3Q06A

An induced fit mechanism regulates p53 dna binding kinetics to confer sequence specificity
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
231
structure length
231
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFVQLAKTVPVQLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKKKTMDGEYFTLQIRGRERFEQFRERNEALELKDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced fit mechanism regulates p53 DNA binding kinetics to confer sequence specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle/dna
molecule keywords Cellular tumor antigen p53
total genus 42
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3q06A00
2J21A 1IO4C 2XWRA 5BUAA 1CMOA 2J1ZA 2OCJA 4AGLA 5ABAA 3WTTA 4LOEA 3TS8A 4IJTA 4IBTA 2AC0A 1T4WA 4GUOA 2J6WA 3WTVA 2FEJA 5G4MA 2PCXA 5LGYA 3WTSA 1GZHC 3Q06A 2BIQA 3D05A 5AOMA 2H1LM 5KBDA 4MZIA 5ECGA 3Q01A 3VD2A 5AOJA 2WGXA 2AHIA 2BIPA 4KVPA 1E50A 2XWCA 4IBZA 5A7BA 2BIOA 3KZ8A 1H9DA 2RMNA 5G4NA 3QYMA 2BIMA 5AOIA 1EAQA 2IOOA 3VD0A 2J1WA 4MZRA 3EXJA 1LJMA 3QYNA 4GUQA 1TUPA 5AOLA 4QO1B 4IBQA 5AOKA 2J1XA 1HJCA 4LO9A 2BINA 2X0WA 3D08A 3EXLA 3IGLA 2IOIA 4IBSA 4LOFA 4G83A 3WTWA 4AGNA 1GZHA 2X0UA 3US1A 3Q05A 4XR8C 3WTYA 5AB9A 1EANA 2ADYA 4AGMA 3WU1A 3D07A 2VUKA 1KZYA 1HU8A 4AGQA 2ATAA 4IBWA 2P52A 1HJBC 3D06A 4G82A 4A63A 2IOMA 4L0YA 1EAOA 3VD1A 3WTXA 4AGOA 4AGPA 4IBVA 5G4OA 2X0VA 4IBUA 4HJEA 5LAPA 3KMDA 1CO1A 2MEJB 1YCSA 3D09A 3IGKA 2J1YA 2GEQA 1TSRA 4IBYA 3D0AA 3ZMEA 2YBGA 3WTUA 1UOLA 2J20A 3US0A 4L18A 4L0ZA
chains in the Genus database with same CATH superfamily
4XCNA 5MEPA 3VW3H 5CO1A 4D9RE 4LDEB 1MH5A 1JZDC 3HI5L 2JNZA 5ETUA 1ESOA 4EQ3A 2IAND 3LQAL 3GXNA 2VIRB 4FKEA 1ZIBA 4K55A 1XH3B 4IJ3C 3RGVD 3QDAA 4MJ4A 1MJ8L 1U8NB 3D1MC 4JHWL 3VFTA 2E7CA 2VLLB 3WUWB 3MRCB 3MLYH 1VJSA 3T2NL 1UG9A 5T1MA 4L5FE 1FC1A 4PP1C 1NC4D 1BQLL 2BWDA 1NBVH 3QCUH 4N6QA 4NI3A 2AVFA 4NENA 2B0SH 3GXIA 5TDOB 3GSNB 4N1EA 3TBWB 1I7ZA 3VGHA 4GG6F 1AC6A 3OAYK 4U1HA 4I4WB 2OR7A 5D1XA 3K81A 4YIQB 5LGJA 2O72A 3ZE0B 5FWQA 1LILA 4JAMB 2WD0A 1NJ9A 4MS8D 4LKXB 1HCVA 1G84A 3WBDA 4BK5A 3FW6A 3SOTA 1BFVL 3BSZH 2FT7A 5LBSL 1NDGB 1E9QA 3MLTB 4BWTA 5I1HL 5A3ID 1T22B 3TJHD 4M8QA 1AVAA 4CSZA 5C6TL 4PGCB 2QKIB 3FQXB 1N8ZA 4FXKC 4IM8A 1GS7A 4TUKL 4OSUL 3CVHA 5C09E 3UBXB 3GHBH 3IGLA 3QCTL 4W93A 3F12A 3IFOB 4G9FD 1HILA 4K7PX 2ADFL 3QO1A 4S1RL 5C0IA 1FIEA 3TT1L 2OMYA 3CIQA 4APXA 2EE2A 1RUAH 1RSYA 4NKIH 2F74B 4U6VH 2ITCA 1T1WA 1A2YB 2YSTA 1UXSB 4G8AC 2XJKA 1G0XA 3ZKSD 3CAFA 1KJMA 4GI9A 4KJPC 4DESA 3VWJD 3TA3D 4ODWA 5HI5C 2FUTA 5BRZD 1WCQA 1U3HD 4TSAH 3RDTD 1THAA 3EJZC 2C3VB 4E41E 5IV2B 5L4MA 1S7UA 3FTYA 4NM4L 1MI5B 4AM0A 1S9XA 5EPMB 1YEEH 1M71B 5HDRA 3VXNB 2W38A 1JPSH 1L9SA 5DK3A 1E9PA 4AITA 2JXMA 1GXEA 5F9OL 2ZX6A 4OTXH 4XMPH 3O4OB 2X4RA 1ZLSH 1TSRA 4AQZA 1MVFA 4JN1L 3L4ZA 1CLYH 3INUH 1KWGA 3ZHDA 3QA3A 4KK8D 4L18A 1QBLL 4N8VG 3BZ4A 5EU3B 3QORC 3V6BR 2Z1KA 1MVUA 2VLRE 5DD1H 2R0LL 4RZCB 4K94L 4FTVB 5A2FA 5FKAB 2FIKB 1N12A 2NT1A 5D7JB 1CDYA 5CUSL 5ISZA 3E6FA 1SXAA 1X44A 4R4BB 4OGXH 1C7TA 1NLBH 3D69A 7PAZA 4HCRH 4EXPX 2CLZA 1TT6A 1AO7B 5IB5A 3U4EA 1DVZA 5SWZE 4OFIA 3VD9A 3D05A 3I02A 3K6NA 2D7QA 4MJIB 3EJQA 3T08A 4UBDD 5A7EA 1TQCC 2DL9A 5AW4B 5AW5B 1BHGA 1DCEA 1PBYA 3UEQA 4XBGA 4CVZB 3RZCC 5LN8A 1OGSA 2PR9A 4JRYB 5AVRB 2O5XH 4P2OB 3B2XA 3BWAA 5T5FA 2D9QB 3X13A 4H5SB 3QDHA 4ODSH 5EU6A 3LN5A 3D2TA 4MXWL 4NC0B 1I8IA 2Y7LA 1PIGA 3DGCR 3NJMA 5F7LB 3AS3A 4BZYA 1ZLUH 4OZGE 2K3TA 5LWYH 1MCPL 3QYCA 5D7KD 4DGIH 4DK5A 2HKFH 2DLFH 1MCSA 2PXYA 1Q72L 4L8CA 1R33A 1R5VA 1OP3H 4AVIA 1V7ML 4XMKL 3G6DL 1JV5B 1GOFA 3LNGA 3HZMB 1NL0H 2RCSL 4U3HA 2Y7QA 4GRWF 5FHBL 4AQ1B 1CFNB 1JXJA 1N2RB 1PGRB 3D0LA 3NEOA 4LCUA 2YK1H 4Y5XC 2NNCA 3K72A 4ELKB 3MRCA 3ZT5A 2WINA 2HRHA 4MX7B 2WQSA 3ZUCA 3ME0B 4M1GL 3TO4A 4K7PH 1FL3A 5CZVH 2IPKB 4AYSA 3WTWA 2UWEF 1SF5A 2RALA 3GDCA 4XN7A 5FM5O 2VIRA 5TK2A 3KS0H 2NTFB 2AJXH 3LNDA 1S7RB 1UJ3B 3T2PA 4Z8FH 3ARSA 5EWIH 4ELMA 2AKRA 4JCMA 4JW3A 2V9TA 4JDTH 1J0IA 4HPHA 1H8NA 3IVKA 1R9FA 2EDMA 4MXVE 1TJGH 3L4UA 1TZIA 2WP3T 1WEJL 5HY9B 4HK3J 5E95B 4PSPA 3O45A 1KJVB 5I8EA 4V1DA 3GKZA 3CH1A 4NLHA 2NSQA 5HYSG 1KCUL 4BE5A 3U4EB 4WEBL 4BUGA 2BW4A 1B6DA 1CD1B 4K71B 3IDJB 4UZUA 3T09A 1BBDH 2EDEA 5F97E 2BNRE 5HGBB 1A7BA 5MERB 4H8QA 1Q9OA 3B9KD 3VFRA 5BJTB 3QIUD 3FZUC 5D1QB 1I75A 5IJVA 1NIEA 3L1GA 4FQIL 5J0BA 3PAZA 3R8QA 4WSGA 3RWJA 5CWSB 4JKMA 1D7DA 1LE9B 2CCLA 4NERA 4LEBA 2FX9L 1AKPA 4Z78B 4YBLB 3Q8BA 1Z7JA 4DCQA 1OGAE 2FBJH 3FQRA 4C54A 3ZY7A 3NJXA 3E3QC 3NYKA 4I3SL 1RPKA 2XA8L 3K6SB 3CVHL 3SO5A 3VXSE 5HD8D 3MBXH 2EIJB 5HGDA 5JHDB 2ED9A 3FBQA 3P3UA 4TSCL 2N7BA 4PJEF 3UAJD 4MQTB 4F8PA 5F96H 3BMVA 5LQBL 4K15A 3ZE2F 1FGNH 3O41A 4BE6A 3N44B 4XNZB 1JF5A 4NQVA 2V5SA 35C8H 6FABH 1FNFA 1HE7A 3US9A 4XO3A 1CBVH 5FPIA 4LLWA 1E0OB 4MXVF 4JHWH 4ZNEA 1RZ8B 3PWNA 3OKMB 3ZL2A 4M93B 4XAWL 5EBLA 4NZRH 4LK4A 5DQ9B 5D2NE 1JFHA 1KELH 4YZWA 5DD0H 3KXFB 5I1DA 1JE6A 3MZGB 2MJWA 3QJHB 1GZPB 1B4JH 1EAQA 2AJVH 3P2TA 2YSSA 5JOFA 1FLRH 2DKUA 2ZG1A 3C87A 3POHA 3HS9A 3ML9A 3OXSB 4FP8L 2L4OA 3BWUF 3F64A 1ID5I 4BKSC 5KANG 