1YEJL

Catalytic antibody complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crossreactivity, efficiency and catalytic specificity of an esterase-like antibody.
pubmed doi rcsb
molecule tags Immune system
molecule keywords PROTEIN (IG ANTIBODY D2.3 (LIGHT CHAIN))
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1998-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejL01
2ATPA 3S34H 5GGRB 1MCWM 3FB5B 4NYLB 1A8JH 3JUZA 1MJ7L 4GXUN 1RJLB 1WFOA 3QFJE 1C5CL 5KW9L 1FDLL 4LSPL 4DGYH 5ESQA 4NM8H 4UNTA 3KXFE 5C0FB 4PRBA 3QYCA 3RIAF 2D7OA 1A7NH 2CLZB 3DX7A 3TP4A 3LV3B 3NZHL 3MCLL 5LCVH 1MIMH 2JIXB 4Y5VC 4UNVA 5ICXA 3G5VA 4O4YH 3VGFA 4FA8A 3UX9B 3RL1A 3RVWC 1FC2D 4YAQB 4GQ9L 3MBXL 43CAA 4FTVB 4NZUH 3BHBA 5L2KE 2YZ1A 4JGUA 2HN7A 3RX8A 4IMLB 3QEHA 4PJ9B 4RRPG 5HYFA 1OW0C 4QRTB 3GMRB 3HI5L 4ZQKB 1U42A 4OFKA 5A2KH 3EZJB 3RY6C 2H1PH 3MUGB 3T3MF 3CDCA 4PJEF 2R2BA 3CX5J 1ZT1B 2P49B 5EU6E 1MCEA 4CW1A 1U41A 5FECA 4XNYH 3QIBC 4XCEA 4DKDC 1YEHH 2OR9L 4GG6B 3L5WB 4W70A 1I1FB 1Q9OB 2AJZB 4P0DA 5EZOL 2FSEA 2IPTH 3F7YA 4NOFA 4OAWB 3GUTB 5H35B 4HUUB 1I4FA 2ORBL 2VDML 1QBBA 1LE9B 1A7OH 3S37H 3S36H 2Z35B 1DBKL 2OMBA 3OSKA 4XBPB 1F11A 1KJ2B 5CD3B 5GGTA 4FQHA 4HGKC 1E6OH 2CGRH 4JFEE 4DW2L 3WUWG 4HWNA 5AAMA 1KN2H 4Z77B 2FX8L 1S7RB 5L6YH 4HZLA 5EZIL 4N8VG 1X7QB 3N0PB 3O9WB 5GXBB 1XZ0A 3BVNB 3STBA 3ZO0A 3BYYA 3MJ8B 3L3IA 3RDTC 3BPCB 4X99A 4CN6A 2HTLD 4FS0A 5HXMA 1Z9SA 2I9TA 1EJOH 4HWEL 2HJLB 3HR6A 4PRHE 4DGIL 2C4XA 3DVGB 4MCYA 2NX5E 2FRGP 4NBXB 5E70A 1YYML 3WFDL 2E7HA 3F7VB 1QBAA 1SYSA 3IU3A 1WISA 3IDMA 3D39D 4G9FB 1BBJA 3O45B 3VH8G 1S3KH 1DQQA 3QIWC 4X7TB 1WLHA 2W0KA 1OSZB 1ZLWK 5FUOH 3RX5A 2VIRB 2XRAL 5DJZB 1FO0A 3CU7A 5CGYD 4NO3B 4OCYH 2OJEA 1WSST 2RAMA 4PJHF 5I8CA 4JFPB 5E9DE 2ZPKL 4ZAKD 3QI9A 1VENA 5DJXA 4XC1L 5JTWA 5F88B 4OQTH 4J3VA 4MDIB 5CBAA 1CFTA 1U58A 5ALBL 5TE7H 2DWDA 1MAKA 5EU4B 1AI1H 1W0WB 4IHOB 1RZIB 1I3RB 3PWJA 1DQJA 2LU4A 5F7DA 1F4AA 5IEKA 4GSDL 2JK5B 2J6EH 2VTFA 4QWWC 3ZTJG 4P5MB 2ILLA 2YEZA 3G04A 2A9NL 3Q3GB 4G9DB 5DD0L 1CU4L 4LL9A 3ZE1E 1T7WA 2BRRH 4X6CB 3RL2A 3BPNB 4UV7L 4JGMA 2ARJQ 4ZUTA 3WUZA 5T1KA 3MPCA 3ARBC 1F4XL 5BQ7A 4NO2B 3SDCC 5HHXH 3QO0A 4TUOA 3C5JB 4GJTB 4H25A 3HNTH 4WGVB 5EBWA 3HPLA 5HPMB 3MXVH 4LRNH 5I71B 3B5HA 1MUJA 4UAOC 1MCRA 4JB9H 4XWGH 4I18B 4DOHB 2Y5EA 2D9QB 1NLDH 3QUYB 4ZFZA 1MCCA 3UPCA 3PHQA 2Y25A 2FECL 4KAQH 2BSTA 5EB9A 3GNML 1MCHA 4KMQA 1IAOB 5J13B 1S7TB 3GSNB 5MENA 2XTLA 3AXLA 1GOHA 5CEZE 4XNZB 4FQIL 1UQSB 2IH3A 2NMSA 2X4RB 4PJAA 3VFSB 4ZOCA 5C08B 4YDLB 1KPRA 3OGCB 1BVLB 3UJIH 2XXCB 1B4RA 3VI4F 3ARED 2KUTA 3QIUC 1IC7H 3TCXA 3VI3E 2HWZL 1GJIA 1R5WB 4XVJL 1R24B 4H20L 1RUPL 3VD7A 5IF0B 1JWMA 4JM2C 4MNHA 4PFEA 3MUJA 4WTWA 5I9QB 3DUSB 1FNSH 1YZZA 3QAZB 5T5NG 3UAJD 1D5XA 1B0GB 2H32B 4YHIA 5B21A 1A6WH 1YJDC 3I02A 3KLAB 1DBBL 1NCBL 2XQBL 4TSCL 5FUCE 1I8MB 5J6HB 3MACH 2ED9A 4UIMA 3L3KB 2IQAB 1BJ1H 3CFDB 1ITCA 2I25N 2RJMA 3GMMA 3V0WH 2R0KL 1RD6A 3GSOB 1BOYA 1KT2A 5EUOB 2VOTA 5C6PB 1V7NH 2D03H 3P9LB 5EBLA 2AJSL 4DCQA 4RMUA 4RCAA 1HKLL 3V6BR 1X5ZA 1CF8H 1X5GA 1XAUA 1AD9A 1IAMA 3OJVC 5MEOA 2AKRA 4FQXC 3NFNA 3TH3T 3CLFL 4YC2B 3I6LD 3FCTB 4XVSL 1CXKA 5DGQA 2Q7YA 3LSOB 2OBGA 3N9GL 1JWUB 4PJCB 3TO2A 4JFED 1KPUB 5I8EB 3OHXB 4DEPB 3AM8A 2P8MB 1N0LA 2XNAB 4Z8FL 3GSRA 4LEOA 1NCCL 1T0MB 3KYKL 3DXAE 4PRNA 3BGMA 3T08A 4QRUB 4ZAKC 3INUL 4UI2A 4U31A 2OP4H 3CFKB 4NJAH 4JY4B 2DLIA 2VDQL 3SN6N 3HE7C 5K9QG 1FAIH 1MCOL 3VXRA 5SWQB 4QHUB 3UBXA 4YHML 3TT1L 3GSXA 4U1IB 4NO5B 4Y4KB 3EDDA 5HHPB 3E8UL 2IPKA 3MRQB 5FM5O 1NKOA 4NRYB 3RJDA 1MWAH 3NPZB 4E42B 4LLVB 4UBDC 3QXAB 1PX3A 4LCIH 2WLZA 3HC3L 1T0PB 3IDYB 4GRLA 5J06A 2VLKE 4O2CB 3F7PC 4RGNE 2YBRB 4HX1A 2NTFB 1MHHA 4XRCA 2DQEL 4HMDA 1Q9WB 1KLUA 3RWFB 1YYLL 5T33L 3KPQB 5EC2A 5D72H 4OZFA 1DCLA 2MJWA 3AMLA 4TQEL 1WC7A 2FGWH 1FGVL 4ONFL 3I75B 1D5BB 2CR6A 1F6LL 3VRIB 2PW2B 4DEPC 3CCHA 3QPXL 3RAJL 3IFPB 5CJQH 1HI6A 4DTGL 4X5XB 3BQUD 3SE9H 1I8KB 4QXTA 5HGHA 4GAFB 4UB0H 1LDSA 3OAUL 1IT9L 4KPHH 1DANT 1Q0XH 1QBLH 4P2OB 2PCPA 4XNQB 4HDIA 5JW3L 2GTZB 5DYOA 4MA7H 3O11B 1QR4A 4QGYA 4QRPA 2P48B 4WTZG 2AJVL 2ICWI 3CX5K 4KDVA 5EA0L 2WM0A 5FHAL 4Y19A 4OCWH 1U8KB 1RVFH 5SWSB 1KJVA 1MAJA 1NCWH 1S7WA 2XTJC 1QP1A 5EG6C 1WWAX 5HSFA 3HMXH 3GRWH 4KMLB 4BQ9A 4M5YL 2VLJE 4YEEA 3DYMA 1A7RL 1WCBB 3D18B 1U95B 3FKUS 5HGBA 3QNZA 4FQQB 3PWUA 3WS3B 4OLYH 3PL6A 4F8QA 1WITA 3FT4A 1XMWA 5EIQA 5C09D 1JMXA 4NM4H 5FCSH 3V0AC 4K2UL 1UZ8B 3QA3A 2B8OT 2YUXA 3M17B 2MKLC 4K9EH 4PV9A 5CWSA 5F72S 3M45A 4HHAB 1MHEA 1BOGB 1AO7E 1DBAL 2XTJB 3HZMB 1VHPA 5D6DC 2BNRA 4OGYL 4HW6A 4WFHE 2OK0H 3NOIA 4NWTL 5GS1A 5KSVB 4XCFH 2UY6A 4JFXA 2GK0B 4JVWA 3RY5A 4DAGH 1AQDA 4MS8D 4OZHF 5DR5H 5M95B 1MJUL 3RY4A 1T4KA 5I18H 4S1QL 2LFGA 5E2TL 3GBML 5I71C 2WUBH 4YXKL 3DMMB 1EEZA 1QLRB 1U36A 3CXDL 4M93B 5DVOA 1S7QA 3VDAA 1G7LB 2VZUA 1IRAY 3WEXB 3C60D 2FH6A 1QLFA 1D9KB 4ODSH 4UBDD 5DUPL 3GMQB 1JJUA 1UA6H 2WK2A 3MRHA 4LLMA 3U7YL 1MI5A 4O02L 4ETQB 5CIPB 3RTQB 1IEBA 3FTGB 2E6QA 5DEGA 3ARYA 3VGAB 5IMOB 2VLLB 2XWTA 4EEEA 1PZUB 1LHZA 1E0OB 