3Q06A

An induced fit mechanism regulates p53 dna binding kinetics to confer sequence specificity
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
231
structure length
231
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFVQLAKTVPVQLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKKKTMDGEYFTLQIRGRERFEQFRERNEALELKDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title An induced fit mechanism regulates p53 DNA binding kinetics to confer sequence specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle/dna
total genus 42
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3q06A00
3US1A 5A7BA 5G4OA 4IBYA 4L0YA 3IGLA 3D06A 1KZYA 1HJCA 4IBSA 3WTVA 3D05A 5AB9A 2J6WA 4MZRA 4GUQA 4IBUA 1HJBC 4AGNA 4IBTA 4IBZA 3US0A 4MZIA 2J21A 1HU8A 1YCSA 3WU1A 5G4MA 4KVPA 1LJMA 2BIOA 4QO1B 2J1YA 3WTSA 1EAQA 5LAPA 1CO1A 3KZ8A 4IBWA 1TSRA 1E50A 2BIPA 2J20A 3Q06A 3ZMEA 3Q05A 2J1ZA 1IO4C 3D07A 4XR8C 3EXJA 4LOFA 4HJEA 5AOKA 5BUAA 3QYMA 3WTTA 2GEQA 5G4NA 2X0VA 5ECGA 2FEJA 4AGPA 2MEJB 5KBDA 3D09A 5ABAA 3D0AA 2P52A 2AHIA 5AOLA 4IBVA 4L0ZA 4L18A 3VD2A 3EXLA 2ADYA 1EAOA 5AOIA 3VD1A 4IJTA 3WTUA 4AGQA 2XWRA 3IGKA 1H9DA 2X0WA 3VD0A 1GZHC 3WTYA 4AGOA 4IBQA 3TS8A 4A63A 2ATAA 4G83A 4LOEA 2J1XA 1EANA 2WGXA 3KMDA 1GZHA 3QYNA 2PCXA 1T4WA 2BINA 3WTXA 4LO9A 3WTWA 2X0UA 2AC0A 2RMNA 2J1WA 2XWCA 5AOMA 4AGLA 2IOIA 2IOMA 1CMOA 4GUOA 1TUPA 2VUKA 3Q01A 3D08A 2YBGA 2IOOA 2H1LM 5LGYA 4G82A 1UOLA 4AGMA 2BIMA 2OCJA 5AOJA 2BIQA
chains in the Genus database with same CATH superfamily
3LHPL 5B21A 5D7IF 1E6OL 4WCYH 3BKCH 5CZVH 3WEOA 3NDZE 5GRUL 3ASWA 5T1JA 4B96A 5B7FA 3TBVB 4W9KC 5FCSH 4DTGL 3ULUC 2O30A 4HIEB 1YO4A 2RBLA 4MMZA 2C9RA 2IPTH 1J5OL 1XCWA 4YFEA 4PJ7F 3EYQD 3KWXA 1JRHL 1IBBA 1SHSA 4FKKA 4N3UA 4M00A 3QAZC 2Q7YB 2O5NA 4QXTB 1T03L 4KK9D 3F5WB 1BBJB 1DQLL 4X8GA 2NDGA 2ZG3A 3M88A 4MASA 4UV4L 3FB6B 4JHZA 4JVUA 4L4JA 4EF3A 4JKMA 1LEKA 5TF0A 3K0WA 2ICES 3AROA 1DQTA 3C5SB 3OSVA 3PY9A 4MX7B 3ARUA 4N5ED 5FO7A 3WGUB 3QE5A 3KD4A 4ZQTA 5I6LA 4DEPB 2DQTL 4JK0D 3HZKB 2VMDA 3DGDA 1H5BB 3H8NA 2AJUL 2H3XC 3O81A 3VFRA 3UTQB 2H8PB 3PIQA 2Q0ZX 2E7LA 3UYRH 4GKSB 4JHWL 3UGXA 4GRLC 1BAGA 3VFMB 3C2AH 2G9HA 1FO0B 1RURL 2JKNA 5MERA 2HT3D 1RZ7H 2X89D 5E9NA 1ES0A 1KWKA 3WHXA 3JZ7A 1IQDA 5EU6E 2GAZB 3QIUC 1JNJA 2CM6A 4K71C 1NCDL 1CT8A 4NZJA 4EKJA 3MLXH 3R18A 4B9CA 4Z23A 4KZDH 3QRFM 3LVEA 3FW6A 4TSBH 2A0LD 5INCB 3VFGH 3D12B 3NIDE 4P3DA 1WZAA 3HZMB 1YYLL 1FF5A 1KLGB 3ATDA 1DQVA 1U3HA 1KGXA 4BK5A 4UT7H 3M8OL 3QJTB 5DZPA 3GXNA 1JFQH 2ADFL 5KVEE 2WXQA 2X9YA 4P4RA 3GGWB 3Q43A 4TOYL 2QELA 4JY6B 1GZHA 2WYZA 4ATTA 1KXQA 5T3ZE 3MFFA 1Z66A 2J44A 1DQDL 2YN3A 4P2RB 3GSNA 4F37K 3UZEC 4ZQKB 1CMOA 1G7LA 3F6JA 4XRCB 1AZNA 1ZRUA 4JKPH 1WT5C 3T4YB 3PGFH 3GDBA 2VR8A 4LIQH 2V3EA 3CBJB 4TPRL 4J5VA 3U2SA 3DMMB 3PAYA 5MENA 4XHJD 4YLQT 3EZ8A 3TBSA 3ALWA 4M6NH 4NHUB 3LKOA 1AO7A 4JHAH 5IW3A 2WXIA 2PP9A 3A23A 4OCSH 3W0WA 3NACL 1J5HA 4LSSL 5AYQA 5IFJB 1BHGA 1G1OA 1PX4A 4DT2A 4OI8A 3WKYA 4I5BB 4BCZA 1UACL 1QX1A 3ROLA 4F27A 3DX3A 3Q0HA 3OKEA 3BESR 5FHAH 4AC4A 4LEXH 4DPRA 4HG4J 3U7WH 3SDCB 2IWGA 4K3DH 5GZNC 2CBPA 4NXSA 2NYYD 2F0CA 2YO3A 1CYXA 4U7KA 3WGVB 7FABH 4GW5B 5HGDB 1TTFA 5I0VA 1U2YA 3RIFF 3HR5A 3BPNC 2YMXL 2PP7A 4FFVD 5LNDA 3GXTA 5JIQA 4WW2C 1NH6A 2ZWZA 1SN5A 2AXFB 3LN4A 2IFGA 1N0XL 1R5VB 5M95B 2DQUL 4UMGA 2ZX9A 3WFBL 1BFVH 1BEXA 1VGEH 1N8ZB 3EJRA 5AW4B 5ADOL 5ISZD 2FR4B 3E2HC 1N5AB 2I32A 4GAJH 4HULB 2XN9A 3BJLA 5D6CB 2WKGA 2ZQKA 4F2FA 4Q9BA 3FB8B 2ZUXA 4PJ5A 5EU6B 3E8UH 5I1CH 2CALA 3L3GA 5B4MD 3WKPA 3U4BL 4GAGL 1E8YA 1OT1A 2Q7AA 1I3UA 3N0AA 5CJQH 2A1WH 1OP9A 4MNGE 3SGEI 2XCMC 4GIOA 5BUPA 2VR9A 1IGYB 1ZVSB 3E80A 3IN2A 1HSAB 5ITBH 3EZJB 4QRRE 5IK3A 3MGTB 4PS4H 4XMTA 5C08D 3U6RB 3SE4C 3DVGB 5KSBF 2Q76A 4F8PA 3JVFC 2FT7A 5JYLA 2ZZUT 1KPVB 3OKMB 2Z0UA 3FSZA 1OO2A 4R5XA 3H9SA 4M7LH 3KDMA 1N7MH 2WLZA 3UYPB 1S5IH 3QJUB 4ODUA 5HDQL 1E9QB 3DTXA 1UEYA 3RGHA 1ETA1 1S2EA 4HUUB 5IHZA 3PLYA 4XAWH 3RVWD 3EHBB 1R24B 4GFXA 1ED3B 4R4NC 2Z34A 1ORQB 1FORL 5J1SC 4KO7A 3QUML 4FNUA 1FSKC 1A3ZA 1HSBB 5FGRA 4PGCA 4RSVA 5EPMB 1EO8L 3GXIA 5IB1A 3CXDH 2CUAA 2DMBA 3BVVA 4ZTOH 4D9QD 4ZFQA 4MDIB 2YGNA 4PUBL 2DPKA 1JMXA 2P5EA 4GUPA 4XZ4A 4XE0A 3F7KA 4KK8C 5E2VL 2QDWA 3BRGC 3WY1A 2F5AL 1KGJA 2BK8A 5GGTH 3RE0A 3S96B 2ZAGA 1QHPA 2FIKA 3NBNA 2XI9A 1E5CA 1UD8A 4K2UH 2KL6A 1HH9B 1D5XA 4KK6C 2ZX8A 2V2WB 2N4IA 3RP1A 3Q2WA 1WICA 1SEQH 3BH8B 4M5YH 2VIRA 1XEDA 1JNNH 4FCAA 3R7QA 1A6UH 1KXTA 4DEPC 1C5BL 4IS6B 1CGSL 3CLEL 1H5BC 3KYMB 4OZHE 3JV4B 1NCBH 5J7CC 2Y3NA 1Q8MA 3D0LA 3QWQB 4DN3H 1JZIA 2DKSA 2JIXD 4H8WL 1R9FA 1CG9B 3TL5A 2D4FA 4Z7NF 3VD5A 2ZXCA 3E3QE 2I7OA 2FGZA 1QBLH 2XV6B 5EIQA 5C0EB 3IU4H 3OC8A 1BF2A 1S78D 4HXBH 5BZZA 2VOTA 3X14B 5T1DH 1KNOB 1JXFA 1R3HB 2W95A 4ZW3A 1A9EA 1E50A 5I23A 5DWPA 2XX0A 3EUUA 2YAFA 4WFEE 1YY9C 3N41B 4GAFB 4TNWK 5D1XA 3SOBL 4ETYA 5J11B 4OLZL 2F58H 4LF3A 2VQ1A 1MCOH 3QXDB 3HKZA 4BHUA 5J12B 3HE6B 4F9LA 3FFCA 4HIXL 2ZOKB 3NCXA 1I8IB 3WN5B 1CURA 4EUPG 3GNML 4QR7A 3RI5F 1OM3H 4QRRB 2KT6A 4OVVA 5IROC 1C16A 1T1XA 4JRYD 4HIIA 3BW9A 5JLZA 