5DWPA 4ODTH 4ZX3A 5D2LF 5FKAA 1ODAA 3JWNC 1F45A 3NIGB 2G75B 3U2SB 3KLAB 2V17H 3TZVB 3PE9A 4WUKH 4X0KA 4H88L 2X3AA 2DQHH 5I1JL 5JHLL 4G43A 2HH0L 4Z0BL 3IBEA 1AOHA 2Z0UA 1WV7T 2E59A 4TV3A 2NUTA 5KUMA 4G6MH 4MBOA 5C0RL 2H6PA 3FO1B 1ZJBA 3TU6A 1WFOA 1NAKL 2VAJA 3A6CL 2C9VA 3GSNA 1NDMA 4NN5B 2YA2A 5I6OA 2WYZA 5CGYC 1PY9A 5EUOB 3NIDB 3PHOA 4ETQB 3P0VH 4XMUA 4KK9C 1IRAY 4Z7QB 3VVWA 4P23A 2CBPA 2XZZA 4HUXA 4Z7WE 5LNEA 3GBNL 2FWUA 3QUYA 1E8YA 3EYQD 4RGMC 1WA0X 2E27L 4OQTA 3CX5K 5CZXD 4OLXL 4ZUWA 3VXTB 2VDRL 3D3VD 4XVJL 3R4RA 1DQMH 2EDJA 1MAKA 1H6TA 1HEHC 4RA3A 4UDTB 1KC5H 3VXSD 2MQGA 2V3DA 1DVTA 5DLML 1EBAA 2ICWJ 4W9IC 3GHEL 1N8ZB 1RK1B 2CWRA 1EO5A 1MFVA 2ZOUA 1DBKL 2VR9A 3QJRB 3EH4B 1BXXA 1XF5A 4HT1H 2WXHA 3CDGB 4P5TD 2AV1B 3DJTA 3FU7A 2DEWX 4L4VA 1QRKA 3KJ4B 5J3HD 5F44A 3ZTDC 1O6SB 3MNMA 4JQIH 3MNZB 3DOHA 5LDUA 2HVKA 3CZEA 4ZFOA 5FB8B 1PCSA 3M1BB 4QXWA 4APXB 5IHUL 4I1RA 2O6FA 3AFLA 4QNPF 1DYZA 4PG2C 1MCCA 3BH4A 1JHLL 2XWBA 3F12B 5IT2H 1Y07A 1IAII 2CXKA 3UZEC 1RUAL 3V4PA 2FX7H 1BAFL 1D5MA 3WN5B 2OZ4L 1GIGH 2YUVA 4JFDD 2H45A 1A3QA 3MRRA 5I8CB 2NX5E 2QT6A 4Y2OB 2VSDA 5HGHA 1C5CL 4I87A 5FYLH 1KB5B 2F54B 3V4VH 4HIPA 4G7VL 5IW6B 3Q6GL 2Y07L 3S8GB 2AXWA 2JLPA 4GINA 4I0PB 5DO2D 1BBDL 4G7YL 3VXRB 4AYID 1BJ8A 2YRPA 4JKKA 4NSKA 5C97A 1A64A 1AQDB 4OCMC 1ZAGA 1WWBX 3WFEL 2CKNA 1HI6B 1UZ6E 2SEBB 1SOQA 2DTMH 3P2DA 4KKBD 4YPGB 2HG5A 2GIXA 3SYAA 3SGDI 4XVUC 4J23A 1IE4A 2EEXA 1PFCA 3GNMH 3I9PA 3HMWL 4FLQA 1RSFA 4QI3A 1NEUA 32C2A 3BPNC 3PFQA 2ICCA 1DDTA 4Z7IA 5AZEH 4YXKH 2OR9H 1L3NA 4B9JA 4LGRB 3W0WB 3IJYB 3IXTA 4OIAA 4WI0A 5CLXA 3EJUA 4PJGB 4X6DA 2VLLA 3LPPA 3OQRA 1IFGA 3PGFH 3VDCA 4ATWA 3BHBB 4DEWA 4DKDC 2OSYA 4KXCA 5FUZH 1X4YA 1DLFH 3BJLA 1PZSA 2K6YA 1YPZE 4ODVH 1W8EA 1FO0H 2YEVB 4QTFA 3Q43A 1XMWA 4EPSA 2PO6C 2UUDK 1M1XA 1WBYB 5E1HB 1AKJD 2CA3A 4JFYB 2WK2A 2BOBB 4X4XA 1DO6A 5DDHB 5A2BA 4KDVA 4JO5A 3KXFA 5LCVA 1F00I 3MRQA 3KBPA 3W38A 4L05A 5CEXB 1U8CA 4P5KA 1ZHKB 3V4PL 1CLOH 1S78D 5DURD 1ACYH 1FDLH 4QRUA 3T8XB 4DAGH 2XV6B 2ZKWA 1DJIA 2X12A 1T1XB 1BEXA 4EKJA 1YC8A 4O9HL 4M1CC 4JY6A 5CP7A 2ERJC 5D7IF 3UPCA 3QUZD 5DSCB 3EDJA 1GHFL 4GS7C 3BKCH 4MQXD 1KWKA 5A2CA 1CE1L 3N06B 2FECL 4HUVA 1GAFL 4HZ1A 4IRJB 3HC0B 3KPOB 2NY3B 3ARBB 1ID2A 3VXRA 2TRYA 1TO5A 1UM4H 3MRGB 1HC1A 3GRWA 5TDNB 3VA6A 3HR5B 5F3HA 1YEFH 4JDVA 3UP6A 1QWHA 4TSAL 5FK9A 5L4FA 3DXAB 2NSMA 2AV7A 4PJEE 5F9AC 5KSUA 1QSFD 1E2WA 4XP4L 1AHWB 4XPAL 3VYOA 4ILDA 1ITCA 4WUUE 2BSEA 3DRQB 2VERN 2ADIB 3WNIA 1OPGH 1VSCA 5DHYA 2OQJA 1AZRA 3NEXA 2HT4D 1K3IA 2XN1A 1UD6A 4PJBB 5DRXB 1JWMB 3BESR 1U92A 4XT1C 3SE4C 3KZ8A 5D55A 5EFIB 2FQGA 1AD0B 2P48B 5EU7C 4FXGB 1SOSA 4Z76A 2G5BA 1JNNL 4FG4A 4X7TB 2EDWA 5I6MA 2AQ2A 2Z3FA 2H26A 4TUJA 1SXZA 4EO5A 4GP4B 5FHBH 1KELL 2NZ9D 5T3ZE 1KIPA 4JFFD 1WA2X 4UILL 4PJ8A 3DX6B 1EEZA 1P5UA 1G9NC 5DWUH 3ENEA 3D4YA 4PLKC 2GBTA 3H3KA 4A6YH 3H2QA 1F86A 4U6HB 4UT7H 1X5HA 2A6DB 5J3HC 1IGFH 1IIIA 2VDPH 3V0AC 4TS6A 5GRVL 1XGPA 4UAHA 2J7LA 2ZX5A 3E9UA 4XMZA 4KZCA 4X7SL 4WFHE 1NFDA 3BVTA 5D93C 3WIAA 2WQ8A 5GIRB 1GYUA 1NDTA 3NJJA 5DLMH 1WEJH 1AIFB 4LCIH 1BZ8A 3AZUA 1Z6JT 3GLZA 2WZPD 2ALAA 4G6ML 3MRBB 4H1LB 4P3DB 4X9FA 5B3SB 3AMKA 4MMZB 4QUOA 1I7TB 5JQHC 3BZDA 1V7MH 3I74A 3HBGA 3VFVB 3B5TA 3HR6A 3FRPA 4LGSB 2A4EA 4UDTA 3DXAE 3CSPA 4KTYA 1ORQB 4OFQA 3WIHH 4I18B 2ODHA 4JFXB 4BGDA 3FCTA 2DLIA 5AAMA 1OTSC 2GIMA 4Q9CA 3LZPA 2A3TA 2NY5H 1DBJL 1BPVA 4ONHA 2G75A 2L7UA 1YYLL 3NSDA 5MEQA 2A1WL 3CD4A 3MRHA 1RHHA 2X28A 3O11B 1Q9KB 2OMXB 4NHUA 3N85H 5CINH 3CXHK 1IJNA 4LCYB 3KLQA 5D96C 5EU6E 1TJGL 4YAQB 3U1QA 3ZQ9A 1XF3B 3CZFB 1KN2L 2WLNA 3RVWD 3IJ8A 2AI0L 3D3VB 4YWGH 4Q9QL 4MAUL 2EAEA 3AVEA 4LNVA 2OJEA 5A2KH 3U6RA 1MY7A 2APTA 4LLYB 5DQ9A 1N0LA 1CVRA 3QO0B 4PLNC 4MJID 3U0TB 2R4RH 5EBMB 3LEYH 1KBGL 5T1DL 4MNQB 4IRZL 1ZVSA 5TFSL 1CGXA 1SY6L 4O02A 1XAUA 3STZA 5MENA 3IDYC 5KSAA 3ECWA 3LH2L 4FFWC 3DX0A 1H15B 1E2ZA 2YS4A 1GW6A 2D73A 2IQ9L 3IM1A 3T65B 5HYSA 3KW8A 5E6RB 4OCSL 2CKBB 3GRGA 4TPRH 3RRQA 1SJHB 4UYPA 43C9A 4NQCE 2VAAA 1YSOA 3LEXB 4R3SB 4JR9H 5J11B 3WKML 1CE6A 2I27N 5I17B 4WK4B 3EO0A 4PY8I 3VFGH 1AI1L 4DK6A 4KZEL 1JJUA 3AQXA 2JH2A 1SLUA 5T3ZL 2VQ1B 5F96L 4HJ0D 1N0XH 3T2OA 4CGTA 3BQUA 2GJZA 2H41A 1ZJAA 3PL6C 4JPKH 4LDLB 2Y5TB 3PJLA 1J5IA 4U1KA 4FFWD 3H4HA 3UGXA 2ROXA 1NMAH 4UTBH 2KPNA 4PJXE 1AHWC 3CFCL 5B38A 1DVFA 1HHIB 2RA1A 4OV5A 3GRWH 3EYVB 2A73A 4TSBH 3O9WB 4DKFL 3IGUA 3ILPA 1C5BH 3F6IA 3WUZA 2E4TA 3Q48A 2CLVA 2DQCH 4GRLB 4M9OA 4A37A 1O7DE 5LVEA 1CFVH 2E7LA 1QTYT 3O6FC 1KV3A 3HTLX 5DS8B 2FH8A 1J5DA 3VM7A 5HVFB 4YHIA 2H2SD 2FUQA 3N41B 3WHE1 1W72A 2CK0L 2FATL 1ZDQA 3BH8B 1A6UH 2VRQA 1JZ2A 4PB0L 1F4WL 2XTJE 2VLRD 1U3HC 2ATKA 2O6CA 3GM0A 4IRSA 2VXVH 4Q9BA 4QXGH 4X6CE 3TZVA 1MLCB 3B43A 2KUTA 2JTYA 1ND0A 4KH9A 3CH8A 5IK3A 3V8OA 4KUZL 5F9WC 1WFTA 4TOYL 5I1CH 4K9EC 2GW5A 3VH8B 4E9VA 4JM2F 1BVKA 3QDGA 4H26B 2F5AH 4WJG3 1DQLH 1I9EA 3PF2A 2H2SC 4JFOA 5LBSA 4LOEA 1XQ4A 1BM3H 2JJTC 4OVVA 4WVRA 4YL9A 1SUJA 3PPEA 5AL0A 3UGUA 1V3KA 2DKMA 4HPOH 4RAVB 1FH5L 4HF5L 1MN4A 3SQOL 2H6OA 3FQTB 3N3EA 5FUZL 1JPFA 4IRZH 5TFSH 1P6WA 5DJ8B 5JLZB 