1YEJL

Catalytic antibody complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
b'DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IG ANTIBODY D2.3 (LIGHT CHAIN))
molecule tags Immune system
publication title Crossreactivity, efficiency and catalytic specificity of an esterase-like antibody.
pubmed doi rcsb
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1998-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yejL01
1J05A 4P46A 3O6LL 3F62A 1LK3H 3WJLA 5JNYA 4U33A 4KQ4L 1FFRA 1QHOA 2WW8A 3MYJA 2V9RA 4P9ML 4U0RB 1SYVB 2ESVD 4PRBA 1MWAH 5B21A 4X99A 5I73B 1YEHH 2HKHL 4WENB 4DZBB 2IH1A 1T83C 4JM2B 5C0GB 4G5ZL 5F1IB 4WU7A 3JTTA 5FHBL 1OM3L 1FE8L 4WHTB 3W39B 4ZNEE 1KB5B 4WV1C 4WI7A 2E7BA 3RNKB 5C3LD 4HV8B 4XP9L 4YC2C 4X6CF 1KELH 1YY9D 5DMIL 2D7TL 2XTLA 1KTLA 2R69L 3G6JE 5IM7B 4UT6L 1F42A 4OLXL 5E00B 1OAZH 4PGEB 5I8EB 3W0WD 2DQJL 2IADA 4LNRA 3DBXB 1LO4L 4RIRB 3ZE0F 3PL6A 5EC2B 5IEKA 4Z7UF 1EHNA 5KTEL 3VFVA 3N9GH 2D2OA 1IM9B 1VENA 2R69H 4YDJA 2Q1EA 4MCZA 4P2RE 3A6BH 4HIIA 3KLHC 3FONA 4IJ3C 1B9ZA 2NTFB 4HS6B 3SKUD 1WZKA 5JW4R 4X5WA 5DEGA 3QO0B 3MZTA 3D85D 3RZWA 3QFJB 3LCYA 5E2UL 3WCYA 3X12A 4HK3N 2ZCHL 4UDUA 1K5NA 4AENA 1RMFL 1RZ7H 4TUJB 3IFNL 1WQVT 4D94A 5EZIL 5C09A 3M17B 1F58H 1U8MA 2YSSB 1EVTC 1S9YA 1U42A 3ELAT 3DV6A 3EZ8A 3QXUA 1UWGH 3CUPA 2FGWH 3PWLB 3ECBA 4G8EB 4X98B 1RIUH 4JFDB 4FNLH 1S7UA 2A83A 3VI4E 4UTAH 2VC2H 5J89A 1O7SA 3QWRA 3U7WL 3ARBA 1CGVA 1SMOA 3L5HA 2AXFB 3QH3B 2KZWA 4GUPB 5FYKL 5KSAA 1I3RA 2D9CA 5FOBA 5C0EA 4Y19D 3GSRB 5GGRB 2NW2A 1J88A 5EIQA 1C12B 4ZQKB 3V2AR 4XCNB 4LKCA 4Z95L 1NAMA 4PJCE 1F6LL 5IF0A 1JZ7A 2C3XA 1DVFD 3RU8L 1MQKL 2FD6H 2ATPB 5TFSH 4P46B 4R4BB 1HCVA 4RGMB 5F7EL 5SX5H 3INUL 1E4XI 3RI5F 4BK5A 2VDQL 3OPZH 2AV1B 5H2BB 1TJHL 3DXAB 1XF2A 1MPAL 5KSBB 4FFWD 1S7TB 4KHTL 3OHXB 4WIQA 2CR3A 4OFYA 3VGDA 3S5LG 5FYJD 4M8QA 4BK4A 2FEDC 5EC1B 1JPST 2VZOA 3OPZL 4HLZH 2GT9B 4KJQC 1FFNA 4CMMB 3U4EB 4U1KA 2V9TA 1OAXH 5D2NE 4NOBA 5LJYH 4D2NA 1OL0A 2QQNL 1SJHA 1RVFH 2OQJA 1FL3B 3FB8A 3SGKC 2GAZA 2DM7A 4MS8C 4OFIA 4O2CB 4GG6E 4I5BA 1TLKA 2IADB 3CVHB 3IB4A 2QQKL 2DKMA 3I75A 2Q7YB 2FEEI 1T7VA 2OI9B 3ARBD 4PJ9C 5ESVA 3PQYB 3TVMD 2CDGB 4JFHD 5LWYH 3PGFH 3VRLF 4YHZH 3TJEL 4Y5XC 5KSBF 4PJIA 4CU6A 1YEJL 3BDBA 5F9OH 3TV3L 1HDMA 3DURB 4DTGL 1BFVH 4Y1AB 4X6BA 3QRGH 3QQ3A 3QI9C 3PABB 1D5MB 2P49B 5DI8A 4J3OC 1CDBA 3RBGA 2N7BA 3VFOB 3BRDA 1VKXA 4IIQC 3VXMD 4HKBA 3VD7A 4QRUA 1S78D 4QO1A 3UAJD 4WI3A 4OAWA 1XFPA 2HJKB 1RJCA 4IMLA 1NGZA 2CKBA 3P0YL 3MBED 15C8H 1SYSA 3OBAA 2H8PB 1AGBA 2NQCA 4G8GA 4AIXA 3LPWA 3SDYL 2HYMA 4Z7WF 3U36B 3P9MA 5I19L 1XF4B 3KS0H 3MODH 2NY5H 5J06A 1DCLA 3HZMB 3UAJC 2VAJA 4UUJB 5FO7B 3S36X 3U46A 1ZE3C 4U05A 3G5YB 5B3JF 5J57B 4FXKA 1JMZA 5DJCB 1JGDB 5F3BB 2XG5A 3DV6B 2Z8VC 4OLVL 5JO5B 5C0CD 2XWJA 3VD3A 1OW0A 4F8TA 2R8SH 4L4TB 4UV7H 3QA3A 4OCLC 4Y16A 2NY5L 3HPLA 3WDHA 3E6HA 4EI6A 4FQ2H 4J6RH 2VLRA 3QIWD 5I8OL 5ELIA 2FX8H 2VB5A 1GOHA 2XZAL 3OXRA 4M7ZC 1AGFB 4DQOL 3GUTA 4OD1H 5CD5D 2JJWA 3MJ8A 4CNIA 2FJHA 3Q3GA 4F57H 4O58L 2PW1A 4Q6IC 4M6NL 5DZOA 2YD7A 3DSNA 1CD8A 4JM2D 2FEEL 2CK0H 4X7TA 4ERSH 1OGAA 3IVKA 3LIZL 1GH7A 2XT1B 2R9HC 1F11B 2GFBA 2VL4A 4K9EC 1VDGA 2OSLA 2XPGB 3HMXA 2R0LH 3LQAH 4O58H 4MNGB 5HHOD 3AS2A 4JM2C 1F2XK 3C6LD 3CCHB 5BZWA 3ZKMC 4FQXC 4NKIL 2G5RA 4LHJB 1NCWH 4HAGA 4ELKB 1C08A 3TYGH 3SDAC 2EDHA 5E2TL 1RIHL 5DUMH 1CDUA 2EXWC 2C4FT 3CUPB 3GHEH 2CK0L 3MNZA 3MR9B 5HI4C 4ERSL 2EICA 2PO6C 3U4AA 3W0WB 5AAWA 1H5BB 2HT3C 2J5LC 2OTUB 1T20B 3PE9A 5ENWB 5ERWB 5D7LE 4ZXBB 1X6LA 1FC2D 2A2QT 2YPLB 3RWJB 2JJTA 2X4QB 2YXMA 5KVDH 4G3YL 4I5BB 4MJIE 3MREB 3O2VH 3CFKB 1MUJB 4OZHE 1NC2D 2JJSC 3QO0A 2CUHA 4XNXL 7FABL 4WUKL 4I0PA 5J1TC 4WFGE 4M9OA 5IOPB 3BGFB 2GCYA 4WI4A 2IG2H 4LAQL 4HS3A 1RU9H 3HRZA 5C0IA 5LAXB 3H9SA 1INDH 1C1EL 3IRPX 4LLVA 3MROB 4N0CD 2DQGL 3V0WL 4GQ9H 4ODVL 1GGTA 1JHKL 3CDGB 3KYNA 3UTSD 3OAZH 4I3SL 4LSTL 4ZO8A 1MLCB 2ZUQC 2G75A 5E94B 5HSFA 4DVBA 1MRDL 2CJUL 4HK0B 2Q8AL 3SPVA 5KJRH 2IG2L 3D48R 4LAQH 4ORZC 4Y2DC 4N5EC 5TE6H 2JIXB 1FLTX 1WWAX 4HPOH 4V2CB 2P46B 2LTQC 2WUBL 4HIXL 2Y36H 5ALCL 3OR7A 4I3SH 4KK5C 4J2XA 4UQ2B 2WBJD 3ZKXB 4R0LA 4U6VH 2W0LA 5E99L 2VLRB 3QB7C 4OD2B 2IANB 1FYTE 3VW3H 2BVQA 4BZ1H 1YMMD 3DGCR 4OCYL 1L7TH 2DM3A 3L3OB 1VKXB 1F4HA 5IMMB 1SM3H 4FTVE 1MRCL 1U92B 3JUYA 1EEUA 4IBLT 3UXFA 1CLZL 1P53A 4P23B 4X4XB 5JOFA 2WZPD 3OGCA 3BPCA 4XB8A 4BZ1L 4NC2B 4O02H 3SDCA 1WSST 5C0JA 1HSBB 5ADPH 3SKJL 1DQMH 5F96L 5IEKB 1PX3A 1NEUA 1Q9WA 1SVZA 4XHQA 3D0VA 3WN5C 4NO2B 1JV5B 4HUXB 5I75B 1N64H 4OCSL 1OQOA 1G7IA 4X4MA 1BWMA 1R5VA 3OJDB 2F19L 2MQCA 5HHXL 4YHYB 2BVOA 3O3DB 3F7YB 5DD6A 3TN0C 5T1LA 4Z5RA 1R3JA 1CICA 3FB5A 1R3KB 4P3DB 5DUPH 4NCC1 1HXMB 4OLWL 3D85B 3ZDYF 1RZIA 1N64L 3BUTA 4OKDA 4F33A 4LPXA 2E5EA 3M8OH 1FIEA 1R24A 4JFOB 4XMLL 4XPHH 3BP5B 4ZUSA 2BNRE 3BZFA 3W2DH 4XPGH 4GRMB 4M93C 3VXTA 3ZLQC 3GMLA 4RGND 3FOMA 2OJEA 3ARWA 3CAFA 1YY9C 2JELH 3MGTB 1ZTXH 2G75B 3KPPB 1LO5A 4TQEL 2O61B 2DWDB 4P3CH 1UXWB 4KVNH 3ARTA 1XEDA 3GI8L 4M62H 3QNZB 3ZTJG 5J9PA 2PUQT 2W65B 4GAJH 4NWUH 