1YEJL

Catalytic antibody complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IG ANTIBODY D2.3 (LIGHT CHAIN))
publication title Crossreactivity, efficiency and catalytic specificity of an esterase-like antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1998-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejL01
4R2GD 1QP1A 5KS9E 2DJUA 2NY2B 5F9WC 3OKLB 4QKXB 2X6MA 2XZQH 4S1RL 3MV01 4LLYB 5DTFA 1YQVL 2VWEC 1RV6X 4GW4B 2DLFL 5SV4A 3DX8B 1EIBA 3LN4B 4NO3B 2NNAB 2X4NA 4NNXA 5E6YA 3X11A 3W11D 4LQFH 1U95B 3MLXL 4FQXC 3HFML 3B2VL 3NIGF 4KJWC 1PG7X 4OCNC 5CS7A 5D1ZB 4B50A 2YPKB 1QHOA 4J6RL 4U1SB 4HWEH 3VFTB 1YC8A 4P9HH 1A1MB 3BGFB 5IVZB 2D7TH 4OQ1A 4GAFB 3BZFA 5AZEH 1T04B 4Z0BH 4IJ3C 1ACZA 3QWOA 4YXLL 4DGIH 3KYOA 3WXWL 2E8YA 4Y7MA 2DQTH 4O58H 2H1PL 1IAII 3EJYD 1H3VA 2W9EH 4O5LL 3NH7L 5DFTA 5JXAH 2QQLL 4L9DA 1M4KA 4XC1H 1JGUH 5I19L 2HFFB 2H8PB 5IEHB 1JGVL 3QEQE 2O61A 5IFAL 2G5BB 1N64H 3WIHA 4WO4B 4MMZC 1NBYB 1Y0LB 3RIAK 3DXAA 3HMWH 5EOTA 4LU5H 3IFPB 4MNHB 5FDYA 3Q6GH 3S36H 5H35B 1CICC 3AMLA 4MXQD 3FO1A 4P23C 5IT2L 1DQLH 5D7LB 4F57L 1R0AL 3C6SA 3UMTA 4PJAA 4JPWH 2P8MA 4YJZL 4DEPB 4HUNB 4HX1B 4RZCB 4K3JL 5GZOC 1B0GA 1W72B 4YHPA 3MLVL 3RNKB 3REVB 3U30C 5A1AA 4HMDA 4YDIH 3ZKXB 5F89B 3S35X 2XKNA 5L8JB 3QUYA 3MLTB 5T1MB 5D7KE 4PJ9B 4I0PB 5EBMB 4UDUB 3NIFE 3QJHA 5E8DH 1JPSL 1U6AL 1F42A 1MHCB 4P0DA 2UVEA 3WFZA 3IJHA 4WEBH 5DZNA 4BH7A 3VXUD 5E1AA 1OHQA 2V17H 3VG0H 3OB0K 3U1SL 1OQXA 3TBTA 4HBCH 4D9RD 2Y6SC 5JW3H 3W0WE 1A1NA 4XP9L 4YEFA 1LO2H 2DJ4A 3FQRA 4QF1B 5KTEL 4YHYB 3I6KA 4M7KH 3MOBL 5ANMB 4X4MA 3KXFA 3MUHL 1XIWA 4KKNA 2X4PB 5B39B 4GRLD 1YA5A 2FHFA 2VQTA 4PJHF 2A6JA 2ZWLT 3O0RH 1QYGH 4HT1L 4NQDD 5F7WC 4FXKA 2B4CC 2R0ZH 3C2SA 1OP5K 4X80H 1MHHB 3PWLB 3IDYB 3LQAC 1IQWH 3U0PA 5T3XL 3DRQB 4PJGF 4QNPE 3RAJL 3HUJB 3D0VB 3M07A 4OLYH 1OGTB 2JB6A 2VABA 3K1KC 1L7TL 2J8UF 4ZTOL 3LKRB 2XYCA 2IANE 4ZUUB 4NQSA 1NDMA 1NAMB 1V7ML 3L3DA 4CADB 5JPNA 2DS4A 3V6BR 1NL0L 3RDTA 4UINH 5FB8B 2BMKA 3HE7C 4C57C 1DBJL 1ORQA 4KZEH 4FQHA 2OXHA 5TFSH 3WS3B 2WQRA 1BQLH 3QIUC 1AI1L 4GAYB 3UJIL 5INDB 2YD7A 3QZWG 4F7EA 5AAWA 2SEBA 4PJIA 1MELA 4GKOA 4A6YB 1JI1A 1WGOA 4KFZC 2AKRA 5IOPB 4TUJB 1A6PA 3FHAA 2VDNH 3TH2T 3GNMH 1CFQB 3JTTB 4OV5A 4WV1C 1FYTA 4V1DB 4MNQE 3SKNB 1JZ3A 4K3DL 1F4YL 1DQQA 4R96B 1S7TB 3J7HA 4J8RB 4NT6A 5DD0L 2DI9A 1M6OA 3MYZA 2I9LA 4ZS7L 1P4BL 3IDIB 3RWHB 2NY2C 4WI6A 1K4DA 5IQ7L 2CJUL 3P9LA 1R5IB 4H20H 2XICA 3MV8E 1G6VK 4M6OH 3B9KD 3KYKL 3S34L 4YH6A 5TDPA 2O5ZH 4XAWH 3DVNA 2EEBA 2D31A 2VUYA 2Z0BA 3F8UB 1DP0A 1U8PB 5D1ZC 1PG7H 4F3FA 5I30L 4YAQB 2XIDA 1CDUA 1GC1C 3R1GL 4X6DF 2AEQH 3BGFC 2FHBA 3DX7B 3UC0L 5BOZG 2JIXA 1F4HA 3WD5L 3NACH 1A9BB 3WKNA 3LAFA 2FYYA 2UYLA 2Y36H 3V2AR 4JFDD 4U1KB 4HLJA 3EAKA 4HPYH 5EZJA 2APFA 3QULA 1MNUH 5FGBC 2HG5B 4LIQL 43CAA 1RZJL 5CD5D 3S96A 3QUXA 5J6GB 1BQHB 2VLKB 1XR9B 4I77L 2NR6C 1BFTA 1UWGH 4WO4C 5DRXA 2G2RB 3H7LA 5TJWK 4MJIE 1MCLA 1QR4A 4JR9H 5EULV 4EQ2A 4H26A 2OCFD 4R90H 3I6GB 3RPIB 3TN0B 1LO3H 3MRGB 4XNYL 2BOCB 5CJOH 4R26H 5FO9A 5K9QG 1D5MB 4DEPC 1R3JA 1U0QA 2XACC 1U8IB 4P4KA 4W4OA 2WBJB 3B8YA 1S7WA 5ITBH 1YYMH 1KNOB 2K7PA 4UT7H 1BHGA 5C09A 3VH8A 4LSTL 1UM4L 2P4AB 2VC2L 3ZKXC 3ZE2E 3KS0H 2DF3A 4WFGD 1I1YB 3QIWB 2D7OA 4PJ9C 2OK0L 2OMNA 4I0PC 3VXSD 2AV1A 3MXVH 3TVMA 4LPWA 4R4FL 5GGQL 1NLBH 1MVUB 3X12A 4J3XA 1R3IL 3RL2B 2YPLA 3VI3E 5FGCE 1CIUA 2I60L 1OSPH 5C0CA 3C5ZB 4JFEB 2NY4D 2MHAA 1ES0A 3BKJL 3KPMB 4U1MB 4NZDA 2X05A 4UILL 1XGRB 2NX5A 1TZIA 2H32A 5T33L 1HILB 4DZ8A 1SY6A 1F6AB 4NYLA 4XVJL 4YHYC 1FO0H 2GJJA 3DETD 5J12B 3LKSA 1FG2A 2FGWH 3BWAB 3TBYA 2A6DB 1MIEH 3RWGB 1ZKAA 1C1EL 3KYAA 1MUJB 4XPHH 4P2RB 1I7RA 3HZVA 2KL6A 3JV6B 4PJ8B 4U6HB 1UM5L 5EO9B 1KLGA 1NMCB 1F2QA 3HPJB 3S6CA 2A1WL 5BV7H 1JNLL 3VFOB 1HWGB 3WLBB 4X7SL 3IDYC 4N9OB 2XWBB 1KENL 3MJ8B 1J05B 5FV1L 5EU3A 1BF8A 2PYED 5HHVH 3LVEA 3MCKB 4G3YL 3NA9H 4WHYG 2ZJSL 5E2UH 1U8MB 3FONB 2P5WE 4GKSB 3A6CH 1GIGH 5J0BA 5I15H 5MHSD 3H8NA 2Z92B 1TTFA 3UPRA 1OAYH 2GCYB 4G8FA 2HVKB 5C2UB 3QEUB 2E9JA 5LJYH 1HH9B 3QPQC 1NCBL 1ED3A 2CLRB 5H8DA 1KCVL 4Q74A 1YY8A 4TPRH 4Y16D 5E5UB 2X5PA 4HKZB 4OZFA 5FM4A 3JVGC 1MRDH 2QADB 5D7SL 3CLEL 1KIPB 1NANH 3MFGB 4U3XA 4N1CA 4QTIL 1KTLB 1RZIB 4ZO9A 1UADC 2DJSA 4NO0D 4K3EH 1RU9H 2ATKB 1GAFH 4PGBB 1T0MA 4I18A 3PJSB 3X13A 4U6XA 5EO0B 4FQLL 5L2KB 2KDGA 2XQBH 4DUVA 4YFDB 3WIHH 5BS0B 3WV0A 2DQHH 3UTSD 2X4UB 2V7NB 1HYRC 5I66B 1CXEA 5L8KB 1LD9A 4XI5D 3U6RA 1A0QH 4LQFL 1RUKH 3QXWA 3RVUC 1FL5B 4IBLT 3K2UL 4EDXB 3RVVD 4XX1G 5IMMB 1JHTB 3MA9L 1HZHH 1WWAX 2E5EA 4LPCA 5DJ8A 1E4XI 4HWEL 2AEPL 4YGAB 4HUUB 4P9HL 1J0KA 1H3PL 1N6UA 2VLRD 5FFLA 1YEDB 5AZEL 4MD5A 4DGIL 4E5XB 1CD1B 3U36B 4NO5A 2DQTL 3VXRB 5KAQF 1ZHBB 4O58L 4GRMA 2W9EL 5HHXH 4KK5D 5CZVL 5CBEB 3RIAF 4FFWD 4XC1L 1SYSA 1GXEA 3RY5A 2EICA 1IGIL 3H9YA 1O7SA 2X42A 3S3JA 4MS8C 4CVXA 1XZ0B 1NFDE 3HMWL 1YNTA 3EYFA 5LXGL 3Q6GL 1T5XA 1MFAH 5HPMA 3R06B 5SWSE 4D9LH 1QRKA 4ODWB 3TN0C 5ID1A 3DXAD 2UY7A 4JPWL 4ZG1A 3HAEB 3OKEB 4QHNB 4IM8A 2F19H 2W9LA 1EJOH 4HWBA 1FG9C 2WBJC 5E2TH 