q8EA 5D7IB 3V5HB 5E6RB 5CLYA 1CG9A 3KPNA 3VM5A 3TA4D 3T0WA 2Q5BA 5AVXB 1RPQA 5GRJL 1S5IL 3QZWG 4EI6A 1EXGA 2VRKA 4JR9H 3NESA 2TSAA 3QGVA 5TE7H 4WWKC 3AS0A 5BZDA 4ZFQA 3BHBA 4YSDA 2J20A 3U0WH 3QIBD 5T3XH 3AXHA 3BVDB 4DAGH 1T1YB 4NM8H 2YMTA 3UABA 2X6UA 1KZYA 4TV3A 1FIEA 2R56H 1G7LA 1ZAGA 3B7YA 1OAQH 1C9SA 4JDTL 4LVOB 1FNEB 2B77A 3L13A 4Z7OB 2ZXGA 3C8KA 2YQ2A 1S5HB 3FB8B 4F92B 1KBGL 1L7TH 3WKYA 1GH7A 1NFAA 4X7TA 4F58H 4U05A 5E1HB 4BINA 4F37F 2Y7QB 3C6LB 3ZTDC 1OKEA 1D5RA 3KXFD 3HHRB 2HUEA 3F5WB 1P9MA 2QFPA 4GW5B 5KJRH 3RZCD 5BPPA 3QRFM 3VFGH 1NGQH 3BFQG 4IRZL 1KJMB 5HBBA 3MJ7A 2NZ9D 4J4PC 4NQUA 2EAEA 2WJ7A 3K46A 2F9BT 1L9PA 4PTUA 2ZOKA 2CBOA 3DXAE 3I50H 3ARBD 3FHAA 2VLRB 2EUZA 2OMWA 2AS5M 3LZRA 4KOBA 5JHDA 2B1OA 3HE7C 3QJHB 5AAMA 3H7LA 1VKXB 1G5GA 4AW4A 3GMOB 1A7PL 4LSSL 4NDMA 4GIAA 3SCMB 5I1CL 3ARGA 3UBXI 1EIBA 1NAKL 5FF6A 2PXYC 3ECVA 4X6BA 1BXAA 1SJEB 4HALA 1H15B 5T1LA 4IBVA 1H3XA 5DD5L 2Y25A 3VB9A 1OPGH 2GJZB 3FN0L 5HYFA 3UOAB 2HFEB 1IAIL 4UTAH 2ESVB 2PCFA 2VN6A 4NRYB 4PI2A 3GXIA 3ZHNA 5ID0B 2X1PA 4GKNA 3WXWL 2DI8A 1ZTXE 3MO1B 1ZV9A 1YO4A 3OHMB 4PV1C 4EKJA 5JXEC 1DQKA 3EHBB 3TO2B 3UGEA 3A3YB 4TNEA 5F96L 4AQAB 3TBBA 4I88A 4LQ1A 1BECA 1PX3A 1T89C 3RB7A 5B7EA 3ESVF 3CX5K 5C0JB 1DVZA 1FN4B 3RYMA 4AGLA 3ZQXA 4BFIB 4YFLF 5D6CA 2BDNL 3APNA 1LE9A 3V95A 2UXTA 3ULVH 3FQWB 4NT6B 1C5CH 3K72B 3OMZA 2P43B 1J10A 3LNDA 3WHE1 5EUOA 1IILE 1BMGA 3SGDI 1CL7I 3V4VA 4ZS7H 3VB8A 3IU4L 4G6AD 4YHKH 1JNJA 1IEHA 3L08A 2YXMA 3VFOA 4FQ2L 3GLAA 4JPSA 3V6ZB 5J56B 2DIEA 2A83B 3EYSH 4OQTA 3BEWB 2PPDA 3AADB 3SD5A 1IBHA 4XXWC 2XV3A 5B39G 2YD6A 3R0NA 1YJDL 2C1PA 5E8DL 1ZDSA 2WUCL 3KYMA 1L7IL 2ESVA 