2R2CA 1Y6KR 1G9EA 1QSED 3H9SB 5JDSB 43CAA 3K80A 3O6FB 4YBQD 1VA9A 4ODXB 3TESA 5D72H 1LNUB 3QCTH 5CEYB 1WT5A 5HDBF 4DGVH 3T1FA 3T2NL 2A6JB 5E4IA 4BSJA 1GGCL 3H3PL 2V5SA 4ZNCD 1KCSH 4HQQL 5I1HH 1ND0A 2ORBL 4NO3B 5DJ6B 4KZDH 3GI8H 4DGYH 3CCHA 2OTWB 1K4CA 4LU5L 3I3DA 1C08B 4LGPB 4DUXA 3UTQB 5JXAH 2V2WB 4Y2OA 1NCBH 1BQHB 2DL2A 2NPLX 2DQIL 3A6OA 5I1IH 1F4XH 3KPMA 4LCCB 4M8VA 1I8KA 5AAMA 9CGTA 4ZSOA 3LKRA 3OF6D 4LOUD 2EEAA 2A9NH 2PR4L 3OAYH 3O3AA 4U1JA 4MQXD 4JY4A 4AG4H 3C8DA 3IETA 3MLYH 1ZXQA 1S7SA 4N0UE 4OCMC 2NY0C 3BPLB 5D1ZB 1I7ZA 3WEXB 5JA9A 2AEQL 4S1DC 2BOCB 2ZOLA 4PD4K 1T66C 4QOKA 2C1PB 4H5SA 2A9NL 2LU7A 4MD5B 4KDTA 4MQXC 3MXVL 4G6FB 3QEGH 3VXPA 2KQMA 2BVOB 5ICYA 1NCCL 2YC1B 3KYOA 3ULUF 1GPOL 5HHPA 2NY6D 3IFPB 1HEZA 4MJ6A 4P3WA 1ZLVK 3JV6B 1U95B 4OF6A 1T66D 1TTGA 2OZ4L 1D5XB 4V1DE 4ETYA 3MJ6A 4U2YA 3SJVD 3HI6L 4QXUL 3D2UD 4JM2F 4EI5D 4OI9A 4LLYA 3EKCA 4G6JH 5I74B 3LSOB 3FT2A 2BDNH 1G7MB 4J8RA 3U36A 3CIQA 4X4XA 1CN4A 3ZE2F 1IC7H 2DRUA 3E2HC 3GSWA 5F7YC 2R29L 4L5FH 4ZFOA 1U8NA 1JWUA 2BY2A 4UUJA 3SHSA 5MEND 5IB5A 3MA7A 3TBVB 5L8LB 3L95A 1JGDA 1Q9WB 4KQ4H 3DSFL 3CPLA 1UCBL 1MIEL 5E2JA 4KRPC 5J6HB 3SE3A 5FXCH 3P30H 4GRLA 2HFFB 4NYLB 3VFUA 4X8JA 4XP6H 3OKKA 3BPOC 3SPVB 5IV2B 4O51A 2RAMA 5E8OA 4OFYD 2WBJB 3ARDB 1IGIH 1I1FB 5HI3C 5FYJE 5FA4A 1UM4L 5SWZE 5L2KA 2X70B 5HHMD 2ZG3A 4WCYL 2FECI 1CIDA 3EDJA 4HJ0C 1MCRA 5DMIH 4APQC 2PW1B 3D0LA 5AYQA 4XP6L 5DFVD 1PSKL 3BQUB 2DL9A 1J0ZA 1V3JA 3OKMB 1NL0H 4WWKD 4K94L 1DVFA 2XI9A 1TTUA 3PHQB 5C08B 3L3DA 3ILPB 4NUJB 4EUPH 2CDFA 3HR5A 4LLQB 2MHAA 3VWKA 1NMAL 4MJIA 4JR9H 2W38A 4FFVC 5GS1C 2XICA 4LCWA 2GY7B 2Z4QA 5A2FA 1WBZA 1BOGB 4EI5A 4HXAH 4RRPA 2VDKH 2WIIB 5D6DC 5BOPA 2YUVA 1J5OL 3BMVA 3SJVA 2DLFL 3HC0B 2A6KA 4NQCA 2P8PA 5BRZB 3G04B 1P9MA 3U48A 5CAYB 4L9LA 3I9GL 4JFDD 5E2UH 1A1OA 3W5MA 4FFVD 3JTSB 3VXUE 5L0QC 5F9JB 1BLNB 1KIPB 4PJXA 2YPLA 2QHRH 3BH8A 4Z0BH 3OAYK 4WI8A 4MD0A 1VFBB 1CFQB 4POUB 1AHWC 2OR9L 1RJLB 2QQLH 3ZDXF 2EDOA 4KUZH 1CCZA 1B3JA 4J3UA 3S88L 4KKCD 2MCPL 1UWGL 4H0GA 1K8DB 5I76A 3I9GH 2PCPB 2VH5L 5EOQL 2W9LA 3V95A 4H20L 3ARFA 3VE0A 4EDWH 1RIUL 1DJSA 5F7MC 4NKDA 3V7AE 5F7DB 1I9IL 3DGGA 4GBXD 4QRQB 1NLBH 5IG7A 1B6UA 4XWOC 5IB3B 3SE4A 3BH9B 3EJZD 2NY1B 4MB3A 5K9KB 4KJWC 4XAKD 4JFYB 5FAAA 3EDFA 3AS1A 1FYTA 4M1GL 2JCCB 3FFCA 1RZKL 1MJUH 3LDBC 4HW6A 2EIDA 3BDXA 1RUMH 2RBLA 5F7WC 1RJZB 3MJ7B 4GRWH 1J12A 2X4PA 3ROOB 3RZCB 5L88L 3EJZC 4YNYB 1R3LB 4L4TE 3ZKMD 1BQUA 2EDKA 1FLRH 3VRJB 1DUZA 3GB7A 1Z9OA 2LU3A 4LCUB 4IOIA 2FHBA 3MNWB 5KSUB 3WHE0 1IGYA 2NY5C 3O6KH 3KPOA 2EYRA 4GG8A 5A16A 2YOCA 5ILTL 4J3WA 2QSVA 2EDYA 3DYOA 4R96A 3D6GA 3BUYB 4JJHA 5E08H 4LFHD 1L0XA 4O2EB 1Z3GL 5IW1A 5D2LE 4PV8A 3QISA 4NYLA 1ZHLA 5T3XE 3WFDH 4HIIB 3SEPA 1IQDB 1CFVH 3WL9A 5HYJD 5EZJB 1QVOB 3BRGC 1YN7A 4YFDB 3X17A 5E9DD 2ZCLL 1G1YA 4YQXL 2WUCH 4P2OA 5DRWB 3GSWB 3S7GA 5JW3H 4OLUL 2R2EB 3ZO0A 3ME0A 3RVVD 4XCYA 2DQCL 1CFVL 3MRQB 4JRXA 4YHZL 5EBMB 3EAKA 4JPIA 1QHPA 2J7LA 3OJ2C 3CZJA 3PHQA 4OCXH 3OV6A 4HGWA 3FJTA 4MNQE 5I1JL 4J8RB 2EIBA 2VIRB 1R3JB 4OLUH 3RGVB 3OKNB 3ZTNH 1DUYA 3BSZH 1HK6A 4BYHA 2P1YA 5D71H 4CGTA 2CXGA 5EIIB 5FEBA 5F1NA 5FO9B 5DO2D 4NN6B 4NKMB 2ZKHH 2HT2D 1FZMB 2NTFA 2BK8A 4FQCH 4NN7C 3QULB 5IMKA 5DRXA 3IF1B 4JKLA 1S7QB 3PGFL 1MQ8A 1A7PH 4G8FA 4K7PY 5J7CC 4GH7B 4QT5B 3CU7A 4HS6A 3TV3H 5SWZA 5L2KE 4LPTA 1WBZB 2F74A 5HD8C 3RVTD 4D3CH 5I75C 1U8QB 4EDXA 2AS5M 4ZS6C 2Q3AA 4Z78B 3GHBL 5FCSH 4HHAA 4PJHE 1N8ZA 3GBNH 3IRZA 4Y5VB 5B39A 1ZWIA 5FCUH 3V5KB 3WKMH 5EC2A 5D7JB 4TTDC 4R97C 4NKOA 5C0EB 1UH4A 3M17A 1FG2A 3THMH 5IK3B 1KF9B 2I9TA 2LAAA 4YDIL 5ITBL 1MCPH 5HD8D 1FYTB 1X5FA 4OD1L 4WEUD 3RVTC 1CDHA 2YS4A 5IQ7H 1ND0B 4MCZB 4R4BA 3O2WH 1KTLB 3GJFB 2HLAA 1LEIA 1BBDH 4ONGH 4WW2A 4X7CC 5JW5B 4M6ML 5B8CB 1I4FA 4HJJH 3E3QC 5I71C 4H26A 3V52H 4JHAL 5DHYB 3SKOB 1IKNA 1FGNH 4LCCA 2UY6A 3NIDE 4OLVH 5IJVA 1DDHA 1U3ZA 3BW9A 3QXWA 4LKCB 3Q1SL 2VITA 1XZ0A 5FF6B 4FZ8H 4PJFB 5EU3A 5EUOF 3QEQA 1CL7L 3V6ZA 1T83A 4G9FB 4AT6A 5KVFH 1QRND 2Q6WA 3TYGL 3K2MC 1E6JH 4NQVB 2NX5B 4XPFH 3BWAA 2VQTA 4N1CA 3V6BR 1OAYH 1A14L 2WWKO 4JHAH 3GRWH 4HWEH 3EHBC 1TVBB 4NNPL 4ONFH 2FATH 4KTYA 1QFUL 4TUJA 5E0QA 4BA8A 4XXDB 1ZT7B 3WL9B 1MI5A 5B38A 1VESA 2QEJA 1AI1L 4X6DF 4AJ0A 4XPFL 5T1KA 5EN2B 3MRDA 3O8XD 3MFGB 1IGFL 1U8IA 2QR0B 1F8TH 3EHBD 1RUAL 4UT7H 5D93C 3VI3E 5SX5K 4NNPH 1NFDF 4Y4FC 3RVUC 1C1EH 3ZE1E 4O2EA 2RB8A 2OCFD 1EVUA 3VXQA 1OGTA 2ATKB 1RIHH 1MCEA 1CR9H 1KYOK 3GHEL 1QVOA 3QG6B 4HKJA 3PWNA 1DE4B 1L4IA 3S3SA 4PJCA 4WUUB 1QBMH 3RWEB 4UOJA 3AUVA 3CSYA 3R4DA 5DVNA 1U8QA 1QSZA 1EEYB 5J6HA 1HQRA 4GAGH 3TZVA 4NM4L 2AGJL 1LGVA 4HKBB 4CUCA 4XMPH 1JGVH 4BSWB 3ZSTA 2ZG1A 4WW1B 3HAEA 3WFHA 3DNKA 1I1AB 3BGMB 3I6KB 4GFTB 2YK1L 1I8MB 2OSLB 1EHLL 4QHKJ 1CD1B 1JHKH 1SVCP 4PB0H 3DWTA 1QFOA 5A16B 4ZOBA 1G6RL 4NNYA 4JRYD 4NQSB 1T20A 5ENWA 3CVIL 4HC1L 5EUKB 5C0DA 4GOSA 1DQML 5F96H 4RAVB 3O9WA 2K7QA 4E5XB 1ETZA 1FVEB 4PG9A 3RBSA 2FLRT 5C08D 2WLZA 4FG6D 1I7UA 3OKOB 2ICWJ 1Z9SA 2H8PA 5DT1H 3MBEA 4BFBD 3O3BB 5CGMA 1MEXL 2DIBA 1JPGB 3QUMB 1BJ8A 4HWZB 4K3DH 