2JWYA

Solution nmr structure of uncharacterized lipoprotein yaji from escherichia coli. northeast structural genomics target er540
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
168
structure length
168
Chain Sequence
MVQQSEVRQMKHSVSTLNQEMTQLNQETVKITQQNRLNAKSSSGVYLLPGAKTPARLESQIGTLRMSLVNITPDADGTTLTLRIQGESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAPASVLAPSDVDIPLQLKGISVDQLGFVRIHDIQPVMQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized lipoprotein yajI
publication title Solution NMR structure of uncharacterized lipoprotein yajI from Escherichia coli.
rcsb
source organism Escherichia coli
molecule tags Lipoprotein
total genus 29
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1620 Mainly Beta Sandwich Immunoglobulin-like Lipoprotein YajI-like 2jwyA01
4C47A 2JWYA
chains in the Genus database with same CATH superfamily
4PJEF 1YA5A 2FEDD 3HS0C 4JG0L 1W0WA 1CK0H 1GZPA 4HKXA 3CMOL 3ME0B 5LCVH 5CU9A 3OL2A 3MRHB 1KEGL 1XGZA 2EAEA 3GRBA 5FHAL 3A4FA 3IDGA 3S0PA 5CBEB 5HVFB 5SWQB 2CLVB 2BW4A 5H37A 2W38A 1AGCB 4TNVK 3VI3A 4PREA 1E7UA 2A73A 3KL0A 4I48A 1F3RB 5HDWA 1YRKA 4DZBA 5EFIB 4XGZA 5E6UB 3WEBA 1U21A 2PYEA 1HSAA 2FQEA 3SYQA 3UIYA 3DRQB 1NCWL 6FABH 1HINL 4NUMA 4JPVH 2DJMA 2OS7A 1DN0A 3D69B 4DP7X 4YBQD 2G75A 3L3DA 5C3TA 1B6UA 3SOBH 5MENE 4PJIA 4JM4H 3WKNA 1A64A 5ANMB 4FXGB 4OZHA 3VGBA 3CDZA 4NQEA 3D52A 3QUMA 3JT0A 3WHE1 3V5DA 4F7MB 3SODB 5D7JD 3KPQA 3TONA 1KWKA 4L4TB 2DMKA 3VXQB 5AVSB 5C0CA 1AS7A 1A6PA 4LFHG 3QUXC 2F53B 3J7HA 4C83B 1P5UC 4J2QA 1VFAB 3R0MA 2HJKB 4LDCA 1E6JL 1S7QA 3ALXA 3U6XS 1J8KA 1E4WH 1BIHA 3VB9A 3CAFA 4W9IC 2KERA 2CO2A 5LUMA 1NBCA 5DC4B 1FG2A 2NZ9C 5AL0A 3PWPD 4PJGF 3FO2A 1SJVA 4QOKE 1BZOA 3HPLA 1OGAB 3FW6A 3L3HA 2JKLA 2PPEA 1GGTA 4OFYA 4WTQA 4BK4A 5C0EB 5GZOC 2WUCL 4JPSA 3TBTA 4XP9L 2VDNL 4KJYA 4WU5A 4UNTA 1Q0YH 4B5ZA 5I6LA 1I1AC 4LCWA 2ZXAA 4WHDA 1JK8B 4CC4A 4P2AA 2HFEB 4U7KA 1D5IH 4MQSB 3FAWA 3V5HB 3RJQB 1B2WL 1KBGH 5I1IL 2ATPA 2HTLC 3O8XB 2KKQA 1G7JB 4G8GD 4DGIH 4MMZC 1PZUB 5DRZB 1FNEA 2NDFA 5LO7A 1UFUA 3GSOB 5KSUA 1L6PA 1N3NA 1AKJD 4F9PA 3WENA 4XNXL 5ACZB 2GSGA 1TZGL 4GFXA 3OM3B 1MKFA 1L0PA 5C08D 4JZNB 2IGTA 5JW5A 3FN0L 2OMTB 3W9EA 3HB3C 1XF5B 1ND0B 3CJJA 4I4WB 3ULSA 2MNWA 1IM9D 4TUJA 5BUAA 1HWHB 2W9EL 4FZEH 4FXKB 3C6LA 3KJ6H 4QJ3B 4FYRA 1E5ZA 1RD6A 5AKTA 4P2OD 4PBDA 2FL5B 1A4CA 1AY1H 4XWGL 3N5AA 1AR1C 3MV8D 1QFOA 5JR1L 3ARSA 2X4SB 4QO1B 1HILB 1S3KH 2ARWA 4LHUD 5T1KA 2FRGP 2G2RB 3NGBC 2LVCA 3A6BL 5F96L 3SBWC 4F2EA 5AD0B 3UTSA 2A83B 3H85A 3DGGB 3OVUB 3LHPH 4NFBA 2ZKHH 4IBUA 3BZEA 2DWYA 2IOMA 3M1BB 3T2NL 4QCIB 5GRXG 3VGEA 3ABMB 4PV1C 4ZW8A 4XPBL 1NUNB 5BVJA 3PDDA 1D9KD 5I6KA 4YL4A 4X8XA 3NZHL 1SUJA 4YHOL 4KKZA 3LTVA 2NY4D 3R4DA 5I1GH 2YPLA 4QXWA 1XD0A 1RU9H 4AQEA 2NSQA 2JJSC 2CK0L 2EDNA 3L4XA 1CF8H 1GJUA 2VXTH 4G7QB 4I3RH 2GG1A 4BHUI 1AGEA 4ZO6A 2C7UA 1KELL 4J4PC 1M53A 2BVTA 5IB1A 1YY8A 3CH8A 3I9PA 1BA9A 