2JWYA

Solution nmr structure of uncharacterized lipoprotein yaji from escherichia coli. northeast structural genomics target er540
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
168
structure length
168
Chain Sequence
MVQQSEVRQMKHSVSTLNQEMTQLNQETVKITQQNRLNAKSSSGVYLLPGAKTPARLESQIGTLRMSLVNITPDADGTTLTLRIQGESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAPASVLAPSDVDIPLQLKGISVDQLGFVRIHDIQPVMQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipoprotein
molecule keywords Uncharacterized lipoprotein yajI
publication title Solution NMR structure of uncharacterized lipoprotein yajI from Escherichia coli.
rcsb
source organism Escherichia coli
total genus 29
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1620 Mainly Beta Sandwich Immunoglobulin-like Lipoprotein YajI-like 2jwyA01
4C47A 2JWYA
chains in the Genus database with same CATH superfamily
1FYTB 4MVBD 4N3TA 2HRHA 3BJLA 4OCNC 1A7NL 4Y0GA 3QJHA 4HIHB 5DD3L 2W5PA 2W0PA 1E8WA 3EHBD 4XNDA 2CZNA 3EJYC 4XPAL 5DJAB 4KXZH 3JV5A 1R3JB 1FNEB 3T1FA 2FIKA 4JVUA 5IW1A 4WK2B 1MUJB 5F72S 5D1QA 2FB4H 3VFOA 1RMFH 3MCG1 5HI5C 1FVCB 3MA7A 4B0MB 1JWUB 1TVBA 1CYGA 2PCXA 4B9YA 4PRIA 1GA2A 2HJLA 3SDCC 4LSVL 4OU3A 3WS3B 4BUQA 3V6ZA 1L0QA 1DQQA 5GS0C 1P1ZB 5ELIA 1MSPA 1NLDL 2OBGA 3CX5J 1QWNA 1YZZA 1ZD6A 1JYWA 3R06B 2VRKA 4V33A 5DYOA 2MHAB 1I1AC 1TQVA 1A7OH 3SKMA 1X5YA 3PG2A 4HIXL 5KTEH 2YD2A 4Z7UA 2PCPA 3G5ZB 1DJSA 4OQTH 3ZYJA 2D0HA 3X13A 3VNYA 3BRDA 5J6GA 5F7LB 3VXMB 4NRYB 5LVEA 2KBGA 3TNMA 1U8HA 4BFIB 4L8SA 4YVUA 1SN5A 2VXVH 5C0ND 3ZRSA 1LEKA 2B2XH 1E6OH 1R24B 1P4BL 2QGBA 5DJ8B 5AUMB 2YQ2A 3D08A 1T1WA 2WYHA 1BQLH 2BC4B 4PR5A 2FCBA 5E8OB 3TC9A 3I9IA 4NCC2 3T2OA 4UQBA 2EH7H 2NY0D 1CF8L 4R90L 3ZHDA 4KGLA 1VFAB 5DQJB 3VG9C 3WO3B 1CK0H 4ZS6D 2BP8B 4UWQB 2YA1A 3M17B 3GXUB 4Q9RH 3KYOA 1CD1A 3FS9A 4Y1AE 3QEUB 2I7SA 5JZ7D 1OGAE 4P46A 2AK4E 2HVKA 3UROR 1XR8A 4LCWE 2F5AH 1X5AA 4LCUA 1TQBC 1YG9A 2DM4A 1Z3RA 5E9DE 1T1YB 3C5XA 3U1SL 3P3YA 1RU9L 5AD0B 2EQDA 4HFUL 4HGWB 5CD3A 2AKRB 2F53D 2A4EA 4YHML 3VU2A 4F2MB 5G4NA 5KOMC 4JQIH 3VTMA 1HJBC 1FP5A 4ZFQA 2Y07L 1OTSD 3O2DL 4QPEA 3H0TA 3S34H 5JXEC 4Q9QL 1FSKB 2ZX5A 1XF5B 4GYBA 5I8CA 1QUNA 2XQ0A 3GKZA 4OCSH 3ZKSD 1QLFA 2FWOB 4OV5B 2YZ1A 3AMLA 3TIDA 3LN4B 4N2AA 1ETZA 5IR1B 3O8XD 5HYJD 3QUYD 4JY4A 1PZ5B 4OZHE 4NSKA 3VXTA 2UZYB 3OR6B 4PB9H 5GSVA 3FQWB 2HRPL 4CRPA 3D33A 4ENEC 2WLNA 5C0CE 4BSWB 4N1CA 4DEUA 5BJTB 4HC1A 3RPBA 4BE5A 5IQ7H 1E8YA 3O6FC 4YSSA 3SGEI 3AY4C 4KJQC 3BQUD 4KZCA 2JKLA 3HBPA 3FCGA 4PJAF 2E9GA 3GF8A 3GO1L 5DZLA 4F1SA 2WB7A 1VA9A 4UM9A 4UV4H 3NRFA 1Q0YL 2EIJB 3OKLB 1CI5A 4XNMB 1U6AH 3W11C 1VKXB 5E70A 3RA7L 1MAKA 4UDUA 1KEGL 1G7JB 4X9GA 3UCQA 3ZHLA 4K94L 4EUPG 5C7ZA 2EVFA 3LX9A 4JUSA 4K55A 5TPWL 3AABA 3V10A 1RPUA 3K6NA 5D7IF 1EFXD 5DLML 1OM3H 2RTTA 4TPRL 2Z91B 4OUUB 4HCRL 3TO4A 4FNQA 1NMAL 2WQXA 3S96A 4F91B 1E9OA 1T7VA 4JZOB 5GS1C 3F6IA 3KM1A 1F6AA 4CVZA 1L6XA 3PP3K 2X87A 2DICA 3LIZH 4X0NA 4A7TA 5KANG 5EZIL 2WXRA 3D34A 5D7LB 1JRHH 1VACB 1FZJB 2XZAH 1R3LA 1ETA1 3UAJD 4QHMA 4X99B 3SSGA 3CHRA 3WJJC 2WQRA 1VAHA 2X28A 3W9DB 4WJG3 2EDHA 2BZCA 3QS2A 1KIQA 5JQIB 3OMIB 3IJSB 4H20L 3DYMA 3VE0B 5AW5B 4W9CC 2WXHA 3TN0A 2B5IB 1ZCRA 1BXVA 4UDTA 1WGVA 3DSNB 1MXDA 1HHJA 2IXQB 4YGVA 2DMCA 5KEZA 3MVSA 3HB3B 1BVZA 4GNKB 4KNQA 3MYJA 4PTUA 1ZHNA 5E94B 1U4EA 4P2QD 4IJ3C 3P3UA 1L3NA 4PG2C 4TLTA 2XWCA 5I0VA 2WNGA 1N7MH 4ELMA 5I74B 3EOBB 4K5LA 5EN3A 3BT2L 4X5WA 1LO5B 2VM9A 4C56B 4PY7B 4U1GC 3V95A 4IOFD 1ZMYA 1S6NA 3GBNL 1JPTH 3S3PA 2H0EA 5DR5L 5DD1H 4DK6A 5JDJA 2AXFA 2Z31C 3P1VA 3T0EA 2D4DA 1A1OA 1NPNA 2Z4TA 1D5XA 4GRWF 3AUVA 4PJEB 5CINH 2Q2EB 3QJFA 3JWNG 1GGIL 1QRKA 1QSED 2GI0A 4IEFB 3GI8H 3QIUC 3QORC 3VMNA 2J25A 3KGRA 3MMEA 1F41A 2DQFB 1JXDA 1PLGL 1X9QA 2DTSA 3HPJB 4R9HA 3T3ME 2VDLL 4B9IA 2FT7A 2FJHA 3BYTA 5T1JA 3TT3H 3QXAA 4Z7OE 4FL4B 1L9OA 1MHHB 3DK0A 4L29A 3HI5H 1CLVA 3HOGA 2H0FA 1BQUA 1Z5HA 3KYMA 2H1PL 2DWDA 4E2OA 2HWZL 3S37L 1T89C 2EDQA 2ARJQ 2OCJA 4WI0B 3FQ4A 2QKIB 4JJ5A 2NRDA 2FEDC 4FQPA 5I6PA 4EN3D 2VISB 2AJ3A 3MFGB 2ADJA 1BREA 5KZCD 3R0NA 4ZQKA 2IH3A 5HDQL 3VW3H 1FO0A 5JORB 1OT4A 4G9FD 3V0IA 3HCVA 4GRLA 1RIUL 1RK1B 4JHWH 5BV7H 4YHLL 4O02H 3FK3A 4RISH 2CNYA 2IFFL 3K0WA 4QJ4B 2C3HA 3GRBA 2WZPA 2WTPA 4TMPA 3RQ3A 3VRIA 2BXYA 2QHRH 1URZA 5DJXA 3FKUS 3U46A 2X7LA 5L0QC 4RDQF 2V5TA 3KD4A 3FFDA 3F58H 2X4NA 4DN4H 3EAKA 2VDMB 4FXGA 4X4YA 5J5EA 2HLEB 1IAIM 1EEYB 1W72H 4OSUH 4K8RC 4M4RB 2MQCA 4KPHH 2Q8BH 4HOXA 4KX8A 3MDJA 3DGCR 2APFA 4MMYA 2MKLC 4OF0A 2AGJL 2R2HA 4L1LA 1LE5A 1Z0MA 1KXQE 3UO1L 3C6LD 3LZNA 5CGYD 4DAGL 5GRJH 3C60D 3K2KA 2EE9A 2LU7A 2R2EA 3RWHA 4PJXB 1LDSA 2C4XA 4XOAA 1ZTMA 1KIPB 2Z8RA 2AV1B 4BK5C 2Y2TA 3CVIH 3I2CH 4NWTL 4K9JA 1A1NA 4G1EA 4GSRA 4KWUA 4MGXA 3JTTB 1S7XB 3IPFA 1M71A 2EE6A 4I77L 4JKPH 4ODSL 4WW1A 1X5GA 4Y1SA 1T0MB 3GBEA 1DEEA 2ZCZA 2WN2A 4NT6B 4AK2A 1H9VA 4XC3L 4WWPA 3O4LE 2XN2A 1P84K 5HY9A 1KTDA 4FHKA 2AQQA 1GY2A 1QTSA 1IC7H 3UOAB 3IDYC 4MJ5A 3GZOA 5BVPH 1T6BX 3V7MA 4JHBA 3CFCH 2MKWA 3N42B 3GBDA 4KDWA 5IMLB 1MIEL 1CGXA 2UYLB 3MC0A 5C8JA 2MQGA 1S3KH 5I15L 1UWYA 1RPQA 4YDZA 1S46A 2CBOA 