4P2OB 4YDIL 1BOGA 3IVKA 5TDNA 3GMOB 5CJ5A 3QPXL 5E6ZA 3QIWC 4EQ3A 2C3GA 3FQWB 3ROOA 4UT9H 3ZYJA 2VKXA 3QUYD 4WEBL 4ETYA 1IT9H 3BHBA 4QRPE 4XXCC 3JWDL 5H94B 5GRZA 1EEYA 5HHMD 2WUBL 2V17L 2EH8H 3K0WA 3VG0L 1CVSC 3N50A 3VMOA 4HBCL 1RK0B 2QHRH 5IVNA 1Q9KB 3C5ZC 5F88A 5KVGL 1UXWA 5JW3L 2OL3A 2FJGB 2AK4E 1LO2L 4JRWA 3SO3B 1BM3H 2OQJB 4M7KL 1RUMH 4Q97A 4NC1C 3QG7H 5F7LB 2UZYB 3PNWA 3KYNB 1TIUA 3SY0A 3ZDXF 5J12C 2M26A 2J3SA 1ZVSB 3FT2B 3I75A 5CSZA 4HS3B 3O0RL 4OB5H 4PJDB 2ZKHL 3KXFD 3CDCA 3DTXA 4PJ8C 5DEGB 3GB7B 1AJ7H 1XIWD 2R0ZL 3MV7A 1NMCC 3GSOB 3FAXA 5EORL 4X80L 3WBDA 3LRSA 4PY8J 4OKVA 1WT5A 1IQWL 4PRBB 1MFCH 3VW3H 3OTTA 5I8OH 3CFJA 2EDNA 1F3RB 3GSRB 3QH3A 5KSUA 2YRLA 2GTWA 4QLRA 4PJEB 1DVFD 2VDOH 4HFWA 4QY8A 3ZT6A 5GS0H 4Y2DC 3SJVA 5GGVL 3RTQA 3TYGH 3LN5A 4NCDA 1OD9A 5D7IA 5L2JB 1X6LA 4F7PB 1OT2A 5IWLC 5E2VH 3CXDH 4UINL 4P3DA 4G6FD 3SE3C 2X7LB 1NGWB 2CPCA 4KZEL 3V0VA 5ERWA 1H8NA 4HZAA 4WWKA 3QXVA 1W0WA 2RB8A 3DVGA 5I1LB 4UIMA 2BY3A 1MVFA 3QYCA 5F3BA 1E4KC 4KI5E 1PKQA 4IHOB 4ZAKA 3TM6A 5C08B 3QUKB 1BZ7B 1HEZA 2VDNL 4G80A 2A6IB 2GUOA 2IFFH 2QADC 3LS4H 4HKBA 1N5YH 1QPXA 5HDQH 5ALCL 5KZCD 4K9EL 3HPLB 3HMXH 4M1CC 4X9FA 5B8CB 4PJ7B 4I3GA 3BIKA 4NKQB 2EDEA 4MQ7B 5BXFB 4WENB 3NCJH 4GKZA 3I6LE 1TXKA 3BDYH 2DWDA 4AEIH 4H20L 2F53A 1CCZA 2WV3A 4MZ3A 4YBQC 4M6OL 3MLSH 4X8XA 1WBXA 3L6FA 3VGGA 4PB9H 4HIHB 2P46B 2PTVA 1JPFA 2DDQH 2O5ZL 4XAWL 1CBVH 2H2SD 2NQCA 3NOIA 4OAWB 3EIFA 3TO4B 2X44D 1MF2H 3GSQB 4PJFA 1MIMH 3BZ4A 3ESUF 1PG7L 4BM7A 3ETBF 4PJBB 3QDJE 4RGNE 3FRUA 1J8KA 1HI6A 3UTTE 3D39E 3QDME 2EIEA 1NQBA 4YR6A 1IEBA 1V3LA 3FO2A 5E56A 5FOBA 2A0LD 3H3KA 2WIIB 1QLEH 4Q6IB 1S9VB 4P57A 5EA0H 5ISZA 3OR6A 4JLRB 4M00A 4HPYL 1GGBH 5I73B 5JPMA 1MNUL 5DJ2A 1I8IA 5FHAH 4DFIA 2D7MA 5I76B 3MV9B 1JMZA 5E4EB 1CVRA 1BP3B 4JFFA 4LNRB 1UWGL 2MFNA 2WW8A 1JHKL 4HUWA 1IKFH 4ONGH 1IZJA 4HQQH 3VFUA 4R90L 3QUXD 1LO3L 1SY6H 3ARBA 1UT9A 4NM4H 5CJOL 4R26L 1SBBA 4MD4B 3PDDA 2I9TB 2ICCA 4R4BA 5ADOH 1AO7E 4N0RA 1VFBA 1UVQA 3FKUS 5DD3H 2H6PB 4DUWA 1YYML 1OAZH 4QRTB 1I9EA 2HT3C 1HE7A 4JKWA 4L4VB 4P2OC 1N8ZA 4P5KB 5IR1A 4L4TE 4M7JH 5D2NA 2EDTA 4XGZA 5AAMA 2A6KB 2Y07H 4JGUA 5HHQB 3MXVL 3KYMA 1NLBL 1M71A 4DKAA 5F7YC 4JFOB 1IQDA 5IJVA 1I3RA 1QZ1A 4TUOB 1OSPL 3FOMB 3TVMD 3X3FL 1FV1B 2R4SH 5EIIA 1EEUA 1JPTH 1BD2E 4AZ8A 3BUYA 2YPLD 4BZ2H 3VE0B 1IGFH 3SO3C 5SX5K 1FO0L 1OW0C 4LKXA 2F8OA 6FABH 2RFXA 3SDXF 1MIEL 4YDLB 5C0NC 4OZHB 4XTRD 1KJVA 1P53A 3UCRA 4XPHL 5DI8A 5AD0A 2YEZB 1B90A 4YIQB 5DVOA 4HS6A 2AGJH 4OZFH 5LVEA 4NBXB 3SGJA 3G5VA 4J1UA 5DQ9A 5C71A 1Q0XH 4NQEE 2DTMH 5HPOA 4XPAH 3CLFH 5FF6A 1U92B 4JY6B 1N2RB 3CJJA 1JNNL 3QNXA 1I7UA 3OAYH 5HHVL 5JW4Q 5EG6C 4UDTB 3AY4C 3NA9L 5E2UL 1JFQH 2BSED 3O3DB 1XF5B 1EFXA 4X4ZA 4FQ2L 1T21A 2CDFB 4Z9KB 1CFTA 1OAYL 3TPUB 5DC0A 5JIKA 3C8KA 3QWRA 4NQDB 1RULH 1TZHA 4N8CL 1M7DA 1FNGB 1J5OH 2VLLB 3QXTA 1O5DT 5DVMA 3RVXC 3FB7B 3TO2A 4BQ6A 3HZMA 3B83A 4X6BB 3U2SA 2GITB 1MRDL 2FEDC 1E28A 3O41B 1U8KB 1RFDL 4X9HA 2VRAA 4NQXA 3LKQA 3HHRB 5JXED 3B6SB 4K3EL 4LLQB 3ALXA 3KLAB 2NW3B 1GAFL 2OLDA 4K3HA 1KEGH 3H0TA 3CFDB 5B8CC 4PJCB 3C2AH 3KPOA 1VGKA 1I7ZB 3WIHL 2DQHL 4W4NA 5F7EH 5FEBA 1D9KA 1KBGH 1X44A 4TQEH 2YC1B 4WNQA 4ZFFA 4R0LA 4FQQA 3EYVB 2G75B 1RUKL 5IW1A 1B88A 5KVFH 3OZ9H 5DDHA 4I1NB 1IKNC 2ICES 4L5FH 4HH8A 3TO4C 1HZHL 1IAKA 4PTTA 4HWBH 1IAIH 1YNKH 3ZDYF 1NCUA 1YEHL 3AFLA 4KTEH 5LGHH 4AIXA 4OLWH 4JM2B 5IK3B 3BESR 4NN5B 5KVDL 4Q6IC 5MEPA 5MENA 1YMMA 2DQDH 4GG6F 1NGZB 3V95A 3VFVB 4PRHD 4OFPA 4LCIL 5I73C 2NY3B 2XOTA 3TPKA 5IMOA 1T89A 5DJZA 1X5KA 4D3CH 2EYTB 3QO0A 3V7MA 3JV5A 5E4EC 4QOKB 1IL1B 2FEEL 1DL7H 3DUUB 1SMAA 3L5JA 4KI1A 4I2XA 4ELKA 1QO3B 3EYSH 4X9GA 4NKOB 2OL3H 2YA2A 2GW5A 4J3UA 1FCGA 4G7YH 1LE9B 1VCAA 3K80A 4X6EB 1WJ3A 1UWEH 3U48A 4KK8C 4Z7WE 3VGFA 3ET9F 3ULSA 2BXZA 4JFDB 2DLTA 4XNMA 1U3ZA 4NFBA 3EJYC 1EJOL 2G9HA 4YDVB 5LGJB 3MACL 2PO6A 3Q6FB 2EC8A 4LRIA 4PGCB 2F74B 3C6LA 5EC1A 3MJGX 5E2TL 5F93C 3FCTB 2L7UA 3ZKND 4XC3H 3WN5B 2LV4A 2VXSH 1AGEB 3MGOB 1QHPA 2IBZX 4N0UA 3VCLA 4QTHB 2WUCL 3PV6A 1NSNH 4WHCA 1VPOL 1HDMB 1VFMA 1RZGA 4NSKB 4ZO6A 4Z5RA 5ILTL 4NWTH 4UT9L 1T7XA 1TVHB 1YMHB 2JCCE 3V0WH 1IT9L 5FYJH 4P3WA 1SJHA 4XCNA 3QNYA 4G7VH 5AZ2L 3BP6A 4GOSA 4LPXA 5IB3B 1GZQB 2XNAB 4LP4A 4UNTA 3VRLE 5E9DB 1NBZA 5CEYA 1UH4A 2HVJA 3OG6B 3TWCH 1RUML 1UACH 3HC0B 5C0RH 2ADIB 3QG7L 4OQTA 4Z7UE 4PGEA 3L7EB 1L4IA 3GGWA 4YDLC 5KSBF 2AK1H 4P9HC 3RZCA 3TT1H 1T03H 5E8EB 5E8NA 4OB5L 4Q58C 1QBAA 2Y1VA 5BZDA 1AJ7L 5BRZA 1SYVB 3D48R 4LGPB 1WICA 4QRUA 3O4LA 3BO8A 4RAVB 3GSXB 4F33B 1MFCL 5I1JL 4CU6A 2HJKB 4WI7A 1XGQA 2ADGB 3MV7D 3AU1A 1IGTB 4MAYB 1IBGL 5I1EL 3FHQA 3O3EB 2VDOL 1K8IA 1OARL 4O02H 3TYGL 5L9DH 3P4OA 2AV7A 5J6HB 1NCWH 1NGYB 4I48B 3CXDL 2NTFA 4XP5H 2J5LB 1VADB 2AI0L 1AD0B 1AGDB 2YD2A 5FYJD 3RL1B 3T0WA 1CDHA 3SJVD 3LV3B 4LCWA 1J10A 4LEXH 4KK6C 1IEAA 4ZFGH 4EUPG 4XRCA 3BN3B 4PJHA 1F45A 3DO7A 4XVUD 1AHWB 5GSRA 2ESVD 43C9B 2X4SA 2BY2A 1HYSD 4M7LT 2PYEB 4QRQB 2XPGA 3HZKB 1YEKH 2IFFL 4WWKD 1ZHKB 4LLDA 4XPBH 4PJGA 1YQ2A 3SE4C 3GIVB 4ELME 5HDQL 