3Q06A

An induced fit mechanism regulates p53 dna binding kinetics to confer sequence specificity
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
231
structure length
231
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFVQLAKTVPVQLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKKKTMDGEYFTLQIRGRERFEQFRERNEALELKDAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title An induced fit mechanism regulates p53 DNA binding kinetics to confer sequence specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle/dna
total genus 42
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3q06A00
2YBGA 4AGQA 2AHIA 2BIQA 3Q06A 2J1YA 2IOOA 1YCSA 2AC0A 4AGPA 4AGNA 5AOJA 4IBVA 4L0YA 3VD1A 1TSRA 2P52A 5G4OA 5LGYA 4XR8C 4MZIA 3IGKA 4IBZA 2X0VA 2FEJA 2J21A 2PCXA 2BIMA 2J6WA 1CMOA 3EXLA 4G83A 4MZRA 1EAOA 2X0UA 4AGMA 2ADYA 4HJEA 2OCJA 5G4MA 2XWCA 4LOFA 1T4WA 1TUPA 2WGXA 1UOLA 1HU8A 4L0ZA 2X0WA 4G82A 3US1A 5LAPA 1IO4C 3WTTA 1KZYA 3WTYA 3Q05A 4L18A 2J1ZA 2J1XA 3WTSA 3WTUA 4IJTA 5KBDA 4IBSA 3WU1A 4AGOA 1HJCA 4KVPA 3Q01A 2GEQA 4IBYA 2XWRA 5ECGA 3WTWA 3D0AA 4LO9A 5AOMA 2IOMA 3IGLA 1LJMA 5ABAA 3KZ8A 3D09A 4GUOA 3WTVA 1CO1A 5BUAA 1EANA 1GZHC 2VUKA 4IBWA 3QYNA 2BINA 3D07A 4IBUA 3US0A 1HJBC 3VD0A 3QYMA 5AB9A 5AOLA 1GZHA 4AGLA 3WTXA 4IBTA 1EAQA 3KMDA 3VD2A 3D08A 2BIOA 2BIPA 2MEJB 5AOKA 5A7BA 3D06A 3TS8A 4GUQA 4A63A 2H1LM 2IOIA 2ATAA 2J20A 1E50A 3D05A 3ZMEA 2RMNA 4QO1B 3EXJA 2J1WA 4IBQA 1H9DA 4LOEA 5G4NA 5AOIA
chains in the Genus database with same CATH superfamily
2C4XA 2Z35B 5K1VA 5D7IE 5D6DC 1AS8A 2BRRH 2C1PB 1CLOL 1AXTL 2GK0A 2XJLA 3DNKA 4N2GA 2CBOA 1U93A 4FQCH 4NQCE 4DFHA 4Q9CA 2DBLL 4JJOA 1CGTA 2HX9A 3EYSH 4CMMB 3NQKA 4A6YB 1VFUA 4NT6B 3PWPB 5IHBA 4D0BA 1QFPA 2EDTA 3RVUD 4Y1TA 4YDIH 3FUEA 4IOFC 1LP9A 3IAPA 3O8XA 1U8QA 4GP4B 2GTWA 4HWBA 4U05A 4YFLF 5GRVK 2CK2A 1CFNB 2JKSA 1D5IL 3VU1A 5HGBA 1JNNH 3NMEA 2CXGA 1Q9LB 1IGYB 3GSNH 5E4IA 1K8DA 2V3FA 1JZGA 5TGBB 3BZFB 3UBXB 4FJYA 2G5BA 3BSHA 1ESOA 3F6LA 2OYMA 1T6VN 4JB9H 5BO0D 1DANT 1FYTB 1H3PH 3BIKA 4XMTA 5ISZB 2ATKB 1O7DE 3FTGA 4CKVX 3BPNC 3HC0B 1E9OB 3JV5A 1HHIB 3VXMD 4ADJA 4J7RA 3VDAA 5C07B 1X5HA 4WW1A 3IJEB 4QRSA 1N6VA 3LKPB 3NCMA 3C2SA 2YRZA 3CZNA 4Z7NE 1FDLH 2FD6H 3Q2LA 4KI1A 4O5LH 3GJEB 2QKIA 4Q97A 3QUMH 1JXGA 4L8CA 1YC8A 3GNMH 1ZOXA 2Y69B 4LASL 3S5LB 1YECH 1LNUB 4JFYB 5I1DA 1M7IA 2YEVB 1S7UB 1ZHKB 3QUZC 1ACCA 2FWSA 2R8SL 3PS6A 4M7JL 4P23A 4PJCB 3OHXB 4IQHA 3VH8B 4P5TD 1VF5C 4E0RB 4A37A 1IEAA 2JJTC 3K2UH 4GUOA 3V0WL 4OZFB 2X4UA 4LCUA 4XPHL 3WIHH 5I24A 2Z7ZA 5F6IB 4ZD3L 5K9QG 1I8UA 3BN9D 3VFNA 2KUTA 1BQ5A 1SJVA 3ULVL 1PQZA 4AYDC 5D2NC 1BXUA 3T4AB 2XQ0A 1QBMH 4ODHH 3T8MA 2DWDB 4JDZB 3OGCA 4MKTA 2FIKA 3C8KB 5DMGD 2WAQA 2ADJA 3EHBD 3RGBA 5GISH 2BIOA 1UD5A 3ARWA 1NCDH 1ZWIA 1KCUL 2W0FB 4YSRA 4AG4L 1IGCL 2YPKA 3INOA 2WNWA 1TJGL 3KPNA 4DN4L 5JZ7D 1VRSA 2QADC 4X4ME 4M8UA 3TBYB 4LKCB 5E8OA 1P4UA 3BC9A 3QCTL 5CIPH 1A1OB 4R8WH 4JDVB 2OCFD 2YD7A 3CZSA 2UVEA 5E94A 5DQJB 3QULA 4M61B 1VFOA 3RNQA 1CURA 4ZUUB 3IFNH 3C09B 3FQNA 1A2YA 2NNXA 5DRXB 1VACB 1Y18B 4G8IA 4IU2B 1CTNA 3SDDD 2ZUVA 4UM9A 5DQDL 3BVWA 1SGKA 4NNYA 5DUMH 3CLFL 4X98B 1Z3GH 1G7MA 3V6FB 3B3BA 3DX8A 4NPJA 1RZIA 4U0RC 3O6FD 3FQUB 1NAKH 2BSRB 2E9GA 1J0IA 1CZ8H 1OK8A 3IFLL 1Z1WA 2NY3B 2VWEE 1QP1A 1V05A 1A6WL 2WQVA 1NGPH 2A74B 1Q38A 1QLEH 1X9LA 3QXUA 5ALCH 1HQRB 5DHVH 1X7SA 3FU7B 1NEZG 3HCVB 1CI5A 1OGAA 3N1MC 4Q9RL 5IESH 3D50A 5J11B 2AEWA 2R2HB 2UXVA 4P2RD 4ZUWA 4YDJB 4MHHG 5A1AA 1SBSH 3B9DA 4AYSA 1B0GB 1MCFA 5F72S 4GEIA 3SPVB 3KBPA 3FN0H 4FKEA 1UD4A 2P48B 2Y36H 1OGTB 5C09D 4X5WB 4IK6A 4XN4A 5LN4A 1DVSA 3WELA 4ADGA 1CQKA 1JF1B 4IK7A 4GP8B 1HNGA 4OKDA 5D1QA 1FA4A 5AVSB 5HYJD 1D9KA 4PWIA 1WBZA 5I5MA 4NUQA 1WT5C 2IH1B 2J6EA 1HILB 1E5ZA 4KTEL 3ZPDA 1JNHB 2WP3T 3IDNA 1BZ7B 4LO9A 2WBXA 4G6FD 4U1KB 5IQMA 1PLGL 3ARVA 4FMFA 4ODSL 3IDIB 4H8WC 1HYSC 4PJ6A 1MAMH 1MZZA 5EZJB 3QG6B 1HH6A 1RCYA 3DXAB 4PJGA 1QBBA 3CSGA 3O3BB 3WTVA 1YMME 2XPGA 4BSVA 1QR1B 4UU9B 2FR4B 2RA1A 1MFEL 2YO3A 5DD0L 5CN1A 1RIUH 5EUKA 1CR9H 5I1HL 4Z7UA 3QYMA 4LDEB 4N0YL 1R0AH 4MAYB 1BXVA 3QAZB 4AV0A 3HS0B 1OAKL 1EJ6A 4XNXH 3QQNA 4PLOB 1R1CA 1RK0B 3B5TA 2BS8A 2WLLA 1IEBA 2KMWA 1CLZL 4XXWA 4L9LB 3LNIA 1PU0A 3QDMD 4BA8A 2VLJB 4I77H 3VXOA 4F33B 1SN0A 43C9A 5DEFB 2I5YH 1JWUA 1SQ2N 4LLDA 5BVJB 3L3DB 2VM9A 2Y6TE 1FG2A 1RZJL 5CEZH 1E5CA 1AKJB 4FMVA 2ZG1A 3OAUL 1G7QA 2JKIS 4F7EB 1X5FA 3Q8AA 4OU3A 3IPFA 1K2DB 5AVWB 4Q9BA 4GRLD 4YL9A 1JS4A 5CLZA 3E1F1 2HFFB 3RWHA 4GO8A 1CFQB 4G42A 4PQXA 1HL4A 3QHFL 4P3DA 1SOXA 4YZWA 3QPKA 1G7JA 2W0PA 3ZQ9A 4P06A 1AZUA 1NM9A 1E4HA 2WXKA 5IHWA 1D7DA 4FOMA 5B1JC 1CL7H 2D7PA 1T89C 4P4KC 3A47A 3HG4A 1CG9B 1KG0A 4JLRB 1AI1L 1PYWA 2I26N 4ZFFA 3EF4A 3MOQA 1CMOA 3RGVA 3HA0A 1DQLL 4DETA 1JSYA 3AM8C 4ZFGL 1N6QL 3X3GL 4FE9A 4Q0XH 2X4RA 4YIQB 3ABZA 4EIGB 4L8SC 4ZSOA 5DK2B 5I1LA 4EZJA 2IADB 4GRWE 4YDVB 5JQIB 2CMRH 5EZIL 2W81C 4MQTB 4YPGB 4AZ8B 4WQOA 4J3OH 1YNKH 4ZNCD 3JV6A 1A8ZA 2NW3A 2J8UE 2Y1YA 2FH6A 3NJHA 5INCB 2R2BB 4PJIB 3BJLA 1JHTA 2X4TB 5I1AB 5KEZA 4KOBA 4IS6A 2B3RA 2WZPA 1CICC 3RWIA 