2BP8A 4BYHA 1QTYT 4ZUUA 2Z7WA 2NMSA 3BUTA 1RULH 3FFOA 3ZSSA 2CO6B 5I1DB 3GDCA 3O6FC 1QP1A 4DO5A 1E5AA 3HVDA 1QD0A 4G6JL 3P4OA 4W9IC 2VE6A 3MA9H 3ME0A 4JR9L 4OBSA 1E8ZA 4M8VA 5DYOA 4G3YH 3U6XS 1TVBB 4P2OC 3CG8A 3PWNB 1CIUA 5CJXC 4JDEB 3TOPA 2LLLA 4X9YA 3QWOB 5K59E 5CINH 4B0MB 2OMXA 3EYUL 5JIDA 4Q9QL 1ND0A 3MX0A 1G6RB 1S7VB 5C7ZA 1YEGH 3B2UD 4UM9D 3V4VA 3QQ4B 1TZHA 2Z35A 3O4LE 3R1GL 4PWGA 4XTRD 3RWCB 4HH9A 1FL5A 4LPWA 3Q01A 3BWAA 2AMUA 2EKSB 5IBTL 2KDYA 2AFNA 1MQ8A 5IMKB 3SDCC 1PYWA 3I6LE 1YEKH 3VH8A 1DVFB 3GBLA 3TESA 3I6GA 4PJXF 1OB0A 3WIFA 3WXWH 5BZWB 3P73B 5LBVA 3RU8H 2BC4A 1FFNA 4HWBH 1BVKB 4YNYB 2EIBA 2YFNA 5DS2A 1W80A 3BRDA 3L3JA 1QHOA 2D0FA 1H3GA 1FLRH 1PF3A 8FABB 1X5IA 5HHPB 4WK2B 1CLCA 4KJQD 4P5TD 4HJ0C 4KTDH 4J3OG 4WO4B 1MREH 5EZLA 4B9JA 5I2IA 3RVTC 2HLEB 3IGUA 2DZEA 4JFEA 3WSQH 2ADGB 2DBLH 5DFTA 1YY8B 1B0GA 2NUPB 3ZJAA 4DVBB 3WS6C 4UWQB 4F8NA 2F74A 4PGBA 4HS3B 4R0LA 5IMOB 2Z93A 4NAQA 3GLDA 3RKDC 2F68X 2YPLD 1MOEA 2YQ3A 5I5JA 1W8EA 1EGJL 4E42A 1Z3GH 5EBWA 4W6YB 4WV1C 1QBAA 3TCTA 3CVCA 3B2XA 3LNEA 2EXYC 4HKZB 1KBGL 2CR0A 3PCYA 4UDTB 5IJCC 2D0GA 1UD5A 4GSDL 2HFFA 1AVAA 1ZHBA 3ZTNH 5IB2A 2ZCKL 3BZDA 2E7CA 2JKRM 1VEPA 3A47A 4YIQA 4O51A 4XXCC 5B1CA 3O41B 1KTDA 1P69B 4NZRH 5BUAA 2AK1L 1W91A 2W60A 4UUJB 4UNTA 5E51A 4J12A 3DETD 1KPUA 5DJXA 3X3GH 1T5XA 1OP3K 1XH3A 2WXMA 5DD0H 5D1ZC 2IAMD 2ZJSH 3DA0A 1JD9A 1YYMH 3PRZA 1YJDL 2W8CA 2B1AH 3ROOA 4LLQB 5DI8A 2QQKL 1SXZA 1NKGA 5CEZH 1FAIH 1E9PB 3L5XH 2VM9A 2ADJB 1QFWL 2E6JA 4TNGA 3NEOA 3VD4A 1NC4D 1CXIA 4WI6A 4LLVB 5GGRB 3PYCA 4NQQA 2QJDA 5FYKH 4PLNC 4TSAL 1ITCA 3VXUE 3GC3A 3VFNB 4L4TE 4XVUD 3QDMD 5KW9L 4M1DL 4AYMC 4PLJD 4O9HH 2YRLA 4WI0B 3MKGA 3L1GA 3O4LB 1NM4A 1MCQA 1T4WA 4GS7B 2X42A 4XWOD 1UA7A 1QRNA 4C57C 5FO8A 1IC5H 1G9ML 4J7RA 5FM8A 1JPST 2O26U 4LAJH 4M5ZL 4G70B 4WTQA 5GPRA 3LKRB 1FUNA 1IE4A 2DJMA 3I75B 3NABH 5BVPH 2HVKA 4X4ME 3ATBA 3APFA 5GISL 2YPKA 4JRXE 2HCZX 3ULAB 4PG2A 3HC4H 2D9QB 2G5BB 3HJ0A 4RAUA 3TJEL 4I87A 2UWEF 3DUSB 3FUMA 2IXQB 1FFQA 3D4CA 1NBZA 3CXHK 1YNKL 2FECL 1EHKB 1AKJB 1HHHA 1Q38A 2O1AA 3BH9B 5FKPA 2WQRA 3ZL1A 5EA0L 1BMZA 4HZ1A 3D3VD 3V10A 3V9EA 3AREA 4P2QE 3VFTA 3KPSD 3SDXE 2VABB 3GHEL 4B7LA 2VDQH 2ZE0A 3MV9E 2VAAA 3C09B 4I18B 3N9GL 5J11C 2IFFL 3DVNA 1CQYA 2L7QA 2FB4L 3VXNB 4WTZG 2YD9A 5JYMA 4B53A 3VSQA 5J12C 3HE6C 5I1AA 5CSBA 3ZYJA 4M8UA 2EVIA 4EBQH 3WN5C 4QRPD 3VTTA 1LO2H 2H26B 3KPPB 5DFWH 3MCLL 2EDWA 1UADC 3QG6B 5IG7A 3GBMH 3GD1C 3ETTA 4NO3B 1U8LA 2O6PA 3UAEA 1LM8V 1RZGB 1ZIAA 2VZ3A 3KH4A 1YQ2A 1JI1A 5I1GL 4Z5RA 4Z3GA 1TZOA 2GW5A 1LWJA 3RFZA 2HLFC 2KS0A 1U6AH 3BN9C 5CP7A 2W0PA 3DHMA 4WRLA 1NDMB 2X6BA 3B2DC 4QHNA 2ZNXA 1Q1JH 4XMPH 5DK0A 4Q6YA 2H0FA 3VFWA 1Q9KB 3HRPA 3O4OB 1M6UA 2A6DA 4HIQA 3TBTB 4JN2B 4ZFOA 3S3CB 5AAPA 5BPPA 2FEEL 1K72A 3F2LA 1SLWA 3B7UX 3UJJH 2BVUA 4HVBA 1OP3H 3VXUB 2OJZH 4B9YA 4ERSL 4YSOA 1QSEE 1YNLL 4YSUA 4JQXC 4WWKB 4JDZA 1DVFC 1KENL 4K9EC 5JTWA 5KZCD 4KUZL 4LOEA 4PRPD 4QRTA 2C3GA 3S98A 5DK2A 1JFHA 1FNEB 2J1XA 2WQSA 4JY4B 2FZ3B 2GJRA 1XR9B 2YAPA 3CDZA 1HHIB 5IEHB 5BRQA 2A73A 4LCIL 5DEGA 2OMYA 2E8ZA 1ET8A 3MRFA 4OZ4A 1PJWA 4URTB 1A7QH 5GGSB 1LEGA 2XOTA 3NSCA 4XPFL 4WO4C 2FSEB 2YGVA 3GZPA 2AXHA 5KYXA 1IAKA 4ZFFA 4NNYA 3FONA 4JRXB 4YHLH 4DF9A 4CILA 3ULUD 4UTBL 2ICWA 3FCGA 5ALBH 3A6BL 2WVTA 3P0GB 1TZIA 3E3QC 1Y18B 2DQIH 5DEZA 3TF7C 4IHOB 4MYWB 3F62A 5D72L 5AZUA 1OB1A 5B1JC 1E4KA 1V55B 4WFHD 1KZYA 1HEJC 5IHLB 4Y5YB 2GBAA 1GGBL 2JTYA 2I60H 2WLIA 5D70L 4Q2ZA 3HN3A 4P2QB 5IJKC 3SDXB 4XMUA 2J6WA 4KMTL 4UB0L 3SDAC 3MV9B 5J9PB 5DFVD 3MYZA 2PCPA 3RAJH 2BX5A 2FE0A 2ICEA 4OVUA 4MXQC 1WAAA 1I8LA 5MP6L 3EG9B 3VXOA 1Z3RA 3ARZA 3FH7A 4G72B 2YC1B 3NDYE 1S7SB 4P59L 2NY2B 3A6CL 1RLBA 2Y7MA 5ILTL 3X13A 4PJ9B 1LGVA 2DTML 3ARDB 5IB5A 1OY3B 1IAIH 2I27N 4RRPA 4A68A 4JS7A 2AKRA 3DPDA 2KQNA 2VN6A 4L29B 3NPSB 1ZV5A 4HUVB 2BSCA 4UNIA 1A14H 4ODBD 2Z31A 3JWOL 4LCUB 4ZT1A 4ZXBA 4N90D 4HGMA 1DZBA 1MHHA 2OMNA 5T5NF 1L0XA 4NB7A 4HHAA 3WLBA 4XP5L 5JHMA 4RSYA 4Y8DC 4GW1A 1NGPL 3DVIA 4ICXA 1W0VB 2PTUA 1F3JB 1P9MA 3AWEA 1IAIM 2ATKB 2WP3O 1NCCH 1JZJA 3BO8B 4G43A 4QIRA 3V4VH 2X4SB 3AY4A 1IC1A 1OW0A 1XGQA 1OAUH 3S5YA 3JV5A 2C7UB 4APQD 2ZXDA 3GMMA 4KROB 3ILPA 1UCBL 1E5ZA 3RYMA 5FYJH 4XT1C 4ISVB 1USQA 1QSEB 4AE1A 1HXKA 3FKUS 2F1AA 2LVEA 1ZGLA 3KGUA 2OR9L 4WWPA 2BHZA 5CFAA 1GSMA 2FX7L 5D93B 1FE8H 4ZPTA 3S3JA 5KTEH 3HB3C 1WTLA 3P0VH 4DGIL 5TJWK 3SDDD 2W65A 1PX8A 5L7XL 2YAQA 3Q8BA 4MTMA 2D31B 4PG9A 1QI5A 1VLXA 4CNIA 4LXFA 3QJHB 2V2TB 2J1WA 5GRZA 5DS8B 5IV2A 3FH5A 1SVBA 1TJIL 3NSDA 4ODTL 3TIEA 4ODXB 3TFKD 4GUOA 3P30H 1KIQB 2K4AA 1RP9A 4L4VD 5I1LA 5DQ9A 4OTXH 5GIRA 4XNMA 2WCPA 4U1LB 4GBXB 4X4XA 3SQBB 2IQ9H 5GS2H 3D30A 4H8VA 2M8XA 3UC0H 2L04A 3C09C 1CL7H 3ILQC 4IGBD 3FCTA 4CVXB 4EZJA 2GTQA 4RMTA 3MRIB 1BZQK 1HE8A 1XHHA 2DDQH 1VESA 2AV7B 4BFIA 1A7BA 3HHSB 3ZRSA 3VNZA 4LKXA 4HBQA 2A99A 3BZFB 1TOXA 3QG7H 1IBZA 4F5CE 1GAFH 2N1KA 1MW0A 4AV4A 3ZTJG 3ZRFC 2KERA 3OF6D 4K94H 4OJDH 5DJCB 1DCEA 3C12A 2OTUB 5E9AA 3FRPG 4DWHA 2VITB 3SDYH 3SKMB 4DKTA 2JKWA 1NINA 4DP1X 5E1IA 2XHNA 3LB6C 5C8JA 4GO6B 1IFHL 5CO1A 