1YEJL

Catalytic antibody complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (IG ANTIBODY D2.3 (LIGHT CHAIN))
publication title Crossreactivity, efficiency and catalytic specificity of an esterase-like antibody.
pubmed doi rcsb
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1998-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejL01
3GKZA 4U05A 5L2JB 4JHAL 2VOTA 1NANH 4G6KL 3VU2A 5F7UA 2Y6SC 4MXWL 5D1QD 4OLXL 3L3DB 1A5FH 5HPOA 3WIHL 1EGJH 3GJFA 3CLEH 3GSRB 2H45A 3MJ6A 1J1XH 4L9LC 2QSTA 1FGVH 1HQ4B 4OB5L 1W72B 4MA8L 4LCCB 1JV5B 4C59B 3GMRB 5SWZD 2VLMD 5C0CB 2R2BA 4XP4H 3ZKSD 3QFJE 5KZCD 4FNLH 2VLKA 1TJHH 1HYSC 1FCCA 3A6BH 5FYKL 1FYHB 5D2NB 4FHBD 1OHQA 2IBBA 1M6OA 1IAIM 4YHMH 3VFPB 1OAZH 4QT5A 3OZ9L 1DQML 3FT3B 1NBQA 2Q87A 2XZCH 2YPVH 4N8CH 1ZT4B 3UTOA 4M4PA 2UYLA 1JPGB 2VLLA 4DZ8B 2PTTA 4OCSL 5CEXB 3OR7A 5LAXA 1DSFL 5EFIB 1M05B 5GGUA 5IEKB 3QO0A 2EKSB 1A6VL 2F53A 4P4KD 5T3ZL 3NABH 3OX8A 2X70A 3SGDH 3V5DA 1KTLA 4RNRB 1F90L 1F42A 1MREH 2EDTA 3LKNB 4HH9A 5IQ7L 1NCCL 3QFDA 4KKCC 3ZE0E 2MHAB 1U2CA 4HXAL 4XMKL 4Z7VA 4M61A 1N8ZB 1UADC 2HVJA 3K8KA 2K1MA 5IOPB 2G5BB 4PJGB 2BVPA 1OVZA 4LDEB 3FB6B 1NCUA 4CMHB 4RA0C 2Q8BL 5FA3A 3TBSA 1D6EA 3ULUL 2VZUA 1VFOA 1P1ZA 4XAKE 1S7WA 4Y16A 2ITCA 2DYPD 3UTZA 4L4VB 2EDEA 3O9WC 4L4TD 1HIMH 3NCMA 3QQ9C 4JM2C 3BN9C 2X4SB 1LEIB 2ZUSA 3DNKA 3ARBA 3IF1A 2WBJD 4EEEA 4QYOA 1JWUB 2WLZA 4NKQB 1KPRB 5JTWA 1M7XA 1N0XH 3RNKA 4XWGL 1CICA 3WXVH 1CK0H 2HLFC 4U0RB 3PGFL 5FYJD 2VLJB 4PGZA 3TIEB 2C4XA 2AV1B 1T1YB 2G75B 1KNOB 4EN3A 4BQ6A 3NCFB 4GQ9L 5CAYB 4DZBA 1DP0A 1T7VA 3RWJA 5A3ID 2IJ0C 1WBZA 3VW3L 3MPCA 1C5CH 2Q3ZA 5FO9A 1DDHB 4GH7B 4JDZA 1NC2B 4X7FC 3X3GL 2JELL 3BP6B 3AROA 1A22B 1PGRB 1GC1C 4M1GL 4XP9H 5C0GA 1FIEA 3AB0B 2GUOB 3QFJD 3WL9A 5F97E 3V6BR 4GKZA 3AGVA 3MZGB 5FKAA 3NOIA 5INDA 1BWMA 2RQ8A 3FO9A 4GKSB 1IBGL 1E28B 2XKUA 3HZVA 5EB9A 4WJ5A 1HSAA 1BIIB 3DX9A 1HCVA 3FCTA 4OGAD 3U1SH 4ISVB 4ZFZB 1A0QL 4QHKJ 4PRPA 1JHLL 3ARGD 1EHAA 1ZHNA 3EFFB 25C8L 2OBGA 2QADC 3ARDA 2A9NL 2FIKA 2X4TB 4V1DB 2YKLL 5IB2A 4O02L 5H37H 1KJ2B 4LLDB 2VDOH 2E6JA 2AV7B 5AYUL 4XNYL 3BIAX 3BRFA 4H0GA 3RZCD 4HGWA 4LLWA 1KC5H 2G60L 2FSEA 1NLDH 1RMFL 3V6OC 1MCBA 4OAWB 3UYPA 3VFTA 4KROC 2EDFA 5C07A 4RAUB 2RR3A 1U6AH 4P2QA 4PV9B 3GSNB 4XPAL 4KI5C 4WTWA 1XCQA 2O61B 1I9EA 2AJ3A 3BP7A 5FA4B 5FB8B 4EXPX 2DTMH 3QDGA 4UUJA 3BE1L 3MRQB 3O3DB 4XAKD 2ZUUA 4LSTH 3OKDA 1FNAA 5FGBC 1FN4A 2P5EB 4ZOAA 3BEWA 1NCDL 3VRJB 5ADOH 2J7LA 4L8BB 2OI9C 2DQGL 2NY6D 3RL1B 4Z78A 4XT1C 1OP5K 5IFHH 3ARYA 1X5LA 2H2SD 3TNNA 3SE4C 3H9SE 3QXDB 3GJEB 3CJJA 4ZUTA 2RAMA 1KB5B 1MFEH 1A7NL 3T65B 2WQ8A 4PG9B 3SCMD 4K8RD 1B90A 3ARSA 2A6KB 1BVZA 3DSFL 3UBXB 5C0EA 5F6IB 1NGZB 1SEBA 1G6RL 4C4KO 2DLIA 3BUTA 1MCHA 1UM6H 4O51B 2JJSA 3IJHA 4PJDA 4U1MA 4YHNA 1IM9A 1R24A 3OJMB 2CIIA 4LNRB 1M7DA 2PW1B 5D2LB 2SEBB 1CTNA 3BGAA 2XT1B 4JO1H 4OZIA 5T33L 4ZXBB 5EUOF 3ZKQD 5FUCC 1B9ZA 3VMPA 5J11B 5E94B 1F02I 5C2BH 1U8LB 3B2UD 4QOKE 2BVUA 4HWBL 5I17B 4O5LH 5F96L 4G80B 1NAKH 1R3IL 4G5ZH 1NANI 4JGUA 3MACH 2VDRH 5DJ2B 1U8KB 4HIXL 1L6ZA 5CEYA 3SGJA 5E08L 4FQPA 3HZYB 4POYA 2HN7B 3R06A 4MSWB 2FDBP 5GIRA 3H3PL 4HWBA 2E8YA 3DETD 4PPTA 5D1QB 2DMBA 1Q9LB 1YPZB 1OGAA 4JZJA 4Y4FA 1UWXK 4XBEL 2GSGB 3MROB 3RVXC 2W07A 1BJMA 5DJZB 2BNRE 1WCQA 1UB6B 3TVMC 3IXTA 4PJEE 1VHPA 1DE4B 5KZCB 4WVRA 2F8XC 4CKVX 2R2HA 2G9HA 5HDOA 1AXTL 5D6CB 3LHPH 3TCLB 3KR3L 1CFQB 3S34L 1G0YR 3HLAB 4ORGB 3SE9H 1PJ9A 2B0SL 3SGDI 1G0DA 3QULA 1CG9A 1PG7L 1CFVL 4I3RL 2BSTB 1XGQB 2F15A 3SGKA 4QRRE 8FABB 4JY5L 3HN3A 4EOWH 4K7FB 3KYAA 2HWZH 4R8WH 3IFLL 1GVIA 4ETQB 1H3WM 4M7LH 4JVWA 2E9WA 3CFCL 3SDDC 1AQDA 3FRUB 1D5ZB 2DD8H 3MOQA 4G8EA 3KPTA 3RVUD 5EUOE 2IAMD 3IFPB 3PDGA 4WHYH 2UZYB 3H9SD 4OUUB 4Z0BL 3SN6N 3WE6B 1AR2A 4OCMC 1FG2A 1PEZA 5T3XH 1FQ9C 4OFDA 3G5XB 1ULVA 3SE3C 3RWIB 4KJWC 3QDAA 3PGCB 3GMMA 3EYQD 2VO5A 5GRWA 3NCJH 2APVA 1INEH 2Q20A 4H1LH 4JG0L 5I1IL 1D9KA 1GGCL 1PKQA 4L4TB 4Y4KA 5ESAA 3ILQC 2QQNL 3MYJB 5EZJA 1YEHL 3PWLB 3MR9A 5J1AA 4X4XA 1RK1A 4PGEA 4UT6H 3PQYE 4S1QL 2LVEA 2WBJB 4PJBF 3S96A 5CHNA 2BOBB 4MYWB 3BDXA 4DUWA 1SEQL 1R0AH 4QOKD 5E5MB 4LNVA 5I1GL 5HI3C 1XF1A 5F9OH 2P45B 4WEBL 4G6ML 2VR4A 1MFNA 1AJ7L 2GFBA 2WUCL 3B5HA 3EYSL 4Y1AB 5IK3A 1VESA 4ODXA 1AGBA 5TJWK 4HC1H 3MRJA 5I1EL 2NY0C 3TA3B 2VAAB 2H32A 5EOQH 4LLQA 1A9BB 3BKJH 5GJSL 5IVOA 4W6YB 5IHLB 1IC5H 4JFEE 5IWLA 4FS0A 3OBAA 5L2KA 4BH7A 3O3BB 1TDQA 2BNRD 2Z35B 3MLRH 4N9OB 4HMCA 5DSCB 3ZO0A 1JTTA 1G9NC 1X5FA 2ESVD 3EDJA 5A1AA 2VXUL 4LRNH 4MNHA 2HJLB 1DUZB 1NFIB 4EI5D 2NCMA 2EC9U 4OCWH 1FFNB 1KENH 2V7HA 1NUGA 3RX5A 4FMFA 1B6DA 4F7MA 4Y5VB 1JP5A 2EDRA 4KDTA 5L7XL 1CU4H 4L3EA 5DHVB 4W6XB 4HBCH 2X4UA 3TPKA 1VFAA 2EEAA 3MGOB 2NZ9C 5ISZE 1MPAH 3VFVB 2DQUH 3BVNA 3ARGB 4QRRD 5DHYB 2XQYG 1CZ8H 3FOLA 4O58L 2C7UA 2ZJSH 3QDJE 3ARXA 2PTUA 5GGVL 5EBLA 5FHBH 2QEJA 1B3JA 3CLFL 4M7ZC 5CD3B 4LP4A 1CDJA 2WK2A 1ERNA 4FZ8L 1FV1A 3LIZH 5I74B 4M43L 2RFXA 3EHBD 1MNUH 2GJ6A 1E6OH 3DX7A 4U6VH 4J3UA 1AFVL 1ITBB 4GW4B 1OAKL 5GSVB 3FZUC 4Y5XC 4TUKH 1Q0XH 4LSVL 1TZHA 