3Q06A

An induced fit mechanism regulates p53 dna binding kinetics to confer sequence specificity
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
231
structure length
231
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFVQLAKTVPVQLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKKKTMDGEYFTLQIRGRERFEQFRERNEALELKDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/dna
molecule keywords Cellular tumor antigen p53
publication title An induced fit mechanism regulates p53 DNA binding kinetics to confer sequence specificity.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3q06A00
2WGXA 4IBZA 1HJCA 2IOMA 2X0WA 3Q05A 3WTYA 1IO4C 4AGMA 5G4MA 4IBTA 1HU8A 3EXLA 4LOEA 2GEQA 2J1YA 4A63A 1EAQA 3TS8A 1T4WA 4LOFA 2J1WA 2XWCA 1LJMA 5A7BA 4MZIA 5AOMA 1CMOA 5LAPA 5LGYA 4IBQA 1HJBC 4HJEA 2BIQA 5AOIA 3IGKA 3D0AA 4KVPA 2BIMA 4AGOA 1TSRA 2MEJB 3D08A 5AB9A 3ZMEA 2BINA 3D05A 2XWRA 2J20A 3D09A 4L0YA 2J21A 2J1XA 4GUOA 4AGLA 4QO1B 4AGPA 3QYMA 2BIOA 2FEJA 5G4NA 2VUKA 3IGLA 2OCJA 2ATAA 3WU1A 4AGNA 3D06A 4XR8C 4GUQA 4LO9A 1H9DA 5AOJA 4IBSA 2J1ZA 2X0VA 3Q06A 3WTUA 3WTXA 1YCSA 3Q01A 2ADYA 4L18A 4IJTA 4G83A 2P52A 4L0ZA 4MZRA 1TUPA 5ABAA 2IOOA 3US0A 2YBGA 5G4OA 3WTVA 1EAOA 3D07A 5AOKA 4IBVA 2AC0A 4G82A 4AGQA 2H1LM 1GZHA 3US1A 2IOIA 1GZHC 1E50A 1UOLA 4IBWA 3KZ8A 3VD0A 1EANA 5ECGA 1CO1A 3WTTA 3VD1A 3KMDA 4IBYA 3VD2A 2BIPA 5AOLA 3WTSA 3QYNA 2PCXA 4IBUA 2RMNA 5KBDA 2AHIA 2X0UA 1KZYA 3WTWA 5BUAA 2J6WA 3EXJA
chains in the Genus database with same CATH superfamily
3BZFA 4BK5A 2Z7WA 3UTPE 1UWEH 4HEME 1JVOA 5E95B 5IKCA 4FD0A 4HD9A 3V2AR 4PJHA 2RIKA 3VXNA 1MCLA 5K9OA 1HU8A 1X5LA 2DM3A 3D2UB 4AEEA 1PYWA 1I8MB 4BZ1H 3WEAA 2BJML 2HX9A 2XNAA 4G5AA 2Y7OA 4U3CA 2WXFA 4JO1H 3MQIA 3DSFL 4F3FB 4HP5A 3W9DB 1ZOXA 1RZFL 1QSEA 4YWGH 3VVVA 1RIVL 5C0RL 1Q0YH 2P8PA 3DUSA 5C7XL 3LD8C 4ONGH 5L2KD 1IM9D 1JN6A 2WINA 3BWSA 4NKQB 1OF2B 5JIMA 4OLUL 3W1ZA 3AT9A 4HAGA 4ICXA 4W6WB 5CJQL 5IBUG 4R6UA 2ISDA 4YDNA 4NFBA 1SGKA 2NNFA 3RWIA 4HJSA 3OSVA 3NCYP 4UQCA 4X2UA 5GZNC 3WNJA 1U2CA 4NQVB 3NIGE 2MKWA 1M6OA 3PCYA 3EZJB 4AV5A 3W5NA 5I66A 1E65A 1B2WH 4NKIL 1J0YA 4L5FH 1D5MB 2X1WL 4PJFF 1SRDA 1K5NA 5EC2A 5IJKC 1OW0C 5ITFB 3T3PF 1DE4B 2IPTL 3WHXA 3C5ZA 4PJ9C 3GM0A 3NABH 3DUUA 2V2WA 4RFNC 2ARWA 3GSQA 5EZIH 4A2EA 1DN2A 5ABAA 3O0RL 5E1HB 2YGPA 3FPXA 3RVTD 1S9YA 2Y07L 4I18B 2X9WA 1SYVA 4K71C 4PTTA 4N0UB 2Q8AH 1OB1A 1TQBB 3ES6B 1TNMA 1AQDB 3GI8H 4JKPH 3ULVF 1DSYA 2NY1B 4GRLA 3ROLB 3TBYB 3DPDA 2OSWA 3BN3B 4ZMPA 1MI5D 3DBXB 1JZ6A 3MCG1 1HDMB 4KTYA 2XXFA 3WIIL 1MCKA 3LSOA 5EF0A 4HPHA 1HHKA 3F7YA 1GGCL 1WAAA 3MLUL 4PJCF 1XB6A 1U30A 1AS6A 1KF9B 3H9SE 5GS0H 1GXEA 3BSHA 2VDKH 2BIHA 4KBPA 4N0YL 5MEOB 2H2PC 3QYNA 3QDAA 1HWHB 2CHNA 5AWNL 3T0BA 1A9VA 5DQDH 1C5DA 1PNDA 4WV1A 2GUYA 1ZEAH 4EQ2A 1FLRL 4DGVH 4ESKA 1QFWI 2HG5B 3FT0A 4OLZL 4OJEH 4F15C 4NWTL 3CZEA 4XH2A 3X14B 2OTWB 2DQHH 4QHKJ 4D7BA 5D5ME 4ZMOA 3WMPA 1NCBL 3M8OL 4EZMA 4IS6A 1VACA 1OP5H 3VFRA 2DL9A 1D9KB 1FO0B 1KTRL 4K8RH 1IVTA 3E2HB 3LYRA 1J11A 3IJ7A 4LSQL 4MAYD 4P57A 4BWWA 1AQHA 3ZHNA 1WPCA 4M6ML 3E6HA 1XX9C 1LJMA 1MJJA 2H1PH 3H3PH 4OD3H 4DUXA 1I1FA 4Z3JA 2WSPA 4LSUH 3F01A 1T0NB 1R17A 2BHFA 2WXJA 5ILTL 1AQKH 4RESB 1E27B 4M61A 1BX2A 1U58A 3EJQA 5J1SC 1F8TL 1XF5B 1PSKL 3CFMA 3I75B 3KJ4C 3UTSB 5LJYH 5LQBH 5LUMA 2H32B 2YAPA 5FYJE 4B95C 4Z7VF 4L0YA 1A9BA 1ADQH 1I1RA 5C0BE 5PAZA 5F7WC 3H2WA 5T3ZL 5AAWA 4JX0A 3ESMA 1UM6L 3NFNA 2W81C 2O4EA 2ZXAA 1NAMA 4G7SB 3IJYA 2J8UE 2Q9OA 2ORBH 3CSTA 4WF7A 1HH6A 1G1OA 4GAFB 3WJJA 2EDYA 3V0VA 1JV5B 2WUBH 4PN6A 4R5XA 1PS3A 3IRZA 5CP7B 4JKKA 3O45A 2H32H 2QVTA 3KM2A 4B7LA 2AI0H 2XV3A 3UPAA 4WGVB 1FFTB 2EXWD 3D3VE 3U6XA 4FQQA 4XN7A 4WFHD 4EAEA 3UBHA 1EWHA 4ONHA 1SVZA 3DGDA 1JPTH 1PBYA 3EW3B 2QQLH 4YL9A 3ME0A 4GJTB 4HUXA 2ZP0T 3BPCA 3FT1A 5TH2B 3EYVB 1OSEA 1TZGH 4EUPG 2GC4C 1I3GL 3CZKA 2XHNA 1D5BA 1DL7H 3CMGA 3SBQA 4BCYA 5E08H 3SCMC 1G9NH 1PG7L 3JT0A 4MA3B 4AQ8C 1UH4A 3HUJF 4MVBC 2Q76B 3QIWB 3ARDD 4U1LA 4AC2A 3B4NA 3GSNB 4FLHA 3BSZA 43C9B 1B4JL 4FXGB 2AV1A 2ICEA 1I7ZB 3TCTA 4YR6B 3GXIA 2PNDA 5LN4A 4YXLL 1SXBA 2IXQB 5AZEH 2XA8L 3VFTB 3FN0H 4YHPA 1KZQA 2W8CA 4PJFB 3BC9A 4AQ1A 2F7RA 4FMVA 1S8DA 2BXYA 4PB0L 2J2ZB 2XX1A 3SYOA 1MFAH 1ZIAA 4UV4H 4PLKC 3G5XB 3BKJH 3BMVA 2BNRE 4WWOA 3CUPA 3T3PB 1FBIH 3TEZA 2EYRA 3B2XA 1HZKA 2CO4A 4N2DA 4N3UA 4IRZH 2DWTA 4NFDA 2KYIA 1GOGA 1Q1JL 4WGWB 3BVUA 2AAAA 3WIFA 3VXUB 5I0XA 5FYLE 4JFFE 1WBYA 4ORZC 4U33A 1Z66A 3GSNH 3FXIC 5MEPB 1WZMA 2AXFB 3BFOA 3E1F1 4OGXH 2DQFA 4XWGH 3TBWB 1Y07A 5J6GA 2C8NA 1NIBA 4KJYA 3K2IA 4FOMA 4HUUB 1ZXQA 3UCRA 5FO7B 4PCSA 2GJ6E 3NA9H 1DO6A 4KVNH 1AHWC 2BIQA 4L8SB 4RMQA 1NGXB 2DICA 4G3YH 1H8NA 5IK3B 3R18A 4MNQD 2IALB 2AK4E 3CXDH 3F7PC 4Z78A 2YXFA 5H2BA 3I6LE 1KJ3H 1PZAA 8FABB 2X1QA 2APBA 2FB4H 4C59B 2ZJSH 4J3WA 2AEIT 1J48A 1CFNB 1KNOA 1RUQH 4Y19E 3LQAC 3WL9A 3MV7A 4PLJC 3K80A 2D3LA 5CN2A 3JV6B 4HGMA 3INUL 2VLKB 3ULVH 2G4GA 1IGCH 3IDGA 3A0OA 4OCYH 4RGNE 2PXYA 3CE1A 2R7EB 1Z5LA 4P2QA 4QXGH 4D3CH 2WXRA 4NN7B 1XFPA 1PY4A 1T0OA 1ORSB 4A04A 1FVCA 3GSRA 1XSIA 1U8JB 3NSCA 4WSJA 2KUTA 