3VXTA 4MCMA 5FM8A 2XTLA 3HNSL 4NKQB 5H37G 3ZTEA 9PCYA 4C58B 1XCQB 1KIPA 3W0WA 4HPHA 5IHUL 1UGNA 2WKOA 1IBDA 1LM8V 3SDXB 5IW1A 2O26U 4HCFA 4ODUB 2ICEB 3NYKA 5KWYC 5EEUA 4W4OA 1M7DB 1DFBL 3GRWL 5AALA 2FUQA 3OKEA 4PJ5A 3LZNA 2D7TH 2VLMD 2JK5B 2O6EA 2B14A 2EE2A 4KK9D 5DJ2B 5KS9B 5JOEA 1MCWM 2JIXB 5GS1A 3VG9B 2Y7OA 3N1GC 4HSAC 4NM4L 1YUHA 3LH8A 1JF6A 3QCVL 2YPVA 3WE6B 3LRGA 2NT1A 4LRIC 1VPOH 1PDKB 3IFOA 1H3PH 1KJ2A 4MA3A 2AAAA 4AEHL 2BVOA 1RZKC 2FHBA 3K0WA 1H3TA 1T1WA 3C8DA 4CU8A 4U1NB 1JRHL 3MOBH 4EI5D 5HYEA 1TKWA 4FP8H 5I1EL 3UZQB 5FDYA 3X3GL 5FM4A 1AMYA 1OAYL 1EXHA 5E5LA 1ZEAH 4X8JA 3WUWA 3RURA 4NM8H 4MWFA 1WD9A 4TN9A 1Q8MA 3HI1A 1FUNA 3KWWA 2NY0C 3FSOA 1I3VA 1N64H 1AOHA 1MF2H 1QUNB 5SWZB 4G6KL 3O6LH 4QY8B 2V3DA 3TTYA 2BS8A 2WQRA 2DWEB 3F58H 4G8EA 5MP6H 4JFOA 3M86A 4DFIA 2XC8A 4RQQB 1UOWA 3FOLB 5SWSA 1P4LB 5C6TL 3LN9A 2D03L 5C0BB 1K85A 1E5BA 1BJ1H 5J6SA 5HD8C 3WY2A 3IJYB 1KGYE 4JB9H 2B3IA 2HT2D 2EADA 4ELDA 1G43A 4YH6A 3GC3A 2HVKA 2P8LB 5AVWB 3NIDB 2BRRH 1RPQA 4G3YH 3KWVA 3QG6A 2OQJB 2F8IA 3A6CH 3EYQD 3UAJC 1PSKL 1JPGA 1ZSHA 4NQDE 4RZKA 1DN2A 1OZUA 3NIFF 3NCJH 5IW6A 1UYWL 2IH8A 1YO4A 4G80B 4GP4B 5HTSA 2O6PA 1M4KA 3HUJA 4QKTA 3VRIB 3GUFA 1T7ZA 4IBLT 1R5WA 1OARL 3D2UB 3VFRA 3I6LE 4N0UB 1CMOA 4GEIA 1EAOA 4YXHH 1SHXA 1JZHA 1JYVA 3F5WB 3QEQA 4PGCA 3H42L 1LP9A 1DBAL 4OLWH 3MRBA 2EXTA 4A2LA 1WFUA 1I9IH 4HCRA 4OGAD 5J0BA 5J56B 1KLFA 1RY7B 1SMOA 4IK7A 4Q6IB 4OI9A 1ZLSL 5CJXA 3PWVB 5FR3A 1YDPB 5HBBA 4B3EA 3PF2A 3NSJA 4I9WD 4R8WL 5D4QA 1YEDB 5DFAA 3TJPA 3RE0A 4PGZA 4JANB 4B27A 3VQLA 1G7LA 5J4MA 1NM4A 1S9XA 1I8IB 4JNXA 1W0WB 1GZPB 4HKXB 4WI3A 3SGDI 5L8LB 3UZVA 4FS0A 4WNSA 5D72L 4A1RA 3MNMA 1WRFA 3IDGB 1JZIA 5KUKA 3BAEL 5DURD 5DVNA 3VI3B 2XWJB 2A73B 4I48B 2OV0A 4GMTL 4DZBB 2A6DA 1TLMA 4XGZB 2PYEB 1HSAB 3H7BA 4ENZA 4Z7QF 3PAZA 2ZPKH 1DN0B 2K8MA 1MELA 4UAOB 2G75B 1N68A 3S6CA 3L3DB 2J12B 4PJIB 1P7HL 3PJNA 4OZHB 4RETB 4HIPA 3CDZB 4HF5L 4NQEB 3QUMB 4FFYL 1A9VA 4MJ6A 3V5DB 1E42A 1BF5A 3KPQB 4ANUA 1HK6A 2CCVA 4YNYB 1HH6A 1UADC 2XXCB 3Q44A 5C0CB 3UMNA 7PCYA 4QTHA 3VVVA 4DUXA 2M1KA 2D9QB 4L5FH 4NN6C 2EDRA 4LLYA 1GJWA 1S7QB 4YDKH 3B1TA 1ODUA 4EZMA 5IFAL 3M7OA 1NFAA 2X89D 1RK7A 4JHWL 4PHZA 4ZUVA 1FG2B 5C2BL 3L1OL 2ZTBA 3DDGA 4N26A 1E5UI 3FO2B 4MLIA 2PP7A 1XGPA 3IAPA 3HPLB 3L3HB 1JWSA 3UJIH 4E41A 3WTVA 2NXYC 1GS7A 3WUWG 4ICXA 4MB3A 3DECA 4E9RA 4KQ0A 2VN7A 3TBTB 2DKUA 2ENSA 2P1YA 4KJYB 4M6ML 4WU5B 1EVTC 2CRZA 5D7LE 2F58H 4LCWB 1YMHB 4HXAL 3GLZA 2Y0SA 2J8UA 3ARQA 4FZ8L 4WWNA 3MJ9L 2H3XC 4NQXA 2PNDA 1ZA3B 1WT5A 2CKNA 5HI4C 4G7RB 1AI1L 1PGRB 2ITCA 2FGWH 4XP5L 4NRYA 1FNEB 4HU8A 4FX5A 5KSUB 1IKOP 2D0HA 2AV7A 3QNXA 1VJSA 2E7DA 2GSGB 2WKGA 1RFDL 1UH3A 4R84A 2FH8A 1UD2A 5IM7A 3QORD 4TRPH 2OZNA 3PWPA 2J57A 4DPCX 5A3IC 5JW5B 5MHSE 2KH2B 1REIA 2LGNA 1IVLA 3W9EB 5E08H 4K23L 4Q9QL 2K78A 3INUL 1YQVL 2ORBH 3OLIA 4Y4FD 3ULSB 1NBZA 5T5FL 3C6LB 1MQKL 4ZBJA 1Y07A 3RLSA 1JXGA 4YDNA 3BH9B 3QDME 