3MV8E 1JZ5A 3BVWA 4PJAF 1RU9H 3BPOB 1OSEA 3MRKB 5GS3A 1O7DC 4LCCB 4GO8A 1ESOA 3QEQE 3NIDB 2YLKA 3REVB 4BE6A 4PWFA 2ZCLL 3H9SD 4AQAA 2BSSB 2V2WB 1EEYB 1SJVA 3RFRA 5AG8A 2EUVA 5HY9B 2XNAA 4LAQH 2LE9A 2WLLA 5EZJB 4MNQB 4D8OA 3I9PA 5JHLL 1A14H 5A43C 2DN7A 4LBEA 3WOVA 3G6AB 1KXTA 4CMHB 3IDMB 5K93A 1IGIH 1ASOA 5BOJA 5GISL 1ACCA 3EH3B 5T3XD 3EYVA 3CCHB 4K3HA 4OAWA 1U8NB 2ZYRA 2NUPA 4L3CA 2YPVL 2MCPL 4Y5XA 2YUZA 1SN0A 4PRHA 1DEEB 1AHWC 2P48B 5JQHC 2DDQL 1PLGH 4QRRE 2IH1A 4J3OF 4GRLB 5F7FA 2Z93B 3CK0H 1XSOA 3CFMA 1NPUA 1NFDE 3HG2A 3RIAF 4DP4X 1DVFC 1ZHLB 4JG9A 4U1SB 1BZEA 3IJ8A 2RGSA 4M7KL 5CD3B 3AU0A 5DTFB 4WUUB 3S3DB 3U4KA 4D0BB 1U0QA 4TQEL 2DQFA 3B7SA 3DYOA 1JZ7A 2OKMA 1XF4A 1S8DA 4MQ7B 2IXQB 4R6UA 2H3XC 3OGCA 3ALPA 1JBJA 1I3GL 1SMOA 3MN8A 3KPPA 5E9DB 5BZXA 4ZG1A 2OMVB 2LLNA 4FQLL 4LOEA 4N0UA 1U8QA 2XTJB 4G7VL 4YC2C 5HY9A 4HOZA 2DYPD 2VH5H 3LEVL 4NQVA 3QCTL 1I9IL 1U8KA 1NMCC 3P11L 4F5CE 2FR4A 4N2AA 4YSPA 4JRXD 1BXUA 2R0ZL 5JUEL 1INEL 1LLAA 1I31A 3NN8A 4PP1C 1QSEE 3NZSA 3PHQA 4JGJA 2X3BA 4NNPL 3K1DA 2Y5TA 5KS9F 2J1YA 4EI5B 1Y6KR 4NWUL 5IHWA 1B2WH 5KJ7E 2BZ7A 3PL6B 4WV1B 1MWAB 1A1OA 4IGBB 1CE6A 2QR0B 1WG3A 3U6RA 2WCGA 3AGVA 3LMJL 2GY7B 2BC4A 2IALB 2QSQA 3I6SA 4KNSA 3UCRA 1F13A 4F93B 3OC5A 4RIRB 3X13A 4APQC 3QQXA 4MQ7A 3MCLL 4HIJB 4IDLA 1PVHA 1HN1A 3A6CL 3CVCA 3TPKA 1N0LA 3ZDYE 4HEPA 3DUSB 3NEOA 4TOYL 1WTLA 5B4MD 2HRLA 1JN6B 1ZEAL 4HHWA 1SYSA 4IMLB 3LKPB 4NENB 3W0WE 4E9LA 3AITA 4Y16A 4UMGA 2LAGB 3IDXL 3CFCH 1JD7A 2B14A 1SJXA 5CXPA 4JKKA 4S1SH 4URTB 5IFAL 4I5BA 2PUQT 2W9DH 4P3DB 3ASOB 4I48A 3X1GA 1NGWA 2APWA 1RUKH 2QKIB 1ZLSH 4Y7OC 4ZMOA 1D6EB 3AJ7A 2IGFL 3UPAA 1LK3L 