4TTDD 5KJRH 2XXMB 3M17B 2ATPB 4BKLA 1J1PH 1REIA 5IVXE 3HI1B 5A3ID 3LQZB 4NZTH 1VEPA 2J8UA 2PCPA 4GUPA 4UOW0 5HHOE 1T7VA 2C7UA 1JWUB 3JWDC 4MAUH 5ESAA 4UMGA 3H42L 4P4RA 3G6AB 1UA6H 3BDYL 3PHOA 3QXDB 4AEIL 4GAJH 3P9WB 4O51B 3VFGH 4JCMA 4LCYB 4LSPL 4Y16B 1R3HB 2DDQL 4P2QB 1RK1A 4E42A 3MSPA 5DJ6A 1FCCA 3IU4H 1MF2L 3DVFA 1LK3H 2X10A 4DCQA 1NFDF 1P69B 1S7QB 1KG0A 5CCKH 1OB1A 1RZ8A 1M7IB 2CR3A 2QQKL 4JM2C 3UJTL 2AQ3A 1A2YB 4N90E 3UTSB 3G5XB 4NN5C 4HKJA 3GSNH 4XXDB 5FKAA 3MRIA 1GGBL 1I8KB 3EO0A 3WHE0 1YUHA 4LLMB 1I1RA 1DBMH 2DIAA 4WTWA 2NY3C 5FHAL 1S8DA 4WCYH 2LVCA 5DTFB 4Y19A 1UH3A 5T1DL 3HCVA 2PTTB 1XCTA 3AS2A 2X4NB 4NNXB 1GZPA 5EPMA 1OT1A 3X11B 5IW6A 4ONGL 4DJMA 4HQQL 1YEIL 2JELH 5HYFA 1A4JA 3GMMA 1SY6L 3MXWL 3QZWA 4JFFD 2CXGA 3D0LA 5I1IL 3OB8A 1CFSA 2EKJA 3C08L 2QSCH 3B9AA 4HG4K 4XBEH 4KRLB 2HTKD 5ADOL 3OAUH 3DYPA 1MWAA 4X6DA 3ULUF 5DD3L 1AR1D 1DTUA 3GJFA 2R2EA 2OS7A 3QWOB 2Q87A 3KYOB 4G6AD 3FFCA 5GIRA 3UYPA 5E8OA 1BIHA 3A6BH 4M7JL 3QT2A 1CDCA 3WN5C 2ARJA 2QTEA 5CD5C 4K9EC 4HIIA 5AYQA 1FBIH 1Z9SA 2O61B 2BHZA 2Q86A 3DXAB 3IFNH 3SN6N 2W1NA 4YHZL 4ZPVA 5EOTB 2GJ6A 4ZPTA 3KLDA 1B6DA 1MCPL 5EUOF 5IJKC 4FN0A 1MJUH 4YNYB 1JPTL 3FO1B 4HJ0D 1P84J 3REWA 4BZ2L 1IGFL 4EI5A 3C6SB 5JHDE 1TNNA 4FFVC 5I1DA 3RKDC 1FZKA 2XZCL 2Q6WA 1NAKH 6FABL 5DC4B 1RUQH 1TZGL 1CLOL 4YHPB 3N1GC 2NXYD 4K8RH 5L88H 2VZUA 2AGJL 4YZFE 3SDDA 1TJGH 2I25N 2XKNB 1C7TA 2AJZA 5HHMB 1G9EA 4AK1A 3QJHB 3O3BA 1CXHA 1G7IA 3TNMB 5CEXB 4YGVA 1K9TA 1Q0XL 4TVPL 4Q6YA 4ODTH 2DTML 5FYLH 3CLFL 1VFAA 2P5EA 4MAYC 4BH7B 5E1AB 5HHNA 1IARB 5H2BA 1MY5A 3TBTB 4WUUE 3BMWA 1JFQL 5D71H 1A1NB 3DETC 3FQRB 3BPOB 3NCYP 3I6KB 1MEXH 3WIIH 4XH2B 3KXFB 2J5LC 1BF2A 1XIWB 5KOMC 3O8XA 1J5OL 3L3OA 1EFXD 2DLIA 4RMTA 1J11A 4MJ5B 2B0SL 2A6JB 1N59A 2ZNWA 3SOBH 3TT3H 1AHWC 5I0ZA 5KBNC 3Q5YA 4FXKB 3U0PB 3WMSA 3RGVD 4I3SH 4U6YA 4K8RD 1KGCE 2EDYA 2Y5TA 5E2WL 4JM4H 5I9QB 2JB6B 2M2DA 2VABB 3PWUA 1KEGL 4OUOA 4NHUA 1E27A 4KUZH 4G6FB 3QFJE 1LEKA 1KPRA 3C2AL 3TIEA 4O2CA 4FQJH 4NQSB 2MCG1 1NDMB 3QHZH 5EU5A 3L3DB 1ND0A 3EOBA 1KBGL 1P9MC 3CFBA 5FYLD 5JPNB 4B7IA 4CN6A 3RDTB 2WSKA 3ISWA 2BMKB 3Q3GA 4KDWA 4FQHB 5HJ3A 5CIPA 5E94A 5T1KA 5D7JA 5DJDA 5F8RC 1KULA 4J23A 4Y16C 5KVFL 3OZ9L 2EDFA 4F7EB 1OAKH 1EZVX 4L5FL 4PJIB 1ORSA 1TNMA 5D7LE 3E3QC 2AKRB 4HWBL 1YNKL 4Y4FA 2ARWA 2YD6A 4M3JA 3G08A 3SGKA 4OV5B 1VKXA 4KTEL 1FYTB 5LGHL 4OLWL 2HRPH 1NMBH 4GW5B 3BX7C 4ZO8A 3B43A 1DQQB 2HLAA 3JZ7A 2F54A 5I1AA 4XB8A 3NPSB 4NT6B 1WZLA 2DQDL 1M6OB 1U9KA 2I9LB 1F8TH 1QQDA 1UJ3A 4XI5C 4ZDHA 4D3CL 2BRRH 2ENYA 3P9LB 1YMMD 1DL7L 3MLZH 1AE6H 3EYSL 3RVVC 2OL3L 2CKNA 4P5MA 1JWMA 5TDPB 1QUNA 3WJLA 4G7YL 1XR8A 3DVNB 5JOPD 2D31B 1UWEL 4B53A 4P46A 1NGXA 3ZDZF 3OAZH 4OQTH 4QGYA 5B4MC 3RWFA 1CF8H 3G04A 1AGBA 4FQ1H 5ANME 3D18A 2DOCA 4KK5C 1PY9A 4EN3A 1RIHH 4U1JA 4WEMB 2JIXB 1VACB 3N1MC 4FFWC 1NUNB 2FYYB 2UYLB 4XC3L 2V9TA 2VXSL 1A3LH 1UKTA 4R7DA 2MKWA 2ICWA 1DBBH 1ZLUH 3KPRA 1NSNL 3QULB 2PO6D 4MQXC 4WY7H 3BH8A 4DKFH 5GJSL 3BEVB 1T0NA 3KGRA 4NWTL 1NJ9A 43CAB 3U46A 1DLHA 3S96B 3QUXB 3V0WL 5FYJL 2IH3A 4G7VL 2CUMA 1RZ7H 3HUJE 5HVFB 1P5VA 4QO1A 3MLUH 4YQXH 5JMOC 4H26B 3MODH 4IDLA 5HHPA 4YO0A 1UACL 5C0RL 4UQ2A 1VENA 5CEZH 5FO9B 4EVNA 5TGBA 2F9BT 2VSCA 4NJAH 3N1PC 4P4KB 3T3PF 5H37G 5MEOA 2VLJB 4JY4A 5ICYA 1S7WB 1CG9A 4U6VH 2AK1L 1A6ZA 3TT1L 5C09B 3INUH 2PXYA 3VH8B 1BJ8A 3FOLA 1T3FA 4L3EB 5GXBB 3MNVA 5HDBF 5KW9H 4NBZB 2AJXH 1JUFA 5B3NA 5E95B 2C1OA 1KPVB 2CGRL 2NPLX 2AV1B 3TVMB 1G7MA 5D5MF 2EDLA 1MRCH 3HI5H 2D4DA 4Z8FH 3AUVA 3X12B 4V1DE 5BRZD 4IRSA 2XXCB 4PLKC 3O4LD 2IGFL 4O4YH 4ORZC 5DMIL 5C0CB 2VLMD 4U49A 5F71A 5TE6H 2MHAB 1F6LL 4O02L 1LE5A 4NZUL 1TCRA 2Y5EA 5L9DL 5LKNA 4LSVH 1NCWL 1LO5A 2NX5B 1TZIB 3FTGA 1BGXL 1RHHA 2H32B 2C4XA 4DZ8B 4XP5L 4NYLB 4GMSH 1GGIL 4LEXL 3LKSB 2RQ8A 1FG2B 1Q94A 3TBYB 4KTYA 4ZFGL 1MFEH 1YZZA 1KCLA 1XIWC 5HGBA 1I7TA 4HJGA 1I7RB 1JZ8A 2JB5H 1KLGB 5CEZD 4C56D 3DGGA 3FB5A 4Y4HD 2HN7A 4GRWB 1YDPA 4U2YA 1N5AA 3V5DA 4XAKE 5KJRL 2J88H 2P48B 1RURH 5EU3B 2I5YL 4KKAC 2ZCHH 2A83A 1T1XA 3U79A 5C7XL 4UIKH 5I9QC 4NZTL 3RWJA 5HYJA 5DK2A 4MAUL 3W82A 5IV2A 1H3XA 1UA6L 4GAJL 3UPRB 5DJYA 1A22B 3BXNA 4J4PD 5CP7A 5IHUH 3RDTC 3UAJD 4G8FB 3K4ZA 2VLKE 3IB4A 2HT4C 3IU4L 1ED3B 4ZSOA 1LK3L 2ZCKH 3B3IA 3W5MA 4PP2A 2OJZL 3QRFM 4AEFA 5F1OB 4KQ4H 2V2WA 4NHCH 5CCKL 4OZFB 1H8OA 1I1CA 3GJFH 3JV0A 3TP4A 1MHEA 2MQCA 3BT2H 4PG2A 2ILLA 3NPSC 1T0MB 4I18B 5T3ZE 1KB5A 5EN2A 5SWZA 1PLGH 5FYJU 5LBSL 4FQPA 2FGZA 4U0RB 2YD5A 4L8BB 2J7LA 4XNXL 4WCYL 2H2SC 2AXJA 5EU4A 3KHQA 3CVIL 1LD9B 2CRYA 4POUB 1UZ6E 3U6RB 1D5ZA 2JELL 1ZS8A 2VDRH 2APXA 4JFEE 1CT8B 4MDIA 4Y19D 1F3JA 4H0IA 5DJ8B 2XKSA 4XBEL 5IF0A 3MRFA 3V0AC 2W0LA 4NC1E 1JYWA 2MTPA 5F1IB 5DHVB 3VRLF 4MD5B 4XB7A 4M3KB 3BYTA 4NO5B 4KMLB 4WUKH 3UTPD 3A6BL 3EOAA 4GRMB 2W60A 3UBXI 1T7ZA 2JK5A 1FE8H 2XN9D 3B2UD 3O6FA 1SYSB 1FBIL 4XVTH 3RWIB 5K93A 4NNPH 1RQ5A 4XVSH 5E5RB 5C9JA 1Z0MA 1CTNA 3QUXC 5IB2A 3IFNL 4CVXB 1I9RH 2O93L 3EYFB 5EBWB 1INEH 3O6LH 2QQQA 1T5XB 4I0KA 4CDGC 5HPMB 1QFWH 1NMAL 4M1GH 3LEYH 3F58H 3MUJA 5J57B 