3Q06A

An induced fit mechanism regulates p53 dna binding kinetics to confer sequence specificity
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
231
structure length
231
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFVQLAKTVPVQLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKKKTMDGEYFTLQIRGRERFEQFRERNEALELKDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced fit mechanism regulates p53 DNA binding kinetics to confer sequence specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle/dna
molecule keywords Cellular tumor antigen p53
total genus 42
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3q06A00
1HJBC 4GUQA 2P52A 3KMDA 2J1ZA 2RMNA 3US1A 1CMOA 2XWRA 4HJEA 1CO1A 4IBUA 2BIMA 5G4MA 2X0VA 2J6WA 2ATAA 4IBVA 1IO4C 4AGQA 3WTUA 3ZMEA 2J1WA 2BINA 3WTVA 3WU1A 1HJCA 3D06A 3WTXA 5A7BA 4L18A 1YCSA 4AGLA 4L0YA 5BUAA 4AGPA 2ADYA 4QO1B 5LAPA 3WTTA 2BIQA 2BIPA 3Q01A 4G83A 3D0AA 1KZYA 3WTWA 3QYMA 2H1LM 3EXLA 5ECGA 5KBDA 2IOIA 1TSRA 3VD1A 3D08A 4XR8C 3IGLA 5ABAA 1EAOA 1EANA 3D09A 2PCXA 5G4NA 4IBYA 4IBSA 5LGYA 2X0WA 4KVPA 4L0ZA 4AGMA 5AB9A 3VD0A 2OCJA 4MZRA 2X0UA 5AOLA 3QYNA 3US0A 1E50A 3VD2A 3Q06A 2MEJB 5G4OA 5AOIA 1EAQA 2AHIA 4MZIA 3WTYA 2J21A 1HU8A 4LOFA 2VUKA 4IBZA 4IJTA 3IGKA 2J1YA 4IBTA 3WTSA 4IBQA 4AGNA 1GZHC 2FEJA 4LO9A 1T4WA 4GUOA 4LOEA 2J20A 4AGOA 4G82A 3Q05A 3EXJA 2IOOA 2XWCA 5AOMA 2GEQA 2WGXA 3D07A 4IBWA 5AOKA 2IOMA 1UOLA 5AOJA 1GZHA 3TS8A 3D05A 1LJMA 2BIOA 4A63A 2J1XA 2YBGA 1H9DA 3KZ8A 2AC0A 1TUPA
chains in the Genus database with same CATH superfamily
1DO6A 2XXFA 3F65A 3CVHB 1IZKA 1JGUH 1IGTB 3MOBL 2BSED 3ZIYA 1O75A 1AGFA 1OAXH 1OL0A 1DVUA 3OVUB 1KIQA 1AZCA 5JZ7C 1OAUL 4P5TC 1XGYL 5CCKL 3P4MB 5JW4R 1G7PA 1J7VR 4DP6X 4LPXA 1E7UA 3QZWA 4PLKC 5D2NE 2EINB 3QUZB 3ZT5A 3D06A 3GXUB 1KC5H 3HE7A 3L4ZA 3MRLA 2XZZA 1D7DA 3MSPA 1FYTA 5FUOH 1NCBL 2FT6A 4KX7A 4LSSH 4MQXC 1Z7JA 4WKZA 1DLFL 1CXHA 1T7ZA 2K6WA 2OZ4L 1NBQA 4WV1A 4XPFL 5FYJU 1JPTH 5BVJA 2Z8VC 3CFKB 3BAEH 2Q8BH 1NCDH 3V9FA 5E8EA 2NY2C 4MLSA 4XXDB 4MA7L 4LSTL 3MLUL 2XPGA 2QQNH 3VFMB 1JIBA 1S7QA 3VFGH 3LZOA 2DEYX 4XMLL 4HW6A 3SQBA 5T1LA 1S5HA 1S7QB 5E9NA 4YQXL 2BSSA 4Y5XA 2A9BA 4DN3L 2CPCA 4HUVA 2P5WA 3ABLB 3C5ZA 4H5SB 3K4AA 3LNHA 3NIFE 2X4NB 2CIKB 2QQLH 1IU1A 4ZQKB 5FO8B 3MGOB 3S35X 1OAYH 1GOFA 3N50A 1ZA6B 3FFOA 4GW4B 3WUWB 5CHNA 4WKZB 4AYFB 1KLUA 5KANI 4O2CA 4YSSA 3CJJA 1URZA 3MC0A 4GFXA 4N85A 5KVEH 1VB9A 3QWOB 2JFCA 1AG0A 4FXGA 4WWPA 1DFBL 3NCXA 4NZTH 3IAGC 1PIFA 5EUOF 2N7SA 3BUYA 3VFNB 4AVKA 2FR4B 4YLBA 4UOW0 2ARJB 4QTIL 1MCPH 3D33A 3ZN6A 2IMNA 3FAXA 4APQB 4YSOA 3VFGL 2APTA 4BFKA 1I85C 1G1KA 3RUGB 3P0VL 4UMSA 4N2BA 4AQAB 1I1AC 5JIDA 4PRBA 5C0NC 1KSRA 2JB5L 1LQSR 4N8VA 1ZLSH 2G3ZA 2Y3AA 2H8PB 1VEOA 2PCYA 2I32A 2YPLE 4PRIB 1IGYA 3HG0A 3F6LA 4HEMA 3T6WA 3QORC 4ZT1A 2DIBA 2P8PA 5L0QB 1KOAA 2FNBA 3MNWB 4XO3A 5TK2A 5TDOA 1VFMA 2OMXB 3BZ5A 3HMXL 1OP9A 2ZOUA 2VXSL 2V17H 3FT2A 2FRGP 5DEGA 3IJSA 3W2DL 3WNNA 1KCUL 3EO0B 3MV8A 2CXGA 2XACC 4G8IA 5IK3A 4IKIA 4CDGC 4HAKA 1TF4A 5BJTB 2AQTA 2AK1H 1GAFH 2O5YH 2ZAGA 3FHEA 1HS6A 1FFQA 4N24A 2JXMA 3FXIC 1ZDSA 3W0WD 5I24A 3ILQD 5KEZA 3T3PF 4NHCH 1M1XB 3U83A 1T3FA 4RH4A 1U92B 1DBML 1NGXA 4X6BA 2BSRB 4L5FH 4PMEA 3GTVA 1IAIL 4P23D 3CSPA 2GT9B 4ZAKB 1RK0A 1RJZA 4LCCB 2AP2A 4OZFH 5F1OB 1GVIA 4KKAC 1E3XA 1O7DC 1UD6A 1OSZB 1QEWA 3A6BH 3QUYD 1J11A 5BUGA 5C0JB 1FQ9C 2P43B 3CSTA 4RSYA 1AD9B 3QDGB 4GRWH 1K6QH 4KO6A 2BO0A 2O6FA 4G8GB 1ND0A 1R24A 4KUZH 2YXMA 2B39A 2IDCA 2KUTA 5EZOL 3WTWA 2X28A 5K59E 4JFZL 1NAMA 3G6AB 4HQQH 1QBAA 4JFXA 3DTXB 4BELD 5ADOH 3SE3A 3MAWA 4GP5B 4B53A 1I7RA 1EANA 3EFOA 3P02A 4IIQC 4IEFB 4KPHL 4Q52A 4YHOL 2NY3B 1PKQE 4HPYH 3WFDH 4M1CD 2HKFL 25C8H 2A4EA 1YMMD 3DIFB 1D6EA 3HEIB 5C0BD 2Q7YB 4ZMAT 2JTYA 1X9QA 4TNVK 1HQ4A 2ZWLT 2F61A 4S1QL 3HNTH 4XMWA 5JW4Q 1AMYA 1JPST 3RZWA 2AGJH 4KOBA 3KYMA 3AAZB 3T2NL 5EBLA 2PUQT 4XAWH 3K72A 3RWFB 1OWWA 3N42F 4CU8A 1A9VA 2C3GA 3EHBC 2VDPH 3S35H 4F9PA 1VACA 4GNKB 3WO3B 3O2WH 3ULUC 3U7YH 1MHHB 2HT3D 2NX5E 2IQ9H 3S8FB 1NJ9B 3UACA 1I9JH 3MXVH 5HVHB 3HNVH 3RFRA 1FH2A 2HT4C 1KCBA 2R0ZL 2GJRA 2ZP0T 1MVUA 3GBMH 4OVVA 1CFQB 2EYSB 1WBXB 3NESA 2XTJC 1NANI 3FCTB 1TQSA 1J8HA 4NQSA 2YGQA 3O41B 1KBGL 1NIDA 4J6RL 5DJXB 3I6SA 3B8SA 3BWUC 4EDWH 5I1DB 1B0GA 3IMUA 3SCMC 5DD3H 4AT6A 4QCIA 2E7DA 3QNFA 3QI9B 4N3TA 4XMLH 2FEEL 2AJSL 1OM9A 2IQAA 4G1MA 5F3BB 5F7NC 3LEYH 3OAZK 1QBML 4MS8D 2B59B 3OR6B 4HUXB 4N0UA 3UROR 2ZONA 1H19A 3IFNL 3O11A 1N5AB 1DCLA 5I1CL 1I7ZB 5EORL 4IKLA 1R46A 4NRXB 4Y2DD 1A1MA 4AY0A 1OALA 5IVXB 3FQUB 3T3PB 5MENE 3HNVL 4RVBA 4KO5A 4L8DB 3GUTB 2JKTM 1JD9A 1BBJB 5CSZB 1P53A 3DVGB 4ZYKA 1KBGH 4JO5A 3HR5A 3EGXB 4Y1AD 3HKFA 4B9FA 1KULA 4FI6A 3LEXB 1FAIL 4EQ3A 3U7WL 2EIBA 4Z3IA 1GGUA 4A1RA 1F5WA 1K3IA 1N26A 1YEFL 4O2EB 1Q0EA 4ZW5A 1TZIB 4J5VA 1ED3A 2NW2A 3DV4A 1LLAA 2QLVB 1ZE3H 3SPJA 4AC2A 1QSVA 2F08A 2AJSH 2DWEB 4YZFF 3B7RL 4GG8B 4XPAL 4ZMTA 4Z7OE 5JORA 1HCZA 3NK3A 2L04A 5JIHA 1CXIA 4X4ME 2NT0A 1J1PH 2IJ0C 4WU7A 5CIPH 2OSLB 1TJXA 3WHXA 3MJ9H 1U8KB 3OKEA 1S9YB 4KK6D 5GRZA 4IRJB 2FGZA 1EAOA 1JGDB 2XN9A 