2SEBB 1TT6A 3T65B 1PZ2A 1CL7I 1EZVY 3N0PB 5DCCA 4MNGA 2VL4A 3HW7A 1SYSA 5EIIB 4KJPD 4B53A 5B39B 1T3FA 4NUMA 1YNKL 2NTFB 3BSHA 1ZLSL 1P7QA 4NHUB 5DHXB 1WFTA 5DK2A 3WKPA 3U36B 4P2RB 5HI3D 1A7NH 1OHZA 5DD3H 1BEXA 3IN0A 4IGBD 4NJAL 3QXDA 2EINB 3NJIA 4X50A 2YRBA 1JXFA 4XPAH 3FU3A 4V1DB 1RXLA 3FCTA 3WXWL 5H2BA 5ADOL 2Y9RT 1KFGA 4JO4H 2KLSA 3F7RA 3ZKNC 2FX7H 4PP2B 3TZVB 2WLJA 1WP6A 4WI8A 3D4CA 3AG2B 4QIRA 2DYSB 3MRCA 1H6EA 4LSVH 5DUJA 4JHAL 1H8NA 1DDHA 4ZO8A 1FQ9C 4UM8A 3OLEA 1NLDH 5FGRA 4ZNEA 3KLKA 1VPOL 2W0LA 1J86A 3G6AA 5T1MB 1LQSR 4RZCA 4HIXH 3DUSB 4UTAH 1NKOA 2EVGA 5I0XA 5DO8A 1ID2A 4QRQA 1IGYB 4PG9A 4Y8AA 3KPOA 5CUSH 1NGWB 1IBDA 2UZXB 3HAEH 2XFGB 1X9LA 1HYSC 1JWSB 1JZFA 4Y5XA 3RP1A 1KJ2A 1II4E 1HS6A 2WVUA 4D8PA 3VJ6A 4J39A 4NIKB 2E3VA 1JNHA 3RDTA 4P5KA 3ZDZB 1MPAL 4XX5A 2AABH 4EF3A 4MJ6A 1U8CB 3W1ZA 1Y18A 3BPCA 1DHKA 1F42A 2ED9A 2VERN 2GKIA 3L4UA 3NTCL 1T4KB 1PX4A 3MGOB 4R5VA 2Y22A 5A2IH 2ED6A 1Z9PA 1CF8H 4R90H 3HLAB 5IG7A 5FO2A 4F57L 1UD2A 3DTXB 3VXUB 4LPVA 1BIIA 4TRPL 4ZI8A 1PDKB 4U4IA 1Y6KR 5C0EB 4MX7B 3FSOA 2X2IA 2C1PB 4A6YA 1ET5A 4MLSA 4Y5YB 1L6PA 1OHQA 2JVUA 4G9DA 3RY6A 3NCJL 4YFDB 5I1AB 2NXYD 2VXTH 3U1SH 3UTTB 2AAAA 3GLEA 5CP7B 1RU9H 2Q9OA 4G43A 3IT8D 3KW8A 4HFUH 4YHMH 3QNXB 1AS6A 4WKZB 2IIJA 5SWSB 2P80D 5K9QG 4FCAA 3PAUA 1CDHA 3PWUB 3NA9L 5K9KA 2Y07H 5G55A 3PJSA 3O2DH 1XCTB 2E9JA 2CLZA 2DBJA 4Q9QH 4MNQB 1ZK9A 4FA6A 1CTMA 3H8NA 1XXFC 3I6KB 3TIEB 1LEIA 4XXWA 3U7WL 3QFGA 4WJKB 4QRSB 4WNJA 3MBEB 1NEUA 4M48L 1SM3L 1WWCA 4RSYA 5T1KD 5SWZE 4G6AC 2XBZA 2PKDA 1ZTXL 3V9EA 4GKNA 5EN2B 1XCXA 2YXMA 2VITA 2HRPH 3GK8L 2GITA 1NIBA 1CT8A 4M5YH 2BVQA 3QC6X 3ARED 4M8VA 4E68A 3FT3B 1M6UA 2JIXA 2Y5TA 4LLAA 5F1IB 3DX4A 3QUMA 4XVOA 5EO9B 4L3ED 3WN6A 4QI3A 4ACPA 3LEVL 4X83A 1PGRB 5EU3B 1BFVL 4GXFA 3WBDA 1PPIA 3GO1H 3ILQD 2VZTA 3FHQA 3SKOA 1U93A 1Q0YH 5EF3A 1MLCB 4DUWA 4XNZB 2X89A 2HP4A 3RA7H 2DMBA 2XBDA 1BJMA 3BKML 3OQRA 5L4JA 1KEGH 1U3HC 2NLJA 3M1BA 4K94H 3M8OL 4J12A 1BIHA 2XACC 5L4MA 2ZXCA 2W94A 1MFDL 5TPWH 1YNTB 3ZKXB 3RWJA 2NW3A 4HH9A 4EZMA 5IVXF 4TPRH 4Y2DD 4G8GA 5JW4R 4HCRH 5EEWA 1NMAH 5DO2C 2VLRA 4HC1L 3TFKD 3ECBA 3E6HB 4DP5X 5JYMA 1JPFB 3MKKA 5JOFA 3UTQA 4GUQA 1UH2A 3QIWD 2R27A 3A0OA 3VGFA 3HZYB 3IVKB 5JHBA 1MCQA 3NESA 2Q3ZA 1DE4B 3W39B 4GBXD 4BINA 1U3YA 2MPAH 4JFYB 3MNMA 4NP9A 3H54A 4H20H 4OCMC 4TLUA 5PCYA 1ZWIA 3B3IB 5D1QE 3D0VA 3LRGA 4APXB 1T7WA 3CH8A 2BP0B 2XG5A 3EYFB 3DYOA 4U7MA 1RLBA 3EUUA 4AM0Q 2ERJC 1JZEA 4Q8BA 1FFQA 5EBMB 2AV7B 2VLKB 5IFAL 4L4TB 1HDMA 3TS8A 5DZ9A 3PGDB 3ATAA 4I3SL 1ADWA 4KNTA 4P4RA 2AXGA 2OJEB 5EUKA 1J0YA 1LP9B 3PV6B 1EVUA 1NCCL 2HAZA 3FNKA 4XVUD 2XIDA 4Z7UE 3HE7C 4KY2A 4W4NA 3RBSA 3V8OA 2ZXBA 3BT2H 1T21A 2M26A 1NTDA 1SOKA 4U0RB 1T0NB 3GBNH 2PPEA 2X4SB 3UEZA 1E2VA 1YN7B 5DR5H 3HE6C 3KVDD 3CHQA 3MV7A 2IMMA 2VDML 1W2KT 3QXTA 2PR4L 4HK3J 2A7BA 4QGYA 2XNAB 4RZKA 2KLRA 1GGIH 4I18A 4Z7QE 4F8TA 1UZGA 1BZ7A 1FUNA 1NBVL 3CZGA 3ZT7A 3ZSSA 2PCFB 5E2WL 1U8KB 2V2XB 3IS0X 1PLGH 4AQAA 1EZVX 1IVLA 4YDKL 3AT0A 4ZUUA 4I9XA 3EGSA 1WFJA 1XDTT 4RGNC 2IAAC 3KPSB 2H1PH 4QNPF 5J8OA 1BD2B 1LHZA 2HT3D 3KEDA 4ZAKA 2HWZH 1AY1L 2ZXAA 4ONGL 3S37H 1ITBB 3B5GA 3V6FB 3DV4B 2XICA 1FZOA 2Y3AA 2Z0UA 3QA3A 5LGHL 3TOPA 2NT1A 4EIZC 3KPQB 1O7SA 3QHZL 3LN5A 3GM0A 1F4AA 1XB3A 5HDQH 3BGMA 5INCB 4AEHL 4BHUI 1RIUH 1KJ3L 2MNWA 4FQ1L 2J7LA 2UXFA 1G94A 4YHLH 1F3DH 3AFLA 3QIBC 4NO2B 5HHXL 3BAIA 3C8KA 2CA4A 3MRHB 3L6FA 4U6VL 4RDQG 2IFFH 1ASPA 3X3FH 3ZX1A 1XF2B 4YDJA 4QRTA 4GW1A 1XR9B 1UGKA 4NZDA 1BFOB 2VN3A 3NJVA 2HTKC 4XPFL 2PF6A 4PJBA 2VRQA 1F3DJ 2ZKMX 3L9RB 4OI7A 3MX0A 3VXOA 4PGJA 4Z78A 4S2SA 1A7RL 4NI3A 5DJCB 4UNTA 5AAWC 1KFAL 3KYKL 5F8QC 3CBKB 2BWDA 1LD9A 3BZ4B 3UBXG 5CIPH 2BIPA 1AD0B 3LN9A 3BPOC 3GDBA 4PGDB 2F61A 5HJGA 4JREC 1OE1A 1CE1L 3AM8A 2AGJH 3FQ1A 4ONOA 2X2JA 4ANWA 2I07A 4DAGH 2Y36L 1V3JA 3OHXC 4FQ2L 2FE0A 4JGMA 4PSPA 5I71B 3STLA 4QRRB 1TQCC 2F74B 1MZYA 3RWFA 1QD0A 3OKMB 5FFLA 2FAUA 2ZYIA 1WBZB 4NWTH 4PREB 4C4KT 3RPKA 5E6RB 1UWXH 5FHAL 3NCCB 4I77H 3NIDB 1AYRA 4ODSH 5FO9A 2Q87A 4YBLC 2XWBB 4B50A 1ERNA 4AUYA 4XC3H 1L9SA 3APNA 3DOSA 2YAPA 4PW4A 4WUUB 2UXGA 2A6JA 2DMHA 4JY5L 2ZUVA 5CR8A 3MOQA 4XO5A 5LQBL 2LTQB 3Q8CA 3PCYA 1TVHA 1DJXA 1SHMA 3OB8A 1MW0A 3ABLB 1H6FA 1YY8B 1DUYA 1F18A 1BJ1J 1ORQB 3O9WA 3WDIA 2D9CA 5FOBA 3GTNA 1MIEH 3MLUL 2NY3B 1F58L 4K2UL 3VWJC 5F9JA 5A2AA 3FMGL 3L13A 1QQDB 1X4ZA 2JKNA 2JLPA 4F58L 2JQMA 1HJCA 5I15H 4J1UA 2ZKWA 3IM1A 2XFXA 3OXSA 4GEJA 1U3JA 4GQZA 1I4FA 2NY1C 3NFPA 3FTSA 1DUZB 4RAVB 3MREA 1IEBA 1N2RA 2DM7A 3ZO0A 5K1JA 1WIOA 1YNKH 2XBTA 4JY6A 2CIKB 1ZLSH 2C34A 3MV8D 3OLIA 4H8HA 2VWEE 5DDHA 4GKZA 4EOWL 1XH3B 3RILA 3RAJL 3QG6A 2IPKB 3SBWA 1QR1A 3B9KD 2FX9L 4BUHA 4NJAH 3L5HA 2L7QA 2OL3B 3EJTA 4JPWH 4P3DB 2GJPA 5KBPA 2NCMA 3H9YA 3WXWH 1KBKA 5ADOH 2Z35A 1VGEL 5IQ9A 3QDGB 5CEYB 4QRBA 5D7HA 5FO7B 3WTWA 3MRLB 4HUVB 1YO4A 1BP3B 4Y5VA 1M7XA 5HI4C 4KXBA 1XF1A 1UH4A 4HBQA 5GZOA 2MIZA 4HWZA 4JHAH 4M3JA 4IIZA 4Z77B 1U8MB 3UADA 3IF1A 1VPOH 2WXNA 4ONHB 4G80B 4V11A 3OZLA 4FULA 5J11B 3DMMC 3S8FB 1GS8A 5C9JB 1DN2A 4YHOL 2X4PA 3C5ZC 5DK0B 4M61B 1D5MA 4APQD 1MHEB 4UQ3A 1FF5A 4U1JB 