4ANKA 5C70A 4JLRA 3I9AA 3C9NA 2RALA 2GBUA 3GKWL 3O4OC 3G5WA 2Z91B 4HIPA 1TTCA 1ZHNB 3MOAL 4WSJA 5CJ8A 1MJ8H 1E5YA 3KLQA 3QT2A 4UT6A 2LLNA 2KMWA 1Q72L 4YUEH 5AVTB 4OLEA 3PL6D 2DKMA 3QUXC 4KPHH 4M56A 1CU4H 3T6WA 4QOKE 3B3IA 5TE7H 3PHOA 2VDNH 5I1EL 3FO9A 5EUKB 5CCHE 3H4HA 4PMEA 1P4BL 3DJTA 4Z7WE 5I1IH 3AU1B 4ZMNA 1GH7A 3RJQB 3CPLA 1BZDA 1JVOA 2EXSA 4FG4A 4WWKC 4MCZB 1V7ML 1A6VL 4ZTEA 2JKLA 4Z77A 5KBKA 2D7TL 5GJSL 4CVZA 4LARL 4G11A 4B9FA 2Y07L 3RNQB 1PZ2A 4OLVH 5FV2A 2FLRT 1DBAL 4FNSA 1A4KA 3AB0B 1MLCA 4HFUH 5JXEA 5C0JA 3JQOB 5CZKA 1ZEAL 3S36H 3VWJC 4HEPG 2J55A 1J0ZA 1J05A 2HRPL 5C3LD 1NFKA 1XAUA 5IFHH 4R4ND 1SYSA 3GSWA 1XF4A 2H7WA 5A6LA 1L6PA 5IVXE 3UZVB 3AXLB 4DKEL 2Y1AA 1T1WB 1KN4H 4DZ8B 3U25A 3E6HA 3JSSA 3B83A 5EDSA 2KPWA 1MLBA 2AGJL 1JHKH 3GTVA 1NGXB 2PXYC 1KTRL 4M62L 4MKTA 4AEFA 4P49A 1HINH 2HTLC 2I5YL 4Y5YC 3L4XA 2FX8L 5DHEA 1U4FA 1ZS8A 2EVJA 2PMZA 3RUGE 3TBCA 3T0EE 2J8UE 2GJZA 1EXUA 1Q9WB 4ZYKB 3QZWG 2F5BL 4LPYA 3F6IA 3U0WL 4KK6D 4YHZL 1I3GL 3VUAA 5BW7A 1PGRB 3RGVA 3BI9X 5FYLE 4XE5B 4QUOA 5A16A 5IHBA 3PAVA 2DL9A 5JW3H 1WHOA 1HQRA 3DBSA 4HIJA 3QPKA 2MCG1 2BWDA 3PHQA 1SUHA 4GRWH 3GIZH 1JNHB 5FW6A 3O3BB 4JUSA 1DVQA 4HUWA 2MMXA 3V4PL 5DSCB 3ARDC 3KW7A 3GIVA 3TNNB 3KVQA 5D2NB 4LL9A 4HPOL 5EU3A 5HY9B 2ZCZA 1VIWA 1SMAA 5HYFA 2VXVH 3NPSC 4F7TB 2JV6A 2MJWA 2CGYA 2AV1B 4Y9BA 1CYWA 1GGTA 3WO4C 2AQSA 5AW0B 5EC1B 5CBAB 2YQBA 3PWVB 1V7NH 1CD8A 1FZMB 4JPKH 3GMLB 3TZVC 4CU7A 1N5YH 2QV2A 1GTFA 3IWVA 4N6RA 4XPTL 5CLZA 4ZS7H 5C9JB 1I8MB 4EDWH 2OMTB 4HJJL 4Y1SA 5I6MA 5B8CA 1PPIA 2ZKWA 2G0KA 3FTYA 4XVTL 1LEIB 1DQKA 4B7IA 5EEYA 4H1LB 1F4YH 3BJ91 4QOKB 4RGND 3J27A 4FHJA 4KROC 5C6WH 2FYYB 1L9MA 4NQCA 4ONGH 5DUML 4Z7WB 4Y1AD 1T04A 3QIWD 2W59A 4V2CB 1C08A 4P2RD 5MHSE 1R5WB 1W9XA 5BVJB 2R1WB 3FUFA 1Q94B 5D93C 4G6AC 1NIBA 3MLRL 1JTTA 3IJSB 4AY0A 1WWBX 4YXLL 4X2UA 2CM5A 2V7NB 3D09A 1IM9A 5FLVA 1P84K 4HWEL 3U6XA 3DMMD 5EWIL 4Y2DC 4PRIE 3RJOA 4GKNA 4XNBA 3LRKA 4UZSA 2PABA 3TO2B 3KCPB 4LEOB 4F7KA 4UAOB 3O3EB 5BZDA 2HKAA 4GXVH 5EIIG 4ELME 4F8QA 1L7IL 5LDSA 3ECWA 5CWSB 4OFIA 5SWQB 5IVXB 1BF8A 5TF1H 5CLXA 3HHMA 1OSPL 5INDB 1S5HA 3BUBA 3J7HA 4B97A 4GBXC 3DSFH 1RIVL 2WVUA 1LNUA 1QQDB 1OAKH 2R27A 1JJUA 4KQ0A 3MACL 2PCXA 3CZNA 1MCBA 3T0WA 1L9RA 2A2QT 3PDOB 4X0KB 1M7UA 3RUGB 3T0EB 2J8UB 4F1ZA 3NFPB 3BEWA 1HAUA 4O4YL 4UZGA 1GYWA 5I8EB 1JPTH 3CD4A 3ET9F 4NKQB 3X12A 5I6KA 2VLMD 5CGMA 3MRQA 5DJ8A 5FUZH 2AQ2A 4PPTA 4H44C 2X4PA 4U3XA 1D7BA 4P23B 1I1CA 2AJSL 2VDLH 1KGCD 1LXMA 1R1CA 2GUYA 3ASOB 3NZ8B 4MA7H 5FM5M 5B3NA 2J5WA 5CUSH 3UTZB 2DEXX 1XV8A 3GK8H 2FNWA 5K9JH 1KCBA 5FKAA 1QR1A 3GSXA 5F3BB 3TP4A 2XVBA 1FVCB 5T1KA 1E8XA 3BQUB 4IDLA 1WFIA 1YEEL 3DX2A 1IMHC 3SZKC 1PZ5B 4JM2C 5KAQG 2F53E 4WHYG 1CR9L 4KNSA 5KVGE 4ZUTA 5EC2A 3JWNE 3ALPA 2X6MA 4DKFH 2QSVA 4BQ8A 4RRPM 3B9AA 4ZMAT 1RJZB 2VC2H 5BV7B 2MCMA 3HG0A 5L2JA 1K2DB 1YAIA 1T2JA 5T3XD 4HD5A 5A2BA 4U6HB 3GLEA 4DEUA 2ZNWA 3VQMA 5EF3A 2VDMH 3MNMA 5AG9A 1ZHKA 4MAUH 4WKXA 4WNQA 1A6PA 5E4EB 5AZEL 4DGVL 1Z9SA 1ZSDA 4NRZA 4W4NA 2EE3A 5D71L 1GYAA 1N68A 4RFEA 3D1MC 3AB0C 1MCIA 4PJHF 1WE5A 2BVEA 2O5XL 4R3SA 5AKTA 1NZRA 3V7AE 1TVHB 4YR6A 2GSGB 4HF5H 5I1JL 3EHBD 4W93A 2EEDA 5IGXL 2MNJB 1OD7A 4PRIB 3RVUC 1LO0H 3AMLA 2YEVB 5HSFA 4CBPA 3ULSA 1OEZW 1JF1A 3KPOA 5CJOL 3GBEA 4JDVA 4PJEA 4ELMB 1S3KH 4KX7A 3U83A 5T3XL 1OIOA 1R3LA 1G9NC 3IJYB 4R26L 5HGHA 5IWLA 3ZE2E 3KPNA 4Y4HB 5HDLA 1OSZA 2VMFA 3VA6A 1GGCL 4RIRB 3V5DB 1HXMA 4JO4L 4NZDA 5E6YA 1XF1A 1TZAA 4NM8H 3HKFA 4MA1B 1TJGL 2EILB 5E0QA 3RIKA 1XBRA 2HFGH 1LO3L 1M9SA 1IFGA 1KBVA 1CLYL 3CFKB 3SKJH 5D1QD 5DRZB 5F9WC 2H2PC 4LQ1A 4GQZA 2R1XA 4ONFH 1IGCL 1MHEB 4OGQC 5DYFA 2OPCA 2JLLA 3RIAK 1IGTB 2UVFA 4NC1E 5CD5C 5LGJA 2Y7QB 1X4YA 3MNWB 4OZFB 3QK0A 1SXSA 5AG8A 2JK5B 3QRGH 4M6MH 4LHUB 3ML8A 4UNVA 3OKOA 3UXFA 1X9RA 3VMOA 4X8JB 1QHQA 2FAUA 2H6PA 3VJ6A 3ZDYE 2WJ7A 4K8RC 2CJ3A 4G6ML 1P0SE 3QO1A 4KTEL 2X89A 4ZX4A 2AEPL 4UT6H 1KJ2B 1MI5E 2HWZL 1HJCA 5L6YL 2DRUA 3F12B 3AQZA 4HK3N 2Y1VA 4KVNH 4XPGH 2EVHA 3KL3A 1NGZA 1A5FL 5E9DD 2VLRD 3QJFA 3SHSA 3R4RA 4OR1A 3OQRA 4PR5B 2BWIA 1UFUA 5JOFA 5CLTA 5K69A 4MXVE 4N20A 2OMUA 2NY7H 2VJ0A 1PLGH 5AAMA 3G08B 3DX8B 4QRRD 4H8HA 4HG4K 3DUUA 2GI0A 1VHPA 2UV3A 2HVJA 1BFOA 1LP9B 3APNA 2X2IA 4WEBH 1OAZH 1CB4A 5ICXB 4QT5A 3DV6B 1FLTX 3LNHA 3PJLA 4L05A 4ORZC 2PO6D 1UURA 3UTPE 1A65A 1JHTA 3OZKA 3O2DH 4G8EA 4GH7B 1UTDA 1WZLA 2P5PA 4UAOC 5JHBA 2WQVA 5FR3A 3IXAB 4P57A 1SBBA 4XOCA 4JO1H 1EZSA 4MZ2A 1SPDA 3MBWA 2JCCA 1JBJA 1T20A 1S9XB 1ZA6A 3FK3A 5E5MB 1NAMB 4KKAC 2V5MA 3OHMB 3ABZA 4MJ6A 2E7HA 2OBGA 3EO9H 3K2UH 4YDJA 4OCXH 1ZK5A 4Z0XB 5JHDD 3EF7A 6PAZA 3ZE2B 3T0EC 4B9PA 4PJ8B 4XNYH 2CHNA 5F7YC 3VXQA 3GM8A 4S1SH 1IEAB 1J9CT 2YKLH 3FMGL 4ZW7A 4HAGA 1KEMH 2E75C 3HC2A 4MSWA 2X1WL 4JMXA 3ZTEA 1XVSA 1YA5A 1DE4B 3MJ9H 2GK0B 2X3AA 4FXGB 5T5FL 3EJJX 3L1OH 1WF5A 4LVHB 1S8DA 4WO4D 4P23C 4FXKB 2OXHB 1RMFH 2ARJQ 3V0IA 4ZOAA 1JK8B 1UKSA 5FAAA 5I26A 3DOSB 3ULVH 4NAMA 2FHFA 4Y19A 2FO8A 3LMJH 5DLML 4AKPA 2PW1B 3BQUC 1M4KA 1T21A 1NLDL 5HJBA 1FHGA 5D7IE 4BFGA 2E74C 1UB6A 1FQ9C 4XXDA 2VH5L 4XH2A 3QA3A 5ISZA 