5JQ6H 3NQIA 3VO0A 5E8OA 1LEIB 2WWOA 1PG7L 4P48A 5T1KB 2IADA 3VGGA 2A9AA 4GW1A 4JPIA 4BFKA 4XCEA 5D6CA 5BNXD 3CE1A 3UTSB 4X0NA 4TTDC 1XBRA 3HE7D 1BMZA 1AD0A 2OCCB 3GBEA 4G8GA 4IW4C 3BZEB 4K3EL 1VFUA 3BLBA 3WIFA 2DV6A 4ODVL 2OYKA 1AKJA 4Z7NE 4OZIA 4YFLI 5ICYA 2EZ0D 3J07A 1QZNA 2Y36H 4UZUA 1TZ8A 5EH1A 3I9AA 2VDKH 5BVJB 1DVSA 2XN9D 4L18A 5D1ZI 2C9VA 2OMNA 3IGUA 2JQZA 4J6IA 5ECJE 2OZ4H 4WW2A 5HDLA 1A9EA 2YPLB 2YRBA 3TL5A 4LNVA 1KUMA 1KFAL 5DK3A 3SKJL 3ARUA 4XBEL 5CWSA 4EO5A 4BGLA 4P2OA 5A2AA 1I3RA 3GD1C 1G5AA 5D7IE 3MV8A 1AGEB 2F68X 2C7UB 3BLPX 5IB1B 1Q38A 1YY8B 5AVTB 2YMOA 2I07B 5KVDE 2OW6A 3VXTB 1NEPA 3QNYA 1YEFH 4XAKE 2WXGA 1GXEA 2C7FA 3CG8A 3PDOB 1KIPB 1YPZA 4FNPA 4TM9A 5IW1B 3W0WB 3WD5H 4A6YB 2IAMC 5EIIA 4M61A 3WU1A 3BUPA 1Q9LA 3SIKA 3GMRA 1DL7L 3OKEB 3S48A 4ZNEA 1CFMA 4PJ5B 3SE4C 4F2ME 3GHBH 5GS1B 4F3FA 1YUHB 3MJ8B 3NOIA 3ZL1A 4PRHE 1NGQH 5E2TH 4DTGL 3IFOB 2K7PA 2YXMA 1KJ2B 3JWNH 3CHQA 3MRJA 4HC1H 4MA3B 3VFOA 1M2OA 1YC8A 2BVOB 4PLNC 5BVPH 2JKWA 1T1WB 2RMNA 3ULVC 1MFAL 5I71C 5CJQL 1J86A 2HUEA 3QDJE 4JFTA 1OQXA 2NY5H 3SBRA 1NGXA 3HRZC 5I8EA 2NX5D 1T6BX 1CIDA 1MOEA 1UXWA 1NA8A 1OCZB 1I9RH 1B4LA 1SLXA 4O4YL 3WUWB 1SN2A 4MWFB 1BF2A 1RQ5A 3IDYB 4ZAKC 3HI1B 1OPOA 1OWWA 1U2YA 3KWWB 4XVJL 1W0YT 5MI0C 4KZEH 4EI0A 2H1PH 5F7WC 5C3IA 4DKEH 1M7IA 2C5DC 2O6CA 4PLJC 4G8EB 1KBWA 1Q4NX 4E9VA 4PRDB 4GG6F 1PCXA 4LVNB 2FWUA 3KE0A 1MFMA 2X6BA 5L4JA 2CJUL 2NNXA 3RUGA 2EVGA 2K7QA 4JRXA 1T83C 2E7CA 5E8PA 3D07A 2Y24A 1H5BC 3QI9C 4EI5A 4TNWF 2JCCF 4X5RA 5CN1A 4BJLA 1MHHA 2HVKB 2EDTA 4YHYB 2IH1A 3QG6B 4WO4C 3H6JA 4JL2A 1I3GL 4AYEC 4PJFE 1JPGB 5FUZH 1UM6L 5IW6B 1K8IA 3EJZD 3HC0B 1VCBC 2IBZY 5J1TC 4IOIA 1NFDA 4LOFA 3HUJB 3EUUA 4PW9A 3UZEC 3SGEI 1SDAB 1IKNA 4PTUA 1R5WB 3VFRB 2BIOA 3ULUH 1S5IH 4RBPH 4RWHA 5DS8A 5A2KH 1BZ9A 4J1UA 2Z4TA 2O4EA 4ZX5A 3KDPB 2OMVA 4YBLC 3QEQB 3MJ7A 4PGCB 4YSCA 3L3JA 3RDTC 7PAZA 5FDWA 1LP9B 2N7BA 5D6DC 4C56D 4Z7VE 1C5CL 3SN6N 5B1CA 4EXPX 1B4RA 3NZUA 1KLFB 2VXQH 3CFNA 5FGCE 3L3OC 4LLWA 3RFRA 4G2AA 5DO2D 3W2DH 3GIZL 4JHZA 2WXJA 1KGCE 3T0WA 3ETTA 5JLZA 2BNQE 4RLDA 1M7XA 1G7LB 4LEBA 2HVBA 3Q2VA 1JHTA 1P6WA 4P46A 3MQIA 5D7HA 1S9XB 3L3KA 5KJRL 1OW0A 2R0KL 4EUPB 1QUPA 2WLIA 1NAMH 3UZVB 4J3WA 5T3XL 1HEHC 4CKVX 1FNAA 3DBXA 5JHLH 4CSZA 4LOEA 4V1DD 1IBFA 1IUZA 1OAXH 3SQBA 5LKNA 2XRAH 1IC7H 3G5XA 2A6DB 4AE0A 4FXTA 4QYAA 2W9DL 5IBLC 4P3DA 2YKLL 1R4XA 3H7BB 4MYWB 1Z9MA 5FF6A 1ZDSA 1WQVT 3L8QA 1CURA 4HAKA 2VITA 4GRMB 4MD5A 4DK5A 5IV2A 3H2QA 1QQDA 4JY4B 1OP5K 3WE1A 4N2LA 1QYGL 2OXGA 2X1OA 4POYA 4Z7UA 5F9OH 3CFBA 4N2NA 4MJ6B 4TUOA 4KKLD 5CN3A 3GF8A 1HH6B 3H9SE 3VFGL 4QTHB 3W5MA 3TO4D 2WNGA 3PPSA 4NKIL 3WIHH 4GPVA 2WQAA 2V7HA 4PJAF 4BUHA 4ZPTA 5JUEL 3QZPA 2BFVH 3P2BA 1NGYA 2IQAA 5F7BA 1BBJA 1GOHA 3FPXA 1QW9A 3U79A 5BZDA 1CL7L 1J48A 2G4GA 2H26A 2Y7LA 1QFUL 1YEJH 4KI5D 4BFNA 1XGPB 3U6RA 5LDUA 1JWSB 4PY7A 2ERJC 3HC3H 4E41B 5BXFA 3LEYH 3V4VA 3BWUF 2CM5A 5E2VH 1OEZW 1C8PA 