4YAQB 3BPNC 1EEUA 3MV8B 1W72H 1N5YH 5D72L 4JQXA 4WFFE 4N90E 1EZVY 4NUJA 1EHLH 1P7HL 3BO8A 4PS4H 5HHMB 5L88H 3O8XA 3IDXL 1DL7H 3J8F7 2I9LB 4NDMA 3LQAL 3T04D 3VGFA 5F70A 3D5OF 4GG8A 3CPLA 3EYUL 3K81A 4TN9A 2ZKHL 2Z93A 2CGRH 3L1OH 4JQVA 5D1XA 2E7LC 3MUGB 4KK9D 1NGYA 3RWEB 4AQ1B 2IPUK 2P8MB 1BD2E 2D7TH 4F37F 2B4CH 5I76B 3SCMB 3I85A 4WW1B 2ZCHL 4YK4B 4HIIA 2H1PL 1U8JB 1MIMH 3NFPA 4G6FD 4OJFL 3T4AB 4O9HH 1WFUA 2MJWA 5HI5C 2YOCA 5CS7A 2Q1EA 3V0WH 3V52H 1R3JB 5JXAL 4WGVB 4JFED 1S9XB 5I30L 3QJFA 3BP5B 4X6FA 4HS8H 1D5BB 3K2MC 5FGRA 3OAUH 1NUDA 4YUEH 3KPRB 1HE7A 4DKFH 1SJVA 3U46B 2N7AA 1YEKL 5A16B 1AH1A 4CVZB 4ZPTB 3V4UH 1HWHB 1PZ5B 1XGUB 2J1KA 2RHEA 1GGBH 2XACC 3KDMB 2WM0A 3RDTB 3ARFA 5TPWH 1LGVA 5C3TA 4U1LA 5J1TC 2OL3L 4PIRF 4BH8B 1OGTB 3ULVH 3U0PB 3QIBD 3FTGB 2DQHL 3DX6A 4HUXA 3FO2B 4YHKL 4I48A 3RY4A 1ROWA 5I1JH 2DOCA 4L29B 1JGDA 1C12A 3QDJD 3BH8A 4KVCH 4ELKB 1CGSL 2ITDA 1YY9C 1ZSDA 2GQHA 1X5HA 5H35A 3CFBA 1QHPA 4PJ5E 5J57B 3BISA 4XBGB 1ZLVK 3D2UD 3WFDH 4PBVC 5C0NC 1TQCB 3O2VH 3DO7A 3BYTA 4NKMB 3VCLA 2GEEA 4KRPB 4XX1G 1IKNA 2NTFA 1DQQA 1KLFA 2W0KA 3I2CH 5C70A 5IIEA 3MV7A 4ZAKD 2AKRA 1CD0A 4M02A 5I1LA 2VDKH 3RVVD 3PWUB 4WFFD 4N90D 5HD8C 3X11B 5D1ZA 3SDXA 3BGFB 3NZHH 3FN0L 5M94B 2QKIB 3W9DA 3IDUA 3HRZB 4U31A 5K9KA 5ACZA 5TF0A 2BVOB 1UKQA 1LE9B 4B5EA 5F21B 1KCSH 2DLTA 4FQHB 1F2QA 2ZOKB 3KLSA 1WBYA 1J05A 5I16B 3QO1B 4PRNA 1AQKL 1TCRA 1HN1A 2VWEC 5MEOB 5F7WC 1CFNB 1BD2D 3LRHA 1BAFH 4X98B 1G84A 4K9EC 1HOCA 5BXFB 1OSPH 3LD8C 1EV2E 5T5NF 3WFHA 2X9XA 1KIQA 4CBPA 4HK3J 1EO8H 1HILB 4HJJH 1IT9L 1J12A 5L2JA 3CCHB 4F7PB 4JN2B 3DRTA 3MCKB 1ACYH 4KKBC 4OCXL 4KUZL 4AT6B 3N1PC 2W38A 3L3DA 1IQWL 1TLKA 3BDYH 3QWRA 3GSRA 3GSNH 1L9NA 4A6YL 2Z8WC 4WTZA 1YNTB 1QLEL 1HQ4A 1CLOL 3DUHA 3ULSB 3RWCB 2X6MA 1W72A 4LCCA 1H8NA 4Q2ZB 1G1CA 1E27B 1JV5A 4UAOB 1MEXL 3LKOB 5C0CA 4PG2C 5FGCE 3TIDB 4NBYB 3MLYH 1V8HA 3DROA 2NY5H 4Y19D 3SDYH 3VI4F 5FYKU 5D2NA 1EMTH 1RZ7H 3SHSA 5CD5D 4XNQB 5SX4H 1I8KB 4IRSD 4P9HH 3VFPA 2XQBL 1EFQA 3FT3A 1X9QA 1RV6X 4QY8B 5L6YH 5DURD 2IPTH 1OQOA 4HUUB 4OFYA 4HCRL 3F5WB 1JPGA 4DZ8A 1YEIH 4TRPL 5CEXA 3P0VH 2F54E 5EFIA 5EN2B 1M05A 5IEKA 2IQ9L 1NKOA 2EKSA 4C56E 3CK0H 2EDNA 3QCUH 3VFNB 4PJ5D 2YPLE 2VDLL 1ADQH 2PO6D 4HCRA 4RNRA 2XA3A 1Q8MA 3VFRB 3LKNA 4R4NC 4H5SB 4MVBD 4LARL 2MHAA 3VDAA 5H2BB 3TP4A 1PLGL 2ZUTA 3CSPA 1N8ZA 4U0QB 3B4NA 4S1DC 2CJUL 5IOPA 2G5BA 3DTXB 1EK3A 3SDCC 4PJGA 4NC1E 4HIEB 1HHIB 4X9FA 1WEJL 1OAXH 2DLHA 3O3UN 3VJ6A 4Z7OF 3EFDH 3NAAL 1JGUH 4QRRB 3GBML 5DWUH 4WTZG 3MLVH 5I1HH 3U6RB 4L4VA 5DA0B 4MQTB 3DYMA 3HAEH 3LSOB 1QKZH 1LEIA 1WIUA 5CP3A 1S7UA 4GRLC 3MX0A 1CS6A 4OBSA 1ZLUH 4DGVH 1JWUA 5D7IE 1E6JH 5EUOB 1YECH 3MUZ1 3M8OL 1KPRA 4HXBH 2FATH 1JE6A 1TZGL 1S8DA 3TO4B 4LLYB 2O5ZH 1NGXB 1UWEH 2VLJA 3FFDB 3PWVB 4D8PB 1ZANH 3TIEA 4ALAH 3HE6D 2AV1A 2XY2A 1KNOA 1T5WB 4CGTA 1A6WH 3KNBB 4UMGA 4B53A 4XNUH 3L5XH 4L4JA 1UKTA 3S36X 1DBML 3AREC 1DDHA 3PQYB 1NC2A 1GYAA 5DMGD 3BP6A 4AQOA 5D93B 3B2VH 4I4WB 3W9EB 3REWB 1RVFL 5DQDH 2GUOA 2HG5A 5CZXD 4P0DA 4X9GA 4K71C 4ZTOH 2A74A 3MMEA 4PP1D 2LTQC 3DSNA 4TQEL 5E4EC 4R0LC 4JFDA 1E28A 1KCRH 5BO1H 1K6QH 3DRQB 1BIIA 1KJ2L 4XP6L 1XGRA 4FQQB 4G6FB 1MAML 4ISVA 3WD5L 4ZFZA 4JFQB 2E27L 5BV7L 1M71A 4XVUC 4OGYL 4Z7OE 5B3JE 3EFFA 3U48A 4C56D 2AEQL 4JFEB 1OTUD 3UAJD 1NMCB 1FZJB 4V1DA 2AAVA 4WWKC 2YPLD 4EDWL 1KJ2A 3VD3A 2AK4E 2AV7A 1A1OB 4LQFL 3BIBX 4JM2F 3SEPA 1F11B 4YDJB 3RL2B 4N0YL 4TUJB 3TT3L 3QHFL 2HTKD 4OAWA 4XGZB 2X1XR 3O45B 4D94A 1V7NL 1BPVA 4RAUA 4XVJH 1T4KB 3RGHA 4PV9A 1NGQH 1U3YA 1XR9B 2CMRH 2LAGB 4DVRH 2O61A 4P3CL 3QIBB 4X9IA 2B1AH 4R2GD 5ISZB 4QWWD 5FA4A 1OT1A 3SO3B 5FB8A 1N2RB 5I8EA 3KLHC 5E24E 5GGTH 4GBXC 2UUDK 3MRQA 3QDJB 1ZT1B 3FOMB 4Y4HC 1OWRM 3L9RB 4PUBL 4YHOH 2MTPA 3TN0C 3GHEH 2P5EA 3D2UB 2XZQL 1U41A 3VRJA 3G6DL 1S5IH 4LMQE 4L8BA 3RL1A 3R1GH 3WNMA 2V5RA 1XR8A 4Z76B 3QG6B 4U1KB 4FABL 4JHAH 1TTFA 2GK0A 3GJEA 1KB5A 1UXWB 2VMFA 4PG9A 4LU5L 4ZAKB 5IM7A 2A6KA 3WIHH 3UBXA 3BD4A 1K5NB 2HH0L 1NGZA 4LSPH 1QBBA 4XCYB 2JF1A 3VA6A 2D31B 3BPLC 1R6VA 3ILPA 5L8JB 4MA8H 1YY8B 4O51A 5IT2H 3ZHDA 2J4WL 4LNRA 2PW1A 4ZPVB 4UTBL 2R0ZL 1JGEA 3QNXB 5E0QA 4PP2A 3AM8C 2GKIA 5DHVH 2KQMA 4JDTL 4XTRD 3S5LB 4YHLL 4HGKC 1ZXQA 3BJLA 4P2OD 5IFJB 3C9NA 4KMTL 5E94A 3BESR 4RWYL 2J5LB 5I71C 5I17A 1NSNH 1BD2B 2X42A 3GHBH 4G80A 3TZVC 3GIVB 2OM5A 3BOVA 2IADA 1KLUB 2AEWA 1DSFH 4YIQB 1A6VH 5DJ2A 4KI5F 1JK8B 1U8KA 3FT4B 3GNMH 5CJOL 1HNGA 5B8CB 1FYTE 2E7MA 5KVDL 3RY5A 3LDBB 2AVGA 4MSWA 1DBAL 1GAFL 5TFSH 4LL9A 3T1FB 3KG5A 5D1QA 1IEBA 2R9HD 5DDHB 1NCCH 3VWJC 2GSGA 3MROA 2OMNA 4ZUVB 4O2CB 3DBXB 5DJZA 4LEXH 3BSZH 4C55A 5GS1B 1UB6A 1SY6H 1MRDL 4CW1B 3LS5L 5SWZA 5SX4I 3IDYB 4NT6B 1DE4A 4YHZH 4NO2B 5J3HC 4TPRL 4IIQC 3CDGB 1BFOB 2XTLA 3MODL 4OI9A 2P47B 5D6CA 3O11A 3UBXG 3RKDC 1DQLL 4IRSB 1CFQA 3LMJL 3RTQC 4HQQL 2Z31D 3H9HB 5DRWB 1KCKA 5DMYA 1NCAL 4JHZA 2O5YH 4ORGA 2ARWA 3CSGA 5F3HB 3LKRB 1FFPB 2BSTA 1XGQA 3N1GC 3UBXI 3C8HA 1A7PH 3QZWB 4YGAB 1KIPA 5DVMA 3U0WH 4K7FA 3TT1L 3TFKC 2OR9L 4ETQA 3BZEA 3C8KB 3UCRA 3RVTC 3U4EB 3FRUA 