2ADGB 3CMOH 2ZQKA 3P1VA 3MOBL 2NW2B 3ARDC 4XCFL 1SGKA 5A3IC 4O9HH 5C09A 4ONOA 2DY2A 4R97C 2CA4A 1HEJC 4DGVH 3OGCA 3LS5L 4KXAA 4JKPH 2WY3B 3X1BA 4P2OC 1GR7A 4GS7B 2O5ZH 2IDCA 4XP6L 5D7IA 1RZJC 2JIXB 3ROOB 2OTUB 4XRCB 2V0AA 1WFNA 4FD0A 3D18B 4D8PB 4JL2A 5GSVB 2IH1B 4LHUG 5CF3A 3ZUNC 1WIUA 5DU7A 5ID1A 4J7RA 1RZIB 2KKQA 4HEMA 1ZOXA 2XPYA 1IQWL 2IC2A 4X5PA 4CVXB 1KPRB 4DCQB 4RQQB 1VFUA 2EIDA 1BYPA 5IMLA 1D6EA 4QWWD 4N2BA 5ENWA 5DJAB 2W65B 3MYZA 2Y6SC 4KNTA 4K5LA 1N4XL 1QFHA 5DJCA 5KYWB 2DJSA 4NQCB 4W1TA 4N8VA 1QRNA 4JFFB 5J57B 2X40A 1BOGB 3BZ5A 3QEUB 3MV7A 3D7PA 3FB6B 2AS5M 5C9KA 1SQMA 3HUJF 1TLKA 1KYOK 1ZLDA 4OQ1A 4NFCA 3OG6B 3D3VE 1FNAA 4Y4HC 4F7PA 2VDKB 5IM7A 3HJ0A 3NESA 3NP4A 3O4LE 1TO4A 2OMNA 4G3YH 1X5KA 3MYJB 3UJIL 2DD8H 4PMEA 5HDLA 5HHME 3WY2A 5H37H 3REWB 5CJ8A 4Q14A 1GTNA 1SLVA 4MJ6B 5SX4I 1HHHB 3MDJA 4QD2E 1D5BB 1ZLSL 4W9KC 1YQVL 3C8DA 5GGQL 2K45A 2AXJA 4KVCL 1B2WL 3VCLA 3V4PH 5HGGS 4X50A 4DPCX 1GGIL 1XTMA 4PSRA 1MRFH 3HBZA 4D9LL 1LP9A 4XVJH 2LU5A 2XN9B 3E1ZA 3IMTA 4UV7H 5HI5D 4L0ZA 3EF7A 3GBDA 4KV5E 1WWCA 3T1FA 1JWUA 4UQ3B 1KLGA 2CM5A 4JO4H 4X6EA 4OZGA 4UANA 5D70L 1JD7A 3K74B 1J0ZA 1T5WA 4HWZA 3QARA 4WO4A 3V95A 4XNUH 2BMKB 5IBUG 3S9DB 4ZOCA 1EEUA 1YMME 3PGFL 5G2NA 4GFXA 4N9GB 4M7KL 2N1TE 1YMMB 5E8PA 4N0FA 2WXFA 1OF2A 4MKMA 3SDCA 1X5ZA 1K6QH 4G80A 4CDGC 2VR5A 3K80A 2QSTA 1BVNP 3N42F 1EJOH 3UXFA 3MGTA 2RB8A 4J6RH 5L7XL 3TEYA 3A4FA 4MRBA 1INDL 2J71A 9PCYA 1Q0YL 2CDFA 3AREB 2AJYL 3C75A 4H0GA 5FGSA 1OLZA 4FE9A 2YQGA 3MUGB 1S7SA 4K8RD 2BOLA 3TURA 1WTGT 3TM6A 4IS6A 1MPAH 1TYJA 3E1F1 4XE5B 4ZD3L 2VRKA 4X9BA 3IPEA 5EZJA 1T22A 4XMWA 4NPYB 4BHUA 4CMMA 2WBJC 1MFAH 4XOEA 1LE5A 2X4UB 2EQDA 5GZOC 1COBA 5JNYB 3EXJA 2N56A 3K46A 4BK4A 3PHQB 5LCVH 3BZ4B 2HTLD 4JM0A 1E3FA 3OLIA 5EBMA 4R0LC 3LNFA 3FFCB 1JPFB 2HLFC 5KVGH 3W11C 3IGFA 4L1DA 1RY7B 3MJ6A 3U6RB 5EEXA 3IWVA 1JPGB 1HKFA 5DS8A 5BVPL 3RPIA 2W0FB 2XCMC 3THMH 3DYMA 5JMRA 2CBTA 3MBEA 2AEPL 3N43F 5IBLC 4FA6A 3BDBA 3SPIA 5IW3A 4CBZA 1XGZA 3S3BB 1HHKB 1XD0A 4JM2A 1XXDC 4EOWL 1FH5H 4HF5H 3SDXB 4E42B 2YD6A 3NAAH 3II1A 1ND0B 3KLDA 4EN3A 3BVNA 4MXQC 1XMEB 5F72S 3X12A 1UXSA 3K7UA 2YQBA 1UWFA 4M48L 3L7EA 3VMNA 2R59A 2GJZB 4G8IA 4R5VA 3I6LE 5E6ZA 5AAWC 1LEGA 2ZNXA 3EGSA 4WDIB 2X4RB 2XU9A 5A16B 1OOAA 1FE8H 3MJGX 1P4IL 3T8VA 5HTSA 2V2WA 5IF0B 5D1QC 3CVIH 4MQSB 3MUJA 3EYUL 2VDOL 4JO3L 3VXNA 4DVBA 3JVGA 4ABQA 4RAHA 5EN2B 2EDTA 1P9MC 5BO0D 1XVSA 4RVBA 4YBQC 5TQ2L 5F2FA 4WKZA 1S6NA 5HJ3A 3TN0A 3NCXA 4X8JB 2VZOA 2VLRB 3TBTB 4L2LA 5DMGC 4YPJA 3SIKA 3PWVB 3G6JB 3UBXI 2VLKD 4L8BA 4F2FA 4HJUA 3UZEA 2QMKA 2VLJE 4JG0H 5GRXG 4UM8A 3DI2B 1YC7A 4ZMVA 1GCYA 3BQUB 4GXFA 5HI4C 1HILB 1SBSH 1G9NH 4PJ9A 2E46A 1AQHA 4FQPA 5BPPA 2Y2WA 3K1DA 1WITA 3DROB 4I4WA 3GPSA 3ZSSA 4DZ8B 1MHPL 4LSVH 4P05A 4WNJA 1FFQA 4KHTL 5DMIH 2Y2YA 1OEZW 3AT9A 1HAWA 2YKKA 4G5ZH 2X6CA 3ASOB 1MDAA 2A77H 5B1JC 4Z7QE 2BXZA 4AL8H 2FX8H 2FVNA 5KYWA 1P5UC 4M00A 3KPSB 2BRQA 3TA4D 3MO1A 3ULUL 1CF1A 3KPQA 5BRZB 4JLRB 2WUCL 1UFGA 4QTIH 1CDHA 2NUPA 3GS4A 4XX5A 5EG6C 1B2WH 1GL4B 5LLIC 1H8LA 4KVCH 1FVEB 3SBRA 4OJFL 4LU5L 4XN2A 3W11D 4DGIL 5EIIB 1ZGLM 4WNSA 4LOUD 5KVMC 4KTDH 4HPYH 4Y1SA 1EUUA 2IDUA 2NQCA 4Y19A 3VXSA 4Z6AT 4ZBJA 1I8AA 1A6TB 1J1XL 1G7LB 2J8OA 4B95C 2YWYA 1K8IB 3MRHB 4AX3A 5DCCA 3CXHJ 1G43A 4HWEH 1D5IH 1ZT4A 3HE7B 2HJFB 4HEPG 3STBA 3F83A 3MKKA 5AYTA 2OMTA 3SDYL 5FW7A 4MBRA 4MQ7B 1QBBA 3FYEB 3QDGE 1NCAL 2GJ6D 2IIJA 3HRZC 2BSED 1DQJB 2BSTB 1Q94B 3B7TA 4BDVA 3K71B 1NBZA 2APVA 2OFQA 3QULB 2C4FU 1T0NA 4Z7VA 2YPVA 2HPOA 5B4MC 2ENYA 2FX9H 4ODUB 3RDTA 4YBHA 1CICC 3B2UC 4MD5B 1DBBH 3P0YH 2YC1B 4PV8A 1IFRA 3PUCA 1GSKA 3HE7D 2ZUUA 5D6CA 5EZIH 2R8SL 3TEZA 3EFDL 1FO0B 1W9XA 5T3XH 1AS7A 4YFEA 2X38A 4LIQH 1CLZH 4OJCA 4Z7UA 4ZO7A 2AAAA 3VRLE 2OXGB 3L81A 1Q72H 5F7KC 4XCYB 3V6OA 4GIPD 2YEZA 3TPKA 4HKBA 3SSGA 2AABH 2ZOKB 4KJQC 4Z3TA 3MRLB 3PG2A 5K39B 2DQCL 2G9HB 3VG9B 3VGEA 3HE7C 4N6RA 5KJRL 1VPOH 1VZGA 3KHQA 3TLRA 1FVDB 15C8H 1WIPA 4IGBD 4JFPA 4XI5D 1KTLB 4LSRL 3KE0A 1JZ7A 3LZFH 4HX1A 3E6HA 3TPUA 4NO3A 5KBKA 5E8EA 2R0LH 1MJUL 1A6UL 3D25A 4N25A 3R7RA 1K4DB 3WENA 1IKNA 3P4OA 2GYSA 2R1XA 3CVHH 4XNUL 2JKNA 4H8UA 1MLBA 4DF9A 4RGOH 4JN1H 4Z5RB 4OKVA 1X5MA 1CICB 4KKPA 4N0CD 4X5LA 4XVSH 4JO1H 1V3JA 3GB7A 4Y2DB 2Q8BL 1U41A 3KDPB 2B14A 4GKZB 4QIRA 1MCWM 4TOYH 4DN4L 2C9SA 2PYEA 3ORJA 5DUMH 5AAPA 3DO7A 3TN0B 4HK3N 2OK0L 1SRDA 2ZX9A 1IBHA 2WN3A 2B59A 2Q7NA 3IEAA 1XGUB 2WXOA 3E8VA 2YGPA 3VXPB 3R7QA 4PIRF 5FX3A 5IOPA 2VTFA 1VA9A 2EXSA 3UPRB 1TUPA 3APMA 1PSKH 3T0BA 1GGYA 4F24A 1CG9A 2WB1A 3PIQA 5DZOA 5E2TH 4NN6C 1J1PL 2PPEA 3RHWF 1FZOA 1EEYA 1CS6A 1MQKL 4QHUA 1EDYA 1TTRA 1TYEB 1NAKH 2UX7A 4GKOA 4D0CB 2BS8A 3MV01 1FH2A 3PREA 5LNGA 3G6DH 1PNCA 1E5AA 4G9DB 3ASNB 3DOSB 1K8DB 4B41A 3Q7JA 5DMJB 1CFTA 3GXMA 2ZF8A 5EEWA 4AK1A 3M8OL 2VABA 1UACL 2OP4H 4LLUB 4LVOB 1S5HB 2ZXQA 2AF2A 1VB9A 4ZMLA 2AJXL 5H4YA 1GJUA 2F7OA 3IDIA 5C0AD 4AGPA 4EIUA 2X1XR 4ZMAT 1NC4A 3FO9B 5I73C 3CSYA 4ORGA 4D9QE 3KMDA 2UX6A 2CALA 1CLYL 2XPZA 3INUL 4MJ2A 1CFQB 2K7PA 4ZUVB 2WZPA 4PB9L 3RGVA 1CD0A 4AVKA 1Q0XH 3LNIA 4PRDA 3US0A 4NZRL 