3ZDYB 1MCPH 1TQBB 1QZ1A 5CZRA 3IK2A 5F1IB 2B5IB 2G2RA 3W82A 3FO1B 3H9HB 5KN5A 1MI5B 3SBPA 3VFVB 1G5GA 1JN6A 5BV7C 1AI1H 4ZW5A 5IOPA 1QO3A 1EEZA 1H8NA 3QUMA 4PJ7E 4OKDA 5LWYL 2J72A 1MCKA 1H3WM 1KCVH 3BGFB 3OMZA 4XP4H 5AKVA 4Q9RL 4MMXB 2E7DA 1U9KA 3DXAD 4NQXA 5DMGD 5E4EC 2J5LB 3W1ZA 3ARPA 5H4ZA 5C08A 4QJ5B 2VXTH 3BWZA 4OD1H 2ZX6A 4XVSL 1B6DA 4N9GA 3QUYA 4MQXD 1AQDB 3PPEA 4Z3TA 4JQVC 2OL3B 4PV9B 3V8OA 2WLNA 3BC9A 3ZL4H 3ZY7A 4Z7UA 3RBGA 5EO9A 5FUOL 5JUEH 3JV0A 3MRJB 1JF6A 1NFDA 4YXKH 2WO2B 4NQDE 1WA2X 3C6SB 4HPYH 4I13B 2AXWA 1GYUA 1U8JA 5BOZG 1ZA3A 4NO5B 4Y2DA 1KBBA 1MJUH 3O4LD 4WK0B 4G7RB 3WE6B 4E5XB 4MA3B 4QTHA 2FBJL 1YNTA 2VDOB 4FXLA 4Y4HC 4PVLA 4ANVA 1LK2A 2ZPKH 1R75A 2FEJA 2DLFL 1VACA 1WZKA 1DUYA 3V4UH 1XCQA 4MA1C 3IJHA 5C92A 5I17B 4P3CH 3BPOB 2EICA 4N0FA 5E2UL 1CF1A 4R7XA 1BVNP 5ENWA 5KWYC 1LHZA 3FQNA 1IQWL 1K4DA 3CVIL 2Z7ZA 5FX3A 1BQHB 4GOSA 2YK1H 4BJLA 4FQJH 4FLRA 4C4KO 3CMOH 2H3NB 1CFQB 3RL1B 4IRJC 3OPZH 4JKKA 1PD1A 1WV7T 2P80A 4WU5A 3B7TA 4AZ8A 2WGNB 4PJBF 2AJZB 1KTJA 4ZO8A 1MHCB 5EZPA 2YRBA 5EBLA 1GPOH 1AKJD 2GYSA 1INDL 5DO2C 1OV8A 5F7MC 2W07B 4HD9A 1BZ7A 1I7ZA 2XWTA 1K3ZA 1XF5A 4XB3A 4LRNH 5D4JA 5D7IB 4E68A 1FL6B 4F80A 1OLLA 3G3LA 3BPLC 3K6DA 4MQSB 1BCIA 1E6OH 4F33B 1I1RA 1I3VA 2DQEL 5GRUH 1E4XI 4D0CB 3IM1A 5GGSY 3STZA 4H8QA 2IO5A 2JLPA 4F15B 2ED9A 4DTGH 4KI5C 1U8PB 1EBAA 4JFFE 1PZDA 3SKOB 4NENB 4PJ7B 5AW7B 5HYSB 4NX0A 3BIKB 5BOJA 1J5OH 1GY2A 1SJEB 3NSXA 1CK0H 1AQMA 3JWDC 1XH1A 5GS1B 2BOCB 4WJ5A 1F5WA 3BFWA 3EF4A 4ZMLA 1T03H 4OCRL 1F0LA 1A4JA 5CMAA 4JRYA 3O2WL 1DQLH 5C0AB 4UV4H 2AXGB 1EO5A 2GQHA 1OTSC 2ITCB 3O45B 4D0DB 1MG2C 4PV1C 4MZRA 3G6JA 5BNXD 1P4LA 2V8LA 4WU7A 5IF0B 1JP5A 3WJMB 2IDQA 3S5LB 2DQTH 1UD6A 1QSFE 3LQAC 2AJUH 3WUWA 2BVPB 1WGOA 2BSSB 4NQDB 4DK5A 4EDXA 4JHWH 5AW1B 3ZL2A 1FZOA 5C0BE 4UM9A 1RURH 1SLUA 3S7GA 4O02L 2WINA 3LD8C 3K80A 1HXYA 1O9WA 2A4ZA 5JW4Q 1ZGLP 1BVNT 2VZVA 3VTAA 4PJ8C 5DZNA 1HHJA 2XLLA 1EGJA 4LDLB 3IGAA 5I8KH 2JSFA 1EXGA 1QLEL 3BGAA 1GC1C 4JPIB 3HMXL 3VWKB 1J87A 3NJKA 1M2OA 1A21A 4LVHC 2BY3A 4Q0XL 1YYLH 2JB5L 2ZOTA 4FXKC 4E9SA 1OTTC 2APSA 5DJZA 5KSBE 2CG9X 5I19H 3CFQA 2E56A 4JRXD 1SRDA 2C26A 2P52A 1TEGA 1QFOA 4NC1C 3PQYB 4P5TA 4J28A 3D7PA 4TOYH 4I2XA 5F9DC 5E8OB 4DPAX 1E30A 1MWAB 3IDYB 3VXSE 4NLHA 1DQDH 4IKJA 1UWEL 2GUOB 2XJLA 3DC0A 4PV8B 3L8QA 3FRUA 1A3LL 2CCWA 3U0TA 3VFUB 3PJSA 3OKLB 1XSOA 4S2SA 3FU5A 4XO5A 1HL5A 3TXAA 2YPLA 4OF8A 4TPRH 5B3SB 2WBJD 1T6BX 2GITA 1F3RB 3VRJB 5IMMA 4YDKL 1EJOL 1S7UA 2N7SA 2YEZB 4ATWA 1WJ3A 4RQQB 3ZUCA 1WFJA 1MH5B 3I74A 3V0WH 2NY2D 1PCXA 2QL1A 3NACH 4LSSH 1OQXA 3KS0J 4MMXC 3T8MA 4PJ9D 2XG5B 4U7SA 5LGKA 4JFFB 3EDKA 1GSKA 1RZKL 2XTLA 1UACH 2J5LC 1OANA 2QVTA 2DYRB 2N7AA 4LSQL 3MLWH 5JDSA 3V0VB 2F54A 5E6IB 3M7OA 1CQKA 1T83A 2CUIA 1PAZA 3QHZL 3WEXB 1WUZA 1BGXL 3O8XB 3K4ZA 4HC1L 4CSTA 1R3JA 4OCLC 3MRPA 3QQXA 4L1DA 3SE3A 3FT4A 3FZUC 1YQVL 1MZYA 1V10A 2ILLA 2XG4A 4JQIA 3PREA 4MHHG 4KAQL 3BGMA 1VGKB 3C08L 1OF0A 1QSFB 2NQ3A 2VLKE 3UZQB 1NC4A 4BFKA 5HYQB 3OGOE 1N0XH 4JZNB 4BHUI 2DQUH 3EFOB 5F7BA 3JZYA 4L37A 4KROD 2BNRE 2YSTA 3BDBA 5SX5K 1NC2B 5F6IC 1U93B 3WFBH 3DX7B 1QSED 3HIZA 2A7BA 5I0DA 5ADOH 3QDMA 5C0BB 1NFIA 3FHEA 4E2OA 3SGJA 1P1ZB 3LY6A 5CR8A 4GQ9L 5F1NB 3NOIA 4YEEA 4WNJA 4E9QA 1M9WA 1X5XA 4OI9A 5D8JH 4HUXA 4YHIB 2X05A 1FRGL 1HQ4A 3BP7B 4N2CA 4X98A 5HJDA 3HUJA 3BPOC 4JFVA 4OU3A 4X5XB 4GAGH 4H26B 3QGVA 3FJTA 1F56A 4HMEA 3BWSA 5JQ6L 4W9CC 1J8RA 4NKOA 3SBWA 4O00A 3L4WA 5KSBB 2ZYIA 1P4UA 3TV3H 2QLYA 4LSUL 4M7JH 5F9JA 2ZKHL 4AVIA 2V0AA 4XVOA 3L3IB 5IP4A 3VXSB 1JGVL 3U9UB 4GBXD 3EJTA 4YC2B 3HR6A 4XBGB 32C2B 3WJJA 1PZSA 5IB4B 4NEHB 5BS0E 4MJ4A 5TQ0L 1AS7A 3D3VA 4L9DA 3ESVF 3T8XA 4WEEA 3SPIA 3UCRA 1U8IB 4LFHG 3KPSA 3QR1A 4R4FL 2AJXL 1W72B 2ENSA 3K2MC 4GKZA 3KPRA 4AGOA 4LGPB 4F15C 1FORH 1JPFA 4L3CB 1U95A 3QUMH 1H8OA 1OP4A 3WELA 4RA3A 4I4WA 2CJSA 3Q3GA 3VFSB 1EO8H 2CDEB 4RAVB 4PJXE 1L5GB 1U8NB 1H3VA 4LO9A 2NNAA 4QRPA 5T1LB 2W38A 2XNAB 3WFDL 4GRMA 1ZIBA 4XNZB 2E9GA 2Y24A 3QXAA 5E2VH 4NNXA 4U3SB 4DP8X 1E28B 4G6FB 2IMNA 2F5AH 4H0IA 4JFQB 3JV6A 4NQED 2X4NB 3U7YH 3CZFA 4KJWD 3MV7E 5BUGA 1YUKB 4LCCB 3HRZB 3D4GA 4KNUA 3WJLA 2DWXA 1IV8A 3AXIA 4X5WB 1UH2A 4R96A 3KG5A 2HT2D 4Q9CA 4QHLA 3WNLA 3CLEH 4PWJA 1CL7I 3GSUB 2ZCLL 2H9GB 4Z7NB 4H8WH 3GQFA 2Q3XA 5BO1L 1JD7A 3QEUA 3EH3B 4UTBA 1DANU 3AITA 4K73A 1LK3L 4BQ6A 3HBQA 1NCAL 4PJCA 1TIUA 2G4GA 1WZ1L 4GINA 2BNRB 2Q86A 3VYOA 4Y7MA 4XWGL 2BSRB 3WNJA 5H94A 4N86A 2AI0L 4LLDB 5E2TH 2PF6A 4JAMB 2AK4A 4PRPA 1JF5A 3KPQB 3UH8A 3MV11 3VWKC 5ID1B 3SOBH 1F11B 5I66B 1WO2A 2VW7A 1L4IA 4Y4FD 1AKPA 3LZFL 1CDGA 4FHKA 1QOKA 4M6AA 4OLZH 4U1HB 4X4KA 4YGVB 3L4VA 2QMJA 4FCHA 4FTVD 5SX5H 3MRLA 1T1YA 4HIXH 1NEPA 5AAWA 5E00A 1OWWA 4ADIA 3GNMH 1AJ7L 5GGQL 2DV6A 3AU0A 3DYPA 2P5WE 1THAA 2JELL 5TPWL 4ALAL 5D6DA 1U2HA 4J3UA 5DDHA 3VQLA 4DHLA 1NAKL 4G6JH 3ABGA 2KI6A 3KLKA 4J8RA 2ID5A 4JR9H 2L3BA 5BS0B 3IDJB 2HH0L 4MDJB 3OVUB 3PFUA 3QQ3A 1ADWA 3EYUH 4UBDC 2KLSA 2QSCL 3LZLA 4HWNA 2G2NA 3U4KA 2WLJA 4TNEA 4Z7QF 1KELL 1DO6A 3R1GH 3B2VH 4LOUC 4CMMB 4L5FH 4ORGB 4RFOL 1ZV9A 2ZOWA 4P5SA 1VFAA 