2PXYD 3EW3B 4WUUD 2VNCA 4K94H 5AW7B 3WCYA 1B0RA 1I8IA 3D18A 2EH7L 3ZHFA 4YDVB 3KS0H 4NQED 3RU8H 1MHPH 3B2VL 4U2YA 4JX0A 1WZAA 4PJ9A 5HYFA 3D2UA 3ISYA 3BPNC 3AG1B 1BVNT 2I25N 1SNRA 1ZV2A 3UJTL 4L4VD 1TQWA 5FO9A 4PVNA 4AM0A 1UWYA 2PO6A 3MRQA 4TSBH 2LTQB 3VXSE 2ITEA 1RMFL 3Q8BA 4HOZA 1EDHA 1HHHA 4QXGL 4UT6L 4NO0A 2WVSA 3L3OA 1MREL 2F5BH 4X9FA 1MJJB 25C8L 3NK4A 1IAIH 4JFED 3WGVB 3P69A 1OHQA 3NACL 2XG4A 2WVVB 1M05B 1YYLH 4FQQB 5F71A 3D1MC 3G04B 1NWOA 3MLTB 4LU5H 4Z7UB 3RIKA 2BXZA 3T0BA 3VTAA 3F58H 2YA0A 5FHBH 4XE5B 4JR9H 1ZV9A 2WBKA 4NKMB 2YPKB 1FCGA 1PKOA 2PTTB 4N0FA 4XCFL 3KPRB 1ZV5A 4LP4A 1TMQA 3SBRA 1HQRA 2ALWA 4DFIA 2B4CL 3EAKA 2Z91B 2F7OA 4DCQB 4EEEA 4MD4B 4P9HL 5CIPA 4Y19A 3WFHA 5CEZL 3DX0A 1SN2A 2C1OA 4BQ9A 3UAEA 4BFEA 4J2XA 2BNQB 5DYOB 1VACB 4XT1C 5AW4B 4HFWB 2LE9A 1E27A 1RUMH 1DVZA 2YGNA 1P0SE 2WXLA 1Q9WB 4PJ5B 2K1MA 1HYSC 1BAFL 1FBIH 5AUMB 2H6PA 1PCSA 2XNAA 3KGTA 3V5HB 2GIMA 5KN5B 4XTRD 4E9LA 5LAXA 4GRLC 2BSBA 5LGHL 4NQSB 3HI1A 3VFUA 3KBFA 2WUBL 2BVOA 2QV2A 2P52A 3BEVB 3VGAB 3KXFD 3KMDA 5E0FA 4LSVL 2AJZB 3FSVA 2BZ7A 4HFUL 4Y4KC 4PFEA 3MBXL 2H32A 5JIPA 3LXBA 2A0LC 2PR9A 4AYID 3ARFA 1MI5D 3T8MA 3W2DH 4MXQD 1L9PA 4DAGH 1WIUA 2X2YA 3WSQL 3FRUB 1NLDH 2Q6WB 4FABL 2R1XB 1BLIA 4PB0L 1E43A 1TQTA 1XSOA 1ETA1 3D3VA 4ZYKB 2P5WE 4LSDA 3AM8C 4KNUA 1SVCP 3UAFA 3DYOA 4JJ5B 4MJJA 4HU8A 3DWTA 4MRBA 2HMIC 3BGFC 3IB4A 1BHGA 1Z5YD 4IHOB 1QYGL 5GJTH 4Y8AA 1BD2E 1EBPA 2A7BA 2BS8A 2RTTA 2VL5B 2J6EL 3FTXA 4PJFF 4HIJB 3BT2H 4ZUVA 2Y22A 4YHPB 2Y7OA 5JUEH 3ZYOA 1A6UH 4XPAH 2ED8A 3LXCA 3OJDA 3D48R 3II1A 1LDSA 5DVMA 3T09A 5HHPB 3DURB 3LEVL 2A73B 5HJ3B 1UKQA 2WXPA 5C0JA 1RZIB 2Y7LA 1AZRA 1DVYA 4PPTA 3IK2A 4LLMB 4PJIF 4ZUTA 2Z1PA 3LRSA 1HNFA 3PHAA 2Z31A 2J12B 5EEYA 1SJEB 5LBGA 5MI0B 2EZ0D 2A9CA 3WTYA 1YQ2A 5T1MB 3K74B 4K5OA 4NI3A 4MAYD 2NZ1A 3UGEA 5GJTL 4JFQA 5TQ0H 2OYLA 4PGDB 3VYNA 4TTDC 4ANVA 1AMXA 3TFBA 1PY9A 3QDHA 5B39B 4JQIH 4RFOH 4E9TA 4FQ2H 5D8JL 3SODB 1TEYA 4WFED 4PTTA 2X9WA 4XN2A 3MJ6A 3WN5C 4Y2DA 5I0VA 5EFIA 4Z76B 2H47C 1WAPA 3MV8E 2LAGB 2B08A 5E8EB 3WLBB 1NEZA 4PJBE 4JO1L 2NXYB 1F2QA 3KLLA 5FCSH 2DI9A 1WIPA 4FL4C 4UV7H 1N7MH 1FYTB 5E4AA 4Y1AA 4IBWA 4QT5B 1B9ZA 5BRZD 4D0DA 3UMNA 4E36A 1Z1WA 3MFFA 4IMLB 4CMMB 5KBLA 5AOJA 4X6EB 5AB2A 3KD4A 5CKGA 5IQLA 4OV5A 5ISZD 4FNSA 5ALBL 2MMXA 4H20L 4R4BA 2YS4A 3WLWC 5CEZH 3OAYH 4BGLA 1P69B 1XBDA 1SZNA 1FPTH 2NLJB 5GSRA 2C34A 2NY4D 3QIUC 4MA1C 4Y2LA 3FU9A 5J1TC 2YD4A 4ZOBA 1TQBB 4K5PA 4M6NH 5DLLA 2BH0A 3RZCC 1GYWA 2H4EA 1OSZA 1QEWB 4BINA 2A9AA 4WIQA 2ESVA 4KJPD 4NXSA 1H5BB 1FDLH 5F7FA 5I6OA 1X4ZA 3I02B 1G84A 2J8OA 2WBJC 1ROCA 5TDNB 1XL4A 3QUZC 3SCMB 5JIMA 1KLUB 4GSDH 2BFVL 1DJHA 2G9KA 3LZNA 4LSUH 2YEQA 4PJHA 4HJSA 2ZXDA 3KPMA 4G6KH 5C0BA 1QW9A 4BYHA 2VT0A 3IXTA 3TBWA 1DJWA 3IU4H 4G72B 3VD3A 1N0XH 2H26B 4BV1A 3M17A 4BFIB 3IMVA 2UXGA 3GZPA 4P2OB 1LWJA 4ALAL 4DF9A 4G8IB 5D1QA 3TIDB 5J06A 3CFBA 1AXTL 2E9JA 5FEBA 1ZK5A 3ALWA 3F05A 3DMMC 1V55B 3B5TA 3R06A 4HWZA 5BS0E 1OTSD 4FMKA 4DW2H 5IROC 4KGJA 5AAWA 1Z3GH 4A2GA 4BDVA 2WBWB 1NDTA 3V0WL 3ZU8A 2V4LA 4MBRA 1YEJH 2B4CC 4NC0B 4N68A 3V4VH 3VXPB 2QQKH 1XIWB 2UZXB 2E7BA 3C08H 4GT7A 4H8WL 4MYPA 3ZTEA 3FFDA 1HYSD 4KXDA 3T1WA 2ZSVB 3MDJA 3M1CA 2KC0A 3DUUB 3VXUD 4HALA 4P59L 4AEEA 1NAMH 4APQA 1QVOB 3DI2B 1B90A 4KRLB 4AYBA 1VSCA 3W57A 4FEMA 4WGKA 3B3IA 3ULUE 1IKNC 3MGTB 2F2HA 4JPWL 4PS8A 3KPOA 3WOVA 4PJHE 5C0BE 5I82A 4E9WA 4X99A 4CKQA 3S3DB 4X8JA 2R69H 2D0HA 1QO3A 3ALPA 3MJGX 1NBCA 4HS6A 4XC3H 1BQHA 3FSWA 1PZUB 3DVIA 5AVSB 2IWKA 3M7FB 2BVPA 1RL1A 1J1OH 2OM5A 2VLRA 1GJWA 4JGJA 4QEGA 5FECA 2FBJL 1HDMB 2BRQA 4WY7H 5GGUA 4JZNB 4EE2A 2EDOA 1BPLB 1NGPL 1RPKA 2UX7A 1NINA 4UILL 5KANG 5K1VA 3ZE1F 4MVBC 4X6EA 4WNQB 3MO1B 1TXKA 1Y07A 4JFQB 4V1DB 2DTSA 3N44F 4Z7UE 1I4FB 4WHYH 4E41B 2GTWB 5IHUH 1ASPA 5D7SL 4KK8D 3BUIA 3EJQA 1EFXB 4UV4L 4X6CF 2H2PC 4PYGA 1WV7T 1QLEB 1TQCC 4B9JA 2CU9A 4P2QA 2NUTB 4KY1L 2EILB 3E2HB 1J9SA 4Y1AB 3K1KC 3QDMD 4UU9B 4YK4B 2VISA 3QH3B 3TPKA 2X4QB 2UWEF 4I88A 5GGVY 3RVXC 3HG3A 5A6IA 2HRPL 2NY0D 4CVUA 4U31A 4DOHB 3CVHA 1SJMA 2YD7A 1EGJA 5GRJL 5D7LB 4PGBA 2N0MA 1FE8L 2C8NA 3QDJB 4OI9A 3KHOA 1XH1A 5B4MD 2PYEA 2YK1L 4R4BB 4TQ8A 2IDFA 4HJUA 1JYNA 3DARA 1AJ7H 1UVQA 5C0AE 5I30L 1SXCA 3KYOA 3F5WB 5L8KB 2QDWA 4GKZA 3NFPA 5AYUL 3V0GA 3ILQC 4AOFA 5ICXB 3FB8B 3GHEL 3MLSL 2FIKA 4HUUA 4KKBD 2P8LA 3GO1H 5DMKB 1PS3A 2EDMA 5E9AA 5SX5H 2G2PA 1WTGT 5GHWH 3FN9A 1YUKB 4N2AA 4BWTA 2OW6A 3LV3B 1TJHL 1E50A 3QFJD 3IAQA 3NZHH 4RX4D 5C08B 3GJEB 2VR3A 1EAQA 3BX7C 4OZIE 5HJDA 2XWJB 4LE8A 5GRUL 4CNIB 3KPPA 4RMWA 4NN7B 2QLYA 3VAEA 2YR3A 3FCSA 1AGEB 1A6TB 1XCXA 1LK3H 3RTQB 5B38B 2OX5A 5JPNC 4TQEH 4OFQA 3RWIB 4F58H 1KT2A 2CR6A 3HC3L 1MW0A 4WW2F 5B3SB 2XN9D 3IDIA 1FC2D 2B2XL 2D7PA 1O7VA 1JPFA 2VR4A 3QB7C 5D7IB 4MJ5B 2DIAA 1MAMH 4PJ9D 4OLXH 3B2MA 4AENB 1RAMA 2OJ1A 1TDQA 3Q8CA 1W15A 2Z4QA 3UPRA 4JN2B 4QOKA 1BF5A 3RPIA 1J88A 3P4NB 1WITA 1HHJA 3SDYH 1R5VB 3MYZA 4OLWL 4UQ2A 5F9OH 3RVUD 4HBCL 5E5MA 1GZHA 3OKDA 4LLUB 1N5YL 3QJXA 2HUHA 3V8CA 1QI3A 2OR9H 4BSWB 3TN0C 4W9EC 1X5MA 4JM4H 5FWRA 2HJLB 2K4WA 1JJUA 4HCGA 1X5IA 