2PO6B 1D5ZA 4LBEB 3UJTH 1MJUL 4EUPH 5EOTB 3U36B 3PGFH 5A2FA 1R3KA 4MCYB 1F13A 1RUAL 3IFPA 3ZE1F 4I18B 4OUUA 2DDQH 1OPGL 3WE6A 3ZL4L 2HRLA 4GQ9H 2R4RL 4KKCD 3D1MC 4CADB 4G7VL 4LSSL 3FQRA 3G5XA 2EEBA 1B0GB 4U3XA 4F9LA 3BH9B 3RWIA 3VW3H 1PSKL 3U2SB 2MSPA 3ARWA 4KI5E 3X3GH 4TOYH 1DBBL 3L5IA 5E2WL 4M1GH 4L4TA 4MHHI 5LGJB 1N3NA 1RZKC 4ZNEA 3MYJA 4TSAH 3PWLA 3QXAB 1RU9L 4DKAA 2VITB 4JFXB 2XXCB 3C60D 5FYJL 1YN7B 2WBJA 3B5TA 1YEDA 2BOBA 3PGDB 5HYFA 5EBWB 3WIIL 1J1OL 5IB3B 5E5MA 3WUWB 1VPOL 1YMMD 2WWKT 4Z7WF 1I7RB 1RURH 3QPQC 5JIPA 3RQ3A 3CIQA 5J1SC 25C8H 2YD9A 1Q9OB 2YK1H 1FYTD 2AQ1A 2YKLH 1JWMB 1U2HA 4O02H 3HE6B 3NH7H 3FFCE 2VAAA 3O81A 3SQBA 3VFWB 3D39E 4JFFE 5AYUH 1VFMA 4UNVA 3W11C 1VADB 1A9BA 1RMFH 3GB7B 2BFVH 1IC7L 3O3BA 2Z35A 2N7BA 2P24B 2E9IA 4XPFH 3R0MA 5DSCA 1MWAL 3QFJA 3HI6L 5FGCB 2HJLA 1DUZA 3E8UH 1MFBL 1UT9A 3BE1H 1FFNA 3JWNC 1R5VA 4HFWB 4Y5VA 4JCLA 1BOYA 1B88A 5ICYA 1MWAA 3T0ED 3MGOA 4UBDD 3VFVA 4NO0B 2F54B 3ARGA 5DHYA 2D0GA 5ID0A 5D7SL 3BP4B 2A2QT 1CI5A 2DQGH 1VGKB 4U3CA 4NUGL 2YPLB 1IAMA 4M62L 2Q7YB 4DEPC 2DICA 4YDKH 3CMOH 5CD3A 3T2PA 2VKWA 4MA7L 1P84K 1A7NH 1SJEB 1AHWA 1G7QA 4JANB 1PW3A 4NOBA 3DSFH 3DECA 1LWRA 3MLZH 3TLRA 3EDEA 3SQOH 1G6RH 2BC4B 3DVNB 4GW4A 1A3QA 5F3BB 5BMFH 5GSVA 2NY4C 2VL5B 1FO0B 15C8H 2DQEL 3MRRB 3L5HA 4YAQA 4Z7WE 4WTXA 4IMKC 1TXKA 3HA0A 4M5ZH 3ELAT 2ZPKL 3UP1A 4H88H 4MJ6B 3KAAA 4KI5D 4EBQH 5T33H 3I9GH 5I1CH 4OLZL 2CSPA 5EPMB 5I19L 4U1HB 3V9FA 1M7IA 1JZ8A 2I9LA 2GIYA 3RWHB 5F96H 1N7ML 1R3IH 3TBYB 5J89A 5BVJB 5D7IB 1ZVYA 2EZ0D 3SE8H 5GRJL 3RWDB 1T7ZA 4X9HA 3MUGA 1QFWH 3HZKB 5E2VH 2P8MA 5D6DC 2HVKB 2LABA 5I76A 3OKOB 4KTDH 3SCMA 5ACMA 1U93B 5F89B 2OSLA 3DYOA 4KTEH 4QXGL 3D0VA 4WW1A 5E8DH 4XBEH 3TGXA 4LPCA 3FFCD 1U8JA 3D39D 4JFFD 1WC7B 1X4XA 2HFEA 1FL3B 4MD4B 1I1AD 2X40A 1R3JA 1Z5LB 2WINB 3L7FB 1MF2L 1S9XA 4HJ0C 3BP5A 3FO1A 2A0LD 4RMQA 3ZDZF 4NCC1 1FNGB 4I8DA 3KPRA 5LGKA 4M8VA 3EOBB 3U46A 4P2OB 5A16A 4CVZA 4ZPTA 3S34H 2MOVA 3MFGB 1PZ5A 1XGUA 2EDLA 3OKEB 4YX2L 4GLRI 3KDMA 4YXKL 1TVHB 1NCTA 1ITCA 2B0SH 1PG7H 1QYGL 4KXZH 4F15B 4I3RH 2E7BA 3EAKA 3PHOA 2NTSP 4BH8A 4NHCL 1OGTA 4JO3H 1MAJA 5IR1A 4YO0B 1VKXB 4I5BB 2PXYC 2NR6D 4HDIB 1KB9J 3VXQB 4CUCA 1IAOB 5DUPL 2M1KA 4L29A 4OD2B 1DQJB 1UZ8A 2F8VA 3A6OA 4R9HA 4ELKA 2I60L 1MCWM 3T4YB 5I8CB 3ES6B 2AK4B 2Y07H 2EH7H 3IDNB 2HKHL 4XBGA 3MNVB 4Z0BH 3BGMA 2B2XL 3RVXD 4L9LB 4NKMA 4OF6A 2C3WA 2P49B 4PRAB 3IETB 3TVMD 1HZHL 2IBZY 2YMXL 4P23C 4RSVA 1AO7E 4X7TB 2Z31B 4M6NL 4NNXB 6FABL 3PWUA 3NA9H 5KTEL 1IM3A 1YEHH 3X11A 1YJDH 3OF6A 3MGAA 2QKIA 5I73C 4BQBA 2NXYD 3HRZA 4NZJA 1SEQH 1FC1A 4Y88A 2BVOA 4ZO7A 1LE9A 5FOBB 1QPPA 1BX2B 1JL8A 3FB7A 4FQHA 1AJ7H 2WUCH 5E6ID 3EYSH 2NXZD 2ZOKA 4KUCF 4X4ME 4CNIA 5I16A 3QO1A 4XC1L 4UILL 4O00A 5I1EH 2AXGB 2YZ8A 3H9SA 5MEOA 1UM5L 3TWCL 3VFGH 1CFNA 4I0PD 4X98A 4L1DA 5BXFA 5GJSH 4GT7A 1HHHA 4OBRA 5ESVB 1I8LC 1IE5A 1GSMA 5TE7H 3WDHA 4LIQE 3CCHA 2R39A 2VTFA 4QRPE 1OP3H 4F7PA 5D71L 3MCKA 2V2WB 4AT6A 2J8OA 2H9GB 1LQSR 2OJEA 1BLNB 4F7EB 3HMWL 3UEZA 4KJWD 3X17A 1LE5B 2VXUH 1NEZB 1WWAX 1I7UB 4MJIE 3SKNB 3RWCA 3EYOB 3O6FC 3O9WB 4Q2ZA 1E27A 2FX9H 4JY6B 5KBNC 4JM2B 1XH3A 3ILQD 4QOKA 3MJ9L 1WF5A 4MZ2A 1MUJB 3TIDA 3WJLA 3I50H 4WIQA 5EU7C 3TBVA 2A1WL 5DEZA 1RIHH 1I8KA 1KCLA 4O58H 3TBTA 1FYTB 5GGVH 4S0TD 2YD8A 2BXZA 4QY8A 4MWFB 4HUUA 3F5WA 5IHZB 1CDBA 3QUXC 1EZVX 5HDLA 5EN2A 2LU4A 3Q48A 4M6MH 5MERA 3VFNA 1AFVH 1E4XH 4HBQA 2BNRA 1J11A 3U7YL 4HMEA 2OK0L 1OAKH 5DTFB 5DUMH 4PJEA 4QGTA 4C4KT 3VFRA 2NY1C 1PY9A 2CK0L 5HYJE 4EI5A 5D72H 1G7HA 2XKSA 3P0GB 1AO7D 3DTXA 1T3FB 1HHIA 3IDXH 4WU5B 4QRRA 3WNKA 2FD6H 4FG6D 2X89D 3EYUH 1AP2B 1KTDB 2NY2D 4MXQC 3U6RA 1JHTB 2NZ9D 4FQXC 3IYLW 3LSOA 5EDXA 4OF5A 1GXEA 2QADB 5GQBA 3MNWB 2AABL 4OIIL 4IEFB 1BJ1J 2IPKB 5JIKA 5EUOA 2O5XH 2H6PB 3FONB 3HFMH 4OJFH 4JLRB 5KSBF 4W81A 3TO4A 4LLYA 4U3HA 4KFZC 5CBEB 2HRPL 4LQ1A 5T1DL 1S9KC 5K9QG 3HUJE 1HKLH 2ICWB 3FFDA 3PWVA 3U9UB 4D8PA 4WI6A 4YXHL 3FZUD 3DGGB 4NFCA 4QRPD 2MKWA 3Q5TA 1T5WA 3RBSA 2DI8A 3KNBA 1WZLA 4HKZA 2MWCA 3FB5A 1YEKH 3MRFB 1ETZB 2W9EH 5JHLL 5K9QI 4GRWF 1NCBL 1ZGLM 4MJID 1MRFL 4M48H 4NQED 1QFWI 4X5WB 3N0PB 3PQYA 2OL3H 4I4WA 4OZGE 3REWA 3W9EA 4NQCE 3RIFK 1VEPA 4TUOB 1KOAA 1LDPL 3JWDL 1KFAL 4O4YH 1EIBA 1WZKA 4QF1A 3GI9L 2MCG1 4LPVA 2YN3A 2OI9B 4XPGL 1KN2L 1YNKH 3HPJB 5JDJA 3FFCB 3OHXB 3SGEI 1OQXA 2JK5B 1P9MC 1CXIA 3D39B 4JFFB 4JFQA 1FPTL 1QBML 4AIXA 3L5WB 1G1YA 3MUJA 3GBLA 4HWNA 4JFEA 3LKSB 1FZJA 3VMNA 4MQXC 3W0WE 5J13C 2B4CC 1A1OA 3CVHB 4KZDL 1QHOA 1EXUB 1F11A 4YDJA 3RL2A 1RIVH 1ZT7B 4KMQA 4TUJA 4F9PA 4WFHE 4IOSD 5HYJD 2UWEF 3B9KC 1A3RL 3O45A 1A7RL 3AAZA 2EDXA 1T4KA 5ALBL 3ARUA 4QRQB 1XR9A 4NRXB 1KB9K 4YQXL 4XNXL 5E8EB 3QIBA 5KSBE 4AMKH 5ISZA 5C0BE 2H26B 3ZTJG 1N2RA 3FKUS 3GSQB 1BM3L 5IP4A 2ZWLT 3QDJA 3IJYA 3X3FL 2CUIA 1B2WL 5CCKL 3GBNL 1IGIL 1G9MC 3L9RA 3WHE0 1AQKH 5JOPE 2GSIA 1ZVSB 5CIPB 1NMAH 3D2UA 4RISL 1WLHA 4GRWE 2I5YL 4KJYB 1I3VA 1IC1A 1YY9D 5CJQL 4PB9H 3TVMB 3LKQB 4LCYB 5LKNA 1RUQH 5JNYA 4M03A 5IHBA 3P30L 1IT9H 4HPOH 3PE9A 4NQDE 4G6JH 4Z7WB 4XMLL 