4BUHA 4X7DC 5CD5D 2P44B 4PJXB 2KKQA 3L08A 5IBTH 2B0SL 1HOCA 4NOBA 1EANA 2HLAB 5E6IC 3V6OE 4TV3A 5KBMA 2YD7A 3LRLA 4NUGL 4FNPA 3MV7B 1QZNA 1CYGA 1C8PA 3KWVA 1OARL 3FT3B 1QTPA 5IHHA 5LJYH 4J23A 3SYAA 1DQJB 3UO1L 4QRQA 1N2RA 2UWEE 2OMVB 4K0OA 4U0RB 1WK0A 4NWTL 3QUZB 5KSUA 4FOMA 3UTOA 4KKCC 4OLUL 4B60A 3M45A 3ZRCC 1FVEB 3E9TA 4KNQA 4BCYA 1AY1L 3CFJA 4QXGL 4APXA 5KVDE 3Q1SL 1Z5HA 3HNSL 2ZG2A 3TURA 4APQA 4ETQA 2NY6C 5CIPA 3CFNA 3VGFA 1XGRB 4PI0A 2HJKA 1EGJH 1JZ8A 4QI3A 3CDCA 5F8QC 5LNGA 3GMNA 4HDIA 4L1BA 3BEVA 4GUQA 3HBGA 4L1SA 4UOZA 1KBGH 1FN4A 1I7UB 2ERJB 4PY7A 1YEJL 3FFDA 3LVTA 4E9YA 4RDBA 1BQUA 2VR4A 1JZ4A 1KIPB 3TTYA 3MGAA 3SDDA 4JJHA 3BXNB 4WUUD 4R4BA 1AD9A 2XFGB 4XN4A 3QJXA 4L8BB 3U1SL 1WWAX 2CGZA 3MDJA 5K1JA 5CM1A 1TF4A 4U6XA 4G9FE 2AK1H 3P4MB 3HG1D 1CD9B 1O6VA 1KCSL 3LPOA 4L8DB 3IMSA 2CDGA 2P5WB 4I88A 5FV1L 2VNCA 4L4VA 4N28A 1UD3A 3K71A 3GZKA 1NCUA 4JFXB 5FXCH 2QQKH 3T0ED 1I53A 4AE0A 2F61A 3UGEA 3O3AB 2A74A 1QFWH 3MV8E 3CLWA 5E8NB 5I28A 4YH6A 4IGBA 1OHZA 1KB9J 2PYEE 2CBMA 3WD5L 5AUMB 4AYEC 4TSAH 3UDWA 4KRPD 3LZNA 1DO5A 3WE1A 5KW9H 3GMPB 4M1DH 4UAHA 1S6NA 1U8KA 4XNZC 1IE5A 4ZNCD 3FULA 4YDVA 3SQRA 3M07A 1DN2A 2ICWI 3L3DA 4FQQB 5DXWA 1TYEB 1G9MH 2JJSC 2VQ4A 1W15A 1OPOA 2NQCA 2XU9A 3NJXA 4M5ZH 1FFTB 4NPKA 3OTTA 4LCCC 3ES6B 3HRZC 5B39A 5CILL 4ANUA 1WFNA 3VGHA 2VDRL 4YBQD 3GZQA 1UUNA 4E9TA 2FO1A 3KLLA 4EVNA 2FT8A 2CJUH 2WM0A 3E1ZA 4BK8A 4MNHB 3NFNA 4B50A 2UWEB 3BUIA 1JGEA 3P4NA 3TJEH 2X4QA 1MIML 1JYXA 3PL6A 2GTZB 1HHKA 4JFPB 3EDJA 1UOLA 1YNKH 2BIMA 2JFCA 4AQEA 3UBXA 3VM7A 5EA0H 2EDDA 3ZQ9A 4BWTA 2QGDA 5IQLA 3O11A 1HILA 3EO0B 3GHEH 3LKQA 4XBPA 2XIIA 4NO0D 4F7PA 2FL5B 4AQOA 1WLHA 3N9GH 4H25B 1KV7A 4MVBC 2IFFH 2FB4H 3IAGC 1YMHA 1J5IA 1K4CB 4AX3A 4HMCA 5DJ6B 4P5RA 1CE6B 4BCXA 3INUL 1NDTA 1SXBA 1DBML 1EFXB 2A9CA 2YD3A 3V4PA 4A2EA 3HS9A 1ITBB 1J9SA 3N1GC 3WCYA 4PSPA 1AGBA 3IAQA 4KH9A 4G9FB 3PXHA 4H1LG 4HIEA 4JE4B 4LASL 4OIIL 4P4KB 5I1GH 1TT6A 2ARJA 4XCEB 5EZOL 4N0RA 2DI7A 3U7AA 3CDFA 4YSRA 3QDGE 3K1KC 2ATPB 1FFPA 1JMZA 3TEXA 1U8HA 5K9QG 2Q7YA 4J3SA 1WSST 3QFDA 5E03A 4QXTA 1XAKA 4OCYL 4LMQI 3F5WA 1MCRA 3LZOA 3NGBB 4NWUL 3QC5X 1VSCA 3QI9D 4Y9EA 4M8QA 2HTKD 2WWMD 4PP2B 3MV8B 3BVNB 4UMSA 2YFOA 4HISA 2GCYB 1B9KA 3CSFA 2PYEB 2E9WA 4M4PA 1EX0A 2M26A 2YZ1A 4MJIE 4WW2F 5GRXG 5LBGA 4MX7A 1MRFL 5GS0C 3S88L 5FA3A 3DURA 2PPAA 3ZKMC 4A2LA 2MCAA 4ERSH 3CFEB 3FTSA 1YNLH 4BXVA 1XD0A 4POZC 1IX2A 2H8PA 3NCFB 2XKNB 5FS5A 4LHUD 2NW3A 1AANA 4YSCA 1FPTL 2LGNA 5I0ZA 4PB0H 3QH3B 4LCIH 2CQVA 2VUYA 4GRWF 4JMNA 4KTGA 4OV5B 1E2VA 1E42A 4OGXL 4YOKA 1J8KA 4XPFH 1U3JA 1N8OE 4IBQA 4U0RC 2MKLC 3MRGB 3RPBA 5C7XL 3QUZC 1JTOA 3DTDA 2NDFA 2JKXA 3L9BA 3S8FB 3TH2T 4LLUB 3QYNA 2NY5C 5HGAB 1D7FA 4UTBH 2XWJB 3HZMA 3QS3A 3VVWA 3A6BH 1SBSL 3D52A 1EXHA 3CVHB 1N6QL 1OZUA 3EYOB 1VADA 4BQCA 4ZUVB 5D72H 4Z6AT 5IBLD 1RZQA 1F45A 4HHGA 5C0GB 1XDTT 2W9EL 5CAYB 5I8CA 1U8QB 4JY6A 1GGBH 4Y1AA 3QIWA 2GJPA 4L3ED 5D70H 3VYNA 4P2RA 1A6TA 1D6EA 4WW1B 3W81A 1FG9C 2ZOLA 2Q8BL 3IDMB 2KZ1B 2D73A 4XRCA 2DWSA 4IOIA 5HI3C 4X6DE 2CO7A 3OB0K 1GXEA 3VACA 5MP6H 1B88A 3T4YA 2QR0B 3OKYA 3PNWB 4J3TA 5EFIB 1GA2A 3DMMA 4JO2L 5C0FB 3A6CH 3EH5B 5ILTH 2QGBA 1TMQA 5DRNB 2C9UA 1SJHB 4JPWL 1PAMA 2DTMH 3V0GA 4AJ0A 5EF2A 2FUQA 2O4EA 3GJFB 3BE1L 1TJXA 3S6CA 3V4LA 3TCLB 2FK9A 1HU8A 3MMEA 4RMVA 1FCCA 4FZEL 3JWOH 3O6ML 2A77L 1Q9LB 3QDGB 43C9B 3LZPA 1TETH 3QNXB 5IFAL 3GSVB 4XP5H 1FNSL 2TSBA 4OLYL 1IGJB 1U41A 3D5OF 3SGKC 2XZAL 1I7RA 4N8VB 1PEWA 1RU9L 4LCWB 4YHKL 1WVZA 4GW5A 4MZ3A 5HHOE 4DZBB 3ZMNA 3EGDA 3NVQA 3TGXA 3L48A 3D0VA 1TMCB 1JGLL 2A6JA 2QADC 2YZ8A 4MJIB 3V0FA 1CZ8H 1KTLB 1M1SA 2CO2A 2EIDA 3D07A 3QQDB 3RWJA 1B4JL 2E4FA 1UCBH 5EO1B 2AXFA 2R0WL 3NN8A 1B4RA 2WXKA 1N67A 2NRDA 3HW7A 1WAAF 1Q0XL 3V6OC 2OR9H 5C0IA 4M3HA 2GPZA 2FX7H 4AL8L 3SQOL 4KWUA 3FO0L 1RFDL 1XB6A 1E4HA 4DGIH 2FNBA 5AOLA 1N5AA 3OHXB 5D6CA 4HKBB 5L7XH 3QIBD 2JJUA 3T3PF 5EU5A 1O6SB 5E99L 4KNTA 3CN3A 4D2NA 3UOAB 3D34A 5DTFA 4NZTH 1UHVA 2H6UA 1BZEA 3TS8A 1FGNL 3QUHA 5DMKA 3ZK0A 4F91B 1XCTB 4YHML 1WEJL 1MFNA 1T22A 1QASA 3RY4A 3MGTA 1TU2B 2A6KB 5D96B 3FUIA 2DN7A 2J2ZB 4TVPH 4MQTB 3V9FA 3VQ2C 4FQLL 3KWTA 3P9WB 4AG4L 4QXVA 2MKWA 3C8KA 5C0DB 3N85L 2VW4A 3MJ8A 4OZFG 1JWUB 1KPVA 2BNUA 5CBEA 1VFBA 5FCUL 5B7EA 3FTZA 3UTPD 2W0LA 3UTTD 1FG2B 4BA8A 1K8DA 3K6SA 3RA7L 4HUUA 4CBZA 4ICWA 3DJZA 2AQTA 4LGRB 1ED3A 1ORQA 1HL9A 1DL7L 3MNVA 1U92B 3T1FA 3TT1L 4AYFA 3IGLA 2CO1A 1HCVA 4KH2A 1HSBA 4P4KC 4GG6A 2JCWA 4AIOA 5HD8C 2XBDA 1MFCL 4NNPL 1G0YR 4JRLA 3IFNL 2CBQA 1IFHH 2JQMA 3OB0H 3IXTA 3GKWH 1S46A 1KLUB 3RRQA 3NGBC 2VO8A 3MOAH 3QDJE 5E8EB 4IBTA 4WIQA 4YLBA 3S96A 2JTDA 2J73A 1K8IB 3GMRA 1JI2A 1Q72H 4PTUA 2OL3L 3ARFD 4DH2A 5C2BL 3ZDXF 5GXBB 1HH9A 1Q9OA 2V2WA 1YC7A 1DP0A 1XZ0A 3BH8A 4N5UA 3QJQB 3K6NA 4YGAB 2XPYA 5I1EH 3V7AG 5HHOB 2ZUQB 1P4BH 3FCSA 3O6KL 2R51A 1AR1B 1BBDL 3BP5A 5D1QA 4RX4D 1V7MH 2BSED 1A6VH 3HHRB 4OUUB 2D7TH 3OLIA 3QJOA 4L9LB 4QF1A 5GJSH 1YG9A 4LARH 4CAGA 3AS1A 2WWOA 2Y07H 3FT2B 2JJWA 3FT1A 4K3EL 4X50A 5E7FA 4ZMTA 3MBEB 7PAZA 5C0EA 3NUKA 3QAQA 2FJFB 3JYBA 3LCYA 4WHDA 2ZOUA 