1YEKH 4ODVH 3TBWB 1W16A 4U1SB 3LQAL 3M45A 4HXBL 3R7QA 2PO6C 4TYUA 3L48A 1KUMA 2Z8RA 2ZJSH 3FB8B 2QJDA 2BSCA 2BZDA 2XTJD 4N0RA 2PCFB 2CWRA 2VDNH 3TN0C 4JCWA 2AJXH 1FFPB 2FVNA 2PMZA 1D5MA 4TNFA 4KXBA 5GGVY 4C56D 3TEWA 3V9FA 1OCCB 2ID5A 5C0ND 2XPZA 1UWXK 1ZA6A 5BV7H 4EN3D 2WUCH 1OE1A 3Q2CA 4W9ZA 5FOBB 3GMLB 2PLTA 4IRSB 5B4MC 1XGTA 5ITBL 1QBLL 4HT1H 3IE9A 1SPDA 4AK2A 3NSCA 3KD4A 1AE6H 3IJHA 4PWGA 3QXDA 1MCDA 5F44A 1USQA 4G6JL 3LXAA 2G75A 1SUHA 3O3DB 2E74C 5HYQA 3KM1A 4PJAF 4OZ4A 3SCMB 3EYQC 4GSDL 4WFED 4MMXC 1DL7L 4ZTPH 3GXPA 2WAHA 4P2QA 3WKNA 3UBHA 1KJ2L 2ZZUT 4NI3A 2VABB 5EORL 3HE6C 1WVZA 1I1FA 3RWEB 2AXHA 3RA7L 4M7LL 4PU2A 1QZNA 2XKNA 5JLZA 5BRQA 4X8GA 1JPEA 4V1DA 1J0KA 3RDJA 3FQ1A 2AAVA 2XWBA 3ZTJG 2PNDA 4YPJA 4HJ0C 3IXAB 4L8BA 3U0TA 5HHOD 5ESVA 3OR7A 4XR8C 1DQKA 1QTSA 2YPLE 5CKGA 3NZSA 3NH7H 4ONOA 4Q4EA 2VRQA 3OTTA 5MEOA 5JUEH 5JXAL 5EG6C 1BSIA 2CO3A 1KDIA 2Z7YA 1AQDB 2KPNA 3CDFA 3EJJX 1MHCB 3O41A 4TSCL 1N4XH 5CBAB 2LAGB 1FG9C 1MAJA 2RIKA 4L9DA 1AACA 2IPUG 1XEUA 4R96A 4EIBA 4J3XA 3DWTA 2WYZA 4MXQD 5GZOA 4R3SB 1MJ8H 1T21B 1CC3A 2AQNA 3A23A 3FRPA 4I7ZC 4K3EH 1ANUA 2C8NA 3VXRD 2F7PA 1HHHB 1T20B 2B39A 1NFKA 2BVQB 2P42B 4AM0B 3GKWH 4X5LA 1A4KB 1LO5A 3WTSA 1RJYA 2YAPA 1GYCA 3BMVA 4NO0A 1NCAH 3DK0A 3HMXH 5E2TH 4AQAB 1OTSD 5CP7A 1IC7L 5E2UL 1KB9J 4E5XG 1MI5B 2EDDA 3NYKA 3OKLA 2JV6A 5DR5L 3HNSH 1TTAA 3EOYG 3EDEA 1Z9LA 5DQ9A 2DWYA 2PXYB 4F7CB 3NK3A 1OKEA 5F7NC 3CAFA 4HCIA 2JJWA 2JELH 2RFXA 1NSNL 2PTVA 4RAUB 2CPUA 5IW6B 3NAAL 3GS7A 1IQWH 1ITBB 3PWJB 1YEHH 1KJVB 4WGWB 4NN7B 1AAJA 4FHKA 4LLYA 4C8XA 3KE0A 1RFDL 1Z0NA 5KYYB 1GAFH 4QUOA 1A7QL 1UWEH 3QZWA 4DQAA 4FQPA 5CHNA 5CN2A 5SWSE 5E8EB 1MOEA 1KTJA 2XZAH 1L9OA 1P4LB 1USZA 1EAPA 3W39B 4R4FL 3MLWH 3UTZA 1SDDB 4NQEE 1CD9B 1MRDH 3DETC 4X4KA 5IBUB 3WXWH 4HKJA 1OB1A 1XF3B 4M6OL 3OHXC 3WO4B 4KY1L 1BJ1H 1EGJL 3MR9B 5JORB 2EZ0D 5FUOH 3EXJA 2CJ3A 5B3NA 4JFQB 2J1WA 2P80A 5FKAB 3K6DA 4MYWB 2OYKA 2NUPA 5E95B 5F6IC 5C0BA 3RUGF 1N5AA 1G4MA 3L6FB 4FF9A 5F8QC 4JN2B 5E5MB 3F85A 4YVNA 1PNDA 4OGQC 5CF3A 2X88A 5SV3A 2X2JA 3P40A 3VRIA 3DVGB 5F0PB 2IPTH 4JFZL 2Z31B 4JM4L 3T4AC 4ZAKC 4ODXB 1V3LA 1PDKA 3QPXH 4HZAA 4NNPH 5DHDA 2VDQH 3VVVA 4LAQH 1UVQB 1CXIA 5EC1A 3O2DL 4KK8C 2O4EA 4K7FA 2X9ZA 4WWNA 1MCLA 4N2DA 4M62L 1EAOA 2OMTB 1JP5A 4PJBB 1T3FA 3I9GH 5IB3A 1KPRB 5C2UB 3LPWA 2NY7L 2VAAB 3I6SA 3AQZA 2FLRT 1I1YA 4KK6C 1C8QA 4J8RB 1Z9SB 2E47A 2LABA 4ELKA 4MS8C 3C09C 2J12B 1SJHA 4ICXA 4OQ1A 3NEOA 3TJEL 4BFGA 4HHAB 5EU3A 4UOZA 5T1KB 1NC2D 1G6RL 4ERSL 3OD3A 2CJUH 3H6AA 3QFJD 4X8XA 1NAML 3GJFK 4XPAL 5F7EH 5FR3A 4U6HA 4H8PA 2RD0A 1JRHL 3JZ7A 4GQRA 2NY3C 2E46A 4LSSH 1X5YA 3TCXA 2ZUSA 1GGTA 2D9CA 4LEXH 2A74C 5J89A 5E1GA 4NQDA 1A3RL 5F7AA 1PZUB 1S78D 3PDGA 4H1LA 4TL4A 2G3MA 1ZE3C 1P53A 3B2XA 3LRGA 2DIAA 1INEH 1Z3RA 5EC2B 1UQSA 1H8LA 5DFVC 2VXQH 4N28A 4UAHA 3O4LD 3D39B 3OVUB 5J11C 1A7OH 4W9GC 3IDUA 1TQVA 4HCRL 3VXSA 1C1EH 3V6OC 3QUHA 4DCQA 3FSAA 2L3BA 1D5BA 2NYYD 3I75B 2ARJA 3MOAL 3WO3B 5AOLA 2NW2B 4N8PA 5FHBH 1G7IA 4BQ8A 3QS2A 4I2XB 1IBGL 2WTPA 4PEEA 4KBPA 4U1JB 2VLLB 3KMDA 4CNIB 1GW0A 4NZ8A 3UBFA 3EO0A 4N2BA 1BAWA 5D70L 1QSEA 3VNYA 4RA3A 4EAEA 2H2PC 4NENB 2WVVB 5AD0A 4AH2A 4BCXA 2WK2A 3SDXE 3O8XD 1AP2A 2HYMA 5IROD 5D4HA 4JO5A 1JMXA 3QH3B 4GP5B 4JY5L 2KC0A 3TZVB 4X6BB 1UH3A 2UZXB 1SLUA 3QW9A 4O02A 2WXLA 4UYPA 4LDOB 4Z7WF 1VGEH 3R4DA 3ATEA 3KGUA 4KKZA 2A6KA 2NY2B 3WDIA 3ZZSA 1NFIB 1NUDA 4R97B 1BQKA 4F15B 3QO0B 4GBXA 3T2OA 3EJSA 4MAYC 2C9RA 2NYZA 2XQBH 4XC3H 2DTML 3HS0C 2E7LC 5DF0A 4N90E 3Q0HA 5AOJA 1OV8A 2PWDA 3AXLB 2P47B 1H3XA 4FN0A 3PWPE 1P5VB 1KDJA 2A6JA 5TPWL 3PJSA 4C58B 4HJ1A 3OR6B 1B4RA 1A4JA 4ENZA 5LQBH 4QRBA 4P23D 4RGNB 1WP6A 3PFQA 1I8LC 3MRJA 5L7XH 3MYZA 5F9OL 4E9TA 2C4FT 3CXDL 1T4WA 4PJEA 3IYLW 4F1SA 3F62A 4L4VA 3C60B 4Y89A 2J5WA 5ISZE 1RD6A 1IGTA 3LZFL 3QJOA 4LCCB 4HQQL 4ALAH 2AV1A 3DBXB 4KKNA 4XNMB 3TIEB 3B2UC 4GYBA 1L0XA 2EIBA 1TZGH 5C07E 3KS0H 4I8DA 3HRZB 1DFBL 2L7JA 3SJVB 4TVPL 1RLBA 3WY2A 5BOJA 2X9YA 3BJ91 4UT6L 1KB9K 3GI9H 2APVA 5D7IF 2ZP9A 3E6FB 4PS3A 1J9QA 3S98A 3V7MA 4L4TA 4BH8B 3PUUA 4BUHA 4C54A 5CJXC 4AQ1B 2OSLA 4EI0A 1MWAL 3QRBA 5CO1A 4JGNA 4PP2B 5LAXB 4PJCE 3QFGA 4Z3IA 3MLTA 1B6UA 2AVGA 4TUJA 1Q9OA 2H6PB 3EFFB 3NN8B 1A25A 2L0DA 1WZ1H 4G7VH 4N0FA 4DUWA 4ZOEA 3BD5A 3WUWA 3L9BA 5HVGB 5AAWA 5ICYB 4OV5B 1HCZA 4UBDC 4QNPE 4QXVA 3HI6H 4UM9D 3VI4B 3QEHA 5GZNA 3FF8A 3IKCA 3UH8A 2NTFB 4DERA 3CN1A 1I3VA 3BO8A 4P59H 4WO4A 3RTQB 4W9HC 1JGEA 5FS5A 1JGDB 3NFPB 4JFHD 2L8AA 2FAUA 1UH2A 5JPNB 2N7BA 5DD3H 1QLRB 2XOTA 1NDMA 3T77B 3PRZA 4M5ZL 2V2WB 2JNZA 1S7SA 3DMMA 5GIRA 2W07A 5DK0B 3FHQA 4Z7NF 4HLJA 3W81A 2QGBA 4P99A 1XL6A 4HIJB 3EH5B 4KJPC 1OGAD 5JXEC 4GI9A 1I7UB 5L9DL 1ZDSA 3HI1B 3L95A 4W9KC 1PY0A 3VSVA 3RFZB 4F1ZA 4UINL 5EDSA 3CDYA 3STBA 4P0DA 3PXJA 3H9ZA 5L2KB 4XBGB 4IKLA 4K8RC 2P5EA 4HUXA 3P3TA 4YVUA 5GGRA 1H5BB 3FT9A 2OK0H 5E2JA 2WO2B 4CJ0A 1Z66A 4K23H 1MCCA 5D55A 3IGUA 5L4IA 2QQQA 3IAQA 5I8KL 1SHMA 3D5OF 4IRSC 1P2CA 2EDWA 3NABL 5D1QD 1K4CA 3NSFA 4JO2H 4F7TB 1JZ4A 3DUSA 1D9KD 3RVUC 5B39G 1FZJA 2DN7A 3GHBL 1KXQA 3WS3B 4JZNB 