3C6SA 4X5RA 2PW2B 3KG5A 3LQAC 1CLCA 4OF0A 3RE0A 4OB5L 2APWA 1T89A 1QOKA 2BVEA 4OTXH 4S1DC 1EDQA 1NGPH 3FQWA 2DLFL 1QKZL 4YHML 4E9RA 1EA9C 1Z0NA 3D25B 1CXEA 1JBJA 1GPOH 1Z9OA 3GMMA 3IMSA 5T3XE 2BOBB 1ZKAA 3HZYB 2I9LA 3HMWH 4D9QE 4HIQA 5C9JA 2ADYA 2J72A 1CGXA 1TQBC 3V6ZB 5E0QA 5JOEA 4XC3L 1ZVNA 4M8QB 2VL4A 3TM6A 5GS1B 2YD5A 1QO3B 5FAAA 5I73C 4F9LA 3SDDC 2QSTA 4QRSB 1VADB 3M8OL 2NTSP 2HFFA 3NCJL 3QEQE 3QAZB 1D7CA 3DOSB 1OPGH 4MCZA 5D7IE 4JGNA 3FF8A 5DJ8A 1FGVL 3L3DA 4XMZA 1ET5A 2PO6B 2Q1EA 5I15L 2CIIB 2W1NA 4MAYA 4O5LL 3O45B 3UG5A 4MCYA 1JTOA 2XKSA 3JTTA 3PAYA 3QIUB 4MA1B 4NRZB 3PGDA 1VFOA 5DQJB 2FEEI 4AEIH 3WYRA 1VGEH 2PPFA 3BO8B 4FQHB 3WHE0 4LCUA 3TV8A 1E2WA 5CZRA 3IFOA 4Y5YC 1PNCA 4YBHA 1MCOH 1N19A 4AUUA 1NC2D 1PG7L 4WWNA 1GOGA 4ZS7L 3T0AA 2BW4A 1XF5A 1XXDC 3L4YA 2P5EA 3C5SB 1U8IA 5TFSH 2GYSA 1F1GA 2ZKHL 4N2NA 4P2OC 5DJ6A 5IGXL 3M17B 2ZYIA 4RMQA 4ZX3A 3BH9A 1JZ4A 3BVTA 3VD9A 2AI0L 1MWAA 2B59A 3OR6A 2APXA 5K39B 5DJAB 3SE9H 2P26A 1UT1A 4CW1A 3AQXA 3KPNB 4E9YA 1MUJA 5F9DC 4ELDA 5MHSD 1C5BL 4PRIE 4M93C 3ZYJA 3MYJB 1K9TA 1Q1PA 1GC1L 2GHZA 3SBWA 4F8LA 1WICA 5LHDA 1X9UA 4JPWH 5ILTL 3VMPA 3FQ2A 4AQEB 2P5EB 2FLRT 35C8L 4DO6A 1A8JH 4FXKA 1GKEA 1UA6L 4XMPL 4XVUC 3UADA 1S7SA 1MFMA 4Q2ZB 3GF8A 3C8HA 3D39B 3SEPA 3BPCA 4JPKH 3ZTNL 1AOHA 3DO7B 5EG6C 1A4JB 3BXNA 2ZQKA 3D85B 1G6RL 4UF7C 3BAWA 3DX9B 2QHLA 4H2CA 5GRUH 4P46B 2XXMB 4WI8A 4X6FB 1B4RA 4J7RA 1ZVYA 1AQDB 1JK9B 2BS9A 3CVHH 4HKJB 2E9WA 4XNUH 2W0FB 2QR0A 1LK3L 2KH2B 4OJYA 3C8KA 1MCBA 3LCYA 1WRFA 1I75A 3GPEA 4DP7X 3HAEB 4QO1B 3N44B 3ASNB 2BIPA 5L4FA 7TAAA 3ZZLA 5FK9A 4XMVA 3OM3B 5E24E 4NQCA 2NXZD 3VU1A 5I1EH 1YEWA 4XP4L 1YC8A 5FYLD 1UA6H 3RYMA 3SQOL 2ZG2A 2YPVH 3S4SG 4IOIA 4NM4H 4KU1A 2Y06H 4WFGE 5ILTH 3GHBL 5DMIH 1JNLL 3X3GH 1BEXA 1ZPUA 1WWAX 4OF8A 3KNBB 4YL4A 3SDYL 7PCYA 4ETYA 3VG0L 3AXLB 4R7DB 1HFUA 1HQ4B 1T4KB 5EU3B 1IFRA 3IGUA 4Z0XA 3BQUC 3H7BB 4J27A 5IMMA 3UDWA 3WUZA 3DROA 4MAYB 1FO0B 1WFUA 3G9AB 5CEYA 1ET8A 4JO8A 1T7XA 2X6MA 3K72B 5ICZA 3JWNG 4QCIB 5EEZA 3HA0A 1FE8H 3G08A 5JNYB 4RGNE 2JKLA 4UT7L 4TNGA 4CC4C 2YXVA 4QRSA 4IJ3B 1M71B 1CLZL 3S5ZA 1XXFC 3PWPA 4MZIA 4RA3A 4DZBA 2AXFA 5DO2D 1WLHA 3EUUA 1NCNA 4M8QA 1J9RA 3SBQA 2WPGA 3UBFA 1XGPB 1AO7E 4XMXA 2OA9A 4ZSOB 1PLCA 4HSQA 1WGVA 5ALBH 4M5SA 2J56A 1M57B 4LVOC 3RAJH 1UA3A 3MLXL 4YXKL 4B3VA 1XR8B 1U8JA 2QGCA 4JLRA 3IETA 5J57B 5J11B 4LNRB 5EEWA 5EU6A 4LCYB 4R5TA 1L7IL 2Q76B 3VFTB 4PJAF 2BXYA 3QPXL 4WV1C 4H25B 2XBDA 1AO7A 2HN7B 1O7DE 2GJPA 4PJAB 4WY7L 5F7YC 4K2UH 4PUBH 3TV3H 2Q5BA 4AYMC 2A1WL 4M6OH 3GFUA 3ZLQC 1T04A 5IB3B 4YGVB 4JG1L 1A7OH 4ZW3A 4UMGA 4N8CL 2GABA 2XBTA 5GGSY 4OQTL 3CIAA 4JUSA 1M4KA 2QL1A 2I85A 2VSDA 5AB0A 2BRRH 1KXTA 2J1KA 2N1TE 4N0RA 1OGTB 2XLLA 4K3EH 5BOJA 4PJ8D 4U6TA 1ZRUA 4LF3B 1CU4H 4X7TB 5I76B 1N10A 2TAAA 1EEYA 3VM7A 1WZLA 1GGTA 3IRZA 3WSQH 5TDOB 1KCWA 3JWOL 4FP8H 4OIAA 5HGHA 3TZVB 4N1EA 4J3UA 3WTTA 1CYXA 4EMZA 1BWWA 3MLZH 4G6JL 3H2WA 2QVFB 3WXVL 2A1WH 4M6OL 4H8WH 1AY1L 4TNWF 4ONHA 5DZLA 3BD4A 5DD3L 2V2TB 1FORL 1X5KA 5DJZA 5FF6B 3TH2T 4AW4A 1M53A 1KIUB 3MV9E 4LHUB 1AQDA 4HIEB 1CJYA 1ADQL 5JDSA 3HG1B 1MFNA 5B1JA 3D85A 3KR3L 3PXHA 4NZDA 2VLRB 4C47A 3MUGA 4IBYA 1MCKA 5C0IB 3CDGA 4X7DC 2IQ9L 5IBLC 3K6DA 2JK5A 2EDBA 3B9KB 5HHXH 4K3HA 5DD0H 5E4EB 1MCDA 3X3FL 4L9LA 2DJUA 5E2WL 5TDPA 2GKIA 1CDYA 4WUKH 3C8KB 4PRID 2YAQA 1K8IA 3K5RA 5AG9A 4CMHB 2D03H 1T6BX 1ZMYA 2Q3ZA 3BWSA 3I6KB 3H9SE 1SF3A 4WHYG 4XZ4A 3RGVB 2E76C 4JO3L 4P46A 4PRPB 1RURL 1FUNA 2AV1B 5EO0B 3VXTA 4JBSA 4TTDD 4YDVA 4DFHA 5FYKH 1XV8A 4R96A 4MNQB 1DN2A 3GGWB 4ZO7A 1G9NL 1MIML 3GT6A 3H42H 1M7IB 3A4FA 4HUVB 2HLEB 2K6ZA 3HRZC 4D9QD 1MF2H 4K55A 2NY7H 4G71B 5H4YA 3W39B 2DWDB 2D2CC 3HB3D 3HE7B 3WS6C 1DSFL 2JVUA 2SEBB 4U7SA 3SDAA 2BCKA 1CFNA 2A77H 3IGFA 2BOLA 4GBXB 5H37G 3RTQD 3MUY1 2VLKB 1RIVH 3N5AA 3QUHA 4BFNA 4DWHA 4GIOA 2UY6A 4XH2B 2Q8AL 1Y6NR 3EYQD 5FO8A 1H3XA 1CFTB 5J6GA 2BY0A 3V5DA 2CLVB 3MRLB 1QPPA 2N7BA 3MVSA 3FQXA 4JO3H 2IH3B 2E6QA 4EZMA 3ARFC 4DH2A 1FSKB 4JG0H 1IQWL 5DC4B 2WTOA 5GRJH 3K1DA 1U93B 5IW6A 5D55A 1HSAA 1KTBA 4GAJH 5C8JB 3BYTA 3PV6A 5EU6D 1TZHB 5FYJL 2DQFB 1NCIA 1H9VA 3TO4D 2A99A 1AACA 1CDUA 1VKXA 1FRGH 1KEMH 2EYRA 5F6IC 1YSOA 3U30B 2MPVA 1N8ZA 3KLAB 4HOMA 5FCUL 3L5XL 2IVFC 2VZVA 3RY5A 3BZEB 3E9UA 3V6FA 2IH8A 2R29A 1N0LB 7CGTA 1RZFH 2J2ZA 4I3SH 1A0QH 3BVUA 1WYJA 1FNFA 3NH7L 4UQ3B 3MRGA 2V7HB 3ZDYE 3FFDB 3P40A 5AZ2L 1G6RB 2I7OA 2P8MB 3F2LA 4L8SB 4N1HB 5JHDD 4XNXL 4YDJB 3VWKC 1ZANL 2BVTA 4YLCA 4X4KA 3SDDA 5I6PA 4JGUA 1UZ6E 3BZDA 4P2RB 3SOTA 4KUCF 2FJHA 1XWVA 4RBPK 1A3LL 1RVFL 1K5NB 5HHOB 5JHBA 4QYOB 5FFGA 3VRLE 2UYLB 3PWUB 4FN0A 4PWKA 2UYLA 3PWUA 3CFTA 1E9PA 3TLRA 4F7EB 4ZXBD 1YAIA 3QBTB 4AYGA 3LQAL 5F3HA 4KDWA 2F54A 3GM0A 3D30A 4AQ1C 3IE4A 1DQML 3MRRB 2W81C 2IPKB 2NUPA 2FQFA 4J12A 4OCYH 3R18A 3TWCL 1YECL 2ZXGA 1NAML 3VXTB 2KT6A 4LL9A 3QDMB 1DBKH 3RPKA 2VLMD 3EJJX 4NC1C 1YMME 3MLRL 1Q9LB 4NWTL 3RL2B 3JT0A 1JWUB 4ZUTB 4RDBA 1RZJL 3GSWB 1AG6A 2C3VA 3UZEA 3BMWA 5KSUA 4ZFGL 3VXMD 5DJ2B 2OXHA 1MELA 4ES8A 4AENA 1C7TA 1ORSA 4JM0A 5IWLC 1WG3A 1BD2D 2AGJL 5HDBE 3VFPB 2VLJE 