1DBAH 1TNNA 3LXAA 2J8OA 2MSPA 2XXMB 3QISA 1ZEAH 3NA4A 3W9DA 3FB5B 1BZOA 3RDTD 3WL9A 1YDPA 2HRPH 5E6RB 1BV8A 2GC4C 1ZT7A 2NR6C 3NIDF 3A4FA 3B7YA 3G5ZB 2EE9A 2UZPA 3I9GL 2TAAA 2MQGA 1R5IB 1XIWB 5BO0D 1LE5B 1E9OB 4DKEH 3LSOA 3D2UD 2WYTA 3QXDA 2UX6A 5E9DA 2AGJH 1M7DA 2VLRA 4DK3A 4FAAB 3TA3B 1AD0A 4E0RB 4M62H 3Q5OA 4KOCA 2Z92B 2I5YH 3NH7L 4XCFL 1ZE3H 3K72B 3RPIB 1EO7A 2FX8H 3VD3A 1RUAL 1YECH 3KM1A 1UA3A 3EBAA 3DIDA 3NCMA 4IEFA 2GIMA 3SJVB 3MO1A 5C0AD 3HG4A 4X6FB 4J4PC 3BLKA 5EOQL 2WGXA 1M3IA 2COQA 2J71A 3NSFA 4YHZH 3U0WH 1ZTXL 3F04A 4QWWC 1J0YA 4N24A 5LGHL 3O9WB 2CO6A 2XV2A 4XAKE 2PO6A 5SV4A 3S35L 2AC0A 4HW6A 4HP5A 3LXUX 3NJLA 2PNDA 5T5FA 5BMFL 2CUMA 3ARQA 3BPCB 3UIZA 5IQMA 2MPAL 4RDQG 3EO1A 3OXRA 3V4PH 1VB9A 3QWOA 1OKEA 1JGDB 1M56B 4FNTA 2K3HA 3UCQA 4DVRL 4EN2A 4PYGA 2QGEA 1OAYL 2E4TA 2EEXA 3MUJA 1UB5A 4HPOH 4M4RA 3LRGA 4X83A 1RSFA 3RWCA 3SE9H 5IVOA 2J8HA 4OB5L 4QGYA 4KXZH 2APXA 5GS3A 1QUNA 1AP2B 1JRHI 2WVVA 4ZNEA 2BH0A 2YLKA 4XPTH 5JHDA 3VXRA 4YVUA 3MC0A 3BP4B 3FTGB 2BY0A 2WWNA 4UOJA 4HJJH 1O9VA 4P9HC 1CTNA 4XVTH 3CHQA 3L54A 2O72A 3DECA 1EQWA 1RUKL 4HEMA 1NL0L 5HHPA 3RIFK 2CIIB 3PQYD 3UMTA 4JJ5B 1YPZE 3SN6N 3MZTA 3WUZA 5DUMH 1J18A 4FQ2L 1TYRA 2VRQA 4LLMA 1GMEA 1F4WL 4PJHE 1A1NA 3UBXG 4DUWA 2R8SL 3FDWA 1YY8A 1EAQA 2NUPA 3OZLA 4JRFA 3V6FB 5HHVL 5ALCL 3KZ8A 4BFBD 1L9TA 1TZGL 4E5XG 3MLRH 4Y88A 5IMOA 5I16A 1NPNA 4YXLH 4JFUA 4P8QA 2YSSB 1H6TA 2Y4SA 5IESL 3U4EB 4HWEH 3FS9A 3MLVL 3UO8B 5EWIH 4KK5D 3ULVF 4OSUL 2R69L 4IIQA 3IGFA 1L0PA 4E41D 3HBZA 3LH9A 2PPCA 1CN4A 4MD4A 4NIYE 1M1XB 4HX1B 5LB1A 1F90L 4UDTA 1CGVA 2DICA 4WDIB 5FLUA 1Y0LA 1L7IH 5JPNA 4UDUB 1DCLA 2EDNA 3C6LB 4JFFD 1N4XL 2LV4A 1OSPH 1KXVA 1IC4L 2EQDA 4HSAC 1AZZC 5D96C 2BVOB 5ANME 1ZT4A 4F7EB 1P7KA 1RIVH 1DBBH 1AZBA 3DXAA 1JAEA 3MACH 4PCKA 2YAHA 3FQTA 3IFPA 3RIAF 2AZAA 3DDFA 4U3CA 4LPVA 3EJZC 2L7JA 2L8AA 3OMAB 4MD0A 5DURB 3N2JA 4HK0A 1M7IA 4PRBB 3O8XD 1JNLH 4O4YH 5MEOB 5EUOA 4U1MA 4LLQA 3L95B 3KYNB 1KJ3L 2Y5QA 1E9PA 1QMUA 2FJUB 1QSFD 2AJSH 2WBWB 4HT1L 3SYPA 2DWDA 4PW3A 5FO2A 4RH4A 4LLVA 5GGRA 3BCDA 5HYIA 2ZSWB 4TNFA 2XWCA 3VE0B 1W6WA 1NC2D 4LSDA 4YL4A 5AD0A 5HYSG 2FBOJ 2YBGA 3IJ8A 3SCMD 1YEEH 2C4XA 2X70B 2MQCA 2XQYA 4HZAA 4AI7A 1TENA 1D9KB 1C9SA 1CR9H 5C6PB 2BFVL 3N44F 2D3VA 2UY6B 3QPQD 4G8GA 1TLMA 3P2TA 2YARA 4EN3C 3KPMB 1P2CA 4DNLA 1MAJA 1VF5C 2C9XA 1NCOA 4TUUA 4OZHF 3I75A 3EH4B 3T3MF 4J8QA 3AM8C 1AR1C 4O58L 3FU6A 3WTVA 3DV4B 3UROR 4S10A 3PHSA 2ZICA 3S5LG 4G80A 3M1BB 5EF1A 1CXLA 2XWEA 1SQMA 4L9LC 4ZFZB 2G5BA 5DD6B 1FH5L 3MBEC 4DGVH 3VXSD 1TCRB 3MJ7A 3WXVL 4PJHB 2VR7A 3CIQA 5D71H 1AKJA 3BH9A 2XA8L 1V3KA 1X3DA 1EIBA 2AANA 3CSBA 5C07A 2O5XH 1P7QB 3OAYK 5AZ2L 5IT2L 5ABZA 2NY1C 2F8VA 1OT4A 2GTWB 4R5TA 5I1JH 4PRHE 4QCIB 4A7VA 3BCFA 2LU3A 1XIWC 3QEQE 1EUUA 5IGXH 3L3KB 5F1OB 4I18A 5F9OL 5KYYB 4C58B 3C60B 5DT1L 1LDPL 4GEJA 4KY1L 2CKNA 1CJYA 2WB7A 3QXVA 2X5PA 4HWZB 4NDMA 2RFXB 3ARBC 4C4UA 5CJOH 4LIQE 5T3XH 4WVRA 2CR3A 5T1LD 1MF2L 2FDBP 3CH1B 3KPPA 1P5UA 3MREB 4K7PY 1BREA 1JVKA 1JXGA 1PKQE 3EOAB 4G6FD 5IM7B 5ANMB 4O02A 2BCMA 3HI1B 5D7JA 1ETZB 3N42F 1KG0B 1T4KB 4I7ZC 4UQ9A 5DJAA 1A02N 1E67A 1ETB1 5IQ9A 1D5MB 1TJGH 4C8XA 1NDMA 1NMBH 3HMXA 4KKNA 1WG3A 1HAWA 1LO3H 4GKOA 2NLJB 3CAFA 4LNRB 5ICYA 1CLYH 1YUHB 2XWRA 1FZKB 4JW3A 5FIEA 2XACC 1UYWL 3UEQA 3NRPA 5E08H 1KYFA 1TCMA 3F7YB 1J11A 4H8PA 3HFFA 1E4XL 4YBHA 2J57A 1JDDA 1B6UA 4DJMA 1KTBA 2FUTA 3C8DA 2MOQA 3EGXB 5GRVL 2BNRD 5JW4M 3B8YA 3Q2CA 3OKNA 4RBPK 2N3JA 4ZK8A 5FB8A 3VO0A 5I30L 5KSAB 4N1CA 1KOAA 4WLCA 4P3WA 4LSVH 3HS8A 4KTEH 2I85A 3EOTL 4HH8A 4X9HA 2AEPH 3MTRA 3FO2A 3LPWA 2EDXA 3K2KA 2HWZH 3QNYA 2FZ3A 4PJEF 1XR9A 5L6YH 5IEHA 3S3SA 3VRLF 4H8UA 1A5FH 5GGSA 1NOFA 3S3PA 4YSSA 2PCFB 3MSPA 3QZMA 3MRNB 3FH8A 3A67L 4BE6A 2WLHA 1S9KC 4K5PA 2BOBA 1M05B 2DQJL 3IETA 3MRBA 3OG4B 4UCFA 4X4MA 4ZD3L 3DOHA 3IAPA 2Q87A 4LRIA 3HC0A 1XGTB 3M17A 4ZUSB 4EXKA 4LP5A 3GM0A 4HCFA 3I9IA 4KDVA 3RHWK 2OK0L 4JFSA 3WFCL 3U0PA 2LU4A 1CGTA 1QFHA 3G5YA 5IEKA 5I73B 1T2XA 1INQB 1OGTA 2HX9A 3FU8A 2EVFA 1LQSR 5BS0D 2H32H 5GZOD 3QULA 1DLHB 3TN0D 5HHQB 3P4LA 4Y2NA 1DJZA 3AWGA 5TDPB 1CI5A 1OCCB 1H8LA 2WLLA 5SWSD 3V6ZB 4HC1A 4Y9GA 4PRHB 3I6KA 5JZ7C 5F7EL 1LMIA 5E2JA 1KT2A 5ESQA 1HN1A 3D39D 4AIEA 2WBJA 3HG3A 4HJ1A 1I3RA 3C6LC 2VISA 4FULA 3S35X 4Z3JA 4Q6IB 5GS0D 3EG9A 1AXSB 3R8QA 1WC7B 2Z1PA 1NBYB 5E5UB 2MRYA 1S7SA 1TKWB 4R8WL 1TZ8A 3C5ZB 1DDTA 4XI5D 3OAYH 4POZD 2JKIS 4PJ9A 2YD0A 1PKQB 1IKNC 2C34A 5AALA 4NO2B 1X6LA 3F7VB 2NYZA 1RL1A 1Y7VA 2OYPA 5TGBA 4EZKA 2BSDA 1CDIA 3FMGH 4JPSA 2M83A 3P11L 1NCTA 1IKFH 2XQYK 3HE7D 1E40A 3CZLA 4KQ4L 2IWFA 4LCYB 3ECVA 4PJBE 5F89A 4WSGA 3AY2A 5T5FH 1AIFB 4WFGE 3SZ6A 4X6EB 2OULB 1QLRA 4JFDE 4JHVA 4PMFA 5SWZE 3VXPA 3QUZD 2R56L 4BSVB 4L48A 3EDEA 4MB3A 1YMMD 4X7FC 4BUQA 1SJVA 3BO8A 2FWSA 3LV3B 1TQSA 3B9KB 1MFMA 3HNTL 3MBXL 3I02B 2C7UA 4KJYA 3WLWD 4I3GA 2VL5B 1D9KC 1IBGL 3D9AL 4ISVA 1QSEA 3T77A 3D6GA 2VDKL 2NPLX 3QFJD 4AYID 1SFHA 2AJ3A 2IH8A 2WP3T 3PF2A 3RJDA 2JCCF 2KHAA 2P3YA 3CSPA 4MBRA 1TFHA 4FGMA 4OCMC 5L2KD 4PJAF 2X9XA 4OFKA 3QJSB 2ZTBA 5LWYH 2BFGA 3AG1B 4FFZL 