1RZFL 3CSYA 4JRXA 2NY6D 1NLDH 5ID1B 2X4TA 2GJ6D 1PAMA 3AXLA 3HA0A 4OLUL 4QHUA 5SWQA 4FFYH 3SGEI 4KRNA 3ZKMC 5IB5A 1NAKL 4OTXH 1OGAB 1RUQL 3VFWA 4P4KC 3MFFA 3RX8A 2APBA 4K8RL 3PIQA 4EI5D 5I17B 5GRWA 1XGUB 2E27H 1TJGL 1N7ML 3BVNA 2Y7QA 3IVKB 5TDNB 4R9HA 12E8H 1RZKH 4ZUWA 4V2BA 3T0ED 1MLCA 4D0BA 3TVMC 4ODTL 1FFNA 4HW6A 5FYLL 3ROOB 5C0BA 4M93B 3TJHD 3BHBB 2ID5A 2M8XA 2P49B 4XMKH 3WS6A 5D1QA 1EEYB 3N1FC 2F8VA 5J4MA 2GJZA 4WW2F 2MWCA 1OOAA 5F88B 2X70A 3STZA 1UXWB 3SKJL 2OL3B 3WXVH 4M9OA 2MQ0A 3UTQA 5HYSG 5L2KE 4HXBH 2P5ED 5J1AA 1BZQK 1MEXL 5CIPH 3BPCA 3WIIL 2R1WA 4KH2A 1IM9A 3PNWB 3SDXA 1KXQE 1JI2A 3SY0B 5HYQA 3PWVA 4PY7A 5T1LB 5D72L 1XF3A 1HIMH 3I75B 5CSZB 3S37X 2CRIA 1W0VA 2X1PA 3SOBL 3IAQA 3DTXB 4TRPH 2VQ1B 3MV7B 1FIEA 1QSZA 5K33A 3G5ZA 3FQNA 3LRSB 1BFSA 1FHGA 3HNVL 4I3SL 3CFJB 3QH3B 3NCCB 2YXFA 5KSUB 2GTWB 2J6EA 4JM4L 5TDOA 5T3XE 3VXRE 3UYRH 4KUZL 4XP4H 3KR3L 4QY8B 4HFWB 4ZUTA 1AR2A 1CXKA 3SJVB 4AJ0A 3RTQB 3LN5B 4FQJL 1BZ9A 3KPTA 3QHZL 5D7IB 3BKCH 5GGSY 4F7TA 4OBRA 3BPLB 3V0VB 2AABL 2EKSA 5ERWB 3EO1B 3MJ9A 3QSKB 5SX4I 3P4MA 1W0WB 3DVGB 4S1QH 1T1WA 1LWRA 5D2LF 1T1YB 2EO1A 5F3BB 3S5LG 4OKDA 4ZAKB 1ZSDA 3WFEH 3OKMA 3WNLA 5T1KD 5D7JD 1HEZB 4PY8I 2GUOB 5GRXG 3BWUC 4M5ZH 3A67H 2HRPL 3BW9A 3MROA 1KUMA 2KZ1B 3VWJA 4Y8DC 4KWUA 1VEMA 3F62A 4DGYL 4YEEA 2DI7A 4I18C 1WVZA 2HMIC 3BIKB 1G6RH 3D9AH 2F54D 4POZD 5MP6H 4GKZB 2DWDB 4U0RC 1FRGH 2F53B 5EU6A 3MLZL 4PIRF 1AE6L 2XA8H 1WBXB 3L6FB 5A2LH 4KK9D 1FYHB 2EZ0C 1A6UL 3ZYOA 1JPFB 3MBEA 5D93B 1SMOA 1TQCB 1MOEA 4PJFB 4OQTL 3BZ4B 4IOIA 3K1DA 2OP4L 1DEEA 1CF8L 4LHUB 3FRUB 1HI6B 2I24N 3BKML 3HG1D 1Y6MR 4YR6B 1TFHA 1IEBB 1RIHL 3QISA 4P46D 3FO2B 1LO4H 2ORBL 1GOGA 5FOBB 1QBMH 5F6IB 1FAIH 1AD9B 4X4YB 4P57B 5ISZB 3OR6B 1A3LL 4GG6A 2DD8H 4PJDE 5JPMB 4LASH 2AJUL 3M8OL 4EN3D 4DKFL 2NY1B 1T20A 2IG2H 2P42B 1I8IB 5J7CC 2JJVA 1S9KC 1DANU 1RZ7L 4NQCA 3OJVC 4LIQE 2EE6A 4HUWB 5IM7A 1YEJL 3MLUL 4YQXL 4JVUA 1IILE 3VFUB 4PJEE 5F70A 4IOFC 3ARBB 2Q1EA 1QRNE 3UTOA 2FJHA 5CEZL 1YEFH 4R4BB 5I1CH 5HD8C 1I3GL 1VFBB 1UVQB 1NKRA 2BK8A 1WFUA 3MRCB 2BERA 3I02A 3INUL 2A9MH 4J3TA 4U7KA 4X5XB 1CGSH 1N8ZB 1A21A 5GPRA 5IR1B 5AYUL 5DJCA 4PGDB 5D2NB 3SQBA 3MCG1 5KW9L 2AJXL 4HHAA 4WFEE 1SVZA 3D2UA 1FJ1B 5C08E 3O2WH 3KYMB 4FMFA 4JO1H 4OGXH 2PXYD 4PD4J 2W9DL 3HI5L 1MRCL 2MQ3A 2MNUA 2PYFA 1ODAA 1M71B 2OX5A 1KIUA 4M93C 1IQDB 3B9DA 1I3RB 5FAAA 4O4YL 2VZ1A 5IJVB 1RAMA 5IBUG 1Z3GH 1MAMH 2D03H 3GI8H 1EGJA 1KYOJ 4JO3L 4LSVL 5EIIB 2C3XA 2HFEA 3V6FA 2WMPA 3OAYK 1ETZA 3BUYB 5HI3C 5KVEH 4PJ7E 3VXOA 2NXYB 3IJYA 1EPFA 4PV8B 4GMSL 3HLAA 3I9GL 4LKXB 3I50H 4KKLD 1MFEL 4KVNH 1KJVB 5KSBA 3S97C 1K5NA 5EUKB 5DI8B 4QXGH 3S37H 2NCMA 4HS6B 2JB5L 5FUCC 3VWKD 2FLRT 3FT3A 5HYEA 1XMWA 5IFJA 3G5VB 3FN3A 5IEKA 5DQ9B 4PJBE 3KLSA 4RFEA 1PYWB 1WT5C 3T65A 1ZEAH 4ORGA 1DQTA 1RURL 2BNRD 3O2VH 1AQKL 3QDGA 5FF6B 4HUMB 2ZCHL 3RPKA 3QNXB 1I7UB 4UIKL 1MCRA 3N0PB 1HCVA 1BBJA 1KTRL 4KAQL 3D87B 3K4AA 3RTQC 1EFXB 1T21B 2F58L 4DN4H 3FQTA 1LILA 4XVUC 5ETUA 1CFTB 5IHUL 3MV9E 3C8KB 3BPLC 5HYJD 2X89A 5E2JA 1TZHB 1HKFA 1M7DB 1E0OB 1QSFB 5E4IA 3T2OA 4PJAF 3TO2B 1JRHI 5JDSA 4JZOA 2NY5H 2ZCKL 3HZMB 1MWAL 3E2HB 3P11H 4XWOC 3U2SB 5FHBH 1PDKA 4KQ4L 4NHCL 4TTDC 1BFVL 1PVHA 4ZAKC 1L6ZA 4Z7NE 1E28B 4JO2H 4FP8H 1MHPH 1T4KB 3BT2L 4PJ5A 3QQ9D 2VR9A 1Y6KR 3QA3A 4L4VE 1AFVH 3H0TB 2CH8A 1QACA 2CK0L 3G6DL 3BRGC 3KPOB 1VGKB 3WL9A 5CZXC 4NCC2 1D9KB 1CR9H 1Z5LB 2HFGL 2MCPH 4WNQB 5C0AA 2YMXH 4W6YB 4R0LB 4FQQB 3RX7A 4ZOAA 2KPNA 4NZJA 4XPTH 3L5WA 3BPNB 4EUPA 2VDRL 5DDHB 5D93C 4PRIA 1TQCC 1NFDA 4RCAA 4Y5VA 5A2IH 2ICWI 4PTTB 1KACB 4WFFE 5KANI 3QEQD 4N5ED 5HI5C 3SGDH 1PKOA 3U9UA 2Z8SA 4NQTA 5JZ7C 4KGLA 1G1CA 1QD0A 4OZHE 2PNDA 4WUKL 2WAHA 5F6IC 5MENB 2R4RL 3B5GA 4M4PA 1YMMB 4WTZG 5CD3A 4K94C 2WANA 5L0QB 3GI9H 5T5FL 5IMOB 2NY1C 5DJZB 4XVTL 4M6ML 4FTVA 3QO0B 4NNPL 1JL8A 4D9RE 5I75B 2OTUA 1I9RL 1UC6A 4I2XB 4ELKB 3TNNA 2XQYK 3O6FD 4JAMA 2DQGH 5J56B 3PWPA 3LZFH 1INEL 3O6LL 1TENA 1QFWL 4MXVE 1SQ2N 3F58L 5D7KD 1ITCA 4JPKH 1AR1C 3ARBC 3WFDH 4YBHA 4TTGA 3MGAA 4ZNEE 5DVLA 1GRWA 4J3WA 3LS5H 2H2PD 4KHXH 3ULSB 5BQ7A 4OTXL 2B20A 4AH2B 4XNMB 3IU3A 5DC9B 2PO6B 1UCBH 4UU9A 3C6LB 1C16A 1Z6JT 5EC1B 1JGEA 3BJ91 4B41A 5JW5A 1JPST 2E27L 4RA3A 1BQHG 2BVQB 3MRMA 12E8L 3W0WD 1EH9A 3OWEA 3F7YA 4AY0A 3H9SA 3MRRB 1IAMA 5D2NC 5IVOA 1RZGB 5ITFA 3EGSA 4Z5RB 2FH8A 1T2QH 2PN5A 2IC2A 4XMKL 5DYOA 1E4WL 4HJ0C 1SJHB 4XCNB 2H3NA 3QNYB 5EOQH 3BP6B 4POYA 5EUOA 3WXVL 1KT2A 1J1XH 1NBZB 3DLQR 4HXBL 4PJCE 2HVJB 5D1QD 5CEYB 5FYKE 2YA0A 4O2FA 1IGML 2NXYC 1G9MC 3QCUH 2PW1A 4PGEB 3ME0A 1WCBA 5TF1H 1A5FH 5C0IA 1HIML 3GGWB 4XZUA 3RZCB 4GXVH 3CFIC 1KB9K 5E8NB 1IM9D 4TRPL 4X6FA 5BZDB 1SVCP 4Y5YB 3U9PH 4QRUB 3O4LB 3BO8B 1U91B 4BH8B 2BNQB 1XEDA 2M1KA 3P0VH 1XGQB 3AU1B 1J86A 4F15B 5F7DA 1JF1A 3SKUD 3BN9C 1T7YA 2D0HA 3P0YL 1ZHNB 4XP4L 1LQSR 1LDSA 1K8IB 4OCSH 3NMEA 5TE7L 4W6WB 3P4OB 2AV7B 5HGDA 1Q1JL 2OR8A 3BKCL 4DN3H 4HK0A 4KY1H 1AC0A 2E7CA 3LEVL 1R5WA 1I9JH 4OFIA 1CDIA 3VI4F 2CLVA 4MNQD 4QOKE 4LCWB 1PQZB 1RJLA 3UDWC 5I0DA 1IEAB 2ED9A 4WU7A 