5IP4A 2PPCA 5IUCA 5HVHC 2HRPL 5EWIH 2KQMA 1J9CT 3BZDA 1MRCH 3QJZA 3MRKA 2DTSA 5E8NB 3WNLA 4MSWB 1NCTA 3PGDA 2W8CA 4OCXL 2VJ8A 2GJPA 3BD3A 3SCMC 2AEQH 4NHUA 1NGXB 1I8IA 1RERA 4A2LA 2HH0H 1JV2A 2VLKA 5FO7B 4NDMB 2F54B 2ZXDA 4PRAA 5FA4B 2OTWB 2DW5A 3V6OE 2JJSC 3WFCH 4GQ9L 4HLEA 1MJUL 5AZ2H 4LGSB 5C0AD 1IU1A 4G82A 4XMKH 5DC9B 4AJWA 1QASA 3KXFA 1WCQA 5ERWB 2EVFA 4UTBL 4XX1G 4AKOA 1FI8C 1RP9A 4BFKA 4AVHA 5TE6L 5LBSH 4WTZA 3CFJB 1TVDA 3C6LA 3HZKB 3IPBA 4WFFD 1T1WA 3U7YL 5I1JH 4RLDA 4JHUA 5LBVA 4EN2A 1MREH 4XI5D 5IQ9A 5CFAA 1SF5A 1PG7W 5BO1L 4MBOA 3O3AB 5BMFL 3D0AA 3CNKA 4MS6A 5HDQL 1V3MA 1OAQH 4ZXBA 4Y4HB 2YPVH 1B4JH 3IGLA 3KJ6L 1HZHH 1JPTH 4XVTL 2XZCH 2HWZH 3DXAE 1MCPL 4QPEA 2HB0A 5BZDA 1CGSH 1OQXA 1NL0H 1GYVA 4Z1PA 1KXTB 2AXJA 5T3ZD 5B38A 1M1SA 2AV7A 3DX3A 1DSYA 3JWOL 3B9EA 4MD0B 4WFGE 4P4RA 4Y16B 3CPLA 5GPRA 5DO2C 5FDWB 4MMYA 2R4SL 3ILQC 1GC1L 2H5UA 2ZIDA 1B2YA 3P4LA 3QYCA 3R06B 5IHZA 1AOZA 2O30A 1IKFL 4GS7B 1TJIL 3ECBA 3II1A 2NXYB 3W56A 3NACL 2IANB 1T83C 6FABH 3PDOA 4F92B 2YWYA 3OPZH 1BVKA 3BUYB 5DHYB 2UXTA 4GSUA 1WC7B 2XIBA 4H8WH 2VLJE 1HESA 2ZCZA 3QQ9D 4O4YH 3RGVD 2G2RA 4ONHB 5FEBA 2PXYC 4KJWD 4PGJA 2C4FU 3FQTB 3QWOA 3MFGB 2QPUA 3QRLA 1FNLA 3RBSA 3ZTNL 5IVNA 4YBLB 4N2OA 3VGAB 1JK9B 1TCRB 5CM1A 2X70A 1FC2D 2H1XA 4WJ5B 5KVDL 4U6VL 5I5RA 3L13A 5C71A 5AG9A 2H8PA 1HKLL 4GW5A 4XAKD 5D8JL 2DQDH 2WGNB 1UM5H 1RULH 3X13B 4A68A 1CBJA 1FH5L 1MG3C 2AQSA 5DMKB 3ARXA 3OB0K 1WFMA 2FDBP 1NGWB 5C0IA 2IDSA 5CGBA 3RNKA 4L0YA 2WLJA 2BLFA 4PRIB 1AQHA 2WZPD 4KI5C 1LEIB 2C1OA 4FKHA 4FX5A 3SQOL 2JKLA 4UTAL 2WXPA 3PJNA 2JB5H 1N0XH 2VRKA 2W60B 4ELMA 1A14H 4F8PA 4MZRA 1JWMB 3BDYL 2E6QA 1DBKH 1KXHA 3DX7B 3SY0B 4S1RL 3MODL 1NCIA 3J27A 5EBLB 5FKPB 4HIIB 4X4ZA 3NJFA 4M8QB 3WO4C 1ASQA 3HZMA 3LN4A 3M1BA 3M7FB 1F6AB 3KBFA 4YNYB 2FTAA 5DEGB 1E8XA 4ORZC 4RQQB 5F97E 3EKCA 4WHTB 4FTVA 4I5BA 2HFGL 2OXHA 1GYAA 4ZPVA 3GK8H 4JO4L 5I1GL 5DUBA 2Z31C 4TVPE 2V5YA 3M8OL 4P2YA 4ZTOH 5E1HB 5JOEA 1S46A 4PWJA 5AVRB 2F5AH 2BSBA 4KVPA 3BT2L 4X99A 5CD3B 2BP5M 1BVLB 3CSFA 1NC4A 3LH2H 3EJRA 4DPRA 1JYWA 3QXAB 2I85A 1G9NH 4P2QD 3FDWA 1SLWA 1O0VA 1JZEA 1VEMA 5HGAA 1KCWA 1IGML 4LBEB 4GT7A 5MP6L 1MWOA 2ESVA 2ARJQ 4S1QH 3SE4C 1BQLL 3ZIMA 2UVFA 4TTGA 5IQ7L 2WCPA 3LNDA 4M3HA 4FYSA 1QQDA 1FZMA 1ZIAA 3K81A 1C16B 2CBMA 4OF6A 1UOVA 2B2XL 4GRWF 2IQ9H 3I2CL 5A16B 1BQHA 1J05A 1R4XA 3NCFB 5SX5H 3PL6B 3VFOB 3VXPA 2GYSA 4FLOA 3RY5A 1E28A 4OFPA 4BZ2A 4JAMB 3DVNB 2J8UF 3MJ7B 4B9IA 1J5IA 1P9MC 2C9QA 4PJ8B 3LRSA 4ZW8A 3NZUA 3IDMB 3ERXA 3MCKB 1KTBA 2UX7A 4JRWA 3CMOL 1N0LB 4QOKA 1THCA 5TH2A 2PYFA 2HJKB 3MA7A 3AXIA 5I28A 2QR0B 3ARGA 5D1ZI 1SOQA 1O7SA 3PAUA 8FABA 1C08A 2BOLA 3BVVA 3F12A 4MQ7A 5GZOD 4G6AD 2Y06H 5K9KA 3B2PA 2AJUL 1F2QA 3FFDB 5E00B 3U7WL 4MNGE 4GRMB 4P3CL 5HGDA 2HLAA 4I87A 5C0JB 3B9KB 2L4OA 1MFDH 1G7LB 5K9QI 4NO0D 1NGZA 2G2NA 3VO0A 3L7FA 3U79A 3IDYB 1OLLA 2Y72A 5IEHA 5TE7L 1G43A 2NY0B 1XSIA 1SM3H 1AGDA 1G84A 1CIUA 4JO1H 3OXSB 1DLFL 2Y7NA 4FXGB 4U4BA 3BWUC 3QQ4A 3TZVC 3TH2T 2BW5A 1A6VL 2XWCA 4PBXA 1QUNA 1OAZH 1MLCB 1XIWB 4AT6A 5HJGA 3U82B 2K70A 4F15C 5JNYA 4DGIL 4WHYG 5T3XE 1CIDA 5F1OB 3WLWC 3KBEA 4TLSA 2OPCA 5EN2B 1X9QA 1FLRL 3IGAA 3DGDA 3LJ3A 2V9UA 5KBPA 2ZCKL 1U91B 4IJTA 1WWWX 2AJVH 3VQLA 4HOZA 3CZJA 2PUQT 1F4WH 6PAZA 1HEZA 5KVGH 2XTJC 1MI5E 1IJ9A 3OKEA 1SEBA 4UQ3B 4NZUH 4RWYL 5C70A 1GVIA 4ABUA 2I27N 3S8WA 4AQOA 1FNGA 5EU7C 3DPBB 3WG7B 1A3LL 1EZSA 1F6LL 2B8OT 4Q6IB 5IGXL 2P80D 3L17A 4ZFOB 3DBSA 2CUMA 2YAOA 1MEXL 4NZRH 3UYPA 5C0BD 2WTRA 5C0NC 2R1XB 3VM5A 2ZWNA 3HNVH 3PWLB 2V7NB 2CA3A 3GINA 5LGJA 2BO0A 4A7GF 4YSDA 4QRUB 1XHHA 3IJSB 3GGWA 3HRZC 4MHHI 3UZVA 4DP4X 1MQKH 2WTOA 6PCYA 4WDIA 4MX7A 2WBWB 4WLCA 2IJ0C 4ZODA 2VXVL 1FL3A 3CFKA 4KI5E 4WENB 4RX4A 1JYXA 1T5XB 2JLLA 4P49A 3VXUB 1RUKL 3ZLQC 5J6GA 5A7BA 1EHKB 5JO5B 1LTXA 4CVUA 4AQ1C 2CSPA 4QD2E 4AV4A 1UENA 5H37A 3II2A 5I8OL 3PV6B 3C5JA 2AJSH 4BFFA 4NBXB 2ITEA 1KB3A 5KVDE 2QV2A 3GZPA 4KMTL 4N0CD 1ET7A 2GW5A 5C09E 2IXQA 4U1LA 4LSVH 4CU7A 2EQDA 3CV5A 2Z0BA 1GZPA 4A2HA 4IRZA 1CQYA 3SHSA 4Y1AA 1FAIL 5B3JE 1Q9KA 3TEYA 3OAYK 1ECZA 3WFBH 4JM0A 2A99A 2BW4A 1JK8B 4I18A 5F9DC 1PF3A 3RTQC 4DNLA 3MGOB 4YS4A 2AEOA 1BIHA 2DLEA 4KPHL 5E9DB 2PPFA 5GJSL 5EEUA 1U8PB 2FQDA 2A9NL 4NQDD 2AI0L 2NY1B 5DZNA 4PJBE 1S5IH 4OZFH 3EO1B 4EBQH 3DO7A 2D8KA 4X83A 1UYWL 2AKRB 2OA9A 3T65A 1SOKA 4NXSA 1QSFA 2WQSA 3P9LB 4UAOB 3QXTA 1TR7A 4ANXA 5JIIA 1INDH 4DPBX 1XCQB 4XNUH 3AY4A 4HIHA 5IB4B 3TA3B 1H5BC 3BKMH 1CVSC 4S0HA 1XV8A 4FQJL 4XCFH 4M48L 4P5SA 4PLJC 5T5NF 4Y0GA 3VX1A 3MFFB 4L3EB 3AAZB 1F4XH 5I26A 3ZTCC 5BOPA 1KBBA 2BFVL 5BNXD 2YMXL 3WDJA 3QDME 1MFCH 5BVPL 3N1PC 1K3IA 1QSED 3BP5B 3SQRA 4CKQA 2YGQA 1I1AA 2ZYRA 1NBZA 1JD9A 3LMJL 3L3KA 4K3GA 2C9AA 1IKNC 2OMYA 4U4IA 1GPOH 4XVUD 3K0WA 3H6JA 4WTQA 1SN2A 1GGIL 5I0WA 1H3WM 1J1OH 1XH1A 2EDXA 43CAB 4E68A 2ZUXA 1OTTD 3BIAX 1NBYA 3DX9A 2WBKA 5KS9E 2JQZA 2APSA 3IJ7A 4QLRA 3QIUB 1LE5B 5CZKA 1BXAA 3QR1A 3RIKA 1KC5L 4GBXD 3RPIA 1WGOA 2NY5H 4QYOB 4Y2DA 4JFEA 2WWOA 5J13B 4WWKB 4KRNA 1HTYA 4I2XE 3ZBMA 5EIIA 5IIEA 2CHWA 4FQXB 4HXAH 4NIYE 1HIML 3E38A 1SYVB 