2P8PB 4JFHE 3FO9B 5FUZL 3RWGB 1A4AA 2BVUA 2N4IA 5AVTB 4R2GB 4S0HA 3GMPA 1XAKA 2UVFA 3HS0C 4OKDA 1KG0A 3QQ9D 1P9MA 4TVUA 2R8SL 4UT6A 3Q5YA 1ZLVH 5JW5A 2FQEA 1U8PB 4YS4A 3IE9A 3A6CL 1KBVA 4GSXA 4NAQA 3NTCH 4U3XA 2CO1A 1RJCA 5IBTL 4LNRA 5EU7C 3RVVD 4OBRA 3RU8L 4TQ8A 4F57H 2FATH 3TASA 4UUJB 3TNNA 1HNFA 3AWFA 2QZ5A 3S5LA 5BXFA 4B7IA 1JYXA 2PXYD 4TRPH 4YHYC 2X2HA 5IEHA 4P5TC 1DVQA 3RX7A 3S97C 2F7RA 4PWIA 2WWMC 1C1EL 4PGBB 1AP2A 4TUOA 1ANUA 1AYOA 2ZUUA 2OZ4A 4AYEC 2NMSA 3NJHA 3OZ9L 3NCJH 2QFRA 4AVKA 4B9KC 3EYVB 1HQ4B 2X9ZA 4NNXB 1OGAB 1O9ZA 2V9UA 1K4CA 2H1XA 3W0WD 2H26B 4DVBB 2DEWX 3ZLQC 4FOMA 5I6XC 3ZUCA 1OF0A 5E9DB 1D2PA 5IY5B 5DTFA 2D2OA 2AITA 1KWKA 4MZ3A 4F92B 1QBAA 2UX7A 1U8IA 3CWGA 3RTQC 4EI6B 5I24A 3N41F 4M7LT 4AENB 4AQ1A 3UYOD 1MG2C 4JZJA 4K0OA 3U7WH 3CLWA 3M45A 4I9WE 1I7RA 4I87A 5ISZE 4M48H 3VXRB 1J1XL 1SM3H 1ZA6B 1MAJA 2ED8A 4OLVL 1KCBA 1ZTXH 3L4VA 4WZ9A 1A3QA 4LSTL 4MXQD 3KPRE 2OZNA 3GK8H 4UZSA 1OWWA 5HYSB 2UWEF 3QUHA 5FHBH 1DCEA 4HHAA 1H8OA 2EO7A 3VFRA 5LN4A 3QZWA 1YYCA 1N4XL 4X9FA 4OZHB 1E40A 4YHZL 1ZS8B 5CZXD 1F6LL 3LEVH 2DQUL 3LSOA 5J9PB 5LBGA 1P84J 2ZJSL 4OD1H 5IP4A 2IAMB 2WLIA 3QUZB 3DHMA 1YY9C 2B1OA 4M56A 3WHXA 5T3XE 2H8PA 4AQZA 1IJ9A 3FCBA 3BKMH 3BN3B 5LAPA 3M8OH 1DJZA 2E4FA 1I8MB 4MA7H 4BKLA 4NWUL 4B97A 1MFDH 1WJ3A 1AR1D 1CICD 3G5XB 4IRJB 1IL1A 4OJFL 5IB4A 3ARDD 4QOKA 2ALWA 3EG9B 4JUTA 3X2QB 1AJ7L 2O72A 3AMKA 4HC1H 3QUML 4MNGE 2F0CA 2WN3A 2YC1A 4HUWA 4Y16B 4DP9X 1NIEA 2BIQA 4PEEA 3MRNB 5L88L 1YEIL 4G8FA 4DPCX 2EEBA 5A16B 2ICWI 3V5HA 2ZX6A 4KDTA 2IV9A 4FMVA 4G6FB 4ABVA 3BP7B 4Q89A 1JXJA 5E5RB 5IGXL 4AJ0A 3V5KA 5I1DA 1M3IA 3BEVB 3TWYA 5E8EB 3W11D 3LJ3A 1FNSL 3OF6D 3HG3A 3ARBD 1J8HD 3KBFA 5HYIA 3US9A 3VM7A 1PYWA 4ZMQA 4IU2B 2O30A 4W9DC 1JD7A 1GJIA 4JRXA 4GQ9L 4RVBA 3OV6A 4HBCL 4PV1C 2WBJC 3DRQB 3W37A 1CZ8H 1D9KA 1JTTA 2GY7B 4F7KA 3LNEA 1TZIB 2DY2A 4GLRI 5IM7B 3ARYA 4D3CL 5IFAH 2XA3A 4JRWA 3I84A 3SCMA 3RL1B 4ZNEE 4PJ7F 4I3SH 4GO6B 5DRZB 1BSIA 2V6HA 2PYEA 3D39D 5DWUL 1NCCH 2GI7A 2J21A 3GMMA 2R0LL 5CZRA 5AB0A 2ZG3A 4IBSA 2AQTA 2WLMA 1ED3A 1KB3A 4L8DB 1QACA 4J3OH 1KPRA 1HH9B 3ILDA 4PCSA 2CG9X 2W60A 4JN2B 2BPBA 3JTSA 3F85A 3PHOB 3T4AB 5L4IA 3QJUB 1H0DA 3V5DB 5KSUB 4NQQA 1D7FA 2P24B 2VDMH 2R4SL 4GUCA 5DMKB 2FLRT 2PR4H 2QQNL 1F11A 1F1GA 2A6KA 4KNSA 2H2SC 2RQEA 4LP8A 5A40E 1NBVH 2BNQD 2VABB 4TUJA 5E2WH 1YPZF 4M6OL 5JNYA 4U49A 3GTTA 3CVHA 4YDKH 3RUGF 4YEFA 2E6JA 5C0IB 1S7SA 1HI6B 5DUPL 3WNLA 1NCWL 6FABL 3BZDA 3ALPA 4OIAA 5HVGB 1UT9A 3STBA 1TF4A 4GPVA 2ZAIA 1QO3A 2X6CA 1AY1H 4HISA 1JF1B 4ONGH 3VFVB 4Z7OB 2D73A 1L5GA 5C07B 2DQ6A 2OMTB 2EC8A 4GAAA 5IF0B 5LGHH 4YZFE 3MLVL 2ZWYA 4NPYA 1JK9B 3RGVD 3FSAA 2ZWNA 2Y5EA 1G1KA 5HD8C 1U8QB 3NPSB 4PJ8B 3U1PA 4BQCA 4AEHH 1KJ3H 4G7QB 2JKTM 2H3NA 1DVFB 4TUUA 3DI3B 2EUWA 3SHSA 3QORD 1EAPB 5HHXH 4NX0A 5HPMB 3GJFB 4U6VH 2YEZB 1JK8A 4S1DD 4BDVA 2EUVA 4BGDA 1Q38A 1EVTC 2FBOJ 4OJAA 4UIMB 4XPFH 5B1CA 3SGEH 4ZTEA 3O4OC 4NDMB 2ICWA 1UENA 1ZLDA 4WW2A 2ZCHL 2YBRB 2ZUYA 4OFYD 4Q6IB 1KFAH 1RK7A 3JYBA 3KYKH 3ORJA 4BEIA 5IVZB 3WNIA 2FEDD 4GFTB 1TNNA 1A6TA 2ZSWB 4A39A 4AM0A 1MY7A 4PRPE 1CE1H 2BOBB 1UVQB 2FH8A 5I73B 2ILLA 2I85A 4XP4L 2Y36H 4FQ2H 1MCSA 1T7XA 1RJYA 2YQ3A 3WO4B 3DXAE 1NANI 5DRNA 1JFQL 3CH1B 2BX5A 3Q05A 2EDDA 2IAND 2FTAA 4DJMA 1FSKC 5JUEL 1NBYB 1HN1A 4DT2A 3FC8A 3SJVB 5TFSL 3V0GA 3UL4A 4XO3A 3HEIB 1EHXA 2IH8A 1AXSA 4I8DA 4U6TA 4ESKA 4JY5H 4QRFA 2XOTA 1NDMA 5LQBH 2BRRL 1ZPUA 1UUNA 1JE6A 2W0FB 3ZSTA 2OTWA 3H9HA 2CLVA 2X1WL 4G8GE 2B9AA 2NPLX 5DSCA 4KROB 4RX4A 2X1OA 2JK5B 3IDIA 4EDXA 3MLUH 1H3VA 3ZDYF 1F58H 2KL6A 4GQRA 4K2UH 2MMXA 1UXSA 3FMGH 4YUEL 4F58H 4ZO6A 4WV1C 4WO4B 3S3JA 4I85A 2IADA 2MOQA 1UEYA 2WJ7A 1TITA 4JKLA 2JCCA 3MLRL 3MOBL 1MCJA 3HG1D 5E1IA 2A83B 2ZWLT 3P9WB 4Y4KA 3GXDA 5DI8B 4PUBL 3ZT6A 1E5UI 3FUMA 4JW3A 2Z34A 1BLNA 3BH9B 3E6FB 2YAQA 2CMRL 2VQ1A 1AQDA 1RFDL 3PABB 2GK0A 4FRWA 3QXVA 3ARFB 4EOWH 3VFUA 1DO5A 3RAJH 5HP5A 4F7TA 1PY9A 1WSST 4N86A 2Y6SC 4RWHA 2FX9H 4XPHL 32C2A 2ZOKA 3TBTB 4ZXBA 2GT9B 3ROOB 2WQSA 3GIZL 1DVSA 4DZBA 3TVMB 4X0KA 1VGEH 4H26B 1OTTC 1EERB 2PTUA 2D0FA 3HBQA 4M7KL 3UPAA 2GTZB 4Q7DA 1VFOA 2EADA 2D7TL 2NTSP 3KLQA 4MJHA 1C16B 5JOPE 3D3VD 1FN4A 3MRKB 1AHWB 1HNGA 3VH8A 2NR6D 1UUSA 3BP5B 3Q1SL 5CJQL 4X4ZA 4XBPA 1NKRA 4U1SB 3U9UA 4ZOEA 2X4RA 5FX3A 4P48A 1JZ3A 5ERWB 3BP4B 4U7KA 2PWDA 4CNIB 4Z5RA 5F7DA 4QJ3B 3PV7A 4Y19A 3MV7E 4JCWA 4TKWA 4AH2A 3FSVA 2H9GB 2YMOA 5E00B 3SPIA 1H5BA 1YMHB 4NN5B 5F96L 4YHOH 2VQTA 1EUUA 1QG3A 3QDMA 1F97A 4CGTA 2X09A 1E90A 1BFTA 4XP1H 5FUZH 4M1DL 3K80A 3B2VL 3TJHD 2DTMH 1A3RL 1BQ5A 1EEZA 1JN6A 3I02A 3X12B 3L1FA 4DO4A 4G72B 5D2LF 5I74C 3DLQR 3MBXL 4MMXA 4YPGB 3GPSA 2WANA 2VMJA 2R8SH 1DP0A 1V55B 4W6XB 4F3FB 2X4TA 1OAYL 2R7EA 1SJVA 4XAWL 2JMRA 3STZA 3LKNB 2IBZX 4HCFA 5GZNC 1B4LA 1MWOA 3RU8H 3RFZA 4UT9A 3PAYA 3KLLA 1RUAL 3T2NL 4YBQC 2CO4A 2X6AA 2B39A 3MRPB 2HMIC 2WLLB 1WAEA 2EUZA 3NIFE 1C1EH 4XMTA 1WHPA 5EBGA 3JQOB 4X4MA 5DHMC 4NOBA 1HWWA 3SPCA 5DZJA 3OZ9H 2HFFB 2WAHA 4CDHA 3MNVA 2KYIA 4FL4C 4NAJA 1KB5B 3QNYB 3VX0A 5FFGA 4TF4A 4PJBE 5DRWB 2BIMA 4UT6L 3VSUA 2EIZA 2QPEB 2AK1L 5I2IA 1HE8A 1XV8A 2QKIC 