2HLFD 4PJHB 1J0HA 1RVFH 4LSDA 3DO7B 1ZA6A 5KN5A 5DD6A 5C0GA 1HQ4B 5GSRB 4S1QL 4HK3N 4DGVH 1XF4A 1AY1H 2DBJA 3WFEL 4OZ4A 4RWYH 5C6TH 2DBLH 3E2HC 1QNZH 2XPGB 2OM5A 5IQ9A 4B5EA 4LLDB 4M5ZL 3A67L 5D9SA 5FO8A 2W59A 3MV8D 4PJGB 1FPTH 4CNIA 1QG3A 5C86A 1CE6A 2QSVA 4BKLB 5IROA 4GH7B 2E9WA 2J8UB 4GUPB 5EU7C 4IDJL 2C7UB 3RY6A 1UENA 3SCMA 2JTDA 5ESAB 3IJSA 3NCMA 4P4RB 5LAXA 3PHOB 1D9KC 1FRGL 3FT4A 1ADQH 4ZUSA 4R0LC 4UZGA 3CXHK 3MRJB 4GFTB 4JO4H 3ILQD 1RK1B 3BPNC 4JDVA 5DJ6B 4MA8H 1UWXH 4CUCA 2DQIH 3DVIA 3KPSB 2DWEA 1YN6A 4JQXA 4JN1L 4DCQB 3LY6A 3T3ME 1U8HA 2YK1L 5E9DE 1KG0B 2HJLA 2E9IA 2OR9H 1OAXH 3MBED 1UCTA 1OB1B 1RZ8B 4JY5H 1QBML 2AXGA 3BP4A 4WFGE 1FAIL 1CFNA 4MJID 1OAUH 3WO4B 3OJ2C 4HKJB 3H7BA 3PQYA 2DD8L 5FKAB 3MRIB 4CRPA 1MCSA 4K23L 3THML 3EO0B 3WNNA 1YUHB 4LASL 1KJ3H 1GH7A 1E6OH 2IG2L 4Z7VF 5L0QC 4KTDH 1S8DB 4G6MH 4J3SA 4ACPA 1FNSH 1KN2L 1T7WA 4PP1C 5I75C 3HCVB 4S10A 1EGJH 2VXQH 1XCTB 3CCHB 3HNSH 1GZPB 5EPMB 1P7KA 5IW6B 2GFBA 1C5DA 1A4JB 3GMMB 2NZ9D 3QZWB 2YD1A 5GQBA 1G84A 1JCKA 1CFSB 4NQCD 1YEFL 4KZDH 5I1CL 3MRQA 2BVYA 4JEGB 1MWAB 4X6DB 1BD2A 2BX5A 3DV6A 3GJFB 2R2EB 2PO6C 4LRIC 1MAKA 1CDBA 3C6LC 3FFCB 1A14L 3EYQD 1CGSL 5GIRB 1G7HB 4HLZG 1FIGH 2ARJB 4HIIB 3O2WL 2FECI 4JO1L 2PYEE 4PRAA 4JKPH 2R1YA 3LPWA 3O9WA 4AL8H 2ZOLB 2Q86B 2NY6B 2YWZA 4BQ8A 5I2IA 4JN2B 3D2UD 4Q7DA 3PV7A 4ZPTB 1MAML 2Y06H 2D03L 3QP3A 2AJ3B 3TZVA 1RY7B 3REWB 4HWZB 4ZQKA 4EI5B 5I1DB 3MREA 2BVPA 4MB3A 1IGCL 1FZKB 2Q6WB 5CFHA 4KVNL 1P7QA 4QXGL 5J11B 4P2QE 3RZCC 3FQXA 3SDDB 2P5WD 2AJZB 1S5IH 2APWA 4Y5YC 1UG9A 4EOWL 1RIVL 4EBQL 5BJTA 5D5MA 4YGVB 1ZEAL 4I0CC 3UO1L 5CKGA 3V6OA 1J9CT 1VFAB 4WJ5A 1KB5L 4ERSH 2P5EB 3PXJA 4MLSA 5HHNB 4F15C 2I07A 3UTSE 1JP5A 2V5SA 3DGCR 3MX0A 4LLVA 1DN0A 5GGTA 4QHLA 4OUUA 4DN4L 4ENEC 1OY3B 1DUYA 4EUPH 4MA7H 1CU4H 3O8XB 3L3OB 1B3JA 4KRPD 1QFUH 1WUNT 2HFTA 5HSFA 3LOWA 5DA4A 5ESVA 5C8JA 4H88L 2X89D 4D8PA 1YEGH 3P11L 3SKOA 5FHBL 4QT5A 2VAAA 3CAFA 2EE9A 4NUGH 4JO2L 1MHPL 2FBJL 1DDHA 3EDEA 4U6YB 4HJJH 2H9GA 2VTFA 1FZJA 4U1HA 3PWUB 5C9KA 5DQJB 3JTSA 1WIUA 1AFVL 1KPUA 3VXTA 3QCVH 1E27B 2VN4A 4N8PA 5IMKA 1LEKB 3HE6D 3IDNA 4N9GA 1KPRB 1ZHLB 2NYYD 3TIEB 4Z7QE 1NCAL 4O2CB 2XQYG 1OTUD 5EU5B 1ND0B 1P6AB 1CR9L 1CFBA 4JVPA 3CFBB 2YMXL 1OVZA 4LDOB 4OI9A 4I9WE 5DGRA 1X5FA 2CKBA 3Q3GB 4XPTL 5HJ3B 5HGHB 3DXAE 4QXTA 4TSAH 5D7JB 5E94B 5T1KB 1KFAH 5J3HC 2HRLA 4LSQH 4OT1H 2V5MA 2Z91A 4JQIH 1KSRA 3TIDB 2CLZB 1UB6A 3ULUH 4ZD3L 1JF6A 4Y4FB 3CZFA 1CD8A 2HWZH 4GBXD 3G08B 1S78C 1M05A 1VKXB 3DWTA 4R3SA 5K9KA 5CAYB 3EHBD 2HLAB 4M48L 5I1AB 2F54B 1SEBA 3VXUA 3W9EA 2YPVL 3WO4C 1INDL 3L7FA 5BOPA 2E7BA 1UJ3B 1QQDB 3O4OB 3GI9L 3WFHA 2C3HA 5FA4B 4ZDHB 1J1OH 5HHME 3QDAA 2X1OA 3MO1A 4LARH 5GRVK 1ZLUK 4FHBD 1X5XA 4L4JA 5DJXA 2Z35A 2C3VA 5JIPA 3L3KA 3LZFL 4GRLA 4P5MB 1JWMB 3UJJH 4CGTA 1DE4A 4MZ2A 1XR8B 4BSWA 1GYAA 5AG9A 4P46B 1NGXB 3WFDL 5F9OH 1ZT1A 3PP3H 2FB4H 5DRNA 4ODHH 3RWFB 3PWPD 1Q9LA 2PW2A 2ZOKB 1N0LA 5HXMA 3G04B 1AGBB 1U8QA 3O3AA 3D18B 4X4ME 1V3JA 3PL6A 3KXFE 4Z78B 4EN3B 4U1JB 1II4E 2FATH 1XGTA 3B2UC 3CX5J 2ADJA 2EECA 4JG0H 3PHQB 4R7DB 3ULUD 3OKNA 2ICWB 3KPRB 3E6HA 5JTWA 3BH8B 2DQEH 1T0NB 1QBLH 4D94A 1NJ9B 1DLHB 1T2QL 2J6EL 4GXUM 2RIKA 4JZJA 4OZGF 1MH5A 3H9SD 2IH3B 8FABA 4LLWA 2NY6C 2P8PA 5EOQL 1DBAH 1T22A 5C0JA 2FZ3A 5EBGA 4F8QA 4UV7H 1A02N 3MRNB 1J1XL 3PWJA 5HHPB 1CS6A 3HN3A 4YO0B 3BKYH 1CL7I 4UQ2B 4EI5C 4D0CA 2BJMH 4EVNB 5TGBB 5E99H 3MJ9L 1FFPA 5DFVD 5MEOB 4JY4B 5ICYB 1CG9B 1GGTA 1A6ZB 2IMMA 4GXVL 1YPZF 3ZHLA 2PXYB 4NKDA 5J11C 4JKMA 3FOLB 3S4SG 5CP3H 1T3FB 3SDDC 1I8LA 3M1BA 3MNVB 3LPGA 5IFHH 3U9PL 4PJIE 4HIEA 3TJHC 2C1OB 4OD2A 2H26A 2R69H 4U33A 1G7MB 3GK8H 3GSUA 4FABH 4FG6C 1BVKA 4WIQA 4N0CD 3AM8A 1FYTE 4RMWA 5DMGC 4IRSB 2UWEF 4MJ4A 1MPAH 4KXZH 3B9KA 2DKUA 5EB9A 3P4NA 3NPZB 4WW2A 5ALBH 2J4WH 1LE5B 1TCRB 1VGEH 4ELMA 3MV11 1LO5B 1ZLWH 5F7MC 1A3RL 3FTGB 1RHHB 4KROB 4KY1L 5GISH 1ZANH 1I9JL 4CAGA 5ID0A 1NBVH 4UNUA 1Q94B 1UB5A 3O8XC 5HGBB 3OXRA 3O45B 4LSSL 1I7TB 1RVFL 4HJGB 4NP4L 4OLXH 4OV6F 1RHFA 4F7MA 1B4JH 4DGVL 3OG4B 1AY1L 5F7FA 2XTLA 4RWYL 5C6TL 1F58L 1C08B 2DBLL 2Q3ZA 3DGGB 3FB5B 1QNZL 2HN7B 2APVA 4R8WH 4EXKA 1YDPB 1NC4A 2AQ1A 3WKMH 1N5AB 3V5DB 5D70L 4RAUA 2BC4A 2QBWA 2R9HD 3PHSA 1B2WH 2A83B 4M61A 4DAGL 1TMCB 3RWJB 5HYJB 5DK2B 4YHKH 4PRPB 1W0YT 4HPOL 1UFUA 1MCJA 5IV2B 2ED8A 4YHNA 2ZPKH 5DJYB 1ADQL 3BXNB 5CP7B 3D39D 4ZFOA 5BMFH 3SCMD 4APQA 4UT6L 1BEYH 2MSPA 4JO4L 4PJXF 1QFPA 4MA8L 3ZL4L 3SPVB 3LHPH 4U0QB 2DQIL 4U2ZA 3KDMA 4ZSOB 3TBVA 3B3IB 5D2LA 3PG2A 1X7QA 4PP2B 2ZUQB 1I8MA 3SDCD 4D0DA 2V2WB 4HD9A 2OR9L 4KPHH 3BUTA 4K7PH 3VXSA 4L29A 2F5BH 1MHEB 4Y4FC 3MYJA 4JY5L 3SGKC 2VLJE 1MCKA 1OAUL 3SE9H 2YRZA 1CLZH 5C09E 1NFIA 4CVUA 4POZC 1FN4A 4ONFH 1KB5B 5EN2B 1KJ3L 1UM6H 4L3EE 3TCXA 1E6OL 3V4UL 1NGPH 4N8VG 5SWZB 5HBBA 1UJ3C 3O4OC 1WAAF 4MSWA 3G9AB 4G6ML 3H9HA 2BVOB 1FNSL 3PQYD 1EAJA 1I3VA 5EU4B 5HY9B 3GBML 1EGJL 1OM3H 3MRLA 1JGLH 1D5ZB 1YNLH 1ZS8B 1NUFA 5C0CE 3CC5A 3WJLC 4MDIB 5DMJB 1KELH 4MLIA 4P46C 3S5LA 3DYOA 2NX5E 3C8DA 4KZDL 4JFQA 5IF0B 1A6TA 