1JHKL 2AK4A 1MCWM 1JZ2A 4ESKA 1TJMA 3V5HB 3ZRFC 2HJLA 4LAJH 4FC3E 3JVGC 1PZSA 1ZE3H 4WU5A 1CFVL 1WFJA 1T6WA 1J5DA 1EMTH 3L3GB 1NIAA 3P0VH 4XO8A 4Y4HC 2DI9A 3N1FC 3VJ6B 2K3TA 3GLAA 5DRWB 4F8NA 1JRHI 4YAQB 4A04A 12E8L 2H7WA 4XP9L 1F18A 3FOMA 1C5DA 3MJ9A 4L4VD 4CA4A 4UM8B 2BIQA 2G9HA 4BDVB 2IOOA 4Y16C 2BM3A 3K8LA 2WXGA 2GSGA 5FECA 1MUJB 3GBDA 3MAWA 5IFJB 1N26A 2W0KA 3EYOB 4GS7C 3GHPA 2YKLL 2GCYB 4I1RA 2NXYC 4XP5H 4HUWB 4RMTA 3MUY1 4HFWA 2EE9A 2XTJE 2P24B 4L4TD 4Q2ZA 3RI5F 2H2SD 1FFTB 1E5YA 3LEVL 3QIBA 4XMXA 5EU7E 1IC1A 1S3KL 4TNVK 4YBLC 1NLDH 3VGAC 5MEQA 3ZL2A 3ATFA 3SDXF 5I0XA 4P9ML 3U48A 3BE1H 5AW2B 5KYXA 4YMPA 2EYRB 4N2AA 1C7TA 4LVHC 3ZYJA 4ZDHA 2Q1EA 5KAQF 3H9SB 5CP3H 3Q5OA 1MW3A 4AOFA 5GZND 3TV3L 5GHWL 3K91A 2XA8H 3Q3GA 1QVOA 1VCBC 1E90A 4KDWA 2R29H 3LKOB 4L29B 4WO4D 2YRBA 3FFCB 2CGYA 5D1XB 3WLBA 4HWBL 3KDMA 1F02I 1NBQA 1S78C 4N1EA 3IMBA 3DMMD 4WFEE 4PLNC 2DEYX 2VDPB 3PP3H 4GMTH 4AEIL 1VAHA 4LSQH 3RY6C 2BS9A 4HK0A 3BT0A 1KGCD 4CMHB 1T4KB 5D7SH 1YEEL 4RAVB 5HI3C 1TVHB 4Z76B 1A66A 3K71B 3TONA 3ABKB 1OZTG 2NYYC 5DZVA 1AXSA 4OIBA 4GSQA 1NKRA 2P5ED 3WJLC 5LXGH 3HEIB 3N91A 3IMTA 2ZXBA 3G6JB 2K4AA 4MB4A 4HUMB 4K5PA 3VI4E 4KMLB 2QSTA 1SRDA 3W0WB 4XVSH 2F19H 3OLDA 2X6AA 4XTRC 3WTXA 3X2QB 2BVEA 1YHPA 3BESR 1ETB1 2CR6A 2R83A 5GSRB 4AYGA 1JHLH 1OE2A 4PIRF 4LHUA 2GHWB 2VC2H 5F3FA 2XG5B 3BKJL 4PS8A 5IVZB 1IBZA 2O61B 1RPQA 1I9IL 3PGFH 3KJ4C 3CLEH 2DMHA 2DQIL 2FBJL 1A7PH 4PWKA 5JIDA 3ML9A 2BVPB 5K39A 4LOEA 2VLKD 4L5FH 1T7ZA 3TBSB 1U8LA 2HKHL 5JHLH 5LDUA 4QRPB 3GLEA 4PJCF 3Q06A 2LHAA 1GTFA 5DK3A 5DRNA 2SODB 3KXFD 4HKZA 3DJTA 4ZUVA 1WFOA 3G5ZA 5HVFB 1PY9A 4FXKB 2W95A 2IG2L 3MNWA 2FLBT 5JOFA 3EOAB 3GO1H 1A6UL 1CF8L 2X6MA 4QXGL 3C6LD 4L23A 4A1RA 4AENB 2AK1H 3ZTDC 1MJJA 1PZCA 3DDFA 4CDGC 1S7RA 3LEXB 4QNPF 3PL6C 1JBJA 2WNGA 3U6XA 3VD5A 4XNYH 5F9JB 2DQFA 5J12C 1JXJA 2X0UA 3MLXH 4LLUB 4ZXBD 4PJ8C 1NCHA 1KBGH 3EJCA 2BP0B 5ITFA 1FFOA 4YLBA 5FO9B 4FQLL 1GHFH 4K8RH 2VIRB 3QUMA 4PHZA 1IFRA 1UB6B 3C9NB 1D6EB 2VJ0A 4CSPA 2AQPA 2DQTH 4XT1C 5C1MB 4NERA 2HN7B 3DDGA 2EEFA 5B1BB 3AU1A 5A6IA 1D7FA 3GZQA 1EJ8A 1KT2B 4NCC1 2CHXA 1XR9A 1E2WA 1FJ1B 2A4EA 4XP6L 4E41B 1YAZA 1EXUB 4EXKA 2VL4A 5F1IA 2DKSA 3WTYA 4MQSB 1JZHA 2GVYA 4I0KA 2W9EL 2WUBH 3CN0A 4FP8L 1GYWA 3UERA 3VA2C 3GMPA 1UGKA 3GSVB 4V2CB 3E9TA 3HNTH 4KQ4L 3IDYC 2ZKHL 1GMEA 3MRMA 4HF5L 2BCMA 2K1MA 2NY0C 1GH7A 1XCTA 3A67L 3V9CA 4U7KA 4OW6A 3HC4H 5ESAB 2W9DH 4FXGC 3HC3H 4PJ7E 2OSWA 3V10A 2ICWA 4N0UA 2DWXA 2VO8A 2F2HA 1XIWC 1WBXB 3FRPG 3LIZH 2VKXA 4HEME 3UYRL 1DQDL 1JZIA 1DBJL 4WUKL 1U8NA 2XY1A 2EXYC 2FO4B 3VB9A 2FBRA 3JXAA 2V2TA 2L7EA 4NX0A 2EEAA 2J6EL 3T6ZA 2IANE 4HSQA 1YPZB 4S10A 1Y6NR 5AOZA 2V4LA 2A6IB 5GGSA 3U0WL 1F1AA 1S9YB 5AVTB 4S11A 5PAZA 1LK2A 1U3HB 1ZKAA 2VDRH 4DGYL 1OM3H 3T8VA 2BP8B 5GS0D 4Y5XB 1P1ZB 1T1YB 3S36X 1NWPA 3D4ZA 3T0EB 2Z93A 4DKAA 1BWWA 2WB1A 3LZLA 1BX2A 1WA1X 3C2AL 4LPTA 3L9RB 4WNQA 2RGSA 1KTLA 3N40P 4FTVD 4TPRL 3MRNA 5DHVA 1JV5B 2NNAB 4ZZKA 4FZ8L 3QZWG 1CXFA 4U1GB 3SE9L 5I9QB 3QWNA 3X3FH 4MMZA 1SOSA 2F1EA 2QSCL 5BZWB 3R0NA 4PRIE 4IRJB 4X9HA 5ECJE 4Q56A 2C3GA 1G7HA 2NR6A 2R2EB 2EEDA 1C8PA 4KZDL 3CZKA 3IN2A 1ZHNA 3I6GA 2ZKYA 5C3LD 3EZ8A 3JTTA 1UEMA 2F53B 1OARH 3O4LE 3CBJB 4JZOB 5DD6A 1JD7A 2JKJA 1XDTT 1QD0A 2MPVA 1CGYA 2YK1L 1M6OA 5T3ZL 1AD9B 2XXFA 5MI0B 2H3NA 3ZDXB 2J4WL 4MASA 4EDWL 5IFHH 1A8JH 2WJ5A 5DHMC 2VR3A 3VCLB 1BF2A 4KXDA 2ESVD 4U3XA 3V0EA 4LK4A 1HHGA 3WE1A 3W38A 4D9LL 4PUBH 3UTTD 2N1TE 4J2XA 2OMVA 5ANMA 1OP9A 4YSTA 3T8XB 4LRNL 5D9SB 2NY6D 3SQBA 2WLYA 5BRZB 2X1QA 3FO0H 2A73B 3RKDD 5MERA 2W1NA 5C8JB 2GC7C 1N70A 1DDTA 4KZEH 2GG1A 3WU1A 4BD4A 4XHQA 2LU7A 5EBMA 3EFDL 3EF7A 4PV8B 3WHE0 1QA9B 3ULUC 4NWUL 3G7TA 3O6ML 5L6YH 2D03L 3H2WA 4P9HL 2BOCB 1TZIB 4PRHB 4QOKD 3LHAA 5IBLD 3BQUB 1DQJA 1U6AH 2B08A 1SHSA 1SYSB 5ETUA 5CSBA 4F37F 4BINA 1L0PA 2ZSWA 1ONQB 5AYUL 3UAJC 1YEJH 5CEYA 2F0CA 1WCBB 3TA3C 3BGFB 2TRYA 4KVCL 1KMGA 1KIPA 4L3AA 3RVWC 5FXCH 2P28B 1U3NA 4WW2B 1PVHA 25C8L 4NCDA 3OKDB 3FTVA 5IMOA 2YC1B 2OL3A 2EYSA 4PLKD 4Z0BL 1R6VA 5HHNB 4JHAL 3WN5A 1BOGA 2SEBB 2QGCA 2K9UA 2P3YA 5I15L 1HCYA 4R7DB 4YE4L 3RAJH 4RFEA 4PCYA 4H1LG 3S2CA 1DP0A 1KLGA 2E76C 2OJZH 2YXWA 1DVZA 5KN5A 3RX8A 2EIZB 3BN3B 4MDJB 4PHXA 5AUMA 1GOGA 4OLEA 3VFRB 4DGWC 1EJOL 1CTMA 2Z6FA 1C9SA 4XNAA 5F93C 4ZMVA 5HP5A 3IEAA 1G1YA 3JTBA 5GGTA 3RUGA 3S3JA 1KCVH 1D5XB 3FU0A 3QIUC 3O9WB 4Y4KD 4LHJB 4HH8A 4AIZA 2V17H 4PRPA 1F1GA 3LB6C 3U9UA 5EZLB 4HUKB 3QJVB 3BZEB 3FB7B 2F8VA 2CNZA 5J13C 3HG5A 3ZL1A 2LVEA 2DQCH 1R3LB 4HZLA 4L3CA 1AANA 4FQXC 2CGRH 3OKMB 4GUCA 2XN1A 4IMKA 5C0DA 5T8IA 2GTZA 1U2HA 2ZOTA 5B8CC 2YBRB 2BIMA 4KTDL 3T0AA 2ZWZA 2WKOF 4JG0L 1KFGA 1IC4L 4LQFH 4JMXA 2H0EA 4NO2A 1OD9A 1UOWA 5AEAA 3DX1A 1A0QL 3DX2A 3SYPA 3EDFA 3VFPA 4IGBB 3THML 1ZLSL 5EEVA 1NCJA 3MLUL 1BW8A 1KOAA 3KPRA 1I9RL 5K93A 3KYKL 3MZGB 3MRRA 5DDHB 2H45A 2H6OA 3MKKA 1U8KB 4IIQC 2FGWH 1IO4C 2E0PA 3L4UA 3MKGA 4GKSB 2XPYA 4JFHE 3E6HA 4PGCB 1WZAA 1BF5A 4KKBC 4JS7A 2IBZY 4NC1C 3QA3B 4AMKL 2MQGA 4UV4L 4DKFL 4UWQB 3FB5A 1ZTXL 2VN3A 1LDPL 1QMUA 3B2VL 4WU7B 4RX4D 4O00A 2L7QA 3T1FB 