4NSKA 1MFEL 5DRNB 4AG4H 2UWEA 3B2UC 3HI6L 4YJZL 2DM2A 4DUXA 3U2SB 3MLPA 1FSKC 1I1CA 1NCTA 3QEQB 4ZDHB 4WW1A 4V2BA 4NKOA 1DANU 5AYUL 3LZFL 3O6KH 3R0NA 4JPKL 4YR6B 5I1DA 1I9RH 5C08D 1SYVA 3FB8B 2J8OA 4E0RA 5MEPB 5IW3A 1CFVH 1XH3B 2GITA 1MJJB 4ZG1A 3BKJL 2VUOA 4R4NC 5EIIA 1NH6A 2VKXA 5FYKU 4PBVC 1N6UA 5JDJA 4HS6A 1V7ML 3W0WD 4MJ2A 5ID0B 1KACB 4KTDL 1AR1D 1RIHL 3T0DA 3P9MA 5DT1L 2KDGA 3GK8H 4Z5RA 3JUYA 3X13B 3C5ZA 3T77A 3S35X 3NH7L 2APXA 3UYRL 4ODTL 4TNWK 3L3HB 1A4KA 5H2BA 4J8RA 4O2FA 2W59A 4U1MB 1FRGH 5IBUG 4M3KB 1KOAA 1WT5C 1BAFL 1X5LA 3IJYB 1IM3A 4TNWF 5BJTB 5EU5B 3EOAB 4G7VH 1U8NB 1MFBL 3HLAB 2BERA 3WS6C 1JNHA 2NTSP 3TPUA 1V3KA 1CD1A 3MR9B 3SJVE 4JVUA 4OZGF 3WNNA 1VKXB 1A3LH 4XXDA 1J0KA 4OB5H 2VXVL 1H3XA 2BFVL 5DEZA 2AGJH 3BISA 2FIKA 5IG7B 1KJ2H 2KKQA 2BNQE 4M5ZL 5ACZA 4RGOL 5C0AA 3IFLL 1MHCB 5H94B 3UDWC 3OPZL 5E1HB 5EFIB 2EYTA 3Q5OA 3DJ9A 3F65A 4GKZB 4G6JL 1DQDH 4KK5D 3RWDB 2WV3A 3GIZL 2DQTL 3FRPG 4LASH 1OTTD 2BX5A 4R4FH 2VQTA 1JV5A 1G9NH 4L3EB 4WHTA 4X6DE 1JGLH 4PJ5A 3MRJA 3DWTA 3HI1B 3GMOA 2PYEE 3NMEA 3MLSL 3REVA 1M6OA 5EC1B 1KJ2A 5CD3A 4F58H 2Y07H 1MPAL 3VGAC 1AXIB 3BWUC 4J1UB 3TO4B 4LNRB 1CR9L 5D1QA 3EOYG 2E27L 4K71B 4PJCE 2VRAA 3N1PC 4U05A 1BX2A 2RHEA 4XPFL 2G75B 2BVPB 2O5YL 3QWQB 4R4BA 1HEZA 3K46A 1MJ8H 4R97B 1UEMA 2YA1A 1BHGA 2DM4A 1EO8H 5CJXC 4F57H 3ECBB 5E0QA 1T7XA 5I17A 4L9LC 3ZTNL 1XIWC 2VXTL 4QXGH 4JO3L 4PJFF 1RJYA 4G6KH 4FXKB 3ZDZE 4NHCL 2LE9A 1URLA 3MUY1 2ADGA 2F5BL 1WK0A 1KELH 4KK9D 3IXAB 3HZKA 3HR5B 3L5XL 1I7ZB 4AMKH 3KJ6L 3DO3A 4LCCA 5TH2A 3LEYL 5I2IA 1L0QA 4FFWD 2F54D 1DQQB 2XFXB 4M4PA 2NCMA 5FDWA 1G84A 4HC1L 4N0YH 5DRWA 1XGPB 4HK3J 5ELIA 1R5VB 3EYOB 3CFEA 1QSFD 2H9GB 4EDXA 3CFBA 2QKIA 4KH2A 4XX1G 5JOEA 4HIXL 4L9LB 1GGCL 3P3YA 4Y16A 3E2HC 5TF0A 1HWGB 5IROC 1K2DA 3VXOB 1EFXB 1FC1A 2P8PA 4PJ9D 2VN4A 2F54E 2GSIA 2VDNH 3FFDB 5HYSB 3T3PF 1SM3H 3ARRA 1ZLVK 5C08E 4K71C 5I1IH 1NUDA 3BZFB 4RZCB 1KGCD 2ICWB 5LAXA 2YA0A 3V0VB 3VXME 2R1WA 1YNKL 1PLGH 5E24E 1KEGH 2IANE 4GBXC 2ZUYA 5HGDB 4NNYA 3MV11 5FUZH 1RZJH 4OBSA 1M71B 3T3ME 2BDNL 3MRIB 4YHNB 1P7QA 2PTVA 3QDJE 5DUBA 4C59B 1FYTD 3EO0A 4TNVK 2CLVB 5C3TA 1Z6JT 1RZKH 3C2AL 5F21B 2XPGA 6FABH 2NY7H 4NGHH 1Q0YL 5HI4D 4NZTL 2F54B 4PY8J 1D5ZB 3NCYS 5E99H 3WXVH 5IQ9A 5DRZB 3TIDB 3S5LA 3D39A 1EXUB 2ADJB 2NXYD 2B4CL 3JV6B 4PLJC 4F9LA 1CIUA 5T3ZD 1JWSA 1HXYA 1J10A 2BHUA 2WIIB 3KHOA 2FEEL 1E4KA 1JFQL 1VPOH 3BKYH 4XGZA 1LO0L 5IMLA 5C2BL 5E8EB 2E3VA 3VGDA 4HK0B 3U9UB 4I0KA 3EOTL 5GISL 1QOKA 1S5HB 4NUJB 1GZPB 4DZ8A 2XY2A 4I5BA 3QG6B 1CXFA 4I9WE 4TSBH 1Z0MA 2A0LC 1RHHB 3X12B 1IGMH 3K0WA 4PRPA 3HAEG 5FHBH 2R4SH 4Q58C 1AKJA 1T5WA 5E6ID 3TYGH 1HDMA 2D2OA 4IRJD 3QIWA 1I7UA 3W9DA 4L3ED 3IXTB 3B5GA 3NCEB 1JYVA 3U4AA 3H9SE 4U1SA 2O5ZH 4RIRA 1MCIA 3F7RA 1HHJB 1I9IL 3D5OF 4NO0D 4D9LH 1DN2A 2SEBB 3ZDXF 3P73B 1R3KB 1E27B 5SV4A 1BZ7B 2AKRB 4X8XA 4ZO7A 1ETZB 3MV9A 3KWWA 4JHWL 1WZLA 4L8SB 1J11A 4X6DB 4NN6C 4P46C 2Z8WC 3RDTA 4Q9RH 5IBTL 3HN3A 1MWAB 4OV5B 2HKFH 3LHPL 4JCLA 4FQXB 4QHNA 4DGVH 3VD3A 3SDXE 4HJJH 4GS7B 4QRUA 3AB0C 5GJSL 1CLZH 3BI9X 1UGNA 3ULVH 4Q2ZB 3P40A 2X4NB 3H3PH 3REWA 5MP6H 5IMMA 4HPOH 4XAWH 5DC4B 4YE4H 3L9RB 1YJDL 4BH7B 3IDGB 3H0TA 3NAAL 1Q9LB 3RPKA 1J1XH 2PO6D 4GAJL 4PGDB 4GG6E 1QKZH 3C08L 3VWJC 1NGWA 2YA2A 3FO0H 1RULH 4MNQA 1O0VA 3R1GH 4S2SA 1Q9KA 1S8DA 4NWUH 1C16A 5GRYA 2WUCL 3U1SH 5GGVH 3O81A 1LEIA 2P46B 3V4PL 3FOMB 4H88H 2CDFA 4P49A 4CGTA 3I50L 1S78C 32C2A 1HHHB 3RWEB 3TCLA 3LMJL 2DB8A 1KCSL 2NW2B 4WI9A 3OL2A 2ZSVA 2YD3A 1XGYL 2MWCA 3ARGD 3CFCH 4MYWB 3UJTL 5ETUA 5C2UB 5DEFB 4QXUL 1DLHA 3WYRA 4OFVA 4IRSB 3GIVA 2R23B 1G9EA 3ULUC 2CXGA 5D93B 3PGCB 4X5WA 3MLZH 1GAFH 4HFUL 1X5HA 4MJIE 3MXWH 1EPFA 4YDJA 1J7VR 4ZD3L 5IB4B 2OR7A 1W72B 3ZZ1A 3FO2B 3UBXG 1TJHL 3QEQE 4U1JA 2V2XA 4N5EC 1XF5A 3I85A 4LOUC 5BZWA 4BQBA 5CEZD 1ZA6A 3K4AA 1NC4B 1MCKA 3LEVL 5K9JL 3MA9H 4BKLA 2LQRA 3O8XB 5HHOA 2H3NB 1TJIH 5KVMC 4HF5L 3S9DB 1A6AB 4HQQH 4LF3B 3SHSA 1BJ1J 5GRWA 4ZNEA 1RSFA 1UKQA 1WCBA 2E6PA 2EDKA 4NQDE 4KJPC 2A6JB 4WI7A 3HE6C 5JW4M 1N0XL 3VJ6B 3RUGB 3GMPA 3HB3C 4JN1L 4JRXE 5D5ME 2NLJB 5K93A 3DHJA 5FA3A 1HH9B 2MCG1 3OJDB 3QA3B 5ISZE 2Y7QA 3TBYA 1IC4H 3RWGB 1IM9A 1OT1A 4PS4L 3EIFA 4OGAD 5DJCB 1IAKA 5ECJE 4FQJL 4XI5D 2ZCKH 1G6RH 2AABL 3CFJA 1FL6B 1AO7B 5CIPH 2ZOKB 4ZTPL 3ZSSA 3DV6B 3HA0A 4JCMA 4XNMA 1DVFA 5F1OB 1ORQB 1EUUA 1HH6A 3V4VH 5KJRH 1QHPA 5B8CA 4KI5C 2JJSC 2XZQL 3C60C 4P2QA 1U6AH 3FFCE 3WL9B 3LY6A 5JPNA 3EGSB 4IS6A 2VQ1A 4PYGA 4CN4A 4FQ1L 1NAMA 1XCQA 3I9GH 3K81A 4L4TE 3N50A 3WBDA 3VWKD 1IGTA 1XR8A 2C3XA 3H9SA 1IKFL 4HH8A 4NO0B 4TSAH 4RMRA 4HIJA 4ZOEA 1F42A 4W4OA 4WFGE 4XPBL 4MD4B 4S1DC 1KPVA 2ZUTA 5JPMA 5CJ8A 2CKBB 3MNVB 4FFYL 4ORGA 4OGZA 1H0DA 4IRJB 4RA0C 3G08B 1CS6A 4B7LA 4D0DA 2A6IB 3SKOB 2DQJH 2X4PB 4KJQC 3LIZH 3WDIA 2ZUQB 4KI5D 1QFWM 3TJEH 3ZKXC 4GMSH 5IFJA 4H0HB 3HUJB 3O3AA 4JRYD 3Q1SL 5HJ3B 2YR3A 4Y1AB 5HYJE 2HAZA 4JG1H 2JIXA 3ROLB 4XMPH 3FRUB 3NIGF 4NFBA 4POUB 2ED7A 5F9AC 3GJFH 1AP2B 5FGBA 1FL5A 1GOGA 5FO8B 3UDWA 2AEIT 2NY0B 5D7IE 2DI9A 1LEKB 4UT9H 4FTVA 4Z7VB 1ZGLP 