4PJIE 4XBPB 5I1KL 1FNLA 5E03A 4ZUTA 3KPQA 1ZT7A 4KY1L 5EZLA 3SDDB 4HWBL 4K71C 4JFQB 4PRHA 4DN3L 3CFEB 1ZGLA 5IQ9B 4JLRA 2YD8A 4RWHA 4XBEL 5GSRA 1MHPH 1QYGH 4FXLA 4K3DL 4LQFH 1YZZA 4XMLH 2P8LB 5ERWA 5ADPL 3HUJB 4FQPA 1W0YT 5EZOH 2JLLA 2Y7QB 3TIDB 3TNNA 3U0PB 3N06B 1F4WL 3MR9A 1OHQA 1DN2A 3CXHJ 3P0VL 4D9RD 4BH8B 3TA3A 4APQD 1YNLH 4IMKC 3GUTB 3S3PA 1QFWI 1A1NB 4EIZC 2YA0A 3SDXB 3WSQH 1MHPL 4G80A 2NY4D 1UG9A 3GI9H 2IQAB 4Y1AD 5CKGA 3B6SA 5CUSL 4JFDE 1CE6B 1PW3A 2VQUA 3RWCA 3VDCA 2X4QA 4GO6B 4CJ1A 3C9NB 3CDGA 3EO9H 4ZPVB 4YE4L 3WE6B 1DP0A 3D5OF 3AROA 1EV2E 2Z0BA 4ZTPH 4S2SB 1YPZE 2NY4C 1MCHA 4YZFF 1G7JB 4X4ME 4KK9D 5INCA 3H3PH 1NDGB 4UINL 4M48H 2F15A 1IKNC 1QLRB 4ZMAT 4BSWA 4DVRH 1VHPA 2VXUL 4LU5H 3C5ZB 5CD3A 3VDBA 1RUKL 5F21B 1KULA 3TBYB 2BJML 5AZEH 4MJ2A 3I50L 5FYLE 2DQDL 1OGAB 3IVKB 2HT3D 1CD9B 2MMXA 1BEYH 4C55A 4JO2H 3OTTA 4TQEH 1SY6H 2NY4B 4AMKL 4YHPB 5F8QC 5T5FH 4PY7B 1N0XL 4LIQH 5IVXA 1ZAGA 4FFZH 5E7BA 2Y25A 1GL4B 4TSBH 3BZEB 1UM6H 3QG6A 5J1AA 3WFHB 4P49A 2B4CC 1CICB 1B0GA 4QTHA 5IP4A 1MCFA 2IH3B 4H8WL 1MCBA 4FP8L 4M4RA 1EEZB 5EO1A 3JV4B 5I1AA 3HE7C 4JO2L 4KI1A 5ANME 4XC3H 4UV4L 4ZPTA 1REIA 3LZFL 3QEUA 3HC4L 3O6MH 3LPGA 4PJDB 3NA9H 3BZFB 1OVZA 1IC5H 1VPOL 4JO3H 1IGCH 2AJXL 5C0DB 1EJOL 1H8NA 2DQIH 4F9PA 4FP8H 4WW1A 5CEZD 4UV4H 3CD4A 3UC0L 1FGVH 4ZFGH 1CE1L 5EIIA 1L7IL 4GKSA 5DLMH 5FK9B 3TCXA 4NRXB 2HJFB 1EEYA 5DHVA 1AJ7H 1JGUH 4OKVB 2XN9E 2BDNL 4WU7B 2AJXH 2XACC 5CHNA 2Z9TA 2A6DA 3B9KD 4ODXA 3W11D 4NKQB 1MCCA 2ZUYA 3ULUE 1FP5A 2HP4A 1NAML 3EOTL 4X6EA 2YSSA 4P59L 4FQLH 3IJSB 1CE1H 3F5WA 1WC7B 2JJSA 5ID1B 2X4RB 2LE9A 1NCCH 3I85A 3OR7B 1KN4H 3MLUH 4ORGB 1E27B 3MRKB 2VUYA 5JOFB 3Q6GL 1UADC 3T0AA 1CFNA 1S7WB 5K93A 1Q1JH 5F9DC 1E4KA 2OZ4H 4U1SA 4NCDA 4OFDA 3IS1X 3TBSB 2VSDA 4PJXF 3B5TA 1UM4H 2F58H 3VXOB 2HKFH 2W07A 2EZ0D 3KYMB 3QP3A 3HNTL 4WEBL 1K3IA 2D03H 1XF3A 1VEOA 4R8WH 3CJJA 3C5ZC 4G7YL 3SN6N 5I66B 5FYKE 4MNHB 3TIEA 3LMJL 4NO0B 3IDMA 3CFIC 4X6CA 2XNAA 2JIXD 1DFBH 3L6FB 2H1PL 3WKNA 1S7TA 3FB6A 4RMQA 3O45B 5DTFA 3H2WA 3HNTH 4XVJL 3QIUB 2EDWA 2XTJC 3OX8A 2D7NA 4FOMA 4NC0B 5ICYB 4NO2A 7CGTA 2V2XA 1IARB 2W65A 3C09C 4P9HC 5DMKA 1FHGA 4P5TD 4UT6H 2Q6WB 2ADFL 1G9NH 1R24B 4ODUA 5KVMC 4U6YA 4PJ7B 4Y19B 1G7IB 3GSVA 5CP7A 2OTWA 3NPSC 4DJMA 4L3CB 4YBHA 3O6LH 3UTQA 2J8UA 1CFBA 1MFDL 2M8XA 1XF2B 4EIGB 1ETZB 1QD0A 4X7FC 3N9GL 5TDNA 4F7MB 1MFNA 1WCQA 3DX9A 4JY4B 2IBGA 1A7NL 3MOBH 5E8PB 1INEL 1ED3B 2DJUA 4L4TD 3LKRB 5D96B 4GAFB 4KUZL 1HILA 4JKKA 1OY3B 5EC1A 5HHNB 3QUZB 2Y4SA 4MAUH 1N7ML 4M7JL 5SX4H 5H35A 3QBTB 2KZ1B 5ESAA 5D7IB 5CILH 3EO1B 3L5JA 3H7BA 5EDXA 5DVMA 1XIWD 1J1PH 3T0DA 3ULSB 1YEGH 2YPLE 4X9FA 1CLOH 2OP4L 1IKFH 1QZ1A 3GSUA 1J5OH 2EYTA 3JV6A 1H3VA 4JY6B 4N0FB 1P7QB 3X13A 4LASH 5CIPA 2EDDA 1AXSA 1JPFB 4S0SD 2J88L 3MLSH 4H25A 3ZDXE 5CMAB 3T8XA 4PTTA 3GBMH 1B0GB 4YJZL 3GNML 1JNLL 4Z0BL 1PAMA 5FYKH 3CSYB 3SO3C 4ORGA 4KZEH 3MRFB 3LSOA 3GSNA 4D0BB 1RSFA 3QEUB 3OF6A 2JB6A 2OR8A 3R8QA 2DJSA 2HFEB 1BFTA 4PY7A 1RZGB 1JYXA 3G5YA 1D5XA 3NFPA 1DVFC 1G0YR 4HZLB 5CJXC 4N8VB 1T21A 1RZ7L 3S4SG 1IC4L 3Q2CA 4LLAA 2R2HB 5ID0A 5IHZA 3OKYA 5GXBB 5E08L 1M05A 1D6EA 1J0HA 8FABA 1MPAH 4I13B 3LKQB 1H0DA 4R9HA 4KHTH 5SV4A 4LPCA 1SEQL 4ENED 4FFWC 1RFDL 2CRZA 1FRGH 1YJDC 3F7QA 5I8EA 1IEBB 4Y4KB 3EYFB 2ERJB 3MCG1 4ZXBC 1U58A 3P77A 3TBYA 1LEKA 3VFOA 3BN9D 2NY6C 1IC4H 5EORH 2KPNA 1OLLA 4NFDA 3QQ4A 3SE3C 4XAWH 1NC4A 4ZUWA 1GZPA 3QFJE 4U1IB 4WFEE 1F45A 5IKCA 1WC7A 2QQNH 3S5LA 3TNMA 3WNMA 4N9OB 4RMWA 3VG0H 3CK0H 1P84J 4NO0A 2FD6L 5TFSL 4JREB 4JPKL 4U1LB 3JVGA 1AQKH 4MLSA 1V3KA 5DRZA 2OXGA 3ORJA 2VWEC 3ZKNC 1DQLL 4ZFOB 4MMXC 3QEHB 5CHNB 2M26A 4MNGA 1Z3GH 4AEIL 1L0YA 4WHCA 1YMMB 4FMFA 2MHAB 1F6AB 4HV8A 2V2XB 3TJEH 3LKOB 4YEFA 2FSEB 3VG0L 4PJDA 1C7SA 4MLIA 3SBWC 4XXCC 4RQQA 3NZ8A 1P5VA 3P9LA 3QRGL 3KPNA 3SOBH 3FMGL 3C6LA 2X4PB 3QI9D 2HA1A 5GRJL 1M4KA 3LRSA 3S96B 3QXDA 5FUOH 4JKPH 4K3EH 1TQCB 4TVPL 1RVFL 2MNUA 3VFTB 4WUUE 1DBMH 5GPRA 2XKNA 4OTXL 4TPRH 4YDJB 4PRHD 1VFBA 3GSQA 2W60B 1MOEA 3MNZB 3GKWH 5DFVC 4NBZB 3VGAC 5KSBE 2UYLB 3MODL 5D7KD 3QIUC 4JDZA 3FFCE 3HHRB 4QOKD 4TVPH 2XIDA 2IAMA 3CSBA 3DGGB 2JCCA 2AJZA 3ZT5A 4PJ5A 1MCPL 2AP2A 3L3GA 5DJXB 1UT9A 1BOYA 4PS4H 4EI5B 3MLRL 3MJ9H 1O7VA 1CVSC 2GJ6E 4UDTB 4PGBA 4Y16D 2Z91B 5DEZA 3GKWL 4BZYA 2OL3B 1ZOXA 1FJ1B 1MJJB 3M1BA 1R5WA 5EULV 2VMFA 5LAXA 1YY8B 1CL7I 4F7PA 4QEGA 1A5FL 3ILPA 4JRYA 3IJYA 3R1GH 1BLNA 1KIPA 4NHCL 3P0YH 4WJ5B 1T1WA 2H2SD 2FB4L 2V17L 4D9QE 4FZ8L 3U2SA 1GAFL 3CX5J 4AQOA 3PQYE 5C3TA 4K9EL 2DF3A 1DN0B 3IU3B 4DAGH 4MMZC 3O8XB 1YEEL 3BJ91 5HY9B 8FABB 4HWEL 3MGOB 3EFFA 3M07A 3TBTB 5ITBH 4AK1A 1UQSB 2BVPA 1MVFA 3BXNB 5DVKA 5INDB 4RAUA 2J1KA 5JW4M 1OSZB 4P2OB 4OCRH 5C0RL 4BQ8A 1AI1H 1WEJH 1IAIH 4HJJL 3FQRA 4KI5F 4M1CD 4OIIL 5EZJA 5L2JB 2KKQA 1ZT4A 1J0YA 1T21B 4NKDB 2HVJB 2Z35A 2PO6D 3QAZC 1NGZB 3QDJD 5DD3H 3TH2T 1IM9D 3Q1SH 4NJ9H 2DLHA 4Q9QH 1XGTA 4HCRH 3WN5A 1OSPL 3MLZL 2YRLA 3WNOA 3O2VL 5HHVL 1E6JL 2EDBA 1A6TB 4D8PA 1JL8A 3KPRD 2BXYA 5FO7A 4X0KB 1IQWL 3HMWH 5FUCC 1EZVY 5MENA 4FABL 1YMMA 3P4MA 1BAFL 