3CVIH 4Y1SA 1QRNA 5FA4A 1Y6NR 4IOSA 3DI2B 1KCUL 2YRLA 4O51B 1KB5L 1A0QL 2HT4D 2CM6A 2WCGA 4XVSH 5FAAA 1NGWA 4K7FB 4PGEA 3NH7L 4UDTA 3KPSE 1SLWA 1TIUA 4C4BA 5LDUA 1VZIA 1TLMA 3DDFA 4WU5A 3AROA 5AL8A 4QRQA 5FF6A 3ATEA 1CGTA 4E9WA 4Z3GA 1ZK5A 5CGMA 5D7JC 2H45A 4ZW5A 1ZY9A 4NQEA 4PV8A 3VXRE 2CLVA 4AMKH 4ZODA 3O3BA 2GIMA 2E6JA 4LOUC 4P2YA 4HIPA 7TAAA 4S0HA 1G9EA 4L3AA 4N2BA 4A6YA 5JPMB 4OCXH 3H2QA 5DSCA 3C60A 4WEBL 4F2MA 2OK0H 1FORH 1SN0A 3I9GL 2VIRA 2QSCL 1TCRB 3CDGB 2ITDB 3RGVA 1EDHA 4KTGA 3D52A 3UC0L 3VD3A 1XD1A 3ETTA 5BZZA 2BFVH 1YEJL 4ANXA 4NQTA 3UGXA 4K9JA 2BWDA 4KO5A 4X5PA 2DQCL 5FM5M 1ZLWK 4NJ9L 5I0WA 1NFIB 4H8WC 3CFDA 4PI0A 3SBPA 2J1YA 3LH8A 4TS6A 4XMPH 2VC2L 3O4LD 4MZIA 3AWFA 5A1AA 2CKBL 1A21A 2MTPA 2Z35B 4G8AC 3HAEG 1QO3A 2YD0A 4UOJA 2VDNL 1DVTA 2XOTA 1QQDA 4Z95H 3VI3B 2VMCA 3QIBD 3ZDXE 1JYVA 4FERA 4K3GA 4WU7A 5DFAA 2FT8A 4G8EB 5IW3A 3S37L 4NQXA 4HV8B 4OAWA 1RLWA 1SQ2N 1RURH 3VRLE 2DMKA 1U3NA 1RK1B 4P5SA 5FW6A 2BIOA 4K5PA 2CZNA 1UCBH 3TT3L 3L48A 4ZMTA 1WQVT 2P42B 4ZTPH 5HGBB 3WXWL 4JN1H 1W0WB 4LVNB 4FFWD 4G6FB 1XBDA 3U0WL 4PU2A 3X12B 4G1MA 2HJKA 3TASA 2Z7ZA 1WAEA 3GDCA 2NXYD 3SPIA 3UZQA 3K6SA 5E6ID 2B9AA 2QMJA 4QXUH 1WISA 3LRMA 3P4MA 4DGIH 3RNQA 1BJMA 3C5ZC 2XN2A 1V7NL 3L4TA 2VJXA 5INCB 3CH1B 1YEKH 3SDCA 1TZIB 3A47A 2B20A 1JPEA 1CXIA 4LVOC 5C2BL 2ZXDA 3UXFA 4KTDL 5IMOA 3Q2LA 2ED6A 2QTVA 5IWLA 4YIQA 4X9GA 4FQHB 5SWZA 2C3HA 1URIA 2OR9L 1MCOL 3T0DA 1A1OA 3DURA 4KPHL 3QQXA 4M48L 1G0XA 3VI4F 1Q9KA 4F8QA 3QCTL 1UEMA 5IEHB 1S78C 3AC0A 1TMCB 3BPLC 1JS4A 1X44A 3JTBA 4XX1G 3QDMD 5LWYH 4WK0B 2GJZA 2AGJH 4KZCA 4Z77A 2VZVA 3ZT6A 1DUYB 1SDAB 1AE6H 4Z3IA 4X42A 4FADA 4HUNB 1N8ZB 2XKNB 3BPNB 1XEUA 3BD5A 5E2VH 1N8OE 4UT6A 1A3LH 1WK0A 3IU4H 5IT2L 4DW2H 5I73C 4E9SA 3WELA 4C54A 3KL5A 2QPFA 4HK0A 4XP5L 4QDGA 2F5AH 5DK2A 4PJXF 4FFYA 2MCMA 5DLMH 1IAKA 2JKLA 1ASOA 3OXRA 4JO2H 3DJRA 3M17A 3TH2T 4ENEC 2LU3A 1BQLL 2WZ6A 3F7VA 4LKCB 2F61A 1KLFB 4RH4A 4UM8B 1KC5H 1A64A 4P2RA 1LXMA 4KVCL 4Z8FL 4UM9D 1RUKH 5EF3A 1T83A 2P8LA 5DJDA 4CJ1A 4J2XA 1XV8A 4NQCE 1FFPB 2IGFL 4ETYA 3VG9C 1CMOA 3IDNA 3GRBA 2F8VA 1AZRA 1QVOB 3GSOB 4D8PA 1MY7A 1RZ8A 1JG9A 3DIFB 4TQIA 3GIZL 2ZP9A 1G9MH 5JXEC 4ODHL 1ZV9A 2IH3A 2ZYHA 1ZD6A 5C3IA 4POYA 2QR0A 3EKCA 3JSSA 1YN6B 1SBSL 1CLVA 4HWZA 2J21A 4UTAH 2E7DA 5AAWC 2R51A 3Q1EA 4MQSB 2BY2A 3LB6C 1XGPA 3OKNA 5IHUH 2OL3H 1OPOA 3AVEA 3OG4B 4JEGB 4Q7DA 3EJUA 4C55A 3KGUA 3IMBA 3TV3H 3TBVB 4HFUL 3UAJD 4PYGA 4F9PA 1EXHA 3LS5H 3STBA 1X6NA 3C09B 1GYWA 4IBSA 3FU3A 1IE4A 3MV8D 5CSZA 5HHXH 4UMSA 4OI9A 1D6EB 4YDIL 3LPPA 4KUZH 3K46A 2ZXEB 3VFWA 2CLZA 3D39B 1D7FA 1QSFA 4N8VG 3BKYL 4OZGF 4U31A 1U3YA 3AS0A 4KRPC 4X4ME 5D5MB 2VLJA 2XSKA 2XG5B 2XUWA 3DRQA 3MGOA 2H0PA 3FTUA 2NY0C 4HD5A 3IDXL 3DARA 5DJZA 3ILQD 1XHHA 3KR3H 5DS8B 4X99A 4GP4B 3X13A 2VYRE 4XCEB 4OB5H 1RZFH 3RWCA 2I9LB 4NP9A 2P8MA 4U3SA 3ARSA 5GJTL 5KN5B 2FEDC 1ZPLA 4H0HB 2EEDA 5EUOE 2GPZA 4ZFZA 5IQ7L 3NZ8B 4APXA 2BSDA 4OLUH 2LU5A 5GS1C 1BZ7A 2NRDA 4QWWD 4HIHB 2JJWA 1NAML 3CMOH 5IQLA 4ZAKC 3UTTE 4XPFL 3ARGD 3GJFB 4BFIB 3GSUB 1KJMB 2HJLA 2NZIA 3IFPA 4KO9A 4N0RA 3RA7L 2AW2A 3SJVD 1XMEB 5EA0L 1P69B 5LO7A 3MJ8A 1OCCB 3K8KA 4KKLC 1TFPA 2A6JB 3QEUB 4Y4HD 2AVFA 3U6XS 4L8BA 5HYJE 1AD0B 2P5EA 3RWJA 3Q2CA 4YK4C 5I1DB 2VLRD 5BRZA 1KCBA 1E5YA 5DVMA 3KLHC 4HCGA 1MFBL 3VXSA 3UZVB 5C08E 5D93C 2IPTH 2WQSA 4LPCA 2BP8B 1AC6A 4KK8D 3ARBA 4DVBB 1QEWA 1X6LA 2GCYA 3EJZD 2W88A 4HJGA 1XSOA 3ARWA 4L1HA 3GMNA 2V37A 3SDXF 1NBZB 3KS0H 3NMEA 2FSDA 3OKEA 3D3VB 4IOFC 4BYHA 4EXKA 1KG0B 4WI8A 2ZIDA 3TF7C 2Y07H 1Y1UA 3KBFA 4PJ9B 3W0WA 3NAAL 3QUYA 1LO5B 3ZT5A 1G5AA 4PRHA 4RFNB 3ABGA 3QHFL 2DD8L 1KCLA 1SN5A 2ICES 5ADOL 1UA6L 1WICA 2W0FA 1M7UA 4NNPL 5F3HB 1RUML 4FKEA 3P3YA 4M7LL 3PDOA 4ALAL 3S35L 2O6PA 3BSZL 3EGSA 4OUOA 3WIIH 2J73A 1NMAL 3X11A 3REWB 3I50L 3U9UA 4X6CA 4K71B 32C2B 4PVLA 2FJGA 1E3XA 5KVFH 4OLXL 1HEZA 1CLCA 2WWMC 4AGLA 5B3SB 1I3RB 4N0YH 4JM2A 3UROR 1YEEL 1TQUA 1INDH 4FG2A 3B7SA 3FO0H 4EVNB 4JK0D 1V8HA 1FLRH 1W15A 2IAND 4ZD3L 4DF9A 4JL1A 1HS6A 5M95B 4H1LG 2N7BA 2NQCA 5F9AC 3QVAA 3ULSB 1H9DA 4OLZH 1SEQL 5ITBL 1WBZB 4NWTH 3S3CB 4NWUL 4Z0BL 4ELMF 2PXYC 2BNRB 2X1XR 5AVYB 3RWHA 3M8OH 3QUZA 4OV5B 1KCVL 3F84A 4GKLA 4S1DC 5I26A 3OJDA 4E2OA 2HT2C 3ZDZF 1ZV2A 1WFOA 1NCTA 2Z6FA 1GY1A 1KBVA 2ENSA 3IDUA 3FRUA 4P5RA 4L0ZA 4LSQH 3ISRA 1ZT1B 1MUJA 4OZ4B 4M6MH 3V4UL 4PD4K 3ZZSA 4F15B 2BY1A 2WLJA 5FECA 4P2CG 3F5WB 1FZJB 3D07A 3T1FB 2W92A 5KSAC 2VR4A 1AP2A 2P24B 2W9DL 1W72B 4M6OL 5B21A 2NY2C 2XBDA 2NPLX 4OVVA 3VM7A 3OKOB 3MXVH 2OAAA 5ILTH 2JIXA 4A7SA 1PSKH 2CO6B 5FIEA 4I9WD 3S4SB 1DQMH 3FFDB 4FP8H 4WO4D 1MAKA 2YGOA 3MA9H 5E2UH 3SY6A 2NNAA 1BFTA 2L04A 1NGZB 1PKQE 3WTTA 2FHCA 4YXHL 2Y1ZA 2NLJB 2R83A 3GUTB 4FHJA 1TVDA 4KZDL 3M1OA 5G2NA 3TBTB 3KJ4B 1YQ2A 4G42A 3QFJA 2PCXA 3VACA 5E2WH 3QRGL 2IAMD 2XV0A 4W9EC 2KPWA 2WMPB 4Y19B 2EDHA 3JTSB 1MWAB 4GUCA 2ARJA 3FQNB 1BA9A 4HVBA 3ZE1B 2WM0A 4A55A 5IGXL 3TXAA 1GS7A 4QJ5B 1DJIA 3V52L 3EXJA 3RE0A 3PYCA 2LFGA 5ICXB 4QKXB 1JD9A 2VRQA 1P4UA 3KPQB 4YQXH 5DO2D 4HULB 3TX4A 1BVKA 1OL0A 1DBMH 4BSVB 1DFBH 3M07A 3HC3L 