3QQ4A 4S1DD 4IRZL 3ULUF 4NWUL 5FPIA 3LQMA 2J8UB 1TF4A 2HRPH 2FYYA 4TUKL 5I73B 4EIZC 4WNQA 4GY4A 4NQXB 3KGTA 5KTEH 3BVUA 1WYJA 2K70A 1VZHA 1N0XL 1XCXA 3B7YA 2ITCB 3L08A 4PWJA 4NRYB 4Y1AA 2A5UA 1N67A 4MASA 4G8IA 3ZYJA 5T3ZL 3ESOA 5IM7B 4YWGH 3T9WA 2JLLA 3PWPB 2EACA 3VAEA 1G9NH 3MACL 5JIHA 5JW4R 5C07A 3QULA 4CJ0A 3UPRA 3O41A 4LDOB 2AITA 2F8OA 4LPXA 2V9TA 4D0DA 3REWA 1KB5H 2AEIT 2NXZB 3OQRA 2XJKA 4RGMB 4Y4KB 5IVNA 2Q86A 3QZMA 4ETQA 3Q2WA 4UTBA 1UJTA 2G60L 5F21B 4NFDA 4ONFH 4YPJA 5E8OB 1XB6A 2IADB 3NJGA 4OGYH 4GW1B 2R29H 2XI9A 4JPIB 4KXBA 3FXIC 4R7NA 1TQWA 4XCEB 5D6CB 5DK0A 5INDA 4NZRL 5E95B 2HT4D 3MSPA 4BA0A 1HCFX 1AD0B 4UF7C 4G8GB 4QXUL 5ISZE 3BKJL 2VLRA 3WIFB 1AXSA 1AAJA 5AYUH 4GI8A 1YJDH 4TSAH 3V0AC 5I74C 5LHDA 4OZIB 5ICYB 1BLNA 5J13C 4C4UA 2MOGA 3D18A 2G5UA 1THAA 4R4FH 3ZTNL 5FYJH 3WLWD 2AMGA 2XG4A 3VD7A 3DSFL 4WW2B 1JXKA 4Y4FA 4Z7OE 2HFGL 1D3CA 4ZFFB 4D8PA 5F7AA 3RTQD 5CWSB 5T5NF 1X5MA 1I3RB 1C5BH 3MV8B 3NABH 1ZE3H 3FK3A 3FUFA 1BM3H 5E2JA 3LZFL 1SQMA 1ZGLM 4H13C 1UB6A 3L4YA 3QNYB 5F3FA 1XCWA 5JMRA 2BWIA 2GT9A 3HE7A 4IQHA 4FTVE 5F89A 4ZTOL 3EJQA 1E9PA 1YPZB 2MCPH 1A6WL 4WWPA 3QNFA 4M61B 2QADD 1Q9LB 3HMWL 5CZXD 1VF5C 3BT2L 3FFCE 1GZHA 3GMRB 1A1MA 2R23A 2YQBA 5DXWA 1A7NH 3RVTC 1X44A 2YD8A 4JQIA 2GBVA 4ELMA 1QLEL 1LO0H 4E9TA 4F3FB 4S0HA 3FUJA 2NY6D 2WAQA 1JFHA 3F6JA 4GRLC 1UH4A 5KYWA 2PR4H 3ERXA 3HAEA 3MRJB 3SDXE 2LTQB 3VFOB 1F4XL 3ULVE 4GP8B 4O00A 3IKCA 4LQFH 3MLUL 5E2WL 3PGFL 2OTUA 2P45B 2DI8A 5DCCA 4BIKA 5I0YA 3A67L 2QT6A 5JDSA 4DZ8A 2ATKB 3BI9X 3FNKA 4KHTH 1AKPA 4L1HA 4KO6A 1UQSA 4AL8H 5KS9E 3GNMH 1NGXB 4H25A 1T0NA 4BFEA 4U6VH 3ZR5A 1PZBA 1WA2X 3PUCA 4LKCA 1M7UA 4YK4B 4ZFGH 1SVBA 1M7IB 2N0KA 5L6YH 3RWFA 4WSKA 2VN3A 3FO1A 1WO2A 1PYWA 3B37A 3CU7A 3IBEA 1T22A 4QHKI 1SZNA 5KZCB 3H4HA 1RV6X 4G1MA 5BQDA 3WTTA 3RUGB 4JZOA 4JRXB 5E8PB 1N6VA 1RLBA 4YXLL 3QG7L 5F7HA 2QBWA 2R9HD 4EI5B 3STZA 4YQXL 4HJEA 5CGYD 1NDGA 1MHHB 3ZL2A 2DL9A 1TO5A 3FONA 3D05A 3VDBA 3D4CA 4RX4D 2IH1B 1GPOL 1NL0H 2EDJA 4KNQA 3GO1H 4D9RD 3SDDC 2OSXA 4XNQA 3D6GA 2WXOA 4U1GB 1BAWA 3FU3A 1K8IB 4MTMA 4XNAA 3S8GB 4IOIB 3QE5A 4WUKH 1NFDB 2VH5H 1WCQA 3NZ8A 4LPVA 5J1AA 1UHVA 2ZNXA 4PTUB 2I60H 3O4OB 2VAAB 3PCYA 4KUCF 4QPEA 5FGRA 3NIDE 5JOFA 5DS8B 2VOTA 1BZ9B 2IOIA 5F8RC 1KCVH 4J1UB 3VSVA 3WYRA 2OAAA 2OMVB 3MJ7B 5CKGA 1OQOA 3L3JB 4G5AA 1SXZA 4N0CD 4YHMH 5I19L 5FDWB 3LKNA 3VG0H 3SQOL 4Y2DD 3TT1H 1DBML 3FU7A 4GO6B 2YEQA 4CGTA 1XGYH 3BWAA 3Q1SH 5F1SA 5CEZE 4LLWB 3F64A 2OW7A 4HBCL 3BCFA 1GSMA 5AKRA 4ZK8A 2OL3L 4ZW7A 2XWBA 3WJJC 4DP6X 2E74C 4UTAL 1S78D 3FU5A 1TUPA 4FYSA 1ZLWK 1O9VA 2AXFB 5JLZB 3T0XA 2QSCH 4HFWA 1ZIAA 4OD1L 2NYKA 1V3JA 5EBWA 1JGVL 2V5RA 3D39B 1NCUA 1JHTB 1A7OH 4P46B 3OJVC 1CVRA 2QZQA 3L3KB 4CU7A 4C8XA 5C0IA 2WLIB 2QTEA 4X9HA 1WIPA 3BSHA 2R2HA 2LABA 4YL9A 1TQUA 3I6GA 3EW3B 5LAPA 3DBXB 3DDFA 3OMAB 2GI7A 2XZQH 5I9QB 5AB1A 3SQBB 5JXED 3G5XB 2I25N 2ZIDA 4WJ5B 3RX9A 4QWWC 3NFSH 1QNIA 5FF6B 