3UJIL 1INDL 1P6FA 1Z5LB 5BVJA 4ACPA 1AO7E 3PG2A 1R5IA 3CU1A 4N90D 5FA3A 5ECJE 3GSUB 2XTJB 1QSFA 1G6RA 3VXSD 1J0KA 1ZGLP 4OZGE 4PJFF 5EUOB 1P4IL 1F8TL 3B5GA 1FORL 5ABDE 1J8KA 5CMAA 4HWBA 1OD7A 3HE7D 4XMPL 4N5UA 2HMIC 1NC4D 4ZTOL 1IL1A 1AKJA 1X5ZA 2BY1A 4FN0A 2UWEF 2LV4A 1EK3A 2APVA 3U6RA 3L3HA 3LQZB 1D5ZB 4PJHA 4TTGA 4TNVF 3MRRA 3M1BB 3FAWA 4G8FB 3ULVE 2C9AA 4HIEB 3FT4B 5L9DL 7FABH 4I18C 3BWAB 2HMID 4MXWL 1RU9L 5IMKB 4QNPF 2P8MB 2VZTA 3IDMB 4LARL 2YUXA 3BPNC 3EIFA 5IR1A 2LVCA 5C09E 1JWMA 3CVIH 3EGSA 3TZVC 1F00I 1U8PB 1N8ZB 4S1RL 2X9YA 1CGXA 3O9WD 5MEOB 4N0YH 1NAKL 5TE4L 4KRPB 4FZEH 3ROLB 1FVDB 4HWUA 3CDYA 5FDWB 1F6AA 5E56A 4Z78A 1MRDH 1J7VR 1I4FB 3BP4A 3MRDB 4Q0XH 4MXWH 1CS6A 4LARH 4JFFB 4OSUH 4PJ9B 3GJFA 1LEIB 2HT2C 3KPSD 3SY0B 3FO1B 4HPOL 1VEPA 3G08A 1S7QA 3EOBA 5I9QB 1ZA6B 2H6PB 4HT1L 4U1JB 5HHMB 4DN3H 4JCMA 4XXCA 3ARFD 5IJVB 4MYWB 4TUOB 3SBWA 3ZYZA 1ORQA 1WIOA 3UZEA 3QWQB 5E8DL 3BQUC 4HKXA 4R90L 3GSQB 1BQSA 3QEHA 1X5LA 2GY5A 1T3FA 2WQ8A 5EU7E 4Z77B 1I8KB 3VXUB 3RUGE 4KKNA 3C5ZD 2YC1A 2IH1B 4JM2A 3DUHA 1HINH 1J87A 3G6AB 1X3DA 1KB5A 1LP9A 3T0XA 5I1KH 3P9LB 4XPHL 5C8JB 4LVNC 3RNKA 1RPQA 2EDRA 1VGKB 5LXGL 3KPLA 5H37G 2PYEE 2W91A 5GS1B 4XXDA 1IRAY 3EO9L 4L3EE 1RHHA 4NKOB 2IANE 1P4LB 1X4YA 3MLWL 5FF6A 5DYOB 4OCSH 3QO1A 2YA2A 4PRNB 4Z7UE 5CCKH 3ZDYE 5GS0H 1HH6B 4NQVA 4U49A 2FO1A 4JGJA 4PBXA 4PREA 1CICD 3WHE1 4RBPH 2HFGL 3PWNB 4NZJA 5D72L 4G6KL 2EE9A 3RWFB 4ZNEA 3BKMH 5HYJA 1JYNA 4IRSB 4LVEA 3WSQL 2BVPB 5DJ8A 1Q9OB 4WI9A 5HYQB 4U6XB 1PD6A 3QDJB 3ZHKA 5DQ9A 3WIFA 3MLPA 1MFBH 1JWMB 4TSBL 4LDEB 2XZCH 1YEIH 2KL6A 4UU9A 1F3JB 2O5XH 1SMAA 3M45A 3MYJB 3O8XC 4G6KH 3NCYP 4PRBB 4R4FL 5KOMC 1MCOH 4RNRB 4L4VA 2ZNXA 1F4XL 3T09A 3KLHD 3H42L 2FIKB 5E8EB 3OJMB 3MRRB 1DANU 2W0FB 5IW6B 5CKAA 3HLAA 1SJEA 4Z7VF 5E9DE 5F7LB 2VL5B 1Y6MR 4BQBA 1IAII 4DK3A 1P2CA 3C8KB 4IIQA 3D25B 3MRHA 4XNMA 2X7LA 5CLWA 1LE9B 3T2NH 1MCOL 5FOBB 3QHFL 3ZYIA 3MA7B 2VDRH 2CK2A 1QFPA 3S34H 5A40E 2DTML 4QHKI 2YHGA 3U9PL 4X99B 1FN4A 1F5WA 4U1GC 1KT2A 5FA3B 3W81A 1ORSB 4LIQL 4MJ4A 3RPIB 4JFFA 4PJ9A 1UM6L 1FG9C 4Y5YC 2R1XB 1BZ7A 2ESVB 1T3FB 1VADA 5EWIH 4GBXA 5D8JH 4PJXB 2CRMA 4YHYC 3RWCB 2AABH 3SGDI 3VWKC 4OCWL 1BBJA 1IL1B 1AKJB 5GGTH 2BRRL 4JQXA 3WN5B 1JGEA 3QUMH 1FAKT 1T2QL 2IPTL 3HC0A 4NQCB 4HIEA 3VXME 5F3HB 3KWWA 3RTQB 1JCKA 4JFQA 4PRHB 2MTPA 3QCUL 4BKLB 2VDNL 4MQTB 2YPVL 4MQ7B 1IFHH 4A6YB 3TVMA 1MAML 4W6XB 2BCKA 5TF1L 2Z4QB 2FEDD 3MV9E 4CBPA 2KUTA 2P48B 1BHGA 4M93B 3QIBB 4MA8L 1RUQL 4R8WL 4OQTH 5CJOH 1ZV5A 2VNCA 4APQA 4PJDF 3BP6A 3O3BA 4LKXA 4UAOC 4LRIC 3G04A 1GGYA 3DOSA 1R3LA 1T7YA 4QGYA 1VFUA 3MXWH 2YPVH 3R8BB 3G5ZA 2ADIA 2B39A 5AUMA 5DDHB 4G80B 1EGJL 1GJIA 1T1WB 4OQTL 4DWHA 3C5ZA 3IKKA 2UUDH 2ITDA 4KKBC 3B6SB 1A21A 2Q8BL 4K94C 1MH5A 1AH1A 5EG6C 1AC6A 1IC7L 3BIBX 5B22A 5H37H 3VWJB 5D7IF 3UJJH 3S35X 2YD2A 1CFSA 1NMCC 3R06A 3TIDA 5IR1B 1TETL 3QJFA 3MV8A 4NCC2 5CD3B 2F58L 4IRZL 5GS3A 2N4IA 4NN7B 1DUZB 3IDXL 4PY8J 3KHOA 3ARVA 5E5MA 1MIML 1QLRA 3WFBH 1HHKA 2HJFA 1KPVB 4HFUL 3R0NA 4NUGL 3RQ3A 5EU6B 4QRPE 4G9FE 2IH3A 4DUVA 1AIFA 4EVNB 4M7JH 4MAUL 3QZWG 1HWGB 4BSVA 3MUZ1 2L4OA 2WK2A 3MBEC 2YD1A 5ETUA 3IJSA 3O4LB 1YEHL 2HKHH 1YA5A 4RRPG 4L4TA 2OYPA 3AREB 4O4YL 3OL2A 1V7NH 3K1KC 2BNRD 1OM3H 4UILL 2J3SA 1FFOA 3S88H 1EXUA 4PRNA 5ISZE 4LAJH 3EYQD 2VH5H 2R23B 5GJSL 1NSNH 4JREC 1OP5H 2AEPL 1YECL 3MLSL 3OB0H 1T1YA 3PWVA 1UZ8B 4KJYA 6FABH 3E8UH 5IW1B 1NCNA 3NABL 2E9WA 3AS3A 1RZJH 4PLKD 1Q38A 4YHPA 4MD5A 1AGBB 2ESVA 1Z0MA 2CO6B 5GIRA 1V05A 5FIEA 5L2KD 3S98A 3BVNA 5L6YL 1NGXB 1I1FA 1CXEA 3VXSB 3NACL 4X6DA 3VRIA 1F02I 4PLKC 2VR5A 2YPLD 2MKLC 2CKNA 4FXKB 1P1ZB 2BFVH 3KPSA 2B2XH 4PY8I 4KKLD 3AC0A 1T89A 4GRLD 2BNRB 1BVKA 2OQJB 1Q72H 2AJUH 3VMNA 4X6BB 1DVFB 4XH2A 1RURH 2GJZB 5IVXB 4NRZB 3GBML 5GGVY 2XQBL 4FTVD 4JG0L 2XKSA 2J8UF 1WAAE 3RZCC 3DMMD 4Y5VC 4KZEL 1NCDL 4IMLB 2P42B 4GRLC 5JPNA 2B2XL 4XAWL 2X4OA 3SO3B 2OBGA 3QIBA 3HG1A 2VO5A 2GUOB 3MOQA 2NXZB 3BGAA 3ARZA 4LKXB 5ANMA 1HILB 4U6XA 3RVWC 3AM8C 3QDJA 3GM8A 2Q76A 1H3PH 2H41A 1FC1A 1A9BA 1FNSL 4X8JB 3SKOA 2BOBA 3KG5A 1N6UA 1YUHA 3F6IA 2L7UA 3ULSA 3W82A 5D5MF 3ARSA 2EH7L 1QTYT 4PJGE 4G9FA 4ODSH 4AT6B 1Z0NA 1SEQH 5IW6A 1FRGL 3QUYD 4YWGL 5CINL 4C54A 2XXCB 4AM0B 2YEZB 5F7EH 1FNSH 4IOFC 3C08L 3K2UL 3QIBC 4Y1AE 1DQJA 4PGDA 4PTTB 4N8CH 5DJ0B 4XZUB 5IVXF 4Y5VA 4OT1L 1D9KB 2C1OA 2XN9A 5C7XH 3S8WA 5C08A 3ZSSA 3HZKA 3MJGX 3QYCA 2J8UB 4BKLA 2Z31C 4R2GD 1C5DB 1G0DA 3I3EA 2Y06H 4YWGH 1XGUA 2GKIA 3O6FD 3PGDB 1FZJA 4OF8A 2X4TA 2AJYH 5DA0B 3KYKH 4Y19A 1RY7B 2HFEA 1I8IA 3C08H 3K2UH 2ZKHL 4Y16B 3EO1A 1CVRA 1FIGL 1KJ3H 2F5BL 1BX2B 1CGUA 4JQVA 2I27N 3O9WC 4XTRD 1CFSB 5LKNA 4KK5D 4RMUA 3MX0A 1NCUA 4YO0A 4RWYL 1EBPA 4P5MB 5F9WC 5SV3A 1PDKA 4XVTL 3SGEI 5I0ZA 2PXYD 2Y06L 3PP4L 5E8PA 3MRLA 2X89A 1PZ5A 3QUKB 2FNBA 5SWZD 1KCUH 5EA0L 5E8NA 5JLZA 4RAHA 1FIGH 3QEQE 4XC1H 3SGJC 1Y18B 1LEKB 2X1QA 3GMPA 1ZEAH 4OD3H 1VCAA 2VSCA 3MRBB 4B5EA 3JWOC 4HX1B 1A5FH 5D71L 4XVTH 1P6AB 1UWXH 1AXTH 2ZUWA 4TTDD 1NQBA 1IQDA 1HZHL 2JB5H 3MMEA 4ODWB 3OX8B 3QIUA 2YPKB 1A3LL 