2CHDA 3JVGC 3JUYA 3SYCA 1B3JA 4U6XA 2XY1A 4QTHB 1S9YB 5CJBA 1JGLL 1MVFA 1IBYA 2WKGA 2X9YA 3PF2A 2ED7A 1OANA 1L7IL 4GUOA 4IRZA 5BRQA 1W8NA 3ULUE 1OAJA 12E8L 1ZHKA 3MRQA 3MV9A 3WU1A 4LLMA 3NP3A 5A7EA 1J1XH 1ZJAA 5C0FA 2AS5M 1I75A 4H8VA 4OLVH 1QASA 5EUOF 4L05A 4LSTH 2FBJL 4AG4L 3QNZB 2JCWA 5SWZB 3RGHA 3WFHA 5FIEA 4DGYL 1N4XH 2AJZB 5C3LD 4JE4B 5EFIB 4L0YA 3UG5A 4AIZA 4YHZH 1QSZA 4OZIB 4PHZA 3DGGA 3MUGA 4PFEA 2DQUH 2XA8L 1CL7H 2ZJSH 3BLBA 1WDAA 1E4JA 2P5WD 4XX1G 4D7PA 1RZKL 3LEXB 3M46A 3GHPA 1QEXA 3PXHA 5EZLA 5T1DL 2E8ZA 3O3EA 2DM2A 2Z9TA 5TDNA 5J7CC 1QATA 2J8UE 2VN6A 3IDUA 3QPXL 4YSAA 5B1JA 2BY2A 4NWUH 1NC4D 5GISH 5JW4N 2VUOA 4O2FA 4OJFH 1UZ6F 4TNVF 3O45B 1IBFA 1QRNA 2BSED 1MWAA 5D7JA 3ARWA 3CCHB 4PWHA 3VXNA 4DO5A 3B2DC 1AJ7H 3UJJL 5F9WB 3QUMH 4WHDA 5GHWL 2R1XB 1XIWD 1CMOA 2EXYC 1YEIH 5CJ8A 3EOAB 3GHEL 3L3KA 1XF4B 4M1CD 5FCUL 4I0PA 3RWEA 5D72L 2GC4C 2QELA 3OG6B 4LCVA 2CUIA 1S7VB 4MAYD 3V9CA 5DEJA 1MFMA 2WJ5A 1QSFB 5D5MA 4XMPL 5GGTL 3GSWA 1W0VB 4KVPA 4FERA 1OP3H 1S7QA 5DHDA 3WXVL 1I3RA 2NT0A 3BVVA 2F53A 2GTWB 1FNSH 2B3IA 3ALWA 2O5ZL 1U3HD 3C87A 4NQED 4PGZA 1MY5A 3WEBA 3E3QC 5I0ZA 2Y72A 1OB1A 2YEQA 1A14L 3G6JA 3IDXL 5IEKA 2ITCA 2J44A 4HBCH 4OJYA 2PN5A 4JRFA 1CFQA 5ANME 1A2YB 1ZGLA 1NUGA 2JB6A 3U6RA 3VI3B 5EH1A 2KI6A 3F64A 3L4WA 1JDCA 4D3CH 4DP4X 3ARVA 3CZUB 5JIMA 1XXDC 5FYLL 4DKFL 2KMWA 4RQQB 4P4KB 3O8XA 4RNRB 3L5WA 3VSQA 3QUYA 4XHJD 3WUWG 2CUAA 5DWUH 4P23C 3G5YA 5KS9A 2JJTC 4U1KA 3SE8L 4ADGA 2NY2D 3SKMB 4Y2LA 1NC2D 3NG5A 3PS6A 2X4QA 2W8CA 2OXHB 3CQFA 4XCYA 3VDAA 3WJLA 3VFPB 5JO5B 1S9VA 3TZVC 2R4SH 5CEZL 2OMYB 4Y4HB 2QQNH 5EZJB 1MVUB 3E9UA 3M88A 3HN8A 3QQ4B 4UMSA 5EOTB 1T1ZB 3C12A 3V7AE 3POHA 1UB6B 1NOLA 2XWDA 3QFDA 1Z9MA 2DZEA 4D0CA 5D4IA 4X6CF 1IEAA 4M6OH 4F7PA 5I1IL 3W57A 5TK4A 4WHYH 5I0WA 1ZVHA 4WFEE 4M5SA 3C5SB 1FFNA 1EHNA 3HI6L 4NO3A 1NCWH 3UZVA 6FABH 3N3EA 2V2TB 4TVPE 2E7LA 3BPNB 3IWVA 1EFXA 3U2IA 3SE4C 3KWVA 1QEWB 2X53A 1OAKL 4H2CA 2MCMA 2Y1VA 4WWKD 2IGLA 3D2UB 2CE6A 2CO2A 3U7YL 4MD0B 5LAXA 4WI4A 1MI5D 1X6NA 3FFCD 2WCPA 1QOKA 4X98B 3CFDB 5HVFB 1KCWA 3VXSD 1ZT4B 3X1NA 2NY5C 1NGPL 3BHBB 1ZLUK 1MEXL 3WEOA 4AE1A 3PJLA 2EYSA 2R23B 5CXPA 3SO3B 4K7FA 4JRLA 4O51A 2I9TB 5AW1B 3LQZA 5C09A 4PJCA 3ETBJ 1SUHA 5DZOA 3P30L 1G9ML 4JFFB 4OAWB 3EO1A 3WMQA 4B9FA 3MUY1 1M9SA 1OCOB 1IFHL 3VYPA 2ZUXA 2WWNA 3FB6A 3UPRA 1PF3A 1JV2B 4IQHA 1Q9KB 3K4AA 5TE7L 3L48A 2ZCHH 2E7DA 4MS6A 2EKSB 2QVIA 3II2A 1Q94A 1S9WA 2C4FT 1RZPA 2A1WL 4P2QA 1P6AB 1A6WL 1MFBL 1ETZB 2MH4A 2QVFB 5GGRB 5GRYA 2GIXA 3E0GA 3UP1A 5LDSA 4P5MA 4PW9A 4TVSa 2QEJA 3V4UL 2BVOA 4XP4H 4OTXL 1OTUD 2FVNA 2BZDA 2W95A 4L3CA 5F1OB 2XV0A 1JFQH 1ZA3A 3NZ8B 5DZVA 3ZYIA 4ZTPL 5IQMA 3JWDL 2VJ0A 3VAEA 5JUEH 4JPVL 5J12B 1XO8A 2J20A 1INDL 2HKAA 4EJ1C 5BOJA 2Y4SA 1QSEA 2X3CA 3TGXA 4GAYA 3MBEC 4PRDB 3MFFB 5TFSH 1HHHB 4B95C 4J27A 3N06B 2BW5A 2EC9T 4N8VB 2VN5A 3P54A 43C9B 4OLYL 2WGNB 1XGTA 4KTDL 2BRRH 1GMIA 2B15A 5FGCE 3NQKA 2HG5B 1ZOXA 3AS0A 4Z7WE 1I8LC 3L9EA 1MCEA 4FTVD 4R26L 2XLLA 3Q7JA 2ZOLA 5C0JA 1UXWA 1GS6X 3H7BB 3QDJA 5I1JL 3TO2B 4YUEH 4A04A 5ID0B 2ESVB 4EN3A 1BBJB 1Z5LB 3CK0L 2OCFD 3BVNB 4MB4A 4KITB 3MLRH 3MOBH 3UACA 4X42A 3MLZL 4I48B 3DGDA 3JWOC 4XNZC 4AQ8A 4PUBH 5D1XA 2DQDL 1V3MA 1OXYA 4NQCB 2GW5A 3FO2B 3WIIL 4CW1B 1SOXA 2CKBA 2CMRH 2KH2B 4A7SA 1RFDH 5AW7B 3ZKXC 5C92A 2FD6L 4JQVC 4HG4J 1TCRA 5JPNA 5D6CA 1W9XA 2GYSA 4JRXE 2CK2A 4Z7VA 4UAHA 1QTYT 1FVDB 1GSMA 2QV2A 3GIZH 2H3XC 3JZYA 1IM3A 1BQHB 1HHKA 1KPVB 2ADGA 4L1DA 1O7DC 2J8HA 1NDGA 3FU9A 4M7KH 4RLDA 2D7TH 3VFNB 5ESAA 1F1AA 4WI2A 5EO1B 1P5VB 1KB5L 3HAEG 4HIPA 4CVXA 2IALB 3AUWB 1G6RB 1EAJA 4FG4A 4G8IA 5CWSA 5KSAD 3UIYA 2FEJA 4R7XA 1NIAA 1VIWA 3ARGB 5BUGA 1EDHA 1M2VB 5DHYA 2QLYA 3GKWH 3ZTJH 3REVB 1ETB1 2IH9A 1IKNC 4W1TA 2X05A 1JV5A 5ETUA 4IBWA 1KDJA 2NX5A 5K5YA 5HHME 3VI4B 3US0A 4M7JL 1FG2A 1HAWA 1IM9D 2EIKB 1IGJA 5F96H 4PJFB 3UTSB 4KY1L 1A6AB 2ZICA 4JHUA 5J1TC 1O6TA 3EBAA 1PVHA 2E7BA 3FRPG 3G6DL 1MW1A 4L4VD 2NY4C 4M1DH 5B3JF 1ONQA 2DH2A 4CSZA 3B2VH 1K8DB 2AJYL 2ADIB 5HI4D 3ULAB 1A3RH 4XCEB 3NMEA 3MBXH 4KQ3L 1S8DB 4F2FA 2L04A 1O5PA 2OSLA 4BFBD 4WFGE 3TH3T 3FO1B 3DJ9A 1OAYH 2WC7A 3OAUH 2DM3A 4U0RC 4NS0A 1CG9A 1FAKT 2F6AA 1WV7T 4ERSL 4LIQE 1RUAH 4H0LC 2VC2L 3T2NH 4OD2A 3LXBA 2ZE0A 2YGQA 3LKOA 3WN5A 1G7IB 3X14A 3BO8B 4KK9D 1AGBB 2RA1A 4YFLI 3WNOA 3AW5A 5HJ3B 2IH3B 1M9WA 4NO0A 4GW5A 4RGMB 3CQPA 3LNHA 4W6WB 1SHSA 2WV3A 4IOIA 4YGAB 1Q9OB 2R0ZH 1FL6A 4A2DA 2XT1B 3IJHB 5D7KD 4UT6H 5EOCL 2YFOA 4IGBA 4LKXA 1KTCA 4KGJA 4AW4A 4Y4FD 1ES0B 2AK1H 2Y3NA 4RH4A 3K6IA 1JHTB 2W91A 3T77A 5B3SB 5IKCB 4E41D 4HWBA 1MCFA 2M2DA 4OLWL 3IDMB 4Y7OC 5KN5A 5IROA 3CFTA 5MERB 4Q2ZB 3G9AB 1U91B 1T5KA 2OI9C 4MMZB 1J8KA 1L7IH 4HIQA 3MODL 1N6UA 3U0TB 3U4EB 12E8H 1YEEL 3BZEA 5E95B 1UQSB 5HHNB 1TQWA 4AIEA 4FNUA 3IGAA 3RZCD 3S5ZA 3U2SB 3BFQG 5ISZB 2F1EA 2FBJH 2H32B 4AG4H 4I5BB 5DJYA 4MASA 5G5DB 2QDWA 3SD2A 5IB5B 1BXUA 4DGYH 4Z3HA 3FPXA 3CFMA 5FWRA 2B08A 3KPRB 5IHUL 3ULVL 5HGHB 4G71B 4JVWA 3UGEA 3O4LD 4KXAA 2XA8H 4AZ8B 3NRPA 2BCKB 4ZPTA 3WFBL 3CFBB 3OAWA 1RZKH 4KJWC 3RTQD 4HU2A 3P4OA 4AGLA 5BZWA 1MELA 5T1DH 4JKKA 2V2WB 2QADC 