1XB3A 2Y06H 5F6HI 1F97A 2AQQA 3GRWA 4MD5B 4RZCA 5IV2B 1GYCA 3EOTL 1QQDB 3MUZ1 4HG4J 1IAMA 2OXGB 1WFJA 5DWPA 4Z7UB 3CFBB 1XF2A 4TUOB 5ADPH 3S7GA 2EE9A 4AK2A 3RX7A 1YEHL 4XXWC 4WFGD 4OSUH 3X17A 1U58B 2WN3A 4QRRE 2R69H 3MPCA 3U46A 3LXUX 2MQ0A 3OXRA 3HAEG 1I8MA 1L9PA 2ZXDA 1DCLA 3U36A 4OH2A 4ZPTB 3TZVA 2Z0BA 5DURB 3S5ZA 1HHGA 3FUEA 1NGYB 4UDTA 2IQAB 4QRAA 1BBJB 4OZHE 5FEBA 1XGTA 5DRWA 5BZDB 4OJFL 2H26B 4ATTA 5F3BB 5JW3L 3L5JA 4D0CA 3U6RB 3I75A 4PY7B 4UILL 5BXFB 2NY2C 3AG1B 3V4VB 1JZDC 2GYSA 3P0YH 2D7NA 2FZ3A 1N5YL 2XPZA 2COVD 2CIIA 3BWUC 2FEDC 3H2WA 5J12B 1CLYH 2RAMA 1O7SA 1ASQA 2PXYD 3QWQB 1S7WA 4NS0A 1QA9A 3BQUA 3FUMA 2FYYB 1ET8A 1CE6B 1A6UL 4WNQB 2Z31C 5FYKE 2UWEE 4YE0A 3TO4A 1ZANH 3QEHA 3FQ4A 1RULL 3VH8A 1E43A 4Y1AB 4MJ2A 2QEJA 1MJ8H 1RURL 5FHBH 4XI5C 3VB8A 1BIIA 1WF5A 1CD1A 2V5MA 2V7NA 2X1PA 3FMGH 2EEBA 2V5TA 1A3LH 4A7VA 3ISWA 4P07A 1R5VA 1OPGH 4QRSA 2VT0A 2GTZA 2EIZA 1ILSA 4MJID 1U91A 4UV7H 2DQEH 4U31A 3QULB 5C07B 3UPRB 2FCBA 3O41B 3GJFA 5IBTH 2N3JA 3MBEC 4D0DB 3REWB 5D7JC 1WBXA 3MBWA 2Q86B 1GGYA 4ETQB 2WZ5A 5C8JA 1XBDA 4LHJB 5IB3A 4GW4A 3AY4C 5T3XD 4H20H 4BCYA 4R7NB 5INDB 4IDJL 3TBYA 1TZIA 3FBKA 3ZE2E 4HKJA 1BVKA 3WBDA 4KXAA 2VLRB 4Y9FA 1AXSB 4GRWH 4HEME 1LMIA 1XB8A 3FSZA 1MQ8A 5DHVA 2GJ6E 1BLNB 4BEIA 2BP8A 5KVMC 3D18B 3GXFA 3LD8B 1ZDQA 1OK0A 3D30A 3AT8A 5CCHE 1BZDA 3BH8A 4Y4FB 5TQ0L 2W92A 2A2QT 3RHWK 1AZCA 1OTTC 2VLJD 4NXSA 5KN5A 2BHFA 3IAGC 4ZQKA 2LT9A 3F7PC 2R2BA 2FBOJ 3FZUC 3VMNA 4KKAD 1H8LA 1NCDL 2H7WA 4G7VL 2CO4A 1SOKA 4QUOA 4Y19A 3VMPA 1KBGL 3HMXH 4NPJA 4AE1A 3RWEA 2VQ1A 4KH2A 1SDDA 4XMPL 4B9YA 1UB6B 4DGIL 1DVQA 2DJ4A 1K6QL 3K7UA 1IGFH 2GT9B 3UC2A 3W56A 4AY0A 3HE7B 4E0RA 1JNLH 2Z7UA 3TT3H 1MCBA 4ONGL 1E9PB 1OZTG 3C60B 3EBAA 4L2LA 4ZTEA 4HSCX 2OLDA 1IAKA 5E9DD 3EBGA 3PLYA 4F5CE 2V9RA 1JPST 4XMXA 1A1MB 2R23B 1ZHBA 2JJTC 4L8SC 4RA0C 5LBVA 2ZOOA 4ELMB 1XD1A 4FFYA 1CDGA 1L6XA 4OZGF 2FSEA 2DI7A 1LWHA 4HUWA 1QR4A 4GKLA 2ADFL 3W81A 5CCJA 5HI5C 3HAEB 2EIDA 3IKCB 2OTUB 3E9UA 4B3VA 4UQ3A 4L3ED 1RVFH 3UAFA 5JDSB 3N85L 4DZ8B 5CEXA 3NACL 1MAML 1D9KC 1UQSB 4U7SA 4BQ9A 2B15A 1T7WA 5GS0L 1L3WA 4NZTL 4RGND 3ARED 4H25B 4FNSA 4OF6A 4XNZC 1I53A 5JORA 3DO7A 3NFPA 1CGSL 1BHGA 1G9NC 1RL1A 2EUXA 1K3IA 1ZPLA 2DZEA 4WQOA 4ZT1A 1MVUA 5I1GL 5L7XL 2YJQA 4JKKA 2VDNB 3NIGB 4FLOA 1AQKH 2I5YH 3RWFB 4P9HL 1YEEH 2QFRA 3ECWA 4I3RL 3FO1B 2ZOWA 1PYWB 1T22B 1MLCA 3TA3D 3BEVA 2DQFA 2VC2L 4G1MB 5K39A 4JK0D 5H2BA 4LSTH 2BSRA 1PX3A 1UWGH 2AVFA 4JZOB 4UWQB 5FLUA 3MLVH 1JHLH 1EZVX 2KI6A 3DMMB 2HSIA 4GRWF 4XHJD 4PJCA 3MNVA 3VH8G 1M1XB 3STZB 2WTPA 1G7PA 3LNHA 5BS0A 1L9NA 3K8MA 2VISA 4X9FA 3FONB 2Q8BL 4XMZA 3KPLA 3BW9A 4X9BA 1NMAL 2B59A 1FFQA 1GC1C 3V6ZA 5JNYA 4K4KA 3ZDZB 3QUKA 5SWSE 4XNQB 4OF3A 1SXNA 2Y6TE 5T5FA 2Q8AL 3WMPA 3QRFM 3JTBA 3VXSD 4H1LA 1KLUA 4I0PC 1NCBH 2CO1A 5IQLA 3K6SA 5J1AB 1ZIBA 1RIUH 2YD0A 3S4SG 4YS4A 1PL3A 2QMJA 1VPOL 4N85A 2GY7B 5E99H 1NIFA 5JOFB 3KYKH 1BWMA 3FF8A 