4GW5B 5DEFA 3IYLW 2BNUB 1AXSB 1JPFA 2XKUA 3N1GC 5F6IB 2GITB 2ICWI 4FQCL 8CGTA 4V1DA 3ULVH 2R2BB 4UU9B 4XB7A 4RZCA 1RIVL 2YUWA 3K4DA 4PBWD 1I9JL 4KRNA 3UPRB 4KJYB 4RNRA 1IEBA 5JR1H 1WFUA 4JFFE 4UZGA 5LCVL 1ZK9A 1OGTB 3L3IA 3LKQA 3WXVL 3FRPG 4DN4H 5HGBB 4DVBB 1MNUL 3GHBH 5T1KD 4BUGA 5HHME 3TEUA 2AV7A 3OKDA 1YEKH 4CW1B 2PYFA 3TBWA 1OB1B 4LLVB 2KH2B 2DLEA 1FNFA 1QQDA 5FUCE 3LKNA 2NNAB 5ANMB 1I1RA 3KPSB 3KYNB 4DZBA 4D0BA 3MLZH 4KVCL 1MNUH 4OFPA 1LEGA 3BISA 1AHWB 4OZFA 1T1ZB 3RY4A 5I8OH 1UENA 1CBVH 1IGFH 3IF1A 5EUKA 1MY5A 5DD6B 5DMGD 2EKJA 4H25B 5LGHL 3MRGB 3HPJA 4PGJA 2OK0L 1NC4B 1WITA 3ZYOA 5IMMA 1F90H 1FZJB 4F57L 4EEEA 2HWZH 2R2EA 2NY7H 1AR2A 5C0RH 5DD5L 5KN5B 1IAIL 1XGRB 2RFXB 2V2WA 4OIIH 3V4PL 1A14H 1I9EA 2J6EH 4XRCB 4D9LH 1YY8A 5HDLA 5C0AE 3IDNA 4LCCC 2FATL 4KGJA 4ZUVB 4NJ9L 5IB4B 2BHUA 4GW4B 2R2HA 5E8NB 3GMQB 4HCRL 3L5XH 2X4TB 4ZS7L 3MRCA 5F70A 4CU7A 5SWSB 2PTTB 3B2UC 4ZDHA 1X5XA 4Q6IA 3MYZA 4APQB 1X5GA 5F1SA 3V4PH 3BPCB 1RUAH 4O2FA 5IMLA 2ZUTA 4OZHF 4H0HB 1NGXA 3QDGA 5TE7L 5DJ0A 1ZLVH 3AXLB 4XZUA 3KVQA 1G7JA 4LOUC 1R3HB 3TBTA 5JOPD 1BD2B 4S11A 1JRHL 3QWOA 4ZS7H 3RX8A 5C2BL 3VFTA 4GKZA 1JNNL 4HUUA 3BT2H 4PRIA 3VU2A 4X80H 4P9HH 1Y18A 4F3FA 3FO0H 4MS8D 1F2QA 4JQIH 4NQDE 4XX1G 1DQJB 3U7AA 4HC1H 2LU4A 1OARL 4NQEA 2PXYA 5E9DB 5TGBB 1JN6B 4LL9A 3DROA 4N0UA 3X3FL 3SE4C 1V5JA 5BV7H 1KJMA 3ILQD 5B38B 4X80L 4Z76B 2X4SA 4E41B 5J1AB 3E3QE 3HE6C 5DT1L 3DUSB 1FJ1A 1MJJA 2CJUH 1N5AA 4NM4H 5DC9B 1A47A 2YWZA 4Y8DC 4G8GE 3N85L 5E8DH 3MPCA 1P9MC 1MVUA 4EZMA 4Q58C 5MENB 2L7JA 5BVPH 4ZPTB 5I8KH 5KANI 1X5AA 4AIOA 3WO4B 2YMXH 3LB6C 3RAJL 3L3JA 4F37K 1AC0A 3LAFA 2Y6SC 2PF6A 5E99H 3IAQA 3QXTA 4HFWA 4R26L 1PZ5B 2IMNA 3BD4A 1KEMH 4P99A 4XBEH 4AH2A 4AIZB 5IVNA 4NO0D 5JLZB 3ALWA 4NZTL 2BVEA 5I16B 3OMZA 1HYSD 1T4KA 1BQHG 1WZ1L 1TQCC 3FO9A 3TCLB 2Y6SD 5L2JA 3HZKB 4PJAA 1QRKA 1D5BB 1Q9KB 4LPYA 1HKFA 3LKSB 5BXFB 4M03A 1LILA 4W4NA 2BC4A 3FOLA 5IBTH 2GAZB 5DK3A 3MLWH 5DFTA 3H9YA 1EHAA 4YHML 2EDTA 3KR3H 5HI3D 3NTCH 3O2DA 2YKLL 1KCRL 1W0WA 1QSFE 4FXGB 1A1MA 3MGOA 2VZUA 5A2IH 1J10A 5F6HJ 2YN3A 3BXNA 3ZE0E 4M48L 2DKSA 4WWKA 3L1OH 4IOSD 1BWWA 5MEPB 5I1CL 1FV1B 3IETB 4AEHL 4JHWH 3IDNB 1R3HA 4YHKH 1JTPA 2ED9A 4OF7A 1A02N 5EO9B 2CGRH 1DN0A 3UTSB 1HHHB 2ZUSA 1H3XA 3JWOL 2DQDH 4OAWB 5CGTA 3GGWB 3MV01 2EDXA 5FA4B 4E9LA 5L2KB 4ELMA 2B1HL 1RJLA 3FQXB 4JFED 3H42H 4ZDHB 5AWNL 1GGIL 3VXPB 4N0RA 2C3WA 4O51B 3EYQC 1UYWL 3ARFB 4JHWL 1IAOB 2Q76B 4YHKL 4Z7WB 1K5NB 1OAKL 3SDAD 5IB1B 4M7LT 2EDJA 3WD5H 1FVCB 1T03L 4KK6D 4FQHB 4Y88A 3OG4B 5DJCA 4I4WA 3TO4C 3MRGA 3QHFH 3JWDC 1W72A 3GMNA 4WY7H 1C5CH 3TO4B 3S34L 4P3CL 5T1MB 2O5YH 3VI4F 5ID1A 1EJ6A 1G7QB 4JFDA 3QSKB 5FECB 3NOIA 4QGTA 3NA9L 4GAJL 4KMTL 3FT2B 1G7MA 1CGYA 2XZCL 4NQCD 1KCVL 2AXFA 2H2PC 5D7JC 5EOCL 3O3EB 3B8YA 3I50H 5F89B 1TCRB 3VFMB 5KS9F 1DBKH 1JWUB 4XRCA 3U7YH 3IGAA 1M7DB 1OB1A 4KTEH 4PJCF 2NY1D 4WY7L 3L95B 4GXVH 5HBBA 4RDQF 1MJ8L 1FYTD 2I5YH 1YMME 2IJ0C 3BI9X 4I18A 2GSIB 3NN8A 4MDIA 1FCGA 1L7IH 1SJVA 5DLML 5D7JD 2R1YA 1ZA3A 2X4NB 3SDAB 1NCBL 2IMMA 4H1LA 4PFEA 5E8OB 4G8GD 3K46A 3PWPE 1G7PA 1XMWA 3BEVA 4N5ED 3EOTH 2ILLA 2VWEE 2X70A 4IEFB 3EOYG 1U9KA 3HE7A 2PR4H 4HMEA 4JDVA 5IM7A 4GKZB 2HG5A 3CFEA 1OGAE 4RFEA 5EWIL 4HIJB 4YXLH 1EJOH 5GS1A 5IBUB 4RIRA 5GZOD 3QDMB 5EIVA 5GS2H 4F7TB 2D0GA 4OFKA 1ADQA 3GMOB 4GUPA 2JB6B 3MXVH 3FFCB 4HBCL 1ZMYA 2YD6A 3FQNA 5LGJB 1AJ7L 4X7DC 2D03L 3BFOA 1FNGA 4YXLL 4AH2B 5DR5H 4MJID 3H9ZA 5D7SH 4G43A 4YDVA 5EO0B 5TDOB 5FM5O 1T0NA 3VWJC 5JMOC 1MVUB 4F80A 2G60L 2H1PH 2YA1A 4IRZH 3VMOA 3HN3A 4ELMF 3VCLA 1B4JH 4FFYL 1DZBA 1U58B 1FZMA 2VKXA 5F7NC 3OAUH 5HVFB 4POYA 4PREB 3S97C 4OZIF 3WO4C 3VD5A 4OZ4B 3T4YA 3T8XB 1JN6A 1QLEL 3S37X 2HKFL 3WS6A 3HS0B 1P5UA 3LRHA 3KJ4C 2CUMA 1YQ2A 1KJ2A 1B4JL 1XF5B 5KSUA 1XCTB 1ADQL 2WINA 3EFDH 4G7YH 2Q8BH 3QXVA 3MOBL 4ZOEA 4O4YH 1BIIB 1BZ9B 3LMJH 3ZDZE 4NIKB 2VLLB 4TNVK 2FIKA 5E8EA 4A6YA 1J1PL 5IBUG 3WFBL 1R3IL 3FQWB 4GRWB 3QUXA 4XBGB 5EU4B 3FHQA 3FRUB 1HH9A 4NUGH 4V1DD 5K33A 1WWBX 3GIVA 2W9DH 1IKFL 2ADFH 4X6CE 3FN0H 4Z9KB 4QCIB 5GQBA 5JW5A 1M1SA 1MSPA 1ORSA 2CKBL 2FZ3A 5JOEA 3SCMB 1KELL 1GVIA 3BW9B 5MERA 4YAQA 4LDOB 2F53E 3QEQB 5DD0L 5DWUL 2VDKL 4PP2A 4U1NA 2RIKA 1V7NL 2IQ9H 3FQXA 1U3YA 3U82B 1K2DA 3TT3H 2X4NA 2AI0H 4GBXB 2XTJE 3QPQD 1RJYA 4OFVA 1HWHB 4EXPX 5DRWA 5I9QC 3RDTA 4KRMB 5KTEH 2AJZB 2XPGA 3EBAA 5DTFB 3I2CL 4YHOH 1UB5A 3L5WB 4X6DE 5HVGB 1FG2B 1NCDH 5T3ZD 3RNQB 4OV5A 4ZUUA 4G43B 4YDVB 5EBMA 1FNEA 1MWAA 5EO0A 4GMSH 4YEEA 1KPUA 5E2VL 2NW3A 4H20H 5FECA 1K85A 5DK2B 2Q87A 1I9IH 4ISVB 1NFKA 3PQYD 4WVRA 4ZXBD 5EORL 5HVWA 3BD3A 3BN9C 1S5HB 4JKWA 4JB9H 4X9GA 4JFPA 5JPMA 3IAGC 5IOPA 3OXSA 2HG5B 2L0DA 4XCCL 2EC9U 3BDYL 3G5VA 4PJEB 3EFFB 2Q86B 4ZOAA 3RWEA 1G7LB 3H3BC 3VMPA 2EE2A 5L88H 4JG0H 4MNQB 4UTBH 5DSCB 5C6WH 5D6CB 4TSAH 4H1LB 1SYVA 3QQNA 5GGSY 3KDMB 4EQ2A 4XCFH 4AQ1B 2A38A 3H9HA 5DJAA 3BEVB 4DKEH 3BKCH 3S3JA 1HHJA 2ICES 3RHWF 3ZL4H 2DQHH 2WWMD 4K3HA 1WCBB 5BOZG 1EUTA 5SWZB 3RIFF 5C6TL 2AJYL 3J8F7 1D5IL 4RFEB 4RA0C 2VDQH 1NCAL 4F37F 2FCBA 3BO8B 3E2HB 1FO0L 