1KCKA 1BJ8A 3QEHB 4PJ9A 4P46A 1KIQB 4MA8L 4TUKL 3BXNA 2ZNXA 2MCPL 2OQJA 4Y16D 1VDGA 3HAEH 5DHVA 4CVUA 1XGRB 5HTSA 4RGNB 3HPJA 2NY2D 1B9ZA 2ESVA 3W39B 2W91A 3MGOB 5FIEA 3QNYB 4PJCF 4JFEA 4EVNB 4MB4A 3SGKC 5F97E 4WCYL 3PGFH 1NAKH 4FXLA 3WE6A 1B3JA 3VFOB 2N7BA 2PTTB 3BZEB 3L95B 3L7EA 3WNOA 4WU5A 3A6BL 4XH2A 4HWZB 2VWEC 5CAYB 4LSTL 2L7UA 5DUML 3FN9A 3RWCB 2Y36L 1K8IA 1VFAA 4R0LA 3M1BA 1QFHA 1SVCP 1VADB 3W9EB 4UT7L 1M7IA 1OLZA 3LPWA 4NC1C 1MEXL 4ENEC 3QO1B 3KLDA 4BZ1H 1CLOL 2XKUA 2QQQA 4PJ5B 5HPOA 4M6OL 2W60B 2FATL 1MCPL 3QQNA 4LHQB 3ZE0E 1XZ0B 4GKNB 4E5XA 3R8QA 4F9PC 2OTWA 2WWKT 3GSNL 2WBJB 5KSBF 3FO9B 4L3CB 2P1YA 4PB9H 5EUOE 3V5HA 1S9WA 4Z78A 5A2FA 1HHKA 4OCRL 4QY8B 5IBLD 4NQSB 1DUYB 3VCLA 2BY0A 4CVZA 5J6GA 4LP4A 1P84K 2HFGH 1FIGL 3L6FA 3P30L 5D8JH 4MD0A 1Q8MA 2E9JA 3O45A 1F4WH 3WSQH 3ZKMC 1LE5B 2VDRL 4Z6AT 5JW5A 1K4DB 3EYVA 2A1WH 3DIFA 5HHQA 2ZUQC 3KPOA 4G7YH 1J86A 1MH5B 4APQA 2QQNH 1UWEH 1ZE3C 5B4MC 3WFEH 1HHIA 3O0RH 4H26A 1NL0H 3HE7A 4JREC 4OLUH 3ROOA 4LCCB 5TH2B 4I3RL 5TPWH 3QNXB 4RGMC 1FVCB 4NN6B 3STLA 3O6FA 4Y5YA 4N0RA 1KC5H 1YMHA 1NBYA 5IEKB 2PYEA 2UZIL 3BRGC 2DBLH 2Z31B 4KRPB 3CSYA 4KVCL 4P5MA 3VFTB 3TBWA 1N5YL 1KN4L 4ZUVA 2YD6A 35C8L 1KNOB 3U7WL 3C9NB 3QRGL 5DJDB 1LP9B 3TH4T 1J8HA 4MSWA 2HRPL 4TRPL 25C8L 4P23C 3T4AB 1OSPL 3AS1A 3GMRA 5CILH 5DMGC 4FG6C 1M1SA 2YRZA 4DOHE 3VD4A 2VDKL 3LQAL 3QCUL 5KTEL 4L8DB 3T2OA 3QQ9C 3GJEA 1KTLB 5IVNA 4K8RH 4QTIL 4OLWL 1S5IL 5I1GH 1C5DA 4X6CE 4YHOH 5K9QI 2QL1A 3O9WC 3EDKA 4XVUC 4ELKB 2NY1C 3T8XB 4LHUA 4RISL 5I1KL 2P7TA 5TE6H 3BEVA 3D48R 1CIDA 1LGVA 3D85D 1FZMA 4NKMB 4IJ3B 4HJGA 3UTSB 5IGXH 4XMLH 2W0PA 4JJHA 4N8VB 1QR1B 4LLUA 4N1HB 4PTUA 2VDLH 4K7PH 2NY3D 4LCUA 2IPUG 4KRPD 4PIRF 3WUWB 3JWDC 2RIKA 4OZIE 3NTCH 1OCWH 5BMFL 4JZOA 4P4RB 4B5EA 4LCCC 3I84A 3P11L 3QI9C 4ZUSA 4WY7L 2X89D 2EE3A 2K3TA 1QFWL 3IU4H 3O9WD 3FAWA 1JMZA 2DQCH 3L3IB 3QHTC 2QQKH 5FB8B 4PRHB 3QDME 5ID1A 5EU3A 3TIEB 3PHOB 3B9KC 3WFBH 4WEMB 2A38A 4OT1L 5A16A 3LN4B 5LGJA 1U8HB 2E9BA 2J88H 3L3JB 4JZJB 3I3DA 4DN3H 4LCYA 5T3XE 1IGFH 4ODWB 4EI6A 4MQ7B 4GRWB 3LD8B 3D3VE 3PDOB 3QDMD 5FV1L 4KZEH 3RWIB 1YPZF 2DKUA 3RY6A 3MLXH 3VWJA 5C6TL 2ZUUA 5FYJE 3DGCR 4Q0XL 1PJ9A 5IJKA 1Z5LA 3ULUE 1P1ZB 1X44A 5J7CC 3IAGC 3I2CH 2YD9A 5T3XD 1ES0B 1TCRB 2NY6D 1I1AA 4NQVA 2IPUK 1UB5A 3K1KC 3PG2A 1BFVH 2FJGA 4LCWD 4JM4L 3QUXB 1RUAH 1BPVA 5F3HB 2B20A 3SKNA 1KTKE 2EYSB 4KY1H 2XZCH 4HKXB 1UWXH 4MMXC 5I19H 4NRYA 4OM1L 1LMKA 2CIIA 1G1YA 1QACA 1FFRA 1XGQA 1HYRC 4HH9A 1DBML 3MLWH 3STZA 1LK2A 3LH2L 3QJFA 5EU6B 1A6PA 4JDTH 1UJTA 1IEAA 5DFVC 4OCLC 3MODL 3PXJA 7FABL 1B4JH 2VZ1A 5B38G 4JHAL 2YD8A 5GGTL 3RVTD 3QQ4B 3DRQB 3BZDA 2EDOA 1UEYA 2K7QA 5JR1L 1EGJA 2B0SL 1WF5A 1NCAH 5L2KB 2MQCA 5TE4L 3SDXF 1KGCE 5A43C 4I4WB 5IHBA 1QG3A 4JN2A 4O2EA 4AH2B 2AJ3A 3CC5A 3RA7L 3PV7A 2JCCE 1EA9C 1BZ9A 4V1DD 3NABL 4BH8A 2P5WD 2EH8L 5HHOD 3NA4A 4JJ5B 1BQLH 4P2RA 3KXFB 4D9RD 2AK1L 3MRRB 4MDJA 2JB5L 2XN9E 1FLRH 4P9MH 5IMKB 5D5MF 3QFJB 5FO7B 1CCZA 3MLVH 5EO1B 5SWZE 1UCBH 1F8TH 1VFBB 2NY4C 1QA9B 4IOSD 1W8OA 1K4CA 1C5CH 1FDLH 1X6NA 4S0SD 1MLBB 4WDIB 1QRNA 3KLAA 3RGVA 2DOCA 5JHLH 4P2RD 3JV5A 3IS0X 1A7NL 1AGDA 3NZHH 5LCVL 1JNLL 3ARGA 1VFUA 4PV8B 1ZWIA 1RZKC 4KUCF 4Z7WA 4PRIA 4IOIB 4FQLL 2I9LA 2UWEE 5JO5A 4HWBA 3ARDA 2D9CA 4L4VE 4GQ9H 5TJWK 4X6FA 1JUFB 4NZUL 2GJZB 3NN8A 2GY5A 3MCKB 1IGCH 4YZFF 3SDDD 4L8CB 5DMKA 5B8CC 3N06B 3V52L 4OF6A 1O7VA 4BFIB 1A7PH 3U6RA 1B0WA 3M17A 2H1PL 5DO2C 2XY1A 5E6IA 4L5FH 4Y5XC 4OF8A 2DLTA 1UH2A 4M1DH 5IVZB 2V9QA 4Q97A 1FZJB 1G6RA 4RNRB 4KJYA 4PRNB 5HVWA 4MMZC 1ZANH 3FOLB 4OGAC 4PJ8B 4XNYL 1TTFA 5C07E 1YEHL 2OR9H 5HI4C 3ILQD 1J8KA 1S9YA 1T0NB 4EOWL 4IDJL 1UYWL 1HWHB 2AV7A 3HFMH 3IDXH 1U3ZA 4HBCL 5FYKD 4F7MA 1U3HD 5EZOH 3L3OA 4YH6A 1R3LB 4LEXL 4EQ2A 2GUOA 1EEYB 3K8MA 3OB0K 2C3VB 4N68A 2FLBT 5E8PA 5IOPA 4UTAH 1T7ZA 4J4PD 3S36L 2FR4B 1BVKA 2QSCH 1Z3GH 2GT9B 4FMKA 1X9QA 1R3IL 2OI9B 3KAAA 4PJXA 1LEGA 3MFGB 2AS5M 3WL9A 5JPNB 1KN2L 3LDBB 1WFNA 1WZ1L 5BS0D 1QSZA 5L6YL 4HX1B 3DTXA 2IANA 4AM0B 1RUQH 3IVKA 3SDCD 3RZCB 1INQA 1AGFA 3O3DA 3QSKB 4NKDA 3GB7B 5DS8A 2VKWA 5HVFB 2X70B 3LRHA 4Y5VB 3NCFB 3DX8B 5CHNB 4OD1H 3PWNA 1C5BL 4HIJB 4HEME 4QYOB 1EJOL 4HWEH 3OR6A 3W81A 4UU9A 1ADQL 2PW2A 1W0VA 4DGIH 3QXTA 4NN5C 1PKOA 5I1LA 3HE6B 3MYJB 2P44B 3MLUH 2IAMC 4K3EL 3ULUH 1YEDB 4R90H 1PFCA 1S3KL 2F8XC 3B8YA 5D7LE 1CICD 3SKMA 4KVNL 5DHYB 5FUOL 4MCZA 2E7CA 4LP5A 2XRAH 3BPOC 1ZEAL 3O4OC 5IBLC 4BFBD 4OCYL 4NOBA 5I16A 2HFTA 2ZPKH 3RZWA 4P9HH 4HV8A 2K1MA 1OP3K 5F7WC 4LQFH 4NRZA 1QEWB 3KYNB 1SEQL 1UM5L 1T5XA 4I77H 2J6EL 4ISVB 3SJVA 1YEIL 1DN0B 4LIQH 4XAKD 3ZT7A 2YMXH 2A9NH 4PJFB 5JZ7D 4P57A 4JRWA 5E03A 5IVOA 2Z93A 3TBVA 5F1KC 3FB7A 1VKXA 3G6DL 5E8DH 2J1KA 2DTML 3W82A 3TA3C 1F4XH 3CJJA 3JWOH 3B2VL 5FYLL 2ITCB 3R06A 5HHXL 1A3RL 3EYUH 4LBEB 1LE9A 1JE6A 2IAMB 1IQDA 4MJ5A 5DSCA 2ZG2A 4RFOL 4BSVA 4OTXH 1OM3L 4HIIA 3QUZC 4ALAL 3L7EB 2A83B 2JCCF 2XKNA 4EKXA 4R2GC 3TF7C 3CXHJ 4PJ7A 2DQUL 3BPNC 3MRGA 4XH2B 2DM7A 4WHTB 3TN0D 3MRJB 3AB0B 3ARFA 3KJ4C 4FQIH 2P5EB 5CP3H 2WBKA 1MIEH 1TZGL 