4LHQB 4IBYA 1T1ZA 2QMKA 3FCBA 4J39A 4RESB 3MRHB 5D6CA 5C0EA 4KKQA 1MRFH 4Z5RB 2HT2C 5E6UB 4LOUD 4PJFB 5EFIB 3OLGA 4TUKL 4U33A 4MCNA 5L0QC 1P4IL 2VUKA 3FHAA 4NO5B 1A1MA 4JJ5A 1D2PA 4YX2L 5C97A 2H9GB 1U8MA 3OBAA 1ROWA 3TVMA 4HVBA 3GSOA 3P3UA 3FJTA 3BRGC 3KDPB 2KZ1B 1EHXA 2DWTA 4Y1AD 4M29A 5M7QA 3TNMA 5C0RH 1BMWA 4LEOA 1IT9H 5D5MB 4ZFZA 4P5KA 4ABQA 1MFVA 1AOHA 1TNMA 4TNWF 3P1VA 2OKMA 3T4YA 1LO2H 5JIPA 3CFCH 4LCWB 5H2BB 3BFOA 5FV1L 5DZLA 4GG6B 4NAJA 1JZFA 1V7NH 3GC3A 4NSKA 4I13B 4UUJA 3T2QA 3RX5A 4YUEH 4CMHC 4Z7IA 3REVA 3K7UA 3ZKND 2A9MH 4OFQA 3V6BR 1S7WB 1R5WA 3AQYA 5DURB 3SGJC 1QSFD 3DUUB 1EDYA 4UDTB 5C0AE 5IHLB 2FQFA 3WUWG 3TT3H 2PYEB 3MV9B 4YQXL 2QELA 3IKKA 1TZHA 4Y8DC 1MFBH 4QY8B 4G8GD 5MHSE 2FL5A 4KH9A 3BZ4A 5DJDB 2MTPA 4K5MA 4NUJB 3RL1A 1F97A 4S1SL 4X4YA 4N8VB 1VEPA 1XGRB 5EUOE 3CQQA 2PWGA 2I07B 5DSCB 1DZ0A 3H54A 5C6WH 3TO2A 1F90H 1OEZW 4ANUA 1BYNA 5DO8A 4EDXB 4MZIA 2ED8A 1I1AD 3UZQA 1I9JL 1LXMA 3ULUE 5IW1A 5LNDA 5FLVA 1NDGA 3KPLA 1SFDA 5KW9L 4KI5F 2YAHA 4NRYB 4I48A 1T0PB 4B97A 2HT3D 1W72A 5EBWB 1FORH 3MXVH 3HJ0A 3KNBB 2C9UA 2YGPA 4HAGA 1BVNT 1T0MA 2FQEA 2WYTA 3D85B 4KU1A 1RVFL 2QPSA 4TLUA 3S5ZA 1MVFA 4KQ3H 3KHQA 4JY4B 4XVJL 4UB0L 4QO1A 4Y2DD 3O0LA 4JFED 3VGHA 3W37A 5EU5A 4FXKC 4RISH 2VE6A 1JTTA 1WTGT 4IOIA 2X3BA 2W65A 5D7IA 4OM1H 3HG2A 2AK4D 4S2SB 4KJQC 5FW8A 3P9WB 4KHXL 5JIMA 4GG8B 5B3JF 1QG3A 5GGQL 4YN3A 1KJ3L 4NQCA 5IOPB 4WUUD 4JKPH 3WNIA 2CO6A 3I85A 4L1HA 1JJUA 2EDBA 2OMUB 3D18B 4YSEA 4LEBA 2BC4B 5IMMA 4XAKE 1MFNA 3BDXA 2F68X 3FO1B 1X7QA 1TQCC 3PE9A 5EOCH 5I16A 2HVKB 1ZVSB 3CCHB 3ALWA 4G6FB 4JANA 4X6DB 4CADA 4PJBF 1U8IB 1JPST 3WSQL 2H26B 3CHSA 4JPWH 2KERA 5ABZA 1M2VB 5IUSA 1NMBH 4WTZG 2IGTA 3UAAA 1U2CA 1HXYB 4AUUA 1X9RA 1CD1B 1CGXA 2JSFA 2VDKB 5I30H 1WZMA 2HTLD 4MCYB 3SGEI 3QG7L 1ES0A 2MEJB 1U3JA 4C83A 4A66A 3LXCA 1F86A 3ISYA 4NFDA 1NMCB 2V33A 2YD1A 1MF2H 2JKXA 3QIBD 4LBAA 1P84K 2VLME 1FZKB 4BUQA 2R69A 3MV11 5H35A 2VZTA 3RIAK 2DQGL 2FSEA 1QO3B 4X80L 3ZUCA 4G80A 1FN4A 5I82A 2VDLB 3VMOA 3ZE0B 1I53A 4GAGL 4XGZA 3RZCA 2B1HH 2DMGA 2V7HB 1AHKA 1DBAL 2XX1A 1KENH 3ZGHA 3C6SA 1SJEB 4MJ2A 4F5CE 1HK6A 4XWOD 2J88H 2HMID 3D9AL 4FFYH 5ICXA 5KS9F 2ED6A 1F4HA 3VG0L 1M9SA 4NC1E 3QZBA 2IWGA 5F7DB 5F3BB 1VDGA 5EOTB 3GLDA 1I4FA 1ID5I 5DTFA 4XXCA 3VFUB 4F9LA 2P43B 4X7TB 2C5DC 1TENA 5GRUL 5E0FA 1IAOB 3G3LA 1U3HC 1YYMH 4U49A 1T1XB 1F1DA 2FX7H 1GSMA 2APFA 4O02L 3SBWA 4C47A 3NZ8A 1LE9A 4Y5XC 1GGUA 3WHXB 1RV6X 1ZT7B 1OSYA 2E6JA 4K15A 3T0EC 1NKOA 3UGXA 5IKCA 4X4MA 3ORJA 5BZZA 5ID1B 3KR3H 5K59E 1I75A 5IBTH 5LHDA 3BWUF 1UT9A 4YH6A 3H9SE 3RYMA 4KH2A 4HUVA 2AZUA 1WEJH 1LEKA 4U1GC 2VXQA 3DSNA 1P6AB 3HE7A 3WKYA 1UFGA 3ZYOA 2ZOKA 5C7XL 3FFCE 3FZUD 3QUKA 2OMXB 4HUUA 1P4BL 4LF3B 5E99H 2BJMH 1W0VB 4IRJC 1K5WA 3NK4A 1A21A 2BNRB 4LHUD 3EGXA 2FEEL 3FSOA 2QHRH 3V6ZB 3I50L 5TQ2L 1T0NB 5IB2B 3ZRSA 4UQ2A 3GUTB 1IKOP 1UXMA 4A2EA 3H2QA 1FVCA 4CVZA 4R7NA 1AY1L 1PLBA 2P46B 3U6RA 2P5PA 2R7EA 1FGNH 2BINA 3LXUX 5MI0C 2Z8VC 4BZYA 2BDNH 1BZQK 4DIXA 3CC1A 2VXSL 2VDMB 2YSSA 3V4UH 4K7PH 3G6JE 4RSYA 3FKUS 5JW5B 3DKHA 3QNXB 3VXTA 4YEEA 2F8XC 2P8PA 2O6DA 3DURA 3QCUL 2Q86B 5C9JB 2YLHA 3L5XL 1DUZB 5HJBA 4NP4H 1T6BX 3VTAA 4OIIL 4Y5YB 2AS5M 1J8HA 2ZP0T 1A9EB 1E6OL 1OTUD 4KX8A 3QEGH 1G0YR 5A2BA 2ISDA 2UUDH 4AY0A 3FXIC 1SXCA 4G59C 1KEML 2BMKB 3SGDI 1F3DJ 4DZ8A 4M43L 2UZYA 5BS0B 3KEHA 3CN3A 3EUUA 4PB0L 5GSVA 2ZAIA 3HLKA 4EUPB 4S1DD 2VL5A 3BQUC 7CGTA 5AW6B 2NZ1A 4HFUL 3MYJA 4LZKA 4QRFA 1JXFA 3VGBA 3B7YA 4RFNB 3X12A 2WLHA 4DH2A 1QAWA 3MREB 1KCSL 1X5GA 3BGFC 1GKEA 3SYOA 2H3XC 1AHWB 3QNZA 4IDJL 3EH2A 4WHCA 4A2MA 5KG9A 3HPJB 2Q6WA 1BQHG 4PRDA 5FK9A 4WW2C 4PD4K 5LXVA 3KWWA 2EIEA 3P4OA 3NCBB 2X1WL 4MA7L 5D6DA 2K3HA 3D2TA 3VI4F 4HMCA 5B1CA 2MCPL 1QFUL 3Q43A 3S3DB 3HC2A 1CLOH 1K8IA 1AR2A 4G6ML 2DBLH 4H20L 3A3YB 4KAQH 3KM2A 4YHPB 2WXMA 1KIQB 1MW1A 1TEGA 1FNEA 4RBPK 2GIMA 1KTDA 4IHOA 2CCWA 4WI9A 3WFEL 1KZQA 3S7GA 4ABWA 1IGIH 2F08A 3SD5A 1KPVB 3O9WC 3IF1B 4X5QA 1D5IH 2OAAA 2JB6B 4E41E 3V0AC 5TF1L 3O0RL 3RVVC 5K1JA 5A3IC 3HVNA 3B6SB 4M1GH 4V33A 3PABB 4DVRH 4HOWA 2WOYA 2WXQA 4TUOA 5E5RB 3BWAB 3RVXC 5EHFA 1V10A 1MW0A 3CSYA 3Q13A 1E4XH 3X1EA 4R9HA 5A6LA 4HA1A 2B59A 3R7RA 2FJFB 3GIVB 4HUCA 4Y2LA 4ATWA 3BCFA 3HAEB 1AXIB 4F27A 5FB8A 3BEWB 2DYPA 3MCLL 3UEQA 4NO3A 1F42A 2QGDA 4YFEA 3TM6A 1VHPA 4IGBC 4NQSA 4OD1L 3QUZA 4PTTA 5HI5D 2WSPA 1IARB 3DC0A 1DJSA 3OKOA 1NCGA 2R8SH 1S9KC 2OMBA 3AXHA 4M7JH 2JJTA 5JR1L 4HGKC 5CINL 2EDEA 4L0PB 4BK8A 1TKWB 3V0WH 2RTTA 1MH5B 1FV1B 1MIML 1QATA 1W6LA 2EDYA 3ETSA 5DWUH 5AFAA 3KL3A 3PGCA 4E9QA 3ARBB 3HOGA 5MENB 4XXDB 1XTLA 5D2NA 1DSWA 1YPZE 3GBMH 4NQDE 1CE6A 2DQUL 2NR6D 3QQ3A 5ICZA 5ABDE 4QJ3B 4CAGA 1B4LA 2J8UA 2KLRA 2XFXA 1KBKA 3UMTA 3VFSA 2R4RH 4H44C 4NI6A 5F96H 1CDGA 4ODTL 4HKXA 5TDPA 5I75B 1UT1A 1A6AA 4KRPD 3IE4A 3T0EE 2WXNA 1Z5HA 3KLHD 4YHML 3FQXA 1KCUH 5CUSL 3AUVA 5FM8A 2MCG1 4Z3JA 1IGCH 4OCNC 2ZPKH 4DN4H 4TOYL 2B4CL 2KDYA 4ETQB 1R5VA 3LX9A 4D0CA 1L5GB 1OT2A 4LVEA 3U1SL 3MLSH 4XCNA 3WCYA 1EFXA 3QCTH 4M7ZB 4PJ7F 4WFHE 1JG9A 4FEMA 3V55A 1QYGL 3SOTA 1ZJBA 3O11B 3QNYA 2DIJA 4JKLA 