1XX9C 2R0KH 3OQ3B 4OJFH 3KWXA 4PW9A 1N26A 3AAZB 3L8QA 4X6DF 3WN5C 5BRZB 4PSPA 4Y19A 3EXLA 4TLKA 4JHBA 4IRSD 4I77L 1XCQB 4UV7L 3WFHA 1CFSB 3UCQA 5E2TL 1MWAA 3E6HB 5BOPA 1HOCA 3ZKNC 2Y2TA 3BUTA 3WFDL 2IADA 1YPZA 1ZS8A 5GGUA 5L8JB 1EHNA 2CQVA 3PHOB 2MJWA 2NY2D 3QS2A 4UT9A 3KE0A 1OAXH 1S7RB 4MGXA 5AZEL 3DX3A 4QOKD 4DERA 4P2YA 3BDBA 5HJDA 2F8XC 2AEOA 4HWZB 3FTYA 4HIJA 2X09A 1FNFA 4WO4A 3QUKA 1N68A 4HK0A 4S1DC 3QEQD 3CH1B 3OTTA 4XXCC 4MQSB 1WISA 2QHRH 3D2UB 5JOPE 2QDWA 2QQKL 3NPSB 3QQ9C 1QW8A 2Z34A 3D9AL 3LKPA 3DV4A 4M62L 4WJ5B 3P3RA 2JIXD 4PV9B 1P4IL 2ATPA 2CGRH 1ILSA 1IC4H 3QORC 3W57A 3RGHA 2VLLB 1BLNB 1L6PA 1QFWM 2Y7OA 2D9CA 2X44D 2WPGA 3QFJD 3QUYB 4A55A 5GS0L 2V4LA 4JZNA 4XNXH 2IPTH 1HQ4B 2IDFA 1KGUA 3K81A 5FGCE 5B3JF 2EVHA 2KLSA 3QWOA 1VEOA 3EJZC 1Y6NR 4LRIC 1G6RL 2UV3A 2ZIDA 4JKWA 5TQ2H 2HXAA 5A16A 1YN6B 5GIRA 4LDCA 3OAZH 3FTGB 4L4VD 3BE1L 4ONGL 4WKZB 2HMIC 1IKNC 1YVLA 5DYOA 2ADYA 3QYNA 1N6VA 2NY1B 3F01A 4DVBB 2ZT9C 1WBXA 4ZPTB 3GO1H 3QG7L 4PPTA 1SN2A 1NUFA 1S7RA 4RRPM 4WJKB 3NQIA 1UEMA 1QHPA 3FQ4A 2HWZL 5IB1B 2LVCA 4RESB 4MQTB 3CH1A 5T1JA 4D3CH 5I1KL 4EIUA 3HIZA 3LV3A 3MRBA 3NT0A 3VWJD 4EI0A 3S7GA 1SF3A 1CK0L 1F1DA 4R2GD 1XZWA 2Y4SA 3TEXA 1JZIA 1ROCA 1VHPA 4PV9A 2P5ED 1G7PA 2CNYA 2ZP8A 4IRZA 4K94C 4Q6KA 3N0AA 4QGYA 3RPIB 1BLNA 5ETUA 5IK3B 4D0DA 2R1XB 4FHBD 2BRQA 4YHIB 5DK3A 3QUYA 2IQ9L 3OKMB 2CHNA 4QY8A 5IESL 1ZANL 1QNIA 4K8RC 5AZUA 5HYJB 4WEEA 4JANB 5C07E 1QSED 4BQBA 1T5XA 3FQXA 2G3ZA 2FGWL 1UM4L 3MLSL 3VI3A 4AVHA 2QHLA 4PD4K 4OT1H 4YDLC 1KLGA 1U9KA 4KXZI 3L3OB 4DK5A 5KSAA 1ETB1 5AKSA 1AHKA 5ESVA 2FBJH 4MXVE 3JT0A 3DTDA 2Y2YA 2PWFA 4HWNA 4P3WA 1MCDA 4KI5C 