5AEAA 4LVOB 3WENA 4RBPH 3AS3A 4HKXB 1E3XA 2PP8A 4Q9RH 2FWOB 4TTGA 1W0WA 1N0LB 3V0EA 4LLYA 2X7LB 4YO0B 4GP5B 1G4MA 1KB5L 3K2IA 1S7XB 4FXTA 3U36B 4HUMB 2P5WD 2R2HB 4FMFA 4A2HA 5CF3A 1HWGB 2IGTA 4XVSH 1HHGA 1WIUA 2K1MA 4M7KL 1A66A 2L7EA 4PY8J 4D8PA 4Z7NE 1KYDA 3L3OB 4U1LA 3SQBA 3KS0H 2CCVA 5KS9F 5FUOH 1XGYL 2HX7A 4W1TA 3WAKA 4QHKI 3C60C 1Q4NX 3MRIA 1NEZA 5C09B 2R4SL 4I48B 3RZCD 4YAQA 1A6AA 2FLMA 1R3IL 1V3MA 2P24A 1QI4A 4I0PB 3CCHB 2HPTA 1RUML 4Q56A 3BDYL 4W9FC 5AWNH 4OGAD 3EYVA 4Y7OC 2FBJH 1HZHL 2QPFA 5ESAB 2NY5H 3KR3H 4N87A 2Z8WC 3LEYL 2OTUA 1A1OB 4EOWL 2OSLA 4XP6L 2VITA 3KL0A 4PRNA 3SKMA 2DLFH 2I9TB 3MV01 2BVQA 4XNQB 1ZWIA 3G6DL 4NQEA 3T0BA 5HVHB 3ILDA 4NKDA 2WZ0A 5E2UH 3IMTA 3LZRA 4NJAL 1FYTE 1IQWH 3LDBB 3T1WA 1JZ3A 5ETUB 4PJBB 2K6YA 5KJ7E 4CN4A 3IRZA 3T2QA 3AAZA 3GBDA 2OTWB 5SWZB 3G6AB 5JMOC 1IM3B 5I15H 1QFWI 5CCKH 3RWHB 4YHPB 4KJPC 1MCDA 1H3PL 4ZUWB 2HPOA 2OCCB 1INDH 5EUKA 3JUYA 4K5NA 5KSAC 3CSYB 1F13A 1RVFL 5JW5A 4MCZA 4AVHA 1AIZA 1NFDF 2OSXA 2NXYB 4WFFE 1OAJA 1ZDQA 1UASA 3K1DA 2H41A 2DQEH 5B1KA 3M46A 1SXCA 4CGUB 5CD3A 2WKLA 3MLSL 3T65B 3D25B 2OKMA 4XHQA 1YNTF 5HGBB 4M03A 3RG1C 4Y4FA 2LAGB 2DYSB 5B38G 2V2XB 3AQYA 2EYTB 2FX9L 3K8KA 4FTVA 3LEVL 4BQ9A 1DTUA 1S7QA 1T1WA 3WKMH 4P4KD 5L0QB 1N59A 1EAPB 4GSXA 1I7TB 5A3IC 4OCRH 5I73C 1EVTC 2YPVH 3K6IA 3O2WH 4CW1A 1NJ9B 4IRSD 2FECI 1JGUL 4UIMA 3V0AC 3CE1A 3L4YA 1JUFB 1IT9H 3P9LA 5H37G 1KXQE 1GYVA 3US1A 3LTVA 2WZPD 2CKBL 4W9HC 2OI9C 3FT9A 5ICZB 1D2OA 4UOW0 2C9PA 2FBRA 1Q9WA 4D9LL 1Q1PA 4ZAKC 2Z4QB 4AJVA 3VXTB 3FTWA 4Q6IC 1MXDA 1HH6A 1JWMA 5CEZE 4AC2A 4HALA 4W4OA 1HCYA 5MENE 3PFQA 5EZIL 3R06A 1UM4L 2HG5A 3O3BA 4HJGB 4I85A 4XMWA 4CMHB 4ZX6A 2P8PA 4F5CA 4PREA 4L8SB 1XBDA 4O02H 5FYKE 4KKRA 2VT0A 1NOAA 4PS7A 5AB2A 5D2NA 3REVA 4DW2L 2XQYG 2BXZA 3T5WA 4JM2F 3P3UA 3BUYA 4M61A 2IWKA 2Y9RT 3A24A 2B77A 1QLEH 4UQ3A 2UX7A 4U1KA 4RNRB 3OZ9L 5CBAA 4Q0XH 2F08A 1FZMA 4G6KL 3IDIA 3LNDA 2PR9A 3GMLA 4GSUA 1S9WA 4BZ2L 5EEUA 2CHWA 3I84A 1U58B 1FYTB 5E8DL 3RTLA 1I8MA 3MXWL 3H42L 2ZUVA 4R2GD 1LEIA 1KULA 2APWA 4J3BA 1DVSA 4TQ8A 5GSVB 2YXVA 1CBJA 3G6JF 3QHFL 5FO7B 1IBYA 1UWEH 2KZWA 4MNQD 4QRUA 1CLVA 3VFRB 4NBXB 4XC3L 1A3LH 4MCYA 3PIQB 4Y5XA 4L0ZA 1MELA 4A6YH 1MY5A 4J4PD 4IJ3B 4FFYH 5F7FA 2DQ6A 1KB9K 3DYOA 1SDYA 3C5XA 5MERB 4FLHA 2XN9E 4YDKH 1EJOH 3RZWA 3WHXB 1IQDB 2LABA 3GS7A 2ISDA 4LVOC 4PJ5E 4AIXA 4K5LA 1WBXB 3BSGA 5IMLA 3M6DA 1AGDA 1PS3A 2Q5BA 2XY2A 3TO2A 4LEOA 1SOXA 1RZKH 2FIRT 3O3EA 4WUUA 4Z95L 4P3DB 3PWUB 4LSQH 4R5VA 3OWEA 5IVXA 1MFUA 5DHVB 3HBPA 3GSOB 1IB5A 3PP4L 1U3HB 4AW7A 4LBEA 2EECA 2VXQL 1NIFA 1QVOB 3HG1A 4LL4A 1EZLA 2JQZA 3DSNA 3QDGD 4K7PX 4P4RB 1UUSA 1RK0A 4GXUN 1IAOB 3QHZH 4N2DA 1VZGA 1BGXH 1MPAH 4PJGA 4EI5B 2NZ1A 4G82A 4HC1H 1MFBL 3MFFB 3H9SE 4LCWD 3TO4D 2J8UA 3TBBA 2WKOF 1Z6JT 4KAQH 1G7LB 3C08H 3FQXA 2J88L 4NT6B 4C83A 5I8EA 3QQ9C 4MJID 5I1HL 2OR7A 5C0CE 1TTBA 5D7KE 3CFDB 2WB1A 2WCGA 3RTQB 3U2SB 4CSSA 5MENB 1HYSC 4Z76A 3GJEA 3NZ8A 3TBSB 1AGCA 3VD7A 1KDJA 3LKOB 3QO0A 3QORD 3WNPA 1LLAA 4BA0A 1FRGH 5J1TC 2XPZA 4QY8A 1OK8A 2P5EE 5EULV 1ZLWK 1EHNA 1JPGA 3PWLA 4LHQB 4N0CC 2W9LA 3II3A 1XB3A 3CN2A 4K15A 3LDBC 3ROLB 1PZ5A 1NUFA 2LHAA 2G9KA 1F86A 2VLLA 4OZGA 5JQ6H 1AQHA 3RWGA 1JZ7A 1X44A 3Q1EA 3G7TA 4YZWA 1G6VK 4JBSA 3DO7B 1VFOA 5HI4D 5JMRA 4JG0L 1Z2KA 2Y7LA 4LSUH 4KITB 1WIOA 3IFOA 3QRBA 1K2DA 2ZKHH 3HR5B 4TNVK 1M2VA 2B59A 3MAWA 4H13C 1H0DB 3VG9B 4S1DC 1JGVH 1A25A 2VYRE 4W9DC 4LOFA 1QA9A 3LN4B 2QPUA 3UAJC 2C3HA 3H6JA 2NXZB 1IGIL 3W11D 2B1OA 4FFWC 4R4FH 2AJXH 4Z7QE 1OGSA 4Y4KA 5CGYC 3DRQA 4NO0A 4A39A 1I9JL 2F7OA 1COBA 4ZJ9A 2XN9B 1CICA 2ORBL 2NTSP 4PJ5B 5LO7A 5FA4B 2VDQB 3L3GB 1FC2D 1RZJL 5L0QC 3HUJF 3WFDH 2D2OA 3CK0L 3ZO9A 1I8UA 2MTPA 2NYKA 5EBGA 1DDHB 1PMYA 1TPXC 5IK3B 2WQXA 1IEBA 3PWJA 4W6XB 5LNEA 5EOCL 2Q76B 3GS4A 4BZ1H 3EOYG 7TAAA 4P04A 4DP6X 4P06A 1MAKA 3GLZA 4GQPH 3H9SB 2UVEA 3FUEA 4YX2L 3PDDA 4U6YA 4FMKA 3QI9A 3D33A 15C8L 1D6VL 2B1HL 4ODUB 4HCRL 5BO1H 3D18B 3CFKA 1A7RL 4CMHC 1BZ9A 2NNCA 1B90A 2EDRA 5C0CB 5TE4L 1NCAH 3BD3A 4LP8A 1WZ1H 1MHEA 4N2IA 1IGTA 1JL8A 4XOBA 3RX8A 4XWGH 2G5UA 1CIDA 4OIAA 4MMZC 1L7TL 5MHSD 4PGCB 2OMWA 5BRPA 5IR1B 4AEIL 5ANHA 2G60H 2JK5A 5IB1B 1YEWA 4LHUA 4MA8L 3GXMA 3TEYA 4JFYA 1QBML 5FYJE 2P5EB 3LZFH 4KHXL 4QO1A 2YAEA 3O6LH 1XIWD 3KVDD 2FIKB 3K91A 1EEUA 4GIAA 4N8VG 5CS7A 1AJ7H 2VIRB 5GGQH 3TA3D 5G5DA 3SD5A 1IJNA 1KXTB 1FVDB 5J56B 4XP1L 1ZLWH 3CFUA 3MR9A 3WY3A 2JELH 2IPUK 2UZXB 3AACA 4JFEE 5DZAA 5TPWH 4ALAH 1A6WL 3D0LB 2SEBB 3SJVD 2E7LC 3OB8A 2XXCB 1II4E 2W88A 1QFUL 1U33A 3L7FA 2YA1A 4FLQA 4IJ3C 4XN9A 4QLWA 1NAKH 5F3HB 1LP9A 1CPUA 2E76C 3FF8A 2QVMA 3O9WD 2EKJA 1KCKA 4L3EA 3DV6A 2YD4A 4PGZA 4DSYA 4AQAA 4Z7QB 2QSCH 1E27A 1F41A 3U4AA 3NJVA 3OAZH 1Q0YL 1RV6X 4XVJL 2ZKMX 2A4CA 4JGJA 4FZ8L 3IXAA 1G7JA 2XFXB 3U9PH 1N70A 4AUJA 4LF3B 2B0SH 3EGSB 2MH4A 2VQ1B 1U3HC 2EZ0C 3MRMA 4BK5C 5LDUA 3AT8A 1AZRA 2DQDL 2LE9A 4AMKL 4P07A 1YZZA 1H9DA 1FAKT 5DJDA 2HSIA 1DYZA 1GZHC 4NUGH 5IJDC 43CAB 4K5MA 1T5WA 2QHLA 1OARH 1T1XB 3QXUA 4BQBA 4HIIB 3UO1H 1HL4A 3BW9B 1J12A 1C7SA 1O75A 3S48A 4AW4A 4F1SA 5JLZB 3IJ9A 1JV5A 