3IETB 1P2CA 3IXTB 4GI6A 2ITFA 5C86A 5IM7A 2DWDA 2W07A 4AYMC 5I17A 4RVBA 1CYWA 4JFOB 4PJHF 2E4TA 3VE0A 1A02N 4EEEA 3KPSB 4J12A 1OK8A 2Q7NA 2WLKA 3CFBB 3HZMB 2X89A 2Q86A 3DRTB 1FF5A 1L6XA 2Y2TA 3E6FB 3TT1L 2C9RA 4A6YL 2NXZC 4YDKL 2CA4A 3T2QA 4YJZL 2YD9A 3DO7B 2UV3A 4AQZA 4B9JA 1ZHNA 3AY4C 4JZOB 2B77A 2KZ1B 1B4JH 2VDOB 4HPOL 1C5BL 2IMMA 5DYOA 5HI3D 4M7KL 1KGYE 1NL0L 1MFCL 2XA8H 3I02B 4J4PD 4N2GA 4XAWL 3T65A 3SCMB 4LGRB 3BAEL 3PNWB 3P4NA 3L4XA 3S7GA 2E59A 1WWAX 2IDQA 4PB0H 4V1DE 1YY9D 4W9KC 4DKTA 5IR1B 5D7IA 4XX1E 4NZJA 2ODIA 4WNQA 3HKZA 3Q06A 2IC2A 5T1LA 4AL8L 2J57A 5IBUB 4XE0A 4XMZA 5F6HI 4L2YA 2GIXA 3FUEA 5D9SA 5C6PB 4FQIL 1D5ZA 3SDCC 1RIUH 1UXSA 1T1WB 1DBJH 2B1HL 3APCA 4OF7A 3Q9QA 4GLRI 3MFFB 3E3QE 4ZMNA 1I7UB 4ZZFA 2A4ZA 3P4LA 1WA1X 1ZK9A 3BHBA 1ZTXL 2QQKH 3EF7A 3CFJB 3UYPA 4KU1A 1JV2B 3SDDC 3WFEL 43CAB 4QHMA 3QULB 4ANKA 1XIWB 1PZCA 1OE2A 3D0LB 2HVKA 3P2TA 1TZOA 1ZE3H 1FL6A 3IXAB 3FB5B 4ENZA 1RZJL 1AHWB 3DC0A 5EU5B 4G11A 3B3BA 4LHQB 4P05A 5MENE 4GBXD 1RULL 3GXTA 1TQSA 3CVHB 2LAAA 4BSJA 6CGTA 1LWHA 1HOEA 1NQBA 5DT1L 1V54B 2GJPA 2QGDA 5C0AA 1WAAF 3INUH 4JFYB 3Q5TA 2WLIA 1TVBA 3HB3C 3MUUA 3QIUA 2XQ0A 1RHHA 4NHCH 2AMGA 2NTFB 4YDVA 4F5CE 3MRPA 4MQTB 1U8OB 15C8H 2VABB 1G87A 2GJJA 3O2WL 4ZXBD 4TVUA 4H0LC 3C9NA 2FJSA 3L3IB 4WI9A 2CCVA 3O9WD 5CEYA 4NIKB 4PBXA 3GMMB 5AYUH 5MERB 2XXMB 3STLA 4PWJA 2B4CL 4RBPK 5HDBF 4NNYB 4B3VA 1X4XA 4JFHE 4XB7A 2Y5TB 4OCWL 3GXMA 1WP6A 2FTAA 4FCHA 2CIKB 2Z92B 1MPAL 1T83C 4N9OB 4F9LA 1KCUH 3HCVB 3CVHH 2ICWA 1PLGL 4L5FE 4JS7A 3P9LB 3RAJH 3VXME 1EAPA 1JXJA 3FTSA 3ARQA 1QTYT 3CHPA 3IFLL 2YKLL 3S0PA 1ZANL 3C87A 5TK2A 3V8CA 4GW5A 3LQAH 3ZRSA 3RGBA 3R1GL 5JDSA 3GO1H 3EGDB 4Y16A 3RIFK 3BT2H 4UT6L 1CD1A 1DR9A 1E8ZA 3AJ7A 3D9AL 2AK1L 4PREA 4C83B 4LT7A 5JOEA 1AVAA 2YUWA 3F58L 3MV9E 4JVUA 4NKDA 3ZHDA 5TF1L 1YNTA 3AGVA 4JHBA 4LLQB 1U8KB 2OM5A 4FFYL 3VTMA 2GIYA 2Y25A 2ZWKA 1ZDQA 3ETBJ 3I9GH 5D7JB 5F1IA 5AYTA 3SDYH 2QSCH 3WNMA 5DMYA 2NR6A 1OT2A 4TVPL 4L8DB 4ZFOB 1NEZG 1N9PA 1PIGA 1RKRA 3ILDA 5CBEB 5DHYB 1MG2C 3UDWA 4HGWA 5K1VA 5IQ9A 4LK4A 5KVGL 1KCSL 4BE6A 2DQCH 1NWOA 2OLDA 4P4KA 5K59F 4W6XB 3JYBA 1IC4H 4NJ9H 3BUYA 4OSUL 5C0EB 4QAMB 1QP1A 1OWRM 2HB0A 2VC2H 2FAUA 2JKJA 2FVNA 4N2AA 3VWJA 3IRPX 1SUHA 1A6TA 4KQ0A 3L81A 3NCXA 2AC0A 1F6FB 4JDVA 2VDNH 1O9WA 4OCSL 5CXPA 5FA3A 3OMAB 1IBDA 4ABUA 3V6ZB 4DZBA 1JFQL 2UUDH 5E9DB 1I1YB 3KYNA 4R90H 1AGCB 2COVD 5I71C 2XQYA 5D8JL 5IFHL 2GC7C 3NCYS 3B37A 3QQ3B 2ICCA 1RK7A 3B9VA 2VXTH 4NKOA 4R2GC 4XVTL 3WXVL 3I84A 5DI8A 5C9KA 2I32A 2WB7A 1MLBB 3KYKL 2CBPA 3R8BB 3TT3H 5I8CB 4LHJB 3T6QC 1N0XH 3UJIL 3WFCH 3RDTC 1OIOA 3VD4A 2FH8A 5JW4Q 1NC2A 1MSPA 3ULUC 4D94A 5EOCJ 3VM5A 4AQEA 2NYYC 5C0CA 4EUPB 2CRMA 4X5LA 4RNRA 5D1XC 2UZPA 3OJMB 4GRWF 1UYWL 1AXTL 4GO9A 1HHJB 4U1NA 4IBZA 2WQRA 2Y5EA 1FNSL 3VX1A 3ZE0E 2WO2B 1BECA 3IK2A 3QI9C 3QUMB 4JN2B 5D7EA 1I8KB 3MBWA 1DQDH 1WGOA 1AIFA 2DH3A 5C2BH 4KTDH 4N0FB 4W81A 5F7FA 3HHMA 4HT1H 4TNVK 4WTZA 2B15A 2M2DA 5GGSB 1G7PB 4J6RL 4Y88A 1DFXA 4JRXB 3VFUA 3FL7A 1FJ1B 2J43A 3EJYD 2UY7A 4WHDA 1AXSB 2OR9H 5B1KA 5SX4H 3KCPB 1YMMA 2L7EA 4KPHH 1XGYH 4LVOB 1MNNA 4M48H 4J23A 1BAFL 2V9TA 3I6KA 5ENWA 1FFQA 5D1ZA 4ZTEA 2BINA 1S9YB 3QUMH 4GXUN 4N2LA 1AKPA 1SYVB 1MVUB 1KIQA 3MLTA 3OLIA 2R29A 4C56E 1NPUA 3MLVL 2VZ1A 3UTTB 3AM8A 3ZOAA 2FO4A 3EGXA 4JM2C 4ZW3A 4CSPA 5IT2H 1GZQA 3BPLB 5CZRA 2GITA 4I89A 1UACL 1I8UA 2ZCHH 3ZTJG 1A6ZA 2H9GB 2X4SA 4NUJA 3ZIYA 1NGYB 1KPVA 1SEBB 3PRZA 3O2VL 4OLWL 4XP5H 5FGCE 4ZX5A 3RVXC 4ONOA 4JQIH 4PJ7A 3TA3C 3IPEA 5BRPA 3DVGB 3QUZC 1N3NB 4JG1H 5I73B 1KTDB 1K3IA 1HSBA 4EDXA 3CTTA 4Q6YA 2ED8A 2FATL 3NESA 1YY8B 3UL4A 1A7OL 4I2XE 4LLUA 2YLHA 3TNMA 3IWVA 2KZWA 5CF3A 4FRWA 2DM2A 4LCCA 3JV4A 5EBLB 5LXVA 1DJGA 4KUCF 5AOKA 1NJ9B 2E86A 1CC3A 3KH4A 3GYRA 1VACB 4JANB 2NW3A 3KEDA 4ODHH 5HDQL 3W56A 2WOBA 2VISB 1E40A 4BFKA 5MHSE 2OBGA 4FTVB 1I85C 5J6HA 1SBSH 4J7RA 2WVUA 3BFQG 3VG9B 3BVNB 3BESR 3NACL 5FHAL 4NDMA 3PFQA 1FVEB 3CZSA 3GEFA 3PWLA 4HWBA 2YRBA 3BQUC 1OO2A 3VXQB 2EC9T 1KT2A 2G3ZA 3Q5OA 2V33A 5CP3A 2Y1YA 2CNYA 1GRWA 3MX0B 3AG2B 3MA7A 4GKZB 1UWFA 4N28A 5I6NA 3SBRA 4WFFD 4FQLL 1GKEA 3TYFA 3F6LA 4MCYB 3NRFA 4M1DL 4YDIH 1U3HA 1FFNB 4JL2A 3NFNB 2DIAA 2VDMB 3QPQD 4WY7H 4XZ4A 5DQ9B 5HY9A 2Y9RT 4AGMA 3IKKA 2E7BA 2ITCB 3GBDA 3MKKA 1J5IA 3CFUA 4RIRA 2BMKA 4HH8A 3IDXH 4GMSL 4WHYG 2G30A 1TFHA 4ZW7A 2VE6B 4CC1A 1FYTD 4AZ8A 3SGJC 1ODUA 1XF4A 4LDEB 4PV9A 1KTLA 3CPUA 5HI5D 4A68A 4PWIA 4DKAA 4KRPB 5JW5A 2FL5A 1PLCA 4QHKI 5GJTH 4UQEA 4PGDB 5EOCL 2NY0B 4GKNA 3ULVE 1YYLL 4N1HB 5IQ7H 3DX2A 3QDJD 3C6LD 1WC7A 5F7KC 4K23H 4PJCE 4JFED 5KSUA 4HJ0D 3IJ8A 1NAMH 2ICWJ 2O30A 1JPFB 3UADA 1ACYL 3Q48A 1MNUH 1TQCC 3MZTA 2ZT9C 3MLWL 1PKQB 3KPRB 4M03A 3RA7H 5IIEB 4FDWA 2AKRA 3KWUA 3N85L 3WGVB 3FQXB 1VFBA 5EA0H 1CCZA 4O00A 1OAXL 4NBYB 1YEFL 4KOCA 4OJCA 1JPST 2W38A 3HAEB 5GS1B 1JYXA 3HZKA 3DOIA 2KH2B 4ZAKB 1MFBH 2BRRL 2R9HD 5EO9B 3G08B 3RVWC 5IJVB 5EFIA 1RZ7L 1WFTA 4N20A 4YDZA 1XH3A 1IGTA 2BX5A 4K7PX 3DDGA 4PGJA 3FFCD 5L2KA 4NHUB 5I6OA 4KMLB 1IM9A 1YA5A 1GCFA 2GSIB 4YK4B 2WVTA 3X17A 5CLWA 5ID0B 3MO1A 3JWOL 