3VG9C 4B9PA 1B4JL 2YO3A 4MMZA 4F7CB 5T33H 4YDZA 1M7XA 4UDUA 2RACA 4K73A 5F0LB 4L4VA 1MI5B 4JFSA 1RJZB 2B0SL 4P2AA 1DSFH 1SXNA 1SQ2N 2GTZB 4Y2OA 3UZEC 3GXDA 2VLKE 3FN0H 3UABA 4JQVC 4AMXA 1RZKC 3H6AA 1OAZH 3JV4B 2ICWJ 3ULSB 5KSVA 3CDZA 5HDQH 4G43A 4F57H 5JHLH 5CBAB 2B9AA 2O72A 1AR1B 5FYKD 2C3WA 2P24A 2ZSWA 2P5ED 1NFKA 1NEZB 5FYJE 3VWJB 3B8YA 1FV1A 1A47A 2LGNA 3HMXA 5B1KA 4Y1AE 4YFEA 1J0KA 1G9HA 4EAEA 1JP5A 1GIGH 3FQXB 5HYQB 1A4KA 1UZGA 5BOZG 3RX8A 5FDYA 3MCKB 3W0WB 3LZFL 4WI2A 5H94A 2ZAIA 4H7VA 1ZT4B 4G3YH 4RAUA 5LKNA 1YQVH 1IT9L 4R2GB 4HS8L 5FWQA 3QFDA 5CJ5A 3HC4L 1ZT4A 2XYCA 3EOBB 1JZFA 3JYBA 1MWOA 2PKDA 2WVUA 1Z5LB 5D1ZC 2A38A 4Z0BH 1PVHA 2YQ3A 5ALCL 2OL3H 1LK2B 3IMTA 5DGQA 4LU5L 3G5XB 2W92A 4TSAH 2WXRA 2EIJB 5EZLB 1LO3H 1ZS8A 2FWLB 5C9KA 4D3CH 1KYUA 4KKLC 4PJEE 3Q2CA 1N64L 3LXAA 2FJSA 2VSMB 2OJZL 1OCCB 1O6VA 1RFDH 2BC4B 3HE6B 3K8LA 4XO4A 1TNMA 5DD6B 2F0CA 4LCYA 5HTSA 1BM7A 1QQDB 5CSBA 4XPHL 1RZPA 2G9HB 4GLRI 5CSGA 3MCLL 4OZIB 3L2MA 5I5IA 1FL6A 3LRLA 2B20A 5MERB 3TPUB 1SHSA 1S7TB 4GB9A 1DZ0A 4XN8A 1M9WA 1I1CA 4G3YL 4G7SB 4WK2B 4L5FE 3C5ZD 2VL5A 5DVKA 4JFEE 2LW3A 3H42L 4UQEA 1RXLA 3MNDA 4HJJH 1A7BA 4L1SA 3SD5A 2NXYC 4Y5YB 2OR8A 3FQTA 4FKHA 4OM0H 5D71L 5CLWA 2VE6A 1XH3A 4JANB 5KVGL 1ZGLA 3ULVH 5HGGS 3UO1H 2R1XA 3R0NA 4IMKC 1JZ6A 3L45A 3MU3A 4UNTA 3N3EA 4N0YL 2ZWKA 2ZD0A 3GMOB 1BDYA 4QYOA 3QXVA 4MQSB 4U1SA 1X44A 3CK0H 3VXUE 4BZ1A 3QUXD 1ZT7B 1S78C 3UTTD 2DQ6A 4O58L 4PJEA 2IG2H 5KVDH 4KROB 4N2CA 2ZYRA 1MCOL 1S46A 4KK9C 2UXFA 1ZLUH 3HE7D 4M8RA 1IBFA 5K9QG 5IOPB 1KB3A 3V0JA 4TUUA 2JB5H 4J3OF 2CGYA 3V95A 1PZ3A 3DI3B 4UQDA 5DS1A 2FJHB 1R3KB 2Z31D 5A2CA 4OZHF 3NCFB 1HJBC 3RGVC 3ZL4H 2AS5M 4YIQB 1EJOL 2IWEA 5L88L 1MCEA 5HYIA 4GAAA 4O00A 4FZEH 1MJJA 5DHVB 5TGBA 4AK1A 4ZUSB 3ETTA 2X2JA 3AU1B 1AZBA 1BGXH 3L4WA 1HHGB 1BVKB 3TT3L 2VW4A 3GSUB 4YL9A 1TTRA 2ITFA 4F7MB 4OKVA 1ITCA 5HI4D 2R83A 2CBTA 3HHSB 4TULL 4PJ9B 3FB5B 4RMUA 3TBVA 2BPBA 5EU6B 3L5WB 4ORGB 2E7HA 4NKIL 3QORA 4A6YA 1AO7D 4CN4A 1LNUB 1OP5H 3U4BH 4P5KB 1YEFH 5BRZA 3WL9A 2FCBA 2XQBH 3OG4B 1IEBA 1N9PA 1RZKL 2I60L 5DVOA 3CXHK 1JHLH 4X7CC 4Y9EA 4X6DB 5GS0D 3OZLA 3BGAA 3DBXB 2BW5A 3V7AE 5HXMA 1RUAH 5B39G 3VX0A 4I0PD 1M56B 2WANA 1T0MB 4N0UB 4M9OA 2CK0H 3VGBA 1DVSA 5ESQA 1M71A 2XC8A 1N59A 4XC1L 5IW1A 2EVIA 3KM2A 3Q9PA 5BRZE 5IHBA 3PJLA 1NGWB 1XHHA 3G08B 2QVTA 3QUZD 4ZW7A 5I0WA 4OIBA 1AKJA 4X5WB 1G4RA 2BMKB 3G5VA 5DJXA 5I71B 4AJYV 1KN4H 3KHQA 4RZCA 5AOIA 2ERJB 1SLWA 3LDBC 3EGXA 4PV1C 1BYPA 4WO4C 3EYUL 1AIFB 4F3FA 2XT1B 1Y18B 3CX5K 2BDNL 3O6LH 1DVQA 1E5CA 4Z9KB 3RFZA 1TZAA 4B0MM 3G5YB 4HS8H 4HHGA 5KUKA 2Y5TA 3MREA 1GCFA 3DX6A 4JKKA 3BFOA 3T2NH 5LG1A 5KTEH 3ZX1A 2OL3L 3DHUA 3FUHA 3WY1A 3TO2B 5ENWB 1A64A 5J56B 1GJUA 1KBVA 1ROWA 2VDNH 4D3CL 3KVQA 5AVTB 2UWEA 3ISRA 5IUCA 3T65A 2Y6SC 3CXHJ 3L1OL 1TKWB 1A3QA 3ALXA 5AVZB 2OL3B 2CM5A 2P3YA 5INCA 5EIIA 1KGJA 2DLHA 5JYMA 3FQUA 3MRHB 2KLTA 4MYWB 2XKUA 2WXFA 5EO1A 5GGVL 2B3RA 3DTDA 1MFEL 4BH7A 2ZCLH 4X9HA 3VG9B 1U8OA 1P4BH 5CILH 5JDSB 5HGHB 1EAPA 1TFPA 5G4MA 4HZLA 4NKOA 2VQUA 4Y1TA 3D25A 2P4AB 3RA7L 3WIIL 4Y5VB 4EIGB 4ZOAA 1J8SA 1E4WL 2AABH 3CVHL 1A6WH 1OY3B 2OL3A 1XGQB 5I75C 2RCSH 4M62L 2AJVL 3EYOB 5FV1L 2YXFA 5KZCD 1AGCB 3KVPA 4PLNC 3TZVA 3RTLA 4M4RA 4PD4K 2ISDA 4UYPA 4QRUB 1MI5E 3UTSB 2XWBA 2FD6L 2R2HB 4N2GA 4DK6A 3ETSA 4KI5D 3SDCC 3OV6A 3FUMA 1KGXA 2K78A 3FOLA 2WYIA 3GSXA 5LGJA 3K2UH 2EP6A 3SE6A 2FATL 4ODUB 2X5PA 4OUUA 4PEEA 1E5UI 2F53A 1U42A 1FJ1B 3WEAA 1ZEAL 4IBSA 1IT9H 2BVUA 2G30A 5CGTA 1SVZA 3F04A 2RJMA 4LSRH 1DLFH 5E9DA 4A67A 4EUPG 2AJVH 5AVUB 1LE5B 4HU2A 1V8HA 1URIA 2WTPA 4QHUA 4XNZC 4HIIB 4MA7H 2ZUQC 1ZHNA 4H0LC 4WCYH 2X88A 3DTXA 2X05A 1MVFA 3CFCL 3CPLA 1UWXK 1KUMA 5ETUB 1LP9A 3AS0A 2DQGL 4A7TA 4V2CB 1CICC 4LNRA 4L4JA 1JZ7A 3CH8A 2FIRT 2IC2A 1WD8A 1IGIL 3CVDA 3JSSA 3N1GC 4M8VA 4MCYB 4NQDE 4PP2A 1IC7H 1M3JA 5T1KA 5TQ2H 3V0FA 2VERA 5D6CB 3HI1B 1ZLWK 4LK4A 5E99L 3TVMD 4Z6AT 2HA1A 2QMKA 4UIMB 3SYCA 3UMTA 2DI7A 3FHAA 5CWSA 3T6ZA 2UZYB 5DRNB 4FFZL 1LO4H 1UQSA 4DGUA 4OLUL 4O2CB 1SOKA 4RWYH 1QFUH 3IDMB 4FQQA 4AYDC 5C0AB 5E5RB 4S11A 4PAZA 1JF5A 4KXZH 4P4KA 4XVSH 3P3TA 1INDL 5D71H 2AJXH 3OWRA 3F5WA 4TQPA 5I15H 2VR9A 4L4VE 3SY6A 4TUOA 2A9MH 4FCAA 4JFWA 4E0RA 1I8MB 3S3CB 3Q5TA 4D7BA 4TQIA 3HZKB 1BX2B 5EBWA 5LNEA 3Q13A 1I8UA 2WQWA 2CMRH 3Q44A 4MDIA 3FSZA 1E67A 4MSWB 5LBSL 1WS7A 4AL8C 1RZGA 3PUCA 3QDGE 4QY8A 1EXHA 2UWEB 4HYTB 4YE4H 4YHKH 2GUOA 3K8KA 3B4NA 5HHVL 4PRPD 1SOSA 1RIVL 5AAMC 1T2QL 2CDGA 3PGCA 4Z8FH 3FTYA 2BINA 4JKNA 5E5MB 5DHXB 4HKJA 4EI5D 1DJSA 5GHWL 3RPIB 1QTYT 1JZGA 2PO6C 3CZNA 4MA3B 4OIFA 1KLFA 4HCRL 1CFVH 2OQJB 3LVEA 4NRYB 4YBQD 5F1SA 5I18H 2WN2A 4JFFB 5DC9B 2NY4C 5IJVA 4U1SB 3W9DB 3TBBA 1RUQH 2X9YA 1DLHA 3RVWC 1DYZA 1A66A 4RNRB 1KN2L 2FR4A 1JK9A 4I18B 3QRGH 3O6FC 2DI8A 2WLJA 2N59A 4M3HA 5CJXC 5D1QE 2D31A 1MRFL 1Q0YL 2R29H 1RFDL 1C5CH 1NC2B 2GHWB 1C5BH 1G7QB 2IFFH 4FG2A 3KLDA 3LPPA 5I16B 5FIEA 4BQBA 5BVJB 2V9TA 4E5XG 2IH1B 4RGMB 4BUQA 4B7IA 5ESQB 4L0ZA 1MJUH 2KYIA 5IVXA 3GSVB 1FPTL 2W59A 4PJIA 1DQQB 3Q2WA 4GKLA 4AMWA 4YSCA 2Y07H 5DEZA 3SKJH 4WUKL 4OJFL 