4BCXA 3SDDC 3QJFB 4PJIA 5CGMA 2W88A 4IIQB 1RZJH 4GLRH 1OE2A 2EDYA 2YSSB 3GRBA 4Y2OA 4F5CE 3JVFC 3K2UL 3LQZA 1DFBH 2ZWSA 3FFDA 1HWGB 5CS7A 3O6LH 5I1DB 4NHCH 1MREL 4TTDC 3K2MC 5I18L 1JD9A 2FB4H 4M4RB 2EO1A 1D9KD 3SGEI 2HVJA 1YN7B 3VWJC 4ES9A 3M1BA 2BHYA 3GFUA 3WL9A 2KHAA 2J25A 4S11A 2PTVA 3AY4C 4I3SH 3SCMC 4UQBA 1KB5H 4NZTL 4WUUA 5BRQA 4WV1C 3BVVA 2L8AA 1ASPA 2FJGA 4PLJD 3U4KA 4FMKA 4ZW5A 2ICES 3O6FD 2PWGA 4HU2A 4QKTA 1N7MH 1NWOA 1VFOA 3L9RA 4KI1A 4N87A 4PD4K 4RAUA 1EMTH 3VXME 2ADJB 5IUSA 5JA9A 4WENB 5IJKC 3DX3A 3QJSB 4ZXBA 4XNZC 5JXAH 4PRAB 1IGFL 1KENH 3B9EA 2XA3A 4UTAL 2WZAA 4P3CL 5K9QI 3LOWA 3ZJAA 2ZT9C 2GTQA 2ZUWA 3DV4A 4HLJA 5CJOL 5EBGA 4BZ1A 4XZUA 2E76C 5F7MC 2WWNA 4AI7A 4FQJH 4P23B 3K3QA 5GJTL 1BXUA 1YY8A 5JUEL 4P4KB 4QHNA 4R7NB 4HJ0C 4JK0D 3IU4L 1NCDH 1IVTA 2ZSVB 1NDMB 5C7XL 3RZWA 3EDDA 4AMWA 4PY7A 2CGRH 4ZTPH 3VFMB 1PLAA 1RUKL 4OCYL 3WJMB 3FO1A 4JFQA 2ZX7A 2MCG1 1QASA 2F1AA 2CU9A 3CFIC 4MD5A 4R90L 1UM4L 1AP2A 3RVUD 2FT8A 4JDZB 1QEXA 2H0EA 3LCYA 3RVXC 5J6GA 4WU5A 2F61A 2ZAGA 4XOBA 4EMZA 4W9LC 5E2UL 5AZUA 3OM3B 5FK9B 1LDPL 1LE9A 3GJEB 3KYOA 2WCSA 4FYQA 4P3WA 4MFHA 4K3EH 4JRWA 1Z2KA 5D1ZB 5BRZE 2FO4A 5FHAH 1MWAB 2WLJA 1OSZA 1ZVYA 4CMMB 4GSQA 3WNMA 3QR0A 1UM6H 1HHJA 3LD8C 2YQ3A 5KVGL 1SJMA 2JELH 1MHCA 3OXSA 4FG0A 4X98A 1DL7L 1NCOA 3D2UB 1KJ3L 4CVXA 3PAVA 5D8JL 3S37X 1AQKL 4BZ2H 5JW3H 1YUKB 3FB8B 2WQRA 3GWJA 5CEZL 3NABL 1KIQB 5C0BD 4PWFA 2DM3A 4AT6B 5I6KA 1G7JA 1NGPH 2DWDA 4RDQG 1I4FB 1RZ8A 1V27A 3LKQB 5KVFE 1CGSL 2CRZA 2QBWA 1FL6A 4Z7VF 4RFNC 2X05A 4OAWB 4OIFA 2WM0A 4L5FL 1R3HA 4HW6A 1LO0H 3BXNA 2XTJC 1ZHBB 2DW5A 1KLFB 4WWKC 2ARJQ 3WIIH 1Z3GL 1QFUH 4TYUA 5E5MA 4ANWA 1Q0YH 1J88A 3M7OA 3W82A 1L7TL 5T33H 1F5WA 2WBJB 2NYKA 4GQRA 1P1ZB 4EN3D 4CVZA 4Z7UF 2V37A 4HUUA 4ENED 4NUMA 5JPMC 1W0VB 2Q7YA 1LLAA 5DQDH 3FPYA 4GXUM 4RFNB 4P2OD 3G9VA 4LL9A 4CGUB 4XNDA 2FLRT 3LN4A 5E08H 2OSXA 1TLMA 3E8UH 3RVWC 1U3ZA 3CFJA 1DFXA 2AJVL 3U9WA 1BZ7B 3MGOB 4XP5H 4LRNH 3TIDB 4A6YL 2VZVA 4PCYA 2DQJH 2ZKHL 4G9FE 1OO2A 1FC2D 1NUNB 3MLXH 4Y4KA 3Q6FB 4LXFA 4TQ8A 3KYOB 2VDPB 4JRXE 1MY5A 4KNSA 1G7MB 1VERA 2X4NA 1UZGA 1OE1A 3QUXD 4L8BB 1ZSDB 2VDLL 1U3YA 3QNXB 2BINA 1G7HA 2FO8A 4NO2B 2IMNA 1H3TA 4XNYL 5DEGB 3RWHB 4FHJA 4HQQL 3IJHB 5B1BB 3ECQA 2ZYHA 3IAGC 3S4SG 4YQXH 3O9WD 4KI5D 4GRLA 4RETB 3BKYH 4K7PY 2JKTM 3A67H 1S7WB 3U9UA 5HSFA 2Z34A 4MVBD 3IVKB 3WY1A 4TVUA 3C5SB 2ZOOA 1U93A 4PGEA 5F93C 1J0YA 1XIWB 4HAKA 2PCPB 3GPEA 1RD6A 2AJ3B 2JJWA 3NOIA 5ESVB 15C8L 1KIRB 1HSAB 4PRID 2ATKB 2Y7SA 3HPLB 4WNQA 2VDKH 1QTSA 5EC2A 5JIDA 1XF1A 3JTTA 1PD0A 2F53E 2MOQA 5D2NB 4R4FL 1RZKL 1FNEB 2EKSA 3CV5A 2GAZA 1QQDA 5BS0B 5HHOD 3FT4A 1RZQA 1BCIA 1TCMA 4XX1G 4H8VA 4ODTL 4AXWA 4PYHA 2IPTH 2ORBL 3GMMB 4JY5H 1SJHA 1ETZB 5FA4B 4R4ND 2IMMA 3EJYD 3QEQA 4G11A 4PRHD 2FJGB 4U6XA 1Q0XL 3IPFA 1ICTA 5FO7A 3TASA 4EDXB 3O8XD 4CC4A 4FFZL 1O7DC 4PRPA 5GS0D 1CIUA 4O2FA 4IU3B 2LLNA 1QKZH 5DRNB 3GBML 3FONA 3I75A 1NAMB 2XHNA 4TMPA 4U1KB 2YPLB 2IALB 3EKCA 4Q56A 3EHBC 5G4MA 4HHAA 3IJ7A 4PJCB 1RVFL 3GDBA 2SODB 3UIZA 2WAQA 3LZOA 3CSFA 2UXGA 4G1MB 3QFJD 3WHXB 2IH3A 3G04B 3LPWA 5LGJB 5J1TC 2G4GA 2D0FA 3QZWB 2AEIT 4JN2A 2JFCA 2IG2H 4CVWA 2EJ1A 1CE1H 3P73A 3QUMH 1OAKL 3U9PL 4XN5A 1I7ZB 1DANT 2DQJL 3DPBA 4PGZA 3GS7A 2DBJA 5D1QE 3F7LA 2FB4L 3V5KB 4AWJC 2IGFH 3TF7C 4LCCA 3HS0C 5C86A 5J6SA 3QW9A 2ZWYA 1HFUA 4X6FA 4EUPG 4IRSB 2BSSB 3MCLH 2WP3O 4QJ3B 1KDJA 4PJDB 1OB0A 4NJAL 3VD0A 4HFUH 1D6EB 1L9RA 4HEME 2BVPA 4QGTA 4HJJH 1MUJA 4KDTA 4O00A 5GHWL 4BK5C 5JOFB 5PCYA 2BNRA 4JKLA 3Q9QA 1TTUA 3J8F7 2QJDA 1E27A 1L6ZA 2XJLA 4NRYA 3IF1B 5GXBB 1ZEAL 3WI9A 1A7OL 1G7JB 2YPVL 3EUUA 3KWWB 4HUCA 1KGCE 3GSVA 5E2WL 5IV2A 1KFGA 2CO2A 4YHKH 5IFJA 1QRNE 2X0UA 2Y25A 4H8WH 2A9CA 4RGOL 4WEBH 5D2NA 3ARDA 1SJEA 4IMKA 2OXHB 5JOPE 5KYYA 1PJWA 4L0PB 2VE6B 3SQBA 1BQSA 2YD0A 3WGUB 4JS7A 5IGXL 4XXWA 1O6TA 4I18A 3WEAA 4BIKA 5MP6H 1NZRA 4XCEA 3C2SA 1OLLA 2H2PC 1C12A 4LL1A 4TUOA 2PXYC 2Z92B 3SBPA 5JLZA 2PP7A 3QZLA 3V5HA 4XNMB 3O0LA 4PJCE 5EO9B 2A9AA 2NQDA 3FFCD 4YLQT 4Q6IC 3D09A 1HWWA 3ARPA 4Y4FB 4GLRI 4OLUH 3DX6A 4KKBC 4PRHE 4QRPB 4XB8A 2R0ZH 5BV7H 4FG6D 2MKLC 2VLJB 2VMEA 4ZOEA 2IH8A 4NM8H 4YE4H 5CU9A 5FYKD 5LUMA 2N7AA 2ZG2A 3CBRA 2FATH 5FW8A 3SDAB 1X6LA 3STZB 2M83A 3C08H 4U1JA 3ELQA 5IJKA 3SKJH 3DMMC 1NCBH 1IC5H 4J28A 4PBDA 2GBUA 2H0JA 3CC1A 3SO3B 4TNWK 4HJSA 3SYCA 4OZHF 3N91A 3NJGA 1UADC 1LL1A 1DQDH 4UNTA 4UT6L 5CZXC 2EIEA 3ZGHA 1X9RA 2CD0A 2R56H 1INQB 3Q3GB 2XZCH 1PZBA 1NMAL 2H7WA 4JQIA 4QR7A 4UTBL 2J2ZA 4B9KC 2ADFH 1RV6X 2QVKA 3ARTA 2JQAA 2WIIA 4DO5A 1E9QB 4NQTA 3DIDA 3IU3B 5TF1L 2H26B 4KXBA 3BKYL 3TL5A 4F33B 3U25A 2Z7YA 2FLBT 1QACA 2EYRB 4KTEL 5ID0B 5FOBA 3BEVB 2AKRB 1TU2B 2JK5A 3PGDA 1E7VA 4LKXA 4ABWA 1NJ9B 1MXDA 3LZQA 3CZNA 2J8UB 5ERWB 2B0SL 4K2UL 4JFXA 3IE9A 1NBVL 3QCUL 4JG9A 4M7JL 7TAAA 2HMID 5JHLA 2EILB 4ZK8A 5IB1B 2AVGA 2Z8WC 4JM4L 4OJDH 1FI8C 3UFIA 3E7JA 1CXLA 3SDCD 3WO4B 2HFFB 4L48A 5SWSE 2N3JA 3DYOA 3P3YA 4MZ2A 1YO4A 3TBYA 1YEDA 3X1FA 1X7QB 1WAPA 3BVWA 3DUUB 1FSKB 2A4CA 2VR3A 2P5WA 3EUDA 1U58A 2ICWB 2FIRT 1YNKL 4BSVA 4HIXH 3UAAA 4DPRA 4Q6IA 2NY1B 