4XB7A 1K5WA 4YO0A 3TYFA 2BOCA 4FP8L 1MXGA 3CZKA 3LKNB 3ZDYB 1V10A 4L8BA 3FU7B 4DK6A 2EKSA 1FYTA 3A24A 3BWAB 4H8PA 4K15A 2YLHA 4RX4A 2N01B 1ZEAL 2XWBB 3H4FA 3D4GA 1NANH 5JPNC 1E67A 1N64L 2O5XH 1MFCL 4HFWB 2X4OB 3LDBC 4AEFA 5HDQL 2WSDA 5EBWB 1WD8A 3T1FB 1F5WA 3KPSA 4JGNA 3HG0A 5C6PB 2J5LC 2ICWJ 5I6MA 3JVGA 5C0IB 4FQHB 5KEZA 1XL4A 4MZ3A 5HGHA 2R2HB 3U1PA 1AVAA 3LEXA 5J9PA 1EZSA 5TPWH 2UZIH 3GTNA 3I6GB 2QV2A 4FKEA 1J5IA 4M6OL 1I1YA 4XMLL 1C16A 5C0AD 4ZUWA 2WVVA 2R0LH 3ZTCC 3US1A 2EICA 3OAYK 5AFAA 3BKMH 2ZF8A 2JKTM 1BZEA 3A6CL 1P1VA 2NY3D 4PJ9D 2MHAA 2RGSA 4LQ1A 4RZCB 3VRJB 3B9KA 2Q76A 4EQ2A 4JFYA 2XXMB 3V7AG 2XCMC 1O7VA 4Y89A 4NDMA 2G3ZA 5EC1B 1U3NA 1XF2B 4N2FA 3ZX1A 3D48R 3K74B 5I1HL 4IS6A 1CU4L 3ARZA 5AB9A 2J43A 2V8LA 4Q89A 1SGKA 3QH3A 4LARH 1CDIA 1DUYA 3U46B 3QCUL 2I32A 3OXRB 1I8MB 4JHUA 3VGDA 3D9AL 2RQEA 2ENPA 3TZVB 1B3IA 2DI9A 3CXHJ 5CUSL 5AW7B 1HHGB 2C1PA 2JKSA 3NCEB 1AMXA 5ABAA 4FI7A 3FCTB 1XGTB 5DRWB 5B38A 1R0AL 4PP2A 4D0CB 3I75B 4H0HB 1O5PA 2XTSA 1O6VA 5D1XD 2FZ3B 3QP3A 3VXRA 3W5NA 1DJWA 5CILH 3VGHA 3GJFK 1R47A 4WVRA 3WOVA 4NSKA 1FLRH 1QSFA 4AEIL 1S7WB 2F19H 1R75A 1QA9B 4PG2C 1DJYA 2W91A 3DJTA 3BQUB 3QHFL 2QQKL 4OFDA 3NG5A 3TO4B 3EGDA 3MLYL 3QEHB 2JH2A 3VH8B 3MUGA 1GTFA 3VA2C 4H40A 1BIIB 2EDYA 1CD1B 2V7NB 4MVBD 2CQVA 4MS8C 3WNLA 2F5AH 1R5VB 1SYSA 3MAWA 3Q3GA 3KM1A 4ORGA 3D1MC 5B1KA 2GTZB 2EIZB 1U91B 4MMXC 2VXUH 1OTSC 2WXFA 3GJFB 2EEAA 5KW9L 2IPTL 1WBXB 4K3JH 1U6AH 2F7IA 2HJLA 1NCOA 2I24N 2PWFA 2XN2A 4OCRL 4GLRH 1PAZA 1CPUA 5TTRA 3LRMA 2Z35A 5IB3B 2HFTA 4GW4B 3TBCA 3KPNA 1V7NH 2AK4D 3U7WH 1TJIL 3MGTA 1DJXA 3IYLW 3PWPE 3C87A 1L0YA 1TTBA 4LPTA 1DJSA 3FB5A 1TZIB 4YDKL 1RUKL 1JTOA 4KDTA 1MEXL 2QR0A 4HKJB 1BVKB 1T4KB 3JUZA 1JYXA 4OJEH 1AHWC 2J6EH 4HJIA 2HMIC 4TNVF 2B2XH 4HYTB 5DHVB 4I0KA 5EU6D 2YZ1A 4F27A 3ATAA 3PE9A 5ID0B 4MJIA 2MQ3A 3MRKA 4FFWC 4AM0A 3G6DH 2WXKA 1XH2A 3GBMH 2WXMA 3BH8B 3T0ED 4FQXC 2PKDA 2DOCA 3BH4A 5I17A 2MSPA 3GLAA 3C8KA 3DOSA 1L7IH 1G87A 2PO6D 4PRID 3AGVA 4G8GE 3FTZA 5JW4M 1H3VA 1W72L 4MBOA 4ZQKB 3QPXL 1IIKA 3K4AA 2XSKA 4Y19B 1RZJH 5C08E 2DL2A 2VQ1B 4GW5A 1S7SA 3RWEB 1UM4H 2CCLA 3IK2A 4E0RB 1IAOA 3BOVA 1HCYA 3QORC 4DEWA 4G6JH 1TPXB 4N2EA 3P0VH 3QDHA 1ILUA 4WI7A 1IAKB 2P49B 4IKIA 5CD5D 3LZOA 3MREA 3GZQA 4K94L 1ZCRA 2EIEA 3MV8E 4OF8A 1HSBA 5HHQA 3D0LB 1TNNA 5BJTB 1ZHBB 4NUGH 1IBGL 4HISA 4XC1H 5D5MB 3KLLA 1YEIH 5IKCA 1VGKA 2FSEB 3MA7A 1J5CA 1QRNA 4DP2X 1AS6A 3BIKA 1DSYA 4HUWB 4KTEH 1HDMB 4RSVA 5AUMA 1YPZE 1HOCA 1RZPA 3AG2B 1D6EA 2GHZA 3WKQA 2ZP0T 1Z3GH 5E70A 2VL4A 4Y2NA 3WJLC 4UQ3B 4KRPC 2WLMA 1OGPA 1ICTA 5CEXB 2C3VB 4FNTA 5IIEA 3KAAA 2R0ZL 5EB9A 3BD4A 1FGVL 2YGPA 4OBRA 2XFGB 4HUKB 5FKPB 3KR3L 4S0SD 1DSFH 3T6XA 3HTLX 1S3RA 5JORB 3DO7B 3L3GA 3NFPB 4JJHA 2Y7MA 5CGTA 5E9DA 4XBPA 1BX2A 1MVUB 1RHFA 3G5YA 4QTFA 3RY4A 1Z0MA 3ALPA 1AXTL 3BZDA 4IRZA 2EH7H 3CSBA 3O45A 5KSVA 1PEZA 4R0LA 4YLCA 5E6IC 2YK1L 2DQFB 3BEVB 4CVUA 3T4AB 2BSRB 5GZND 