3IDMB 4ZSOA 1NM9A 1T1YB 2F74A 3K1KC 1YN7A 4ZO9A 4CBPA 3CUPB 5LNEA 3OAYH 3QR1A 2YD1A 2DMHA 2A9BA 4FABH 1OEZW 2CHDA 5JOFB 3SQOL 1LD9A 3QHFH 4Q8BA 2DD8H 1CFTA 4Z7OE 5ADOH 2QVMA 4M5YL 1WFMA 5IVZA 3PABB 4NNPH 3I85A 2EIZB 4M7LH 1KELL 4GRWH 4ALAH 3S35H 2EUZA 2IFGA 1CLOL 3BSZH 4XWOC 5JNYB 2NY6C 3B8YA 4I0PD 1NMAH 4YSCA 3VD0A 3DHJA 5TDPA 3SEPA 1D5XB 4Z7VE 2WJ7A 1S7TB 4OLXH 3MR9B 3WCYA 2BVPB 5BJTB 1ES0B 4E41A 5FO8B 1YEEH 5DVKA 2IDFA 3D2UD 4ZD3H 1M3IA 3FHEA 3MCKB 2JELL 4HFWA 3HC4L 4APQC 4HHWA 2OMUB 1K2DB 4HBCL 4KKQA 5H2BB 1H3XA 4LLVA 3W11C 3IYLW 5KYWA 4NWUH 1AZNA 3GGWB 2DWXA 3LZQA 3ATDA 5CIPB 4LIQE 4DOHE 1E5UI 1KCVH 1A47A 3H8NA 4U4BA 2C3VA 1A22B 4E9VA 3ZKMC 1MCPL 1MI5A 4QRPE 5K1JA 3TH3T 4E9LA 1QA9A 3DX8A 1LNUA 2K8MA 1PEWA 3MUGB 1JWUA 5GIRA 5I6LA 2LABA 5EF1A 1SM3L 2QJDA 4MLSA 3OBAA 2W9DH 5SX5K 3UTZB 3FB6A 4OFQA 3TJHD 3VH8G 4TSCL 3P3SA 2NTSP 1KIRA 4JB9L 3D69B 1FDLL 1H3WM 3P9MB 1BSIA 2GAZB 1QD0A 2W9LA 5CIPH 1P84K 5DMJB 3RTQC 3U2SB 1S3KL 3FQ2A 4ETQA 5IOKA 1NIEA 1U36A 1OTTD 4KJQD 5IB2A 5KSAB 2BW5A 4RMVA 1MLCB 4DKFL 1SDYA 2NY2B 3MBXL 4MQ7A 3S36X 4MCZA 3BD4A 3CHXA 3CFCL 2JXMB 3RB7A 1JZGA 4RFEB 4LBEB 3SPGA 1ZA3B 4DO4A 5GS0D 2B59B 3MNDA 1R19A 4AGNA 4HKZA 2A99A 3CXHK 4NQEB 1OGTA 3H42L 4R3SA 5IGXH 1L9NA 3O3BB 1QHQA 3B7RL 4JO3H 2MCPL 2NY1D 2Z0UA 1QTSA 1WFIA 1YJDL 2C7UB 4GAGL 2CO7B 5E8NB 4F2MB 2QKSA 5I8EB 1UD3A 3DETD 2D7NA 2ZKYA 2BFGA 1MOEA 1XH0A 3OMNB 4HWNA 4JPIA 5SX4I 1FZKB 4UT9A 1U8HA 5EZOL 5DVLA 1FN4A 3FUMA 1F42A 2FK9A 4QOKB 2WTRB 4PJIE 3T3MF 3CG8A 4OV6F 4TOYL 2XXGA 4QR7A 5BQ7B 1JNHB 3PGFH 3TYGH 2GKIA 4N8VB 1M05B 3B56A 3V8OA 3LAFA 3L8QA 4J1UB 1KDIA 3QJXA 2QLYA 3O3DA 4A6YH 4DUVA 4KKPA 1GJUA 4YDKH 2IQ9L 3FT3B 4FG0A 4KHXL 5LG1A 4POUB 4FQPA 4LFHG 4ZS6D 3D4CA 4ODUA 4FXTA 4HPOH 5AQ0A 4F7EA 1C5BH 3OG6B 5E4AA 3VD9A 1D9KD 3QHZL 4M7KH 1M1XA 2BIPA 1B0RA 4FEMA 1MFCH 3F7LA 5JA8B 3BIBX 1LO3H 3GMLA 4PBVC 2NXZB 1BLNA 3QNZA 4O2EA 5CEZD 2YD4A 4NC0B 1EVUA 1OSYA 1NCNA 1SOKA 1UWGL 3IE4A 4ILDA 1F0LA 4JFXA 2AQTA 2DQIL 4AL8H 1L9QA 3MRMA 1UFGA 4NAMA 3S3DB 1OV8A 3O81A 4FQIH 3ARXA 3ILPA 1S7RA 4QRTA 2ESVE 3ULUF 1OAQL 2R0ZL 3P11L 2DMBA 1BZOA 1S6NA 3FHQA 3HR6A 4RGMC 3ARDA 4KKRA 1EAQA 1OGAE 2ZWSA 3NT0A 5DZPA 4ZUVB 8CGTA 3QJUB 2YEVB 4OZHE 5F7UA 4N8CL 4G6AD 4WHTB 4BINA 4U0RC 1BQHG 1S2EA 2JK5A 4AJYV 4BFJA 3IJSB 4X4KA 3QO1B 3WOVA 3IFOB 3FUJA 4B50A 1IU1A 3UACA 3WFEH 3VFVB 5DJ0A 4X98A 1IAOA 2R59A 4WUUB 3EUDA 2WWNA 1QFHA 1F4XL 4M8VA 2X4NB 1WD9A 4YHZH 2GTWB 3GD1C 3MKGA 3FSZA 4TM9A 4B9GA 3SDDB 5E03A 1MCWW 5KOVC 3LKNA 1RULH 4I0KA 5DJ6A 3V10A 4AE0A 1IEBB 4IU3B 1J8RA 1K6QL 2VMDA 1E6JL 4ONFL 4OF0A 3MRGA 4UMGA 5DT1H 5JZ7C 4DP9X 5F8QC 4CJ0A 5J56B 3OKLB 4Q52A 3ETBF 4X6CF 3QJVB 5KJ4A 2QGCA 5IHZB 2Q10A 2E46A 1DBKL 3EYQD 5EBWB 1UXLA 1RJLB 5DD0L 3MRJA 3VO0A 3EHBC 4HU2A 5F88A 4JM2F 5L4IA 4N90D 5CGTA 1UQSB 4RETB 5BZXA 1XCWA 4G83A 2B4CH 3RU8H 4MNQA 1EHKB 2FEEL 1QWHA 2J88H 3HB3B 1F11A 5LCVL 1TXKA 3MOBH 1MPAH 3L6FA 3QIWD 1KPUB 3QZMA 1D3CA 3BVXA 4EDWH 3L54A 1RSFA 2CPCA 2K78A 2XG4A 4OTXL 4WQOA 4H1LB 1PLGH 5JHMA 5DUBA 4BFRA 4QXTA 4OJDH 3SB3A 4R5VA 4ZUTB 1P4IL 4JDEB 3WY4A 2CDEB 2O5YH 3UH8A 4UCFA 2R29L 2V8MA 1GH7A 3L1OL 4KY1L 1ZANH 3D18B 3OGCB 4HH9B 3QQ9D 4Y5YB 1M71A 2E75C 1E3FA 4UT6H 5DC9B 3D9AH 3WUWG 5I1JL 2AK1H 2HKAA 1I9RL 4KROC 3UBXA 4Z7NE 4Z76A 3F58H 2WQAA 3U25A 1GZPA 4L29B 1RZ8B 2ZKWA 5KZCB 3VXUD 3V4LA 1TKWA 4WIQA 1OARL 1QOKA 4UINH 4AM0A 5GGVY 2ZOWA 5GS3A 3NPZB 3O3UN 4WO0A 1A8ZA 4KMTL 4KI5F 1KLUB 1PL3A 2FX8L 1U8NA 4TNWK 4P3DB 1HYSD 4X7SL 5F3BB 5LLIC 5GGVL 1MRDH 3VJ6A 3ZKNC 1XR9A 1I9JL 1H8OA 5KVGH 1FCGA 2Z91B 4KAQH 3ARPA 4OIAA 4WW2A 5BV7C 1OT4A 4F92B 3B7UX 4Z7WE 3FC8A 3WNOA 2A83A 1MFDL 1VZHA 3K6OA 1KENH 4LCWE 2GJRA 1BGXL 2YD6A 1MZYA 4KV5F 5JOPD 2EIDA 3LKOA 4X8JB 2G75A 2AJXL 1IEHA 4TUJA 1JOIA 3OV6A 2CLZB 4MNGE 5DWUL 1OQXA 1AGDB 4OCSH 5CINH 5F7YC 3MYZA 1EX0A 3RJQB 2VR5A 4LSTH 2Q8BL 5CJXC 3VI4E 5DJZB 2IPUG 2VLKD 1TSRA 5FO9A 5D8JH 4R7NA 2OMYA 4PGBA 2LAGB 1RH8A 2X4TA 5KOMC 1U6AL 1Q72L 2Q2EB 2YQBA 3KXFA 4XVTH 2VW7A 3WXVH 5BVJA 5IQMA 1NBQA 4QO1B 3LRSA 2X70A 1J7VR 2BSTB 2WQXA 5I71B 3NJNA 2BNUB 2VMEA 1F4WL 4BH7B 1E9QA 4H44C 3RBSA 3O4LA 4M93B 1A8JH 3NUKA 4URKA 4R2GB 5IHLB 5AUMB 4FQJH 1UYWH 4N87A 1FGNL 1MFUA 2NW2B 2GFBB 1MIMH 1IUZA 1FNSH 4W9DC 4HZLA 1OP9A 1QBLL 4XMWA 3KPMB 5IB4A 3RDTB 3GINA 4BFEA 3QIBA 4E9TA 3LCYA 2ZXCA 2Y6TE 1QR1B 2J56A 4Y9CA 5T3ZE 4LU5L 5D1XB 2NY5C 3N06B 2FYVA 4J6RH 5D7IF 5DCCA 4XVUD 5F1KC 4NENA 2I25N 4IHOB 3F04A 3QI9B 3WS6C 3NZHL 4NBXB 2KLTA 1ID5I 4HJGB 4OUUB 1BAFH 5KYUA 4AEIH 3IJ9A 2WLZA 3CDZB 4HYTB 4L1SA 3W38A 1UT2A 2WKLA 4PJDE 1CVSC 3RHWK 5E6IA 4LEOB 3FCTA 4N4YB 3PIQB 2WK2A 1RP8A 4GQPH 3ULUH 4LQFH 5EF2A 4PJ5E 5ECJE 2FLRT 3QG6A 3CZLA 1Z3GL 5E2TL 3DXAE 3NJLA 1NIDA 5GRJL 3VMOA 3SSGA 4CVZA 3BP4A 3IDIB 1SJVA 5JHLA 2GHZA 1MCCA 1U8LB 1J8SA 2BPBA 3LY6A 3T8XB 3BP5A 4OLWH 1GGBH 3BEWB 3A6OA 3GFUA 4G9DB 2XTSA 1T5WB 2NY4C 2Y7SA 3P02A 3SQBB 3SD5A 4MQXC 2FNBA 1QWUA 4OZGE 1JGVH 2X4UB 35C8H 1LO4L 3KLDA 5EU6E 5ESVB 4GT0A 3BQVA 3U9WA 4G8FA 1B88A 3MRIA 5KYYA 1AO7E 3GB7A 3EXLA 3QDMA 4GG6A 3L1FA 1A7OH 1TENA 1CFSB 3ABMB 