3GJEA 1E28B 1OP4A 2HWZH 3MFFB 5BCAA 1ZK9A 3IFNH 2L7EA 2ADGA 2NOYA 1HH9B 3WFHA 1TEYA 1UGNA 4WSJA 3DTDA 2IDFA 1Z9LA 5CEYA 1EO8L 3GMOB 4GAYB 3W0WD 2GC4C 2AJSL 1RK7A 2OYMA 1QG3A 1IEAA 2BVEA 3UBXG 4NQCD 4RFOH 3C8KB 4DT2A 3IFLL 4N3TA 4XMTA 1G6RL 1DQIA 1A4JA 2YQ2A 3IDUA 2H47C 3ZDXF 3IDGB 4NRXA 5E6IB 2IF7A 1S7QA 3BWUC 4GAGH 5JPMA 4IOIA 1YEHL 3C6LB 2ZUQC 4J3OD 1OY3B 2F7QA 4XZUB 5F6IC 1M05B 4FADA 5AVXB 1UC6A 2VERA 4M7ZB 3L1OH 1HXMA 4NQEA 1F90L 2CUHA 5FYKU 1J8SA 4H7VA 4YHZH 5BS0D 1WAAE 4YSOA 1SEBA 2QVMA 4ZXBB 3RWFB 4LVHB 1A6AB 1AIZA 4I5BA 2VXQL 3EO0B 2BZDA 3NCYS 5L7XH 2A0LD 2EE9A 4Y4HD 3WJMA 2GTWB 1K9TA 3TCXA 3D34A 4F1SA 2CLVB 2VITB 4R8WL 1QSEB 4HBCH 3QNYB 1JV2B 2GTZB 3BPNB 4Q74A 1XR9B 3WSQL 3MXVH 5C0CE 2MRYA 4YHKL 4O2EB 2XA8H 4NEHB 2XTJD 3HLAA 1F1DA 4X8GA 2J6EL 3LZRA 2BO0A 1SUHA 5IVXB 3HN8A 2CO3A 3FQWA 4H2CA 5E2VL 5EU5A 1T2XA 1AGCB 2VC2H 1KIUA 4F7KA 5HD8C 4GI6A 3H9SE 1A6VH 1YNTA 2RMNA 3MLXL 4N2LA 3VGBA 4H20L 4TQHA 3ZL4H 4UDUA 4M8UA 1PZCA 4BD4A 1FBIH 4PY8J 4BBWA 4U1GB 5GGQH 5JO5B 1X5IA 5F7UA 1PQZB 5C07B 4GQZA 4P9HC 2EDRA 3Q2WA 1FNGB 3VU1A 3NN8B 3B34A 4QO1B 2QQLL 1GOHA 4HLEA 5IIEA 4TQEL 1W15A 1OCZB 3T0VA 1TTAA 2HKFL 2BY0A 2R29A 1JPTH 4LL4A 4KRNA 4PTTB 3KM2A 5F0MB 1ES0B 3HE6B 1L0YA 4AEFA 4NJ9H 3CHSA 1IFHH 2Z35B 4A7UA 3F6JA 3ZKXC 1SY6H 3RQ3A 32C2B 4I3RH 3QJZA 4GKNB 1ZLVH 1BVZA 2XBDA 1MQ8A 1R34A 4LEXH 4DOHB 1H5BA 4H0LC 4ZX6A 1UUSA 4OJYA 4DP7X 2LLGA 3KLLA 4OV6F 5KS9B 2WWKT 3KLAA 5T5NF 4HSAC 4XVOA 5CBEB 4FFTA 1HXYA 4TVPE 2W0LA 3RUGE 4ZMTA 1ZKAA 2WLLB 1LE5B 4QY8B 4ZFGH 1GGBH 3O3EA 1M7IB 3HIZA 3HC0A 4NO0D 4I48A 3ETBF 3P9WB 3RPBA 5IQOA 5AKTA 4JGMA 4NP9A 4WGWB 4EF3A 4LHUA 1MFMA 4GKSA 5DSCA 2I07B 4EI5B 3TBYB 4FN0A 4Z7OE 2WJ5A 1U91B 3MRFA 3OAZK 3HAEB 5FYJH 1OP9A 1X5YA 4HGWB 1OGAA 3B6SA 3EADA 3MUGA 3LH8A 4GRWH 4PQXA 2VZUA 1OXYA 2EXYD 2ZUYA 1SJXA 4UT9A 2QV4A 3GMRB 2M2DA 2AANA 1OPOA 3ARGC 2C7UA 3VACA 4Y9BA 1T4WA 3U2SA 5FYJE 3MNZA 4PJXA 4YDMA 1W2KT 3SDAD 3DV6A 1B4RA 1FJ1A 3GMNA 5L2JA 4LSVL 4QRSB 4DP8X 1K3ZA 3HMWH 1ULVA 3H2PA 3P4MA 1MLBB 5FO8B 3RX7A 3QNZB 3D39D 5GJSH 4F7CB 3RPKA 2J6EA 2C34A 3CU1A 4NZDA 3REVB 4QKXB 1RIHH 1TVBA 4D9LH 1FFOA 4WFED 3H9SD 4P5MA 3MRJB 1OHQA 4QHMB 1L9PA 4L9LC 2JKIS 1QZ1A 3F7YB 4ZX4A 1SDYA 8FABA 3QIUA 1H9DA 3UBHA 3FU9A 2C1OB 1CGWA 2NUPB 1QHOA 4JANA 2Y5QA 3DTXB 3FO0H 2WLKA 2R2HA 3NZ8B 1EK3A 1AQDA 2V3FA 2XTSA 4GG6B 1HZHH 2NY6C 2OZ4H 3CXDH 5EZOH 5HI3C 1MRDL 4OIBA 4YDLB 2E27H 4HCIA 2WIIB 1EBPA 4H40A 1Q9WA 2IBZX 3UDWA 4E41D 3BSZA 1JK9B 1WT5A 1J8HB 3PXLA 3OMZA 1OSPH 4GSDL 4Y4FA 5EO1B 4FRWA 5KVGE 4QRUB 3ZDZB 2QFPA 1EXGA 3GLDA 2BVQA 4HK0B 4DVBB 3OL2A 3SD2A 4JKPL 4TXVB 3TNNA 1JNLH 1HXMB 3EJZD 2XQYG 2BOBA 4X4XB 4X0KB 1TFHA 2ZOTA 3TBBA 2YEZB 1DQJA 5A16A 4XAKE 1U2YA 3WNPA 1BFSA 3IAQA 3UACA 3ZYJA 3KR3L 5CEZE 4CSTA 1Q38A 3DURB 1EJ6A 2GKIA 4YHMH 3ZZ1A 5ICYA 2D7OA 4CKVX 2BDNL 2V5RA 1LO5B 1W0WB 3NJLA 3BHBA 3CU7A 3EJSA 3MACL 3FN9A 4IOSD 1OTTC 5D7LE 4BWWA 4X8JA 2AJZB 5JW5B 1PLGH 3LQAH 5DEJA 4PJAB 3SBWA 1TETH 4Z7VB 4DW2H 4AG4H 2ZUXA 4HUMB 2IDQA 4XRCA 2YBGA 3TTSA 3V0VB 4ANXA 2Z8RA 2HTKC 1M53A 3F62A 4UF7C 1N67A 2AERT 2FLMA 1OK8A 4X9YA 5E8NB 5DVMA 1PEWA 4RFOL 3KPPA 1RU9L 4K0OA 4JKWA 3L9EA 2DM4A 4X6CB 3HE7A 5GGVL 4AEHH 3BE1L 3QQ3B 5DEZA 5AOZA 4F33A 4YSEA 1X7QA 1RMFH 5FLUA 3BRFA 3LEVH 4FLRA 4W81A 4X4ME 5L2KB 3TGXA 3QUGA 4ZXBD 1UJ3C 2HFFA 2YO3A 4TULL 2CHZA 2XETA 3HHMA 3VXUA 2NYYD 3MBEB 4Z77A 5DJ0B 1JMZA 4L3FA 3HI1B 4YXKL 4MNHA 1MJ7H 4PLKD 1MW2A 1SMOA 3S8WA 4AQOA 3GSNH 4NCC2 4AIEA 1T04A 4KDWA 2YLKA 1ACZA 4UTAH 3COOA 5GGTL 2A7BA 1JI2A 4W9ZA 2HT4C 5K1VA 1LK3H 1TQTA 1VFAA 1X9QA 5DFWH 5HVHC 3IDNB 3L4WA 1RZGB 3BUYB 2CBMA 4B5EA 2N1KA 3VD5A 2HT3D 2R1WA 1BREA 3GSRA 3EBGA 4EDXA 4U1IA 5B3JE 2OM5A 2WTOA 4A66A 2PW2A 4XOAA 4DKFH 4XNMA 2FR4A 1X5FA 2WBKA 3FXIC 4W9CC 1BEYH 1ZS8A 5HHXH 4I0CC 1CLZL 1BGXH 3O81A 3FL7A 5DZLA 4HAFA 1XH1A 3N1MC 4ZODA 3OKNB 4I77L 4M5ZH 1T0MB 1IL1B 1IGIL 5A43C 1QPKA 4OIIL 4PW3A 1RJLB 3JWOC 4NJ9L 2ITCB 3OSKA 5SX5K 5CZRA 4AUYA 3L7FA 4ODBD 4R96A 4NT6A 5F7FA 2XT1B 4OF8A 2K6ZA 3VNZA 1QLFA 1P6AB 4FQXA 5DVNA 4DQOL 4AVHA 5CN2A 4I2XB 1S2EA 1OM3H 3WHE0 3MRPB 3BP5B 2NY3C 1S9XB 3ARBC 4JJHA 4LCWB 1D5IL 2PF6A 3CNKA 4HKJB 3EFOB 4YE4L 3ZHKA 5ITBH 1GGCH 2I5YH 1FQ9C 1X9UA 3VFGL 3B2VH 4N86A 4A04A 3RLSA 2P7TB 5M7QA 1WWAX 2K3HA 5IW1A 5DI8B 3QDJA 4APQC 4Y5VA 5DJXA 4X42A 3BUIA 4TPRL 3WG7B 4YDIL 2D7PA 1U8PB 2BRRH 4V33A 2YXWA 3TIEB 5IJVB 5GGSB 3FRUB 1KB9K 4OKDA 2JB5H 2VJ0A 1SHXA 2O5ZL 1M1SA 1E40A 4MXWH 3UO8B 3WSQH 3T3PB 4XNQA 3B56A 5DRWB 2YUXA 4YE0A 4N2IA 5TE6H 1OSEA 1FFNA 1I1AA 3OF6D 3BVUA 5AW6B 1XBDA 5FCSH 4CW1B 2XVKA 2JB6A 5ILTH 2CZNA 4QOKB 3PABB 1G7MA 2X4NB 1WS7A 1P5VB 3A5VA 5EZIL 3B8SA 1U0QA 1XH3A 1IFHL 2QKIC 3DX9A 3FTZA 3R0MA 4Q9QH 4ODHL 1IEHA 3OGCB 2CO7B 5FGCB 2I9TB 1SXNA 1OZUA 4Z95L 3RTLA 4F27A 4KQ0A 2DQDL 1KT2B 4PJ7E 2H8PA 1UB5B 1AXTH 1F56A 1QUNB 25C8L 3QUMB 4RQQA 3UABA 1JZHA 3UTSA 1FG2B 1U6AH 4JZOB 4POYA 2Z7WA 4D0BA 2Y1ZA 3H9SB 3K72B 4ELKA 4KQ3L 4NS0A 2CPCA 4JCLA 5H8DA 1A6ZB 3UTOA 1IM3D 2Q7AA 4BQ8A 2XKUA 4HBQA 4DP6X 3QXAB 4HZLB 1V05A 4GXUN 4AMKH 1FYHB 4J3SA 4DETA 2WXKA 4GEJA 