4I18C 2P24A 2BSED 4E41D 1DEDA 1IC7L 5D7KD 4ZXBD 3UC0L 3AC0A 1P6AB 1R6VA 2CRZA 2FYYA 4U6XA 3HE7D 1BGXL 5D2LF 3EDJA 4R4BB 3BUTA 1OP9A 2YPKB 1AFVL 2L7JA 3FMGL 1FNSL 3VA6A 3VXSD 3UP1A 1BREA 4KTEH 1BBJB 1QQDA 1E4JA 4QOKE 4UQ3B 1DBBH 1NCBH 3WIIH 3MV8B 2XACC 4X9GA 4JFQA 5KVEL 4EIZC 5FYJL 3MRLB 1GXEA 3IF1B 3VI4E 1T89A 2J8UE 2OJEB 4QKXB 1K6QL 4J2XA 4FNLH 3VFNA 2FHBA 4OM0L 4MDIA 4ODXB 2UYLA 5J1AB 1HKLH 3D9AH 5F7DB 5J3HC 2F5AH 1SQ2N 5JXAH 1M7DB 5EWIH 2NW3A 1F6AB 4XVSH 1IBGL 2R9HC 1G9MH 3N9GH 5B3NA 1JGVH 2WLYA 3E3QE 3O4LE 5TQ2L 3RNQB 4KKBC 4N0FA 1ZLVH 5BS0E 5TDOA 4JKPH 1U8LB 2ZUSA 4PJAE 2V2WB 4CUCA 2VITA 4AIZB 2FNBA 5KANI 2W07A 3INUH 3MNWA 3G5YB 2AJYH 2OP4L 2X44D 4NJAL 2JB6A 2ATKB 3BOVA 3MRNB 4XXCC 4WHYG 3IU3B 5KOMC 4GW5B 4YBLB 5GS0C 2H6PA 3KPNB 3ZE1F 4OJFL 1M71A 5DMGD 1LP9A 1JNJA 3MRIA 1I8LC 1J8HE 5T1DH 5J1SC 3FQUB 4OFYD 1QHOA 2HRLA 2IAMD 5J57B 4GAGH 1HOCB 4S1RL 3DURA 4KRMB 4HFWB 1C12B 5I73B 4CBPA 4Y4HC 3RQ3A 3HC3H 3T0EA 1BD2A 5DJ2A 4IOFC 2BVTA 3WMSA 3HMWH 5C0AB 3VXUA 2NZIA 5FO9B 1TZIA 2DQEH 4DFIA 1PZ5A 3S5LB 2XOTA 2Z92B 2OXHA 4WNQB 5C0JA 4RQQA 5HHMB 3O3EB 3V5KA 4HKJB 5E4IA 2HFEB 2PXYD 3ZKND 1LILA 2V5SA 4K94C 4FQCH 1MVUB 1NMBH 2XICA 4J6RH 4X80H 5F7LB 3MRMA 1Q1JL 3RJQB 1AC0A 4DTGH 3SE9L 3EUUA 4HK3N 3UZVB 1A9BA 4UB0L 3SGKA 4PRDB 1IGYA 5D7JA 4L1HA 4OZGE 1QBLL 1OLLA 2K9UA 4K94H 1KT2B 4YHKH 2BOBB 4MA7L 4L4TA 3QG7H 4XBGB 5DDHB 3RFZC 2C26A 1MFCL 1TVHA 3C5SA 2QTEA 2QADD 2CO7B 4X6BB 5FHAH 5EU3B 3TIEA 4OCWL 4LDOB 3WHE1 3T0ED 4Y19E 1NCWL 3CH1A 4HG4K 4WW2F 3MNZA 1LWRA 1NFDE 1KLFA 2VSDA 3HG1A 5IR1A 2HG5A 4HGWA 3SDCB 3GBNL 1T1ZB 3HG1E 4OCSL 3TGXA 1J5OH 4DUVA 3KNBB 1NFDA 4TVPD 4I9WD 1HQ4A 1P84J 3O3UN 2BOCB 2GK2A 3QH3B 2VL5A 4Z7UB 1BD2E 3WLWC 2FJHA 4TTDC 2EKSA 4X0KA 2GAZB 1ITBB 2IQAA 4U49A 4XMKH 4QRRB 5D2NC 3UXFA 4LAJH 4ELME 3P0GB 4NQCE 5EUOA 3DO7A 1RIVH 2NNAB 4H1LG 3EJZC 4OGYH 4ZNEE 3H0TB 5IK3B 4H25B 4DQOH 5FDYA 2F19L 5MERA 5C07D 8FABB 5TDPA 5HHOE 2HFFA 2Z91A 5TF1H 1T21A 4LKXB 3UTTD 4PJDE 1Q72L 4YXKH 4OCXL 4XP4L 1T3FB 5ICZA 4U1GC 2EO1A 2DI7A 3KR3H 4BSWB 4AENB 3OBAA 4HUWA 4KRLB 4IJ3C 3S88H 4UV4L 1H15B 3BSZL 1OF2B 3QQ4A 1G7PB 4YLQT 3WIFB 3BH8B 2R1XA 2XG5A 4RAHA 3VXRE 2FWOB 3GJFK 4OZHE 1MLCB 2MQ3A 3MV7B 2ADFL 1LO5B 5DJ0B 2NY4B 4L9DA 3VXSA 3T0AA 4EN3B 1MFEH 5HVHB 3AU1A 3OZ9L 1V3MA 4Y4KA 5DD5L 5DA4A 4XPHL 4CADB 2HT3D 2IPKB 4MA3B 3OKKB 2NY5L 2OL3H 4NHUB 5IB2B 4E41A 3C8KB 4TUJA 1D5MA 3LZFH 3O6KL 4B53A 1D5XB 5AD0A 3GSVB 3K8LA 3VE0A 1I9RL 5DZOA 4M1GL 1KTRL 3SBWC 3U0WL 2Q8AH 4IRJC 3QDGB 2X7LA 4LAQH 4YDJB 4NZRH 4M7KH 1QSEB 1H5BA 4FFWC 2A9ML 3MROA 2V5TA 2FX9H 1PKQA 3GSWA 1CDHA 3PL6C 3WKML 1CE6B 5EOTA 5D7SH 4KMTL 5HGGS 3GKWL 5D71L 3BDBA 2RGSA 3GK8L 5IIEB 1JHTA 4PRPB 3JV0A 4F15C 1U8PA 3NH7H 4AEEA 1OAYL 3O2DL 4Y8DC 2I26N 5FGSA 4NKIH 4O51B 3EHBC 1MRCH 1UZ8A 3BIKA 4CU8A 1FRGL 5D1ZA 1AKJD 5F9WC 3HZVA 3EYFA 4ZODA 4R3SA 4G7VL 3KPSE 3U0TB 3X14B 3F12A 3VU2A 2FZ3A 2XKSA 4G43B 3WFZA 2AERT 4L8BA 3LKSA 2F15A 4YIQB 2BXYA 3CK0L 1A6VH 1A3LL 4CU6A 4OB5L 4QHMB 2P47B 4M6NL 1JYWA 1U8KA 3LKQB 3RNKB 1KJVB 3RU8L 4QT5A 4KJYB 1FL3B 4ZPVB 2Q20A 1ZK9A 1Y18A 2XT1B 3QZWB 3QUYC 3OTTA 4Q2ZA 1EMTH 4UAOB 3VD9A 3KPRE 5AWNL 1R0AH 4FRWA 4M8QA 4NC2B 5TQ0L 4ELMA 4UQ2A 1J0HA 2NY6B 2DQGL 1N8ZB 2M1KA 3FZUD 5J56B 3KPPA 3SE3C 2NX5A 1NGWB 3S35H 1FFQA 3KPQA 5EC2B 4F58L 1UT9A 3EW3B 1MPAH 5DTFA 5MEND 1IGTB 3DSNA 1I3VA 1CR9H 3TZVB 5T1MB 4R8WH 2V5RA 5JNYA 3VRIA 4CDHA 1OB1A 2YPLB 1N64L 4XPFH 1GGIL 1XH3A 1MJ8L 1YN7B 2VUYA 1G0DA 4YGAB 3I6LE 3C6LA 4NKDB 2FDBP 5DWUL 4D0DB 5KVDL 2VXTH 4FOMA 5CP3A 4P2OA 3JV4A 4F2MA 1CFSA 5TGBA 2Q1EA 4X4YA 2FX7H 4J4PA 3DXAD 3GKZA 4JFZH 3EYSH 1NMCB 4DN4L 1MAMH 5GHWH 1UADC 3KJ6H 4Z0XB 5GS3A 2WP3O 2AXGB 2EDQA 2P4AB 2R23A 3BP4B 3HMXA 3LEYH 1XIWD 3QEUB 3FJTA 2JJUA 2IBZX 3NGBB 4Z7VA 4PJGB 2Y6SD 4U1HA 5FM8A 3PIQA 5AZEL 1CI5A 4GRMB 4HIXH 1AXSA 3BMWA 3QI9D 4PRAB 3P0YH 2W1NA 4RBPK 1FNLA 1CGUA 3A6CL 3HC4H 1O5DT 1RJLA 1IM9D 4UUJB 1H8OA 1G9NC 3RWHB 2EDRA 4LPXA 5D1ZD 4BZYA 2D7TH 5IW1A 1U93A 2FEDD 1NC2A 5D9SB 1KF9B 4GLRI 5CZVL 1KB5H 4P57B 2RFXA 4ZUUA 1T1XB 3EDFA 2PW1A 5FUZL 2C1OB 3VFOA 3CIQA 1XGUA 2X5PA 1JNNL 3RWDA 3MRPA 3PF2A 5KSAB 1B6DA 3FHQA 4LARH 3K7UA 3UTTB 1JGEB 1HQRB 3C5ZB 4ORZC 3FT2A 4R7DA 4PJDA 3SE8H 2X4TA 3G6JE 2QLVB 4GOSA 1IGJB 2CMRH 4U6TA 4Y2DD 4N0CC 5E2UH 1RZKL 4YXHH 5BRZE 5KOVC 1MFNA 3ARSA 1DSFH 2IPTL 4LLYB 1FYHB 2D0GA 3HB3D 4QRRD 4G8IA 1PVHA 3KS0J 3IT8D 1A7OL 3LN9A 1B2WL 1A1MA 3I6GB 3D6GA 3ES6B 4GG6A 1RY7B 5IVXF 4ETQA 3MMEB 3HAEB 4P2QB 1JFQH 4WI4A 1PX4A 1LO0H 1I1FA 4GG6F 2GTWB 4PJBA 1OAQH 5DZLA 3MGTA 3QUZD 1HSBB 4HG4J 1JF5A 5KVGL 4G8GB 3AVEA 1YPZA 2RBLA 1FG2A 1CDGA 2BVYA 4B0MM 5F6IB 3PABA 2G5BB 3MRBA 4MAYB 4TSBL 2LVEA 1NGZB 5HYSG 4KJWD 5JDSA 2EXWD 5IM7A 4MD4A 3PUCA 4HIHB 2XQYK 4K7PX 2AI0L 3PDGA 4TTGA 4JFQB 4APQB 1RZJC 1SY6A 5D7IF 2DQFB 3GMNB 2DICA 5KANG 3TA3B 4G6FB 1KCUL 4AY0A 2VZOA 1A14L 1F58H 2I9TB 4NO2A 1PSKH 2VAJA 2VO5A 3BH9A 5JOPE 5BV7L 5ILTH 3TPKA 4JHWH 4J8RB 5I8OH 4XC1H 2BNQA 4OQTL 5ALBH 5TE7L 4FFZH 3UJJL 4BUHA 4HULB 1QRNE 4NQXB 2B1AH 2VXUH 4GSDH 1ZAGA 1H9VA 