4HCRH 3F6JA 3SDXA 5HYQA 1LGVA 2WAQA 3SZ6A 3U4AA 3U2JA 2VC2L 4YSAA 2KLRA 3VFMA 3QHFL 3TBSB 5AEAA 2ED7A 4QHLA 2JJWA 4Y9CA 3WV0A 4L3EE 2A74C 5FKPB 4M56A 4HUMB 4EIUA 1KELH 2CKBB 4J8RA 4LO9A 4L3FA 1KGWA 1KF9B 5H4ZA 3O41A 2J88L 5DS8B 1PL3A 4F2FA 3LKQB 2CJUL 3WEBA 3SZKC 4YZFE 2CJSA 4P04A 4E41D 1AQ8A 5GS0L 1H6EA 1QNZH 2VMDA 3TBVB 4O58H 4N90D 2R2EA 3GHEH 3A6OA 3MLSH 5DI8B 4F93B 1UM6L 3IMWA 5F3BA 3J7HA 4FFVD 3BRGC 5CUSL 5EIIG 1KTJA 1THAA 3E3QC 3TIDA 2A0LD 3F7RA 2AW2A 2WSDA 2YBRB 3N43F 3LN4A 3KW8A 4G8AC 4W1TA 3QUGA 5D2LE 3SDCD 1NCBH 4ZUSA 3M8OH 1F4WL 3TU6A 3D87B 1OF0A 2ITDA 4OD2A 4JFFD 2W0KA 1ILUA 4FYSA 2BSDA 5IM7A 3LZQA 5DO2C 3DUHA 1GHFH 3ZE2F 4HS3A 1BQSA 1Y6MR 3DX7B 5CAYB 2APFA 3GBEA 1UWFA 4JG1H 3DETD 4WVRA 1MHHA 4NEHB 1P5VB 4A66A 2D3NA 4AQ1A 2VDML 4XXWA 1BZ7B 5AAPA 2Y5EA 4N9OB 4OQTH 4BZ1H 5IEKB 2Y7NA 1JNHB 1XB8A 4JY5H 4PJAE 4PJGE 5EZJB 4Q9RL 3SGDH 4M1GL 2VIRA 4UB0H 3N85H 1DHKA 1K2DB 4NENB 2VE6B 4JANA 1E40A 1QNZL 2VIRB 3CQQA 3QUKB 4TM9A 1JPFB 1VFAA 4XPGL 5HY9A 4FERA 4FFWC 5D93C 1TFHA 3KPQB 3EXLA 2L7EA 4DTGH 1FG2A 4DZ8A 4XBPA 3JXAA 1TJIL 1L3WA 1A14L 4Q6IA 3SE3C 4DZ8B 3QUMB 4YSEA 2YGVA 2QZQA 4UQ2B 1DO5A 3PWNA 1M1SA 1BBDL 4IU3B 3LS5L 4WTQA 2WKLA 5D7JC 3WEMA 1HINL 3SGKC 4YZWA 4LSUL 2HSIA 1HOEA 4CSTA 2CUIA 2D7TL 3VI4F 2J25A 4F7EA 1KNOB 4YBLC 3DDFA 3G5WA 5F7LB 2DLTA 3IDIB 4AK2A 5BS0D 4UWQB 6TAAA 1YY8A 2FUQA 4CSPA 3AG2B 5IMOA 5IJBC 5E6SB 4KH9A 3KCWA 2A77L 4NZRH 5KS9A 3L9BA 3ENEA 4GO9A 4BDVB 2GJ6D 2OMNA 4AIXA 4HK3N 3OXRB 1X9RA 3NEXA 2BIIA 4AZ8B 1ZOXA 5L7XH 3HG5A 3JV4A 3DO3A 3LTVA 4F2EA 1UWEL 3BP6A 1PG7W 2WJ7A 4IIQA 1TZGL 5CGBA 1OARH 5HDWA 5AD0B 1UM5L 1NFIA 4NQVA 4DKTA 1E7VA 3SDCB 3QPQD 5HYSG 4UNUA 3AROA 5C7XH 2FX9L 4ZQTA 4EZJA 4BRVA 2HVKB 2OKMA 5KOVC 4H1LH 4AIZB 1MIEL 4M1DH 4MX7B 3CXFA 2GAZA 3I50H 3VFPA 3ZHDA 4GLRH 1V7MH 4K4KA 1FVCB 5DYFA 4EIBA 4L3CA 9CGTA 5FGBA 1V05A 1L9OA 3Q48A 4P5MB 4U1MA 1U3HB 2NTFA 3GXMA 3GXFA 5KYXB 1M6UA 1R3HA 4XMTA 1W6LA 2ZF9A 3OSKA 2E47A 1MW2A 3IWUA 4BCZA 3AG3B 1GYCA 3TXAA 1NEPA 4C57C 1X5ZA 2F7QA 1SBBA 4YFDB 4JPQA 4W9FC 3LNGA 3MRFA 3QDJA 4PJ7B 2NYYD 2P42B 1Q1JH 2FZ3A 3I9GL 1W72B 5E5LA 5E2WH 5C2UB 2JKIS 2AEOA 2YQBA 4BZYA 2E7LA 4PI0A 3S97C 3QNYB 1BJ8A 4IU2A 1UD5A 2QHRH 1EUUA 5CXPA 4JJHA 3V6OE 4BK5A 5C7XL 4WI7A 4M3JA 3W11D 4X0KB 4GRWF 4ZXBA 4U2ZA 1IAIM 1S3RA 3QWOA 3ELAT 4PGBB 1MI5A 3HJ0A 4CMMA 2CCVA 2CLVA 3BAYA 4HHWA 3VU2A 5IGXH 3ESNA 3NGBC 4OCSH 1PZSA 3ZDXF 1IGFH 4FQ1L 3UG3A 4NRYA 3FUEA 4ALAC 4M1CC 1HCFX 3DHMA 3UO8B 2BVOB 5C0RL 4JFUA 3A24A 2Z0UA 2JQZA 4TUKH 4LEOA 3MR9A 3D3VE 3O2DA 4Q7DA 5E6IC 2AMGA 4EN3D 3IGLA 3WO4C 3FT3A 1RZFL 2BWIA 3NT0A 1ODAA 4A6YH 4APQD 4PJEF 3RUGE 3L81A 3MX0A 5C0CE 4DN4L 4YDLB 3NFNB 3GMRB 3EJSA 5HHOA 3HS0C 2NY2D 3K71B 3UXFA 4JFVA 4WO4D 1MJ8H 4BRJA 4PB0H 1UGKA 4MA3A 4EKJA 2VM3A 4YUEL 5IB2B 3KJ6L 4JKPH 4PJ8A 2Y4SA 4KO7A 4BA0A 5JIKA 4B9GA 2Y23A 4OY9A 1HXYA 2ITCA 5I8KH 1S8DA 4RFEA 4Q97A 1JXKA 1I1FB 2NZIA 4Q9QL 2JELH 2VUYA 3R06B 1DEEA 1QFWM 1S78D 4HWZB 4XVOA 4M6MH 4ZDHB 3IFPB 4G8FA 4K23H 1FL5A 5F1IB 1NMCB 3QIWD 4Z7VB 4AGNA 1ADWA 3NJGA 3PPEA 5JMRA 1RUKH 4I18C 5GSVA 3THML 1XTLA 1U8QA 2YEZB 3B43A 5FHAL 1ODUA 3ZDWA 4FTVD 1YUHA 3K5SA 4XVJH 4LP8A 1RZJC 2N0KA 2A4ZA 4RA0C 3C6EA 4U1GB 5GGTL 3EJYD 2KDYA 3UIZA 1F02I 3PDOB 4PP1C 3FRUA 5DHDA 2QQNL 2IH9A 2RCSL 4GAFB 3DO4A 3UTQB 4C56A 4OUUB 3O6FA 4FLRA 2LR4A 3O8XD 1BQKA 1I3GL 2XBZA 3QISA 4WJ5A 2Y25A 3N40F 4U6XA 5FM4A 1ML0A 2D3VA 2ZE0A 2JCWA 4Z7NF 3US1A 1NGYA 2XJLA 4HKXA 5D2NB 3GZQA 3BAJA 4Q58C 4J23A 3QUYC 5C86A 3N41B 4JHZA 3CHRA 1JXFA 4IRJD 4W70A 3D39D 3ZT7A 1NMBH 1EMTH 3MACH 5F9OL 5AUMA 4HBCH 1KTLA 3D0LA 5A2KH 5CR1A 3MV11 5JYLA 3T4YB 3T8XA 5E9DB 4JRWA 4LIQH 2XTLA 5CGYC 2NY2B 5F7BA 1NFDE 2WLIA 3N41F 1JNNH 4UBDC 3ZXAC 5FB8B 3LQZA 4DGIL 5C0GB 4Z76A 3SPIA 1NBZA 4MAUL 1FGVH 1XGZA 1EK3A 1DCEA 5DRXB 2X09A 1EHNA 2D0FA 2JJTC 4RWHA 3W82A 3KLHC 2YA2A 2EUVA 2RALA 1X4XA 4RESB 5EU4B 2B9BA 3V4VB 1MCFA 3ISWA 2MPAH 3GKZA 4TSAL 3RNQB 3BFWA 4RQQB 1T2XA 5I17A 4XODA 5D9SB 4OVUA 4BXSV 2VJXA 2WXIA 4H88L 4WNJA 1BIHA 1DUZB 3FZUC 3QEGH 4JG5A 1PBYA 4FTVB 4QPEA 2MHAB 4YXLH 3VVWA 3NBNA 3CFJA 3RVUC 1OANA 2DWSA 1J8HB 3BJ91 3KJ4B 1IQDB 1AZVA 2GBAA 1EZLA 1TZGH 2YN5A 1T6VN 4HXAH 3ZTJG 2C9RA 1OPOA 4I3GA 1E8ZA 1H8OA 2NQDA 3PXLA 4NP4L 3OJDB 4Y2NA 3RFZB 2B3IA 3K6FA 4P2QE 3HS0A 3II3A 1T5KA 5EO1B 2K3TA 1NJ9A 4RFNC 2R0KH 4YHPA 3HG1A 5KVEE 1KTRL 1S7SB 3D2TA 1XFPA 4HWBH 2DS4A 5AYQA 5D93B 3VD7A 1RIHL 5T33L 4HV8B 4FQXD 1IGCH 2B5IC 3DX4A 4P3DA 3PJSA 3E6HA 3L9EA 3MNVB 2V2TA 4HCFA 1NGWA 5I71C 1Y1DA 4GP8B 4A04A 1PJ9A 2GJZA 1RZIA 1WISA 4TPRH 5IF0A 3HAEG 3ME0B 1FYTE 1H3PL 2WNKA 2AEPH 2WWKT 3IU3B 3QFJE 2R51A 2YAMA 4D8OA 2DQCH 4M5ZH 3IDJB 3BC9A 3D07A 4LLYB 2QELA 3G7TA 4KI5F 5SWSE 4W9LC 1QHOA 4EUPA 4XPTL 4I1RA 3I74A 4JFFE 4JRXB 4R3SB 3IJEA 5I1AA 2E9IA 3LKPB 2OMTA 3H9HB 4NZTL 2D7NA 1GMIA 2XN1A 1J12A 3EOAB 5K9OB 3F01A 1RZ7H 1F1AA 5B38G 4ZOCA 2XV2A 4R9HA 1A7RH 3MJ8A 3GMQA 3Q2LA 4JHAL 4PWEA 3D9AL 2R8SL 3OAYK 3QR1A 4AV4A 3U0TA 2CNYA 1CLZH 3QO0A 1MJ7H 4Q9BA 1KFGA 3MA7B 4Q9QH 2XIBA 3IFLL 2XG5B 3UTOA 3ZGHA 4IHOA 1V5JA 5F72S 4C4UA 3HPJA 3BIKA 