4P5TA 4CN6A 2GITA 4PB9H 4QRQB 4NNXA 1I9RL 3PJSB 1UWYA 4UOW0 1AGBB 1C1EL 4LASH 2HJKA 5CJQL 3AQZA 4EEEA 5D1XC 2O30A 2VN3A 3EJRA 1QSEE 1OGAD 4JGUA 1JHKH 4JREC 5CCKL 4Z7WF 1RUPL 2VR6A 4NNPL 2WHVA 1NCWL 1NCAH 2XN0A 2VUKA 1D5BA 1QAWA 3UG4A 3LKQA 4HC1L 4ECNA 4OCNC 3GMMA 5C1MB 1JDDA 2BNUB 1GS6X 3UBXA 2HYMA 2G60H 1IC7L 4AUUA 5L8KB 2J5LB 3JT0A 3IAPA 3X1NA 4G8FB 1QR1A 5DRWA 1YLBB 1QSFA 4NWTL 2DTSA 3FT3A 3KL0A 3U2IA 1C08B 4IK6A 2NZ9C 3VFWA 1N3NB 1O9ZA 4F8LA 3MHZA 1HQRB 4OJFH 4XXCC 5IVXE 1TZHA 2OZNA 4A7VA 3CJJA 3OLEA 4J4PA 3FSOA 4FTVA 5D1ZA 4KK9D 3VU2A 5K93A 4PHXA 5T3XD 4DH2A 2P4AB 4UWQB 1G87A 3DX8A 3ALWA 4OCSH 4JX0A 4YLCA 4XWGL 4ZZFA 4NN7C 3MNVB 3NPSC 2OCJA 5JHBA 3GK8H 4HK0A 5DJ0A 1E2VA 4M5TA 3DMMA 3L1FA 4JFQB 3DHPA 5CKGA 1OAZL 1T7XA 3SDYH 3N40F 1WISA 2VSKB 3P02A 4RBPH 4NENB 1XZ0B 2BNQD 3CC5A 4OCRL 2AXGB 3WN6A 4CNIB 1S7UB 4JPKL 1NBCA 3TBSA 1QPXA 2IDSA 3WV0A 5C0AE 1IBYA 2A73B 1D7BA 2DWXA 4HIIA 4LMQE 5DVPA 4N5EC 1YY8B 2NR6C 3H42L 4U3XA 3BXNB 4MAYC 1I8IB 1HL8A 3NSJA 4TULH 1U8IB 4V2CB 1UA6L 2F7IA 3SOBH 3QISA 3VI3B 3CCHA 4PG2A 5IQNA 5MENB 4HWBL 4BH7B 3HB3B 4GI8A 1RFDL 5IFAH 3HVDA 4GXVL 2WINB 4RRPA 2F5BH 2A74A 2P47B 2XOTA 4OU3A 1GJIA 2ZF9A 1N64H 4K5NA 3L5XL 3ZOAA 3K6OA 4MJIA 2F8XC 4WW2C 4K23L 1JXKA 5DZAA 5AOIA 4IIQC 4JFEB 3VNYA 1NINA 2FJHA 3BX7C 2B4CH 2ZIDA 2QKIA 3FQXA 4N2CA 3T0EE 4IKIA 4B9PA 3O2WH 4N85A 4OM1L 5I0WA 3AM8C 3F00A 3RAJH 4O5LH 3GSNL 3NZUA 3KBEA 2GK2A 2FQDA 5A2JH 1K5NA 1QBMH 5ICYB 2IPTL 3ZO0A 1OZTG 2JLLA 1MWAA 3FAWA 4ESKA 4WHDA 3ZT7A 3PDDA 2IO5A 4H4NA 1P9MA 1EAPB 5D7LA 5HJBA 4ONFL 3UTTD 3Q8AA 1FFTB 3WIFB 3LMJH 2DI7A 3A6BH 5F9DC 4A67A 2P7TA 5EEUA 1EJ8A 2VL5A 3K8LA 3NCEB 5CD5D 3FOLB 1PMYA 4WWKA 3W2DH 1NIAA 4HOMA 4MNHB 2P80A 3VI3E 2DQIL 2PCFB 2Z31B 3GSQB 3MV9A 1RUMH 1ZXKA 4IEFB 5TGBB 5IB3B 3MOBH 4V2BA 3X3FL 4X98B 3CMOL 6TAAA 4HZAA 2A38A 1DR9A 1F42A 3VD1A 2VDQH 5HDQL 2YIHA 4TRPL 3QDMB 5D7JA 3VA2C 5I19H 1XH2A 4FQXD 4X7CC 2RFXA 1QOKA 1TJHH 4JANB 5HVGB 1KSRA 5ADOL 3TVMC 3EYOB 1A7QL 3ETBJ 2DV6A 1RJZB 3S37L 5JO5A 4PLOB 1IEBB 1H3UA 3F7YA 4PI2A 1NCDL 8FABB 3ARQA 1B9KA 1JOIA 2OULB 5HDBB 1ZV2A 4Y8DC 3DJSA 4P9HL 3P9LB 4YDNA 3QK0A 1S7XB 3BPCB 3CFEB 1FFOB 3RGBA 3RVVD 4NZJA 4O51A 4OZ4B 2DBLH 2ZKHH 2WXIA 3ESPA 5KVFH 1ETA1 2IFGA 1KCRH 3A21A 4B27A 4UTAA 4AMXA 4JQVC 4F9LA 5I1IH 5E9NA 3TYFA 5FB8A 3U48A 3S3SA 4MWFB 4GUOA 3IRPX 4K3GA 4P4KA 2B39A 5K1NA 1R3LA 3IDNA 3QFDB 1UOVA 4NQXB 3CLEL 3FNKA 3ULUD 4Q4EA 5ESVA 5D70H 3FTGA 4F7TA 3U1SL 1FNSH 3THML 3CFMA 5JQ6H 3PNWA 5JORB 1IL1A 3QQDB 3UPAA 5BO1L 5E6ID 1K4DA 4LRIA 3GZKA 5CCKH 2ERJB 1SVBA 4FQQA 2Z4QA 1Q9LA 5E00A 1MCLA 1ZS8B 1PG7W 3BZEA 3FQNA 4U1LB 5DK2A 4FEMA 2OMWB 1Z32X 2YPLD 2EH8H 2B08A 1WBXB 1YEGH 1AH1A 1VLXA 4P2QE 4NO2A 3WKYA 3TBVA 3VFNB 1M7DA 4MZ3A 2EDOA 1E4WH 3VFUB 3BQVA 2ENSA 3O6LL 4QRRA 4GMTL 3MLVL 4P59H 1ZA3A 5DC0A 3HHRB 2XNAA 4ZUVA 3RWEB 5LAXB 1GYVA 5C0RH 1HKLL 1J18A 4MSWA 5C0DA 1KUMA 4OLVH 5IB3A 2CDGB 5GS2H 4HU8A 3LQAC 4KKAD 1S7TB 1Q0EA 3LRMA 4WAFA 4G6FD 3LHAA 5HHNA 1IQDB 2EEFA 1CWVA 4R2GB 5GZNA 3UBGA 3KGRA 3RTQA 1CI5A 3KVPA 1D5RA 4WRLA 2J3SA 2DMKA 2DWEB 4XO8A 1VGEL 3EYSH 2F58H 3N9GH 4NBXB 1QLEH 3BISA 3GJFK 4OB5H 3RWGA 5DQJA 4UNUA 5DJZB 3C2AL 4IQHA 5E2WH 2C4FT 4L9LB 3T77A 4HH8A 4ZTOH 3LRSA 1U8LB 4WFGD 5FYLE 5IBTH 4UOQA 1XGYL 3Q5TA 3N04A 2XXGA 1F02I 1KFAL 1HYSD 2LU7A 2J73A 4OQTH 2ARWA 2V7NB 3MOAH 3SPCA 5IMMA 1DSFH 4ZQKB 4DEPC 3FU5A 3OAUL 5CJBA 3ZTNH 4I18C 4TNGA 5DHXB 1NA8A 1TQUA 5SX5H 2XZQH 2A6KA 3JTBA 3MRQB 4YDLC 4JJOA 3WTUA 2E7MA 2IGTA 1IAOA 4HS8L 1JZ4A 1BM7A 3NZSA 4K8RH 2DM7A 4HSQA 1WGOA 5C9JB 3FC8A 1J86A 2EVIA 4MD4A 1CR9L 2R2EB 1GC1H 4EDWH 1DJGA 1U2CA 2R83A 1SHSA 5HJGA 1WZ1H 1I53A 2HJLB 5FDWA 1CBJA 1J48A 1I1AD 1FORH 3OF6A 4XXDB 2OX5B 2GTZA 2Z0BA 1OAXL 5INCB 2XQYA 3CFUA 5L8JB 3MV9E 4EJ1C 1NM9A 1PLCA 2DQUL 2J6EH 3FSVA 4RSVA 4RMSA 3EJCA 2OSWA 5JHDA 3VJ6A 4WHYH 4NQUA 3ATEA 3GT6A 4K3EL 4V1DD 4HGMA 5DS1A 4X5XA 5I8CA 2WQUA 4GUCA 4W9JC 1B9ZA 2F7RA 1KCVL 1XCTA 1FVEA 1IIKA 2I60H 4FA8A 2IANE 4NO5A 2WAHA 5KWYC 2K70A 2N59A 2DMCA 3BFOA 5JHAA 3MO1B 1ES0A 1MCIA 3HE6A 4XHQA 3QWOB 2EYRA 5ID0A 1J0KA 1KCUH 4R7VA 4UIKL 4F8OA 5IQ7H 2E47A 3IKCB 4K7FB 2VDNL 3CN3A 1OARL 2PKDA 3KPMA 1E8ZA 4JDEA 2KH2B 1E8WA 5E8DH 5J1AA 5A6LA 3PWPB 3DDGA 4R4NC 1YA5A 3B3IB 2BNQA 1Y7VA 3R19A 3WS6A 1R5IA 5I74C 4HWNA 3C5ZA 4C56B 3OVUB 3VRIA 4P5RA 1XIWC 3NIFE 4N2AA 1MCPH 3NQIA 1J8RA 1ZHNB 5IVOA 3RNQA 2Q8AL 5EORH 5CCJA 5IY5B 1D5XB 3T2LA 4M5SA 1JZ8A 4OIIH 1M1XB 1WBYA 4JMNA 5E24E 4LP4A 4RISL 1T83A 2WLIB 1SYSB 1KCRL 4JVWA 5B38G 1WAAF 3O2DL 4KTGA 1OM9A 5AVWB 1E4KA 2AAVA 3PWVA 3JT2A 1FO0A 4NXSA 4UAOC 1VDGA 4RWYH 4ZO9A 5EUOA 4EIBA 3IXTB 3TYFB 3SE9L 3I6GA 1RI8A 3ALXA 3SCMD 4XGZB 1QI3A 4XZ4A 2WQVA 4MAZA 2CUIA 2VITA 3LMJL 3WS3A 3RJDA 2BHZA 1DTUA 4CU8A 4IBVA 3IBOA 2X0VA 1U8CB 1RURH 2F0CA 2YBRB 4OZ4A 1K4CA 3SKMA 5IF0A 1NOLA 3IN0A 4WV1A 2XZAL 1S8DB 4S0HA 4QRTB 4EVNA 4A68A 1SXSA 3ZE1E 2WTRA 1OCWL 1R19A 4KRPD 2EYSB 3ES6A 3FOMB 4FHBD 4LPWA 3X3FH 1XGTB 5C3TA 3SDDD 1VZIA 2UWEE 4UZGA 1P5VA 3MRIB 3HRPA 4Y1AD 1UXLA 1T66D 4FJYA 4KKZA 5JPMB 4ZS7H 5IIEB 2X6AA 4LCCB 4DN3H 3IJYA 4WI0B 