3BP5A 2B0SH 2EINB 2X2UA 1CO1A 1SY6H 1G7PB 5BS0B 1MCIA 1DTUA 2VISB 3W39A 2VLME 3AFLA 3KPLB 3WD5L 3HKZA 3BW9B 3AREA 2FIKA 2ZCKL 2B59B 3K71A 5JNYB 4AQAA 2W94A 3QUKB 1HHJA 1JWUA 4HWBL 2NY7H 3M7FB 3FT2A 3VNYA 3IDXL 1Z0NA 3GHBL 4H1LB 1KLUB 3NEEA 1I1CA 3G04A 1CQKA 3KZ8A 5HVWA 2WBXA 1UT2A 1YCSA 2XOTA 3RZCC 4DW2H 5BMFH 3K6SB 1KN4H 2P80D 2JJVA 5E2TL 1NGQL 4XN9A 1MI5A 4Q9BA 4HC1L 3TA3A 3HZYB 3H9HA 1FNLA 2TAAA 4YO0B 3TYFB 1AZNA 3MNZB 5ADOH 2BOCB 1E8XA 1KLGA 1J12A 4FQPA 4M6NL 1I85A 2ZWZA 3LRHA 1KPRA 4L8BB 3LX9A 1QBMH 5GS2H 5K9OB 4M7JL 1DSWA 3TA4D 2EKSB 1FYTB 1I9EA 1RUQH 2YRZA 3ABZA 4DPRA 2CPUA 2ZX8A 4XOCA 4XB3A 3UTTA 3O6MH 5H37H 1YECL 1RERA 1DVFD 4YHLH 3MA9H 1PLGH 2JMRA 4QTIL 3QEGH 5DT1L 1QKZH 3VXSA 3EBIA 3KPSB 2PCXA 3A5VA 4U0RC 2PCYA 3M17A 1OCOB 4KX9A 4HK0A 5HGHB 4UBDD 3EKCA 3LEXB 2WC7A 5J9PB 2J4WL 1C1EH 1MVYA 2X12A 4XHQA 1TCRA 2VUYA 1I1YB 1C16B 4ZUWB 1QATA 4P2CG 1S7RA 3O81A 4PRPA 4E9LA 3EJZC 1N2RA 1QABA 4H8WC 4XPHH 3DX6A 2B16A 4UQ9A 3B9KB 2Q76B 4HULB 4CJ1A 4JFYB 4IOSD 1N6QH 2Y5TA 4J2XA 3QUZC 4FTDA 2A0LD 2DY2A 4KJPD 4NDMB 1UASA 1MN4A 3L5WA 5FYKH 4K5MA 2X44D 4IS6B 1GY1A 4PIBA 2WM0A 2P5ED 3NSXA 1S5IL 3ECVA 1DUYB 4ABVA 4ALAL 5AB2A 5IJVA 2DWSA 4ZI8A 2A9BA 2OR9L 3N91A 4I1NB 4ZFOL 4I9WE 1IFHH 4P04A 5KBMA 4GSRA 2C1PB 5C0AA 4JFWA 2QSTA 4G5ZH 4L3FA 1RPUA 2YFNA 5DO2C 2Y6SC 4UM8A 1LDSA 1UT9A 2DQIH 4B95C 2VSDA 3UFIA 5B38B 2ZJSL 4JFDD 3CDFA 4PP2B 1TJHH 4PJ9A 4HIJA 1ZJBA 4JG5A 4WGWB 1KZQA 4PJ8D 3VXRB 2C9PA 4NJAH 4JG1H 4NSKB 5GSRA 2B1AH 1QSFB 2BY1A 3SJVD 1SJEB 4PFEA 5FO2A 1IM3D 1HZHH 5KANG 4WWOA 4RMQA 4LIQE 3VSUA 2GJJA 3BO8A 1YYMH 3EGDB 5I5JA 1AG6A 1G1OA 2IAND 4YHNA 5JHLL 3MUGB 1FWXA 5BO1H 5I1CL 1IGML 3ZK0A 1RJYA 3FTWA 3UYPB 4ANKA 5EF3A 5FLVA 3OG6B 1S46A 1MRDH 4IBSA 1CDHA 4MHHG 4NENA 1SYSB 3AAZB 3FL7A 4X80H 3Q3GB 3VI3F 4X4YA 4IEFB 1LO4L 1OP9A 4ORGB 2P5WA 1OAUH 2H0EA 4PWEA 5DWUL 4JRWA 1DQDH 1FL5A 1T0PB 4MDIA 2ZUSA 4KK8D 3QXDB 5D1XA 5F9JA 4CC1A 1KCWA 2HJLB 3AZUA 3BDXA 4H0IA 4KMLB 4YDLB 2F18A 5F9OL 5E9NA 4WKZA 4Y5VC 2Z35B 2KT6A 4MZRA 1C8QA 4PJIF 4ZTPH 3SPGA 2OKMA 2Z7ZA 3NAAL 4U3HA 3MGTB 1JTPA 4OZHF 3L9BA 3WIHL 1VENA 2R4RL 5IB5A 1QMUA 1WAAA 3E6HA 3IMVA 2QR0B 1PZAA 2HKHH 3ORJA 4HJ0D 3K8KA 3P77A 4AVIA 1LNUA 1UD6A 2ADJA 4Q2ZA 3DO3A 1F45A 3ARDC 3HNTL 4UQBA 4MMYA 2OL3A 1UACH 3LSOA 3LEYL 4MJIB 4UTAA 5F2FA 4AM0B 1RK1A 5JZ7D 5E1AA 2VW4A 3GI8L 1MCRA 5I17B 3NJKA 5EIQA 2K45A 3BDYL 2F1BA 3C8KB 4JREB 5E2UH 5JO5A 1UKQA 4XVSH 3DOSB 3H3PH 3WFCL 1A3RH 4A2FA 4EIGB 2QGBA 2HRPL 4DVRL 4KQ4L 1V3MA 2FJSA 3D4ZA 3GS0A 3IMWA 1OTUC 4S11A 1BGXH 4W9CC 43C9A 2G4EA 2C9AA 1E27A 4GW5B 4M3HA 1S7SB 1I8LA 2VO8A 2EE6A 5L9DH 1IAOB 4Z77A 5EUKB 1A14L 5DZPA 2YPVH 2NCMA 1E8WA 1T7XA 4CL7A 2ZXWB 5BOPA 1KC5L 1KJ2H 2L8AA 2P3YA 4FGMA 4KBPA 5B22A 5C0NC 3MREB 4N1CA 3W38A 2VDPH 4GQRA 5HHQB 5ESQA 1HSBB 1FAIH 4Y5XA 1D7FA 4MCZA 3LJ3A 4QAMB 1FI8C 2FQFA 4HCGA 3W9DA 2WNKA 4F8LA 2CWRA 3DVNA 2YSTA 3K6OA 1PMYA 5IKCB 5DUMH 1VGKB 2PO6A 