2SODB 4H8PA 1O6TA 4P5TA 4FFWD 5DLML 3REWA 4JAMB 4ZUUA 2DQCL 1N59B 2ICWA 2CK0L 1XEUA 3AY4A 4WFHD 3ULVL 3HNSH 1D2OA 1UKTA 1AGDA 2K8MA 2E74C 1DANU 2IAMA 1Y0LA 3L08A 5B8CA 3DGDA 4POZD 4C58B 4CGUB 2L7QA 2E9BA 2H1LM 3OGCA 4X4MA 4YE0A 3Q6FA 3AXHA 2L3BA 2PTTA 1F90L 3VYOA 4U4BA 4FA6A 1KJ2B 2HKHL 3C5SA 5D7KE 5TE4H 1GGCL 2GSGA 4M7ZC 4Q4EA 3UG4A 5IFAL 5JOFB 2BSTA 2AERT 1FZJB 2VN4A 4PWGA 5I1IH 3FO9A 3I9PA 1FRGL 3DLQR 1LO2L 5BOPA 3FO1B 1CFVL 3OMAB 4LARL 3U2SB 4GPVA 4NCC2 1D5MA 1KLGB 5GIRB 3AAZA 3NCYP 5FGCE 3APMA 3L5XH 3RGBA 1MAML 1D6VH 1ZY9A 4H0IA 5DQJA 3RWJB 5FGSA 2Y0SA 1XZWA 2J7LA 4OAWA 4MB1A 3H7LA 2J5LC 4Q8BA 3QXDA 4ELMB 1AS6A 1NUDA 2WV3A 4CC4A 4KKPA 4HK0A 4PR5A 3WAKA 3BUYB 4GSRA 5GS1C 2W38A 2NPLX 4JW3A 2FECL 1WBYA 4NJ9H 5F7WC 4BUGA 4UT9L 4PRAA 4ZNCD 5ITBH 2CRIA 1IAOB 2RR3A 4XGZB 4Q6IC 2CSPA 3QI9C 1UENA 1L9SA 2BZDA 1DUZA 4JKMA 4YWGH 4GS7B 3WI9A 2X9XA 5IJCC 5KVDE 1G0DA 3AADB 1WJ3A 3HI5H 2IBZY 1NMAL 3QQXA 4N5UA 4RZKA 3IWVA 1TJHH 2OCFD 3OSVA 1ET7A 5I17B 3D2UD 3QIUD 4HPYL 3EJZD 3ARDD 3WFDL 5IFHH 3F6IA 4E5XA 3ZDZF 3WE1A 1XH0A 4XAWL 3PP3K 5AFAA 5JXAL 3BSGA 3DXAB 4Z78B 1BVNP 2OMVB 5C08D 5GZNA 2Z8SA 4JPVH 2NW3A 3AACA 1KGUA 2Y5TB 2VQ4A 3E38A 2G9HA 2XRAH 4KNSA 3VXRA 1LYQA 3ZTJH 5EPMB 5K93A 1Z3RA 4BK4A 4IOFC 1GR7A 5CSZA 3ZW3A 2X9ZA 1ZHLA 2B14A 1OAJA 2Y69B 2ZKYA 4QMEA 3TA3C 3WNJA 2AKRA 2EE2A 4E9SA 1KPUA 3ZZQA 4JGMA 5FYKL 3QCTH 4N2HA 3BSZH 4AGQA 3WFBL 4BZ2A 1YJDH 1TZIA 5ACMA 2FT7A 3MYJA 4WNSA 1HHJB 1KTCA 3BKYL 3WN5B 3OLIA 4J3SA 5F0PB 4N0CC 2HT2C 3OKOA 1C12B 4YWGL 3ZMNA 4ZZKA 1H15B 1YEIL 4PJFE 2YUZA 4OFDA 1XF5B 4JQIL 5AKTA 3CQFA 3V0EA 1I31A 5FO7B 4Q0XH 5F1KC 4UAOB 1PX3A 3LNEA 1MRCL 4A2DA 3A6CL 3H3BC 1YPZE 1NIAA 2B1OA 4K7FA 4B5EA 4U1IA 2O5XH 1IAKB 1OTTD 4H8HA 4XAKD 4R8WH 4C56B 2XZCL 1EEZA 4IS6A 3T6QC 4LBEA 3E6FA 4X8GA 3T2QA 2W91A 3F7QA 2RQ8A 5KJRH 1CFMA 2DBLL 1A21A 4JY5L 1B6UA 2Q8BL 1J5OH 2NZ9C 3V52L 2X4QA 3WXVH 1F90H 4MX7A 1WIOA 2YZ8A 4F7MA 3B2DC 5TF1H 3ARUA 2X38A 1PCXA 1T21B 4FFZH 2Y2WA 4M93B 4H26A 4OF6A 5B22A 4NQVB 3RP1A 4Z7VA 4HC1A 1WA2X 2LVEA 4PCYA 2YKLL 3NA9H 3H4HA 4P2CG 5ICXA 2VTFA 1QA9B 2OR7A 3PWPD 3MRKB 4PJDF 3JTSB 5IBTH 2QADB 1IZJA 3WFEL 1PYWA 1YAZA 4FXTA 3SOBH 4EN2A 1D5IL 1SN5A 1OT1A 2VDPL 4J3OC 1TVHA 1BW8A 2E59A 3KDMA 4TOYH 3QW9A 4LBAA 1RJLA 3NPZB 1L9RA 3KJ4C 4GAGH 4UDUB 2YSSA 1J5DA 3QIWB 1WUZA 3FUFA 3ELQA 3V52H 1EX0A 4B9CA 5DDHB 4MAYC 3NMEA 3UTTA 3VXOA 1J10A 1SYVB 4MJHA 4UQIM 4ZMVA 1PMYA 1TLKA 4K7PX 1YPZB 4GQRA 2EIZA 2WGXA 2AAVA 3EOTL 1SDDA 2AZUA 2KLSA 3QGVA 3CCHB 4YHOH 3FH7A 4EO5A 3CFIC 5ANME 5CZVH 2TRHA 4WW1A 4JMXA 3RWIA 1F4YH 3G9VA 3S36X 1Z0MA 3ETBF 4XP5L 4XBPB 3RTQA 4IRSA 5B38A 2JCCF 1DVFD 2HVBA 1NKGA 4ZTEA 3QCVH 1JI2A 1QABA 1OOAA 1IKNA 2H45A 5D1XE 4DUWA 4C83B 1JZDC 1HAUA 2IANA 4JKWA 5GRYA 4AMKH 4FADA 3ASOB 3EH5B 2WNGA 2L7JA 1B9KA 4GAYB 5DCCA 2XOTA 5FYJD 2VABA 2R0ZH 3B7TA 5IUSA 2D9CA 2ZKMX 1KC5L 4JDEB 1QBLH 3BAIA 1MFCH 5LO7A 3RHWK 3HKZA 1WUNT 1VCBC 3RIFF 3ZKMD 1J0ZA 2DKMA 4OZFB 2ZX6A 2O5NA 2ZG3A 2RH0A 2KPWA 1QZNA 3ECBB 4PS4H 4KI1A 2VSKB 2WQVA 3PV6B 3U4EB 2E8ZA 3GO1L 2JXMB 1JGEB 4JZOB 2CALA 3WUWG 4XRCA 1A4AA 1C8QA 2EEXA 3CFQA 3KWUA 1JWSB 4OCNC 3SDDB 1IBGL 2YMXH 1E5BA 5E8OB 4NJAH 2ENPA 2WZ6A 1MWAL 1H6UA 5J1SC 4OCXH 1TZOA 4ZMYA 1Y7VA 1KJ3H 4XP1L 5F7DA 5GS2D 4BFIA 3HRZA 5D1ZA 3IGAB 1I9IL 3MRJA 4UIKL 3DXAD 4UTAA 5GRXG 3WIFA 1N0LA 1H3GA 2P44B 5IQ9A 1GZQB 1UACH 3FSAA 3B7YA 5DD0L 4LVNC 3NCCB 1AI1L 2V3EA 1L9TA 4OCSL 3JYCA 4FNPA 4KOCA 4QRPB 3OKOB 2CKBH 4DAGL 2X40A 3H9YA 2F68X 2JJSA 1W6WA 5E2JA 1I1RA 4FGMA 3VI4E 3NYKA 1M2VB 2IBBA 1JI1A 3HIZA 4D9LL 4U0RC 3IJYB 4JM2D 4JJOA 1KPUB 5I8EA 3RX5A 2VDNB 4U1LB 1BXXA 4KZEL 5FKPA 1I4FA 3LN5B 4UYQA 3LZFH 4WU5B 4QTFA 4YHZL 2DJMA 3C5ZB 2DJ4A 4QRRD 5A43C 4W6YB 4ODSL 2IV9A 2VXQL 1X3DA 3O3BB 3KYKL 2VXVL 1U9KA 4M7LH 1JVLA 2JJTA 4WI6A 4XXDA 1V54B 2Y7QB 1JXGA 3ARDC 1BZ9B 2IGFH 1RSYA 3MI6A 4MKTA 2OSXA 2PYFB 1VEPA 1D5BA 1VGKB 4JE4B 4KAQH 1V7ML 5AKRA 3B9KD 4EI6A 5I8EB 3G5ZB 1KGCD 3TZVC 3TWCH 3CSYA 5HI5D 5AOKA 4ZTOH 2WZ0A 3LZLA 3QK0A 4GXVH 4BZ1L 4IRSD 1JZJA 3PABA 3D05A 4PJXB 1NFDA 4PJBF 4RMVA 3P3YA 4IRJC 2AXHA 1X5LA 1FNSL 2Z8RA 1H9DA 3L4TA 1UH2A 4HK0B 1P7KA 1KXHA 5D4QA 1BREA 3HBPA 3U1SH 1DQDH 3QNYA 1DBBL 4JO2H 4CJ1A 1FLTX 3QHZL 3VH8G 4I77L 5GSRB 4R7VA 1O9VA 2R4SL 3FL7A 4UM9A 5EH1A 5T1LB 1QI4A 3ARBA 1K4CA 3ZKSD 5JO5B 3UBXB 4JRLA 3WJJA 4TUOB 5GIRA 2ZCKH 5I19H 5CM1A 3HCVB 4GRWE 5L4MA 4FULA 4ISVA 5CN2A 1DQJA 2QEJA 1YZZA 3VXNA 4AGLA 4NCC1 4M03A 3FUNA 5IIEA 4FZEL 2HFEB 4G9FB 4U0QB 2DTML 3WLBA 5IW6B 4TTGA 4LLQB 1WFMA 3T71A 2IAND 4KKRA 4AJWA 1E5AA 1PEWA 3TT3H 5I6XB 3QJTB 2QSCH 2O6CA 4ADGA 1NOAA 1NBYB 4UCFA 2F54D 4JO2L 2E7CA 3ZO0A 5HPMA 4HIXH 5ECJE 4OJFH 2AFNA 4F1ZA 5H37A 4PJAA 1HK6A 4AV0A 3U2SA 1FNEB 1CICD 3HE6D 3LKRB 2B7DT 3ZDZB 5I6LA 3WIIH 1YN6B 3TWYA 1NLBL 2AQ2A 5IHHA 1B2YA 2ZAHA 3J2PA 2VRAA 5JW4N 3S34H 2AF2A 4APXB 3BAEL 3T4AA 5AALA 1FNHA 1I9IH 3BP4B 2UZYA 1FDLL 2XX1A 3NCMA 3ZYIA 2BERA 6PAZA 3CH1B 1QR1B 1RU9L 2J6EA 3O2DL 4OJCA 1CLYH 4JB9L 4UQBA 1UCBL 1XF3A 1E4XI 1AGDB 4LOFA 5FOJA 3OF6D 2M26A 3D6GA 3BE1L 5C71A 4OZFG 3IVKB 4JRFA 3N1FC 5CD5D 