1UWGL 2I32A 3TVMC 4AI7A 1UWYA 3TH3T 1R3IH 3DKHA 1UJTA 2WSPA 3RB5A 3QEGL 2ZAHA 1FVDB 2NY7L 1HC1A 2ORBH 4I3SH 4MFHA 1IQDA 4F57H 2FJGA 3HR5A 4CU6A 4FF9A 3C60A 5B22A 5IMMB 3T65A 4AUUA 5J6HB 2C1OB 4MCZB 1DBML 5GGVL 4MMYA 2D7QA 4AGPA 1K2DA 3V4UH 3VXRE 4PJIE 4HLZG 5JYMA 2B1HH 1UXLA 3SYOA 3MOBL 4S1RH 2N0KA 4WI4A 1T5WA 1HCVA 5IK3A 1BVKA 4D7PA 1JGVL 2EIBA 4YHIA 4HWUA 3OKMA 3C5ZC 4L9LB 3WSQH 5FXCH 2V8MA 4Y2DC 5L2KA 4TSAL 4CVXA 1MAKA 4C4KT 3A5VA 1P5UC 4PGEB 4Y4KB 1XCXA 1DQIA 1BAWA 2BVOA 4JDEB 1I8UA 4LCIH 5GRWA 1DVUA 1FC1A 2G0LA 2JKIS 2WXGA 4B9IA 4Y4HB 2BSTA 1M3JA 3JV4B 5CP7B 1JZGA 2HRPH 3T77A 3U36B 1DDHB 5FO9A 3DMMD 1PS3A 2GHWB 2P4AB 4TS6A 4BYHA 1IM9B 3GNML 1J9SA 5BQ7A 1S7XB 1TPXC 2BMKB 3LTVA 4MS8D 1QO3B 3GKWL 3HOGA 4P8QA 1OY3B 1OAYH 2ISDA 2P9RA 1CS6A 2DW5A 1AS7A 4ODBD 5JOPD 5CLTA 1AG0A 4AJ0A 4HFUL 3T0VA 2FEDD 4AX3A 3QIUC 2E9JA 1HL4A 3IXTA 1PZCA 1E6OH 3SGDH 2EE2A 4K9EH 1I4FB 1T6VN 2XPGA 5C3LD 1M1XA 1F2XK 2CM5A 5JHLA 3QCVL 1A6VL 2P3YA 2XY2A 3CFDB 3LPFA 4UOW0 1L9NA 5DC4B 5SWZA 4KQ3L 4LIQE 4D94A 1QLEH 2EDHA 3DSFL 5IHUL 1I1AC 2JKXA 5H37G 3L5WA 5JA9A 4OFYA 2ICWB 5FYJE 5KVMC 2YPVA 4DTGL 3LIZH 2F19L 4LLUB 4OM1L 2ZWYA 4LSUL 2K78A 1EEUA 4KK5C 4OFDA 4RSYA 4P5TB 5AVWB 1QFUL 5CFHA 1SYVB 4AKQA 4TTDC 1K4DA 4PREA 5TFSH 4BIKA 1G4RA 3NH7L 4KHTL 1D5ZA 1H3WM 5CP7A 2Y36L 1S3RA 2ARJB 2CRMA 3H3PH 2CLRA 1OTSC 1T7ZA 4HIIB 3K6SB 1CFVH 5I1IL 3NTCH 4KRPC 2G60H 2C3GA 1IM9A 4IIQA 1EV2E 4WDIB 1ZLUK 5IB2A 1CT8A 5F6HI 2WXFA 4BH8B 1WBYB 4G7YL 3NJMA 4DQOL 3ESOA 2NW3B 4MA3B 4F7CB 4PB0L 3H54A 3OKEA 3ZTNL 3T8XB 2OMTB 1FJ1B 4ZFZA 2D7PA 4HZLB 5E23A 3W1ZA 5JW3L 2P8MA 4MHHI 3UPCA 3TBYB 1A7BA 2HT3D 3N40F 1RY7B 2JTDA 