1DJZA 3RX9A 3ARVA 3TA3B 3UTOA 4W68A 3KBHE 4NFCA 1AD9B 2N4IA 1J86A 2WQ8A 3QUZB 3WN5A 4OZIA 3EJCA 1U91B 3V0GA 1K72A 3VXOA 2K7QA 5DK3A 2YBRB 3EH5B 3VRIB 5HDQH 5AD0B 3FRUB 4Z7OB 3EOTL 4G6FD 4H0IA 3D0VA 2RBLA 1FAKT 1KACB 1MUJB 1TZHB 4GUPA 5T1KB 3WEXB 4AXWA 1F3RB 1ZHLB 3EYUL 3JTTB 4A1RA 2UZYA 3PP4H 3TO4C 3A3YB 4LPYA 4MAUH 3UTPD 4FNTA 4Y2OB 4CC4A 5INDB 3FUDA 3FONB 2F19L 4UM9A 3OSKA 2HMID 2PTUA 3EFOB 4IMLB 3Q8EA 4JVPA 4N2OA 5EOTB 5DJXB 2F7IA 4U6VL 3OHXA 4KQ3L 4L4VA 2A6DA 4GOSA 2VGLM 3BQUB 3Q01A 4YLQT 2Z31B 2YIHA 4IK6A 1YNTF 4DOHB 1U95A 5L0QC 3DTUB 4BUHA 1INEH 4D2NA 2EDJA 5FKPB 4J39A 2F8OA 3QDGE 5KS9F 2RTTA 3SDXE 1QPKA 3QEQE 4ZQKB 4GG8A 4ZPVB 5DMIH 5I1LB 4QYAA 3WN6A 1NBVL 3CDFA 1T7WA 3US0A 3WD5L 2GK0A 1HHIB 3P40A 1ZLSL 3MRHA 4MB4A 1NOAA 5K93A 2XRAL 4MGXA 1IT9L 2NUPB 1TTAA 4X8XA 3ILEA 3FBKA 2ARJQ 2Q3XA 4IOIA 3L4VA 2DWEB 2C4FT 4L9LB 5F97E 1EHLL 5C07E 3UAJA 1HE8A 3ZQ9A 4KITB 4FN0A 3ZL4L 3N40F 2DYPB 4QHUA 4I87A 4M7JL 1CO1A 3RDJA 2AJVL 5CZXD 1Z6JT 1ACYH 4IRJC 2DYSB 3QG7L 2APXA 4Y8AA 1ET7A 4KXDA 1OAXH 4IKIA 1WA0X 2YD7A 1YEFH 3B2VH 3BVDB 3QB7C 5DHEA 4EZLA 1HN1A 3LKQA 2DWSA 5L9DH 5A7EA 4A2FA 1EZUA 4QRSB 4ODBD 4NI6A 1TQCB 1EEQA 2BRRH 1IKFH 5J3HD 3MN8A 1U8IA 1RZ7H 4ELME 4UT9L 1G7HA 1BREA 1G6RA 2XVKA 3HHRB 1VHPA 9PCYA 2P3YA 4OCRL 1ZLUK 5JHDE 4NJAL 1U92A 2OQJA 5J1AA 1UATA 4BA8A 5L4JA 3KVQA 4X50A 1RJYA 5DMGC 3ARGA 1M9SA 3OQ3B 3HRZC 4F24A 4D0DA 3SQOH 4HMCA 2PWEA 4IJ3C 5F7EH 2K45A 1X9LA 3DGCR 2K9FB 1NDTA 3S34L 1D6VL 2BSSA 4ZX3A 5I8OL 4Y4HA 2PP7A 2XFGB 4PJIB 5I8KL 1H3TA 3NVQA 1KJVA 4PUBL 5D2LA 4MKMA 3QO0B 2XWRA 1SMAA 5ESAB 1YPZA 4DN4L 3P54A 1RSYA 4DKEH 5KANI 4HEPA 1J8HE 3D39D 3FN3A 2EC9U 1UZ6F 3IU3A 1SJMA 2XZQL 3L08A 2DMGA 1OSZA 4K3HA 5G55A 2NY6B 3UCQA 3BFWA 5I9QC 4W93A 5JW3L 4ZNEE 3MROB 2DLFL 2JELH 5DJ8A 5F9WC 2YD3A 3D06A 4P46C 2CHZA 4HBCH 4JHUA 3ZSSA 5IB3B 4LO9A 1R3LA 2LFEA 2Z0BA 2WZ0A 2JQAA 3WI9A 1U8MA 2Z3FA 3SE4A 1CIUA 4EI5B 1JTPA 3ZKQD 1MCPH 1Q94A 3L2LA 2HCZX 1X9UA 4QTHA 4WK4B 3ROOB 4APQB 4LDLB 4MJIB 2ESVB 4MMYB 1WWCA 4R97C 1A4CA 4X0KA 3RGHA 1RHHB 2A77L 5EN2B 5LG6A 4FL4C 4PJ7F 4RLDA 3RI5F 3BH4A 1OGAB 3NFSH 4OZHB 1CF1A 4TSCH 5DEGA 3MTXA 4OT1L 1TOXA 4PJHE 1AMYA 2NCMA 2ZUWA 5CD3B 5GSRA 4G8IA 2Z1KA 2IANA 1UM5H 3BVTA 4OZFA 1J9TA 4KNTA 3NFPA 4ZFQA 5GZND 5CBAB 5FCSH 3IVKB 4DEPB 3T4AA 1OPGL 5HHVL 4DKFH 2G5BA 3GMPB 4JGJA 4P4RA 1QSEE 4JFQB 2LOEA 5JLZA 2R0KL 4GAJL 3RTQB 3KWWB 2PTVA 4J3SA 4CMHC 1Z9SB 5FGSA 1PEZA 1VCBC 4YAQB 3GSWA 1PAMA 1I7RB 2ATPA 1MHPH 4PJ9D 3H42H 4ZMQA 4HF5L 1KZYA 4XPHH 3EIFA 2XZAH 2VITB 3MLZL 2MCPH 5IVXE 4F7CA 5JIPA 3D33A 3L13A 1GS6X 1YJDH 4OJYA 2WBKA 1KV3A 3AMLA 4KK9C 3OZ9L 1F41A 3L9EA 4PG2C 2X7LA 4WO4A 2AJUL 5KS9B 1R24B 1UZ8B 1SQMA 1J1XL 4BA0A 4N6RA 1I9IL 5EZOH 4NQQA 3LHPH 3QZOA 1BVZA 5KW9L 4E36A 3S98A 5F7DB 5ACMA 1UG9A 4XZUB 4RGOH 3HN8A 1J5OH 1MW0A 1BOGA 4D9RE 2IAMA 3UJTL 3FOLB 4MS6A 1T6BX 1GKOA 3VCLB 3QXUA 1AOHA 4OGZA 4HKJA 1FPTH 3CZGA 3NK3A 3HC0A 4CVXB 2VSCA 2H2PD 5J13C 3EO0B 4UI2A 1W9XA 4Z7NB 3QHZH 4EI0A 2D2OA 5F6IC 2JJSC 4XPAL 3FH8A 5C09A 3VFMB 5SWQB 2XWTA 1JDCA 3S5LG 4BUGA 2VXQA 1QAWA 1IAIL 2UWEE 2MFNA 1UWGH 1CTOA 3QFDA 4K9EL 5HJBA 3KNBB 1XXFC 2JTDA 3ARYA 2J1ZA 1UWXH 4UDUA 4HWEL 2WZPD 4Y8DC 5JW4M 3S88H 5HDRA 2ZAIA 4JHZA 3UMTA 2BS8A 3FOMA 3P11H 4JLRB 4ODXA 1C12B 2B0SL 5HDBE 1G94A 1Q9WA 2WYHA 1F90H 2DQTH 3PWPB 2ADGA 5IHWA 3MI6A 4LXFA 5EIIA 1AKJD 2DJMA 4B53A 2VAAB 1EERB 3N41F 1E7UA 1R34A 1JK8B 3BX7C 1PX4A 4M5ZH 4JKMA 4PY8I 1NH6A 2GT9A 1NBYB 5DUML 2JJTA 4J4PA 2HRLA 4Y19D 3SPVB 1BXVA 1QX1A 1VFMA 4DQOH 6FABL 5A3IC 4RGMB 4U1IA 4F58L 1NCDL 5IEKB 4ELKB 3G9AB 1F4XH 4YNYB 3RUGE 4BKLA 2BC4B 1WO2A 2RQ8A 4LCUB 3IT8D 3OKKA 2H4EA 4MJ4A 4NP4L 5KVMC 1DSFL 4Y5XB 2UVFA 4R5TA 5D72H 3TEXA 3HC2A 4BSWB 2Z4QA 1A25A 2W94A 3QWRD 4WEMB 4HU8A 1TO5A 5IFAL 1G7LA 1E6JH 5K39B 1PFCA 4FNRA 2HLAA 1Y0LB 1T21A 2LGNA 2X09A 5F1NB 1TYEB 1CL7H 1CBVL 4LHUG 3MV11 3MRRB 3WTWA 4GYBA 5E8OB 2AQ3A 5E51A 2OJZL 2Y06L 1TNNA 1A66A 4DT2A 3OL2A 2V3DA 4JAMA 4XB8A 5ALBL 2YSSA 3CIAA 4HOWA 1R5WA 3PJSB 4KX8A 1NIAA 3IMUA 1N7ML 2XI9A 4HGKC 3EHBB 2OMNA 3WAKA 5JO5B 5B8CA 1J1PL 4GBXA 4HQQL 3GJEB 1T03H 1CK0L 2PW2A 1ZS8B 1MRCL 1XZ0A 2BCMA 4GO8A 4R84A 1BBDH 5LBSL 2R29H 3L1OH 4M8QA 1ZWIA 3SCMD 1QLRB 3QRBA 2WSDA 4KY1H 4MVBD 3BO8B 5F96L 5TK4A 2D7OA 1DZ0A 3CFKA 5KVEL 3K71B 5GISL 4QNPE 1UD6A 1IC5L 1UKTA 2HVBA 4FG6C 3VFNB 3KLSA 4ZXBA 5I1JH 4PJDB 3DWTA 3TEYA 5AEAA 5JHLL 1M53A 4H0GA 3REVA 3O9WA 1OSPL 1D5IL 3PFUA 4PJ5B 2P46B 1HX0A 3U4BL 5KBKA 1OARH 3ZUCA 3HBQA 1IC7L 4PLKD 3VH8B 3IMRA 1PCXA 3NCBB 5IREA 2X9YA 4YSOA 4KROB 2QADC 4NO3B 1HKLH 2V6HA 2WIIA 1FNEA 4X7SH 3LRHA 4DK3A 4GRWE 5GGVH 3QQ4A 4BM7A 4KXAA 1GVIA 1NMBH 1I9JH 3KPPB 3PWVA 2EH8H 4XPTH 1H5BA 4LPUA 4O5LH 3OXSA 1MFDH 1G6VK 2D3NA 1BGXH 4ATWA 1G0DA 5E9AA 2AJXH 2Z65C 4CW1B 4AK1A 4NQUA 4ACTA 4AWJC 2ROXA 1S7UA 1L9OA 5DRXA 2W1NA 4FKKA 4NZRH 3K8MA 1UXWA 3DK0A 1SY6L 2QKIA 2ZQKA 1NDMA 2PYEB 1BOYA 4GSQA 3Q6GL 3LEXB 1BD2B 2P48B 3V6OE 4HWBH 5DWPA 4F7TA 2WXPA 3D25A 3RWDA 1Q72H 1OP4A 2R1WB 1F00I 4AYGA 4G43A 2YAMA 4PLJD 4YH6A 2HN7B 4YE0A 2BVQA 1L0XA 1MELA 4RMSA 5A16A 2EDNA 