5HHVL 2MOVA 3K46A 3TBCA 1CIDA 4KV5F 4PJEF 1EZLA 3B56A 5ADPH 4K3JL 3NOIA 3B6SB 1MOEA 1Y7VA 2C3VB 1S9XA 3VD4A 1NM9A 1NLBH 5ICXA 2JCCE 2DLIA 4PLJD 3UJJH 3QQXA 4KK6D 4MHHG 4TQHA 1CUOA 2TAAA 4MJIA 5GHWH 3NVQA 1HEZB 1QFWL 1KELL 4NB7A 3AY2A 3GHEH 4IHBA 5IBLC 2B8OT 3C2AL 4MNGB 3KGTA 3AG4B 5D72H 1I1YA 2LTQC 3PQYD 1JZGA 1H15A 2VAAA 2YSTA 8CGTA 4XMPH 5GGTH 1G87A 1LO2H 1F2XK 3RL2A 5B7MA 1FZKA 5TE6L 4PJAA 3I74A 3WXVH 1FCGA 1B0GA 4HOWA 1TJIH 3ML8A 5H4ZA 2O5ZH 2D31B 1SXBA 5CMAA 5IJVA 1BX2A 5LB1A 2DRUA 2ITFA 2ZOWA 1A14H 3IDXH 1TU2A 1GZHC 1MWAL 2HPOA 3L45A 3HPLB 4O00A 4WEEA 3SDAB 5LN8A 5MHSE 4Z3GA 3H3BC 3QYNA 3EJQA 2VZ1A 5AVYB 4AE0A 4AWJC 5IMMA 4NZTL 5E6ID 1HSAA 3ARPA 2HSIA 3IJYA 3QR2A 1LXMA 3GRWA 5D7IA 5FUCE 4MWFB 4DKFH 1NPJA 2VLJD 3IFNH 5IUSA 4W70A 4J3OF 2BVYA 3NBNA 4Y19E 2WINA 3BMVA 3C9NA 3IETB 4KU1A 3SE8H 2A6DA 2QGCA 3QDME 1KSRA 4CMMA 2KZBA 3PWPB 5EO0B 2HFGH 4N90E 3BUYB 4L3EA 5GS3A 4YC2B 5KVEE 5MP6L 3T8VA 2GJ6D 4GO9A 2AQSA 2GG1A 5AB9A 4XMWA 4X8JA 5CEZH 2HN7A 1Z3GL 5HBBA 1N8ZB 1QW8A 4Y9EA 4XXCC 5BUPA 4QAWA 3L2NA 4YDIL 3RTLA 1OSZB 5GGVL 3ETTA 3EGDA 1OSYA 4PJXF 4QT5A 1IVTA 1J11A 4JFOA 5L2KE 3CLFH 3DBSA 3F04A 3D18A 5I1IH 2UUDH 3WJMB 1UJ3C 3Q9PA 3MUHL 5F0PB 3HI6H 5I9QB 5J11C 1FYTD 2P5EA 2GHWB 4JFDB 2BSBA 1K6QL 2CO7A 3O0RL 4FFTA 4Y2DA 4GI9A 1RZFH 2R69A 3S98A 2YMTA 4BFNA 2H0JA 2P8LA 2CJUL 3TV3L 2K6WA 4I1NB 1C5BL 3FL7A 3GSNB 2EYRB 1ZDQA 3RVXC 3T5WA 1XBRA 4R2GC 3QIWA 1NEZB 3N42F 3MJGX 3K4DA 3DV6A 2H6UA 1NGPH 4G9DB 3GMOB 3HVNA 3P2TA 5F3HB 2WP3T 1GCYA 2H2SD 3EFOA 3MCYA 4LVHB 4GBXA 4MDJB 1MEXH 3F7VA 4PJ9B 5SWQA 1PD1A 2VDOB 1VZIA 3CVHH 5EU6B 5AAMC 5BW7A 3TPUA 2WGXA 1QA9B 3Q1EA 4GP5B 3S4SG 3P30H 1G9MH 2WKLA 4L8CA 4JFQA 3IAPA 1IFHH 2QQKL 3PWJA 4E9RA 4WU7B 3BZ5A 4NIYE 5CFAA 5TE7H 3QB7C 2XTSA 4AQEA 3MV9E 4C4KO 4OB5L 5I26A 4NYLA 1EDYA 1HYSD 5TDPA 4K5NA 4OFKA 5D2NA 4J28A 1A6WH 1MFBH 1ICTA 2KS0A 3QUXB 3WG7B 4PV9B 5C08A 3NCEB 3FQRB 1XCQA 5F6HI 3RWCB 3V4UH 3DETC 4LSUL 4OTXH 4ZNCD 1FRGL 1KJMA 4PRPB 1LGVA 1YJDH 1F4YL 4L9DA 4ZTPH 1YEJL 1X5ZA 4PRHA 4K15A 1T5WA 3JWDH 3ESUF 5E2VL 4GINA 4JPVH 3DXAB 3QUKB 1INDH 4MCYB 5SX5K 4JCMA 1I8KB 1U36A 5HGAA 2ZOOA 2A0LD 1LE9A 2AVGA 1G6RL 1BG1A 3MZGB 1NL0L 3V0JA 3KJ6L 1WF5A 3TA4D 1XF3A 4OLYH 4Z7NB 4KRPB 4WTQA 3D05A 1DANU 5I5MA 1SMAA 2ICWJ 3B8YA 3LRLA 1MRDL 4DETA 2BVEA 4R26H 2GSGA 1GPOH 4UOQA 3EJZD 5DVLA 3U9PL 5AW3B 2YAMA 1EIBA 3EGXB 5SV4A 5DD0L 1UM6L 1LL1A 2AQRA 1YQ2A 2Z7UA 4GW4B 5I1JH 3ZDZF 4PWEA 1FNGB 1T66D 1E65A 2IAMC 1BDYA 2Z7ZA 3CK0H 3PGCA 3QQDA 3QUZC 4GLRH 3U30B 1G84A 4X6FA 3MNZA 4GKOA 3MLZH 1E9PA 4XMKL 4KKNA 4FX5A 3KHQA 2H6OA 2WOBA 3SGJA 4F15B 4ZFGL 3MLTA 4AYDC 5CEXA 2DQDH 2F53E 1SY6L 2DDQL 2O6PA 3B9DA 3WIIH 4E36A 2XQBL 1UM5L 2C1OA 5H35B 2FD6H 4IRJC 4PRID 2VMCA 3OL2A 3K6SB 1QMUA 3MUJA 3QT2A 4XNYH 1FL3A 1KTBA 5AG9A 2ZQKA 4DP2X 1NICA 3QZBA 3GZQA 3V4PB 4X7SH 4Y16C 3V6OA 5DF0A 2W07B 4HKJA 3TU6A 1AMXA 4HXAL 1FBIL 4M8QA 5DJ2A 4AX3A 3WY3A 2ATKA 4YN3A 4R7DB 2DWEB 5E9AA 4FEIA 1THAA 1UD4A 5HYJE 4WK4B 2BMKB 1A25A 3FU7A 1TQTA 3EDEA 5FECA 4XMXA 1KB5H 5KS9E 2GTQA 3IFOB 3QEQB 1G6VK 1QW9A 4QTIL 1FFPA 4LPYA 4IIQB 4PMFA 1I9JL 2IQAA 3F7PC 1BW8A 2AEIT 1X5LA 2ID5A 1A9BA 2RFXB 4U1HB 1XSOA 3KPMB 2KERA 5T5FA 4RMQA 2DQEH 4LGRB 1A9EB 4LBEB 4XP9L 1I1RA 3LXAA 4LDEB 3B5HA 4RETB 1NCDL 2ZXEB 4M7JH 1AKJA 2MTPA 2Y6SD 2QGEA 3QWRA 4KY1H 3H3KA 2OKMA 5FW6A 5B21A 3G6DH 1GYVA 1OTTD 5I76A 3WELA 1JAEA 2X3AA 4AVIA 2AJYH 5FYKL 5DVMA 1MJJA 2DH3A 5T1LA 1F4WL 2F8IA 4U1LB 4KQ3H 4ODXB 5ICZA 1IC4L 2QT6A 4FQJL 5I16A 3EW3B 4X6BA 1SJEA 3DHJA 5DMYA 1JNNL 2YGNA 4P46D 3QWOB 3WNKA 4NQXA 2EXWD 1D5ZA 3DO7A 1LO3L 1MRCL 3T4AC 2EEXA 1FJ1B 3FQ2A 4ERSH 5E1AA 4B6ZA 3UC0L 2VC2H 3N91A 2I69A 4XH2A 4LRIA 1MH5A 1NJ9A 3DX7B 1N18A 4QCIB 1O7VA 1SXCA 3QYCA 5CLYA 5TDOA 2XWTB 2G0LA 4P2OC 4HIJA 3HB3D 3MV8A 1KZYA 5L7XL 4OLXL 1NSNH 4KZDL 4AXWA 3NIFB 3PWVB 2AQ1A 2GSIA 2VDPB 2X0WA 1ML0A 4TSCH 3C8KB 3R7RA 4ICXA 4KKCD 3L6FB 1FNAA 3B9KA 1NANH 4LPWA 1EAOA 3B2UD 4XO9A 1IMHC 3MHZA 4W6YB 4ZYKB 4LLWB 4OCXH 4I2XA 4OLWH 2E0PA 4LF3A 4ZUTB 2YGPA 4P2QE 3MV11 3R4RA 3NPSC 4PJ8C 5LGYA 1YEEH 3ERXA 1RI8A 1E27A 2ZP9A 5FM8A 2NY6B 1NGXA 2VSKB 1KBGL 3P77B 4R7NA 1YEKL 5JW4Q 3LZRA 4LPXA 3HZVB 4KJYB 1TEFA 1KLGA 1GC1C 4UQEA 4LHQB 1KB9J 5IHUH 3ULVH 1QSEE 5FV2A 4YHIA 2GK2A 3L3GB 1LP9F 1ID5I 3M1CA 2NYYD 2Q10A 4Q6IC 1X4YA 2C3XA 3WFBH 4FA8A 2ZAHA 3D12B 3OLGA 4ZO7A 4HZAA 5AAPA 3AS1A 3IBOA 4EN2A 1IAOA 4L2LA 3ATBA 1TETH 4QRUA 2YGVA 4GO8A 3SDCA 5GGSB 5IB3A 1YN6B 2N7SA 1WC7A 4C55A 5HHVH 3P02A 4NKIH 5EC1B 5FW8A 3QDJE 4MSWA 2CGZA 3UH8A 3REWA 3WO4C 3SQRA 1OSEA 1PJ9A 2OSXA 2N0MA 5HDLA 3RIAF 1NGZA 2VDQB 4HEMA 2J8UB 5I19L 5LNDA 5FA3B 4LEOA 2CDGB 1IUZA 3S37X 4LVNB 4J3OD 4PRBB 4UQ2B 1QFWH 3OKEB 5CO1A 1KELH 2IOOA 3E8UH 2D3NA 3LH2L 4HDIA 3SZKC 3TN0D 3FTUA 1KBWA 3NFPB 4YAQB 3C2AH 2ARJB 3N40F 1JNLL 5BOPA 2ZPKL 3F65A 5ACZA 3D52A 4XBGB 2HT4C 1IGTB 4Z7VE 5EBLA 4FQXB 3SDDB 5KSBE 2BZ7A 5TE6H 2R2BA 1RVFL 3AQDA 1X5XA 4F33A 1KC5L 2YXFA 4N0UB 1B88A 5ENWA 5C0GA 4A68A 3FULA 5GIRA 1JERA 3FQTB 3T8XB 2WIIA 5FO7A 1JGDA 1KPUA 1G9MC 3CPLB 4WHTA 4ZRGA 2JXMA 5J57B 4WO4C 1ZLWK 1MWAH 3GSNL 5CN2A 4J3OG 3WE6A 3BIKA 