3D05A 4XWOC 5CEYB 2KL6A 2GFBA 2EIEA 3OM3B 4HISA 4BKLA 5ES4B 5DZOA 3TT3H 5I0YA 2B4CL 3CVHH 5FYLD 4PJXB 8PAZA 1IM3D 1NPJA 2YKLH 4LESA 1EZSA 2ED8A 3HRPA 3N1PC 4FDWA 2VXSH 4HUXA 4KKAD 4MQXD 4S2SA 4M6OH 3HCVB 1E65A 3QUML 2LW3A 1MH5B 3VD0A 4LLUA 4X6CB 1D2OA 2PR9A 2DJUA 1KXVC 5IIEB 5JPNA 4LFHD 5AUMA 4N28A 4C57C 3ARDC 4FQQA 4X6DA 1E4KA 4HG4K 2V3EA 2DQUL 3WJMA 2COVD 3UC0L 2ARJA 3THMH 5GSRB 1AGFB 4HETA 2XQ0A 4PJFF 3KYAA 4D0CB 3NRFA 4GBXA 2KMWA 1PD0A 2YA2A 4Z7UB 4F3FB 5I75C 1PMYA 3VFPB 1AZUA 4N2FA 3KPQA 3SOBH 2ZX5A 3VWKC 4I3GA 4JFYA 5C0CE 1LE5A 2EIKB 4MWFB 5TDPB 1V7NL 4K3EL 1A3RH 2EE0A 3M7OA 5E8NA 1Q72H 4A2LA 4DKAA 1VFAB 2V9TA 3CC1A 4ZX6A 3ZE1B 5C2UB 5I1DB 2HX7A 2R83A 1KFAL 3CQQA 1Y1DA 1AKPA 3JVGA 1LO3H 1X4ZA 4X8CA 5JHMA 4LLDB 3PF2A 3VXUE 4PJXA 1GCFA 4KI5E 4YHPA 1QRND 3VMOA 2VXTL 5C0RH 2JJWA 1R5WB 3WS3A 1Q9LB 5KBDA 4YLCA 1E9QA 5HHXH 3RDJA 5T33H 4AIZA 1MH5A 4D9LH 1GKOA 5D6DC 4KMTL 4X6CA 4Y2LA 3AABA 3FTXA 5ITFA 1A4JA 1NJ9A 4QXTB 3H53A 4HLZH 2WJ5A 3JWNG 4RAUB 4P48A 3ARED 2X9XA 3CMOL 2EDRA 1CDCA 2ZUUA 4BSJA 5DJCA 3O3DA 2YPLD 5GSRA 3UIYA 3ETBF 3ZT7A 4JZJB 3GXNA 2B1AH 4OLEA 1HZKA 5AYTA 1X5AA 4A2EA 1FGNL 2Y72A 3M8OH 5MEQA 2E6JA 3OPUA 4HF5L 1UQSA 1TZIA 2ZXEB 2D7NA 3VG9C 3NACL 4M6MH 1BBDL 5DS8B 4C83B 1ZTMA 3B5HA 2W0FB 1A8ZA 5KBPA 3VFMB 5IJCC 1WEJH 4E41D 1ES0B 2NCEA 2YAQA 4M7ZB 1KN4L 4KRMB 3UTPE 4IBLT 4Z23A 4U7SA 1FFTB 1AO7A 1JGDA 3DTXA 1T22A 2WXJA 1D9KB 3WG7B 1CLOH 1XCTB 3MA7B 4HCRL 1KT2B 2E7HA 3L95B 4NNYA 1G6RA 3OG6B 3UEZA 1I8IA 4X5XA 1FDLL 3HE6D 3Q3GA 2F7QA 2BCKB 3U1SL 1YEIH 4RAUA 2ZP9A 3D52A 4EBQH 5IQ7L 4FKEA 1WO2A 1IGYB 1J86A 5EO0B 3CN1A 4MXWL 1TEFA 3PGFL 1U8OB 4G9FD 4MBRA 