4OCXH 4KUZH 1UXWA 2PYFB 3LOWA 4ZAKA 3CX5K 2VXVL 4AZ8A 3OAZH 1RZIB 1MCDA 1K5NA 4A6YH 2NW2B 1K2DB 1QLEH 1P4IL 5KSUB 2R4SH 2AJXL 3AFLA 1YY8A 3EJZC 4Y89A 4ZMAT 1MJ8H 2WZPD 1MEXH 1F58H 1QPXA 2BY0A 4ZPVA 5I2IA 3QNXA 2VYRE 5IBTL 4JJHA 4NFDA 1V3MA 2DIJA 4FFZL 5IF0A 3S5LA 4NQCD 3U7WH 5IFJA 3DWTA 2ERJC 3ZDXF 4P4RB 4R26L 3PHQB 4TTGA 1BD2A 4I0PB 4K3JH 1JGVL 4TRPH 5C0AE 1G6VK 3GIVA 5GRVK 4PJ8C 1KLUA 2PKDA 1CFBA 3DXAE 1JK8A 3FT4A 3L95B 5B8CA 2AW2A 1WK0A 4LDLB 4BSVB 2VDLH 4G7YH 4OD1L 3WYRA 4APQD 2K7QA 5DDHA 4R7NB 5DVLA 3W0WD 3A6CL 1RZGA 1Z9MA 2VJXA 3DBXA 2DBLL 2PR4H 5GS1A 4I77L 4JREC 3DARA 5HYSB 2VC2L 5D7JD 4CW1A 1DQTA 2CJUH 5LGHH 4WFHD 2BJMH 4JPKH 5DR5L 4OLYL 4NT6A 4NO2A 2F58L 3JWOH 1WEJH 3CDGA 1YZZA 3L3JB 4Q6IA 1A6UL 3N9GH 2V5TA 2PETA 4IRSA 3RGVC 4NC2B 4NC0B 1C1EL 2FHFA 2VDPL 3H9HA 4OM1L 5DRWA 2PYEB 5C0BD 3RHWK 1WQVT 4PJ9D 1E4XI 1SYSA 3M1BB 3NIGF 4U6TA 5F9DC 5F3HA 3LKRA 1FFPA 5AZEL 2CLRB 2E9JA 3VXMD 1FVDB 1J0KA 3QZWA 1Q94B 2FB4H 2NY0B 1NH6A 3VG0L 1XGYL 3S37L 3QEUB 5F1SA 5JOPD 3S5LG 1V7ML 3M8OH 1CXLA 4PJ5A 2F74A 3C8KA 1S78D 3U4EA 1PZUB 1N26A 2PO6A 5DQJA 4LBEA 1YEGL 1ZK9A 2VLRE 4NZUL 4FQLH 5EU3B 4AIOA 5EOTA 3VXTB 3EO9L 3U36A 1IZJA 3PP4L 4JHWL 4YPJA 4MCYA 5DD3L 4NQDD 2FGWL 1EVTC 4I18A 4J12A 5ESQB 1AO7B 2HFGL 3X12B 4XPBL 2EC9T 2P7TB 1XT5A 2P43B 1FJ1B 4PJXF 3RFZC 3U2SA 4FQ1L 3ZYIA 4HSQA 3K8MA 3V6FA 5FXCH 2Y5TB 1RVFH 1HSBB 1BGXL 1U9KA 4L5FH 3NA4A 3IDGA 5LGJA 1AC0A 1EPFA 4NP4L 4JM4H 2VQ1B 2ZZUT 5EIIB 2Y06H 3QXAA 3K2UL 3RI5K 3QHZL 4PJAF 2VITA 4JFXA 3BRGC 2P5WB 5FYJU 2LVCA 4D9LH 3T1WA 1UG9A 5F44A 5JR1H 1UQSB 3PGDA 4M7ZB 4GW1B 5IB3A 4JKPL 3WUWA 3LEYL 1I7RA 3WD5H 5C0AD 5CMAB 3IXAB 4OGYH 3KPNB 5IV2B 2AEQH 1Q9OA 4U1NB 2AEIT 1JWMA 3HE6A 4Y5XB 3QZWG 1EO7A 1QBAA 4DFIA 2V9TA 1RZJC 1HEZA 2I24N 3BPNB 4LQFH 4XP5L 3VFWA 5M95B 2EDQA 1VADA 5ITBL 4N0YH 1Y18B 3TT3H 3QHFH 1HINL 3GB7A 5GS0D 4TNWF 1J87A 1CQKA 1JYVA 1V7NH 3N06B 3S7GA 1Y6KR 2P24A 5K93A 4LPYA 3K74B 4P3CH 1OAUH 4PLKD 1PX3A 4RFOL 4KK8D 3O2DL 4HWZB 5IBUB 4MLSA 3PDDA 5DS8B 3ZHLA 4FFWD 4X7EC 4HFWA 1FCGA 1T1XB 5TF1L 3QIUC 2DL9A 4R4FL 1K3IA 2F54A 3BP4A 3QR2A 3O2DA 4C56A 4GRMB 35C8L 5TDNB 2APFA 1OTSC 4K23L 1EAPB 2Q7YA 2YPLA 1GRWA 2VSCA 5ADPH 4XVUD 3QAZC 1T66D 3I3EA 1WICA 3P11L 4X5LA 4X7SH 4MJ4A 1NCWL 3WUWG 2VLRD 3EO1B 3S35L 1BVKB 1SJEA 4H25B 5HYJB 4WWKD 1HXMB 4JANA 4PJAE 2DS4A 2BC4A 3DVNA 5F3BA 1JYNA 2VL5A 1FO0A 4K7PY 3MRRA 4UINL 4UT7H 2EXWD 1U58B 4HUKB 3CXDH 5EBMB 1ZTXL 5IKCB 4UTBH 4MJ6A 4YZFF 4MAUH 3WFCH 5MEPB 4HK0B 4JDTH 3FL7A 4YHLH 1OSZB 3L5JA 4KMTH 5EPMA 3KLHD 3GZKA 4X4ZA 4AL8H 1JPST 3NTCL 2ZUQB 3G04A 3RWHA 2E5EA 2YSSB 5JLZB 3QIWC 4ZOCA 2CR3A 1JNHA 4Y4HD 3S4SA 3MXWL 5D7IA 3TN0D 3RWDA 3CVIH 5CJOH 3IVKB 1CL7I 3BIKB 4KQ3L 3HZKA 3ESVF 1DBAH 1GAFH 1JJUA 1CGUA 2HVKA 1DCLA 4AG4L 3ARBD 3HUJB 1U93A 2X4RB 4LVOC 5F89A 4MAYC 2Q7NA 3RA7L 3MC0A 1J8HE 1OP5H 1XF5B 4DFHA 4HWEH 2J6EL 1F6AB 4FOMA 1WC7A 4U1IA 1X5JA 1FL3A 2XWBB 1XGTB 4MD4A 4U6HB 1UWGH 1F3RB 2C9AA 4MS8C 1Z5LA 2WINA 3L7FA 1GC1H 3H8NA 1BQUA 4TPRH 3LZFH 3WLWC 1JYXA 4GMSL 3JV6B 4NQCB 4BQCA 3EOBA 2H41A 4P2OA 4YHYC 5E03A 4HQQH 1MCKA 3OKEA 3O6KL 4KQ4H 1NCAH 1TVHA 3P4NB 4RWHA 1BIHA 5F93C 1HXYB 4K55A 3RJQB 3DI2B 5T5NG 3CFDB 4P59L 4UDTB 3TT1H 4YO0A 1S7TA 1VKXA 4HDIA 4RX4A 1J0YA 3VXQA 3EDFA 4R4BA 1IAOA 1PYWB 4D9RE 3LD8B 3KXFE 4KJPD 1DQJA 2X4PB 1MJUH 3P40A 3W0WB 3T4YA 3ES6A 1BFVL 4AY0A 3S4SG 2AK4A 4S2SB 1MHPH 3IDNA 4JFOB 4EIGB 3MNVA 5FKPB 2WMPA 5GZND 2VXQL 1JF1B 4DN3L 2DLEA 4L9LA 2R69L 3ZSTA 4G7VH 4LSSH 1UWXH 2GW5A 43C9B 3IETA 1AE6H 3H6JA 3E6HB 4Q9QL 1DBBH 4JPVL 4X7TA 4PD4J 5KSBB 5J3HD 3UTSE 2Z31A 3R0NA 5E2WH 2R1WB 5C0BB 4NNXA 2WP3O 3QPXL 3JTSB 5KAQF 1DZBA 4WEMB 3HB3C 4P2QD 3RTQD 1ND0B 1A8JH 3CFKB 4P5TC 5HHNB 1NCNA 1J1OH 4TSCL 4ACPA 1VPOH 5K33A 4E42B 2R8SL 1EVUA 3INUL 4GRWB 5FOBA 3ULUC 1BX2A 5B4MC 3GJFK 4UTAL 5CILH 2AXGA 4NQDB 1U3HC 5DD6B 5HGGS 4ONHB 3MUHL 2Y4SA 4X6CF 1QSEE 4K2UL 2EDYA 1Z0NA 2R1YB 1YYLH 1D5IL 1J8HD 4EN3C 3NFNB 3CVHH 5ESVA 2YUWA 2V17H 3CH8A 4M7JL 3HMXH 3SDCB 1MLBB 2ADJB 2V2WA 2AI0L 2F5AL 2H9GA 1AI1L 4PR5B 4DW2H 1BLNA 3IFNL 3QJHB 2GJJA 4F7EA 2XWJB 3LB6C 1LE5A 1I3GL 3B6SA 4OZFH 1KYOJ 4YDIL 3GUTB 1I7UA 4H8WL 4AEEA 5DMIH 3SKNA 2AJUH 1JUFA 4JY6A 1I8IB 3C87A 3RPKA 5ICZB 1MUJA 4YBLB 4OZHF 5GS2H 1NBYB 4GRLB 5C0AB 2UWEB 3SDAD 5D7SH 3DXAB 3P9MB 4OFPA 1FYTA 5CIPH 5MENE 4BFGA 3E3QC 4MWFA 3ARDC 2CDEB 5IHZA 3KXFD 2FBJH 5F8QC 4MA7H 2EE6A 2J88L 2H3NB 5DT1L 3IAPA 3KS0J 3I3BA 1QLRB 3NCBB 4D9QD 3QNZB 2ARJQ 2CH8A 5HGHA 3GI8H 3BI9X 5DTFA 4HF5H 3AREB 3WN5C 4LMQI 4ONOA 5GRXG 1R3LB 3F6LA 1XF4B 3QXWA 5E6ZA 3UTSD 5HGBB 4K71B 1X6LA 1T3FA 4OLZH 2YD5A 2LTQB 5I19H 5EZOL 4S1RL 4R0LB 4WU5A 1K9TA 4UQ2B 5HDBE 2R0WH 5KANG 3CSBA 3IFOB 1XF3A 1N6UA 1HI6B 1FAIH 2C3HA 1AP2A 1YNLH 1KTDA 4KK5D 1EUTA 2MKLC 5GRJH 3G08B 1JHTA 4LCWE 4HGMA 4BSWB 2L7JA 3ZT5A 3KYKL 4RDQF 3FAWA 4JG1L 4F57H 2VLRB 4LVNC 3MNWA 4Z8FH 2DM3A 1OAQL 4WWKB 1KV3A 4M93C 1WTLA 2IPKA 3EBAA 4QXGH 2LE9A 2R0KL 2H6PA 3FONA 3MRNB 1VFUA 1UH3A 2X10A 2BVEA 1MI5E 4JLRA 4XB8A 2CD0A 1QSED 1Q9WB 1F8TL 4XP1H 5CBEA 4OZHE 