4CJ0A 5IB1A 2VITB 3CUPB 4M62L 4NO3A 3LKNA 1L9NA 5DQ9B 4OLVH 3RPIA 2BRRL 5I6XB 1IL1A 3H3PL 5C0AD 4UV7H 3RDTD 3OXSB 4HPOL 4XAWL 1ULVA 4E9LA 4PRBB 1ZSDA 4OAWA 2B2XL 2C4FU 2XI9A 2QKIB 4TVPL 3LV3A 4I48B 4LRNL 3QUZA 2BHYA 2CIKA 3FO0L 3DPBA 5JMRA 4L4TD 1SJEA 2HT2C 3UTTE 2ZKHH 1PG7H 4G8FA 4S1DD 4ZSOE 1GIGH 5CEZL 4BUGA 3GJFA 5SV3A 1GOFA 4WFGD 2R8SH 4LVEA 4H88L 2D0FA 4NKQB 3LN5A 5GS1C 2BSRB 5T3ZL 3I50H 1U3JA 1FNAA 3I6KA 3L3KA 4KKNA 1N59A 4R6UA 5E9DD 3BVNA 3LMJH 4NIKB 5T3ZE 3MJ8A 1KCSH 1HZHH 4LPCA 3O6FD 3OKOB 1ZHBB 1RUPH 3TN0A 3CFCL 4LFHD 3LOWA 3LS5L 5I0ZA 2EDWA 4KROB 5E08L 3MZTA 4FXGA 1CTOA 3ZKXB 1OHQA 3CVHL 4F80A 3J7HA 1MRFH 2PR4H 3TO2B 1Z9OA 3MLZL 1KG0B 2YC1A 5CINL 1IFHL 5DVKA 2BOBA 4PJHA 1EAJA 4JPWH 1IAIH 2OZ4A 3ETBF 3HZKB 4X4XA 2CLRA 1KYOJ 4L8SA 4X6DA 5I2IB 1U8MA 4M4RA 2GJ6B 1TDQA 3ARBD 5DQDH 5EU4A 2D03L 2AJSH 2BNQD 1S7RA 5GSVA 5SWQA 3VWKB 4RBPH 1MH5A 2KZWA 1I8MA 5E8NB 3JWOC 4HF5H 4UTBH 5BOPA 5GRZA 1C1EL 3HE7B 1RIUL 3ILPB 1HHGA 3ROOB 3L1OL 1N2RA 4HCRL 1IQWL 4NN7B 1EFXA 5F3BB 1RHHA 3X12A 3KYKH 1WAAE 4O2CA 3TBTA 1QYGH 4Y4FD 2IH1A 3MLTB 4I3GA 4Z7QF 3HPLB 1RZFL 2QQLH 5GZOD 4IIQA 3BW9B 4MXVF 1RUML 5D1XB 2VDQH 1OAXH 5DVMA 1RFDH 1KNOA 1EGJH 4PJCA 3QJFB 1ZGLM 4L3AA 1P7HL 4FQJH 5JXEC 2AABH 4UOW1 1FFNB 3DYOA 2AV1A 2C4FT 5MEQB 4OF3A 5HHVL 1KJMB 5IBUB 4W81A 3E8UH 4AIOA 2ITDA 1FO0B 5DUBB 1OGAE 2P8LB 5DJ8B 1WZKA 5KJRL 4X9IA 4LKXA 4LCIL 2VR9A 4YHLH 2G2RB 2HJFA 1X4ZA 1U6AL 5EOCH 3RVXC 3FB6B 3ZMRA 3BP7B 2W9EL 2ZSWA 4S0TD 5D70L 4NCDA 4Q7DA 4GRLD 3TIDA 4NJ9H 1UXSA 2Z9TA 4RFEA 1T22B 4KTYA 2D0HA 5GZOC 2VDOL 4TQEH 3I3EA 4PP1C 3PWVA 4LIQE 2YWZA 3P4NA 4XPBH 3AU1B 1S7WB 3ZKSD 3ARFD 4PGBB 4YNYA 4FFYH 2ZG1A 4LLUB 3O3BB 5CBEA 1QA9A 4Z76A 4LCUB 1ZLWH 5M7QA 2ENSA 2PO6C 3OAZH 1NGPH 3WUWA 1ZTXH 1A1NA 4PRPE 3OAUH 3QZWG 1IT9H 2HTKC 4GH7B 1UB6A 3LIZL 5JW3H 3U9PL 3DECA 3CMOH 1NFIA 4PD4J 4KRNA 5D1QC 1MCFA 4DCQB 2ZUVA 2AJVH 4N9OB 1HDMB 1QSEE 3VFVA 1DQLH 5B39A 3RI5F 1T04B 1I85C 1YDPB 5F1NB 3WNLA 5JO5B 3EFDH 1DLFL 4UT9L 4U1SB 2V7NB 4WJ5B 4F33B 4PJAF 1EAPA 2BNUB 3S37X 2CJUL 4TUKH 3HMXL 5DO2D 2MCPH 2V2TB 3SJVD 2GK0A 5I1HH 4EI5D 1JZ6A 3QDGD 6CGTA 4YHZH 3MV7E 4OZHB 1FNGA 3VXRB 4OV5A 4Z18A 3U0TA 4JRXD 4X6EA 3F5WB 1N7MH 4NDMB 4PJXE 1P4IL 2JF1A 1KBGH 1OGAB 5E7FA 4WCYH 4TULH 1DVFD 1NAKL 3KLHC 2GY7B 3ARFC 1Q94B 3WS3A 3FTGA 1R3LA 1U3HB 3QXDA 2X1XR 3OKMB 2VL4A 3QFDA 2OK0L 4NWTH 5IOPB 4HKXA 1KLUB 5BRZA 4DAGL 2ZNWA 4ONHA 2WINA 3FO1A 3IFNH 3KS0H 5IW6B 3T2PA 5F7EL 3SKJH 4RWHA 1MEXH 1BOGA 1TENA 1TTUA 3ZSTA 4LDLB 3VRJB 4HJ0C 4ELMB 4BZ1L 1TVBB 4S1SH 3VDBA 5GS2H 2EC9T 5HYQB 1I3UA 4M6OH 5KSVA 3W5NA 4ODSL 1XR9B 5DUPH 5CMAB 1HILB 1JRHH 3V4UL 5DURB 3H42H 4OIIL 2JE8A 1KSRA 1F45A 2HTKD 4KC3B 1CL7H 1G0YR 4UIKH 2EE2A 4JFFD 1BFOA 2GJ6E 5FKAB 2V7HB 4HPYL 4OCRH 2QHLA 3O6MH 4GG8A 4XNMB 1ZHKA 3C6LB 2AW2A 2E7MA 3MYJA 4RFNB 3BZ4B 4B50A 4P2RB 3DV4B 4H0IA 4AEIH 3WSQL 4Y19B 3WNMA 2VDRH 4PG2C 4WFEE 3IJYA 3CSPA 2B7DT 4ZNCD 3EOAA 1D6VL 1NAMB 1XCQB 5L2JB 4NSKB 1U8NA 3VFRA 3BKJH 3WFEL 1FPTH 3HLAA 1NL0L 3MOBL 2R4RL 4OLUL 1KIRA 1J87A 4OLXH 5AZ2L 1JYXA 1V7MH 2JTDA 3LKOA 1NEZG 1KB5B 4KTDH 1NMAL 4KI5E 4KRPC 4OZGB 1QEWA 3KYNA 4I0CC 1NGXB 4L29A 1T7YA 2VJXA 2DBLL 2DLHA 3SE4A 3IFPA 5KSBB 1L6ZA 4X5XA 3IETA 1NSNL 5EIIB 1IVLA 5I9QC 3WE6B 4U6HA 2AEPH 2EDLA 1VACB 3U7WH 2YKLH 1D6EB 4JPIB 3F8UB 5DD6A 3MCKA 4ZSOB 5F7YC 4CVXB 3T0EC 5DMKB 4ZFOB 2H26B 4RGMB 3BUYB 2YPVL 1FYTE 3PGDB 4LBEA 5C09A 2VLJD 5E5RB 5KTEH 1M6OB 3DNKA 3CNKA 4PJDF 5GS0L 1SJHA 2BFVH 1S5IH 1I7TA 3JTSB 1LEKA 2VLRB 4GW1B 4RGOH 2DBJA 4YHYC 4W6WB 4KK8D 1TMCB 5E9DA 3MUZ1 1MELA 3WLWD 2HVJB 5FYLD 1D9KA 2P5WE 2B5IC 4NNPL 3IFOA 3L5WA 1U95A 5TE6L 4Z7NF 3QUXD 1XGRA 1WIOA 2DQTH 3MA7A 1FQ9C 1RJYB 3FT4B 1RZ8B 4CN1A 4K7FB 4PJIF 3FRPA 1LP9F 3OJ2C 3E2HB 2Y07L 2Z35A 1F11B 3MMEA 4R26H 5A2IH 3X17A 3RVWD 4NO0A 1U3YA 3KPSA 2HLFC 1LNUB 5I1DB 2BVUA 1OPGH 3NIDF 3P11H 4E0RB 2Y5TA 4FZ8L 4WWID 5IHUH 4JFXB 2W65B 1CZ8H 3HI1A 1EO8L 5IJVB 3M1BB 1S7XB 3MJ7A 3OGOE 4DKAA 1ROWA 3CZJA 3ZTNH 5ICXB 2YD2A 3DX8A 4R7NA 5D5MA 3ARGC 4QXGL 3LKPB 5F1IB 4JO1H 4FN0A 3FQWA 1G7QB 1AQKH 5ABDE 3BT2H 2WMPA 5DJAB 5CEXB 5ANME 2ICWA 1MY5A 2Z31A 3ULVC 4YFDB 2HLAB 3L7FA 1UM6L 1L4IA 4LLMB 4O2FB 4NRXA 4KZEL 1DR9A 4QOKB 1FV1A 4ODVL 3VXUD 3D25B 5C6TH 3ZYIA 2V2WA 4WHYH 1KIQA 1DE4A 1VSCA 3EDEA 5F9WB 1R3JA 2PYED 1GGCH 2IG2H 2J4WL 1CD1B 3O2WH 1JZ5A 3RWJA 5GRVL 2PETA 2ATKA 4PBWD 4HS8L 3VWJD 3EJYC 3PP4H 2VDNL 2MKWA 1MF2L 1X5AA 3KYOB 4BQ6A 5I73C 2IADB 2XFXA 1S7VA 3U0PB 5I1IL 3MCG1 1U2HA 3F7YB 4O58L 2OTPA 3D69A 4EDXB 4NQED 4OM1H 3G6JB 2DLFH 4BSJA 3VW3H 3DURB 2YEZB 3Q3GA 3O6LL 3T8XA 2NY2C 2BDNH 5DZNA 1CG9B 3V6ZA 5C0GB 2GIYA 4JDTL 1RU9L 3B6SA 1T6VN 3V95A 3RP1A 5LAXB 4M7JL 4BFGA 1JK8A 3UTOA 2FL5A 3B43A 1FORL 3WN5B 5DSCB 5GGTH 2GSGB 4KXZH 5C0CA 4OD2B 5JR1H 2NY7L 3UZEA 4XP9L 1DZBA 1Q38A 4J1UA 3D2UB 3ARDC 2H8PB 3WXVL 4JZOB 2ZCLH 3T09A 1K9TA 1A5FL 2VLJA 2B4CH 4MNQE 3TPUB 2AXJA 4XCEB 1QO3A 1ZA3B 3M07A 1BQHA 1WV7T 1BQLL 3QIWB 3W9DB 4PJGE 2X4RA 2CRYA 1C08A 2LAAA 5TDNB 5C2BH 2DJ4A 2NYYC 4L3CA 4P9ML 4TYUA 3HTLX 1WIUA 