2E47A 2WUBL 2DH3A 5H37H 5I0VA 1KIQA 1JZEA 3T0EA 1NINA 5F0LB 5AW2B 2CDFB 2RD0A 5D2NA 4ZUTA 2WCPA 4HBCL 1BBJB 1RL1A 1PAZA 4L5FE 5I0WA 2QVFB 4L1TA 5L2JB 1JTPA 2F74B 4BA0A 1IARB 2KPNA 4GUQA 3TCXA 3WNMA 4R8WH 2N0MA 2BNRB 4DZ8B 3FZUC 4E9YA 5DEZA 4HPOH 3MLYH 5DGRA 1F3DH 1IC5H 2XI9A 1BQHG 4P5MB 5E7FA 1C5BH 2VC2B 1TITA 1N4XH 2BRRH 3LYRA 3NABH 2QTVA 1NDGA 2NPLX 2E46A 4ZMLA 4ZW5A 1RZFH 3OQRA 4P4RB 4TL5A 1TETH 1UXSA 1V55B 2APBA 1NCCH 2J55A 3CIAA 4HIPA 4XMXA 4GSDH 4GRWH 4P23C 5CUSL 5L6YL 1VFOA 4P4KA 4Q9RL 4ICXA 5EG6C 2BIQA 4MA7H 2AJSL 4PRBA 3TS8A 1M2VB 3QIWB 1DHKA 1QNZL 1ZTXL 2YUXA 4I85A 4P2OD 1UZ8B 4MDIB 3ZTEA 4PJ7B 1ORSB 5EFIB 2H2SC 1A4AA 2PP8A 2OSLB 1I9RL 3EYOA 4YDVA 5HHPA 1R5VB 2JB5H 2WXHA 4BZ2L 4M1GH 5B38A 2PCPB 4POZD 5CD5D 4NUGL 2IOIA 5DFTA 4NC2B 3KLDA 2IAMD 1HHJB 5C0CD 3C5XA 1W0WA 1BBJA 1LM8V 1VA9A 2B2XH 3MV9D 3QDGD 5CJQL 2NX5B 1SBSL 3LIUA 4YHLH 5CILH 4R97B 3U4EB 4GUOA 1F4WL 2F58H 3DGDA 4LSTL 4U1IA 1NEZA 4H8QA 3WDIA 4LCUA 2BNRA 4DZ8A 5EZIH 3JUYA 2FHBA 4BWWA 1OAZL 4P5MA 3GMLB 5ILTH 2OFQA 5B1AB 2G9HB 4E5XB 3WD5L 4IDJH 4NP9A 3VJ6B 3L4TA 5JO5A 4PJ8D 4W6WB 3HUJA 5F88A 4Z1PA 5F93C 3G5XA 2B0SH 5IROD 4M03A 2AJ3A 4MDRA 2EKSB 3BIBX 1PKOA 3LQAC 3UACA 5GQBA 5BXFB 1ZKAA 1Z9OA 3FSWA 3GTVA 1M2VA 3QIWA 3GBDA 2K6ZA 2DQGH 1UHVA 5D9SA 4WAFA 5E6IA 4PJ7A 1ORSA 5DD0L 5DVOA 4FD0A 5CSZB 1FQ9C 4HS3A 1O5PA 5E1GA 3KDPB 3HA0A 4Q6IC 1SF5A 4H8VA 3JWDL 4M8QB 2F8IA 4PWGA 1I82A 4ES9A 2GSGA 1EA9C 5D1QA 1SOXA 1N3NA 1RK7A 4G8IB 2J4WL 2VQ4A 2QBWA 2EP6A 3JWNH 3BVNA 3Q5TA 4FEMA 3SE4C 5I76B 5DFVD 4X99A 1IQWL 1YAZA 3NSJA 2DLFL 2E3VA 5ID1B 4AH2B 4XVSL 2NXZD 3T3PF 1KIRB 1DLFH 4LXFA 1KTLA 2GABA 4KTEH 2CDGB 5EEUA