3MRFB 4MVBD 2YRPA 4KVCL 4OD3H 2VXVL 2XY2A 2VDKH 5LCVH 1D6VH 2G60L 4EN3C 5JHDA 1Y6NR 3EOAB 2FX7H 4ZOCA 4OCXH 1FIGL 2JK5B 1BD2D 3L3JA 4FQIH 3O6FB 1HKLL 3P2TA 2EDBA 3N9GH 3W9DB 3MRPA 4GRWE 4AL8L 3LEXB 4AG4H 3TA3A 5C9JB 1C7SA 5IB2B 3VXMB 2GY5A 2VDMH 3DROA 4OCRH 5GGTH 2Y06L 4KMTL 4ALAL 3VG9B 1FP5A 1BVLA 3FRPG 5E6ID 4ESKA 3CSYB 4JRXB 5I1KH 3QXUA 3WCYA 1ZT4A 3AXLB 4QHUB 5IB5B 5SWQB 4WUUA 4F7CA 3TCLA 3I3BA 4NQED 4OCMC 3NZHH 1CIDA 1F11A 4M5YH 3VFWB 1GPOH 1IC5H 3MFFB 3PIQB 3NFPA 4NO0A 4G9FA 4WHTA 2LE9A 3PDOA 3SDAD 2ZCLL 2PXYC 3BVNB 3WLWD 2Y7QB 4G5ZH 4MCZB 1EVUA 1FGVL 1S5IL 2BFVH 4U1IA 4GXUN 1P7QD 4LKCB 4C59B 3DARA 1MLCB 4D0BB 5GGVY 1FFNB 5FECA 2Q7YA 2IPUG 4HSQA 5C0BB 1J8HA 5D1QB 5KOVC 4IRSC 4ODSH 4D9QE 4K55A 2GJZB 4TVPE 4M1DH 5J1SC 5DURB 1TLKA 2UUDH 3QUMH 1PGRB 2X70B 3NFSL 1KCRH 3STZB 3UTQB 4FFZL 5J1AB 2PETA 2CKBH 4KROC 1ERNA 3BPCB 3MZGB 3QFJA 2R1WB 1IM9B 4MA7L 3LD8B 2VLRA 3SDXB 3PWVB 1QFUL 1XF3B 5B3JE 4Q9QH 4DOHB 1JK8A 2H8PA 1W0VB 3HTLX 2P1YA 5M7QA 1NBYA 4G9DA 4G8IA 3FQUA 1SM3H 2P24A 3G5ZB 4NUGL 5TQ2H 1H15A 3FQNB 4JZNA 1HQRA 4H8WL 4HJJL 1FLTX 4OD1L 4U7MA 1PBYA 3TC9A 3ILPB 1YYLH 4GMTL 5CBAA 5TDOB 3V8CA 1S9XA 5DA0B 3FL7A 3QCVL 2WLYA 5I16A 4ZUTB 1UKSA 4MDJA 1TQBB 1BZ9B 1B6UA 1CE1H 2AEIT 2EXYD 5F89A 2ITCA 3ZE0E 2E7LA 4TSAL 4ONHB 2EKSB 1KFAL 1MQKH 4LSQL 4OT1L 25C8H 1T1WB 3K4DA 1ZSDB 3ULUL 3OKMB 2DI8A 4YX2H 4XMLL 5E1HB 3X17A 1RPQA 2ZUQC 2HWZL 1A7PH 1OGAE 3BW9B 3GZKA 1ZV5A 2HTLD 2NMSA 3CDGA 3MROB 3TGXA 2D7NA 3VWJB 4NOBA 5DS8A 4PG2C 5HGAA 4S1SH 2A9NH 2DKMA 1F90H 5ICXA 3NAAL 3FJTA 3VA6A 4NRXA 2A73A 2JLLA 4Z7OE 3ARGA 2QKIB 2GYSA 2ICEB 1I85A 2FO1A 4OZIF 4OI8A 4GG8A 4LARL 5E08H 5EU6B 1A7NH 4LF3A 1MCWM 2EEDA 5A40E 1TTGA 3QRGL 4MNGB 3WFCH 3UJJL 3VD5A 1YECH 4H5SA 1OL0A 4PUBH 5TPWL 5F9OL 1CZ8H 2FB4L 4IOIB 1QLFB 4ODHL 1D5IH 4DQOH 4JDTH 1DEEB 5ENWA 4JFPA 1WWWX 1IC7H 4BQCA 3MOQA 1PW3A 1QSEA 4G8GB 3OKKA 2FATL 1MY7A 1ZWIA 5JQHC 3LKOA 1VSCA 4PREA 3RWEA 3WDHA 2COQA 4JG0L 5IMLB 5FUCE 4GG6B 2FNBA 4HUVA 3PL6D 1DVFA 1VDGA 4WTXA 2C1PA 5GRJH 1T20B 3MV7E 2VZVA 4WFHD 5DLMH 3G6JF 1QBLL 3O6FC 2CK2A 1IAOA 1DSFL 5DMYA 1UEMA 5TH2A 1HSAA 3OF6A 4NQCB 4TSCH 5LWYL 4KKBC 5IOPA 3BYYA 5IM7B 1DBAL 5GRUL 2H2PC 3VG9C 4UV7L 3IF1A 3SJVE 3IGAA 3BDBA 3FN9A 3OJDB 3UXFA 1S7TA 5D7IE 2XTJE 1OCWL 2BJML 3W5NA 5E99L 1Q8MA 1QLRB 3H2WA 4X7FC 5ACLA 4W68A 3I02B 4LCCA 1N4XH 5DJCB 4WTZA 5I74B 5IFHL 2R1XA 3S9DB 3KJ6H 1FL3A 4PR5A 3PGDA 4N1EA 5JUEH 4HHAB 5F96H 3D2UB 3HI6H 3MRHA 3EUUA 1A3QA 2VL5B 4FABL 4FRWA 2PYFB 2ZP0T 1UJTA 3IKCB 2R56H 5E00A 4TN9A 1MPAL 3UTZA 3WS6C 5C3LD 4N1HB 4QXWA 5ALBL 4FQXD 4TYUA 2EIBA 4CN1A 1HINH 2HFEB 2N56A 3V6FB 1ETZB 3VXOB 5JNYB 3D3VA 3IJYB 4JANA 5GISL 2VYRE 5JOFA 3HLAB 4JB9H 1NBVL 2FWOB 4B7LA 2F53E 4W70A 3LD8C 1HHIA 2FD6H 4Z7QF 5KSBB 3VFRA 4M6NH 4OLVH 3T1WA 4F8TA 4WVRA 2YUWA 5HHOD 2HAZA 1R3LA 3DUSA 1BQHA 1G0XA 2YWYA 4KV5F 5J6GA 1XR9A 3KWWA 3FT3B 4PJFE 1MFDH 5IFJB 2J2ZA 1GGYA 2QLVB 5GJTL 2XG4A 1ZTXH 2OMBA 4OJFH 5GGRA 4RFEB 3WKML 4HULB 5HVWA 3T65B 2CUHA 3S88H 4ORGB 3TN0A 3MUZ1 3QDGB 1B2WL 4HV8A 3HMXA 4K71B 1N6QH 1NC4D 3CVHH 1MJJA 4ZXBA 5ISZE 1CICD 4X8JA 4YHKL 1BBJB 4YXKH 5EH1A 1FLRH 1I9IL 3UP1A 4HXAL 1TQBC 4KRPB 3FQTB 2B4CH 2HLFC 2ZPKL 4OSUH 4N0FA 5ETUB 1SBSH 5FCUH 5GZOD 1EO7A 1BEYL 3E8UL 2RBLA 3V4VL 2IPKA 3QIWA 4LEOA 1OLLA 4HCRA 1XT5A 3QXAA 3LHPL 1U2HA 4QXUH 1XCQB 5JDSB 3K2MC 4JZOB 2D9CA 5D6DA 1GCFA 4LK4A 4ZOBA 4NKIH 5E7BA 3RL2A 4APQD 4GLRH 4ETQA 3BOVA 3C5SA 1LVEA 4LP5A 1ROWA 4KPHL 1IGYA 4K7PL 3LRGA 2F5BL 3X14A 3TF7C 4PJ5B 3S35H 4FZ8H 4IRZH 2YZ8A 3WSQL 1HILA 3VWJC 1OPGL 3QA3B 2DLHA 4IMLA 2D9QB 2Y6SD 1URLA 3RX5A 3JUZA 4FNLH 4L8CB 3FZUC 1C5CH 5D2NE 4G8EB 3RUGF 4KJYA 3WL9B 2HH0H 1WBYA 3QG6A 3HR5A 5C0AB 3CMGA 2GY7B 2GAZA 5DEZA 3L5WB 5ICZA 4EUPB 3TYFA 5CSBA 2XWBA 4PRIB 1KELL 1NFDB 2GKIA 4Y5VB 3QO1A 5AWNH 3ZHKA 2FIRT 1IJ9A 1NCCH 4LAQH 4Y2DA 5K59E 2VDKL 4YFLF 5LCVL 4J3VA 1D6VL 4GKSA 3U9UB 3HNTH 1RJCA 1FZOA 3CFKA 1JZ7A 4RQQB 4G6JH 5CD3B 1ACYH 4OCXL 2GCYA 3GHEH 1P4LA 3NIDE 4FQIL 4Z7VA 5JHDD 3GSWA 3N9GL 5MERA 1P1ZA 3ZE1F 4PB0L 4FTVB 4AG4L 4X6CF 2OTUB 1GC1H 2VDML 4OCRL 4X5LA 3TNNB 4JAMB 3ALPA 5GGTL 1RSFA 3PWPB 4HKZA 3QHTC 2ZSVA 3TA3D 2BSSA 3IFOB 5I1KL 3V5KB 1N3NA 4OCYH 1ZK9A 5L7XL 1WK0A 5BO1H 5BQ7B 3EYQC 3VU2A 3NZHL 4M5YL 4JHWH 4U31A 1IC5L 3D85D 4UU9B 4MB5A 1ZGLA 1C16B 1QSFE 5JXEA 1JGEB 4JHAH 5JW5B 4WUUD 2CSPA 4G5ZL 3TH4T 5FGSA 3N1QC 3MRMB 3F7YB 1EAPA 3H9SB 1MFBH 4LCUA 5I74C 1KJ2A 1OF2B 3MLYH 2F5AH 5D6CB 2VZTA 4C54A 1JHLH 3EGSB 2X1QA 3X3GL 4G9FD 4OIIH 5TE4H 3V7AE 4KU1A 5FXCH 3EYUH 5DQDL 3CMOH 4S2SA 5DYOB 5F7NC 2R29H 2H3NB 1X5AA 1WZ1H 1INQB 3P4LA 4M1DL 1CK0H 1W72H 3RA7H 3F7VA 5EUOB 3QUML 2XZQL 5FYLE 4AENA 1UXSB 5EU7E 2ZG1A 1KT2B 1G0YR 2BNUB 1J8HD 4KDVA 1TITA 3P77A 2CKBL 1DN2A 2FRGP 3VH8G 2EDXA 4O2FB 1WQVT 2HKFH 3I3EA 4KJPC 4QRSA 2PW1B 3QDHA 1WCBB 1A7QH 1FDLH 1LP9F 4QRRA 4XZUB 5GS1A 3EZ8A 5GHWH 4F9LA 1WBZA 4X99A 3QFJD 1DLFH 1W2KT 3BAEH 3LMJH 4X6FB 2D7TL 3FFDA 2VXTH 4PRHA 4Z0BL 1SM3L 4LVHB 4XBGB 5JR1H 2F15A 1QA9A 4MHHI 5GS2H 3LSOA 4JFZH 1PFCA 4WO4D 5JXAL 1YYLL 