4XPGL 5BUGA 2QPFA 1ZMYA 4RMQA 5ANMB 3IDMB 2Z9TA 3ZR5A 2DMGA 3U36B 1OW0A 3W9EB 2FJHB 1TCRB 1FAIL 3C6LC 1VRSA 1ED3B 4W68A 1S7SB 2C9UA 3DROA 4B3EA 1IAIH 1EHKB 4F37K 3RGHA 2J57A 3GGWB 3V5DA 3X3GH 1UTDA 4HULB 1MCKA 3QIBB 5FYJD 3LVTA 1V8HA 4LBEB 4TQIA 5AZEL 2R15A 1JXFA 1IGCH 4LPVA 2AHIA 1J1OH 3B2MA 3PDGA 5DUPL 4QOKD 1K8DA 1OAJA 5DZJA 1EX0A 4CRPA 1K5NB 3GHBL 2BJML 2VISA 3P69A 3QJUB 3RHWK 2FNWA 3MA7A 4HUNB 2A1WH 3KCPA 5F8RC 3QORB 4CNIA 4NKMA 3VVVA 4HGKC 5DMKB 5BZDB 2NNAA 2ZP0T 3QAZC 3VO0A 2AXFB 2NSXA 3SO3C 2TAAA 3LN9A 1TPXB 1U2HA 4LBAA 3WE6A 2PPAA 3GD1C 1TZGL 4P2CG 3V4VL 5IHBA 4CSPA 3AAZA 3O4LB 5E1QA 4K8RL 3CHPA 4Z7NB 4HS8H 5IB2B 2DM2A 1QFWI 2KDGA 3MKGA 3MR9A 5AKVA 4AGNA 2OR8A 2CE6A 4IOIB 5AYUL 1EANA 3F7KA 3W5NA 4W9EC 3QDMA 5E70A 1XB6A 1KB5L 4NZTH 4Y4FC 3ULUC 1KZYA 5KJRH 4DTGH 4OGXL 4PWKA 3TFKD 1FHNA 1H8SA 3CC5B 3U7YH 1BD2B 3WJLC 4KNQA 4ZW6A 3NDYE 2DQUH 1INQA 3Q3GA 2DL2A 1OT4A 3VXTA 5FKPB 1BFVH 3BSZL 5CHNB 4F7MB 4J3TA 3RVUC 3EGSB 1CCZA 4I13B 1QPPA 2OR9L 4JNXA 3AU1B 3MV8B 1SMDA 3KYMB 4PRNB 4D2NA 1WHOA 4PI0A 3K2UH 5T1KD 5HHOB 2D03H 5ITFB 4KKLD 2OXGA 4FQHA 1ZANH 4HLZH 1PS3A 3T4YB 2ZXEB 3L6FA 1G1YA 4P2AA 3OKKB 1UH3A 3RTQD 3S2CA 3BGAA 1S7VA 3ASWA 4LNRA 1KDIA 3QWNA 2ESVE 2D31B 3CH1B 4IBTA 3TA3B 3LEYL 4LPCA 4HKXA 4XH2A 3MV8D 3EFDH 3FOLA 3GO1L 3WFCH 3ZZSA 1FVCA 1TQBB 5I6NA 4W6WB 4DEPB 1HH9A 3L8QA 3PJNA 3DMMD 4YX2H 4IRSC 5AAMC 5EUOE 3VFTB 4WW2B 1P7KA 3GI8L 3RZCA 4IOFC 1CIDA 4G5AA 3T6WA 2IAMC 3S3JA 5BZWB 1WTLA 3QC5X 5DA4A 1HCFX 3VD2A 1I8MA 5GZNC 4TN9A 4N0YL 4LB8A 3JWDC 2PPDA 1WIOA 5C6TH 1E50A 2R69A 3MPCA 4PRPE 4OFKA 5DJ8A 4L3EE 3RDJA 1BMGA 5E5RB 3CFBB 5GRUL 4E9YA 3S88H 4G8EB 4NUJB 3V0GA 2UYLB 2E4FA 2AJUH 3AREA 2GJ6B 2ZZUT 1DUZB 4WWID 2KC0A 3FB7B 5I1IL 3ARFB 3Q44A 4PWEA 4BSJA 4H8WC 4HV8A 4J3UA 1J9RA 2RJMA 2EC9U 1OSZB 2VLME 4OH2A 5DHDA 1A7RH 2J1XA 2X9ZA 1XZWA 1PZ5B 2V7HA 1CFVL 1A3LH 2CR0A 5GS1A 4UM9B 3N1PC 4KHXH 1WFIA 3IETA 3N85L 5CINL 3DX1A 3FKUS 3QHFH 1ZE3C 1TYRA 1KPVA 1V10A 4RISH 3WFEH 3SGKA 3L9YA 5T5NG 2XKNA 3CK0L 5BOPA 1UB6B 2FNBA 2WZ0A 1BWWA 4ERSH 1PPIA 3GS0A 4Q4IA 4RDQF 1AKJA 4IDJH 4LSPL 4PRBB 1MJJB 5F70A 3UYPA 2RTTA 4PS3A 3TIEA 3K4ZA 2WUBL 5B38B 5HGAB 2E8ZA 2R2HB 5CGBA 2W65A 1R3KB 5TJWK 1AAJA 2XZQL 1THCA 1A2YA 5FFGA 3HNVH 1HKLH 2Y5TA 2YOAA 2X4PA 1EMTL 3GBNH 4JDZA 2PYFA 2DH2A 2C5DC 1JUFA 1E5UI 5E4OA 1GCFA 4NUJA 2VZ3A 3TJPA 1CQKA 4AE1A 1TZIB 3I50L 4R26L 5E8OB 1P1ZA 5C0AB 3WAJA 3ETTA 1A7PL 4N4YB 4F7CA 3ULSB 3VD7A 5DD6A 5EDSA 4U1NB 2HT2C 4XC1H 3ZE1B 1CI3M 1RCYA 4OM0L 4N1HB 1RZGA 2JVUA 3ARUA 3BUYA 3DRTA 4PVLA 4QRSA 4RMUA 5HHQA 4A7GF 5JDSB 4XODA 4P2QA 2EH7L 3VFSB 2PTUA 3WL9B 3L5HA 3BD5A 3C6EA 5HP5A 2P5ED 1OSPL 4GSDH 4OGQC 1ZGLA 1Y6NR 4OZIE 4AYMC 3PS6A 1TEFA 4M02A 1KY6A 3QEGL 2WGXA 3F65A 3QXWA 3MLYL 2XDHA 3ECVA 5GSVA 5DMKA 3HKZA 3T0EC 2ADJA 1OL0A 3NZHH 5F89A 1FSKC 1AO7A 3O8XB 1AG6A 1G0DA 1Q90A 2I07A 5JR1H 4PJIF 1NSNL 3BVXA 4EI5C 4X2UA 3RWHA 1E4WL 4I9XA 4IGBC 5TF0A 2QDWA 2NXZD 3E6FB 3ZPDA 5BVPH 4JM2C 3O3EB 1H15A 5FUCC 1ZSDA 3OKDB 3QQXA 4BQBA 5EA0L 4L37B 5JOPD 1N5AA 5H37G 5TQ0H 1RURL 4X6CA 5K9JL 1ZVSB 2NPLX 1QLRA 3V0IA 1ERNA 4HCFA 4ZO6A 2IJ0C 5I1CL 2DICA 1WFMA 2WO2B 1NC2D 1ZANL 1FIGH 4X99B 4QRTA 3CFJB 4YHIB 3PLYA 2J72A 4J6RL 4PGDA 1ETZA 5TE4L 4H1LH 3O2DH 3GTTA 1QLEL 1RPQA 3HB3D 3E2HC 4Q0XL 6FABL 4F91B 4LSPH 1E67A 2QSCH 4W4NA 3QUML 3VMOA 4UQEA 5L2KA 5I1KH 2PTTB 1B4TA 1IT9H 1NKOA 2IANB 1HHIA 3L54A 4FNTA 5H35B 2G5RA 5ACMA 3I3EA 4OV5B 4WU7A 5HHOA 5FA3A 3PQYE 1NQBA 1T6WA 2IALA 4PREA 3RB5A 3MN8A 1KEGL 1NWPA 2W9DL 3F8UB 2ZUTA 4PR5B 4MQXC 2ZXGA 4P2QB 3HC3H 4AQEA 2CBOA 2X3BA 1KTRL 1NGWA 2QGCA 3D4CA 1KGYE 4MA1B 4L3EB 4U2ZA 5DD6B 1FO0L 2GUOA 3UAEA 5KW9H 1ZWIB 1WDAA 3WKQA 2NNAB 2ZWNA 4Y4KC 3F3HA 3ATBA 4Y7MA 4XNXH 3D0AA 3BP5A 1W0YT 4M7KH 1T2QL 3VI4E 2FSEA 3TTYA 4FQCH 4Y16D 4PWHA 3MA7B 2EP6A 2C3VA 2D7NA 4KJYB 3NPSB 5JW4N 3ATDA 3SE6A 5LQBH 2X4OB 4G7VH 4MHHI 2AJUL 1PG7X 2WWMC 3MFGB 5FECA 4AMKL 3H8NA 3LYRA 4ODXB 1AC0A 4UV7L 1CYWA 2NR6D 3AAZB 3O4LA 4OGAC 4PBXA 4Y4KB 2EEBA 4XHJD 3TWCH 5KTEH 1JRHH 2XI9A 1DZ0A 1SPDA 5KYXA 3OAZH 4M1DL 2FEDD 3RY5A 2AXFA 1JWSB 1AMYA 5DJ2A 1ASOA 5EDXA 4AIZA 5BZDA 1ZT1B 2VGLM 3MV7E 3RU8H 2FYYA 3IPBA 3HI1A 3FH8A 2XIBA 1BQRA 2E6PA 2XKNB 3EH3B 1RUPH 3ZQWA 2XN9E 3I9GH 4Y9CA 4RCAA 1IGIH 2ETWA 1P7BA 4KZ0A 5CP3H 3L3DA 3NEEA 5KSAD 2X2JA 1FYTB 5C0JA 2AQPA 3WOVA 1Z3RA 4QJ5B 4WTXA 2GJ6E 2M8XA 3AU0A 1JCKA 1BZ9B 2F08A 3JV4B 3NFPA 3QDME 4BKLA 3E2HB 1IBFA 4QHNB 4R7NA 3IMVA 1ROCA 2FBJL 3VWJB 2LW3A 3NCMA 2HH0H 4Z0BH 2DQHL 4C4UA 1AJ7H 1JZFA 1YPZB 3RFZB 5H4ZA 2Y7OA 4ZW7A 3MAWA 2BH0A 4NPKA 1HHGA 1DEDA 4MYPA 5IB4A 1JMXA 4A2EA 2DLFL 3DRQA 2V3EA 4P4KC 4F57L 3B3BA 4P9MH 4YR6B 1HJCA 4MD0B 3QR2A 2YZ1A 4YBQD 4LEOB 3ZDYE 2R1YA 1UD4A 4MB3A 3A6CH 3K0YA 3FSAA 1CXKA 1QEWA 4TKWA 1J10A 4XBPB 5C0BA 4UT9H 4N2OA 3DIVA 1UVQB 1R3IL 4KK5D 5BMFH 4EBQH 1W0WA 2B2XL 4L29A 3QQ3A 4FG2A 4F2MB 3CLWA 1TTCA 2NY4B 4M3HA 1XGTA 2OBGA 2X89A 2R0WH 3A6OA 2EIKB 3CFNA 1EEYB 1FJ1B 3GMNB 4N3UA 3B9KA 2IAMD 2EDLA 3HJEA 4UM9D 1NGXB 4L4TA 3OGOE 3NJKA 1M2VB 4LLMA 3SCMB 4IBUA 3GI8H 2AEOA 1MCOL 3K0WA 4Y1AB 1ZLWH 5EF1A 