2XG5A 4U49A 4J4PC 4F33B 2DAVA 3U9UA 2ICWA 4YH6A 3CX2A 2QSCL 2NY4D 3DGGA 1F6FB 4BZ1H 12E8L 1CWVA 5JA8B 2BDNL 4XPHH 1GOFA 2ATPB 2MCPH 2JIXD 4XWOC 4Y7MA 1YEEL 1EA9C 3RIFF 3AY4C 4YX2H 4YXKH 2W92A 3C2SA 2HKFL 4GBXB 3QQ3A 5C08E 4X5WA 1WT5A 1QYGH 3STZB 4Y4HB 4CN1A 3D69B 2A77L 4XB7A 2VH5L 5IW1B 5BZDB 5KVGL 1IVLA 1F4XH 1FGNH 4NHCH 5FGBA 3TN0B 5A43C 4TUOA 3WJJC 1D9KD 1DBJL 4Y4KD 4Q0XL 5FCSH 4TVPL 2WAHA 3BMWA 1WGOA 2K7PA 4DVBB 3TH2T 2IBZX 3MGTB 1RFDH 5DUPH 4NZRL 3HNTL 5HI4C 3SGJC 2XTJC 3HPJA 5MEND 4ZFGL 1JWSB 4XC3H 3FFCA 3OHXA 2KZ1B 3SE4A 1XIWC 2JK5A 3D39A 4JFFA 4JZJC 2EIZB 4U6YB 2XXMB 1WZ1L 4N9GB 2HKHH 3QCTH 5GISH 3VE0B 2Z9TA 3AS2A 4LHQB 2B2XH 3L5WA 4FMKA 3BZFB 1G9NH 3BPLB 4KKLC 3WS3A 4ZNCD 1HZHH 3I6KB 1MY5A 2YMXH 3MLWH 3LS4L 4POZC 1EXUA 5CJ5A 1ZT7A 5E2TL 2DM7A 3NIDE 4M6NH 5DRXB 1UZ6F 1OTTD 3QDME 6FABH 3QUML 5KTEH 3K4ZA 5T3XE 1KPVB 3P77B 4WW2C 3U82B 3GRWA 4MDJB 4NN6C 4QRQA 4NRXA 3CFEB 2FYYA 3MRCB 5E8EA 5I71B 5DJ8B 3SGKC 5C7XH 1UM4L 2H26A 3TZVB 1WIOA 3QP3A 4OLVH 3VMOA 4GSDL 3GSQA 4KK6D 4PJXB 2ICWI 1CXKA 1FZKB 4FQCL 2Q76B 2R2EB 2IGFH 3OAYK 1ZVSA 2AJYL 4KHTL 5FCUL 2CKBB 5DA4A 2D7PA 3B9DA 3VWJB 4KJYA 3QDHA 4PJAB 1ZA6B 1CXHA 4N1CA 4LP5A 3SOBL 4UIMB 1MHHB 1VEOA 3TVMA 5F7EL 1MI5D 4NWUL 2YXFA 1E4KC 4Z7WA 1ZLVH 3SBWC 3ROOB 4ZUUB 1D5MB 3Q2CA 2PYFA 1JFQL 2D3VA 4IIQB 1N5AB 1OCWH 1S9VB 1RZIA 4ZD3H 2NW2A 1K2DA 4WI9A 4Z7QF 2BHUA 4Q6YA 3GM8A 5DXWA 3RTQB 3K1DA 1MCWW 1OOAA 4NN7C 3BEVB 4OTXL 1NBZB 3H7LA 4PJFF 3MJ9H 1IGFL 1L0YA 2VXTL 5C08D 1FE8H 1FBIH 4AENA 1B6UA 3AUVA 5E6IA 2A1WH 5CFHA 3EW3B 5DI8B 4I9WE 4Z77A 2DQFB 4P4RA 1YJDC 3F12A 3O8XD 3PHQA 4U7KA 1QFWM 2ZSVA 1OARH 4I0PA 3R8BB 3JSSA 1NAML 4OF7A 3TYFB 1WAAF 3O3AB 4MA3A 1J8HB 3GIZL 3L95A 4PBWD 3U7YH 3JV4B 2OLDA 3ESUF 5DFVD 5E00B 3SE3A 3BRDA 4R7NA 1JNLL 4JJ5B 5IFAL 3QWOB 4GXVH 4LLAA 3KGRA 4LSRL 1SYVB 2DMKA 5HYSA 3PL6C 1CIDA 2R23B 1U8OB 5LBSL 4HUMB 4RIRB 3QDMD 1EJ6A 4PY8I 4DOHE 3EO0B 1J1PL 5T3XD 3RHWF 3O6FD 2DQDH 3SDAB 1ZHKB 5TGBA 3L3JA 1MFAH 1M1SA 3CXHK 1AC6A 5DUBB 3MJ7A 2PYEA 4PJIF 2H2PC 1DANT 2MMXA 3M1BA 2ADIA 5I0DA 3KXFB 2BY3A 5LG1A 1FVDA 2AABH 3C2AL 4X80H 4OIIH 5JHDE 1Q94A 4LASH 3QEUA 3REVB 2YD1A 1TPXC 1FNFA 1KN4L 3VRLF 2GCYB 3OXRB 3VFSB 4JR9L 3CZFB 3ET9F 3MXVL 1KEML 2ICEB 4YFEA 2HRPH 5EU3A 1BFTA 5T1DH 2XQYK 3C5ZC 5EWIL 1H3UA 4KKAD 4MA1C 2WBWB 5ESQA 1QNZL 1AO7A 3CGTA 3UTSB 1T5XB 3PWJB 2F5BH 2A9MH 4AM0B 3R4DA 2P7TA 5I1DB 4OZ4B 5TDOB 5DEGB 1NCBH 1FJ1A 1LO3L 1MRFH 1N4XH 3FN9A 3HRPA 3RI5F 3QUYD 2X89A 1ORQB 1HSBA 4B41A 5HYSG 2FX8H 3KLDA 2VQ1A 1W0YT 3GI9H 2VUOA 3O4OC 3O6ML 3CDCA 5J6GB 1IEAB 3GSVB 4BFBD 4XPGH 2FJHB 4X4MA 4MXQD 4JQVC 5D1XC 4M3JA 4ODTL 4K9EH 4LIQL 1UQSA 1G7LB 2KBGA 4DEPB 4GW1A 2ORBL 4OQTL 3LQAC 3UXFA 2DI9A 5T1KD 1L0QA 1QSEB 4PLJC 5I6XC 5CMAA 3ULVE 3IXAA 1QBMH 4NN5C 3HG1E 4ODSL 5FFLA 5IV2A 4U1NA 4Y5XA 2NY4B 1JTOA 4QRPA 5CKAA 1OP3K 4OQTA 3F7VB 3GSXB 2ADFL 4PJIE 1VERA 2JIXB 3IAQA 1EEZA 1Y18A 1A1NB 4XNZC 4MJIA 3GSWB 3JZ7A 4S1SL 1A7RH 4LHJB 3W5NA 1MRCH 3F6IA 2ZUVA 1F3JA 5ALBH 4DTGL 1HH6B 4M7LT 4ZUWB 5IHUL 4YQXH 2D0FA 2BY2A 4XNXH 4UV4L 3VRLE 1LEGB 5AG8A 4HWZA 3F7YB 1PD6A 5MENB 1JN6A 4DUXA 3X3FH 1B2WH 5E99L 1T1XA 5GGRB 3C5JB 3S3JA 1CFSB 4M6OH 4RISH 5EUKB 1CLYL 5JHDD 3C5SB 4GRMA 4Y5YA 5CJQH 5I8OL 4GG6F 4KPHH 1AGCA 4LKXA 4OFYD 3WIFB 5FM5O 3ZKMD 5I15L 5HHOE 2BHYA 1GGTA 3KLAB 4HX1B 4IRJC 3WS6C 1BVKA 2HA1A 2BMKB 1F4YL 1IKNC 4MQXD 4H25A 5HYJA 1HXMA 4BK4A 3T8XB 4QTIL 4M5YL 5CEZH 4M1DL 5FECB 2NNAB 5IBLC 5C1MB 3FQXB 2OR7A 1P4IH 5JOFA 2AJXH 3ROLB 1TQBC 1U58A 4ZS7H 4CVWA 4S10A 4GKOA 3VXSE 4N8VB 5EBMA 3BKMH 5FO7B 1OM3H 5IKCA 3VGHA 1FL6B 1P53A 4E0RB 5KG9B 5MEPA 4HK0A 1D7FA 4FFZH 2EIDA 2GAZB 2A6JB 4LCWB 1ES0B 1OSZA 2PXYB 1GGIL 2V9QA 4LSUL 2YSSA 2W91A 5JLZA 5D70L 1JGVH 2UUDH 1QRNE 4PRBA 4Y2DC 5IBUG 4WUUB 5GRUL 2R56L 3IVKA 1MI5B 3BIKA 5C0IB 3K1KC 1KBGH 3BZ4B 2ZOLA 3ULVD 4OZHB 4OD1H 5ERWB 3HC0B 3HPLB 3HG1D 2OR8A 3HUJA 2X4RA 1OD9A 4M7KH 3EYVB 1OY3B 1RQ5A 4BUHA 1XF5A 3L3KA 4P23B 4X6BB 1F6AA 4KHXL 4CDHA 3RX8A 3OKNB 2XWBA 1XGTA 2V5MA 3GO1H 2QJDA 4N5ED 4U6HA 2X1QA 5ITFB 5L8LB 1PFCA 2H8PA 1T80A 5C08B 5IVNA 5I73B 1T2XA 4MD0A 5DZLA 3EJZD 3QCVH 3HC4L 3JV6A 5CINL 4F2MA 4GG6E 3KHQA 4OZGA 1A6UH 4NQCA 4WY7H 1RJYB 1TVDA 5D2LE 3P4NA 4E41B 5H94A 2ZSWB 2PN5A 1HXYA 5K9OB 3GKWL 3MRBB 5EO1B 3CFDA 1MAKA 3D85D 3TYGH 4UDTA 3S37H 4NBZB 4NRYA 3QYCA 4YPGB 5BVPL 3DV4B 4TULH 4OCRH 4LOUC 2XV6B 3L3IB 1YEFH 3S36L 1PYWA 4AEHL 4APQA 4C54A 2X4PA 4NZUH 1C7TA 3A67L 3EO9H 3W0WA 2FH8A 3KPQB 4S2SA 3NBNA 1DEEB 5HHOD 1B4JH 5D7JA 3DI3B 1IFHH 5FKPA 3RJDA 1JF1A 3FB8B 3DUSB 3NGBC 4JAMB 3C6LD 3QDMB 4HUNB 1YPZE 4D3CL 43C9A 3MJGX 3O6FB 1ZEAL 3WFZA 3LEXB 1UH2A 4FQ1H 4P49A 3E6HA 4NJAL 5KSBA 1O7SA 4PG2A 5CJ8A 5C0BA 1YMHB 1BGXH 1JF5A 4PJ9A 4H1LB 1CR9L 5FO8B 4NP4H 1G0XA 4E9LA 5F7HA 3JTSA 5AAWA 3K2UH 4PGBB 5KS9F 3NACL 1VB9A 4IDJH 1ND0A 3CFKA 4QEGA 3RNQB 4FFYL 5HHNA 4ETYA 4JKPH 4E42A 3U9PL 1RZ8B 3LEYH 4PREB 2NYYD 3MV11 2IH1B 3FQWB 3HR5B 4U7MA 1JPSL 1MCLA 3S88L 5GHWH 1FRGL 4Q9BA 4NQDA 4MX7B 4G3YL 1CFTB 5CZVL 2FJFA 1T2QL 5IVZA 5D7LB 4ONHA 4XHJC 3H42H 