4NDMA 5DRWA 5F7DB 1JF1B 3ZYIA 1JGUL 1R24A 4K71C 1RJZA 5MENE 1H3WM 2R0LH 1N64L 4NN6B 5HGDB 2HYMA 2J12B 5A2FA 5DUMH 4KRPC 4HK0B 4LU5L 1MRFH 5CWSA 1U58A 1R5WB 3L5IA 2CLVB 5JOPE 3QCTH 3S36L 2W0KA 1RJLB 3STLA 1DQLL 4I2XE 4WWID 3DUHA 1J88A 1KIQA 3VA2C 1ZA6B 25C8L 5KN5B 5DD6B 5C0GB 2LFGA 1EMTH 1XF4B 2C26A 3IRZA 2AERT 4OZ4B 4PJ9D 5H94A 3NIGE 3ABZA 1CGWA 1QVOA 2YXMA 1UWXK 4F80A 1A7PL 4TOYH 1NFKA 2FJFA 1RK0A 5D9SB 5FO8B 1EV2E 1Q9KA 3MUGA 3TBWA 3MZTA 4CNIB 1I1FA 3B9EA 4S1SL 4S11A 1CXLA 2A9NL 1F90L 1DR9A 5E8DL 1HK6A 3WHXB 3SCMB 5E24E 1WLHA 3FT2A 3IJSB 5GS2D 2WNGA 5LAXB 3LIZH 5DO2C 3FT4B 4LL9A 2RGSA 3LCYA 4ZUSB 4NC0B 3T1FA 3WFCL 1S7XA 5CSGA 3CDFA 3T4AA 4H25A 3ARGD 1YECL 4JDVB 4MJ2A 3DURA 5JO5A 2X4OA 2Q3AA 4YBLB 4PUBL 1NGQH 1QEWA 3ARFA 2DWEB 1YN6B 3AREA 3GSRA 4XP1H 4G6KH 4DQOL 5HDOA 4JDTL 1MCDA 2HJLB 4JKLA 1DEDA 4AIZA 4K3GA 4Y5VC 4YPGB 1IC7L 3GRWA 1NEZG 4Z18A 1QYGL 4PLJC 5IIEA 1K4CA 4S0SD 4DW2H 3ULVE 4HDIB 4PYHA 1QRNA 4OF0A 3BP4B 4FMKA 1CFNB 3H7BB 3PQYB 2VXUH 4H8WC 3QQ3A 3IDJB 3D1MC 1QSED 4C55A 4XCEA 5DLML 1X9QA 3O6MH 1MCOH 4OLYL 3D5OF 1N6VA 2IFGA 2BNQE 2FIKA 3AMKA 3KHOA 3BE1H 1DQJA 2V2TA 1CL7H 3F7RA 4QGTA 2E6JA 1WIOA 1OP3H 5GGUA 3QPQD 3MTRA 1IM3A 2GFBB 2IQ9H 3FO0H 4JJ5A 4TVSa 1U3HA 3KJ4B 2ESVA 5FM5O 4OIBA 3ROLA 3S3SA 4PBVC 3OF6D 4NKMA 1EO5A 5TFSL 5KS9F 4NC2B 5F1NA 3RU8H 3MRQB 1IAIM 4OM1H 1BQLL 3QWQB 3WJJA 2Z31B 4PG9A 4OF6A 1GL4B 4V1DD 3ULUC 3DV6B 1WWBX 4LCWE 5CEZE 1N4XL 1J7VR 1LNUA 4MQ7A 3PGFH 1TPXB 4PJHE 3GNML 3KJ6L 4ZFZB 3NN8A 1KLUA 1DZBA 4TUKH 5CGYD 4PRAB 4Y1AA 2R1YB 3O9WB 2R56L 1YY9C 1CFVH 3OL2A 4OZGA 3TO4A 4PJGE 4RBPH 2LU7A 1EUUA 5JLZB 5I2IB 1LGVA 1VESA 3BGMA 4MD0A 4Y4KB 4XHJC 4FQCH 2NLJA 4OGAC 3WNKA 1HINL 2J8UE 4JRYB 1SEQH 3TZVB 3MRDA 5DFVC 4ZFOL 2ZUWA 4ZQKB 2D7PA 1YC7A 3MREB 2BVPB 1JJUA 3FB6A 4GQPH 4GW1B 5GS0D 1RJYB 4HCRH 3GMPB 4XAKD 2FD6L 1F4XH 4D2NA 3P30H 1PEZA 4PV9A 1NANI 1T83A 3QNZA 4M6NL 1P7QB 1YPZA 3D3VD 2V2XA 2P44B 3FQXB 4ZUVB 4PLOB 2DQCH 3KNBA 1J18A 1HSBA 4DZBB 5DEFA 3KPSE 4LGRB 4N0CC 1ZT7A 2AEQL 1MFDL 1I4FA 1J0YA 2DLFH 1JYVA 1O0VA 4R2GB 4LVHC 4OJFL 3QIBA 4NPYA 3NACL 3L9RA 4M4RA 5BJTB 5D5MB 1UQSA 2Y36L 3MLXH 5JW4M 4MA3A 4MS8D 1G7PA 4WJ5B 2UWEA 3B2VH 2I27N 3ZT7A 4OGYH 2I07B 1N6QL 4J6RH 3T0BA 4YXKL 5J9PA 2XA3A 4LLVB 1FLRL 1KJMA 3TN0D 1VEOA 4NN6C 2B4CL 3T0DA 3NIFF 3WXWH 4OSUL 5C92A 1DUYB 1SBSL 4JFYA 4JR9L 4ZXBD 1ZMYA 2WP3T 2D4FA 4O5LH 3NH7H 2WBJD 1HXYA 1AP2B 3V52H 3CPLA 4R7NA 2QQLH 4K07A 4QXUL 4XBPA 4UUJB 2AXHA 5ESVB 1JGVH 5C8JB 5IFAH 3S4SA 4D8PB 3LH2H 1X4YA 4NKIL 3E6FB 3SKOB 15C8H 4MXWH 4QT5B 2R9HC 2VAAB 2X1XR 3QIWD 5ITBL 5FKPA 2A74A 4UT7L 2WWMC 5JORA 1MQ8A 1HNGA 1H5BB 1DDHB 4X6DE 2Z93A 3S35L 4FZ8L 2H9GB 5IT2H 4IRZL 2FEEI 1R0AH 4WDIA 1FZJB 3GSNA 4HEME 4U1HB 1HHKA 3FFCE 5SV3A 3JTSB 1KPUB 3C5ZD 4JFED 5IROC 3VXTB 3MMEA 4FXGA 4FNLL 4K3JH 3KVQA 1C5CL 5IMKB 3IDNB 1KCKA 4N9GB 3BRDA 4H1LG 4HGMA 3RY6C 3SCMC 2HH0L 3HB3D 3BD5A 3MLVH 4YHOH 4C83A 3IXAA 3IAPA 3BD3A 2CKBB 4QNPF 5CINH 4QXTB 3CSBA 1U2CA 4PJXA 3ARTA 4P5TA 4XMPH 3CUPA 2H41A 2Z91B 2DRUA 4PJ8D 1U6AH 4YBLC 3BH9A 1AIFA 1UB6B 4PRNA 2FGWL 4JQXC 4F9PC 5AWNL 4LAJH 3CZFB 1NCCL 4LAQL 1S3KH 1M05B 3U0TA 3PP3K 3P73A 4R3SB 5JOEA 5K9KB 3HNTL 4KKCD 4CBPA 1SEBB 3VXUB 3W9EB 1KJ2H 3IDGA 4G6JL 3C09B 1ACYL 5BV7L 3MOBH 2KH2B 3TPUA 3L7FB 4Y2DD 3GHEL 4YLQT 4Y5XA 5FA3B 3WFHB 2X40A 1KV3A 1WAAA 2P7TA 4M8QA 3V8OA 2V5TA 3FB7A 3MO1B 4CU7A 2VMFA 1RZJC 3MNWB 3W39A 1HWHB 2GTZA 5DJXB 2Z35B 2C3VB 3U7AA 3L3KB 3F65A 3MC0A 4LHUG 2P5EE 4GRLB 2IH1B 3A6CL 1GIGL 4JVWA 5CHNA 5FUOH 5I15L 1FFOA 1DE4B 4MVBC 2DL9A 5T3XH 2K7QA 3KPLA 4OCYL 3KJ4C 5DRNB 1Q9LB 2PW2B 2N1KA 2NW3A 3O3AB 1U8QB 4S1DC 4WU5A 3PL6B 1W8NA 1DBKH 2EYRA 2Z31C 3QB7C 4JHWL 3RGVA 1L6XA 5EZIH 3JWOH 4GT7A 4HLZH 4TPRL 2ADJB 2ICWJ 4GKNA 1TPXC 2YUVA 1YJDH 3ARSA 5GZNC 2YC1A 5IG7A 1C12A 1MFBL 3OKNB 5E5MA 3E6HB 5L2KD 2F5AL 4MJ6A 1JHLL 4N8VA 3U83A 3ZTJG 4OIIL 1DANT 3GMNA 1WISA 1BWMA 5BVPH 1AI1H 1RU9L 3EYUL 3H6JA 3CMOL 3O9WC 3VFPA 1MH5B 35C8H 2R29L 8FABB 3TJEH 1EHXA 4LLWB 1WZ1L 2XQBL 2P8PB 5DXWA 2MOVA 5C2BH 1CK0L 1AXTH 3KPPA 3RA7L 1T22B 5C0JB 3CU1A 4Y4KC 3RNQA 4JM2A 2APTA 3PWJB 4ZTPH 3TZVC 4K3DH 1WCQA 2YKLH 4D0CB 2HKFL 2RJMA 1A0QL 3WO3B 5KSVA 1ZLWK 4AQOA 4FZEH 3VFVA 1FFPB 3WLWC 1A7QL 4J2XA 3ARUA 1FDLL 1TTUA 1PG7W 3JBG7 5T3XD 4NKDB 2W38A 3CDYA 7FABH 1DLFL 3BAEL 3LMJL 3M1BB 4UQ3A 2VXTL 2DM2A 4HIEB 3BZDA 5EDXA 4QRRD 3S34H 4OD2B 5JR1L 4R2GC 2R39A 2E6PA 3GSUB 6CGTA 1BVKB 5D8JH 5HHXL 4HKXA 3V6OC 2QR0A 1X5YA 3B9KB 2ZZUT 2EYSB 3UX9B 2F54E 4WW2B 5I30H 2CDEA 3DI2B 4XCYA 4CKVX 2K3TA 2R0LL 3FRPA 3W11C 3NZ8B 3ZE2F 4PGCA 5DUML 3T04D 2X4RA 2VDPH 3UC0H 1CGVA 5AEAA 3H3BC 1MRFL 2LU3A 4AIOA 5ID0B 1MFAL 4D9LL 1UB5B 4QTHA 4M62H 1HDMA 2HT3D 3OXRB 3VI3F 4F7MB 4RWHA 3ARDA 2AVGA 1EX0A 2F19L 3CU7A 3GRWH 1SJEA 1XF2B 4TOYL 1NC4B 5IGXH 3CX2A 1AQDA 4RAUB 1H5BC 1GGUA 1JGDB 5F1SA 4XNYH 2E3VA 4M61B 3SEPA 2EXYC 4EJ1C 5IB1B 1G7QA 3L7EA 4YXHH 4IS6A 5GSVA 3KPRE 2NY7H 4MXQC 3ES6A 1T1ZA 4XCFH 2EH8L 3CK0H 1MI5A 3C60A 2QHRL 4ZFOB 3PGCA 1UM4H 4APQB 1X5HA 1WFNA 2V7HB 1BM3L 1JMXA 