4ES9A 1KFAL 4U1HB 3L08A 3UTQB 3WFDL 4FQQA 1IC0A 2V3EA 5KANG 2XRAL 5CXPA 5IR1A 4YXKH 1AH1A 1DHKA 2MOGA 5DQDH 5SX4H 5CLXA 1QRNB 3GS0A 3CLFH 5H37G 7PCYA 3ZHFA 1H6FA 4N3TA 3IAGC 1CXHA 4YHOL 2G0KA 2F53E 1DN0B 1TZ8A 5I17A 5E4EB 1FRGL 4Y88A 3ZDXE 1XQ4A 1A6WH 2P8LA 3NSYA 1XR8B 4PREB 1UXSA 3H7BB 2I60L 5ACZB 4U6XB 4BSWA 5DJZB 4RZKA 3US1A 2PW1B 1E2VA 2HA1A 3QP3A 4D9RD 2PTTA 5CEZD 5T1DH 4HV8B 5BRZE 4WWID 1YO4A 4MB5A 1ZGLM 3BP6A 4XN5A 2WLZA 1UADC 1TSHA 2VR9A 5C3TA 1Z0MA 2CO2A 1I8KB 4W6XB 4K71C 2W9LA 1FNAA 3UPRB 2VMDA 1VADB 5GS0L 3IDXH 5AVXB 3GXDA 3QXWA 4WKZA 1GJWA 5ADOL 3CC5B 5C08A 4AYEC 4PJEE 3SY6A 4PRHE 2YPLA 1L9TA 2Z92A 3IFPB 1WQVT 1X5ZA 3ZTEA 4XE5B 1S7QB 3GLZA 3QXVA 2VQ1A 2IQAB 3US0A 1EEQA 4KTEH 4F2MB 2QFPA 3NEEA 4RMSA 4WK0B 5GGVL 4PRPD 3EBGA 3WMQA 1EX0A 1PLCA 1XWVA 2MTAA 3LVEA 4A7GA 3U2JA 3CU7A 4HIXL 2HVJA 4CGTA 3FYIB 2OR7A 3HR6A 4JDEB 4L4TE 2EVGA 4CC1A 4F7KA 1LMKA 1MFEH 2ZX5A 3GMMB 3Q7JA 4MAUH 5DD0H 4HC1H 3RG1C 3MV7B 3LTVA 3HHSB 1MHPH 3ULUH 4N0YH 2ICWJ 4PS4L 5E1IA 4JQVC 4LPVA 3SOBL 2BY1A 4BQ9A 2YMOA 3POHA 4Z78A 2G3ZA 3MRCB 1A3QA 4TRPL 4OCRH 3BH9B 3O45B 4IJ3B 4D0BB 3GSRB 3V5KA 3UCRA 3V2AR 1HQ4A 1Q1JL 1UACL 2CALA 3KPRD 5CGYC 4XN8A 1G94A 2J8OA 4HS8L 1AGBA 1AIFA 2NXZC 4WTXA 3EYVB 2Q10A 3MVSA 3QEUB 1C5BH 1RZJH 5EIIG 4L3FA 3WHE1 5KVFE 1BQRA 2G5BB 3EBAA 5KSBB 1KYDA 4NFCA 1JERA 4HCGA 5D7LB 5JDSA 1UA7A 3M07A 3RURA 5LVEA 4BZ2L 3BIKB 3EBHA 4G5ZL 4JHZA 4G70B 4NQXA 2FYVA 4Y2OA 3FTGB 5D7KD 4APXA 2XWXA 5DD5H 1KGCE 2JLPA 4GKNA 1I1RA 2C3VA 5SWSA 3WFHB 5E6ZA 4URTB 2QTEA 2WM0A 1JGVL 3QHFH 1NMCC 3F7YB 5DFWH 3W82A 5FFGA 5B1JA 5K9OB 1K6QL 1P6WA 1T89A 4P4KA 4UZGA 3UROR 3JZYA 2EC9T 4M8RA 4AQEA 4NQEA 4QHUA 5IB1A 2J7LA 3K2MC 5I1DB 2KLSA 3CZLA 3TVMD 3GSNB 2IPKA 2C3XA 1OCWL 1DQLH 4P23B 1KBPA 3FQRB 4PMFA 2GT9A 2R56H 4L8SA 5DT1L 1X5XA 5FWRA 5G5DB 5KYUA 3VFGH 1KJMA 1DVXA 2CNYA 4LCUB 4HJGA 1KXQE 4MQXD 4UTCA 1T03L 1OY3B 3C87A 2N0MA 3UTPD 1BYPA 2D3NA 5EZIH 2G5RA 3RBGA 1SEQH 1HINH 3O3UN 4TULL 3MRBA 1E43A 1YUKB 3Q01A 2CUIA 3HMWL 3RWFA 1L6ZA 1CE1H 4RZCA 4Y8AA 4G9FB 4BELD 3RWJA 2NT0A 4O51A 1NANI 4ZX6A 1WICA 2O6EA 1CICA 1URZA 2VLKE 4CW1B 4N26A 4NFBA 4DVBB 5GS1B 5FUZL 1M1XB 2HVBA 1J88A 3D2UA 5D2LB 3WIIL 2F61A 3WOVA 5MEPB 4HXBH 2CPCA 2YPKB 5KYNA 2LFEA 4UIMA 3FBKA 3KBHE 3T6VA 5FYKU 5HD8D 2HLFD 5HY9A 1YNTB 2DJMA 1XD0A 2O1AA 5IVXB 5T33H 3TN0A 1U8OB 3IWUA 4NZTL 3ESMA 2Y7MA 5HPMB 2QVIA 4POZD 2VSCA 1D5ZA 3ARYA 1ED3B 2ADFL 5D5ME 3DROB 3G9AB 1RU9L 1KYAA 4QIRA 2X6UA 4AJ0A 4IOSA 4LCWE 2YGOA 3MUJA 3SKNB 3O3EB 2I9TB 4WVRA 2UY7A 5CJBA 4GG6E 2CR3A 1F4YH 4NKOB 4NPYA 5F89B 1LK3H 3B9AA 1NOLA 3DX8B 4GAYA 4R0LB 1QBLH 1RZIB 5IMLA 4DO4A 4O2EA 2XTLA 3D8MA 4Y4KC 3NSXA 1EO8H 1WTLA 3US9A 2PYEE 2VZ3A 2OM5A 2NY4B 2XN2A 3PHSA 3IDJB 5GRYA 1AQKL 5DMIL 1OHQA 1VKXA 4X6CB 4MMXA 4X6FB 2WXIA 2CIKB 1OOAA 5DS8A 2CM5A 5JYMA 3GIZL 3QUYB 3G5XB 5E6IA 5HHMD 2OW7A 1NJ9A 2OZ4A 4I4WB 3NIDB 4JFDB 4ZUWB 1KJ2H 2GBTA 2Y7QA 5EORH 3WNMA 3ALPA 4W4NA 1KPUB 4Y5YC 4LHUG 4WWOA 3LS5L 1KELH 2MKWA 5E56A 5ELIA 1K5NA 2P49B 4DT2A 1G0DA 2VDPH 1BEYL 3PWNB 3PWVA 4NQCD 2VMEA 3KPPB 4I89A 3S88H 2EUVA 2WXOA 2GTQA 4XMUA 2ZD0A 1UOKA 2AXFA 3LDBB 5F9AC 1WBZB 3STZA 4UIKL 4JPIA 2YOCA 3ESUF 2NLJA 3SDXA 2OX5B 3FTSA 3TF7C 1JXKA 1IL1B 3AVEA 2VJXA 4XPTL 5JXAH 4IRZL 4MNQB 2O5ZL 3MRFB 4JFOA 5T1LA 1TQBC 2X3CA 1AHWC 3LKRB 2Z35A 1LO4L 2GIYA 1J9RA 1QW8A 4L05A 4EOWH 5AL8A 3VD9A 3EYUH 1P1VA 4Z7UB 2C1PA 2OI9B 4NEHB 5B7EA 1QI4A 5LG6A 6CGTA 1AQMA 4WKXA 4FG6D 5EUOF 4U0QB 3QSKB 3VD7A 4CMMA 4A6YA 1M56B 4NT6A 1LO0L 3PWPA 4U1MB 1BFVL 1IC7H 1I8MB 5E2UH 3D07A 3ULUF 4GW4B 3RZCD 1PG7H 4Z95L 4X6DE 1OCOB 1S7VB 5GGUB 2X4SB 5FYJE 1A65A 3TJPA 2ZAHA 5TGBA 3UBXA 1S7TB 1NSNH 3S37L 1FYTA 3DRTB 3S34H 5ISZA 2AVFA 2ATKA 2IO5A 3HC0A 1E9OA 1NFAA 3JTSB 1KN2L 1HHIA 2XVLA 5DZPA 1RFDH 5C07A 3NJKA 4YSSA 2VR4A 1ZPLA 1FIGL 3MBEB 1A7QH 1I7ZA 1N64H 1UUSA 3LKPA 4HS3B 4TTDC 3TEUA 3MBXL 2J20A 1CLYL 2IAAC 2OMZB 3GJEA 5ACMA 2B14A 3B9VA 2CK0L 4PGDB 3SE6A 2C3WA 1Q1PA 3ULAB 2BSSB 3S5LA 2ESVE 4JFYA 3WIFB 3UTTE 1S7UA 2FNWA 1A4CA 1W8OA 1U95B 2CAKA 2YD8A 3B8YA 3DX6B 5K69A 2FX9H 4PJCA 3OHXA 3OMNB 3B7TA 4PV1C 2XDHA 3VH8A 1KWGA 4E0RA 5EO9B 1W8NA 1S5HA 4MCZB 4OZFA 1EGJH 4XMLH 3ASWA 1BECA 4RMQA 4U7SA 3U25A 3U0PB 3HE7D 5I1LB 3VW3H 1KEGL 4DJMA 4H0HB 2AJ3B 1B9ZA 1OCRB 3ARBC 5LGYA 2O5XL 2ENJA 1BXXA 2HSIA 2WOBA 3N41B 4DPAX 4IBZA 3T4AA 4ZAKA 3JV6B 2Q8BL 2DWDA 2PN5A 4JRYB 1ODUA 4JDZA 1HE8A 4Q4IA 3C8KA 5DU7A 5FM4A 1QBAA 5SWZB 4IBLT 4F57L 2PPDA 5I75C 2CLZB 1C12B 2W0FA 3RWIB 2X7LB 4OB5L 4A67A 2WBJB 3MJ9L 5ESQB 4MXWL 1XGUB 3RHWF 4OCWL 3N44B 4HKBB 1FL5B 1KN4H 2WVSA 3FQWB 3L3HB 3TBYA 4LKCA 1RZKH 3TYGL 4Y2DC 5DMYA 1RUAH 2F58L 3MNZB 1L7IL 4KHTL 1A1OA 2X87A 4JDVA 4FFVD 4LL1A 2ZUUA 3CSTA 3KHOA 4M7ZC 4UCFA 5DQJA 3ZUNC 4M61A 5C2BH 3IDGB 1KSRA 4ZUUA 3KH3A 5TFSH 4XRCB 1G9ML 35C8L 1VACA 1Y18A 4IU2A 5DRXA 5KBDA 1J8HD 4ZO8A 1ADQA 2BNRE 3ZE2E 1AJ7L 4X98A 3CHXA 3TJEH 3HZVA 5TK2A 1ZXQA 1GS6X 2BXZA 4ERSH 2XYCA 3RB7A 3FQUA 1EH9A 3KCPB 3PHQB 3HFFA 1NAMH 2BSRA 3JWNC 1BVOA 3A6OA 4XPAH 5IJKA 5E4EC 4HPOH 5T1MA 2A74A 1JRHH 3HZ3A 4KVNL 3QJFB 2JI1A 1A3RH 