1QNZH 5TDPB 3BN3B 4LLAA 2LVEA 3PP3H 2FBOJ 1B3JA 4UTCA 3Q1EA 4MDIA 3OZ9H 1EFXD 4X4YA 4HSCX 2P42B 3IYLW 3L5XH 2XUWA 5EIQA 2QZ5A 4CN1A 2HFEB 2Q6WA 3QRFM 3FZUD 2CK0H 1P4LB 3D39A 5F0PB 4LAQL 4Y5XA 3IU3A 4TUUA 3NZ8A 2I9LB 1WHPA 2FWSA 4B5ZA 2E7HA 3MA9H 4RMBA 4UQ2A 3HS0B 3F01A 4DTGL 2RQEA 1LEKA 2FGWL 3CPUA 2ILLA 3FT9A 4Z18A 1AGEB 4UCFA 4DQOH 1ML0A 5CSZA 1YQ2A 1JFQH 1B0GA 2BIQA 5EBWA 3V9CA 5EO1A 4YH6A 2JQMA 4JG0L 2N0MA 4LPYA 1QKZL 2PPFA 3RI5F 3GMPA 1UASA 2FT6A 1FBIL 1IGTB 2KLRA 2OMVB 5L9DH 3CN1A 1E7UA 1MNUH 1DQDL 3TNMB 5F1OB 2HFGL 4XPTL 2YUWA 1BF5A 4Q89A 3ZIYA 4ZMOA 5EF0A 3CQFA 3VFNA 2ZE0A 2Z64C 1W80A 2VLRA 5K5YA 1N18A 1KYFA 1Q1PA 1C8QA 5HGHB 3L1OL 5F88B 1CG9B 3QXTA 2XLLA 3SOBL 1FN4B 2P8MA 1TJHL 3LXUX 1A02N 1IX2A 1M2VA 1R0AL 2KZWA 4Z3JA 2Z92A 4N5UA 1TZGH 3JV6B 4PJHF 4PUBL 3DVIA 5K9QG 2G2NA 5AOKA 2QADC 4FNLL 3VFOA 5KSBF 4CC1A 4DIXA 5LG6A 3QZPA 3SZKC 1VF5C 4YDJA 3M88A 4ODXA 5I5MA 3KLHC 1ZT4B 1BIIB 1GZHA 4PJFB 1UA7A 5KYYB 2IEPA 3GB7B 4Y2DA 1MJ7L 4QHLA 4YXLL 2CH8A 4K9EH 1G7LA 1T2JA 2VB5A 2CIIA 1A6TA 4KJYA 2OI9C 4LKCB 2W5PA 4UQCA 3K5RA 1KFAH 3RWIA 4WUKL 1MZYA 5I1JH 5SWZD 2YD7A 4B96A 1OB1A 3ZVVA 3T2NH 4J3XA 3BPOB 5DDHA 4ZQKA 2JSFA 3U0WH 1YYLH 4JO2H 3GMOA 5TQ0L 3U7AA 4EI5A 4JJ5B 4DP0X 3EYOA 4Z3GA 4HS6A 1DN0B 4UQ2B 2OCCB 3M1OA 5L88H 3T4AA 2AK1L 4NB7A 2G3XA 2AK4D 4HOZA 5I30L 2G4EA 4E42A 2BY3A 4ZD3H 2BFVL 5JPNB 1BF8A 3CHXA 2UZIL 1CUOA 3L3DB 4LSTH 3ZZQA 1O75A 5TD4A 3DNKA 3NJHA 3FCGA 4HFWA 4I0PC 4L3ED 4WK2B 4DZ8A 2VW6A 4UDUB 1KBGH 2KMWA 1JGUL 4LQFL 1EWHA 3QPQC 5E00B 2YN3A 4WI8A 4X6CF 4DGYL 3OV6A 4A2MA 3WE1A 2OPCA 2BNRD 3FRPB 5EU5B 4BXSV 1TFPA 2I60L 5JORA 3FT2A 5E6SB 2F1BA 4JRYD 4OF0A 2VMFA 3LIUA 4U0RC 4OW6A 3I3BA 2QMJA 4O58H 4I3RL 2YMXL 2JK5B 3EZJB 4AEIL 3LB6D 5FOBB 1L7IH 3QQ4B 4ENZA 4I3GA 3BGMB 4L8DB 4BFFA 2D4FA 1UWXK 2H1PH 5CLWA 1KBPA 4D7BA 1QI5A 1TTBA 5E8OA 1CICD 2E7BA 2GTWA 5E8DL 1JTTA 1QWUA 1TTFA 4Q2ZA 1T0OA 2NY5L 2Q20A 3S5LB 1PY4A 4PJFF 2N4IA 2P9RA 3BI9X 2P28B 3DVFA 2OZ4A 2Z31D 1KG0A 3AGVA 2LOEA 1AGCA 1LD9A 4R6UA 2EICA 1NGWB 3NMEA 3OKMA 1DVUA 3MREA 3MNVA 3ZTCC 1BVLA 1KTKE 2C9PA 3BD3A 3DC0A 1M05A 5EMYA 4OTXL 4XMPL 5ALBL 3WJLA 5DUJA 3ZK0A 2OK0H 1OE3A 3QB7C 2CLRB 2BWQA 3BUTA 1F4YL 1P4LA 1BQHG 1QHPA 4Z76B 2XVBA 3BUDA 3FH5A 4XPAH 2RAMA 1AZBA 1JWMA 4UQIM 1QW8A 3C8KA 3MV11 2OTWB 5K1JA 3ZTJH 2KZKA 1GW0A 5E6IC 4KZDH 1S7XA 1XCQA 3HHSB 4HA1A 5EBWB 4KRPB 4KO6A 4ICXA 2Z91A 3DARA 1KXVA 2VWEC 2ZKYA 4NC1C 2WQWA 1XTLA 4HBCL 1C12B 4TUOB 2LLLA 3MODH 3P54A 2GSGA 2W1NA 3SE4A 3Q2LA 1E65A 3UROR 4AJWA 1QUPA 5ESAB 5FYJL 3QXDB 4F1ZA 2YXVA 2WBXA 4LVEA 1WUNT 2W80C 3BP7B 4QRAA 4OSUH 1BWMA 1KTJA 5FECB 4P46B 5EULV 5BXFB 1WICA 2QLYA 5FV1L 3QG7H 3M86A 3LS4H 3QUKB 3IKKA 5HYJD 1NFKA 1SN2A 4GT7A 1A4KA 2XICA 4PV8B 4WKZB 1H8OA 1Q1JL 1RULL 1SN0A 1Z0MA 2J21A 2OTPA 4GQPH 4KJWD 5C8JB 1VHPA 3JYCA 3OC5A 2FECI 4U6VL 1T7ZA 1EHXA 3P0YL 1W6WA 2QPSA 3L17A 4U3SB 5D71H 4ADGA 1BYNA 5GS1B 1Z5LB 1ACYL 1JI1A 5GPRA 2AP2A 1AACA 1E8XA 3VSVA 1MCJA 3Q8CA 1HL5A 1B0WA 4A7TA 4MKTA 5EIIG 5I0DA 5AVUB 1ZA6B 5K9OB 2NQ3A 5CZKA 4P46D 2NTFA 1HL4A 3U0PA 2OP4L 4M7LL 4L23A 1U8LA 4MRCA 3U6XS 1QMUA 5C2BL 4Q6KA 4NHCL 3QEQE 1MELA 1ZT7B 3NH7L 2ZOLB 4G6FB 1SVCP 3P9MB 4X80H 1I3RA 4YXLH 3F04A 1M6UA 2G5UA 1KCSL 3LIZH 4U7SA 1R3IH 5BMFL 3WFBL 2JELL 3WEXA 2GSIA 4N5ED 2GUYA 3RTQB 3D52A 5DUBA 1DJZA 4PG9A 5ACZB 4NZFA 4KRLB 4YN3A 5IREA 3LTVA 1WCBA 5D72L 4A2FA 1NGQL 3NFSH 3D69B 1UB5A 3FQ2A 4JLRA 4WTQA 1A9EB 1HQ4B 1MFUA 3NA4A 2GFBA 1MI5E 1MG2C 4NAMA 3RWEA 3H56A 4BH8A 4Z3IA 4AV0A 1VEPA 2Y36H 3EGDB 1NIDA 5H2BB 1F6AA 1A6VL 1AD9B 3B7UX 3FB5A 1OCRB 1BQHB 3GYRA 3ZSTA 1P7QA 2QDVA 4ZMQA 4HXAH 1TJIL 5CHNA 1GPOL 4LHQB 3CFKA 5BO1H 2X70A 1IZKA 3QEHA 1G7QB 3T1WA 1T6VN 2I32A 1JXGA 3V0EA 2ZYRA 4LCWA 2WLZA 5DJ6B 2B9BA 2DLTA 4BFNA 4YDKH 2GI0A 1W16A 5CBAB 4FYSA 2KLSA 5T1KB 2QQLH 4B50A 2WOBA 5E23A 3EYVA 3RP1A 3OKLB 1U8HB 1XDTT 2ORBH 3ERXA 4JY5L 3FTGB 5J9PB 1RUKH 4M7LT 5KJ4A 1IC1A 1MRCH 1YYMH 2ZTBA 4URKA 5GJSL 4GUPB 2BERA 4PJ9D 5HDBF 1R0AH 3ARGB 2W91A 1ZLEA 3MREB 2VQ1A 3NCJL 1W72B 2LT9A 3L3GA 2J8UE 5B22A 3DIFA 1I1CA 2AEQL 2JXMB 3AG3B 4AUJA 2UXTA 3O45B 1PL3A 4R3SA 5D2LA 1MWOA 5FDYA 1U8JA 3UCQA 4PGCA 2HB0A 4HKZB 3AMLA 1TMCB 4OZFB 5AQ0A 4B3VA 1H3GA 3L08A 4FNUA 1IO4C 1KTDB 5F7NC 1BX2B 1RIVL 1KJMB 5AEAA 5JOEA 3D6GA 4X9GA 3RWDB 2P5EE 3TCLA 4FQ2H 4EI6B 2DQIH 4WW2A 4R90H 2V6HA 1IARB 3MRKB 3U1SH 2XTLA 3KLSA 1E3ZA 4Y9EA 4BFJA 5CLZA 4XPFH 3ZDZE 3BFQG 4EZJA 1Q4NX 2WXGA 4FQXC 5GGRY 1KCLA 3I02B 2C9AA 1NUGA 4H88H 1JGLL 2YHGA 1A6ZA 2EXWD 5I8KH 1AZUA 1PCXA 2QV2A 2X1PA 4NKMB 4GP8B 2X44D 2XSKA 1F6LL 1CFSA 3KBHE 1LO0L 3VM5A 1MW1A 4OUUA 3CZFA 2Q87A 3DSFL 1BBJB 3GEFA 2QGEA 4Y19E 1KYDA 4HH9B 1VFAB 1YECH 2FIKA 2CO7A 1O9WA 5B39G 4PPTA 3AXHA 5E5MB 4HIEB 5T3XE 4TVPD 5IFHH 4HS6B 2NRDA 2F5AL 3EBHA 3U0TA 3QG6A 4ZUUB 1UD8A 1PLGL 1JHTA 3Q9PA 3KPNB 1UATA 5KUKA 1XR8A 1ZPUA 2WANA 1DL7H 4K94C 2AEWA 2KQMA 5GS1C 2VNCA 1TVDA 4HKJA 4IS6B 4PCKA 2X88A 3LN4B 2XXCB 1TCRA 2YBRA 4DZBA 4A2HA 1TQSA 1LO3H 1QWNA 4D8PA 4I2XA 1S78C 2P26A 3WXWL 2EDQA 4K73A 3KGSA 3US1A 4JPVL 1MXGA 4LARH 3NTCH 1S3RA 1CGSH 4NNYB 5L9DL