1Q9WB 1WFMA 4NZTH 3VXPA 4OKVA 3H4FA 5IHWA 2KZ1B 3KXFB 4AYGA 2G2RB 1ZGLM 4J2QA 4NKQB 5IB1B 2J12B 2EILB 2EXYD 4NKDA 1C12B 2FNWA 5G4MA 5ANMB 5IVXA 4D9LL 3WEXA 1DN0A 3VB8A 3T0ED 3WFDL 4A1RA 2AHIA 2KDGA 1MVYA 2BS71 3LHPL 2NX5E 4G1MA 4R4BB 3C8HA 5I0YA 1RPKA 3N1QC 4DEPB 1HCFX 2F8VA 5DT1L 3I9PA 3WL9B 3TVMC 2EYTA 1N67A 1XQ4A 4K23L 5MP6H 2X4PB 3G3LA 4POUB 3DURA 2J5LC 1Z3GH 3ILPA 4QO1B 1AHWC 5ID1B 1WIPA 3JSSA 1T22B 1YYLL 4YDIH 3KNBB 3BUQA 3P73B 4TL5A 2X9WA 1M7DA 2AZUA 2UZPA 3TONA 2NDGA 4XC1L 2Z8SA 1J0KA 2OR9L 3QW9A 3D25A 3NIDF 1VGKB 1CICA 1AGDB 4NC1E 3MGAA 3VWKB 1BF8A 1P4IL 4P2RD 1KLFB 3O0RH 5CU5A 2HTLD 3V0DA 4GRLD 2WYZA 3RX8A 5BMFL 4KI1A 4EVNB 2COQA 1JP5A 3HMWL 2DJUA 5DVPA 3ETBF 4V1DD 1KBBA 1JMXA 3TV3H 1JTOA 1C5BH 2A6IB 1I8AA 2Y6TE 2WZPD 3AY4A 5IEHB 1I1AB 4XAKD 3K8LA 3BVWA 1AO7B 3ML9A 1PTZA 3BLKA 3TZVD 3MI6A 2R1YB 3IDGA 4KAQL 4HIEB 1GGYA 4Y9BA 3CDYA 5EIIG 5C70A 2Y1YA 4FABL 3QBTB 4MD4A 2DYPB 1DBBL 4QF1A 3L3JB 3VFWB 4NZRL 5LGJB 1F56A 4WY7H 1SOQA 4CSSA 1DQTA 4O2CA 3WENA 2PW2A 1BWWA 5EMYA 3POCA 1LK3H 3D7PA 3N04A 2WUBL 1B6UA 1UG9A 4CILA 2QQKH 4GY4A 3B2MA 4IMKC 3IJEA 4N0YL 5JTWA 2XKUA 5JHDB 4EQ2A 3NSFA 4OB5H 1LK2B 5GS1A 1KTLB 3M07A 4F7MB 3IPBA 3PXLA 1ZHBB 3P40A 4F27A 4KXZI 3GB7A 1RP8A 2ZWZA 4ODVL 1F8TH 2X42A 3D39A 5LCVA 3P0YL 3U0PB 3VD9A 1G7QB 2PO6C 1S7UA 1MCLA 3WJJA 4LFHD 1Y6MR 1OGPA 2AEOA 2JI2A 3ES6A 4LSUH 1FRGH 2NUPB 4JDEA 4X6DB 2QTEA 3V4PL 4AIXA 1SLVA 2ZT9C 5LBSA 1JCVA 3SQOL 4PJ5A 1F4YH 5BS0B 1YEJH 5LHDA 1GRWA 2FGWL 1YUHA 5E2VH 4HHWA 3FQYA 1JMZA 4CBPA 4ZFZB 4CC4A 4G6JL 1JWMB 5I6LA 3RNKA 2BSSB 2R9HC 3Q6GL 1G6RH 2P28B 3K5SA 1HSBA 1NL0H 3KJ6H 4XWOC 1CJYA 4IHOB 8PAZA 2VE6A 1HXYA 2Y69B 1BVLB 1FHNA 4LFHG 4N8UA 1MRDH 4PG2A 4HOMA 4JPIB 3UTTD 5AZUA 3U9PH 3VCLA 4JFWA 2OXGB 5DD0H 1UM6H 5KBMA 5SWSD 4R97B 1YDPA 4Z7WB 5F93C 1EHLL 1F4HA 5FA4A 2VXUL 5JLZA 3B83A 4ONFL 1N59A 2XG4A 4POZC 2ATAA 4QRPA 1S78C 2EP6A 1Z1WA 5A1AA 2Z31A 3INUL 4XMKH 2YJLA 4JG9A 1DQIA 4ZFGH 4PJAE 4D0DB 3O6FB 4KMLB 1X6LA 1SY6H 2DDQH 3QORA 4JFEA 4P57A 3GPEA 1L3WA 2XQBH 1UM5H 3V5KB 2NNAA 1HYRC 1O9WA 4RAUA 4JAMB 4X6EB 2EH8L 2XN1A 5F9WC 2F54B 1HOCA 4QHNB 1JCKA 2R59A 3A24A 3DO3A 2E6QA 1FBIH 4HXAH 1T89A 4ANKA 4OFYA 1U30A 2X6BA 2WYIA 4GS7B 1JG9A 1GJWA 2VXQA 1I9RL 5B38B 5HHQA 4HFWB 4AV5A 3BH4A 3CZSA 3HUJB 4AYFA 3O11A 4AKOA 5AVRB 3FO0L 2E4TA 1X7QA 4QTIH 4XNQB 1G1OA 1TFPA 4P9HH 2ZUTA 3GUTB 1BMWA 3V6BR 1I9JH 1WISA 3OAYK 3VFGL 4M9PA 2CKBH 2LU4A 3O3BB 1QR4A 4L3EE 2Y1AA 4N20A 4XP9H 3D69A 1MW2A 1NCDH 1KPRB 4LVEA 2OMWB 5JW3L 5D1QC 1OGTA 5IW3A 3BMWA 5A3ID 2V17H 4LL9A 3T0WA 1CDBA 1FGVL 4N6RB 5HHMB 4PVNA 2A6KB 3V2AR 2WW8A 4P4KC 4MD5B 3LPFA 4FC3E 4B5EA 4BH8B 2UX6A 1A6UL 1WPCA 4DKTA 3EYQC 4FZEH 1CGWA 1F4WH 2JELL 2P5EE 2Y7QB 3KJ4B 4Z3FA 2H32H 1IC4H 4MS8C 4FQJH 4C8XA 2Z93A 4GUPA 1JNNH 5J6HA 3GNML 4JGUA 3RVWC 2ODIA 5KVDE 1LO3H 3H2QA 1MRCH 4J6IA 2CO6B 2BIHA 3OTTA 1FL5B 5BVJA 3FT9A 3BAYA 3UC0H 4HMDA 5KJ4A 4Z18A 2FYYA 4TNWK 3BP6B 3HZKA 2BSDA 3OSVA 4BK5A 3H9SA 3CNKA 4JO2L 3HG1A 4NOFA 4BWTA 4ZODA 5FKAA 4FCHA 4D0BB 1OWRM 2VLKD 5L7XH 2K8MA 4L4TD 4OLXH 4KZDH 2O61A 5FM5O 4GRWE 1R3KB 2VDRB 4HK0B 2XWJB 4UILL 3L3DA 1T20A 3C6SA 4GG8B 3A6OA 4KKAC 2VDQL 4FMKA 2XIIA 5DC9B 3DVFA 5E56A 3QIUB 3QCVL 5AYQA 3NRQA 3DK2A 2K7PA 1KT2A 4UTBA 4DPAX 1CLOH 3ROLA 4XGZA 4N2HA 5AOZA 3VFTB 3TX4A 4WW2B 1BZ9A 3QHTC 1YMMB 4MJ2A 4WNSA 5D2NE 3CC1A 2JIXD 5C0AA 4N26A 4YLBA 4BYHA 4QUOA 3IKKA 1HESA 5AZ2L 2DQIL 4DKAA 1DYZA 4HZLA 4OIFA 3QO1A 3PUUA 3VRJB 3QO0A 2HYMA 4OGAD 3SO3C 1KBGH 1YEKH 2BNUB 3SKNA 3PL6B 4PRHE 4BRVA 4FKHA 2VNCA 5EZOL 4CN4A 2X89D 3KPSD 3DX6A 4IU3B 1BD2D 1S7TB 1TEYA 1ZRUA 2FLMA 4WGVB 2FR4B 3G08B 3V4VA 2BWQA 5DD5L 3QFJA 4AEFA 2YEVB 4JQIA 2G5BB 1D5IL 4PGCA 5HGBB 1SBSL 4PYGA 2CAKA 3FTGB 4MQ7B 4LRNL 3GSXA 5MEQA 5MEOA 1FYHB 3KLAA 2RALA 3P4MB 1ZSDB 2VLRD 5DJ0B 1R9FA 1KCSL 3ZGIA 4X5XA 4EI5B 1IT9L 4XN4A 3TEXA 5L0QB 3MYZA 4L8BA 3Q06A 1KYOK 1IIKA 5KG9A 4FDWA 2ZF9A 2WUCL 3FTVA 3IDIB 4DGVL 1I1FB 1I82A 5I19H 1R46A 3MKGA 1A64A 3FT0A 4H0IA 2ENQA 5J12C 4NNYB 4F2EA 5E4AA 2IVFC 5I0DA 3BYYA 4JO3L 2MTAA 3LH2H 5AOLA 2OA9A 2GABA 3D2TA 3F5WA 4FFWD 3IKCA 2UWEA 1UFGA 1XD0A 2AQ2A 2PWFA 4Z7OF 5CF3A 1JNLH 1D5BB 3HIZA 2ZPKH 1V27A 3GSVB 3HKFA 4Y2NA 2YPKB 1TNMA 4KJWD 1OEZW 3WMSA 4BSVA 3QNFA 3ABGA 3EKCA 4EI0A 1GGCL 2LGNA 2OULB 1I53A 1KC5H 3V6OE 3V9FA 1LTXA 3LNIA 5GS0L 2X5PA 4HUUB 5AYTA 5JPMA 3TO4C 2BRQA 4JG1L 4PLOB 2WTRA 1HZHL 3GSNH 4S10A 4QWWC 1MFNA 3AAZA 5J1AA 2GAZA 1SJHA 1VEMA 4M43L 5JMRA 2HRGA 3HBGA 2ZWSA 2BNRB 1WZLA 2YPLB 4LSSL 4YDVB 3LIZA 1WZ1L 2PP9A 1QVOB 2OSWA 4D9LH 4ZMNA 1AXTL 3WFDH 4WUUD 8FABB 3F6JA 3KL3A 4EMZA 1TENA 4IRSB 5FCSH 2VWEC 1J05B 2KZWA 2YUZA 3LDBB 5DT1H 4WHYG 4C83B 4ISVA 2HLAB 5FLUA 1SHXA 4LAJH 4K23H 3GC3A 3WFCL 3FAWA 3EYOA 2NY3D 2AFNA 3TV8A 2IMNA 4ZFOB 2YARA 1ACZA 2HKFL 43CAB 2WVSA 3FOMA 5HDBB 5A43C 5D55A 3QCTL 4WGKA 4Y2OB 5HGDA 1JUFA 1NCIA 4MB5A 1XFPA 2JKJA 3GRWH 4XC1H 2IWGA 4XCNA 2OR9H 2XPZA 1EH9A 1J10A 4Q0XL 1NC4A 4AV0A 2AEWA 5FM4A 2YAFA 4EQ3A 2BIIA 5L2KB 1P4IH 2NNCA 1MAML 1RZQA 1LM8V 3GIVA 4MBOA 4LARL 1HQRB 5BMFH 2E27L 4QHUA 3C09B 4KKRA 5E8NA 4MQXC 3FUIA 4PJ7A 3HMWH 1KN4L 1OP5H 4F8OA 