1EEZB 3DNKA 3HZVA 2PWDA 3K1DA 1OP5K 1Q9LB 5JMRA 5BV7H 1F4WH 1V7ML 5EEVA 5I30L 3BUIA 2V2TA 1I7TA 4KI1A 2AHIA 3FH5A 4UQ3A 2UY6A 3HW7A 3AREC 1FGNH 3COOA 4XBGA 5AB1A 1YEWA 4LMQI 5JUEL 2FWUA 5E5MA 5CLXA 2PR9A 2PR4L 1CLZL 5EWIL 3GI9L 2W9EL 3MXWL 5DD6B 5CEXB 4LU5H 3OB8A 2QSQA 4JFWA 2OTUA 3SKMA 1JZDC 1RK0B 3LNEA 4AIOA 1GW6A 3SPHA 3RNKB 3BIKB 4IIZA 5E00A 3QDGB 1DCEA 3QXAA 3M7FB 3TBSA 3TS8A 2VR3A 2FE0A 4OI8A 4GO6B 3DX9A 2XIBA 3NZHH 1G7MA 4IU2A 4AT6A 1I8IB 2YS4A 1S7XA 5D7JD 2JLPA 5L88H 1BZ9B 1MW1A 2EDBA 2MMXA 2YN3A 3U46A 4KK5C 4K94C 5DHVA 4MAZA 4ZSOB 1QRNE 5AB9A 1LWRA 1HH9A 1EHXA 3RPIB 4LOUD 5C07B 4FTDA 2F53E 1QKZH 4XXWA 4C4KT 1LDPL 5D6CA 5B22A 4LLWA 2K6WA 4N24A 4XTRC 5DC4B 3C5XA 2A6KB 5G4NA 2A9ML 2X6MA 1Q9OB 4ZUWA 1WD8A 5BW7C 1KB5B 4L1BA 3S2AA 1HL8A 1G6RL 2PETA 5D1QC 3HG1B 2YAFA 1S7SA 1C08A 1OTSC 2FLMA 1DTUA 2ZX8A 3ECQA 2VJ0A 2HSIA 2ICWI 2NY5H 3N50A 3MYJA 4FYTA 4QY8A 3MRDA 1TITA 1KB9J 1Y18B 3SE4C 1PY9A 1TJMA 4NRXA 4TSBH 5E9DD 3E8VA 5IJDC 2NY7L 3QQDB 3WE6B 4HFWB 1KXQA 3FBQA 1SMDA 4HLEA 3TIDA 3O6KH 3O3AB 2RA1A 1BJ8A 3QHTC 2NY4B 1UZGA 4GIPD 3US9A 3NCJL 4DUWA 4JG0L 4LB8A 2IDUA 1KBGL 3AZUA 3FTXA 5JIIA 5HHPA 4PPTA 5DVOA 3AU1A 2IADA 3BJLA 1B3IA 3FCBA 1GOFA 1M4KA 3EOTH 4PM1A 4ZPTA 5T5FA 2WKGA 2XWDA 4K3EL 2WVVB 1YYCA 3EYUH 1DQJA 4YZFF 2SEBB 1A2YA 3LZFL 3SE3A 3T4AC 1JGDB 3LN9A 4XMTA 3VFSB 5HPOA 1ND0A 7CGTA 4NN5C 4Y9BA 4WI0B 5DRNA 1J8HB 4KKAC 4ZJ9A 2BOBB 1BM3L 1XGZA 4FZ8L 2I9TB 1ZTXE 2FWOA 4L23A 2CA3A 2VQ1B 4JRXD 1IM3A 2JJUA 3TO4B 1CXLA 3C5ZD 4EOWL 3U1SL 1K4CB 3OX8B 1AAJA 1I4FB 4PCKA 3IDJA 2WTPA 4PRNA 2CCLA 5CKGA 3WUWB 1KN4L 3CXFA 4YN3A 4XE5B 1B4RA 1ETZB 4PJEE 4P9HL 1DVYA 1T6VN 3CIQA 1TJXA 3B2PA 2JCCE 3P77B 4JY5H 3H7BA 5DJAB 1NBVH 3MGTB 5HJGA 3ABZA 4FFZH 1YECL 5A7BA 3LV3A 2DBLH 1RUAH 2X87A 4OFPA 4WW2F 4YSPA 3C8DA 4P5KA 1FC1A 2XRAH 1IT9H 3KBEA 3OB0H 4FQCL 5L0QB 1S78D 2WKOA 4GKOA 1XTMA 4L1TA 2OYKA 4DK5A 1XCQA 2DQEL 2BM3A 3ZL4H 5HDWA 1HSAB 1I3UA 1UT9A 5SWZE 4YL4A 1GC1C 2BERA 3QZLA 5H35B 5ISZA 3RKPA 2WXKA 4QXVA 4BH8A 1CL7I 2WHVA 4DAGH 3NJGA 4PAZA 4EI6A 4NCC1 4XBEL 1H6UA 3CLEH 2YRPA 2CO1A 3TWCL 2Y0SA 1X3DA 2ALAA 2B16A 4IRJB 4WDIA 5IV2B 1OB0A 3G7TA 4M4RB 4MNHB 4PJAA 4ENED 5CJ5A 4L3CB 2OP4L 4OKVA 4UT9H 4ODUB 1IMHC 2NUTB 3MOAL 5I76A 2A6IA 4BFOA 4NXKA 5IVXB 4R8WL 2FX7H 5D1QE 4MD5B 4OCRH 3QDJA 3C6LA 5HHOB 2COQA 4FTVD 2WXIA 2XWBA 2JNZA 1BAGA 2JKTM 4TLKA 1QLEB 2WCPA 5DFTA 1BVLA 5JXED 3D7PA 3KBPA 4J3OG 4PY7A 3CPLB 1JHTA 3EOAB 4X80L 1D6VH 1G5GA 2OXHA 3ILPB 4TVPE 2JV6A 2ZUSA 3HG5A 5I8KH 1AZUA 4P2RE 5IW6A 4XBPB 1ZVSB 1WEJL 4NZUL 4PUBH 4UF7C 5KVGE 3HRZB 3NRQA 1NGQL 3L5WB 1OOAA 4IJ3B 3LB6D 4QRRB 1JGLL 4YHLL 4FG4A 3FFCA 2XZQH 2I60H 1DJXA 4LNVA 2Y5QA 2HTLC 1QLEH 1TVHB 3FTGB 3LKSB 5TE6H 1BG1A 4U49A 3SY0B 4O9HH 5HI4C 3H9HA 1EEUA 4HKBB 1P1ZA 2UWEB 4HIJB 5I1GL 4YZWA 1RLBA 2JB6B 4ZS7L 4LP5A 5CR1A 2P49B 4KRPD 3GHEH 4IHBA 2EC8A 4L9DA 3GMRA 4B6ZA 1LP9A 2NY0D 1UVQA 4NS0A 1RV6X 5AAPA 4I85A 4X0NA 3B1UA 4Z7UB 5I9QB 4BCZA 4ZFGL 5EO1A 4I0PA 1KGJA 4P46B 3EJSA 3O41B 4AYEC 4NUGL 1LEKB 5BOZG 4XP4H 4PLNC 3ZO9A 1NGPH 1CZ8L 1TG8A 4KZ0A 1CXEA 3KPRD 2E9JA 4AUYA 2J1WA 3A24A 4TRPL 5DQJB 3MRJB 3NZUA 3RILA 1JYWA 4F33B 2J55A 2FEDD 2ROYA 2LQRA 3CU7A 1QSFE 2OXGB 4MDRA 1KTBA 1JGUL 2C4FU 3D2UA 3QNYB 3T3ME 1I8MA 3T0EC 5HGAB 1HOCB 1JWSB 4X6BB 4YX2H 4R97B 5EOQL 4GG6F 4ZAKD 3FFOA 4FL4B 1XCXA 1T66C 4F3FA 3W9DA 3E9TA 1OPGH 5HHVH 3RUGB 1EXUB 3AQZA 3D5OF 4OZIF 4KKLD 4P3CL 3UYRH 4YSUA 2Y3AA 3QJHB 3NCFB 5BS0E 2NOYA 4BQCA 4WFGE 5HBBA 1N0LB 1OF2A 4GAJH 4W1TA 4XXCA 1LO0L 4HC1H 3KLHD 3SE8L 4L4TE 2F5BL 1XH1A 3OAZH 3J27A 4JQVC 1F58L 3BVVA 2H3KA 2C1PB 4IRSA 4PRIB 4MDIB 4NQVA 5B1JC 4U6YA 2WC7A 3WAJA 12E8H 1PD6A 3G6AB 4H8VA 5DJYB 3P2BA 5E1IA 3VD7A 1D5MA 4PTUB 3DROB 1H5BC 4IOFD 4M62H 5I74C 2AP2A 4XMVA 4CMHB 2IMNA 2AJUH 3P0YL 2B2XH 1V3JA 4PYHA 1YHPA 2P5EE 1J1XH 4OGYL 5ITFA 4B27A 1DE4A 5BRZE 1DEEB 5DC2A 1O7DC 3EBAA 2TSAA 3VJ6B 1T5KA 3KLQA 3ZTDC 4Y4KB 1H6FA 3EO9L 4JKLA 1PX8A 4Y2DB 5DJCB 5DZLA 3CAFA 5GRVK 4AJ0A 5CD5C 2Y6SC 2QKIC 1JPSL 3LPWA 4XN5A 5TGBB 3CJJA 3BOVA 4RAUA 5CUSH 4Q0XL 1I8AA 2H6PA 4I18A 1WFJA 4XNYL 5J9PB 4N0UA 2WWMD 4HUWB 3ES6A 3G5VA 1JD7A 1CE6B 5EN3A 3W0WE 3CZNA 1JWMB 1GSMA 1RU9L 2WYIA 4YFDB 4PRHE 1N5YL 3ROLA 4J3VA 3ZMRA 4NUMA 3TBYA 1Y6MR 1Z2KA 5BPPA 2Y3NA 3MV7D 4Y4FB 5CZVL 3DBXA 5LB1A 1HDMA 3PPSA 3WE1A 4JFVA 1YQVL 4JJHA 4XPAH 3H3BC 5EH1A 3SYCA 2H6OA 1DBBL 1MCEA 3MPCA 3WFHB 4X6CE 2PXYD 1EDQA 2XTJE 1ZLEA 3OR6A 4B9CA 4S1DD 5MEOA 2BHYA 5J13B 1MAJA 5BUAA 1KGUA 2HT2D 1X5ZA 5GJSL 3N91A 3QORC 1MHEB 4UIKL 4HWEH 5J0BA 5F6IB 1CGYA 4RMRA 4P04A 3AB0B 2X44D 2HG5A 4LPTA 5JIKA 3VQMA 3MACH 4TVSa 1JNNL 2WP3O 4LL9A 5KSAD 3X14A 5B3NA 2OTWA 2NY2D 1R3KB 4OM1H 3TESA 2Z64C 1N12A 4KWUA 1YLBB 4Y5VB 5BZDB 1D9KA 3HNSL 5D70H 5GGQL 1FO0A 2WXOA 5HYQB 5DUMH 4ANUA 4O58H 5IFJB 4KKBC 3IGAB 2O61B 1ZLVH 4EIZC 4OQ1A 4J3OC 4NQED 1AR1B 1PCSA 2BVTA 3FN9A 4NB7A 4NP4H 1LVEA 1T0NA 3SKUD 1E27A 4PJ8C 3FTYA 1XF5A 3I75A 3UTSA 1Z9PA 3B2DC 2H32A 5HJ3B 4HJJH 2R2HA 1YEIH 3IGLA 4PW4A 4A7UA 1EO7A 2OMWB 5D2LF 3E0GA 1A7RL 4N5EC 4UILL 1H9VA 1YPZF 1IKOP 3JBG7 4Y1AE 4W9IC 