1M7DA 3IGAB 3IJYB 4ODSL 4ZXBA 5FV1L 5AG9A 1YMHA 5LQBH 4JKPL 4K3EL 1HI6B 3O4LA 1S9VA 2CLRA 3JXAA 1A3QA 4XH2B 5GRVK 2XA8L 4TPRL 3PWVB 3P4MB 1DQLH 3VFRA 4PIRF 5JW3L 1JE6A 3IDGA 3W9DA 4AEIH 3UTPE 1EFXA 2GFBB 4XNZC 1AGCA 3SCMC 3D2UB 2R4SL 1WGOA 3ULUH 3GSNL 4WRLA 4PTUB 1VEMA 1HZHH 4PJFA 5EU3B 3WFEH 2AW2A 2QQKH 5C07E 4OV6F 1A3LH 4ZD3L 5DMJB 3V6FB 3TJHC 1YUHB 3R0MA 4Y16C 3FO2B 3D3VD 5EO9A 3ZTNL 5JHDE 4CAGA 1ZLUH 3LQZA 4HS8L 1G6VK 1EMTH 2HTLC 5JR1L 3GZKA 3FRUA 4PJBF 4HJGB 4XCEA 5BW7C 5ACZA 4XP4H 4WO4B 5FB8A 4DN4L 4K9EH 3AAZA 1U8PA 3QI9A 3WUWB 4DAGL 1QFHA 1LWRA 3V8CA 1FAIH 1X7QB 3KJ4B 1YEEH 2VXVH 3B9AA 1AXTL 4I4WB 4XCNA 2NTSP 1SEBA 1LDSA 2JB5L 2FSEA 2WM0A 3TO4A 1EO7A 4PS4L 1G7HB 3F58L 5B3JE 4XP5L 1NBQA 4CADB 4MCYA 2DKUA 1RZKC 4X4ZA 2XN9D 2BVUA 3MRPA 1TCRA 4HEME 3CH8A 2GI7A 2OK0H 3JBG7 3IDJA 4MXQC 3ZKSD 3IFLL 2DWDA 5HDOA 4XWOD 4OZGA 2DD8H 3REVA 3WXVH 4YFLF 1UKSA 2DI9A 4ONGL 5IQ9A 1X5KA 2W60A 1A9BB 3D18B 4XWGL 5J13B 2AK4D 3HI5H 3H9SD 4PRPB 2J6EL 4D9LL 1FPTL 2XXMB 5KVGL 1MAJA 2E27H 3UTTE 1IQWH 3HMWL 4J12A 3MLTA 4TRPL 4U7MA 4YHIB 3WFZA 2PKDA 5GSRB 4C83A 1LMKA 5FGSA 4KVCH 1TZHB 2O5ZH 5CEZH 1LP9F 2Q7YA 2VLRD 1AE6H 3QIWA 5D2LA 1JIBA 2Y7QA 4LHQB 2DBLL 2CLZA 4P4KB 2ID5A 1KBGL 5TPWH 1GC1C 2NW3B 5D93B 1P4IH 5IHBA 4NQCE 1FPTH 5KVGH 1HNFA 4L1HA 3GRWL 3BO8A 2HH0L 4PR5B 3NFNB 2Q86A 3MQIA 3VXMB 3QWRD 1YJDH 3D2UA 3TN0B 4WV1B 3PXHA 5TH2A 5HHOE 3MGTA 2NY7L 4HMDA 3VGHA 2VDLL 1S9VB 3ESVF 1I7UB 3OKOA 4UIKH 1BF8A 3UTSE 4OI8A 4JJ5B 3NBNA 3C9NA 3WE6A 5KVEH 1OQXA 1I7ZB 4JQIL 3WEXA 4BFGA 4N8PA 4YFLI 4NSKB 2BOBB 2DMKA 1G7LA 2CIKB 2IAMD 3MV7A 2BVYA 3TZVD 4XCEB 4YPJA 3O4OB 1WZLA 5MEQA 5DYOA 1U0QA 4L1DA 4WFHE 4BELD 3BP5A 1LP9B 4KDTC 4F9LC 4GW5A 4KHXH 1A0QL 3ULVF 3MNVA 1HHGB 3N85H 3GMMA 4R7NA 2JE8A 3DVNA 3UZVB 2AXGA 4NM8L 5KSAB 1FNAA 3B83A 2BVTA 3RAJH 1A6UL 2ICWA 3GSOA 4HT1H 4JRYB 4QXTB 1LO5B 3HMXH 4NWTL 1C12A 3S6CA 2PXYC 3D25A 1ZVSB 2HVKA 4B7LA 4DK6A 1W8OA 2GITA 2VE6A 3IFOB 1BIIA 1ZLWH 2ATPA 3ARFC 3SKMB 1A7OL 4U1SB 5FKPA 1RUPH 4NBXB 4JRXD 2PO6B 4QHUB 3T1FB 4YFEA 5IB4A 3H9HB 5DJAB 2ZOLB 3VGEA 1LEGB 2F5AH 4XBGA 5D7KE 5EU4A 4KJPC 5JORA 2ED8A 1DLHB 1HINL 4PBVC 2WMPA 5HYQA 3VW3L 4S0TD 4WO4A 2KQNA 1N4XL 3MV8D 3EYSH 3VWJD 4OZIA 3L6FA 3QDGB 3FB7A 4UAOB 3PV7A 4V1DB 1DBAL 3CVHL 1KXVC 2GT9A 3RGVD 1OGAD 2EZ0C 2YKLH 4CMMA 1Y0LA 4PJIF 5ISZD 3QUXC 3KYAA 4EN3A 5D1QD 2Z8SA 5MP6L 4TOYL 4PRIB 3STZA 3IDYB 4OZFB 3KLAB 2Z8WC 1J1OL 3RY6A 2YD4A 3RTQC 3SKJH 3BKJH 1GXEA 3LVEA 3WYRA 1UC6A 1WZ1H 5D1ZA 1S7WA 2BCKB 1VACB 5GISL 2J8HA 1UB5B 4PLNC 3L5WA 4QRPD 4Z7VB 2ZOKA 5GHWL 5FK9A 1QEWA 1J1OH 1DQQA 3GMQA 4WU5A 4RGOL 1I3GH 3O11B 1UYWH 1AQDB 3FN3A 3FFCD 5D7IA 4OIAA 3CLFL 1CK0L 5DRXB 1TNMA 4WFED 4L9DA 1T03H 2UVFA 3FB6B 1H8OA 2DLIA 5LG1A 4HFWB 2E3VA 2O5YL 3U6RB 3W2DL 5GS0L 3N1FC 1JHLL 4OLYH 3PHOB 4OKVA 2XY1A 3RUGB 4LHUG 5J56B 3O45A 1CK0H 2OR7A 3IDIB 2ZCKL 3VXMA 4HF5H 2ZSWA 1NBZA 1SBBA 1MJ8H 3PL6D 5AD0B 5BRZE 5CP7B 4QYOB 1TFHA 5HXMA 1MFBL 4LSSH 1BQLL 2H9GB 1E27A 3QIWB 2GSGA 1OAKH 4L3EB 2RHEA 5D8JL 4HS3B 3GMRB 1VFOA 3BZ4A 4IOIB 3DMMB 1AGFA 6CGTA 4OCWH 4HGMA 5F8RC 2H32B 4X8XA 4LVOC 3VWKD 1ZVSA 5T5FL 4DGYL 4NC1C 2E9BA 1ZLSH 3LEVL 1OT2A 2EECA 4U6YB 2W9EL 5A2KH 1T4KB 3FO9B 4JY6A 4N0FA 3L7EA 5C1MB 12E8H 1OAQH 2YZ1A 3MNVB 5I1IL 4KTEL 3GGWA 4MQSB 5E9DA 5TGBA 3BIAX 1EA9C 2CIKA 1CDCA 3LS5L 3G9VA 1WIUA 4ODHH 1IFHL 5L0QB 1G9MC 4P46D 2F53D 5BZWB 2VN7A 3AY4A 4QXTA 3BH9A 4K7FB 1LD9A 4OZIB 1FFOB 2W9EH 2A6KB 5DMKB 1J9CT 4JO3L 5EU6A 5HHNA 4IRJA 4R3SB 3IFOA 3VXSA 4X6DB 3MLXL 4G7VH 1OAQL 3UYRL 2OTUA 4L3CA 1DANT 1P1ZA 4Z7VA 4ZYKA 3MACL 3RWJA 1HHIA 2E8ZA 2QJDA 4WV1A 3JWDL 2ADJA 2C4XA 5GGTL 1W0WB 1VB9A 2AXGB 4OQ1A 4RFOL 1CFQA 4XP1L 1ZT1B 2P5ED 1ONQA 1W0VB 5IWLC 5SWSD 5BRZD 4KRPD 5ACZB 3UCRA 5EU7C 4PJGA 2A6IA 4Z7QF 5IFJA 4P2CG 5MHSD 4XNZB 4LSRH 4MA1C 3HI6H 2CXKA 4NPYA 2PO6A 5K9JL 3IDXH 4HXBH 2FDBP 2XKNB 1A6VL 1IVLA 5AEAA 4MA8H 1QSEA 1MCSA 5CP3H 2VXQL 2GTZA 1YC8A 5DR5L 2APWA 2GJZA 1T80A 3QEQD 3IXTA 2IALA 1RJZA 3MRJA 1U2HA 5DRZB 2PTUA 2DYPB 3VGBA 3VRJA 2BERA 1EGJH 2MQ0A 1G7QA 2JTDA 4L8SA 2LQRA 2VISA 4LRIA 5ICXA 1RQ5A 1R3IH 4U3CA 5GGRA 5IHLB 3CFCL 3RX7A 3REVB 2XZZA 4JRXB 1W72B 1IAOA 5HTSA 5F71A 2CLVA 2CQVA 3KPSE 1QR1A 2IAND 4KRLB 2BSED 3LV3A 2VQ1A 1I85A 1K8IA 1FVCA 1AO7D 4PRPA 1XR9B 2QV2A 4WJ5A 4MQ7A 1FVEA 4PG9B 3TH4T 2OLDA 3EDKA 3E1F1 3L3KA 3PNWA 5CJQL 4MAYA 1WAAA 3S5LB 1G9NL 1LK2B 3GEWB 4RA3A 1FE8H 4K94H 1DQDL 1WLHA 4M8QB 5DGRA 1DEEB 1S7RA 5KANG 3T08A 5B38G 3UYPA 2A0LD 2V6HA 3BP7B 5TDPB 3ARGC 1T1XB 2VABA 3V0VB 4AL8H 1NFIB 1H3TA 4R0LC 5L8KB 5AUMB 4X5XA 3CFBB 3NN8B 1SJHB 2W9DL 3LKOA 2BFVL 4LEOB 5T1MA 4OLXH 1DQDH 1IAKA 1LE5B 4KJWD 3DRTA 4GMSL 1IGJA 5E2VH 4F15B 1XF1A 5CSGA 1J86A 2Z91A 5J11B 2RGSA 4OGXH 3RUGA 3O3EA 3VFMA 5CD5C 3GMRA 5D70L 2B5IB 3QFDA 1YEGL 2YN5A 1NBYB 5IHUH 3NABH 1BFOB 1VFAB 4LLYB 4LIQE 4K7FA 5ITFB 4JN2A 3VXNA 5E6IA 4LK4A 4GRWF 4Y1AA 4EDWL 3QQ9C 4RGNB 3ZE1F 4JHBA 1MLBA 4XCCH 4BSVB 3F65A 3U0TA 2DM4A 5A3IC 5HGHB 3SDDC 3C6LB 3GNMH 4IM8A 5JXED 2IFGA 3O8XA 3JV0A 4F7EA 4JFZL 4FQXD 5F9AC 4XAKE 1HH9B 4DKEL 