1ASPA 2OXGA 3HCVA 2R0WH 1SBBA 3DV6B 3NDYE 4HBCL 1WWBX 4YOKA 5JHBA 1M7XA 1FZOB 1CVRA 5ADPL 3CVHB 1ZCRA 2R2HA 1CFSB 4P2QB 4AL8H 4YDJA 3V6OA 3CFQA 4GIPD 1B0GA 3O2VL 5K59F 1FL6B 2EIKB 5CCJA 3SPVA 2XV3A 3CVCA 3ZZ1A 2IH8A 1UH4A 3MNMA 3MLZL 3OAZK 1NGQL 4RDQG 1UM6L 4V1DB 3ZYIA 4HGMA 2C7FA 3LRHA 2ED7A 3RWCB 4ZT1A 5BS0E 3ET9F 2IH1A 1XSKA 1UWXH 5ESVB 1HILA 4IOFD 2WANA 3GUFA 3V4VL 2ORBL 4M56A 4XBPB 2FEEI 2HPOA 3ARDB 1CDUA 1JNHA 2BX5A 1BZ7A 2YOAA 4U1KA 1JYVA 5FUCC 3IDIA 5DXWA 4PG9B 1CB4A 4HDIB 3DXAA 4ISVB 4WK2B 2AC0A 3O3BA 3NIFE 1GMIA 4OFDA 3ROLB 4YBQC 3VB8A 1QR1A 4UU9A 2FR4A 1NTDA 3CZUB 2YMTA 1X4XA 2FK9A 5G4OA 3CHOA 3G6JF 4MAYA 1JZJA 2BRRL 3LKQB 2V5RA 4M3KB 1YEFL 5CP3A 3GRWA 3HS0A 3L1OH 4FQCL 2E7LA 1U8HB 3EYSL 1RK0A 4IYKA 4WEUD 2E7DA 3ZTJH 1LO5B 1ASOA 3X1BA 1WHOA 1PZ5B 3DX4A 3WBDA 2DYPD 3ZT6A 4QXTB 1RJLB 4YDIL 4DO5A 4IJ3C 4YDMA 3QUZD 5TPWH 1UASA 2VLJA 3VDCA 4F33A 4HWEH 1YEDB 2QPEB 4ZPTB 5J6SA 1JPFB 1JNNL 5DEFA 2J73A 3KLDA 3OZ9H 4GO9A 4ONFL 3L3DA 4GXVL 5TE4H 3MJ8B 3H0TB 3FONA 2FX8L 4F7EA 4O2FB 3FZUC 1K2DA 5F9OH 4JB9L 3LXBA 3QT2A 4Y5VB 1RIVH 2D7NA 4M6NH 4EKXA 1JZ3A 4DP8X 4QCIB 3TTYA 2HFFA 4NJAH 4BFRA 3LN5B 2W88A 4LLYB 4J3OG 3ZL4H 3BH8B 1CFQA 5KZCD 4OZHE 4JKWA 4OT1H 1Y07A 4FYQA 3HB3B 2DS4A 3BMWA 5LBGA 1J48A 1FDLL 1A3ZA 4BJLA 1WBYA 2HCZX 1QSFE 3FT3A 3T6WA 4F58H 3QUML 1MCRA 5F1SA 3ZT7A 5DA0B 3MRQB 4NOBA 3TFKC 3K1KC 1CG9A 4EVNA 4JLRA 3LN9A 5CJXA 5I71B 3SDCB 2E9IA 4G8GE 3UTZB 3RJQB 4L1LA 5BUPA 5T5FH 2NZIA 3DOHA 4HKJB 4JRLA 5D4QA 1YG9A 4YIQA 1EFXD 3V0GA 5DK2A 3OKKB 1XGYH 1Y6KR 4YDVA 1ETJA 3VX0A 4WI7A 2APBA 4YPGA 2BVYA 1HKFA 1ZIBA 3DJ9A 3ISRA 1N7ML 4J27A 4AZ8A 2GEEA 1T22B 4JY6A 3X1GA 4Z23A 3J8F7 1J87A 2CKBB 3AT8A 1QBML 4ODHL 3IXTA 2R2BA 4M4RB 2AERT 4PJIA 5INCA 2X4TA 5I1AA 4Z7VB 1E4KC 4ZOAA 5GISL 3SDYL 1J12A 2DQJL 4E5XA 1B6DA 1ZD6A 4GPVA 3TBWA 4C4BA 2Y5TB 4U1SA 2MQ0A 2PCYA 3MI6A 5GS1C 2BSEA 2FUTA 2J43A 3FB8A 1DLHA 5M95B 3UX9B 3VYOA 4XB8A 5JXEA 2PCFA 3LYRA 5DD1L 4BFOA 5L9DH 4RMVA 3C5ZB 5JDJA 4X5XB 1FFPA 1TG8A 1J0ZA 1IB5A 3HR5B 4UINH 2OP4H 4ADIA 2ZUTA 2CUAA 4GUPA 2DQHL 4XPGL 3VSUA 3K72B 4JDTH 4WUUE 5DGQA 1MFAH 4NC0B 1AZNA 4AWJC 1DCLA 5DUML 3L4YA 3GMOB 3TWYA 4OCMC 4ZRGA 2FEJA 3NJMA 5FOBA 2M1KA 3GMLA 2VDQB 1QRNE 3QC6X 1E4WH 4IRSA 5EU3B 2A7BA 3BP7B 2WKOA 5I8KH 4NOFA 3JWNE 1NAKL 5C08D 4R0LC 3NABH 1CZ8L 4LSTH 1YPZF 2QPFA 1MVUB 2YPLD 4MD5A 4OGYH 4AQ8C 1TTBA 2EACA 4J3TA 3O3DA 4U1IB 5ALCL 3ZIYA 2A83B 4PVNA 4DK3A 2NY4C 2PP8A 3L1FA 4MD4B 3EO9H 3SCMA 1VZGA 4OCXH 1U8JB 3DTUB 3QUYC 2MNJB 4UDUA 2VABA 5BCAA 2LOEA 3STLB 2WSDA 2XKUA 3VXSB 1TDQA 3FN0L 3RWEA 2PWHA 4GQ9H 2Y36L 3LIZA 4JHWL 4OM0H 4UTBH 4TSBL 3DHJA 2Y2YA 4H40A 1N3NB 4Y19B 1BGXL 5TE6H 4LIQE 1RUML 2NQ3A 4YBHA 3LDBC 4NZDA 4U2YA 2Q7AA 2YQ2A 2J72A 4G7YL 4G6KL 1U2YA 1QSZA 3IRPX 3RJOA 5CKAA 4BGLA 5FUCE 1AQDA 4F2ME 5BMFH 1OCZB 1MHCA 5KUMA 5CBAA 3MRGB 1JDAA 1BFTA 5FPIA 1MAML 3OB8A 2NSQA 2EABA 4KO6A 5A2AA 1RZFL 3NCYS 5DLLA 3UBGA 3ZDXF 1SQMA 3ENEA 3LKNB 2FWLB 4R3SA 1T21A 3B8SA 2ODHA 3MV7E 4GBXB 4F8OA 4AM0A 2OI9C 4XNXL 1BAGA 3AS1A 5SWSD 5HDOA 1A4KA 4ZX5A 4KRPC 1T83A 4AQAA 4QRRB 4LP4A 3KLHC 3GSWB 1TJIH 4DUXA 4P4KD 4RRPA 5DLMH 1MI5A 1I7RB 4I77L 5A2LH 5CNHA 3NJJA 4F7CA 5FYLE 1UB5B 2PXYA 2XCMC 1MCBA 1L9NA 3FMGH 5DJ6B 3WKMH 5CEZL 1GYUA 4PJEF 1HCVA 4RAUA 3DLQR 4AKQA 5IW6A 3IVKA 3MRJB 3S8GB 3PWJA 3B37A 2OL3L 1CGVA 2IMNA 5KSBE 1VCAA 5C9KA 5H4ZA 1HSAB 3BVXA 2WXJA 5D7LE 3S2AA 1PAMA 2DL9A 3TGXA 3UC2A 1CGWA 1EO5A 4L4VB 5DEJA 4KWUA 3IGKA 1JYNA 1NWOA 3KPSB 3KLSA 5KYYA 3IMSA 4PV9B 5IV2B 2J21A 4XZ4A 3ZDZE 3EUDA 4WW2F 4GNKB 1UD3A 4GB9A 5AB0A 1X5MA 2W38A 1P4LA 3F7VB 1DEDA 1CICD 3W39A 2XBTA 5GGTL 3V0VB 4YJZL 1SDDA 3D2UD 2WGXA 1ACYH 1G7PB 1KIRB 2APTA 4XCYB 3FO2B 3U36B 4DN3H 1LE9B 2OSLB 1YEGL 4PP1C 1PBYA 2V8MA 3CWGA 1F45A 3BDYH 3MR9A 1F13A 5JORA 3S9DB 4H8QA 4GO6B 3GTTA 2E8YA 4S1RH 4JFQA 1Q9OB 4JRFA 5FKAA 4H8VA 1K9TA 3Q05A 1HHJB 3QDJD 2CMRL 2VDKH 3NIGB 2QLVB 5C09A 4XO3A 4PW9A 5E5MA 4N2LA 5DVKA 4BH7B 5B7MA 2R59A 1W15A 1DJGA 1YNKL 2YN5A 4IOSD 3CDCA 3DVGA 1MHEB 2Z31A 5E5UB 4G72B 2CCVA 5B4MD 3DTDA 4JO4H 5I1GH 3ZR5A 4G9FE 3LS4H 1UVQA 4MYPA 3BO8B 2DI7A 5IHUH 1BZDA 4A55A 1YEKL 2X2UA 1S7XB 2KDGA 2VDLH 2ZCHH 3QR0A 4KX9A 5D2LE 2YWZA 2WBJC 2K6WA 1XFPA 3MV8B 4IBUA 2NUTB 2OMTA 2IV8A 3EYQD 2ZOLA 4U7MA 2X05A 3IWVA 4PJBA 1TYJA 2H0JA 4MJ4A 2VDNL 5IVXE 1KPRA 4UMGA 2AJXL 5E6ID 4FNQA 4X5RA 3C75A 4FADA 5IHHA 1QNIA 2CRMA 1M57B 4QGYA 4J8RA 1FFNB 1Z9SA 4IEFB 3SE4A 3U2SB 1WE5A 4J3OC 3KWVA 5BV7L 1XF4B 2WUCL 2BVOB 1BQLH 2VKWA 1UA6H 4HHAA 4J6IA 2V9QA 5IQ7H 1DZBA 1YNLL 3FU9A 5T1KA 5IQLA 3WYRA 4N2IA 4HJ0D 2AFNA 2UY6B 1AE6L 4X7DC 3QDMA 1K4CB 1A6TB 3DUSB 1EPFA 4K9EL 2XBDA 3L5HA 1IAIH 5AG8A 2ZSVB 5CZRA 1P9MA 4NKQB 4AGQA 2F7QA 1PY4A 2DYRB 2IGLA 1ML0A 3MRKB 3VFWB 1MZYA 5KJRL 4X6CE 5EC2A 5T1LD 1V8HA 4X8JB 4K3DL 5CJQL 1FVDB 4HPHA 4EZKA 3D39A 4IKNA 4Q74A 3N1GC 4LNVA 4K5LA 3NIDE 4LSUH 4JFDE 1EEYB 1JV2B 4TQPA 2JCWA 15C8H 3AZUA 1YJDH 3I75A 4XN9A 4WJKB 2W59A 3MUGB 4XOAA 4RSVA 4F8QA 5I6OA 2AJUH 3U7WH 4YSUA 2H32B 4I2XA 1UXLA 2FJGB 4U1JA 4J3SA 4UT9H 2VLLA 2D7QA 3IU3B 4N90D 5D5MF 2ZTBA 4ZMXA 2YD6A 