1WFOA 3KPMA 4ZYKB 4OT1L 1D6VL 1HINH 2Z8RA 2X05A 3NFNA 5HDQH 1AY1L 3HE7D 4MJ5B 3F58L 1BBDL 1KLGB 3SDCA 3QUYB 1UEMA 2ADJA 3B3IB 4PR5A 5ECJE 3QJHA 2XWJA 2DJUA 4RFOH 3GUTA 1MCFA 1AD9B 3HNVL 3P9WB 2KH2B 5HHVL 5TDPB 3QEGL 1ZA3B 4LEOB 5HTSA 1CD9B 5ICZA 4Z7VF 5T1KB 5TF1H 4R4FH 1NBYA 4GRLA 3MBXL 5CWSB 4RGOL 5C0AA 1T7WA 3O3EB 4DKEL 1I1RA 5GS0L 4PRHB 4ZXBD 4K7PX 3DXAA 35C8H 1FLRH 2VZOA 4K23H 1NFKA 1OAYH 2CKBH 1TETH 4KY1H 3LN4B 4PB0L 1IAKB 3EOAB 2BP3A 2GTZB 2XNAB 1RUPL 4TVSa 4WV1C 4Y1AE 2H3NA 5CZKA 5KS9E 1UCBL 4ODVL 2Q8AL 1MJJA 3ARQA 1QLRA 5K59E 5BV7C 1T2JA 4N8PA 2YS4A 3W82A 3ULUF 5F7LB 1UA6L 3DVGB 3JUZA 4JRYE 1PEWA 4DOHB 4XZUA 3I02B 1ZTXH 1R3HB 4XH2B 1R3LA 1XF4A 3QUKB 5HGBA 1YQ2A 4ZS6D 4LGPB 1IAIH 1K85A 1RHHB 4R0LA 4HW6A 3MLUL 4D0DB 3S35X 3FO0H 1HI6A 5JHDB 4L8SC 4HT1H 4QCIB 4X99B 3M17B 3UMTA 3QIUD 2FZ3B 1L7TH 4IRZL 3G08A 3QI9C 3EYFB 2WIIB 4OCLC 4PJFB 3ARPA 2VLRA 2KPNA 4U2YA 2ED8A 5JUEH 4WWKA 2YBRA 4WI4A 3HI5H 5JZ7C 4BUGA 3G5YA 5GJTL 1V3JA 3MRNA 2Y25A 1BHGA 5HHPB 2J6EH 1QQDB 1RZFL 5F71A 5LQBH 1RULH 5F6IC 3PDOB 1A6TB 2X7LB 4F33A 4HLZH 4NWTH 3VRIA 2JTDA 2V9RA 2QSQA 1XFPA 2BZDA 2Y7QB 4GAJL 5E4IA 1CLZH 5C9JB 5CUSH 1RZKH 1J7VR 4GMSH 2ATPA 1EEQA 3UYRL 3BAEL 5EU5A 3KJ6L 1CDIA 4LF3A 3O6KH 4GBXA 5CSZB 3D18B 3MV8E 1QTYT 1FH5H 5J11C 4Y8DC 3STZA 4RQQB 5MI0C 4Y4HA 2FX7H 3D69A 3R8QA 5IW1A 4N1HB 1IGML 5KSAC 1ZLSH 4RAVB 3TN0A 4YE4L 32C2B 5HHME 3LH2H 1NQBA 3QIWD 3LEVL 4U2ZA 4DVBA 4DGYH 3MGTA 1HK6A 3LPGA 1J0JA 3HG1B 4AH2B 4XPTL 4NO5B 3MFFB 3Q6GL 3IU4H 4U6YA 4PJIB 2W65B 4N9GA 3VE0A 5LWYH 1TVBB 4JN1H 4DN3H 1JI1A 4Y1AD 1LO2L 3BZFA 1K8DB 4B0MM 2YN5A 5JMRA 1MOEA 1WJ3A 4CRPA 1MH5B 2C1PB 4QHUB 3TA3D 3I6KA 5LJYH 3T0XA 2LAAA 4UB0L 4DCQB 4Q9QH 3HR6A 4JPVH 5D9SB 4JRYD 4O2EB 2VISB 5BOZG 5DRXA 3AM8A 3P0YL 1OWWA 2DMCA 4I13B 1KPVA 3P77A 3TJEH 2ERJB 5TQ0H 4MDJA 1U42A 3KPRE 3D85B 1FZMA 3CFEA 3QG7H 3MRCA 3JBG7 4WRLA 5FYLH 3UJJL 4TSCH 3AS1A 2QHRL 4UIKL 2V2XA 4RMRA 1VGEL 4P4KC 3GSUB 4PJDF 4R6UA 4XMPL 4XVTL 3SKOB 2OZ4A 1FZKA 4HUWB 2R2EA 5JDSB 3PJSB 5HHOB 4OZIF 2CKBA 3G9VA 3U30C 3VWJA 4PJAA 3C6LB 1ZA6A 4HS3B 5C8JB 1D5IH 4UIMA 1CQYA 1IGCH 1TTUA 1B0RA 1A5FL 4JREB 1EGJL 1MHHA 3CLEL 5F7DB 3D48R 4M7JH 1BZ9B 2HP4A 4J8RB 3VXSB 5JW4M 2AI0H 3ROOA 1D5MA 3BQUC 1NBVH 1AI1H 4S0SD 2YC1B 1N5AA 5C0RH 1S9VA 4LSDA 4YDIH 3ALPA 3KWWB 1I7TB 4OQ1A 3T3MF 4D0BB 1QA9A 1TJHL 3RGVB 1EGJA 4Z7UF 3RTQA 3A6BL 3BKCL 3VI3F 4ZO9A 4M6AA 1P4BH 3P9LB 4YXLL 3BEVA 1NJ9B 1XGPB 1NBZA 4BM7A 2CRMA 4XVSH 4YHML 4DQOH 4OD3H 1H8SA 2WBJC 1CN4A 3VFOB 3MV8D 3WKMH 2XZCL 2YPVL 4N8CL 3AMLA 1QRNB 2CXGA 4HJGB 4QHLB 3CAFA 4P5TD 5DI8A 1MJ7H 1Q9KA 2DQFA 2P46B 5HHMD 3MO1A 4JPIB 3NABL 1CD1A 3L7EA 3JTTB 4W70A 3TYFA 3O3AA 2DKSA 1KEGH 4WW2F 1J8HA 3IS0X 3HE7B 2AK1L 3K7UA 4J3OC 1D3CA 3OGCB 3H3BC 5JW4R 5IJKC 3JV4A 5JXED 5A3IC 3IAGC 2VR9A 1QFHA 2P8PB 4RGMC 5E00A 1FORH 1FC2D 3CH1B 1GH7A 2EH8L 1LNUB 4JJ5A 1WIPA 3QWOA 4GG6B 2C3GA 4YLQT 1WISA 2RCSH 1SYVA 2ZUWA 4MMZC 5DD1H 1IC4H 2XZZA 2R23A 1U8OA 4JVPA 1H5BB 3D25B 1CDCA 3AMKA 3QNYB 4JEGB 1QVOA 3F65A 1CDGA 4S1RH 3EO0A 1B4RA 3BX7C 4OGAC 4YJZL 3SDAA 1T89C 4FXLA 3KPRD 4HAGA 5BW7A 1HH9B 5CP7B 3I6GB 2ADGB 3RWFB 1H9VA 5AD0B 3GK8L 2YA1A 3KXFA 3RDTD 1YN6B 1R5IB 3HAEB 2Y1VA 1N0XL 3V4VL 1NC4D 1VACA 3TH3T 4NFBA 1S9WB 4F58L 4F8QA 3RZCC 4Z7UE 2W9LA 2XYCA 3VI3E 3THML 3REVA 1U8NB 1JNJA 4BQ8A 1AHWC 1CE1L 2GCYA 3OXRA 3VFSA 3CZFA 4LDOB 1F8TH 4GS7C 2ICEA 2ED9A 4GAGL 3D3VE 1KPUB 5HHXL 4F7CA 5DHXB 2QSCH 3V5KB 2DM2A 5HJ3B 12E8H 1W0VB 2BDNH 4KI1A 3SKJH 3UTSA 3VD9A 1T5XA 1U95B 3PWJA 5MP6L 4AM0A 4HS6B 2R29L 5I1DA 2P42B 1I9JL 4OZ4A 5DEGA 5TDOA 1KULA 4YNYB 4KRPD 2HKFH 1GPOL 1T21B 1IQDB 1ZMYA 3WHE1 4AEFA 2XRAL 5BS0E 1ORQA 3QIUB 4B50A 1DBJH 3BXNA 3U1SL 1YQVL 4Q0XH 2NY6C 4TVPH 1LK2B 5C6WH 1FIGH 1MY7A 2B5IC 5J6GA 1IEAA 3GSVA 4UQ3B 5EU6E 3OF6D 1SVZA 4NZRH 2FJHA 3HNTH 2H2SC 2IQAB 4ESKA 1A47A 1QP1A 4NCDA 3QAZB 5JIIA 1HHJB 3CU1A 2YD2A 3SCMC 4MDIB 1QSEA 1U0QA 4MD5B 3DO3A 2C3VB 5E8PB 1GIGL 4EVNA 3MLPA 1XAUA 1NLDL 3PWPE 1BBJB 1WSST 3BPCB 1TJGH 4NNPH 2YRPA 4Z95L 4M8QB 5GGSB 3F7VA 4OKDA 4IMKA 4HG4J 3CC5B 5C0FB 1QR1B 3CDFA 5EO0A 2JIXA 3UZEA 5E6YA 1GZQB 1L6XA 5E2TH 3KYMB 3GSWA 1R5WB 4OLWL 4OLUH 3LAFA 5ETUB 2WP3T 1HH6A 1P6FA 4LSTL 4LCIL 2VZ1A 1LEGA 5DK2B 3VXRE 3QIWB 4DWHA 5JQHC 1MVFA 5A2IH 3F7YA 1JRHH 2EO9A 5C2UB 4HIJB 5MENA 5ADOL 4FQCH 3DETC 3P4OB 1L9MA 4P5KA 2OTWB 3V79C 3C5JA 5FCUH 1CFSA 3I75B 5EUKA 5IB5B 4MAYB 3FMGH 1U8IA 3C5SA 4MCZB 2X41A 3E6FA 1CF8H 1MFEL 5KS9B 4LSQL 1QZ1A 4G8FB 3MREB 3GJFB 3N85H 5F7EH 1V3KA 2FR4B 3WIFA 4NWUH 3KLAA 4HX1A 4JRYB 1LILA 2BMKA 3D3VD 3MRMB 1JFQH 3AS3A 3T8XA 5FECA 3TJHD 2NNAA 2DRUA 3CFIC 3FQXA 4YHYB 4ODUB 3ROLA 4JO1L 3VD5A 4Z5RA 3GMOA 1TZIB 2CRZA 4ZQKB 4OTXH 3BGFC 1KG0A 2BSED 5H37G 4N8VA 5FO7A 3VWKC 1IGFH 5DC0A 1FL6A 2VXTH 5D8JH 5BOPA 5C2BL 3AS0A 4LGRB 1FHGA 5KG9A 1NGPH 1DQDH 5D96C 5GGRY 3NFSL 2V6HA 2VLLB 2GAZA 3CSYB 2A6JA 4O5LL 3VGAC 5BS0D 3QB7C 2PTTB 3VA2C 4LCWA 1ES0A 2L4OA 3MACL 5DJYB 4CVXB 1JYWA 4BFIB 3GMQB 5EU6D 1NFDF 3AC0A 1AKJD 2IAMC 2M26A 2HMID 3OXSB 1NLBL 2IALB 1MI5A 2AP2A 