3SKNA 2E8YA 2X05A 2VJXA 4M1GH 3ZL4L 1Q72L 3ABZA 3RWHA 3U9UB 4WGWB 4AY0A 3ZKQD 5I73C 1XZ0B 1EAPB 3PDOB 3QNZA 2A6IB 3QZWA 4M6OL 2OL3A 3SDDD 5C6PB 3QUYA 3GMPB 3U46B 4F7PB 4H88H 4N8CL 4GXUN 1QQDB 1D9KD 2VISB 4R6UA 5CSBA 5MERB 4M7LH 2FJFA 3ARGB 4ZAKB 5GZOC 1NGPH 4OLZL 1FO0H 2XWBA 1QSEB 3ULUD 2V5MA 1QR1B 2JJTC 2WP3T 1RFDH 3RVVC 5JZ7D 3CDCA 3E6FA 1N6QH 3FTGA 3L3GB 5DJXA 4Z7OE 5E5MB 4LVHC 3IXAA 5HGBA 2C4FU 2D7MA 2IEPA 3FB7B 2B1AH 2IPKB 3UBXB 3WIHH 2FGZA 2CR6A 3DMMA 5I6XB 1I1AC 1Y0LB 3CXDL 4RWYH 3EUUA 5TQ2H 5C0CE 3NAAL 5IVXE 1B4RA 1U91A 3ULUL 3CC5B 2EXYC 1EPFA 1KCUL 4XPBH 2GK0B 2BP3A 2VYRE 3MFFB 4FS0A 1HIML 5E2WL 4ZUVA 2B1AL 1I1AD 4OT1H 2WBJA 4GW4A 4U1MB 2HRLA 1G9NC 4QF1A 5J12B 1OAXL 2C1PA 1EZVX 5SWQB 4G9DA 1MI5B 1F97A 4GMTL 1GGUA 3VCLB 3IDUA 2GK2A 3FMGH 4PJ8D 1A3RL 1B0RB 1S9YB 5IMOA 1CXKA 1HHIB 3PP4H 4LCIL 5C92A 3H9SE 2UZYB 1YEJH 4FA8A 3WFEL 3MREA 3QUXB 2DWEA 4N8VG 3RJQB 4QCIA 2W1NA 3PHOA 3UTTA 3PP3K 4PJBE 4NRYB 4LLWA 4X0KA 4Z7WE 1KIQA 3U1SL 1VGEL 3ROLA 1RHHB 1YEKL 4Y7MA 4PJHF 2W0PA 1IGYB 3VFVB 3ZKXC 1KB9J 4NQUA 1T6WA 2P5WE 3MRCB 3RTQD 2DD8L 5GGSA 3RL1B 3TN0D 3JTTB 4P5TA 4MNHA 1IAMA 2H9GA 3H3KA 1MFAH 4JFPB 3SGJA 4D0DB 1R0AH 2ZSVA 4Y2DB 2BX5A 3X12B 1FAIL 2A9MH 4JZJA 3MUJA 4RX4D 2E27L 2NY3C 4IRSA 4YDIH 4N0UB 5DMGC 5IQ7L 1V8HA 3SCMA 2MKWA 1DTUA 3KDMA 1JVKA 5JPMB 4XP5H 4IDJL 4UQ2A 3TO2B 3O2WL 1UXSA 4KTDL 2VXSL 1CDGA 4UV7L 1MRFL 3B5HA 3NIDF 3WS3B 3MBXL 4I2XA 3G6AA 2ARJB 1KBGH 3LRGA 5EUOE 3LKPA 3PL6B 3SY0A 5BXFA 1NUNB 4JGMA 2P7TB 4DQOH 1YJDL 1JNHB 2DMBA 5C9KA 3V4UH 1M71A 3CMOL 3W9EB 4I77L 5JNYB 3MMEB 4ODWA 3I3BA 1UEYA 2A74B 1PKOA 4W6YB 5FDWA 1PEZA 3F12A 3VFPB 3BP4B 5GS0C 5HYJE 1H5BC 3KPOB 3NFSL 4OGYL 3SO5A 1DUYB 4CVZB 4K2UL 3QDHA 4BZ2L 1H3UA 2XRAL 5E1HB 3V4UL 2EO9A 4OCNC 1HN1A 1QFUH 4G6AC 4X5XB 3VXUA 2NZ9D 3EOBB 4X4YA 1OSPH 1GHFL 3B9KA 5D5MA 5FGCE 4QHMA 1L0QA 5DS8B 2BMKA 4GS7C 3LH2L 1UZ6E 5DUML 2JJUA 4P9HL 2WQRA 5DC0A 3WMSA 1EAPA 3QZWB 1JWSA 2HH0H 4ETQA 4FABH 2NXYC 3RWIA 5BCAA 2X4UB 1U6AH 1ZHNB 4NM8H 1IE5A 2D7PA 1MCJA 4R7DA 1MCWM 1SQ2N 4JN2B 4UIKL 4FQ1H 5E6IB 3MRQA 4KWUA 3SDXA 2VLME 3AAZB 3UX9B 4PUBL 1IGTB 4K7PX 4WUKH 1WWCA 1XCQA 1XIWA 5DJZB 2GK0A 2F54A 4TUKH 4HJGA 4X5WB 5DEGB 3QDMD 1QBML 2A73A 1Q0XL 3DO3A 2LTQB 4WTZG 3GRWA 2YMXL 4PJDE 2VL5A 4YK4B 1XH3A 1L6XA 3BWUC 2DQEL 3BT2L 4XMKH 5JMRA 2OJZH 4GAGL 1SEBB 3PP3H 4FG6C 4J3VA 1C16A 1KEML 1NANI 5GRVL 1FV1A 1A0QH 3QPXL 1VERA 1PYWA 2YK1H 1DBAH 3CVHH 4S1RH 1MFEH 4DW2H 4RMTA 3RJDA 4FZEL 1A6UH 2I07A 4OUUA 2QADC 3QH3A 4CADA 4PB0L 4TOYH 1K4DA 4DEPB 4XGZB 1BJ1H 1P2CB 3VGFA 3CLEL 3DETC 3QPXH 4JDTH 4BUHA 5I0DA 2APBA 3MLTB 2BNQE 1K6QL 1ZHBA 1PG7X 3HZMA 3QI9B 1T1XA 2VABB 4I3RH 5IB1A 1RK1A 2X1PA 2CDGA 1I7RB 1WWWX 5C2UB 5IMOB 1XGYL 4KKBD 3D39B 3WJJC 1ITBB 3CXHK 4JPIB 5DURB 3WJLC 4Y4FA 5K9OB 3W0WA 2ARJA 3CLEH 1CDYA 1TVDA 4WNQB 3RUGF 5GGUA 3VH8A 1N4XH 1ZA3B 4MHHG 4O02L 1I3GL 1K6QH 3FFDB 3MRKA 1N2RB 3C5SB 2QL1A 4I3RL 4LHUA 3KLSA 3ES6B 2OX5A 3TVMB 3CLFH 1JYWA 4CN6A 4M5ZH 3CX2A 4E41E 2CGRL 2WIMA 3HAEH 3MSPA 4LRNL 3K8KA 1BFOA 1VFAA 3JWOH 5KSAD 3BN3B 3G5ZB 2UUDK 5DGQA 4G8GB 3T0ED 4Z76A 4KDWA 3V7AG 3ARDD 4MXQD 2X44D 4NQXB 1GGIH 4YHMH 1WV7T 5HYSG 3C2SA 3F7RA 1AGDA 1BP3B 1KFAL 1B0RA 5HGHA 3P0VH 1AD0A 1EEQA 2ZCHH 4R7DB 4NC1E 2ZCKH 3ET9F 3IFNH 3T0BA 4YHLL 4XNQB 1A22B 2VOTA 3AXLA 4KK6C 4C4KO 4GSDH 2XA3A 5GHWH 3T3PE 4WW2F 1KTDA 3FQUB 5I1CH 3UTZB 1UA6H 3HB3D 3VFWB 5FOJA 4D9RE 2WBKA 2FGWL 3DO7B 1NC2B 1BQLH 5EH1A 4RFNB 5F7UA 3AVEA 3KWWB 5FGRA 4XT1C 4PJEE 5EOCH 4GG6A 5J6GB 1DBKL 3V9FA 1ZTXL 2XWTA 3O2DL 1MAKA 1GIGH 3SDCC 4GSDL 2C3GA 3NCCB 3LPFA 1GRWA 1IEAA 5I2IB 3VXQB 2NY1C 2HFFA 3DX9B 1RZGA 4EVNA 2A1WH 3WXWL 4PLJC 3U4BL 4CVXB 4UNTA 1F13A 3F12B 3NCJL 1MQKH 5I15H 4DFIA 4R4FH 4I0CC 1GIGL 1SJXA 1BVLB 1TJHH 1SY6L 5H8DA 4NZUH 1MF2L 5F97E 4PLJD 2ORBH 2IAMC 1E4WH 3D87B 3TT1H 5MEQB 1UVQB 4O9HL 1ZHBB 2AK1H 4I2XB 1KCVH 3ZYJA 1FSKB 1MH5B 5TQ0H 5D5ME 3NIFE 2K9UA 4DKFL 4PJGF 4G7VL 3UTSA 2C5DC 1JWSB 4ETQB 4J1UA 4P4RB 1U8HB 4Y4HA 2VDRL 1UWEH 4ELMB 3QCVH 2DQUL 1T7WA 1K2DB 2I5YL 1YEDA 1Z2KA 5DJDA 3AREA 1XH3B 3EJJX 3MRFA 3O0RH 1U8JA 4PGEA 1A6AB 5ICZB 3VXRB 2BXZA 4JANA 1C16B 2UZXB 4AZ8A 4K07A 5FM8A 1RK1B 1JMXA 1CYGA 3GO1H 4H0IA 4CL7A 2AEQH 2VLLA 1TZIB 3NFPB 3MROA 1EDQA 2M2DA 2ZSWB 1ES0B 2VLKD 4U1NB 1N59A 4POZD 3QUML 1A9EB 1SY6A 2ICWB 4IOFD 5HGAA 1GPOH 3C60C 4WDIA 1P7QA 4HKJB 3LEXB 1WBYA 4P2OC 3UYRH 3GO1L 4LSDA 5GRXG 3WHXB 1NAMH 2E6QA 3BQUD 3QCUH 1PLGL 1DR9A 1FZOB 4G8IA 1QKZL 5E1AA 1QLEH 2EXYD 4X9IA 2VLKE 3KPRB 4ODTH 4NJAL 4ZUWB 1W8NA 2YXFA 5E6ID 5JIKA 3X14B 3CFCH 2FH8A 1NANH 3QUZD 5C09D 5GGUB 4YBLB 35C8L 1M6OA 2X09A 3L7FB 5D1QB 4ONHB 4BFEA 4LSRL 4JZJB 2G60H 5FO8B 1RV6X 4PG2C 1M05B 2R0WH 1I7RA 1WVZA 4LLUA 4ODTL 4TNWK 1H0DB 2VXQH 5HGGS 4WW2C 1NUFA 3P11H 3OAUL 4HIJA 3UJJL 3FQTB 1UACL 5DZLA 4QYOA 4FQ2L 5DSCA 4L3EA 3DJ9A 2RJMA 1KUMA 4PRPE 1E28B 2SEBA 2EO1A 2VZ3A 1CG9B 2FO4B 1ZA6A 2H6PA 3NCFB 4XVJH 4YO0B 1DBBL 4MNQD 1A6PA 5LGJA 1XGPA 1PSKH 3RPKA 1ACYH 5IJKC 2H32A 2P4AB 5IESH 2K7PA 5IROC 5GS2D 3S35L 3BZ4B 1R3KA 4P3DA 3I02B 4L3AA 2UYLA 