4KI5E 5CNHA 2XFXB 1CBVH 4Q9CA 5I0ZA 4QOKD 3T2LA 2EXYC 1XVSA 1XSKA 2WB1A 4L3FA 1JZIA 2D8KA 4CVZB 2VXSL 5CJ8A 5EEYA 2CDFB 4FNLL 1JV5A 1N7MH 4PVNA 5CP7A 5FFLA 5JW4R 2PYFB 1B6DA 1AFVL 3I9PA 5D4QA 1J1PH 3IJEB 4LSVH 4IBVA 3ZR6A 3WBDA 3CZUB 4HJIA 1HXMB 2R2CA 1MAML 5KYYB 1O7DE 2NXZD 3GUFA 2AEQL 5KVEH 1KYDA 1JVKA 5GISH 1IC5H 3SKOB 5DD5L 3GBML 3QZWG 1R75A 5JHLH 1QFWL 4KNUA 2Q6WB 5TH2A 3EYVA 3KCWA 1OSPH 2F53B 1D5IH 2BSBA 4PRBA 1DANT 3U4BH 3OF6D 1KXVC 4FS0A 1OGSA 2QDWA 3EFDL 5A2FA 1IC7H 1SLXA 4YHYC 4MA3A 2V9RA 3HMXL 4WUKL 2F1BA 2YAHA 4JDTH 2Q76A 1R9FA 4MD4B 3GSNA 1CWVA 1F4YH 3PWJB 4WJKB 4G6JH 43C9A 3IPBA 1I7ZA 1HCFX 4YR6A 3SDCD 3UTQB 2IXQA 2JSFA 4OQTA 4WNSA 4PJFA 1HHGB 4EN3C 5ABZA 4WUUD 3B8SA 3FPYA 3ZDYF 1DVZA 2ZCLH 1CGXA 3G5XA 2QADB 3HE6C 5KAQG 2PWFA 3ESUF 2AZAA 4GKSA 2EEBA 3GKZA 3GS7A 4U6XB 5FB8B 2EKJA 1O9ZA 5D7IE 3R7RA 4H88H 3SDDD 2EIKB 4XNQB 5FR3A 5T5FL 4Q9BA 3FJTA 3VXUA 5DURB 4MMXC 4P5TC 3NJFA 5D4JA 4Q6IC 4ZDHB 4DIXA 2AXFA 5MEPA 5EU3B 3TBWA 2DLHA 3LQZB 1U93B 1VA9A 3PF2A 2B1AL 4GG8B 4HUUA 4JZNB 3RG1C 1TQWA 1CQYA 5K9JL 5FO7A 3C5SB 3ZYZA 2VXUL 2DM4A 4GNKB 2RHEA 2VM9A 3Q9PA 4L8SA 1NGXA 1GY2A 3GS0A 1IARB 5DHMC 4RAVB 5IK3A 2IALA 4J8RB 2IAAC 2DIJA 3HB3D 5DRZB 1ASPA 1WAPA 5L8JB 1V7MH 3S35X 2EO1A 3GS4A 4JO4L 8FABA 4PWFA 1CGVA 4XCFL 2Y72A 1CUOA 2CH8A 4GQ9L 4RQQB 3MCLH 1CFNA 4YHML 4PJGB 3WTXA 3T77B 2IDSA 1NICA 4BKSC 2OW7A 3JV6A 3U79A 2PR4H 1CLZH 5EWIH 2VLKA 5H94B 5C0AE 1HHHB 1JGIA 5TQ2H 2R7EA 3AREB 1T1XB 2JCCB 3S5LB 4XCYB 3VSVA 3PWNB 2R0WH 5KZCD 2NDFA 2CGZA 1ORSA 2AABL 2GW5A 4AITA 2H2SC 4QRUB 1KB3A 1U8JA 4I1NB 2YEQA 4MA7H 5D2NC 3V9FA 1LEIB 4W9ZA 2HJFB 4EKJA 5I0YA 4Q9RL 3VFOB 4O51A 1ILSA 3PWUB 5B4MC 4S11A 1IVLA 5F21B 1KYAA 4K7FA 4OM0L 3NIFE 4BFBD 5I82A 2OW6A 4D0DB 1LDPH 3QGVA 4RRPA 3ZRCC 1XAKA 2JKSA 4AMXA 3LEYL 1I1AB 5AOZA 2A9MH 5LGJA 4BD4A 1RZIB 2YGVA 1HL9A 1G6RH 1C1EH 5EHFA 4XP9L 3UAEA 3O4OC 2DV6A 4XOAA 5HDLA 3LNGA 3CN4A 5JPMA 3LZRA 3K2UL 2L7QA 4CU8A 2X0WA 4XMKL 3VSQA 3I2CH 1TCRA 2NY7H 3CDGA 2ITDA 1ULVA 3HS8A 5D1QB 2D7TL 3RFRA 3S96B 5DEZA 2VN3A 3D1MC 3UBXI 3NCJH 4K94H 5E5RB 1KBGH 2QQNL 3F8UB 4W4OA 1IRAY 4X4YB 1P6FA 4LHUB 5JIQA 4B9YA 3OKDB 2PABA 4TUKL 1XO8A 4AEFA 2X88A 1TO4A 5D71L 4K3EH 3R06B 4R2GD 2DIBA 1UWEL 2Z35A 3INOA 2FDBP 3LZFH 4WFED 3DPBB 1EUUA 4MRBA 5KUKA 3VI3A 1A6VL 2LT9A 3O2DA 3RDTD 2J44A 3ABLB 3NJJA 3ULUD 4S1SH 3CN3A 4G8EA 3QYMA 3KLAB 2NYYD 1U2HA 4XNMB 5D1XD 5TE4L 4HV8A 5K9QG 1PZ2A 3HBGA 3BEVB 3X1GA 2NQ3A 4MCMA 4A2HA 5KSBB 3T4AB 4IRSC 5FYJU 1RK1A 4EOWH 3S8GB 1XCTB 2CDGA 3QI9D 1Q0YL 5HGBA 3MJ9A 4ONGL 4YSSA 4I1PA 1D7CA 4URTB 4NQSB 3D8MA 1W0WA 2Y7QB 2LV4A 2OSLB 3I3BA 4RDQG 1NLBH 4P9HH 3RL1B 3X12A 1OAJA 3U4KA 1HT6A 1BXUA 1TETH 4KK6C 3U4EA 4AK2A 2Z93B 3GKWL 1UCTA 2PUQT 4PMEA 2EE0A 2QFPA 3K72B 3WJMA 5INCA 3CH1A 4N68A 3UG4A 2CGRL 4ANWA 2XVBA 1TZIA 1B2WL 3FQYA 2IH9A 5JDJA 1CYGA 4HS6B 1R47A 3U36B 2IGTA 4Q9QH 1HNGA 4FQHA 5AB2A 1AHKA 2ZAHA 5A6LA 3NABL 1XGTB 4S1QL 4H8UA 1JUFB 1ZSHA 4XN4A 1G9HA 2OYMA 4RMBA 3MUZ1 5AL0A 2HFEB 1O6TA 1IBBA 1UZ6E 1BOGB 1YMME 5IESH 2AANA 3N42B 4AYSA 5IEHA 2J8OA 3FKUS 4R4NC 5BS0B 5HGHB 4UNTA 4N2IA 4MA1C 3RVXD 3UEQA 3RWEB 1NEUA 5E99H 4L4TB 1DUYA 2WBJA 3TA3D 4JZJC 3RWFB 5FX3A 2OP4H 2BP3A 1AJ7H 1N8ZA 3QUZD 2XKNA 4G6MH 1JMXA 2FIKB 1KGCD 3X1FA 2R27A 1MRFH 4R8WH 1DEDA 2OMVB 4DGWC 5C3LD 4HJUA 4OR1A 1E28B 1CFVH 1A3RH 1KBBA 5T1KD 2YJQA 4YVNA 3ZE2F 1JZ4A 3N3EA 3HG3A 5GS0L 5EUKB 2VDKL 3MAWA 5J11C 3HZYB 2MSPA 2P4AB 1XB3A 4I4WB 4LKCA 1H3PL 5FC9A 3T2NL 3FCSB 1KLFA 2QHRL 5DQDL 2JIXD 4UM8A 4YEFA 1ZEAL 3U1QA 1CTNA 3LEVH 1PKOA 3U7AA 1GC1H 5BOJA 3MRCB 1FFPA 1WEJH 5I2IB 4PCYA 1N5AB 4WSKA 4RX4A 2CR0A 2UZIH 1FG9C 2DQHL 1QVOA 4OCMC 3GSOA 1HNFA 1R5VB 2IBBA 3DIFA 2JLLA 4NQDB 2AF2A 2DEXX 3BQUD 2VXQH 3KVDD 4YHLH 3V7AG 2J1XA 5E0FA 3QFJD 5JTWA 3RYMA 3QDHA 4KKCC 1FGVH 1YN6A 3TM6A 3H3PL 2H1PL 3JT2A 1AXIB 1OE1A 3PHQB 4OD3L 5E6SB 4D9QD 4LARH 2XC8A 3BPOC 1E30A 3IF1B 4E42B 4ZRGA 2J4WH 3IEAA 4XP1H 5LQBL 2IBZX 1CDCA 4ZFGH 1XH2A 3TBVA 1VKXB 1WJ3A 3DX7B 1S9XB 2OX5B 1ADQL 3C6SB 2DYPD 4IBLT 2VJ8A 4NUGH 1D6EA 1CZ8H 4XC3H 4BHUA 2WV3A 1XF3B 3UIZA 3WDJA 1WTGT 5GGRB 5CEZL 5D5MA 3EUUA 3WJLA 1NCWH 2XG5A 1JGUH 3VGGA 2QELA 5C70A 1H15A 3GDBA 4PH8A 5DS8A 3V6FA 4WEEA 1JERA 5I1HH 2H8PB 1YG9A 3M46A 3EDDA 2WLNA 3H53A 1NFKA 1PX3A 5FLVA 1MEXH 2WUBL 1MXDA 3ZYIA 4HOMA 4IBWA 4XCEA 4O2FB 2AI0L 2I9LA 3JVGC 2DJ4A 1AYOA 1IEAB 2A38A 5KN5A 3G6DH 1U21A 3T0EB 3NQIA 3QUHA 4KTEL 2KDYA 3NZ8A 4LLMA 1LO0H 1QFUH 2ZSVB 3FAXA 3A21A 4XXDB 3SE8H 1JPTL 4HIHA 2F5BH 4LNRB 1FG2B 3EBIA 3RVWD 1G7IB 2QQLL 1SJHB 3CBRA 3GJFA 4BFIA 4NC1C 3GSUA 1KJMA 3QAZC 2ATKB 4Y1AB 1TZGL 3GXNA 3LN4A 1L7IH 2UX6A 2A6JA 3QEUA 2WGXA 4NX0A 4MD0B 1FA4A 2IPUK 1AD0A 3JV0A 1W8OA 1H8LA 5E08L 5I1DA 5I1EH 2MQGA 1B2YA 3VU2A 3HS0C 3T2PA 5GZNA 3UZVA 3DTXB 2NNCA 4JBSA 3FU9A 3W82A 2BP8A 3K2KA 2IQAB 2D31B 1ZIBA 4X5XB 4DVBA 4MA8L 1DQTA 3QJFB 3DVNB 1W0VB 1SHXA 2Z7UA 4W9LC 5AZEL 4UTCA 2FSEB 3OXSB 2VR9A 4XWOD 5L2KE 5FGBC 1NBZA 2NY6D 3ALPA 5IJKA 1JPSH 3D3VA 3GMQB 4NPYB 2XKUA 1KG0A 1P5UB 2EADA 4UV4L 3QXVA 3BKJL 3EH2A 3KLKA 1FBIL 2FJFB 4PJ9A 5F7LB 1AHMA 1LO5A 