1NGQL 5E7FA 3TBVB 5D2LB 4XP1L 1X7QB 2EIZA 1IGTA 1I8MB 4XX1E 4D0DB 2KBGA 5I18H 3VXSB 4L29B 3MYJB 3RKPA 3ARFD 4DW2L 2X09A 3ARED 3B5HA 3FO9B 5T33H 1NFIB 4XVJH 5LQBH 3EFDH 3C09C 1FN4B 2NY4B 3VW3L 5I8OL 1LK2B 3O6ML 1QRND 1MCOL 2DAVA 1Q0YH 4MSWB 4OZIA 3HS0A 4WI5A 5GS0L 3BE1L 3MRLB 1D6EB 1U8NA 3VRJA 3RVXD 1MCWW 2A1WH 4GRLC 1ZHKA 1JNLH 2IQ9L 5E2VL 3CC5B 4NRZA 2VWEE 4UTBH 4WFED 5C08D 3M17A 4JFQB 4C56A 4Y4HA 5BW7C 1A6TB 2FEDD 3RU8L 1T5WA 4E41A 2AXFA 3HI1A 2ZNXA 1EJ6A 3GJEA 4G3YH 3PL6C 1U3HD 4Q2ZA 3MBXH 3ZDXE 1PX4A 1EEZA 4GO6B 3PGFL 3QXDA 4L8SA 2EDHA 2IJ0C 4LCYA 4LOUD 5I8KH 3LS4L 1N5YL 3G6JA 4TUKL 4HUXA 1U8LA 3MRPB 4I13B 3HMXL 3CFEA 1CFVL 3TA3B 4J4PA 2UZIH 3OXSA 1KCVH 3SBWA 1I1AA 1S7QA 2EC9U 4FQCL 3OKYA 3NCJL 3BMVA 2P45B 1BVLB 1BLNA 2AAVA 3CLEH 1MJ8H 4Y1AD 1SEQL 5HTSA 4EIZC 1EERB 3CSPA 5HYJE 3TO4D 1A7BA 3MLSL 2Z9TA 4Y89A 5I1GH 3HKFA 4PB9L 4QTIH 4PRPE 1EBPA 2UUDK 1FO0B 1ZE3C 1PEWA 1ZT4B 3BP7A 4F7CB 4HCRL 3PP4H 1CBVL 2ZUXA 5CKAA 1F11B 3P30L 1X5GA 4MB4A 4WGWB 1MIML 2P43B 1FZMA 4QYOA 3NFPB 2FDBP 3HZYB 4G9FB 3PDOB 4NO0B 4WHTB 2DQCL 2XV6B 3K7UA 3T77A 3L5XH 4ZSOE 1I8LC 1QFOA 2PTTA 3UBXG 4U1IB 3GFUA 5D1XA 1JF5A 5BV7B 4GQ9H 1QLEL 4U3HA 5EA0L 3MV9D 1HNFA 2YBRA 5FECB 2DTSA 2Q7YB 3AM8C 1J8HB 3ARWA 3K2UH 4RMVA 4OGYL 3MA9H 2X1WL 3B9KC 3QIBD 2AEPH 2BVUA 4IMKA 2ZUUA 4WW2C 1MSPA 1ONQA 1H3PH 4X5WA 2BSTA 4KK8D 2XWTA 5SWZE 4HWNA 4OF7A 3ARQA 1FORH 1IKFL 3QFJB 4L3AA 4E9LA 4OM0H 2VLRB 3C5JA 4NM4L 5CZVH 3CH1A 3V52L 4L9LA 1DQMH 1JK8B 4L4VD 1IGIH 4YHIA 4RSVA 3LH2L 5ACMA 15C8L 4MXWL 2XN9A 4JJHA 4G9DB 4G8IB 3BZFB 3FQUB 2P24B 2XKUA 1OAZL 1H15B 4JZNB 1P2CA 4HAGA 5LXGH 1HQRB 3MLWH 2AJSH 4YNYA 1JTOA 4DK3A 1HHHA 5CBAB 3W81A 2Y07L 1EUTA 2D7QA 3VFNA 5IBUB 1S9XB 1GGCH 5I16B 4MDJB 3ULVF 3HC3H 4WFFD 4YHOL 2Y4SA 3ARVA 2ITCB 2R4SL 5CINL 3T0XA 3VXME 1BBDH 4APQC 1O7VA 2V9QA 2LVEA 3QPXH 4XMPL 5A43C 1ZA3A 4PJAB 3TNMA 2P8MB 4AM0A 5CEXA 1RI8A 3O3UN 1K3IA 1B0GB 3RBGA 4JRXE 3JWDH 3RJDA 2WUBH 4P5TD 1S3KL 5FYKH 2NW2A 5IBLD 3T0EA 4BZYA 5KVGH 3CDGB 1MLBA 3U0WH 3EOTH 3QUYB 5DS8B 2VOTA 1KJ2L 4Z95H 3B8SA 5HGAB 4C58B 3ZSSA 3DMMA 5EOCJ 5IW3A 5ICXB 4DWHA 4XH2A 4W6XB 1SHMA 4N0YH 4NFDA 4NRXB 2A73B 2NY4C 1F4WH 3RUGA 4KI5F 4XPAL 3IJHB 2VIRA 3ARGB 4MJ5A 2AJYH 4GG8B 5HYIA 2BHUA 4LF3B 2ZKHH 4KK6D 5C0BE 2CIKA 5FUOL 4CVZA 5EORH 2AJVH 32C2A 4H5SB 4RMSA 1D7FA 1RULL 3EJZD 4OBSA 5ENWB 4CN4A 4JFPB 3Q0HA 5IHZA 2PTUA 2VSDA 1DBKL 1MCFA 2B39A 1MCEA 1QSEB 3OKKB 5EZIL 3RWDA 3JWOL 5GGVH 3SDXE 1ZWIB 3HRZA 3VD7A 3DHMA 3LKOB 1NCDH 1FC1A 4DOHE 4HK3J 4PREB 3RWEB 1YJDL 2DYPA 4Q0XH 4ONOA 4XNQA 4HUVB 4BELD 1DVFB 3F12A 2C1PB 1VB9A 2Q7NA 5FYKD 4LRNH 1BX2A 4NCC1 4BSVA 3PABA 5BVPL 1IAOB 1YEEH 4X6CA 35C8L 5TH2B 3TA3C 3TJEL 1HSAB 5C2BL 4UAOB 1AXTL 5J8OA 2OJEA 2YS4A 5F7EL 2Q8BH 3K8MA 2ZUYA 4HS8H 4TQEL 1Z2KA 2FHCA 4JQVA 5IHLB 3IF1B 4ZTPL 3IGAB 4GW5A 2YKLL 1E4XH 1ORQB 5ALCH 4Y8AA 4K9EH 3D25A 3K74B 1JZ4A 2B2XH 4FZEL 4DTGH 1LO0H 1R5VA 4JM2D 2VKWA 1ZLSH 3WNMA 2SEBB 4LCCB 1L0XA 5KZCB 3R0MA 7FABL 1IAIL 1S9YA 2C4FU 1Q72H 2R1XB 5EO1A 4PR5B 1FL3B 3PGDB 5I1HH 1TVDA 1JZ2A 2NY3D 3MRHB 5BV7C 5D8JL 4QOKD 5E00B 4XCCH 2VR5A 3UTZB 2CO7B 5I8EA 1EHLH 1UGNA 1K4DB 2VE6A 3ZTNH 3ZZ1A 1QFWM 2VDPL 4L8DA 1VACA 3D3VB 4JANB 4HGWA 1PY4A 5JOFB 2YSSA 1EZVY 3GMQA 5DSCA 5EU6E 3OJMB 3WUZA 4XPGH 3VXQA 2IALA 1HHIB 4CMHB 3HG1A 4M62L 1ZGLP 1LP9A 4Z77A 4MNGE 3VFRB 2DKSA 3BEVA 4X7CC 1CD9B 4F3FB 4YPJA 5TQ0H 4JREB 3EDFA 1R3LB 3DUSB 3GRWL 3KWWB 3F7QA 1JHKH 2QSQA 5GGRB 3ZDYE 3ARDD 5IGXL 2BOBA 3EDJA 2B1HH 4G8GE 5EZJB 4HV8B 2DMBA 4ZXBB 1MJJB 4X8JB 4GG6E 3BEWA 5F21B 4YXHL 1G6RA 2VLJA 4QEGA 5ESQA 2NY7L 5E9DD 4FFVD 2ZG3A 4XCFL 1S7RA 5DRXB 3CK0L 4J7RA 3RKDD 3ZO0A 2CUIA 4N0FB 4L3EA 5C07A 3C8HA 2E7LC 4EEEA 2IPKB 3VDAA 4LEOB 1KPVA 2OI9B 4NQCE 3TWCL 3QXAB 1MI5D 5FDWA 3C60D 5IB4A 5ADPH 2ZG2A 3KAAA 1R3JB 3DX6A 5DMKA 1KIRA 4HH9A 4ETQB 3C5SB 3NCFB 1JPGA 2OTWA 5I18L 1IGYB 1T03L 3X3FH 3X14B 1G7JA 5CJ8A 4LBEA 4MAYD 5F7KC 3QUYC 1A8JH 3RVTD 3C9NA 5LQBL 3EFDL 1ZAGA 4IMLB 4R97B 4P9MH 2OYPA 1I75A 1NCNA 4KJYB 4V2CB 5F9JA 1Q0YL 1WBYB 2YPLB 2DLEA 3MRBA 1K6QH 3ARGC 3QG6B 4O00A 5E70A 1I85C 3HR5B 4RAHA 2LTQB 1RMFH 3VGAB 4GSDH 5DK0A 3DIFA 5I8CA 1ES0B 2GAZB 5DHXB 5ICZB 1MFNA 5MI0B 3GBNH 3RJQB 3TYFB 2PUQT 3BPOC 4UTBL 4HC1A 3VWKA 3ZSTA 3EFFA 4X7TA 3QO1B 1JNNH 4XWGH 2KUTA 3ESVF 2CRMA 1DJSA 4Y2DB 5DUBA 3HZVB 1AGFA 3MBXL 4HEPG 2BNRA 3HR6A 4LPTA 1FZOB 1KN4H 3CFKB 4FQ2H 5KSBE 5DUPH 4E41D 3BP5A 1YEKL 3AVEA 3QQ4A 2XZAH 1VFOA 4XPBL 4JPIA 1P4LB 4N8CH 5I8KL 3EBAA 1DVFC 4Z7VB 5F6HI 3GSWB 5MERB 1P1ZB 3DNKA 1JBJA 1J1PL 1BFOA 2UZIL 5ECJE 5ACZA 1U8OA 3MNZA 3QDGE 2GIYA 4UAOC 2B8OT 4P2QD 1P84K 1Q9WA 2R2CA 1MJ8L 2IAMA 2ZSVB 3VFGL 1RFDH 2BSSB 2IBGA 2Q76A 1I3UA 5I1GL 1N3NB 1I1AD 4WW1A 5CJXA 5KS9A 5KAQG 5BVJA 3PP4L 1CDJA 1NEZA 4N68A 5KANG 3OSKA 1ZGLB 4LHJB 1YY8B 4LCCC 4L8BA 5CGYC 3QHFH 1A4KA 3V79C 3L5XL 1TETH 1E4JA 1EAPB 3E1F1 4LCUB 1KJ2B 5FUZH 4K7FA 4GQ9L 4Z7WF 1WF5A 3GSNL 1CT8A 1QFHA 2VZOA 1UEYA 3AAZA 4S2SB 3X13B 4BQ9A 4U6XB 4PJ5E 5B21A 1KXVC 1DBML 5D1XD 5M95B 3F5WA 3F7VB 4AENB 5F1IA 5FK9A 5GS0C