5KS9F 4QY8A 1F8TL 3GGWB 4PLOB 1DUYA 3DRTB 3ZKQD 4DUWA 3JV6A 4OFYA 4LHUB 3SE4C 3NFPA 1ETZA 2FO1A 3LQZA 3MV9B 5L8LB 1HXYB 4LMQI 2X4QB 1CFTB 1U58B 2QSTA 2J12B 5C0CE 3EYVB 4LSRH 1X6LA 4DZBA 5FHBL 2R4SL 4LRIC 4M3JA 1VA9A 4QEGA 3CDGB 1F3JB 2HG5B 4HGWB 5D2NB 1H3WM 4WWKB 4LPUA 4OI8A 2AQ3A 3IRZA 2YPLE 4J3XA 4HSQA 2R56H 4LVNB 3UTZB 2KZ1B 4WV1B 3E6HA 4POZC 5J1AA 4MQTB 2R69H 4Y2DC 3EOBA 2FJHB 5DD1H 1M7DA 2O61B 3B3IA 4LOUD 1F3DJ 4N5ED 3MLYL 4JG0L 2A74B 4L5FL 5CGTA 4WUUA 3BRFA 4HAFA 5C0IB 5T1KD 3QUYA 3QIBD 3C09C 2CR3A 5EU6A 3LHPH 1XF2B 3WXWH 5L9DL 4DGVL 4YX2H 3RIFF 1ZANL 3RVVD 2WQRA 4HJJL 1JPGA 5E4EC 1CLZL 5I1AB 15C8L 3K8KA 4APQD 3ULVL 5F7UA 1UYWH 4XI5C 5KS9A 3IDXL 4U0RB 3ARVA 3DRQA 4KJPD 3OKEB 4ONGH 1I1AC 4YE4L 5HYIA 5CEYA 3DX9B 4UTAL 1U0QA 3QIUB 4JN2B 4O2EB 4AH2A 1QKZL 4RRPA 5INCB 4KKLD 3R1GL 1RK1A 2EICA 3S36X 1IKNC 5BS0A 2HT2D 3DUSA 3WIFA 4W4OC 3H9SD 3HZYA 5ESAA 5E8EA 3FN0L 3X3FL 1E4WH 2YBRA 2C7UA 3QFJA 5FO7A 4I13B 1RUQL 4PJEB 4Y2DB 3OG4B 5HGDA 4RWYL 1GZPA 4JR9L 1GHFL 1P2CA 3SGDH 5FGCB 1ED3A 5MI0C 4PREA 4XP1L 5KZCD 3RIAK 1ZKAA 4EI5A 2YS4A 5E2JA 3IGAA 1KCVL 5CUSH 1QSEA 4G5ZH 1J88A 3SO3B 5EO9B 4HWUA 1IC5H 5IFHL 3V6FB 3MLUL 2ZOLA 3SY0B 5CJBA 4Z7WB 2JELL 3QDGE 4R90L 1K3IA 2PTUA 3GSQA 4D9RE 1YEKL 1KPUA 2A6KB 3B5TA 1SY6L 3MRFB 1TJHH 4QRPB 4Y88A 1W0YT 2FD6L 1S9VB 3LDBC 5I1CL 3WJJA 4MS8C 4OKVA 3RWIA 3PWPB 2DIAA 3CZFA 3I02B 4LVNC 4H5SB 1MWAA 5IB3B 5J9PA 3T1WA 1YEGH 1A9EA 1TJIL 3CFJB 4LIQL 4GUPA 2JCCB 5JXEA 2YMXL 2Q87A 4HXAH 1NDGA 3KNBA 4ZYKB 1WUNT 2DYPD 1HQ4B 1F97A 4KKAC 3VGEA 4ETYA 4FQQA 4BK4A 1BBDL 4XPTH 1A3RH 5HHOB 2AEWA 1MHHB 1T1WA 4LVHB 5F96H 3IDNB 5FXCH 4LSVH 4OFIA 3WO4C 3NFSH 1IZJA 1JVKA 3G5ZA 4HHAA 4GRLC 1RV6X 3QXDB 1OW0A 4H8WL 5JLZB 5HDOA 2DQUH 2P5WA 4GAYB 4ZTPH 1OD7A 5DC0A 1FLTX 4F37K 4KK8C 4DK3A 5C6WH 3U6RB 2R39A 1KLGA 3RZCA 1UXWA 2NXYC 1AIFA 4KROC 2KH2B 1TZGH 1TXKA 5AUMA 1JPSH 3PL6D 1A2YA 2A73A 1OT2A 2DKSA 4XCCL 4I4WA 4PGEA 3KPLB 3CC5B 5D6DA 2BRQA 2ADIA 4Y4FA 3HE6A 1QVOB 4KTEL 4M7ZC 2VLMD 4LLVA 4ZUWA 4IRSA 3REWB 4TSAL 3QIBB 3VGBA 1JGDA 1YC7A 4Z0BL 3U46A 5ITBH 2HH0H 4YBQC 4W68A 5BOZG 3VMOA 2PKDA 4MA3A 2XQYG 1MNUH 1KUMA 1LK3L 1GC1C 3WDJA 4MLIA 1K85A 4LCWA 2EEAA 5GGRA 3JWDL 4LRIA 4OM0H 4JPVH 4WHCA 3HRZA 3T4YB 3QDMB 3W39A 3FOMA 4Z7WF 1B0RA 2F5AL 3HC0A 2DRUA 2XG4A 5JXAL 2L4OA 5EWIL 4JKLA 3FQNA 3ARGB 5JA9A 3LEXA 1FZKB 4PJIA 1NFKA 4F3FB 4MQXD 3G08A 1FVEA 1JGVL 4OD3H 3G5VB 4QF1A 4OZIB 3BWAB 1F90H 2VLKD 3VGHA 4CKVX 4P5TC 3RGHA 1WAAF 2DI8A 3MFFB 4K7PY 4MA8H 2Q86B 2KQNA 3O3AB 1Y0LB 1QSED 3EJZD 3GHEL 4YGVB 3ROLA 1UZ6E 4JFYA 1T4KB 4NC1E 1VACA 4EXKA 5K9OB 3W11C 1B90A 1EUTA 3TNMB 5BV7B 3VFMA 3QIWD 1JGEA 3NIDE 3RIFK 5E94A 4XP6L 5ERWA 1X5FA 4GAGL 2X4TB 3PGFL 2ED8A 1ORQA 4KXZI 1HH6B 4RSVA 3VFWB 5HGBB 5DXWA 3PWPD 2PXYA 4WI2A 4GW1A 3HMWL 3K74B 2DQDH 2X09A 1Q9OA 2AJZA 2IC2A 3A6BH 3FQTA 4LSUH 4BELD 4LSTH 3ULVE 1TITA 4UT7H 4F9PA 2UV3A 3D85A 2YUVA 4JFFB 3WD5L 3MV7D 3BMVA 3L95A 5EUKA 4MD0B 3S5LG 2VDPL 4J6RL 2X9WA 1CTNA 3O41B 1CLOH 1N8ZA 4GT7A 5JMOC 5T3XL 2FATH 3RWCA 1X7QA 2NY1D 4NPYA 3O9WA 4JFDB 4I0PB 4JQXC 1IEHA 3HS0B 5BZDA 3TT3H 4JVPA 3STLB 5EBMB 5DI8B 3QG7L 1Y6KR 4JANB 4N0UB 5CSZB 1BQSA 4U3XA 1DDHB 1TVDA 1FIGH 3P30H 5D8JL 4F7PA 1R3HB 3MLRH 1YEDA 2W9DH 4ESKA 4YPJA 4QOKD 2CLZA 2XWJA 5E6YA 4PJIE 4OUUB 4QO1A 1UJ3B 3AAZA 2QQNL 5GGSY 1HHKB 1UWEL 5JIIA 1SJVA 3H3KA 3GBNH 1SBBA 3O0RL 5F9OH 5HD8C 1FNEA 4X4ZA 4R96A 1A6UH 2ATPB 2IALB 3VXRD 5TPWL 5FYKE 2X1QA 5F88A 4LCWE 1QLEH 3D25A 4YO0B 2DWDB 5FYJD 1KC5L 2P5EE 1IC1A 2JKXA 5HYJD 1YECL 4PJ5E 2EEDA 1KN4H 4RAUB 1GPOH 2VLME 1CXLA 4NT6B 2A6IA 35C8H 4OLZH 2EECA 4OBRA 3FONB 2X42A 3OX8A 2LU7A 1KENH 4QWWD 5IWLC 3KJ4B 1YA5A 1J05A 5DLMH 3ZYOA 4XTRC 4DQOL 4ZPTB 3QO0B 4P23B 3C5JA 2Z92A 2CIKB 2X4OA 4PJ7F 4NCC1 2OSLA 2WWMD 5FO8A 5T5FL 5JUEH 4YDIL 5KSAA 4PG9B 3FQXA 4C56B 2BMKB 1U8LA 4YHOL 2NPLX 4ERSL 3RVVC 3S88L 1H3TA 1JNHB 1JF1A 3R4DA 3T1FB 3ARFB 4RISH 2D7MA 5BXFB 4AEFA 5CZXC 5LVEA 3FAXA 2IH3B 5EOQH 1TLKA 1LO2L 2AJUH 4MNGA 4TNVF 3VFSA 4F7CB 5GZNC 2VE6B 5MI0B 3MO1B 2WBJC 5IUSA 4XMLL 4FXKA 4LHUD 5DD5H 5SWZD 3GUTA 4XPHH 2BJML 1I4FB 1A1MB 3I6GA 1FJ1B 5CCKH 5DD3L 2OL3L 4MB3A 4QXWA 1JWMB 4KDWA 3ZT5A 3AREA 5DJYB 4I3SH 4KQ4H 4MLSA 2Y6SC 1QQDB 4YPGB 2R0LL 4OIAA 2DF3A 1LE5A 4K07A 1I9JL 3NPSC 4HWZA 4M7KL 1I8IA 1QFWH 3IU4L 1T03L 1BEYL 4P3DA 4Y1AE 5HYJB 3HUJE 2DQCL 1NBQA 1VADA 1MCDA 4MHHI 3MRBB 4MAYA 3BPCA 4KKCD 4X99B 2AEQH 3TBSA 3ZDYF 4ODXA 1FVCA 5F9JB 4P4KC 4U0RC 1E28B 2ZJSL 2J88L 4NZJA 1DBJH 1QFPA 5E2VL 1AD0A 4X0KB 2F53D 5DJXB 2IGFH 4HUXB 4X4ME 1UWXK 4NKIL 5SX5H 5CBAB 4JRYB 1YEJL 1O7SA 5F9DC 3CXHK 3BDYL 5MENE 1XF4A 5BW7A 2ZCHL 1LK2B 3T04D 2YUWA 5KS9E 2ICEA 1HHJA 3C6LD 4PGCB 4Q6IB 1VB9A 4X6CA 3RL2B 5DJZA 1P7KB 5J6GB 3O6FC 4PJBF 1DQMH 3S97C 4TN9A 1R5IB 4KUZL 3CFKA 5FKPB 3WIHA 1UH3A 3K3QA 3RU8H 5DURD 1R5VA 2XZCL 4QHKJ 1HYSD 4XPAL 5I8KH 1Z5LB 2NY1B 5I19L 4NO5A 1WIPA 2VISB 3AS3A 5D4QA 5IQ7H 4HUVB 1I9EA 1EMTL 4G9DA 1NQBA 5AWNH 2P7TB 4LVOC 2R1XB 2R29L 3PV6A 1IAOA 5GGUA 4KKLC 1PEWA 3ULUF 4TOYL 3S4SB 3TEUA 2DQGH 1T80A 1A21A 2OL3B 