3MOAH 4JAMB 3PGCB 4LBEB 1IZKA 1CZ8L 2BY3A 5I1GL 1NEZG 1JFQL 1A4JA 5BS0B 2R39A 3HTLX 3B8SA 1A7NH 4QRTA 5F88A 3FL7A 3B9KB 3L9RB 5T5NG 4B50A 5M94B 3GK8L 4EKXA 2XQYK 2DIJA 3C2AH 5J3HC 1KLFA 4K3GA 3VH8B 2CKBH 4UDTA 4Y8AA 2D31B 4X6EB 3HKFA 4P23A 3GJEA 2AK4E 3NCYS 2AEPH 3LQAC 3T4YB 3MOAL 3PWUB 5F1OB 3F5WB 3SDCB 5JHDD 1HQ4B 1HSBA 1EEZA 1ZHNA 5DD0H 5DWUH 5EO1B 1MY7A 3C6SB 1W0VA 4F7TA 2IQ9L 4L8DB 1KCLA 3K74B 1C5DA 3HI1B 1O5DT 3CFJB 4G3YH 1HI6A 2AI0L 1IEAB 5J9PB 4LASL 1INQA 1YNKL 3IU4L 1X7QA 3S4SA 1IGMH 4OGXL 4U3XA 4MDJA 3MRBA 3V4VL 4KUCF 1NLBL 4U0RC 2YUZA 4JFHE 2X2YA 3I6LE 1V7ML 4EJ1C 4B0MM 2IGFL 3FZUC 3LEYL 5F93C 4OLZH 4GAYA 4CN1A 3V0WH 3BKCL 1NLDL 5HGAB 4FMKA 2J8UE 1RZKH 1U41A 3LKNB 2Z92A 2ZP0T 3VFWA 1OSZA 5I71B 5KZCB 4F33B 2Q8AH 4CW1A 4KMLB 3H8NA 1JI1A 2ZUVA 4GJTB 5J4MA 25C8H 1ZWIB 3KS0J 3V5KA 5ALBL 4YXKL 3RKDC 4JFZH 5B8CC 3HE6A 3KXFD 4JO4H 4L4VB 3LS4L 1TZGL 5EU6D 1NLDH 2FJGA 5KBNC 3FT4A 5D7LD 4HH9A 4Q9BA 1M6OB 1J18A 4S10A 2FBOJ 2R0ZL 4WDIB 2XA8H 5E5RB 25C8L 4MA3A 1WZMA 4Y4HC 3OSKA 4OCYH 4UQ3B 4F9LA 5EU6E 4JO4L 3KXFE 1FVDA 2EH7H 5E1AB 3WFDL 1PY9A 3HZYB 4KXZI 4OZGB 3NGBB 4ZUUB 3CPLB 4O5LL 3GSNH 3CK0L 4CRPA 5C6TH 1NKRA 1Q9LB 4JN1H 2MCG1 5IIEA 1AQKL 2ZUQB 2V7NA 2VKWA 1EAJA 3O4LE 2VXTL 1PQZA 3T04D 1MCNA 4CMHC 4QWWD 4LHUB 5FGCB 1S7RB 3A6CL 1PG7H 4MD0B 4F2MA 4LQ1A 3ILQC 3PNWB 3UPCA 1I9RH 3CDFA 2ITCA 2P5WA 3LN9A 2YRZA 4XNUH 4LSUL 3RWHB 3U9UA 4P57A 3IKCA 5L7XL 4RISH 3VE0B 2G5BA 4JANB 2XZQL 3QDME 4NSKA 2F19H 5HHXH 5IG7B 5I16A 3QFDB 3WFCH 4LSQH 1AGDB 1BGXL 1A6WL 3WNKA 3MC0A 5T1DH 1QP1A 5I18L 1PKQB 1QBAA 5K9KA 1VGEH 3VA6A 4S1QH 4GKOA 3OQ3B 4XNUL 4UNUA 3AGVA 3S37H 4Q9RH 3MV11 4GRLB 3UMTA 1LE5A 3FTGB 4GMTH 1A9EA 2CMRL 5EBLA 4OTXH 4L8SB 4TVSa 2R56L 4H5SB 4IDLA 1MLBB 4ZD3H 4I0PD 2XZQH 3SJVB 1C5BH 3ROOA 3ZMRA 4NQEB 5D2NB 5CZVL 2R15A 1S3KH 1R0AL 4YGVB 2E9JA 4YIQA 1D6VL 1DSFH 3BH8B 4LF3A 4ONOA 2JCCF 4QRRE 1MLCA 2W0KA 1Q8MA 1LDPH 1U8OB 1VSCA 2NY2D 4KVNL 5E5UB 3ISWA 1WICA 4Q6IB 1IEHA 3DRTB 5KG9B 3GBNL 1S3KL 4PP1D 4QHLA 3IDGB 1RZFH 4LLQA 2XNAB 1FDLL 4M02A 3BP7A 2R1WB 5C0FB 3QUYB 3T0EC 1KB5L 1NKOA 5C0AB 3NIGE 3OKLA 4KV5F 4OGZA 2CPCA 4YDKH 1ZVYA 2Z92B 1DL7H 4UB0L 4XVSL 4PYHA 5FGBA 3VXNB 4KPHL 5JHDB 4PP1C 3WJJA 3NGBC 4LLDB 1URLA 3B9EA 4CDGC 3TCLA 2J5LB 3MCLH 2ADGB 4E41D 4FQHA 4TSCH 2DS4A 3GJEB 4OGAD 4HK3J 4PLOB 4EN3B 2XRAH 4F8QA 4M9PA 5ID0B 5KSBA 3D9AL 4HH9B 1BD2E 1MRFH 5KVFL 4X83A 2NY2B 2VAAA 4LMQI 5ITFA 3MBXH 3TFKD 1K8DA 4M5YH 1U3HA 1N5AB 1CBVL 3NMEA 3MLYL 2X40A 3T0EE 3K0WA 4M7KL 5ESQB 4F2MB 5JHLH 3K4AA 4EUPG 3P77B 5GGRY 4AENB 2FWOB 2Y9RT 3NH7H 5DD3L 1S8DB 5DFWH 1H9VA 1NBVL 1BD2D 4WTZA 2HWZL 4Q9QL 5EFIB 1EFXB 1S9KC 1ZGLB 4KGLA 5T5NF 4MCYB 5GRZA 3L9RA 3QEGL 4FQ1L 4GAYB 4M5YL 1J1XH 4LCWB 4PUBH 3RL2B 5I1LB 4Z5RB 1T2XA 3F8UB 1BAFH 4Y2DD 2M1KA 3UJIH 3DX8B 3EOAB 4J3XA 4LNRB 2HFTA 3D85A 3L5XL 1GHFH 2BNQD 2YZ8A 1CT8B 1UKQA 2NW2B 1JGEB 1UXSB 4QXUH 3P0GB 4G42B 1JGLL 2IBBA 2BC4B 3FOLB 1CGSL 5GRUL 3O11A 2EDEA 2BNQA 2ICCA 4RQQB 4DKAA 4MNGE 2OJEB 2F54E 3T77A 3DARA 2XFXA 4HIHA 3KLDA 3T0VA 5C2BH 2FR4B 3BD5A 5GGSB 1A6ZA 3DVIA 4YH6A 1NEZB 3W0WE 2P5EB 1UCBH 3STBA 3BIKA 4LCWD 1JZ2A 1FN4B 3IU3A 3B9KC 3AS0A 4I1NB 4L8BA 4NT6B 4Y4KA 3LN4A 4PJXE 1NMBL 1OTUC 1JGVL 5F6HI 5DHYA 5HHOB 1KIQB 3ARPA 3O41B 3IDIA 3MLVL 1Q0XH 2EEDA 3VG9C 2A83B 5TH2B 1F3DJ 4N0YL 5TE4H 2A6JA 3X3FH 5DVOA 4NZRL 1OPGH 2DQEH 4W68A 4XMKL 3C60D 5EOTB 5D5MB 2LAGB 4QRSA 4P9MH 3AMLA 3BYYA 4TYUA 1HYRC 1MWAL 2DYPD 4Y5XB 4G9DB 3L7EB 1LO3L 2QSTA 2WBWB 1G6RH 1NGQH 5HYSA 4KUCD 4OSUL 4L8CA 1G7PB 2G5BB 4YLQT 4KXZH 4XNMB 1MFEL 5BJTA 1QOKA 3LKPB 2A77L 3HNSL 4MSWA 2VDMH 5KAQF 1OPGL 4LRNH 4X9HA 3MV9B 3DPBA 2AV1A 5H2BA 4XPAH 4LSPL 4CVZA 2FRGP 2HLAB 3EYSL 3QULA 4JRYE 4LP4A 2VDML 2XTJD 3S96A 1ROWA 4EOWL 2VAAB 2NY3D 5IBTL 4XPAL 2F74B 1WISA 2QQLL 4NN5C 2MCPH 32C2B 5EZOL 4QHMB 5DS8A 4MX7A 4YHNB 3KPRE 2ADGA 3DRQA 4HGWB 3EJYD 2ADJB 2NCMA 1S9XA 3FQNB 3NPZB 2VRAA 1A8JH 4Z0XA 1HXYA 3MUGA 1MUJA 3STLB 3L1OL 5IVZB 2DI8A 1I1YB 3RL2A 5AG8A 2P8MA 3ARXA 4AEHH 1E4KC 4YZFE 1QPPA 1GYAA 4H26B 2VERN 3P73A 3V7MA 5C0IB 2HFGH 3RHWK 3QAZB 4X6FA 1XF5A 1RULH 5TJWK 1ZS8B 4E0RB 2CRIA 3PWPB 4PRDB 1FLRL 3GM0A 4G42A 5AWNH 4NT6A 4G6AD 3V6ZB 5HVHC 4JZNB 3DVGA 3FQWA 5HDBE 2VLJA 3T3MF 5CBAB 5GRWA 3GSOB 2F8OA 1F4AA 4HK0A 1X5HA 1RUKH 1KXQE 3BYTA 1FH5H 5ILTH 1CQYA 4Z7VE 1RULL 4NQDD 2FR4A 4W81A 5EOTA 1J8HD 1PBYA 3T4AB 5IB2B 4U7KA 1BEYL 2QSCL 3HS0A 1UZ8A 2JJVA 2DQUH 4K8RC 1KIRB 2E7MA 1QEWB 4MXVE 5F1KC 1JTOA 1N0XH 3P9WB 5C0CB 3QT2A 4HAFA 2A1WL 3GDBA 2OZ4A 3WXWH 3LD8C 4LSSL 4F9PC 1SHMA 2NYYC 2DQTL 3WUWG 4JM4H 1DLHA 4Y5YA 2AERT 2AVGA 3EYVA 3S9DB 2IF7A 4KDVA 4M00A 4ENEC 3EOAA 1MF2H 1BFSA 3H0TB 4Y4FB 3JWDH 3U9PH 1FL5A 4Y5XA 1YN6B 1KIUA 1RK0B 4PPTA 2ATKA 4P57B 5ICXB 4YX2H 1U2CA 1XCTA 2WINB 4CNIB 1RJYB 2P8PB 5E4EB 4EI5C 2J4WH 3D3VE 12E8L 4NQSA 2E7LA 3DUUB 2GJ6B 3QNYB 4K55A 5C07D 4R4ND 5DK2A 4YPGA 2B20A 2ARWA 4GG6F 3QCVL 1S8DA 1Z5LA 5BVJB 3LS5H 3U30B 3G08B 1NFDB 5BQ7A 4JVUA 1KPUB 1F3RB 5K9JH 1EO8H 3AB0C 1QSFB 1A6ZB 3UP1A 1KLGB 2BSSB 43C9B 2PCPA 3MLXH 1BFVL 4ELKA