1PZ3A 4CNIA 1KV3A 3KYAA 1TOXA 2X89A 1FAKT 3PWPD 4B9FA 4AIOA 2DEXX 3L3JB 4NENA 2WVVA 5BW7C 3G5YB 5JUEL 3B56A 4GG6F 3ARDC 1KGJA 2VDMH 5C0CB 3QH3A 5JHMA 5LGKA 4KROC 2A77H 4MNQE 3T2NL 3TZVA 1OSEA 1GA2A 4X6BA 1DLFH 2UZXA 3WKQA 1LWJA 4FYTA 2Y9RT 1Z32X 2CU9A 1M7UA 2J1ZA 1A6VH 3U4BL 2CUHA 7FABL 3EJZC 1FYTD 1MJ8L 3QO0A 5ISZD 5J5EA 4AYMC 5B38B 1ZAGA 3ZN6A 2AV7B 3L7EA 3CPLB 4JPQA 5C07D 5LNGA 2XQYK 5ECGA 5I2IB 5IHZB 3QJUB 5E24E 5PCYA 4GY4A 2IOMA 4K73A 4BZ1A 3AXLA 5E2TL 5J6HB 2AGJH 4FKKA 1W72L 2ZCKH 5KANI 5LGHL 4KKRA 1WJ3A 1P5VA 3GWJA 3KGSA 1NCCL 5BUAA 4FYRA 2P1YA 3UC0H 4B3EA 1RZ8B 3AS0A 3DETD 3OR6A 3ALXA 5F0MB 2RHEA 3ZHKA 1ZV9A 1IFHH 4ES8A 3OJMB 1YEHL 3EYFB 3L4TA 4IBTA 3BGMB 1GXEA 4Y5VC 3QRGL 3MMEA 4OZGB 2H8PB 3DBXA 3TIEA 3GSXB 4XNMA 4N5EC 2OJEB 1UWEL 3TS8A 4WEBL 1RY7B 3HRZA 3CXHK 2YKKA 1AR1B 3SJVA 2XZAL 5CILH 1IAMA 2X4NB 2ITCB 3E6FA 4KK8D 1N5YL 4XNDA 2P4AB 5KVEE 3MLWL 2B0SL 2VXVH 4YFLI 4BH8A 4XE0A 3S0PA 5HGHB 4AQ1A 3GEWB 4R4ND 3RILA 2DMBA 3SDCC 5I71C 4PP2A 3UAEA 1H0DB 2R15A 3LD8C 4D9RE 3DV4B 4P48A 1YVLA 2I25N 1TFPA 2H6PA 2VYRE 4HP5A 2X09A 1I7TB 1QPKA 3NN8A 4BFNA 4G1EB 3W2DH 1NCNA 5SV4A 3HZMB 4KK6D 4D2NA 5IMKB 3QDGB 5DYOB 3IETB 3HTLX 3QE5A 5ICYA 4K5OA 4OV5A 3P4NA 4X6DF 4NBZB 1FCGA 2X38A 3G9VA 5EMYA 2Z1PA 3VI4A 2OXHB 3S97C 4GMSL 2IPTL 1BD2B 1FPTL 4X6EB 4ZPVB 2MKLC 4JRYE 3HAEH 2NTFA 4NNPL 3EOBB 2XNAB 2R69L 4LAQL 1F8TL 1URIA 5SWZE 3RTQA 2BP3A 3JQOB 5EU6B 1JGDA 3NFPA 3JT0A 2NY3D 2XJKA 1QLRA 2AJYH 4HSCX 3T77A 4TNGA 2V2WA 1S9WB 3PPSA 4QF1A 5I1EH 4KPHH 5DK0A 1IM3B 2D7TL 2J56A 5GJSH 2IFGA 1JN6A 3OB0H 2X0WA 2XFGB 5B3SB 2AI0H 3D69B 2EDMA 1NC4B 1ZANL 4HIJA 1I7UA 5E70A 5LO7A 5DFVD 4JRXB 2CIIB 1WS8A 3B43A 3L9YA 4B96A 3C5ZC 1ZTMA 2K8QA 4KO5A 4FL4B 5L2KA 1UUNA 4XBGA 5ILTH 1BIIB 1A6PA 1H5BA 3CQFA 3V95A 3D3VB 4GSRA 3U4EB 4PY7B 1ZY9A 1PKOA 3FFOA 4FQJH 2CJUL 2X28A 5D71H 3HFML 4I3SH 1ILUA 5F7HA 4F7TA 1BVNP 5F7EL 5LNEA 3CZFB 2VH5L 3KPRE 1ZEAH 1TEYA 2BFVH 2H2PD 3B83A 4JZNA 3V4PB 4LSSL 3WS3A 4BE5A 2BXYA 1IKNA 1A9VA 3IK2A 3FUFA 4HS6B 3N43B 1RZGB 4MSWA 4ZNEE 2JI3A 3VG9B 1NGXA 1GGIH 1WFIA 3SKUD 3DXAD 2VXQL 3CIAA 3ZDWA 1CUOA 3WS6C 1A7OL 3KYOB 3NRQA 5FO7A 3MA7B 4OJAA 4NDMA 5FA4A 3ARGB 4D94A 2OTWA 8FABB 3BWSA 1A64A 5AW8B 3CBRA 4MQ7B 1OO2A 1FQ9C 2FBOJ 3PNWA 4MAYD 5DVPA 2DKMA 4AM0Q 5ERWA 3P0YH 2P5WB 1KC5H 1RZ7H 1XGZA 4AC4A 2WHVA 1U36A 5AW4B 5HGDB 3OQ3B 3CFJA 1YUHB 4FFYA 5EF3A 3HZKA 2WQWA 2GFBB 4UMSA 1EZVY 2V6HA 4XX5A 1MCQA 3KWUA 3TBVB 3UJIH 1F2XK 1D6VH 3L7FB 4R7LA 3JVGA 3ZE2F 3QI9B 1T66C 3IJYB 3VRLE 3NA9H 4KITB 2NNRA 2OR9H 3O3AA 4L1DA 2VLJD 3MUZ1 5AOIA 3TNNB 4D9QE 4JL2A 4G8AC 4Y4HA 1CFVH 2JCCE 4A7TA 4C4KO 1EXGA 4PJ7A 1VGEL 1Q0XH 1KXTA 1EBPA 1HH9A 4HGWB 12E8H 2F18A 4NRXB 3TURA 4HEMA 5FO2A 4Y16A 2UYLA 1UFUA 3B2UD 5FDWA 3F7PC 2AEIT 3E1ZA 3BPCB 5LG1A 4CDHA 2Z9TA 3BUQA 3R06A 5CJ5A 4L8DB 3ABLB 3T2LA 4N1HB 5A2KH 3BUDA 1X5LA 2EH8H 3L4VA 1I9EA 5I0VA 2IANA 3DGGB 1JUFB 1EHLH 2YKLH 4JMNA 4G9DB 4KK5D 3TYFB 5DHYA 2YXMA 3ECUA 2JJVA 5EPMB 5LQBL 4N8CH 4ONHA 4OLYL 1O5DT 5EBGA 1I1CA 2DD8L 3ZO9A 3FQTA 3B1UA 4MRCA 3QORB 5L7XL 4AW4A 1JK9A 1TCRA 4X0KB 2DMCA 1HDMA 4HETA 1HSBA 2J1XA 3M6DA 3KLLA 4PR5B 2DYSB 3UYPB 3VI3B 4UBDD 3N42B 2EIJB 4WHYH 1R3KB 1IV8A 4GI8A 1WFNA 3X11B 1TZGL 3X13A 1FBIL 1K3ZA 3C08L 1TLMA 3OL2A 4TV3A 2J1KA 5DMKA 5GHWH 3WJJC 4YSCA 3GGWB 4WV1B 1NGWA 3OX8B 4PRIA 2Y7SA 1O6SB 1SXBA 3FT4A 5ABAA 4FLSA 2CZNA 3LOWA 1UWFA 4HJIA 5FYLH 3GXTA 4QHMB 5J6GB 2BSED 2W60A 4AVKA 1QHOA 3RY6A 3BISA 3L1EA 3DX7A 3SY0A 5JXED 1WAAE 4J3WA 4KJPD 4LP5A 3QZPA 4WTWA 2M2DA 3KPQA 5EBLA 5FKPA 3T3MB 4M8QA 5T5NG 3F00A 1PX3A 3INUL 1F6AA 3DA0A 2IH3B 4YNYA 1ZLVH 5DEGA 7TAAA 4K8RD 4RQQA 3WJLA 1JXDA 3VD2A 2JJUA 4ALAC 1N18A 3HI6L 4NM8H 5C6TL 1M2OA 3VU2A 4MA8H 4Q6YA 5AW3B 2WMPB 4IRSD 4O2CB 4P59L 5A40E 1U21A 2UWEB 1Z9PA 2R0LH 5DD3L 4I18B 1E9PB 4BGDA 5KTEH 2FATH 4OZHF 4AIEA 5CD3A 2KS0A 1N2RB 1BVLA 2NDFA 4OR1A 4PJ5B 3SCMD 2V9TA 2YFNA 1N19A 3OPUA 4KGLA 1RH8A 3HPLB 5AB2A 5KSUB 3MJGX 2HZHA 2I69A 2OCCB 1RUQH 2YD5A 3NJLA 1OWWA 2XN9B 3ZZQA 4H0LC 3BKCH 5F70A 4LBEA 4ZX4A 1KTRL 4NXKA 2OK0L 1G87A 5AL0A 1B0IA 1OLZA 1ZGLP 2ZOUA 3CHQA 3H4HA 4R83A 1HZKA 5A16A 4OFYA 2QQKH 2CDGB 3O6LL 3GMNB 2DH2A 4QXGH 4ECNA 1A6UH 1CF8H 1WAPA 3WUZA 3QHTC 5A2CA 3PL6A 5I5JA 5EWIL 2YA1A 2Y23A 4JAMA 3DVNA 3MJ7A 1TUPA 1KYOJ 4PJ8A 2ZG2A 5IK3B 3OAYH 1ZT1B 3U4AA 3IDMA 3MCKA 4JPKH 1SMAA 1N0LA 4YHNA 2OV0A 2ICWI 3PV7A 2HJKA 1E8YA 2HH0L 2LVCA 2QR0A 3G6AB 4FQLH 3ETTA 2Y7OA 3R1GH 3DX9B 4QXUH 3EJUA 2ZKWA 2R0KH 2WC7A 2BZ7A 5T3XD 1IVLA 2DLFH 2Z91A 5DO2D 3NCJH 2PR9A 5E00A 3FFDA 3ILQD 2X42A 1L7TH 4G3YL 2WZ5A 4GRMA 2F7RA 2VXTL 4NCC2 3BUPA 4XP6H 5CWSB 5AKVA 5C0JA 3ZMRA 4Y19E 5I1JL 2DB8A 4AVIA 4FP8H 3VFTB 1NOAA 4MBRA 4TLKA 4CN4A 3GMRB 3V52H 2Z8SA 1U4FA 4PH8A 1MI5D 2YUXA 1KLUB 2Z4TA 4I9XA 4NKDB 5F3HB 2PXYD 3M1OA 4WU5B 1B4JL 1JGUL 3DTXB 3OXSA 2VUOA 3ZY7A 5KAQG 1HZHL 1MAKA 1JPTL 4FXGA 3A67H 3ME0A 4AYFB 5AWNL 2W0LA 1NL0L 2K7QA 4URKA 3LPGA 2Y3NA 1SVZA 3NGBB 1MLCA 1XIWA 3G6DH 4PFEA 3H56A 1L9SA 2D7MA 4N25A 5J8OA 3MOBH 2M26A 1CS6A 5EN2A 1B9KA 1DBJH 1EZLA 1XZ0B 4KXAA 4WUKH 4A63A 4EKJA 1EDQA