4JHAH 1OQXA 3N1QC 1ZGLA 2HP4A 1I1YA 1WQVT 2AK4B 5E5UB 4QNPE 2YN3A 3DUUB 3RUGE 5CKAA 1C16B 1NCAL 1OP5K 2Q76B 5DRXB 1AGCB 4L4VB 3I75A 1XCTA 1N64H 1FNFA 1GGIH 2ZG3A 2R0WH 4P48A 1F2QA 1HXMB 5BVJB 2EH8H 1K5NA 1FN4A 5DWUH 4PRDA 3PP3K 4QXTB 2AK1H 5IVXA 1UB6B 3S6CA 4XNQA 1CGSL 3PXHA 1FE8L 4G42B 3CFDA 2Y72A 5C1MB 4N8CH 1MOEA 4F8TA 3L3JA 1MAML 3CH8A 4ODUB 3K2MC 5SWZB 1OF2A 4BFIA 2IFFL 3G9AB 3SCMC 4P2CG 3BEVB 4OQTA 3RDTB 1M05B 5JHLL 4U1NB 4X5WB 4CMMA 2BCKA 3MV01 3H3BC 1PBYA 1TPXC 2OX5A 3GI8L 1TTGA 1U9KA 3BEWA 3TNNA 3UZQA 3DGGB 1AXTH 3BKCH 4LDEB 3VFPA 3QT2A 5LKNA 2N1KA 4NHUA 4X8JA 4FQLH 3OHXA 5AYQA 5IB2A 2Z8VC 2I24N 3RGVD 4M61A 3SGJC 4GKOA 2X4NA 3DROB 4BKLB 1IGCL 5GSVB 3RGVB 3PWLB 4IRSD 5E8OB 4M6ML 2P45B 4JAMB 4GUPB 5CZVH 1RMFH 4XVTH 5ITFB 1KB5L 4PLKC 5JQ6H 4JREB 2ZWLT 1P4LB 2CIIB 2OZ4L 4QHUA 5EZJB 4PRHA 5HHNA 4HH9B 4JKMA 2Q8BH 5ID1B 3UBXB 1JNNH 1CE6A 4M1DL 1OARH 2BNRD 2MPAL 1MHEB 3C6LC 3LN4A 5LGJB 1S7UA 3U36B 5FCUH 3ULUD 5A3IC 4LEOB 4ZXBC 2UVEA 3BGMB 3RZCD 1NMCC 2CMRL 1KIPA 4Z7NE 4IDJH 5E2UL 4YXHL 1IGIL 1TCMA 3HFML 3P4MB 1RK0A 3G5ZB 4HBCH 4X83A 1DSFL 4LEXH 3BD4A 1RURH 1BIHA 5L88L 3QCVL 2F58L 2FZ3B 2YK1L 2YPLA 4G43A 1B2WH 3QWOB 2PO6B 1KLGB 2QEJA 1UZ6F 5T5NF 1Z3GL 1FG9C 3BDXA 1R3IH 5D7IA 1IILE 3FB6A 5DFVD 1MHPH 4P2QD 1BFOB 2IBGA 4WUKH 1HI6B 1LO5A 1OAQL 2XWTB 3D3VB 1GCFA 4G6AC 1I1RA 2YHGA 1MREL 4HDIB 4PB0L 4BZ2L 4S2SB 3KDMA 1UWGH 3MX0A 3PWVB 4OD1L 2AQ1A 3RVXD 3P4NB 4WI8A 3CGTA 1LD9A 3B2UD 3BX7C 1ADQH 3PQYB 3M8OH 2AI0H 1G7MA 2YRPA 3VXNB 4EBQL 3CVHA 3CPLB 3MROB 3NZ8A 5EN2B 4PJ8D 4XWOC 1X5YA 1KCUH 5LJYH 1ZWIB 1KIRB 2G9HB 5DTFB 3SDDB 2OYPA 1A14H 1IAII 3PWNB 5GS0D 5L2KA 1F58L 4P2OC 4JO2L 3RUGA 1PSKL 2V5YA 4ACPA 3FT3B 5BV7H 5IFJB 4OZIF 5I75C 1NEZA 4P9HL 4F3FA 5I8OL 1QD0A 3TLRA 3BIBX 3UTSE 4Q9CA 4FFZL 5ENWA 3UJJH 2DDQL 1IM9B 4PYHA 4JFOA 5L8JB 1MCBA 4P3WA 5TGBB 1SEQH 1KFAL 2R9HD 4I77L 2BVQB 4PP1D 4YHYB 4MCZB 5FV2A 4P46B 1W72A 4AIXA 1G7JB 4ZFOL 2PYFA 1Y0LA 1TETH 1Z9MA 4OLVL 3DVNA 3G6DH 1EHAA 4PTTB 4QGTA 4YHPB 5FOBA 1IARB 5FYLH 3L3OB 5IHZA 3U4BL 2B2XH 4U1HB 3GRWA 4Q6YA 1XF3A 2D7PA 2GCYB 1NAMH 4TVPH 2FYYB 4U6XB 4OGXL 4LF3A 3QDJB 3K2UH 4JRXA 5E1AA 4PJFA 1QSVA 3T2NL 4OTXL 1OM3H 5I74B 4PV9B 3TC9A 1TQCC 2Z93B 2HKHL 4ALAH 4M7ZB 3FB7B 2YSSB 1GIGL 3BZEA 5CEZH 5F1SA 1WJ3A 4L8SC 1LP9E 3BKML 4MJID 4Z7QE 3TV3H 4Z7OE 2PUQT 4PJBB 4UQ2B 5CFHA 3GMQA 1A4JA 3DI3B 3BQUA 1RQ5A 5T3ZH 5LBSL 3EJJX 1HSBA 3IDJA 2RFXB 5EIVA 3VXMB 4MJ5B 3SO3C 4EXPX 3F62A 1HZHL 4XCNA 3G6AB 1CGXA 3HUJF 3OR7B 3A6OA 4MX7A 5EU6D 4MZ3A 2Q6WB 3VRJA 3UC0H 2IQ9L 5TFSH 1HINL 3O2VL 1FYTA 5C09E 1VGEL 1BGXH 1DEEB 4O5LL 1QRKA 2WBWB 2VZTA 1CDUA 3P77B 1AFVH 3G9VA 2CSPA 4B41A 2XWBB 3TA3A 3U4EB 4CAGA 1F6AA 1JHKH 5C8JA 5E2WL 3CVHH 4ODBD 1MRFL 2PR4L 5C0NC 3EHBD 4LPYA 5CINH 1IFHH 5KVFL 3QCTH 3FO9A 4JANA 5CSZA 5TDOB 3MJ9L 4L1DA 3SDAB 1S9WB 4Z78B 5KVEH 1IAIL 4PY8I 4XHJC 5DRNA 1JPTH 3MGAA 3N1MC 1YMMB 5F44A 1UVQA 3BPLC 4MD5A 3SEPA 3MREB 1K6QH 2A6DA 1WZMA 2GT9A 4HV8B 1AGBB 1NLBH 1ORSA 1S9KC 5D2LE 4PJ9C 3MGOA 1A4KB 5H2BB 4G6FD 5MEPA 4UTBL 2CKBA 3NCJH 1C1EH 2VZ3A 3HG1D 3ULVF 1G9ML 4NNXB 4HCRH 1IQWH 4XZUA 4UILH 1ZLSH 1BLNB 1NCNA 4C54A 4KHTL 4ZAKA 2HA1A 4JKPL 4OKDA 3RWHA 3UBXI 4E41E 3OKLA 3BHBB 3N1FC 1W0VB 5LG1A 3VFGL 2FO4A 3VH8A 4JFHD 1PZ5B 1RUMH 4PY7B 4L3EE 4K8RC 4X98A 1OAXL 4PRPD 1RFDL 1JGUL 3FRUA 3LPFA 4EUPB 4RA3A 2MHAA 5GGSB 5IB5A 5DD6B 4ZSOA 4JDVA 3V6ZB 5T1DL 1J05B 4PJ7B 5DQJB 3B6SB 2BY1A 4WV1C 4YHNA 2D31B 5HHVH 5C07A 3OKNA 2R1YA 1X5JA 4S1RH 3NPSB 5GSRB 4WIQA 4YHLL 4N1EA 2BNQB 1OGTB 4AQOA 5ESVB 5FK9A 4CNIA 2ARJB 3C6SA 1KTLA 2VLRA 3KPNA 2H8PA 4LHJB 1MY7A 4WUUE 4M1CC 5FFLA 1YN6B 5ACZB 4NJ9L 4MAUL 2FIRT 4MAYC 4HLZH 4NP4H 4LNRA 3B9EA 1REIA 3PE9A 5B3JE 4FXGB 3UTSD 3RPIB 5KBNC 3RRQA 3SO5A 4MNGB 1DVFC 1NMBL 2G75A 3DVGA 4OFDA 4BQ8A 1UCTA 5DMIH 1Q1JH 1JV5B 3H9YA 5EU7E 3MYZA 4N8VA 4BK5A 1S5HA 1NGPL 1ZTXL 1EVTC 4D8PB 3LD8C 3ARUA 4MXWH 3CSBA 3ZHKA 4IMKC 5KZCB 4NUGH 3GHBH 2UYLB 1BIIA 4Y5YB 2V9RA 3LN5B 5K9KB 1U92A 2HVKA 4XP5L 1KEMH 3HNVH 5IJVA 1DQLL 2Z31D 4G6ML 3DX6A 4ENED 1T2QL 1EEUA 1DLFH 5FB8A 1QUNA 3WHE0 4H0GA 5C0CD 4RIRB 5DK2A 4M00A 2CJUH 2D4FA 4L4TB 1AGEA 3VFUA 3GSUB 3P4OB 5I1HL 2XA8L 2V5MA 3KG5A 2W0FA 5AEAA 4OCSH 1J5OL 4JQIL 1QSFA 3BP6B 3GFUA 2E8YA 1VEPA 4NRXB 3KWWB 4YHZL 3GMLA 1RJZB 1W0WA 3FN3A 4IHOA 1PQZA 5DRWB 3LS4L 1RZIA 3PWJB 4NNYB 3FL7A 1CQYA 2ITDB 3MRLA 1MCSA 1CLYH 1ZT1A 3CLEL 1H15A 3DBXB 2EDDA 4CW1B 5E00B 1JYNA 1T2JA 3U0PA 5T1KB 4C55A 1IMHC 3WV0A 3U82B 3W11D 2F19H 4N0CD 4WNQA 4PGZA 3OKKA 2FSEB 3V5KB 3ZYZA 1BVLA 1EHLH 4I18A 1PAMA 1Q72H 5F7EH 3SKJL 2WBJD 4XP4H 4RMWA 5F3BA 2BY3A 3CVIH 5DJDA 2XTJE 1A47A 3ARXA 3DO7B 4HKBB 2NNAA 4NQDB 1H3GA 3V5DA 4QLRA 5GGRY 4WWKD 4CMHC 1QFUH 3PNWA 4Y2DA 3WN5A 1F4HA 4HEPG 3WLBB 3CFIC 5F71A 3KLSA 4IRZH 1TJGL 1HHHA 2GJJA 5LWYH 3MJ9A 4LKCB 4YBHA 2DD8L 4OIBA 1WWWX 4R0LC 4FG6D 4LLDA 2G60H 1L6XA 1NUNB 3EYQD 3OZ9H 3FQUA 5DRZA 2VLJB 1F3DH 3CDYA 3QHZH 2NY5H 5BVJA 2CDGB 2ADJA 3BD3A 2D3VA 5LGKA 1T04A 1YDPA 1JN6B 5SWSE 5CD5D 4MJIB 1P6FA 1PY4A 3O4LA 5IHLB 4M1GH 1AKJB 1T5WB 3U0WH 