4ENEC 4ZUUB 4NWTH 1D5RA 2H47C 2R2BB 4LOVA 3L13A 4RFNC 2AJVH 4OLUH 2F15A 2GK0A 3N06B 3P4OB 4FXGA 1WPCA 2EIZB 2VE6B 3ME0B 2SODB 5DYOB 3SSGA 1AY1H 3WMQA 1JERA 1X4XA 2OXHA 2J4WL 3KGRA 4QXGH 1RPKA 2W9DL 3G5VB 5L4MA 3Q1SH 4A66A 5LUMA 3GXPA 3HNSH 1XSJA 3DKHA 3ZKXB 1O6TA 2OMXB 1FIEA 1NCGA 1ND0B 3VSUA 3MX0B 1ERNA 4IU3A 4EZMA 2IANA 4U1NA 3V4VB 4NZUL 3CHPA 2E59A 4HH9B 5TE6L 3S36X 3FOMA 2QZQA 2C1OB 1IEHA 1QRNE 1PG7L 2QTEA 4IBYA 5IJVA 1YEJH 3OGCA 2V9QA 4KXZI 1PYWB 1WCQA 1SEBA 3I6GB 3LRSA 4IBSA 4N3TA 2EH7L 3LKSA 2BC4B 4KI5F 3IJ7A 3QIBA 4PLKC 1CBVH 1FFNB 3ELAT 3FO1A 4N1HB 3U1SH 4LT7A 2Y5EA 4ZG1A 1T80A 4J6RL 3C6LD 3IT8D 4G59C 1UJ3A 4MXWL 1OTUD 2D03L 1KCSH 4MAYD 4AMXA 4XPAL 2EADA 5EZLB 3UBHA 5I2IB 2XBTA 3QDHA 3T6XA 2NXZC 4NUJA 2L7UA 3DOIA 5J1AA 4WWID 4JO8A 1BP3B 2F74B 2J7LA 2YIHA 3DHJA 4PGBB 2BIIA 2Z93B 1KN2L 4MLSA 2OL3A 4PV9A 4EPSA 1BXXA 1MVYA 1FJ1A 1MNUL 5TK4A 3UTTA 1BQSA 2HMIC 1TITA 1ZLEA 2FD6L 3LH2H 5EBWB 3MRJA 3DPBA 5EOCJ 4EIZC 3CIAA 5AOKA 1SLXA 3DX1A 5BXFA 3H3KA 3NJNA 5H35A 1XGPA 3ZR6A 3CVDA 1ZHBB 4XMLH 4WO0A 4GRWE 2XICA 5IB2B 3WE6A 4YIQB 4O51B 3MRKB 2XN2A 4R90L 3VX1A 5CILH 3K8MA 2VDRH 2IIJA 5JIKA 5HHXL 1MJJA 4MS6A 1KPUB 5DJXB 5F93C 1UCTA 1XH3B 2Y7NA 2EH8L 2R1YB 3CVBA 1PFOA 4OGYL 4QDGA 1MIMH 2WW8A 3ARFA 4U1JA 3ROOB 4IOFC 1P6AB 4J2XA 1WAEA 4Y16D 4U1GC 5AYUH 1BQHA 3QZLA 3FU7A 2H3NA 2Y6SC 5LAXB 5DC0A 4LBAA 5EHFA 1W16A 1MHCA 1R34A 2VN3A 4RX4A 2BSEA 1WBZA 3MOBL 3CUPA 2BO0A 2VDNB 4OKVA 1P7QD 4KKLC 1I9RL 4RDQF 4EO5A 4C4KT 4DCQB 2FEDD 1XF3A 4BWWA 1FL6A 1TQWA 1NCWL 1QRNB 2UZIL 2C1PA 2XPGA 4FI7A 5FO8B 2P8LA 1HNFA 4IHBA 4F33A 2V7HA 2CLVA 1FZJB 3C60D 3BT2L 3RDTA 3INUH 4WY7L 1FH2A 1HIML 2IPUG 2X2JA 1IBDA 4OW6A 2CA3A 5JQHC 2HVKB 1U8PA 3FQ2A 1ZDSA 3ECBB 4OIIH 4LASH 3D2UA 2YPKB 2WY3B 3BIKA 5EZOH 2LR4A 4QYOB 3APCA 1L0QA 4RAUB 4B9IA 4ANXA 3FB7A 4EKXA 5GS1A 4N26A 2CPUA 2W0KA 3GRWL 4OCYH 4NWUH 3UG4A 5FKPB 5TH2A 1G0XA 2Z8VC 1EUTA 4IKNA 5C0AA 3HFML 1T7VA 3DO4A 3ZGIA 3QNZB 2ITCA 3O45A 4KY2A 3REWA 4WW2B 4D0DA 5JIPA 1HVXA 5I1KH 2E0PA 3AREB 3VFTB 1Y1UA 3HPLA 3ECUA 3G5XA 5D1XC 3HC3L 4LLWB 5EOTA 3WJMA 3S88H 2VAAB 4TSCL 2ROXA 3DVNB 4H7VA 1WAAE 1OGPA 1XD1A 2BSSA 4M1GH 4DN4L 2WZ6A 4F9LC 5I1AB 4YSEA 4WCYL 5KSAD 2EIKB 3ARGA 1FPTH 1ACYL 4GRWB 5TTRA 5EIIB 4DESA 2GY5A 4CVWA 1VERA 5IG7B 5I6XC 1T0OA 4N2NA 2GSMB 2AAVA 5T33L 4OGXH 4ESKA 3AGVA 4OLXL 4EAEA 1OAQH 1RZIB 2VLJE 3LH8A 3ZZQA 5C7XH 5J6HA 3HLAA 1T66C 2R69A 3LQZA 3I9PA 4R7DA 1E6JL 2B39A 3RFZB 2NT1A 3WFHB 2X87A 3H0TA 4OFYD 4Y8AA 5CP7B 5SX4H 4TTDC 4QHNB 5F1KC 2A9ML 1WFTA 3GS0A 5DK0B 3H1ZA 1SBSH 4Y5VA 1BEYL 5DZOA 3VFWB 1N6QH 2Z9TA 2PPEA 3ZKXC 1CUOA 4ZFOB 1D3CA 1Q0EA 2KBGA 2W9EH 2ZUSA 3ABKB 3PQYA 5FOBA 4ADJA 4Y9FA 5LBSL 1WCBA 5KSVA 4TQPA 5E4AA 1BYPA 1JPSH 3MVSA 2GUOA 4UU9A 3CMGA 4PV8A 1I85A 5FFGA 4GI6A 1CTOA 4JDZB 3TASA 5AOMA 3RPKA 3V0JA 3VFUA 2H2SC 3KE0A 1FSKB 4QRTB 4M29A 2W81C 5DK2B 2G2PA 2CPCA 2R0ZL 1OAXL 1XF2A 1I8KA 4JO2H 1A7NL 3T0XA 1PL3A 5D7LD 1J9RA 3CDZB 2Q7NA 1URLA 1RZ7L 2A73B 4OUOA 5DEGB 4E41A 2OMYB 4OZ4B 4JPWH 1BJ8A 3MUHL 4RQQA 5E2WL 4A1RA 1LEGB 2UXTA 5AL8A 1UZ8B 3RX7A 3C5ZD 5KYXB 1IAKB 3MLXL 5JDJA 2XVGA 2JXMB 4JFFA 1ILUA 1R6VA 4NNYB 3FONB 1C5CL 1EJFA 3BT0A 4FZEH 3TJHC 5HGGS 4E9WA 2A77H 1BWMA 4EJ1C 2ICWB 1MZZA 3ZDXE 2P4AB 4UYQA 4W9EC 5IFAH 4WWNA 3SIKA 2I25N 4R0LC 1RZFL 2NX5D 3MRCB 4XCYA 4OLYH 4UT7L 2XZAH 1QW9A 4Z7OF 1RU9H 3PABA 1HJBC 4HBCL 2F19L 4HAKA 1GIGH 1T7ZA 2WBXA 2ZP0T 2EABA 5IIEA 3O8XA 1UXWB 2WLIB 3ML9A 2XY1A 4J3WA 1JGLH 4JGMA 4JHBA 2E9IA 4ZMYA 1Y07A 2PCPB 1B4JH 5C0ND 4LL1A 2ICEB 1OGAA 3B9KD 4BRVA 2R0WH 5HYQA 4R9HA 3UERA 3VXOB 1N64L 5CLWA 1M71B 1ICTA 1Q0XH 5EDXA 1NC2A 3MCYA 1U93A 5B3JF 4X5PA 4AL8H 3SQOH 3FO0H 1RFDH 3WNIA 1BYOA 1DJIA 4K94C 1JXKA 2VDLB 4M6NL 1P1ZA 4NPJA 4PLOB 3VYPA 1GS8A 1J9TA 1HEHC 3CDYA 5IB5B 3SCMA 3T3PB 4JL2A 1NIEA 3MJGX 4F8OA 4FABL 3E7JA 3H4FA 2ZSVA 3FQRB 1SM3L 2VERA 2AKRB 5E99H 3NCCB 3TF4A 2VW6A 4X4YB 2VLJB 1PG7X 3OKDA 4BH8B 2Z31B 4KKBC 3CHSA 3FHQA 4YWGL 3SGDI 3PAZA 2Z7UA 3JXAA 1FGNH 4GW1B 2IGLA 4XMKL 4YHMH 4BELD 1WEJH 3CZUB 2VERN 3S4SA 4JY5L 3TBWA 2BDNL 2YLHA 7FABL 1ZANL 4PU2A 3B3BA 4WAFA 3O6FB 2HZHA 1SJXA 4FQLH 3N85H 3PUCA 1XGQB 2VC2B 1F2QA 1AMYA 4FNRA 4C4BA 3QHTC 1BIIA 2PTTA 4FG6D 4P5KA 2K0RA 3HZVA 4P2OB 5FCUH 5GGVY 3GMMB 3U9UA 3ILPB 3VXSA 1CFBA 1ETJA 3KEHA 2VDMB 3NRFA 3RWEA 1NUGA 3CFMA 3RA7H 5C09D 3TWCL 3Q8CA 1MKFA 4GYBA 5JQIB 4OCNC 4CKVX 4OF6A 4ZPTB 3VDBA 5E8PA 1JTPA 2QQNL 1DL7H 3NIGF 4I0PD 4BE5A 5A6MA 2W65B 4BKLA 2WTRA 4AJWA 2IG2L 3VFSA 2CDEA 4PG2C 2C9AA 2VSDA 1MFCH 2OMZA 4PG9B 1HYSD 1PZ3A 1L5GA 2IJ0C 1HI6A 2VZSA 4ILDA 4XPHL 4XCNB 5T1LA 1GZQA 4YJZL 1LTXA 2A1WL 5IV2B 3TIEB 1JYNA 2VSCA 2XJKA 2PWFA 4JFQA 3ZDXB 1RP8A 3TEWA 3AVEA 2WXJA 3D06A 3KPLA 5I1LB 3ARTA 3K5SA 3AUVA 2OL3H 3QDAA 5C2BH 4PS4L 3AREC 4XNMB 3CTTA 3AW5A 2H0PA 1CF8H 3I85A 4X4XB 3EFFA 5B1AB 2VQTA 2B9AA 4WFGD 5AB9A 5SWZD 4AEHL 3FCTB 3O6KH 1MCEA 4FA6A 1BBDH 3GSUA 3TV8A 1HFUA 3KGTA 2ENYA 4J6IA 4M7LL 5HHNB 4BFIB 4AV5A 2VN7A 4JFHE 4NM4H 3LKNA 2W0FA 4HLZH 2CWRA 1JZFA 4K3EH 4FYQA 4LKXB 4LQFL 4WV1B 2FTAA 4DQOL 1BLNA 2NXYD 3ULVE 2BNQD 2BNRA