2FZ3B 4E9LA 3GS0A 2FWSA 3QDGD 1ZGLP 3MV8E 5HYEA 2N59A 4I4WB 4X9HA 5EC2A 2HVJA 4FA7B 3R8QA 4MAYA 4G3YL 3K81A 3FOLB 2XTJD 4O2EA 3H2WA 4N1HB 2BJMH 3FB5B 3WUWA 1DBBH 5BUAA 4HJEA 3IXTB 4NZRH 1HCYA 5DFVC 3ZE1B 5EEXA 4N2MA 3MLWL 2Z65C 1U3HA 4I2XE 2X0UA 4NQEA 4KFZC 5TGBA 3TBSA 2F9BT 2A74A 3OKOB 3EHBB 1LYQA 4H25B 4HV8B 2WUBH 2OS7A 4NQSA 5L9DL 3LRSA 1F0LA 3ARTA 1YPZA 2VUYA 2IDQA 3AROA 2RJMA 3RUGA 4N0YH 3CX5K 3DRTB 3GUFA 5AG8A 3CDZB 2XVGA 2AJXL 2CBPA 4H40A 4KMTL 4ODUB 1RCYA 4ZJ9A 1URIA 3GMQA 1NBZB 2Q86A 3QAZB 4GRMA 1TZHB 4HX1B 4RGMC 4W4OC 1R5IA 1XMWA 3MRQB 4MBRA 4DGWC 1I8IB 1U95B 4R2GD 3IU3A 2HJFB 4U3HA 4RFNB 3P0YH 4XT1C 4E5XA 3NH7L 3F7KA 3HZMB 5IB2B 3FH8A 3D30A 3QI9B 4HYTB 3V4PH 1LNUB 4O02A 3F3HA 3L5XL 4GRWH 3MNWA 1E3FA 1OD7A 1GS7A 3ZE0B 2FGWH 3CSYB 4NO5A 4MMZC 3GSRA 2IO5A 3EADA 3O9WD 5I8OL 1TPXB 4FXGC 1SYVB 4G6JH 1AG0A 2P42B 4OF6A 3Q6GH 1ZT1A 2V8LA 2EDOA 2L3BA 1S5HB 1W72A 5GJSL 4KKLC 4Z1PA 2L7JA 1VFMA 3IFPA 2XXGA 5LCVL 3QHFL 3T04D 1WVZA 1ZJBA 3WSQH 3KPLB 2C26A 2NY0B 2YD6A 5TE4L 2C7UB 2LLGA 1HXMB 2ISDA 1EHLH 1GZQB 1DQVA 3CHPA 2QVTA 2VXUH 4KRNA 2VL5B 3IMVA 4LLYA 4ONFH 3NJGA 1NCJA 1MI5A 4W9KC 1RURL 5EU5A 4U1IA 1H3PL 2AXWA 4LBAA 1SDDA 1IBHA 3INUH 3Q13A 1ZLWH 3VXSA 3W0WE 4MNHA 3CE1A 4KTEL 3BE1L 4BCYA 3BESR 1CURA 1QI5A 2V8MA 2VR5A 3D48R 3GSWB 4FXKB 3VXRD 1N0LA 1FPTH 2P47B 5CGMA 4OZ4A 5GZOD 1EXUA 4V2CB 2DEYX 4YL4A 3DKHA 2OFQA 4KOCA 1U92A 3TFBA 3WAJA 4Z8FL 4E0RB 3OGOE 5E08L 3EJJX 2ADYA 3BFOA 3CLEL 4RFOH 5F89A 4E9TA 3ZTJG 5C0BA 3GGWB 2EVJA 4Q58C 5CJXC 1JI2A 2CLRB 5AEAA 4XN5A 4DCQA 1I7TB 3IXAA 1LEGA 1M57B 3DECA 3MO1B 5E5MB 5IVXE 4AZUA 2P43B 1I9RH 3MUUA 1EV2E 3QUZD 1NEPA 3RKDC 1UCTA 3FXIC 3GSQB 1IO4C 1UD5A 3FO0H 1HL5A 3WYRA 5HYJB 2FRGP 3H6AA 1QLEH 5F0MB 4EUPB 2JJVA 3VFGH 3NGBB 3KWWA 2ICEB 2ZSVB 1LJMA 2VDNB 5AKVA 5HYSG 2EDTA 3GLZA 3QIBA 1OL0A 3AU1A 4F8PA 4YSDA 1USQA 4M29A 1GZPB 4IRJD 3SDAC 1FORL 1YEFL 5JW3H 3JT2A 3OB0H 2F7IA 5DRXA 3BQUB 5TH2B 3L8QA 5DFTA 2X4UB 2IH1A 3M7FB 3FAXA 2YKKA 2NW2A 1FGVH 4AEIL 4ELKB 3ZZLA 4JRYB 2ZCKL 2FJGA 3B34A 5IK3A 4GI8A 2CDEA 2XVKA 1A8JH 4N85A 1N8OE 3QFDB 1JFHA 2XXMB 5AAWA 2UXTA 2JELH 1DLHB 1XAUA 5AENA 4OZIF 1E4XI 3FBQA 4HS3A 4G6FD 1A6ZB 2A38A 2ERJB 3EJRA 3GNMH 3O41A 3HJ0A 1AFVL 3QVAA 5I66B 1PLCA 1CBJA 3OHXA 2ZXQA 5JA8B 2X1QA 5EDSA 1GGTA 1INQA 1AQHA 1EPFA 1JF5A 1NGYA 3HC0B 3LKSA 3P9LA 4JO2H 4PJIB 4WDIA 3L3IA 4WNQA 5AW6B 3WMPA 1PQZB 2IBBA 4N0FB 4WI7A 1M53A 4YIQA 5I8EA 1J8HE 3GXMA 3HFFA 5I9QC 3SQBA 3ZGHA 3FCUB 4UILH 2ZOUA 5E7BA 3MRBB 4E9VA 2HXAA 2VDQH 2PYFA 4K8RL 1OD9A 3IAGC 3JTBA 3SDXB 3KPNB 5KVGE 4S1QL 3KGUA 3QCVH 1JGVL 2OR8A 1PD6A 1E28A 3ABKB 1DQML 1TSRA 5F6HJ 4WK0B 2V3FA 2XPGB 2NXZB 5D2LA 4M1GH 1OZTG 1FVEB 3VWJA 1HFUA 1ORSA 3FRPA 2ENJA 3GJEA 3D39E 4JANB 5ALCL 5KBLA 4MHHI 4QXTB 3IPEA 4ETYA 3NZHL 2XXFA 3RY6C 2Q7YB 3PIQA 5AZ2H 2DQIH 4X9IA 1B0RA 2VQ4A 3L08A 4AOFA 5DYFA 2O5XL 4G6KL 1BWMA 1BZDA 3VI3F 2OMVB 3HI1B 4ODBD 1IBGL 4JL1A 4PTTA 1Z6JT 2E7HA 1IM9A 2GJZB 1D5RA 5DD5H 2BNQE 1FV1B 4N1EA 4JFXB 5C07D 4FFZL 1XGQB 2FJFA 2AEPL 1PW3A 2GUYA 1P4LA 1D5IH 3QZWG 1O0VA 1SBSH 1A1MA 1YEGL 3WFEL 4OIBA 2JKSA 2IDSA 1Y07A 3PU7A 4LRNH 4QOKD 4EDWL 5K1NA 3QUXC 5BQDA 1AZZC 3FTWA 1NCHA 1Q9LA 1KCSH 1NH6A 1U2CA 3TCTA 3WIFA 1IT9H 2ICCA 3GT6A 1D3CA 4BA8A 4NKMA 3WTYA 1DVFD 1NFDE 1MF2H 1TTFA 5CBEB 3MRRA 5FYLD 5DUML 1IC5H 2WUCH 4ODHL 3KYNA 3GMNA 1ND0A 4DGVH 4HSCX 4ZFOL 1G5AA 1AIFB 3D0AA 4JREB 3DMMA 2RB8A 4R8WL 5BRZB 4YNYB 5C0DA 4HJIA 3DBXB 5EUOA 2PTVA 4GAJL 1I3UA 3FUFA 4NBZB 4NKOA 1G5GA 1TQCB 4IW4C 1WBYA 4G9FB 3L7EB 2K4WA 5CEZD 5IJDC 4MDIA 4HWEL 2QKSA 3VXQA 5INDB 4ZSOA 5I30L 4X5QA 3FQXB 3PAZA 4Y4FA 4L1TA 5LO7A 5AW8B 2QR0B 4X2UA 5GS0H 4N8PA 1IAMA 4ZUSA 5BZDB 4A7QA 5KSBB 4E41A 3LQMA 4JG1H 5JMOC 3OGCA 5FF6A 2PYED 4LLUB 2JI1A 3TF7C 2GUOB 1NFKA 1S7RA 2VIRA 2WXKA 1QLRA 1HZHH 1K2DA 2P7TA 3CQQA 5K39A 1HHKB 2ZX8A 3U30C 1C08A 5CCKL 2NSMA 5F6IC 3K71B 3KAAA 2E7CA 3BGAA 4PD4J 3ZR5A 1UZ8A 5DEFA 4JPKH 4NN6B 4M43H 4QEGA 3E1ZA 3SJVD 1MCDA 3HR5A 4LSSH 1R3HB 4P5TA 3NFNB 3PHAA 2YRPA 1TSHA 3OX8A 3EXJA 1CFSB 4DSYA 3ZY7A 4ZG1A 3C6LB 2ZX9A 4IBLT 2IANE 4UQCA 3C60B 4R4NC 3G6JF 4W68A 5ETUB 2RR3A 4KROD 2CM5A 1RZ8B 2RBLA 3WFCH 3IGKA 5JHAA 1IGJB 3CXHK 3MROA 1XMEB 3HR6A 1U8JB 2HKFH 2VW4A 4GMTL 3BH8A 4E9SA 2MRYA 3RTQA 4OD3L 3QCTH 3I85A 1ONQB 2G60L 3OM3B 1IGIL 2IDTA 5M7QA 4Q56A 4IIQC 3H7LA 3OHMB 2DLFL 3DIFB 4I3RH 5DS8B 1F3JA 1WZAA 3HRZA 1W91A 2VDKL 4WLCA 5C6WH 4JNXA 1KYFA 2EIBA 5AVXB 1ZV5A 3ARFD 1MAMH 4NQDB 4NI6A 5F7EL 4FHBD 1E67A 1X4XA 2BFGA 2FO4A 1CFTB 1U8OB 2V7HB 2E27H 3HG1E 4LARH 5LXGL 2RH0A 3QISA 3CZFB 4L9LA 2J1ZA 3V0VA 3A4EA 4A7VA 3QH3B 5I28A 1T2JA 3GWJA 4LLQB 3ZN6A 1RZGA 2ATPA 2HB0A 5T5NF 1OPGL 2WPGA 4XP6L 1PJWA 2UY6A 3PQYA 4G3YH 4LCYB 5KYUA 3RHWF 3R7QA 4GG6B 1U8LB 1O6SA 1GSKA 1JGUL 3C5ZB 1LILA 3KCWA 1SEQH 4KTYA 2RD0A 2E47A 1GIGL 3MRDB 1DLFL 3MLWH 3U4AA 4ECNA 3FDWA 1Q1JH 2OW6A 4H5SB 1TQSA 2GPZA 3QXUA 2V7NB 4QXGL 3CVBA 2VW7A 3FB7A 3HS0B 5L9DH 1RJZB 3S3DB 4X6CA 4J4PC 3D3VE 3N1FC 3DUUB 3UAFA 5E6IA 1KCUL 2AJXH 3N2JA 3VFMA 1R0AL 3OJVC 4UINL 1FAIL 4BWUA 1AGCA 4BJLA 2ZYSA 5K9OB 3ME0B 5GGUB 5H94A 1VZHA 2Z92B 5IMKB 4PPTA 