2Q8AL 4LAQL 1GSMA 4F9LC 4NZRL 4TTDD 3NFNB 2CRIA 3JVGC 2A9MH 1MFAH 1E6JL 3IDMB 1FPTL 2FX9L 4RFEB 5ACMA 2R4RH 5FUCC 5SWZA 3EFFA 4OLXL 1W72H 1L9MA 2P8MA 2VNCA 5D7SL 5LQBH 4RGND 2NZ9D 3GKWH 5D71H 3UPAA 4CMMB 5I8CB 4X6EB 3QDJD 4XBEL 1K8DB 1OAYH 3L3DA 3SQOL 1SBSH 1MRCL 4EUPG 4LLWB 3C5ZD 5ICYB 4P5TB 3O8XC 1KYOK 4MNGE 1U8QA 2YKLL 4XCYB 4Y19D 5FYKH 3E6HB 1X5XA 2IF7A 2R2HA 3VJ6A 1CXHA 5JHDA 4GQPH 1N5AB 1OTSD 1KB9K 1J0IA 4UT6H 2YPVH 3AS2A 3H7BB 1T0MA 2DIJA 4HXBL 5FA3B 4Z95H 4IIQB 5MERB 5BQ7B 5GS0H 5E6ZA 5D1ZB 4M6NH 2PNDA 2HJKB 1T83C 4HWBH 2VAAB 4HS3A 1G0XA 3VWJB 4LK4A 4EIGB 3S96A 2QHRL 3DOSA 4ZMAT 1G6RB 5GRJL 4R2GD 3SDXB 3TZVC 3J8F7 5FA4B 4PJ7E 1UXWB 1S78D 2DKMA 3PQYD 5FEBA 4J3OC 4HUNB 3MRCB 1C7TA 2HJFB 4C83A 1UACH 2FWOA 3D1MC 3LVEA 5TQ0H 1NFDF 4YFEA 1OAKH 3RKDC 4X4YB 1FL3A 4ZPVA 3MZGB 4MXQD 1J12A 3S35L 1AY1H 5EBGA 3RWFA 3DXAB 1OAZL 1RK1B 1J1OH 3D3VD 4E41B 3EZ8A 3MQIA 3GSVA 3H9SB 5IF0A 3QR2A 4N90D 1L7TL 5EORH 2P5ED 4QTHA 1OPGL 1M4KA 5IK3A 1A6TA 1FFOB 3PIQB 1CZ8L 5TDPB 3F6IA 1TZHB 3AREC 3QIUD 4NBZB 4HGMA 1X4YA 3KDMB 3SPVB 3GB7A 5KVDH 1FP5A 5FM4A 2VH5H 2X70A 4Y5VA 4XC3H 4JO1L 1LD9B 4I2XB 3Q2CA 4EI5B 3UTPD 3BT2L 2GTZA 1ZA6B 1CGTA 3GSOA 1NC4A 2EDHA 3HUJA 2E7LA 5GHWL 1OP5H 5K59E 4ZUUB 1SJXA 1KXTB 3BH8A 5CZKA 4JJ5A 5LGHL 4FP8H 3HCVB 5SWSA 5AZEH 1VCAA 2YXFA 2K7PA 3FT3A 5J89A 3P0YL 4J3SA 3O2WL 1G9MC 1KXVC 4L8BB 3A6CH 3HC4L 3OMZA 3PP4L 4XXCA 2BNRB 1MF2H 2OTUA 3H9HA 3IJSB 3G5XA 5IB3A 4X7SL 2D7TL 3T65B 4IOFD 4DVBB 1A6ZA 4Z7UF 5E94B 3K1DA 4OI9A 4DVRH 3VW3L 2WAHA 4PJBE 5K33A 4M93C 1FL6A 2JJTC 2XZAL 5F70A 3LKOB 8CGTA 3GSXB 4U1IA 1XFPA 3FQRB 4LARL 4UUJA 3K80A 5DJ6B 4LVOB 4M9PA 1A1OB 4M7JH 5CGYC 3SE8L 4ZTOL 4Y5YC 3MRHB 4YDVB 2E7BA 2IANB 4U7SA 4XPGL 2EDJA 2WINB 3FO1B 1BM3L 4XX1E 1T1XA 4BSVB 5HDBE 4XP9H 3B9KD 5B38A 1TIUA 1VGKB 2DL9A 2BNRE 4BM7A 2FHFA 3PP3H 2I07B 1A5FH 4WW1B 3IDJB 1JPFA 1F6FB 2JLLA 5D96B 2X1PA 3TVMB 4OFPA 1D9KC 5ESQB 3G6AA 3OV6A 4FFVC 3JV4B 4F2MB 2AK4D 4ORGB 2P24B 1KULA 1CBVH 1F4YH 1I8KA 5HGHB 5KVGH 3BH9B 2I5YL 3QUML 1HIML 4YAQA 3LQMA 4MQSB 1V8HA 4I2XE 3JVGA 4IRSC 1GZQA 2E5EA 5KN5B 2M26A 3Q6GL 2VZSA 2QSQA 1QFOA 4LSRL 4X6CF 4YFLF 4KK6D 1AP2A 1GL4B 2DLEA 1HSAB 3RWJB 3JTTB 4OI7A 4LSQL 2G5BA 1IL1B 1AGBA 1RI8A 4XNUH 4UDUB 2GI7A 1T7VA 5FECB 4EUPH 2XXMB 4Y8AA 4Z5RB 1P5UA 2PYEB 5ILTL 3TVMC 3CSYB 3MLYH 2WWMC 4JG0H 3ZTJH 3MV8D 3R0MA 3G6JA 4ZFFA 5EPMA 4GMTH 5DA0B 3Q0HA 5C0RH 4U6HB 4YFLI 4NQCD 4U1MA 1UFUA 1MHCA 5H94A 3ULSB 4DKEH 2XKNB 2B1AL 2VXUL 5L9DH 4YX2L 3OXRA 3QJHA 5DJAA 5CEXA 4OCNC 4M62H 4AIZA 1MFDL 15C8H 4HIEA 3VH8B 1MQKL 5GGQH 4AEHL 2X6MA 5J12B 4J3WA 1FVDA 1EX0A 2EIZB 3RBGA 3MR9A 3VRLE 4ZXBB 4DKFH 4Z77A 5IWLA 1SJHB 2R0ZH 4ONGL 4K23H 2H6PB 1FV1B 1CD9B 4Q9QH 4PG9A 5D6CA 3P2TA 3U83A 1L7IL 5ISZA 1AQDB 3PDDA 1INEH 1J0JA 1I75A 1MCWW 3W9EA 3SJVB 1ZHBA 2EC8A 4YK4B 1M7IB 2DTSA 2R2BB 4M7LH 2I27N 4M6AA 4QNPF 2ZKHL 1PG7L 4A6YA 3C6SB 2FGZA 5GPRA 3KXFD 3VXTB 2R8SL 5IEHB 2VE6A 1JZ3A 3X3FH 3BJLA 4X7FC 5BO1L 3AROA 1N4XL 3ECBA 1IEBB 1PY9A 1V5JA 4RWYH 4JR9H 3HNSL 3RX7A 4HKJA 3VXPB 4F37F 4HIIB 4XP1H 4FTVE 1OSZA 3G6JF 4N9GA 4KKBD 4UDTA 3D0LA 4KHXH 4P4RA 4H1LA 4G5ZL 4RDQG 3LS5H 4P3DB 4ZUSB 3MRMB 4HKZA 5E08H 1AE6H 2BVPA 5IFHH 4FABL 4WWKA 4ZOAA 4P59L 5IV2B 1K4DA 1I3GL 1N3NA 1XGPA 5HHQB 1I3RA 5T1LD 5I15H 4K3HA 3CFEB 3MOAL 3DX7B 5JQHC 3CMGA 2H2PD 4JPWL 4LU5L 1DTUA 5IKCB 2AXHA 4XBGA 5DDHA 2ADGB 4HUXA 1BECA 3B83A 3H7LA 2FD6H 4HMEA 3L7FB 4CVZB 3IDIA 3HR5A 1P4BH 1TVHB 5KG9B 4EI6B 1DUZA 3LB6D 5C0IA 3QRFM 2HN7B 1JHLL 5DQDL 1FFPA 4GRWH 3UTQB 4RX4A 5M94B 2JJTA 4NQXA 3DIFB 3EO1A 4GKSB 4NQEA 1B6UA 4G9FA 2VYRE 4ZFZB 4HXAL 1RIUH 4R96B 4Q9BA 1QSFB 3L1OH 4X7TA 1BQHG 5I1JH 2EXYD 1BBDH 5GJTH 1QYGL 3QUXA 1WBZA 2CLVA 2E8ZA 5E8NA 1TZIB 1RZFH 2QQLL 2H2PC 1CE1L 3NFSL 1CGWA 1T22A 3DBXA 4RQQB 4YUEL 4NT6A 3KPRD 1EGJL 1DQJB 2IJ0C 4ZUVB 2JK5A 5EOCJ 5GGUB 4NZDA 4EQ3A 3S4SA 2VC2L 2EE9A 5FF6B 4UZGA 5ESAB 3VG0H 5C0DA 1J9CT 1P7QB 2DMKA 1FZOA 3C60A 4WGWB 3G5YA 4WO4A 5ISZD 3I3BA 3TESA 4A6YL 4XGZB 5AG9A 4CRPA 5EOCL 3N1GC 4HZLB 2V17L 1JPSL 3ARBB 2KBGA 2W9EH 5D70H 4NQDA 4YDLC 4FQ2L 3NACL 1D5ZA 4G80B 4OCMC 2J8HA 3ZYJA 5HBBA 1YEEH 2VDOH 1D5IL 5KS9B 3IAQA 5B39B 5J1TC 4NQCA 4LLQB 2HJLA 2X4UB 3QDAA 4P4KB 4Z0BH 5ITBL 4I0PD 1S7TA 3GSNA 1FZMB 2B5IB 4HJGB 3UTSA 5EH1A 2EKJA 4C57C 1MNUL 1LK3H 3DRTA 3WHXB 1AHWA 4ODUA 1GC1L 4NUJA 3E6FB 5JOFA 1S9VA 3LQZB 5CZXD 4OQ1A 1U8HA 4KQ3L 3U9PH 3CMOL 1HNFA 3UO1L 1E27A 4H5SA 3EJYD 1I7ZA 4G3YH 1QBMH 2DQIL 4WU7A 4D0BA 2BVOB 3QI9B 1OGAD 2X9XA 3MTRA 5KSUA 2LV4A 1B0GA 2H32A 2AAVA 3VFPB 1A9BB 5ADPL 3EFDL 4YXLH 2I9LB 1YNLH 1NCDL 2GJZA 1JI1A 3OWEA 4FZEH 5H37H 5C0ND 1QFWI 3G04B 3GO1H 1EBAA 4P5KA 3TBTB 3H2WA 4RDQF 4E42A 2ZOLB 1UKTA 4ELMF 5FOJA 1GGBL 4WUUB 5FYJU 3BIKB 1U8QB 2VLKB 2YD5A 3NCCB 4WRLA 4XCYA 5GS2D 2DJSA 3IKCA 4BA8A 2APTA 2HMIC 1XF2A 1N7ML 4ZO6A 5MEQA 3FCTA 1P4IH 1KBGL 4AENA 1KJMA 1FZJA 1JPGB 4HUWB 4TULL 3BESR 1PEZA 1UJ3C 4F7TB 5BRZD 1DL7H 4C56E 5IESH 5CMAA 5L2KD 2GJ6A 4NQVB 2EXWC 3BGFB 4H8WC 2H2SD 1T20B 2FJGB 3AGVA 1RZ7L 3L5JA 4MB5A 3WNKA 2DQHL 4J3TA 3QIUA