2AQNA 5A2JH 3W2DL 4Z7QE 1Z1WA 3L3JB 5M94B 4YC2C 2FUQA 4L8SC 3GSNL 5F3HA 5AW8B 4N86A 5CZVH 5B38G 5FOBB 2WKOF 4XWGL 3RKDC 3GQFA 3LX9A 1URZA 4X7TB 1JBJA 1J9SA 1QW9A 2YZ1A 3RTLA 4APQD 4PJBB 2JB5H 4MJID 2GBTA 3REWA 4F57L 4OFVA 3ZVVA 3W11D 4FJ6A 1GTNA 32C2A 2C3WA 1OP3H 1A6AB 3NA9L 5HYSG 4KVNL 4ZMWA 1ZGLB 1I3RA 4U1JB 2A9NH 2VZUA 4Z3TA 2PPFA 3ZKMD 4OH2A 3B7YA 3EZ8A 3WTUA 5H37G 2WN2A 4U1MB 1KCRH 4EVNA 3CXDL 2MWCA 3FQTB 3D4GA 4B97A 3ULSA 4IKNA 3V0FA 1WBZA 1E8WA 5FCUL 1KJ3L 1BF2A 2YMOA 3H56A 5AVUB 3LRKA 4PJAF 3ZHKA 2BNRA 3WKYA 4OV5A 3GBNH 3QORB 4LLDB 2WCSA 2APTA 2L4OA 3HNSH 5GGQH 1KCKA 5ERWB 3RTQD 4H5SB 5CCJA 5HHMD 1MI5E 1ZT1A 1YEGL 4OZ4A 4PS4H 1K4DB 4AGQA 1IGCL 5D7LB 1DDHB 3F5WA 1FZJA 1I53A 4OCYL 3SHSA 3T1FA 3VVWA 4NCC2 1A4AA 4XGZB 1MY5A 2EDOA 4QXGL 1UJ3B 2P24A 1JNJA 1HQ4B 1W72A 3L45A 1JAEA 3OKOA 4EKXA 3CZFB 5GSVB 5EEXA 2WZPA 3T09A 2CO6A 3VNZA 1UUSA 3S4SA 5AB0A 3FFDA 5LBVA 3S2CA 4GXFA 3U46B 1RVFH 1SDDB 1NGZA 2OCFD 2RQEA 3MRNB 1A7RH 2Q1EA 4UILH 5JORB 4XVSL 2FO8A 4HK3J 1BLIA 2NLJA 3GUTA 4UTBH 1F2XK 3DKHA 2CKNA 4PJ8B 3TBTA 1AG6A 3PDGA 4BQ9A 1F18A 2C9QA 2NX5B 1YNKH 2WMPA 4LSDA 4Y19A 3JTSA 1B4LA 1MWAA 5IMKB 5DK0B 3FQNA 4V33A 2AQ1A 4LEXH 2X2JA 4P9MH 1BEXA 2NY3C 3IGFA 2VDLH 4B0MM 1UH2A 5ICXA 5ELIA 3FQWB 3KPQA 4UUJB 5DHVH 4IMKA 4OCXL 2CU9A 1LP9F 4ABQA 4PHZA 4TXVB 4W4OC 3QWRA 2OK0L 1HJBC 4BSVA 1MFVA 4OD1L 2CR6A 3IETA 3IXTA 4AM0Q 2OV0A 5DD5H 3GBMH 4WEUD 3GNML 3LZLA 3L2NA 2CGYA 2E9IA 3A4EA 1KJ2B 2AAVA 4GY4A 4JMNA 4OKDA 2BNQB 4UYQA 3NIFB 1DVFA 3KPSA 3CFBA 3HZMA 5H4YA 4J3TA 4I9XA 1ZJAA 3DRTA 3E6FA 4XMPL 2VAJA 3PWPD 2LHAA 3N1MC 2D3VA 3BUQA 1E5BA 3DO7A 4KRNA 2B3IA 4JZOA 3UGEA 4N0CC 4CN1A 2KBGA 2FIRT 5I1AB 3OAYK 4E9YA 1LEGB 2VN7A 1IC1A 3I02A 5I18L 2CUHA 3APDA 3ML8A 2VDQH 4WWNA 3SCMA 4AQ8A 1QG3A 1T4KB 4UT7H 4WFHE 3B34A 2H1XA 5IR1A 2XN9E 3C5JB 3ZLQC 2H0FA 2X4PB 1IM3B 2WXQA 3STZB 4UNVA 4L1DA 1URLA 3BZDA 3QUXC 5FUCC 5T5FH 1WIOA 2ZG1A 4ZX4A 3S8WA 2ZG2A 4MJ5B 2XXCB 4JN1L 4EN3B 1T1WA 4D7PA 3FMGH 5TDNB 3T04D 3Q0HA 3MFFA 5I1CH 2EDEA 3HE6B 3SPCA 1I7UA 3O2DL 1WZ1H 2QBWA 2R1YB 5TE7H 5E4EC 1B0GB 2XPYA 3TO2B 5BO0D 3AUWB 3CFJA 4DGIL 1I8LC 2HWZH 1JV2A 4DP4X 2VXUH 1FIGH 4MMXB 1YEKL 4P5TB 1T22B 1HINL 4Q6IB 4GH7B 5AW1B 4PRPB 5AZUA 43CAA 5BZWB 3QULA 4HIQA 5JZ7D 1XIWA 2WWKT 3D0LA 3NCCB 4ODWB 4HW6A 2YD5A 4ZO7A 1FHNA 1IV8A 1MCQA 1MG3C 1OGPA 2P43B 3IXAA 3FB5A 1AHWA 1TTRA 5EU5A 2WBJC 3EHBD 3MC0A 5LXGL 4GQ9H 1CN4A 2ZWLT 1MIEH 4J28A 4TNGA 5F0MB 5ISZB 2HYMA 3BPNC 4DCQB 5ACZB 3WMSA 3ZZ1A 3RY4A 3KYMB 4X6DF 4JFYA 5LWYL 4NNXB 2AGJL 4PWKA 3FS9A 2C34A 2NTFA 4WRLA 1UOVA 1U8OA 2VABA 3HFMH 3G6JE 3CXHJ 3L3IA 4CRPA 1ZT4B 2QPUA 3GT6A 5E2VL 3GMMA 1A3LL 3IU4L 4E0RB 2C9AA 4NNYA 4QT5B 3F85A 2Y5TA 2EVFA 1C8PA 4MNQE 4DP7X 2CIKA 2Z92A 5D7KD 5DRWB 1HC1A 3V0WH 3GMOB 2F5AL 3R4RA 2VT0A 4KROD 5DLML 4OM0H 1CI5A 4YZFE 3BVWA 4KJPC 1C7TA 4JFSA 3P9LA 1OCRB 1DANU 2ZUQB 2JH2A 3ZX1A 1QUNB 4AY0A 1NCAL 1F02I 2ERJC 1KC5L 5D2NB 1BAWA 5HVWA 4QJ3B 1JK9B 1RUKL 5KG9A 2OSYA 5T1JA 4TQ8A 2FEJA 3EGDA 3F65A 2NZ9C 3VFGL 2YXVA 5C8JB 4C83A 2XV2A 3ZKND 4OGAC 2HRHA 4WKXA 3MREB 4N26A 1Q0EA 3P73B 1G9ML 5EU7E 4LLQA 1AZVA 1U8KA 3K2UH 2PYED 4FFTA 1KN2L 1EJOH 4XMKH 1KGWA 1BD2D 4XMLL 2D7TH 1WGVA 4MTMA 4ZFOA 5FO2A 3O4OB 3S3SA 4UTAL 1YMHB 3HKFA 5CBEA 1KEML 5DHYA 1P1ZB 1UKSA 3EYOB 4IGBC 2CIIB 3CSPA 3LRLA 1TT6A 3RVVC 3CFEB 2QQNH 3DX3A 3L9RB 3DV6B 2GTZB 5C0EA 4QHLB 1PPIA 2EACA 1GGUA 3EDKA 4TUKH 4YXKH 1T1ZA 1WE5A 1B6UA 5D71H 1E50A 4F80A 5HHXL 3NSDA 3R8QA 3VDBA 2FH6A 4KUZL 4PGCB 1T0MB 1F1DA 2DM7A 3T0VA 1QBML 4AV4A 2YR3A 3RX8A 3KW7A 3POHA 1A6VH 1BFVL 3V6ZA 1M7DB 1UURA 3NIDF 5E9DA 1AANA 1I1YA 5ADPH 3KR3L 1AGCA 2PCYA 4ZI8A 3CFNA 5TE4H 4H25B 4MCNA 3RURA 1HZHL 3QQ3A 3QDGD 4DWHA 3B43A 3MRKB 4OB5L 3J2PA 5I16B 1RPUA 3DO4A 1MLBA 1NUFA 5I8CA 1REIA 4N8UA 3B5GA 3U2JA 1FL5B 3QZWB 1W91A 1QYGL 3PAYA 5JXAH 3B9DA 3L3KB 3GHBL 4NUQA 3WTYA 2PCPB 2FBRA 4DEWA 1TU2B 4EUPA 4KMQA 3CMOL 5ETUA 4IRSB 3O4LE 1FRGH 3GKWH 1HHJA 4U6YB 3VTTA 2RR3A 2GEQA 1VZGA 4PP2B 3QUMA 4GS7C 4JN2A 2CGRH 1I8KA 3BLPX 4U7SA 4F7PB 4CAGA 1BZQK 3JWDC 4YHOH 4N0FA 5GGSA 1G7PA 4ZTOL 3QWOB 4JRXA 3HG1D 1FJ1A 5F0JB 5DZNA 1AXSA 1BF5A 3HOGA 4S1QH 3BAIA 4J5VA 4JGMA 3KCPA 2IDCA 3D85B 5AW5B 4EE2A 4XVJH 5E0QA 4RZCB 4E41D 3M88A 1ITBB 1VCAA 4JQIA 4RSYA 2J25A 5IVNA 1L6PA 4RAUB 2H6PB 3AMKA 1MVUA 2YGNA 2FQFA 1IAIM 2NY4D 4P2AA 2FHFA 3ARUA 3MGAA 3G5VB 1HILB 3KGRA 3OMIB 4MQXD 4XNDA 3LZOA 3GSVB 3UTTA 1A4KB 4G80B 2MPVA 4J2QA 4BFNA 2F1AA 1CYXA 2AMUA 3BYTA 5DZ9A 3MSPA 2GSGB 3CFQA 5C0JB 5HVFB 5KYNA 1E4KC 2H9GA 4MA1B 1QHOA 1NGYA 1SEBA 1NFDB 3A6CL 4X6DB 4AH2B 4PS3A 2FR4B 3VRJB 2EJ1A 4JZJB 5KVFL 1AQMA 2WBXA 1O5DT 3OR6B 4UU9B 2E9WA 2I5YH 5F93C 1M57B 1A14L 2JKWA 3DVGA 2FX9H 1N3NA 4GINA 1H3PH 3T2NH 1J8HD 1T0PB 5A40E 1INDL 2QHRH 4KRLB 1KTDA 1MQKH 3FO0L 4YE4L 4KC3B 2Z9TA 3UYOD 4I3RH 1XDTT 1DUZB 1YY8A 1JZ3A 3QDME 1X7TA 4F2FA 5AG9A 1BBJB 4Q74A 3TO4D 2CXGA 5EBLA 3ZJAA 1A7QH 1NIFA 4ZMXA 5J11B 1NJ9A 3AADB 1N4XH 3PJNA 1U4FA 1FVDB 4JANA 4KY2A 1CG9B 4E5XG 1TF4A 3RJDA 2VLLB 2VISA 4K2UL 3T6XA 3DVFA 4LBAA 3T0WA 3KM1A 4FTVA 2KZBA 1UD4A 2W65B 1NSNL