2ZCLL 5SWSE 5C0IA 3KPPB 1TIUA 3BZ4A 1S9YB 3ME0A 4Z7VB 4OZHA 5ERWA 4M61B 3EDKA 3HC0A 3HPLA 4K3HA 3EYQC 1FSKC 2FECI 2QHLA 3EYVA 4WHTA 5KAQG 1JNLH 4PJBE 5IFAH 2WWMD 4P23A 4X6BA 1SBSL 1TJIH 4LRIA 3OKNA 4LSRH 4LLMB 4FN0A 4CU8A 3TO4D 5ITFA 4K94L 2KDGA 1IZKA 3GGWB 1P1ZB 5C86A 1DLFL 4JO4H 5C08A 5DGRA 4UAOC 2DJ4A 3SE9L 4KZEH 1T7XA 3MOBH 2IH3A 4KDVA 4P5TB 4PRIE 5T1LB 1RJYA 4P9MH 1UVQB 4EOWL 3RAJH 3VXRD 2HWZL 2FEEL 4ZFOB 1KUMA 4M7LL 2KUTA 1H3XA 1T1ZB 3PQYD 2ZSWA 4N8VG 5K9OA 3MRBA 5EO1A 3ZKXC 3C2AH 5L9DL 4FZEH 4LGSB 1QFUH 5IMMA 4QHMB 5IEHB 3DV4A 1U3HB 2EE9A 2W9DH 1E0OB 2A73B 4PV8B 2VABB 3MXVH 1O7VA 1KEMH 1BWWA 5T3XL 1RJZB 4DZBB 1IEHA 3NZ8B 1KXQE 4EUPB 5BJTB 4WI7A 1WBZB 4A2LA 4XCFH 1DEEA 4RA3A 1MCQA 5FO9B 1J0ZA 4JDZB 4EI5C 5DK0B 5DEFA 3FB8A 4JAMA 1INEL 2ATKB 4RZCA 5I0ZA 3QDMA 1TENA 2WIMA 4QLRA 3LN9A 2EDKA 2HTLD 3DIFB 2OP4H 2AJSH 4IS6A 4YR6B 3O6FA 3PL6D 2G2RB 4U1SB 2CPCA 3LEXA 4NHUB 3FO9B 5F6HI 4UT6L 2YPKB 5JW5B 4C58B 5KVFH 2Z4QB 4AIZB 4Q9RL 2X1WL 2AS5M 4WCYH 1YMHA 5E95B 1HSAB 3MA9H 4H1LA 1C16B 1R0AL 5FO8A 1OLZA 3BUYB 1G9MH 3O6MH 5HXMA 4PGBA 5F9OL 1ZGLA 1URLA 5GRYA 5FHAH 1MQ8A 1NC4B 4MQSB 2AGJH 2QR0A 3RNQA 3ARDB 4FP8L 2FIKB 2ORBH 1V05A 4PGDB 4TSBL 4X83A 5ISZD 1RZ8A 3EHBC 4HC1L 4OM0H 4WO4C 5F9AC 2R0LH 4PREA 2IH1A 3FQWA 3RP1A 1MSPA 3HR5A 3KYNB 3QUZD 4EI6B 4ODSH 3BKJL 3SJVE 2FSEB 5SWSD 5EH1A 5C07B 3H9ZA 1S3KH 1LHZA 2DTSA 2EXYD 3MLRL 4HC1A 4NCC2 5D7LA 5JQ6H 3C5ZD 3WN5B 2OJZL 1XCQB 4ZYKA 2D03H 3OTTA 2FL5B 1MCRA 3UC0H 2CLZB 1X3DA 3QUYA 4OCWL 1KENL 1WTGT 3B3IA 5IHUH 1F4WL 4L8CB 4UV4H 1FZOB 2KKQA 2FEEI 4RDQG 1CU4L 3JVGC 3QWQB 4HBCL 1AD9A 2EECA 5IESH 4WHYG 3IU3B 1MPAL 1JNNH 5TDPA 4PRID 4J3WA 1ZA3A 1SBBA 4KK9C 4LEOA 1MVUB 1CZ8L 1BFSA 1N64H 3ARTA 3B5GA 4Z78B 5T1KA 4LVNB 1P2CA 2VZSA 5CWSA 2EEDA 1BJ1H 3O3EA 4M93B 3TNNB 1CBVL 1CLYH 4H1LG 4P99A 5JORB 4PRHA 5DMJB 3DOSA 3JWDC 3L3GB 3PXJA 1MNUL 3LQZB 1E6OL 4G6AD 4U6VL 3LN4A 4JKWA 5TE4H 2AXFB 5AZ2H 1IAKA 2VUYA 3EOAA 3QXVA 1GHFL 5C09E 4TUKL 2GTZA 2XNAA 4PJCF 1F4YH 4PJDB 4QTIH 4M5YH 1M7DB 1S7VB 4X7CC 1W72L 5AEAA 5J9PB 1N5YL 4NQSB 3MLSH 4NGHL 4OZIB 1G6RB 1EHLL 3DVGA 2VB5A 3I02A 1P7KB 5IG7B 5L88L 1R3HA 1DL7L 5F1IB 2EDDA 4XH2A 5T1MB 5AAMA 2DM4A 3B9EA 3GMRA 4BKLB 2HT3D 1RHHA 2EO1A 3O0RL 5CEYB 2CGRL 3L1OL 1JVKA 4D0DA 1Z3GL 3RWGB 5CJXA 5JHDA 5D70H 3T09A 4XXDB 4QCIA 4YBQD 3RU8H 1XIWB 4Z7UB 1P9MA 2FZ3A 3UTTE 5GRUH 2R56H 2V7NB 1E4WL 1ZT4A 5LXGH 2X09A 1MIML 5EU4B 4O9HL 2GI7A 3MRLB 2LV4A 4DAGH 3D3VB 5KOMC 3SJVD 3GDBA 3VG9C 3H2WA 3UPAA 3UX9B 4JFZH 5HHPA 4IRJD 3STLB 4ZAKC 3HI1B 4HS8L 1RI8A 2VDNH 1L0XA 3PDOA 3NPSC 3VXNB 4DKFL 2X7LA 1P6AB 1YDPB 3V4UL 5IBLD 4WW2B 2Y7QA 1GGBL 1U3ZA 4NN6B 5C9JA 5BS0B 3QULB 1MCIA 2NY3C 5TPWL 2BVYA 5C0DB 3FB6A 3ULVL 4PJCE 5CSZA 5EU6B 3D18A 3WCYA 5I1JL 5FUOL 4RQQA 1AKJB 3GKWH 4X6DF 2J5LC 3VDCA 5ILTL 4G8EB 5BVPH 3S36H 2X4SA 2Y23A 4DKDC 3HG1A 1RZJH 1F5WA 1TFHA 4AH2A 3WFDL 3PWPB 4NO5A 4BFEA 2DQTL 3MFFA 1N6VA 4HIHB 3O2VL 1I85A 3LRSB 1DBKH 2W65A 4PJIA 5C09D 4XCCL 2CDGB 1GCFA 1TVBA 3I2CL 3JV5A 3VI4E 1K8DA 3KPSE 4G9DB 4Z7NF 4HD9A 2VDKL 1MH5A 1I9RL 4QHUA 4RMWA 1T1YA 2G75A 4NN7B 2I27N 3NZHL 4DCQA 4X4XB 3ZTNL 4NJAH 3O6LL 4UU9B 4W4OA 5D9SA 5F88B 4O2EA 5DJCB 1LD9B 3VXRB 2O26U 3E0GA 4Q6IC 4M00A 5CD5C 2YWYA 1A7BA 4IRSC 2BRRL 4J7RA 1PX4A 3NACH 1KCSL 4X8JB 2MQCA 3BDBA 4PTTB 3D85A 5IK3B 1I1FB 4R97C 5I1AB 3PP3H 3C8DA 4PGCB 4UT9H 1A3LH 5FV1L 4GKSA 3GSUA 3WUZA 1BAFL 4LFHD 3SKOA 4HUWA 5JIHA 3UTTD 2PO6C 1FRGH 5JDSA 3PJSA 5HHOA 1EO8L 2OXHA 5CZVH 5HYIA 4NO0D 2F54D 2MQ3A 4IOFD 4LLVB 3W5MA 1YEJH 3C6LA 4EIZC 4HS3A 3EOYG 4I18C 2X4TA 1AY1H 4YBHA 3VXUE 3F58H 3PL6B 1T20B 3GSNL 4X6DE 1BZ9A 4LLDA 4J8RA 1H3PH 2IMMA 3VXSA 1FVCB 3RBGA 4NKDB 4F7MB 2YC1A 4ZTPH 4WHDA 4L3EB 3GM0A 1VFAB 1I7TA 3HNVH 3KWWA 4JHBA 4CDGC 4D0BA 4JFPB 3MLXH 3GSNA 1EBAA 3MLYL 2NY5L 3SDYL 3P9LA 4OF0A 1RZ7L 1BEYH 1NJ9A 1XGPA 3Q1SL 4P9HL 3JUYA 1G7PB 5KOVC 5EOCJ 3TPUB 1ZHLB 2IPTL 3MBXH 4NM4L 1QRNA 5DRNB 4XI5C 1YEIL 3QUZB 5GS0H 3O3DA 4QHLA 1E4JA 1RUKL 1PY4A 2GJ6B 5SWSB 1EHNA 4JPIA 2JJWA 5E8OB 4PB0H 1KB5L 3OGOE 3JTTA 3C5ZB 4FA8A 1ADQL 1RIUH 3ZYZA 1TZHB 3GJFH 5DLMH 4MA1B 3OKKB 1N6QH 2QQQA 3HE7A 4PJBB 4BELD 1UCBH 4OIAA 1S7QB 2Q8AH 3E1F1 4BQ9A 2ZCKL 3QXDA 4G6KH 3T65A 2P8PA 4MXWH 4OLXH 4UOW0 1UA6H 5DMGC 1ADQA 4G8GE 1LNUA 1OAXL 1WWCA 4GG6A 4OB5H 4PRIB 4YC2C 1JGUL 5CZXC 4EKXA 3B83A 2JB5L 4PP1C 3T0AA 4GG8B 5DWUL 1H5BA 3D25A 5A2KH 3M07A 3MLVL 3O4OB 4M1CC 4ZG1A 3QNYA 5I1HL 5D2LA 2SEBA 3LKPB 2RB8A 4LAQL 3MLUH 3PABB 1QKZL 1L4IA 3QH3B 5E5UB 1NGYB 1Q72L 5FYKH 4ZXBA 3PF2A 3NCEB 1HH9A 5CP7A 3I6GA 4IRZH 3OZ9H 1DQMH 4DGVL 1U8LA 1E6JL 5AD0A 5H8DA 5I6XB 1YECL 3MRHB 4HIIB 1OTUC 3UAJC 4NN5B 1YN6A 4CMMB 4OCSH 1R5IA 3HAEA 1YA5A 4PYHA 2BCKB 1IL1B 2O5ZL 1S9WA 4BJLA 4N0FB 5DJ6B 2EYRB 1UWEL 3RY6A 5T3ZH 1ZANL 3HZYA 1U8NA 2HN7A 4RX4D 4NQVB 4ALAL 4OFKA 3GMNB 4LKCB 4XNZB 2FLBT 1NFDB 1Q9LA 1YPZA 1F90H 2B1HL 5IQ7H 1KPUA 3MA7B 3VXUD 4HXAH 4NC1C 4BSJA 1O0VA 4XMKH 2AK4D 4GAJH 3V5KA 5HJ3A 3BW9B 4R2GC 2Y6SD 4QWWC 2W0FB 1U95A 3B2VL 1G7JB 1YUHB 3KJ6H 5DQDL 4HS6A 4YNYA 3G5VB 2D9CA 