4LVHC 43C9B 1T20B 3JUZA 4N2EA 4NGHL 5F0MB 4N22A 4XCCH 4ZO6A 3MV7E 5AVRB 8FABB 2XWEA 5AVVB 3UC0L 4HH9B 4NJAL 2EXSA 3BDYH 2V9UA 3KCPA 2WZ5A 1BJMA 1BG9A 1GKOA 3ARGA 3EBGA 3RILA 2MKLC 5FA4A 1MNNA 3PWPB 4HKZB 3IPEA 2JIXD 5F9AC 2WUCH 5L9DL 3TN0D 1G7IB 3QJRB 6PCYA 4G8EB 1C9SA 2ZUYA 3ERXA 3OAZH 5CJQH 2R9HC 3QCVL 4JMNA 1DDHB 3KPRA 2OMTB 3I6GB 1GL4B 4G1EA 2YQ2A 3T0ED 5FX3A 3DROB 3F83A 4MTMA 3ILPA 4ONHB 3L54A 3G6JF 1GC1H 5DC2A 4ZFZA 2R7EB 4X5QA 2NXZB 1OZTG 4YDKL 5B1AB 1U6AH 2DQIL 2AXGB 2EIDA 3TBTB 4OGXL 4KHTL 1BJ1J 3RGVA 3QCTL 1J8HD 1S7VB 2VZOA 3HB3B 7FABH 3N04A 3V5HA 5D1XD 2YBRA 1BFOA 4HJGB 4GY4A 3FZUD 3MFFB 4TNVF 2Z1KA 1U2YA 4O9HL 4TXVB 3LKOB 5BRPA 1L0PA 2FEDD 4HX1B 2DB8A 2ZUQB 3BWUF 1IGML 2WBXA 1W72H 3QJOA 5JW3L 1JDCA 32C2B 4MMYB 4M6AA 4GMTH 5DFWH 2WZPD 1HKLH 2Z91A 5F44A 3SGKA 3KGSA 4LBEB 4Y2DB 3KLHD 3DHJA 1LD9A 1XCTA 1KGCE 3QG6A 2D7TH 1CI5A 2YRBA 5AW2B 2EDXA 2PR4H 2DMGA 4XMUA 2QKIB 3W5MA 4RMRA 5B7EA 3L6FA 5KG9A 1P1ZB 5EF2A 4NLAA 4WHTA 3GSQA 2QSCL 4FD0A 1T1YA 2WLHA 3O0RL 1MLCA 4UUJA 1UQSB 2G3NA 3I85A 2Q87A 4NSKB 4X4YB 4PB9H 5DJYB 1FL3B 3DSFL 2UX6A 3D69A 4PWFA 4HG4J 3PNRB 3C6LD 5T1LD 1JRHI 2KQMA 3LEXA 4HOWA 1OP3H 4DESA 5JLZA 4L4TB 3HI6H 4NFBA 3C2SA 4K8RH 4QXTA 2I69A 4BQ6A 5JXEA 4BA8A 1ADQA 1R17A 2JCCA 2VMEA 4JL1A 2G3MA 4M4PA 4ELKB 4U6VL 3HC2A 1KDJA 2YUXA 1AGBA 2NY1B 1YEKH 3T3MB 4TL4A 4R6UA 3SIKA 1M9SA 4J39A 1JGVH 4LDLB 4OCMC 1MHCA 3SKMA 4HLEA 5DGRA 3TESA 4RRPM 4RNRA 5SWSB 1DBAH 1VERA 2X1PA 3KWXA 2DLFH 4LPCA 1MCWW 4I9XA 3DYMA 4RGMC 2X10A 4EZKA 4N8PA 1L5GA 2H9GB 3BN9C 4FFZA 2R59A 4A2MA 1IV8A 1XT5A 4LOVA 4PRNB 1ED3B 4KJYA 4J3WA 4PN6A 3ARFB 5DJ8B 3G3LA 2WCPA 3L2LA 5EUOE 5BO1H 3QPXH 1BVLB 2I5YH 2CLZB 3QG7L 4GOSA 3LRHA 1BFVH 1R3JA 2OZ4H 3RI5F 3B1TA 1T0OA 1UWXH 3HR5B 3VTMA 1RJYB 1S7RA 5A2FA 1R4XA 3EJRA 4F5CA 1CR9H 5C9JB 1R3KA 3H0TA 2J88H 3KBHE 3SGDI 5LCVH 5CIPB 2I07A 4TLTA 2ZUUA 1N2RA 2GSMB 1SJXA 1I3VA 3ESPA 2XVGA 4OZHA 1D5MB 1KLGA 2W95A 1K8DA 3CD4A 3OPZL 4HUNB 3T04D 4L29A 1F4AA 3AB0C 3KH3A 3NGBB 3PP4L 4DQAA 5D2LA 5FCUH 1ZGLB 5D7JD 4OM1L 3DBSA 2Y2TA 5CS7A 3T0XA 2XTJB 4V1DE 1HQRB 4LAJH 4ENEC 1OGAA 1QWHA 3D12B 3OKEB 3BP7A 4DW2L 1U91B 5BW7C 1XB3A 4TF4A 5ADPH 2E46A 3INUH 5CJQL 3MLTA 4R5VA 4Z7UA 4UT7H 1MVUB 1SOQA 2A74A 3HS9A 1SXBA 3KPNA 4Z7OB 3JBG7 1HXMB 3IDGB 3WEXA 3O3UN 4LCVA 2WIIB 5J6HA 2P80A 4X5LA 3ZKXB 3GPSA 2HLFD 2IAAC 2ZG1A 3S8WA 1S7TA 1NUFA 4A2LA 2IFFL 3ZRCC 5HD8D 3LD8B 3PYCA 1T1WB 3AT8A 3X11B 4BFBD 1H8SA 4UTBA 2BC4A 3MBEC 3UAJC 1TT6A 4FTVE 3F7YA 1EQWA 3QXTA 4NDMA 1SUJA 2AEQL 4IBQA 4RAUB 3GD1C 1IFHL 5I1GH 4XPBL 5JDJA 1DTUA 1AGBB 5E8PB 1KB5H 3FQ4A 1IC0A 3NIGF 3NEOA 3D52A 5HYSA 2Q20A 3ARQA 1A6TA 1SGKA 2VLJB 2XZQL 3LS4L 1CS6A 3CXDL 1P1ZA 4GKNA 4QXTB 1JL8A 1NMAH 1XB6A 3VE0A 4QXGH 4UT6H 3QXUA 3L17A 4QHKI 3C2AH 3ESVF 3W0WA 4D0CB 4QTHA 5DJYA 1BQLH 3VQ2C 2D73A 3HC3H 6FABH 2QPDB 1HNYA 3ARXA 2FWSA 3CFUA 2WQRA 5D1ZI 2JB6A 3NCYS 2R1WB 4JM2A 4R4FH 2WWMD 5DRZB 4DGVH 4K8RD 1T1ZA 4U1JA 4ZI8A 2P8LB 1ASQA 4N4YB 4X80L 5D7SH 2GIYA 3WKPA 2KZ1B 5T3XD 1QRND 3U46A 1MHEA 3AS1A 5I9QC 3IMBA 1INDH 2LT9A 3W0WE 2DQEH 3BAKA 3WTVA 1GGCH 1BFOB 4HJGA 1QACA 1BVKA 1KZQA 1XR9B 3BVWA 1G7IA 3FQRB 3FT2B 4EXKA 1A1NA 3ABKB 5T3ZH 2YAFA 3I9IA 1CLOL 3ZUCA 4DQOH 4NZFA 4XBMA 3ARGB 5CBEB 5SWSD 3PWNB 5A1AA 3ARRA 4N2OA 2E4TA 1HIML 3DDGA 2H5UA 2R0WL 4E2OA 1JGLL 1FFNA 3TJEH 2ENSA 4JFXB 4UOJA 5I5RA 1JWMB 2XX0A 1TYRA 3MA9L 2O5XL 4RGNC 2KL6A 2F74A 3KYMB 4YXLL 2D4DA 1TYJA 5J3HD 2XTJE 3HFML 4X9GA 4QOKB 1PZ2A 3GDCA 3GLEA 3NH7H 3MRRA 4XPTH 1QLEL 3ILPB 3U82B 1TTFA 4I1PA 3ARBD 2A6DB 3U9WA 5EF1A 3BUQA 2I7SA 2DLGA 4HX1A 4AZUA 3DV6B 4OW6A 3TV3L 1RP8A 2WWMC 4YHNB 1LDPL 4J3OD 3QUZA 3BWZA 4B3EA 4YHYC 3FO2B 1WT5A 3GJFK 5E2UH 4QRQB 1TCRB 4KVCH 3WS3A 1VLXA 1EFXA 3IVKA 3EYFB 1IC4H 1D6EB 1NAMB 1KIQB 5C92A 2FGWL 3ZSTA 5E2VH 4OGQC 5FGCB 3HC0A 3NP3A 1NCCL 4JHUA 1AD9A 3QDGA 5EU4A 5F93C 3SO3B 3V4VA 5IQ7L 5I23A 3KYAA 1ETZB 2QGBA 3PWJA 4U3HA 1UACL 4PJFA 4OSUL 5KYUA 3S3PA 1P4UA 1KPRB 2J20A 3LV3A 1EV2E 2EYRB 1DL7H 4ANWA 3SKJL 1NGQL 1FZKB 1I82A 1IEAB 2VZSA 4EOWL 2P47B 3FBQA 1X7TA 2BY1A 1FL6B 1NBZB 3MACL 2MTAA 2XFXB 3PRZA 1HHIA 3W9EB 5FLVA 3IM1A 2R2EB 4M7KH 1CG9B 4XWOD 2WYHA 3CK0L 3QEQA 1QW8A 1G1OA 3EFDL 5T1DL 4LCIL 1DVXA 3ECWA 4FQJH 1UOVA 4C8XA 3VXNB 4GKZB 3HI5L 4IDJL 1MFAL 2NMSA 2CO4A 5HPMB 2F7RA 4WGWB 5DHYB 3WIAA 4RLDA 1K4CB 5HHNA 4DP5X 4NUJB 4P0DA 1HHKA 2G5BA 1DN0A 4A7QA 5KSBF 1SOXA 3UH8A 1C16B 2DQIH 4X5XB 4Q0XL 2EABA 1EVUA 4S2SB 3MRDA 3KPMB 1C16A 3CDFA 3MLWH 4NO2A 3RNKA 2XCMC 4HPHA 4G9FD 4XCEB 4ANXA 2Z6FA 4N90E 4WEBH 2NNAB 1K4DA 4GXFA 2ZWZA 4H1LA 4NAJA 5DK2A 4S1SH 2C9VA 4YSTA 4J3BA 4YGAB 1DFBH 3MGAA 1AKJD 3K6SB 3F00A 3IJSB 3ULUF 3WTXA 1DQQA 1MFCL 2LFEA 2WWOA 3IJ7A 2AVFA 5HDRA 4LB8A 5MI0C 4CN6A 1L6XA 3Q8EA 3BLPX 2PCFA 3RVTC 2W0PA 5FDWA 2CR3A 1X7QA 3PP3H 2F19L 4I2XB 4AQAA 3TEZA 2FIKB 3N2JA 4HUUB 1NDMB 2Z35B 4UT9H 4W6XB 1CICB 4M1DL 4RMBA 1JPSH 1IAII 4PHXA 2FO1A 2HJFA 4KNQA 1KTKE 3VGDA 1BOYA 2ICES 1A4BA 1H0DA 3ASWA 3BP5B 4XVTL 5D1QB 5HVGB 1C7SA 4Z5RA 5SV4A 3X1GA 4PG2C 5I6MA 1H0DB 3BP5A 4KI5C 3UFIA 4A2HA 4OT1L 4G7VH 3V9CA 4Z0BL 4C59B 