3NH7H 1Q4NX 5E9NA 2IOMA 4LSQL 1ASQA 3L16A 5HYQA 3IMWA 1ULVA 4JO1L 1MCIA 3L5XH 4IYKA 3RG1C 3TF4A 1UB5A 3W81A 2GJ6A 3C5JB 5I5RA 1JZ6A 2K3HA 3BXNA 4U2ZA 2J73A 2VR3A 1G0XA 3I9AA 5KVGH 5I8OH 2OMNA 3WNNA 4YPJA 5I6XB 3D5OF 3SE3C 5FK9A 3LTVA 3NDYE 2NY6C 4N0CC 3VI4F 2CGYA 4KK8D 1X5KA 4MB3A 4RMBA 4HMEA 3ULUC 2DL9A 4PJFF 5GJSH 2X2UA 1FYTA 4FQCL 5LCVH 1E9QB 3QHFH 3GMRB 1B0WA 4Y4KD 1RP9A 1MHPL 2D7NA 3J27A 3J07A 1TMCB 4FJ6A 1IAKB 5TE4H 1A5FL 5DJAA 1R3JA 1FNEA 1YNLL 2XYBA 1F6FB 5DVKA 4X7FC 3LQAC 1MUJA 1RURH 3OKDB 1DR9A 2EEDA 1FVCA 1CGTA 1H3PH 3FN3A 3A23A 1AHMA 1Z5YD 1JWUA 1TJHL 4KTEH 3CSTA 3BE1H 2C8NA 4PI2A 3WS3A 3Q48A 4DWHA 35C8L 1IC1A 3TH4T 2R56L 4WTXA 1P1ZA 4WAFA 3UDWC 3HC4L 3THML 4TSAL 5LJYH 2B20A 2BVTA 2MHAA 3ZJAA 1JZ5A 3UERA 3ELAT 4Z8FH 3ENEA 4JMNA 2FSEB 5E08H 1N6QL 4OZGB 3CLEH 3DNKA 4U1MB 1E42A 4C54A 2XX1A 3BIBX 4LVNC 4N2LA 4YSTA 3G5ZA 1E50A 4XX1E 1M7IB 4FQIL 4F9PA 4AMWA 4CJ0A 4CN1A 5J6SA 3TEUA 3CZEA 4NRYA 5E6YA 4CVWA 2DIAA 1MCOL 3A3YB 4BFIA 5T1KB 3SDDC 1JPST 5IMOB 3D09A 3BWZA 4BWWA 1GKOA 3ESNA 3NYKA 1R24A 5DJ8A 5AUMA 4JBSA 3SBWC 1ZXKA 2BSCA 3VH8G 3T3PB 2ZCLL 2EZ0C 2BC4A 5E8OA 3AREB 4AQOA 2GVYA 2W81C 4D9QD 1I9EA 1ZDSA 4OJEH 1WAAF 1RZIB 2P5WE 1FORH 1YEFH 3ESVF 4MKTA 3UTOA 5HVHB 4KBPA 4N2EA 3VTAA 3BW9B 4XTRC 3SYPA 2CHZA 4Y5VC 1VFAA 3LB6C 5DQJA 4AEIH 2HN7B 2R2CA 2BP8A 2ZCKH 4LCIL 4FG6C 3M17A 2JJUA 4U6YB 3QEUA 4W9IC 1VEOA 4HLJA 1I1CA 4OM1H 4LHJB 4J3UA 4G8AC 3BISA 2WBJB 2D7QA 4DEPC 3H1ZA 3DVIA 2R1WB 3WEAA 3JZ7A 4DERA 1T1YA 2XCMC 2XN9D 3LRMA 2H1LM 1BYPA 3WKQA 3ZTDC 4PJ7E 3U4BH 1F86A 5AD0A 2JE8A 1AFVH 2AJUH 3B3BA 4HGWA 2AKRA 3T0VA 4F2MA 3MJ8B 5D9SB 4DPBX 2CALA 5F21B 4M03A 1CDCA 3I6GB 1TZOA 3RURA 4TNVK 4HU8A 4UU9B 1LO4L 3ULVD 1XF5A 2VLLB 3TT1L 1NCAL 3LKRB 5B8CB 2FWOA 2NNXA 1HU8A 2QFPA 4OV5A 3F12B 3LN4A 3DROB 1P9MC 3BSZL 5I17B 3DHUA 2NNFA 4NQEE 3MQIA 1MHCB 4P4KD 3VWKC 5IR1A 2APTA 2Q2LA 3LRHA 1PZ5A 1UWGL 4K8RH 4GAFB 5AW2B 2UZYA 3OR6A 4JZNB 5FS5A 3FQWA 4MS8D 4S1QH 3MV9D 4BSWA 1KIRB 1JGVH 3RUGE 3CMGA 1G0YR 1A4KB 4NUJB 2XN0A 1DQMH 2YHGA 5BJTA 1ZPLA 3RVWD 1KBPA 1A7BA 3RVTC 4DUXA 3KLSA 3OJDB 5I1GL 2DLHA 2XQYA 1AQKL 5IOPB 3TYGL 5F1KC 4NRZB 4TSBL 3TM6A 3BWSA 5ALCH 4Y4HD 1X9RA 1OOAA 4GB9A 3NZHH 5KVFL 3KMDA 3OKLA 4XNMA 4AIOA 1PMYA 2LHAA 1VKXA 3K72B 5IVNA 3PDGA 1OZUA 1G7JA 4HJGB 2O5XH 4G6KH 1M05B 4HULB 1R17A 1IBGH 1E43A 1A65A 3CXDL 3IMSA 1D6EB 1AXIB 2N0KA 1JVKA 2Z91A 4OUUA 4WFHD 5GSRB 2O6EA 3AU0A 4FFZH 4U1NB 4JZOA 4PIRF 2AEPH 4UTBH 4UOW0 2EXSA 3OAZH 1MCWW 1QRND 1YEGH 5B22A 3WFEH 4EDWH 1VZGA 1ZK5A 3UZEA 5D7JD 4JFZL 2HLFC 5D7LA 5E1QA 1VACA 1FZJA 1YSOA 1NCGA 5FV1L 3O4OB 4X99A 4X7EC 2KHAA 3W9DA 4JN1L 3FT4B 4ODWB 4Y9CA 2Z8WC 4I0PD 5DUMH 4CU8A 5HYFA 5LXVA 1U3ZA 5I18L 1C5CL 4ODHH 3IJSA 3T4YB 3ZL4L 4FQLL 3VE0A 1L0YA 4J3SA 1MI5E 1IE5A 3FFCE 4JFFD 3DX8B 3OZKA 4XN8A 2Z4QB 4GEIA 4R8WH 3S0PA 4MZ2A 3VXSE 5CSZB 1PZSA 4MCZB 3V4VH 4M8RA 3CTTA 5FO8B 4GAJH 4HPHA 2IXQA 3DVGB 4X6FB 1FIGL 4JQXA 1OK8A 1VSCA 3UBXB 5A2CA 1XH0A 5E94A 3MLTB 4HWEH 3K91A 5AB1A 4R5TA 5I30H 1KV7A 3NQIA 3FU0A 5GJTL 5T3ZL 1UXMA 3EOBA 5KBKA 1RIHL 3FSZA 1LO5A 4R97C 1H8LA 4PY7A 3B8SA 3CN1A 4YZFF 3HFML 1J9TA 2MSPA 4XRCB 5ES4B 4HCIA 2ZNXA 5GZNA 3QSKB 1Y1DA 2Y06L 2Z3FA 1MIML 4Q4IA 5FYJL 5CCKH 2XRAL 5DA4A 4XB8A 2WQWA 5EHFA 3HHSB 3ZDYE 4OCWL 4PJEA 2AVFA 3OSKA 3QQNA 4IEFA 1HHGB 4JLRB 3FN9A 5CM1A 4ZO9A 3G5VB 1E4XL 1IX2A 4LEEA 3WFZA 5ABDE 1XD1A 2DQFA 1QWHA 3HPJA 3MJ7A 1I85C 4WV1B 3QQ3B 3SOBL 4IDLA 1N19A 1MHHA 3DX9B 1FA4A 4YFLF 2FNBA 4ACTA 4GT0A 4LHUB 2NQDA 1EJ6A 3KCPB 3IRPX 4XCCH 1BECA 5FPIA 2E9IA 4WI0A 4GS7C 2QKIA 5JW4M 1UWXK 3GEFA 2PP7A 2WMPB 3UGXA 2ESVD 4GMTH 4YHNB 1IKOP 5HHOB 2VISA 3QWNA 4N2IA 3EYUL 4OD3H 1IC0A 4BCZA 2H6PB 2G60H 4QWWD 4FTVE 1IGIH 5JORA 1YEDB 3NP4A 1B2WL 4LASL 4N8VG 5HHPB 2YRZA 4NLAA 2DLFH 1NGQL 1RK1A 1J9SA 2VDKH 2XZCL 1RJLB 4KVNH 3W9EB 3ARUA 5F7EH 4PVLA 5LXGH 3ZDXF 5ANHA 5I1LB 1PFOA 4PRAB 4ZOCA 4Z7NF 5E1AB 1D7CA 3NK4A 3ZYOA 1PEWA 3BWAB 3FB8B 3M1OA 3QC5X 5C09D 1OPGH 5TF0A 1SF5A 4XP6H 3KJ4C 2B3RA 3BD4A 1EEYA 5DMIL 3BZFB 4M4RA 3IJ7A 3WCYA 1JGUH 4JM2B 4AXWB 3RGBA 1LO0L 1GIGH 1DLFH 3GZKA 3ARGD 4UNVA 5H8DA 1HINL 1Z9SB 2AP2A 5D2LE 3CSFA 4QXGH 4AL8C 4PJXA 3MRFB 5A7BA 1KIPA 1E4KC 2AV1A 4HJ0D 1BQHG 1GTNA 2CSPA 5K1VA 3UTSD 5JIQA 2VAJA 1KCUH 2XETA 2ZIDA 1S7XA 1ZEAL 3JTTA 3MN8A 3TLRA 3VGHA 4ENZA 1UT2A 4H4NA 4QY8B 5DC0A 4UINH 4YO0B 5BPPA 1NAMB 1FAIH 1T0MA 3LVTA 4DESA 1XGPB 4NT6A 2Z7YA 4RESB 3MCLL 3W56A 2BY0A 3ESMA 4Q6KA 2WO2B 4JE0A 3I3BA 3FJTA 1VEPA 4LSQH 5HGGS 2G9KA 1MG3C 1CDUA 3EO9L 2Z7WA 1R5WB 4H8UA 1QBBA 4ELDA 4RGOL 2F7PA 5AWNL 4IS6B 2UYLA 4L4VE 1SF3A 4KK5C 2Q7AA 3WGVB 4APQB 4WW2C 4KKBD 5DJZB 3AVEA 3NCFB 2R29A 4B5ZA 2DIBA 4DOHE 3HG4A 2SEBA 3T65A 1W8OA 3QDJD 1DVZA 1UACL 2DMGA 1FZMB 5EIIA 3DI2B 4PJDE 4ZW7A 2DQGH 2NTFA 4MJ4A 1XSKA 4NHUA 3PL6C 1V5JA 5MEPB 2F19L 2F8XC 1ZLVK 3CFEB 4PV8B 4P2RA 5F88B 5LNEA 3U36A 2TSAA 5D1XD 1MHPH 1UADC 5MENB 5EUOE 1OQOA 4F24A 1A5FH 1RH8A 1PY4A 2O6FA 4V1DA 1YNLH 3BPLB 4HSQA 2V3DA 4G5ZL 2PXYB 2WNXA 3VQ1C 4PP2A 1UA6L 3TZVA 1HL9A 2VO8A 4HP5A 5I1KL 3PHQB 4EI5C 1TJHH 5BQ7B 2I26N 4LOFA 4NERA 2WAQA 5D7KE 1IM3D 3RWIB 35C8H 5CBAB