3DX6B 1ZE3C 4ZTOL 1T21A 3H7BB 1IQDA 2NX5E 1Y6NR 4GMTL 2Q8BH 1IGTB 3TCLA 2AEPL 3ULUH 1IGMH 3QIUA 1BQSA 2FWOB 1KCRL 1NGWB 5IMOB 2OL3B 5B38B 1AR1C 3HLAA 1HYSD 1LK2A 1ZSDB 3MRPB 3FQTB 5H35B 4UQ3A 1BQLL 3SJVB 8FABA 3VGBA 2IQAA 3QI9D 3OB8A 4FFVC 1INQB 1HHJA 3VCLB 5IB1B 4IRJB 3GMPB 4MDIA 4FXKB 2ZG3A 4XWGH 1CGWA 3LCYA 5E8PA 5CJBA 1LO2H 5CSGA 1BBJA 3HAEG 1I3RB 5HYQB 3WNPA 4R96B 4M8QA 1TQBB 5GGSA 4XVJL 1LO5B 4ZDHB 3CC5A 3O4LE 1JZ5A 3G6AB 5C0FA 3V6OE 3TV3L 2CMRL 4MHHG 4WNQB 4G8GD 4XTRC 3KYMA 5K9KB 1R5WA 2B1AL 3JXAA 3MV01 3ECBB 3K8LA 3KHOA 3PGCA 5ETUA 1IMHC 2JELH 1T22B 3ZKNC 5MHSE 4F15C 1OT2A 5FV2A 2QHRH 5DK2A 3QIWA 3C09B 4UIKH 4Y2DB 5KSAD 1IBGH 4MZ3A 4HIJA 4XVTH 3O9WD 1QLFB 1J18A 1HOCB 5GGTA 3QQ9D 4JM2D 4F80A 3BN9D 3WFHB 3R1GL 4WI8A 2OTWA 3SY0B 2IANE 5C09B 3W2DL 3I75A 1A0QH 5AWNL 5IB5A 1JHLH 4MAYA 5DQ9B 5GGSY 4Y1AA 3DRTB 1DANU 4MCZA 1S7RB 2QTEA 2QV2A 2A9NH 5KS9A 1MHCB 4QRSB 4UNTA 4G8FA 2IMNA 3MREA 2ILLA 2ICWJ 3TA3A 5DJAB 3MTRA 1VA9A 4LSPL 2FR4A 4XNYH 2HLFD 2J12B 3HC3L 3GMLB 4JRYA 2G60H 3MRMA 5FK9B 5GXBB 5IT2L 5LCVL 2A38A 2W0LA 3AXLB 1AGDB 2Z31C 2KL6A 4O2FB 3WIHA 4ODUA 4XPAH 3RPIB 1HQRB 3BKCH 4A6YB 3DROB 1TZIA 4YXLH 4YFLF 4ZQKA 5HVGB 4U33A 1NFIA 2NX5D 4GXUM 3LY6A 4POUB 1NSNL 3GHBL 3ARVA 3CSYA 5FUCE 2C3XA 1T0PB 2HAZA 3UTTB 2IF7A 3ZE1E 1C08B 3LQMA 5DJYA 3PV7A 5DHVA 3KYOB 5HGDB 4CVXA 3GNML 4BFIA 2X2YA 3GMQA 2NY7L 3DX8B 4LVHC 4PFEA 1BZ7B 4Q74A 1NCDH 5TFSL 4QXUL 2AK1H 1X5KA 3BZDA 3IT8D 3OXSA 5DVKA 2IALA 3QSKB 2W0PA 5FYJE 3OAYH 3ZSSA 5EZLB 3KPPA 1S9YA 3NGBB 3BSZL 4LEXL 2QADD 1SY6L 4Y8AA 2ICCA 1SMAA 3B43A 2GITB 2OCFD 4YHZL 4HWUA 2EH8H 5DJDB 2BY1A 3VJ6B 1MCNA 3O4LD 2EDBA 2EDOA 3BQUD 4NZDA 4LLMA 4NPYB 3BPOC 4KROD 1SY6A 3GGWA 4ZFOL 3C60C 2OMBA 5EC1B 2P44B 4PJCB 3RX7A 3MV8A 4IHOB 3T2OA 2O5YL 4OGXL 4G9FE 4OV6F 2NLJB 5MHSD 4P5TA 5T1LA 1S7UB 2XWTB 1A7PL 2RJMA 1UVQA 3B8SA 4TNVK 4H8WC 3U0WL 4KH2A 3GK8H 4ZFOA 4I2XE 3DMMC 4HWBH 1T1ZA 4K8RL 1S8DB 4PY8J 3UJTL 3V4VH 4QHMA 2JKXA 4F58H 2BK8A 4HIXH 5IEHA 1U3HA 5E08H 2D9QB 2IAND 1SJXA 3THMH 5JXEA 2A73A 2AXHA 4PV8A 3RWEA 2VABA 1CE1H 1H15B 3H3PH 2DDQL 1T6WA 1I75A 3OKMB 4GAGH 3KPSB 1RJZA 5HHXH 4BK5A 3DHJA 3NZ8A 4EUPA 5BJTA 3T4AA 5BQ7B 2IFFL 4ODHL 4TOYL 5DK0A 4XCNB 5MP6H 1RAMA 2ATKA 2J8UF 1FDLL 2R29H 1UC6A 1I9JH 2FGZA 3DIFA 4AJ0A 1X44A 2HG5B 4IJ3B 3UO1L 4YR6A 1GPOH 2G2RA 4U1SA 1D5BA 2A74B 3MMEB 4TSAL 5IJVB 4NHUA 1AXTH 3T0EC 2XRAH 3KR3H 2YPKA 4UBDC 4JFDB 5JW4N 5JW5A 2RBLA 2Z4QA 4AIZA 2VL4A 1A6ZB 4KVNL 4YHIB 3L3HB 1MFCL 4S11A 1C16A 1YQVH 1XGRB 3BUYA 4QTHB 3RDTA 1RURL 4NKIL 1CFVH 2JLLA 5E56A 5HVHC 1M71B 4JY5H 3D6GA 1NC4A 4ONGL 3ISWA 3U0PA 2YK1L 3FTGA 4PGDA 2HYMA 1JZ6A 3IFLH 4YWGL 3FO2A 2PYEE 1X7QB 3NH7L 3CFCH 3U4AA 1IKFL 4WV1B 2YR3A 1T1WB 3KYNA 3KS0H 4MB4A 5EA0L 3NPZB 4EI6A 5GS2D 4Y0GA 1GIGH 3VXUB 1K4CB 4X6DB 5BV7B 2BFVL 1J86A 4Z95H 1HNFA 1W0WB 4XPFL 3WN5A 1DN2A 1LO0L 2FL5A 4PY7B 4N0RA 4OLWH 3E8UL 2Z8SA 4CJ1A 4ODWB 2CLZA 5I8EB 2ZNXA 2WNGA 3T0DA 3GFUA 4EUPG 3OKLB 4JG0H 1WT5C 5I1IH 4L8CA 1GGCH 1F2XK 3MJ8B 1FZOA 4LCIH 3S9DB 1TNMA 4L8SB 3IDMB 2QQNH 2EZ0C 4G9FD 3IU3A 4HZLB 3V5HB 3F7RA 4PJEF 3ZDYF 2X4OB 4S1QH 3QI9B 1MVUA 3QRFM 3T2NL 3DV6B 2H32H 3TBWB 1WCBB 4FQ2L 1EO5A 5I1GH 1XR8B 4QRUB 2J8UE 4YDKL 3OB0K 3CMOL 4WEBH 4G6MH 4ZSOE 5AYQA 5JORA 2GK0B 2P5WE 3ZDZE 3L3GA 1I1AC 3LQZA 5IM7B 4LSQH 4FQIL 3SDDD 2AXFA 3MLZL 3SQOL 2ENYA 4J4PA 4Q97A 5BMFL 15C8L 2A0LC 3ILPB 3PV6B 4G8GB 3ZT6A 3X14B 4JPWL 2KQNA 4M5ZL 2BNQE 1S7VA 4H88L 1HILA 5J9PA 1JGEB 1CDYA 1RHFA 4NQSA 4JN2A 3B9VA 4PP2B 3HKFA 2WSKA 4EBQL 1OF2B 1G6RA 3AY4A 3I9GL 5I1CL 2K9UA 2YHGA 3NCYP 3C9NB 2CDFB 3WBDA 1DVFC 1P7KA 5JO5B 5IG7A 5MI0B 1T83C 1YNTA 2WANA 5F1IA 5KSAB 3ULSA 5T1MA 4OI7A 2NR6C 3NFSH 3WJJA 4HEME 1SM3L 2UY7A 3ZE2F 2IADB 1X5GA 3LKOA 4BKLA 5L7XH 5JPNB 3SE8L 1WITA 4Z0XB 3RWGA 1QFWL 5E2VL 3WLBB 4XXDA 4K3EL 5FUZL 2KZWA 4XNQA 2HJFB 4KTDL 1XIWA 4Z7UA 1IEBB 1LK3L 5HI3D 4KTEL 2PYED 1NLBH 5E8DL 5D5MF 2V7NA 2ZCLH 3CLFH 4DGIL 1ZS8B 3QEHB 5EU4A 5CGMA 4FZ8H 3MRLA 4XAWL 2CK2A 4M43H 3D3VA 1DR9A 1ZLWH 5SWZB 2NY0D 1U8PB 2JJTA 3ZDYE 2ESVE 1Q0YL 4WEUD 5IB4B 3STLA 1SBSH 3HI1A 4JVUA 4LSVH 4KRNA 3O11B 3VXNA 4K94H 1YDPA 4H5SA 3ZYJA 4J3VA 1JPTL 1DLFH 2NXYC 4WW2A 4H26B 5H2BA 4JO2L 2NX5B 3OWEA 1JHKL 5BS0A 5C0DA 3UDWA 2FRGP 4H20L 4HIEA 3RIAK 3VWKD 1KIPB 1N0LA 4JO3L 1LVEA 5E6IC 2NXZC 4P4KB 2YWZA 5EU6A 3BZEB 3LQAH 3UZQA 2HT4C 1AKJA 5FM8A 1CDUA 5L9DH 5EG6C 3N1FC 1JZ2A 4I0PC 2ZKHH 3U30B 1R3KB 2Y07L 2EH7L 1ED3B 1RUML 2VAJA 3MBEC 2P5WD 1MCOL 3PWPA 1K3ZA 4HIHA 2ZCHH 4R3SB 2H1PH 1E4KA 4KC3B 3FQRB 4QRTB 3SBWA 3OSKA 3O4LB 3LRSA 5E2JA 3BQUB 5E9DE 3ZE2E 4HUVB 4OSUL 2CDGA 1UENA 4CN6A 4KROB 4J3TA 1ZHBB 3K0WA 1NGXA 5JXAH 2DYPB 5E2UL 5I30H 2BNQD 1OW0A 4BZ2L 4G9DA 1N3NB 2VE6B 3NA9L 1WWWX 2NPLX 1YJDL 4HKBB 1IILE 3TO2B 4MMXC 2FEDC 5D5ME 4UU9A 4B7LA 5F88A 4Q9RH 2UZIL 5DJCA 1LD9A 3VXRA 1YEDB 5DC4B 2OYPA 5GRZA 3S6CA 3PXHA 4X8JA 4PTTA 2BHZA 1I1FA 5I1AA 5DC9B 5IW3A 1C8PA 4FP8H 2DQHH 2IANB 4TSBH 3TH4T 4YHKH 1BZQK 4PGCA 5FF6B 5IVXF 1EH9A 3VFGL 1MCPL 3DRQA 1CGSH 4MNGE 4YHPB 1P5UA 4FQQA 2VWEE 5HYE