1NCJA 1PDKA 3IEAA 3RL1B 3U2IA 1J9CT 3NTCH 4Z95L 3AY4C 4LL1A 2XYBA 1P5UA 4WFEE 2K8QA 4XMPH 2AV1A 3KPSE 4DP0X 4XCCL 4Q56A 3QZNA 1D5BB 1P5UB 3VD0A 1GGBL 5I2IA 1AHWC 3S3JA 2CQVA 1KEGH 3VB8A 1K8IB 1NMBL 2DV6A 4LDCA 3HFMH 2ESVB 4U1MB 3U48A 4U3SB 2DQEL 1I53A 2NY0B 2GJ6B 1WO2A 4KHXH 1MQ8A 3D9AH 3KWWB 3O3EA 4L48A 3JUYA 4R96B 1HEHC 2R8SH 3RL1A 4EI0A 4P46C 5E56A 5EFIB 5T1MA 2MFNA 4PJ7A 1RUPH 4UQ9A 2DWTA 2ENYA 4DHLA 3T3PE 5DUML 4Y19E 3FPYA 2W65A 2VR5A 4PJXA 5DEJA 1DBAL 3L1EA 5FF6A 3L5IA 4FYQA 4G7VL 1MH5A 1U3JA 4QT5A 4R7NA 3QCUL 4RETB 3DURA 2XIDA 2GC4C 1VRSA 4U1LA 2G60L 3F64A 1AGFB 3ZIMA 2CKNA 3BDXA 3MUGB 4NUGH 3ARZA 5IKCA 5I66A 3BPOB 3STLA 5BNXD 5IHZB 3Q2NA 4AEFA 3QFJB 2HKHH 2PTUA 1MCWM 2C3HA 4FA7B 2IG2L 3TFKC 1ORQA 4NIYE 3GS0A 2AJUH 2BNRD 2XXGA 3EJZC 3KJ6H 4JKPL 2GY5A 1JWSA 4RDQG 1MHEB 1DBBH 4MZ3A 5EZPA 3CSFA 4OB5H 2CGZA 3OJVC 4YGVA 2DMKA 3CPLB 1P4BL 2VAJA 3GEFA 4X7SL 3QQ9D 3TO4B 3C9NB 4WW1B 3QC5X 5B1CA 4TLUA 3R8QA 4LHQB 4PJGF 4JJ5A 1KXQE 2WIMA 4ZW8A 4JDEA 1J18A 8PAZA 4OM0L 1BFSA 4D0CA 1CT8B 4OD3L 5AZUA 2Q8AH 4QRPA 2VN7A 1OAXL 4JR9L 5DZAA 1OE3A 3ARSA 1DSYA 4YR6A 4AI7A 5B3NA 3Q01A 1DFXA 2Y72A 4S2SA 5TK4A 2YPLB 2NNFA 3EOAA 2QHRL 3MJ9A 4U1NB 1ILSA 3VFUB 5ETUA 5I8OH 2B8OT 1J87A 2JLPA 4OGXH 3VG0H 1FFNB 3ML8A 1P5VA 4HUCA 5EU6E 5CEZD 4P05A 5EBGA 1ZIAA 4NQXA 5LBVA 2F19H 2F1EA 1N6UA 5J11C 3MCYA 5I74B 4ES9A 3QXWA 4DGIH 4W4OC 5AKVA 1YDPB 1MY5A 2DLEA 2C9UA 2OCCB 1D5ZB 2VXQH 1AS8A 4FG0A 5KSAC 5C3LD 3WJJC 3PQYE 2ED6A 5SWQA 2NY1D 3MLWL 3O4OB 1JZ3A 1V3LA 3GRWA 5FO2A 2WXKA 5J0BA 2R9HD 4GRMB 4DKFL 2QPSA 2MPAL 3VD2A 4J1UA 4YNYB 4DIXA 3GGWA 1JV5A 3SSGA 1MCIA 2X41A 3LYRA 4PJ9C 3GIVA 3X14A 1N7ML 2CZNA 2OI9B 3QNXB 4RRPG 3APNA 3RIAF 4IS6B 5CCGE 4OGYH 1DUYB 2V5MA 4JL2A 3HPLA 4PRPA 4ZS6D 3NEEA 2OP4L 5GZOC 1F42A 1JZ2A 3FTGA 2BLFA 3ARPA 4L05A 4PV9B 4RAHA 1HI6A 4X6FA 4QNPF 5D1ZD 1SXSA 2NX5A 3A67L 4YK4C 3GNML 2GEQA 1R6VA 4GO6B 1WK0A 4AX3A 5J4MA 1DQVA 3GMNB 2VAAA 1GRWA 4HOXA 4FYRA 5TH2A 4N8CH 3BLBA 3L3KA 4TL5A 5FKAB 5F7HA 4UQAA 2P5WD 3A4DA 3DRQA 3RJQB 2VDKH 3QJZA 2DAVA 1J5IA 2CKBA 4FKEA 1Y1UA 1NGQH 1UADC 2BRRL 4F91B 3ZMRA 4KJQC 3CN4A 3NOIA 5AWNL 1HC1A 4CBPA 5JPNA 5L4IA 3MODH 2DIJA 4Z7NE 1S7RB 4WHDA 5LBSH 3B9KC 1CYGA 5KS9F 4J3OH 5E4EC 2WQSA 3CHXA 3D39E 5D7JB 2D31B 4BZ2H 3FTSA 2LHAA 2A6KB 2DQUH 1A1NB 5K39A 5GGTH 4YAQA 5BV7L 4MJIB 5EIVA 3FU3A 4TQHA 4XO8A 4F9PC 5CEXB 2VDQH 3LHAA 4LSQL 1RD6A 4HIXL 4P99A 4WEUD 3OAWA 4B9ZA 4A68A 5F7UA 3L13A 5D7LD 2QVIA 5SV3A 3UZVB 3S2CA 2ZCKL 1QX1A 3QYCA 1P1VA 4FMVA 5I19L 5D5MF 3P77A 5DD1L 3MRBB 3QEUA 1ZTXH 3K8MA 2VO8A 3D39A 5GS3A 5EPMA 5E8PA 3P54A 1EHLL 1WCQA 2AEPL 5KBDA 1HL4A 4PRAB 4G9FE 3U0PB 4ODWB 5IR1B 4XOBA 2DH2A 4N87A 4CADB 2ADIB 2M83A 3HG4A 5C0CB 2OMVA 4ZS6C 2HN7A 2ZUSA 3NSXA 1UFGA 4HFWA 5DQDL 1IGIH 1UUSA 2BVYA 1AP2A 2DQUL 2YAEA 1IFHH 1FZOB 4AKPA 4F80A 5EN3A 4Q9RH 1AYOA 4G5AA 4DCQA 2VLJA 1EWHA 1U8JB 1F6FB 2F8XC 4ZXBC 1JMXA 2W88A 3LKNA 2OSWA 1U58B 2WWNA 3K6SA 4HC1H 1N5AA 3RKPA 3S36H 1F6AA 5J1AB 2VZUA 3PHSA 2N56A 4OZ4A 5LGHH 5KYXA 5HHQB 3HLAA 4HUXA 4ZPTB 3CVIH 3PHOB 5BO0D 1O5DT 1XGRB 1UXLA 2G5UA 4JPIB 2ZUTA 4NZUL 1GZPA 3L9RB 2X2UA 3RVTD 2ZJSL 1GZPB 2HP4A 2EIMB 1S8DB 2K70A 4RFEB 3GUTA 3GI8H 1U8NB 2FEJA 3QNZB 1A7QL 2Y36H 1UXWB 4N5EC 1YEKL 5CJXA 4AG4L 3SYPA 1JYXA 4CDHA 2HG5A 3KYNA 1JF1B 3O9WB 4LRIC 1N2RB 2MKWA 3B56A 3OB0H 5GGRY 1DLHB 4FABH 5IVNA 2VN5A 5ACLA 3O4LA 1ZDQA 1A9BB 5EC1B 1I7UA 3GMLA 2VDOB 3CUPB 4G9DA 4NYLA 2EC9U 4WTXA 7FABL 3QUMH 2X1WL 5JQ6H 1EEYB 5EWIL 2CUHA 3P9MA 2MQGA 1GAFL 1R3JB 1KCRL 2D7OA 2J4WL 2WWKO 3KPSD 4Y1SA 5BZDA 2DD8H 3C09B 3L95A 5ANHA 5L2JB 1SDAB 1H3UA 4JFDA 5C6PB 1WZKA 4JDZA 3FO9B 1KJVB 3LQMA 3MUZ1 4GRWB 4XN7A 1FGNH 2MCAA 1RY7B 4JRYA 4F15B 1W91A 4P8QA 2R7EA 2FBOJ 2HJLA 3U7YL 2Z92A 2GSGB 1EHKB 2DN7A 1L5GB 3H2QA 5EC1A 3B37A 4NAMA 5H2BB 4YNYA 2ATAA 4FMFA 4AE1A 4KKCD 5I6XC 1JZ8A 1DDHA 5DD5L 3CFEB 4N28A 3BIKB 1KCUH 1MRFH 4KJYB 3T1FA 4AM0B 5FO9B 4OIIL 3FQWB 3APFA 4H25A 1BMGA 2Y6TE 2OMZA 3I6LD 3SYQA 4A7VA 2B4CH 1E42A 4JFEA 3E8UH 5EO9B 5LAPA 4GP4B 3ZO9A 1HWGB 3A5VA 5BZWA 3TT1L 3VA2C 3ZDYB 4CC1A 4HDIB 4NGHH 5SWZD 1RSFA 5C0AA 5AAWC 1WA1X 1U8MA 2VR7A 1Q1JL 5I26A 4OQTA 4JCLA 4XN5A 3VUAA 4RWYL 4V2BA 5I18L 2XY2A 3DC0A 5B1JC 2Q3AA 3NIDF 4G6FB 5CWSB 2J4WH 2V9QA 1T3FB 3BKJH 3EH1A 3O9WC 3CTTA 4AL8L 3B9EA 3GRGA 2O6DA 2Z34A 3EYVB 4JG9A 4ZTPL 1PGRB 1EZUA 2EE3A 1ETB1 4F33B 5B8CB 2WK2A 4ZK8A 3OG6B 2C3XA 4M00A 4APQC 4XP9L 4NWUL 3Q43A 1DBJH 1CD9B 2AJYH 1CT8A 4NQQA 3CFJB 4XN1A 3QZBA 5DQ9B 2Q2LA 1YEEH 3RGHA 3V4LA 4AYSA 1F11B 1VFBB 1KYFA 4WKXA 4CMHC 4K94L 2GJ6E 4MJ2A 3HVDA 3I75B 5EZLA 1UGNA 1HSBA 1BXAA 3DGGB 4ODTH 2P24B 4OLUH 4BHUI 2QJDA 3P11L 2B1AL 3Q1SH 4ACPA 1E6OL 3L7EB 5JQHC 1QSFA 2J3SA 4OLEA 1A1OA 3H3PL 2GUYA 1G9MC 3FU7B 3IRCA 3VGGA 1NUNB 3PNWB 4TVUA 2WXNA 5EOCH 3KYOB 4R97B 3E6HB 1IQDA 1HL8A 4LPYA 2H0PA 3MREB 1UHVA 2IF7A 3RWGB 1N4XL 4NRXA 3TEXA 1FL3A 4PG2A 3K2IA 4FXGB 3DMMB 4XNDA 3BT2L 2F53D 5I66B 4NNYB 3RA7H 4F24A 3NAAH 1OHZA 3II2A 3O6MH 2PF6A 3QE5A 4YBQC 4I3RH 2NYYC 3DGGA 4HP5A 3TA3B 4FQCH 3NRPA 2YXWA 3ROOA 1DVFC 2EDKA 2ALAA 4M7JL 3HB3C 2V33A 2FB4H