3MA7B 4NZUL 4BRVA 1QRNB 3BIKB 4ONHB 3B9VA 4DGYH 2HXAA 4JFFB 4UQCA 5I15H 2ETWA 2Z9TA 4OGYL 2HT4C 1D6EB 2R29L 4N8CH 1EH9A 1BLIA 2UV3A 4N8VA 2BJMH 2O5YL 4KY2A 2XN9E 2PW2B 1TSHA 1WK0A 3FTGA 3REVA 5IIEB 5D1ZD 1S9WA 3QCTH 1EK3A 4JKNA 4S1SL 2AJVL 4ZFZA 5IQ7L 4TL4A 2DMBA 4N8UA 2GITA 1IB5A 3V7MA 4P3CH 4BFGA 5F70A 3L3GB 3RYMA 4R4FL 3RGVD 2OULB 5E9DB 3LN4A 1KCLA 4P5TC 4XBPB 3V8CA 1BX2B 5DJDA 3X3FH 3RTQC 3G5YB 1SOSA 5C0FB 3W11C 2H6PA 1E4JA 4NP9A 4CN6A 1EO8H 1GHFH 1I75A 5I6XC 1YN6B 2CBOA 2J1KA 5ITFA 2DAVA 4NRZA 4AG4H 4PLOB 5KSVB 4R0LB 5K5YA 5F72S 3MRLA 4FQQA 1XH1A 1RZFL 3BP5B 4G82A 2EVIA 1KDJA 1G9MH 4GUPA 3ML8A 3U7YH 3JTTA 1NEZA 3MRFA 1JF1A 1EX0A 3NJHA 1WGOA 2J55A 5ALBH 3IM1A 3W39B 1YMMA 2JV6A 4FOMA 2DQHH 1JSYA 3AREB 2FIKB 4X4KA 2RCSL 3K71B 4AQAB 4Z3HA 3UDWA 3T4YB 1HHJB 1JWUB 4LP5A 2WKOF 2HX7A 1QR1A 1A7NL 3CBRA 1LO3H 3QZNA 4PJBA 3G04B 4OCLC 2XV6B 4A38A 4HCRH 2AS5M 3UABA 3ARRA 4RDQG 3K80A 5IJKA 3ZTJG 4X9GA 4AUUA 4KOCA 4L9LC 1MI5B 5CIPA 3QJFA 3TA3B 4F37K 2X9XA 4KKCD 1RH8A 2NX5E 3H9HB 3MDJA 5KSAA 4W9HC 2PYFB 2YRPA 4MDJA 4PVMA 5GSVA 1KLGB 3WGVB 4I77L 4LEXH 3L3IA 3C5SA 4K71B 4AMXA 1KPRB 3O6FD 2YAEA 4K7PH 3MFFB 4D9QD 2UUDK 1BF8A 4PV9A 4U6VL 2G5RA 4W9KC 4N8PA 3UTTB 4M5TA 3TV3L 1BCIA 1VB9A 1L9RA 2D4FA 3IAQA 4FJ6A 1S9YA 1RK0A 4F15B 2C9QA 1OAQH 3WKMH 4ZFGL 3PGCA 4O58H 3VXSB 1MFDL 4NO0A 2VR5A 4OIFA 3QR0A 1FF5A 1X5GA 3NJMA 2P80A 3M17B 2WO2B 3CC1A 3LNDA 2RTTA 4HK0B 5M94B 3QIWC 4NKOB 2R9HC 2Z92A 2RACA 1TCRB 1MH5A 1HNFA 2GTWB 5EZOL 1I7TA 4XNMB 2WQUA 5FYLD 5ILTL 4A7GA 1S7RB 3FT3A 2IDFA 2XVKA 2YD1A 4XC3H 4BSJA 3GSQB 2J2ZA 4PRPB 5AAMA 1ZT7A 1N2RB 1OHZA 4JGUA 3GO1L 3DX6B 2AABH 2VSKB 3K2UH 4DAGH 4OB5H 4HXBH 2AVGA 3SHSA 2Y5TB 2YXFA 1AHKA 2XN0A 1HAWA 1QLEB 4POZD 3MLZH 2YR3A 5KYNA 3L5WB 4ZOBA 3TXAA 2CU9A 1TZOA 4XMKH 1OP5H 1XSOA 1IMHC 4BFFA 4P4KD 4JHBA 4JFQA 4C56E 1VSCA 3HI5H 4I18A 5IJVB 3HUJF 4N0CC 3B2DC 1T0MA 2ZCHL 4WNJA 3PL6A 4WV1A 1PJ9A 3V6FB 2NW3A 5C0AB 4EBQH 3TT1L 5CP7A 1FNFA 2IXQA 3LAFA 4UM8B 1RPKA 3FU0A 4L2YA 3CH1A 4LDEB 1LP9F 1NOAA 2VKWA 4PJ9B 3BAIA 4HIJB 1L4IA 3L5XH 2ADYA 2CM6A 4LMQI 3SDCA 3BT0A 5GSRB 4JAMA 1F90L 2ZKYA 4OJYA 2OYLA 4Q6IC 3V95A 3JSSA 4G70B 4V1DE 2BNRB 2LHAA 3FTUA 4IGBD 4MXQD 4PH8A 4AUJA 3ROOA 2H6UA 4GSXA 3BO8B 4WY7L 4KV5F 5JXEC 3VM7A 4P2QA 4LSQH 3G6JE 4L4VD 3RAJH 4YHNB 2XZQL 4JM2F 4NX0A 1JNNH 1NCGA 1RJYB 3BAJA 1TQCB 2H2SD 1A6ZB 1HN1A 4YSRA 4R97C 3FAXA 4NENB 1E90A 3OHXA 4X4YB 4RDBA 2P5WB 3MXVH 3ZMEA 4X6DA 5E4OA 1E9OA 1FL5B 1U3HA 4MDIB 4XVTL 1VZIA 3OSVA 3IFPA 4HGKC 5D1XB 2EXSA 3F05A 4PJ8A 3ZIMA 5F9JB 4M7LL 1PEWA 4WKZB 1FIGH 2Z4QB 5AW3B 3SJVA 4UAOC 1UA6L 4Y4HC 3O0RL 2GIMA 4UM9A 3TESA 4Y16B 2D31A 2CR3A 3F7VA 4QAWA 1U3ZA 1MCPH 3E6HB 4X7EC 3VD9A 3KXFD 5DMGD 3H0TB 5TE4L 2F08A 2X0VA 1MIEL 3P77B 4HT1H 1IGJA 4S1QL 1LNUB 2ADJB 4Q2ZB 5I5RA 3IRZA 1DEEA 4PM1A 5KBKA 2VDMH 3HLKA 3IPBA 4MMYB 2OL3B 4R2GD 3LSOB 2QQLH 2JI1A 5EUOA 1RK1B 3SCMD 1BZ8A 1ID2A 5E1AB 3P4MA 3QRGH 3LNGA 1BEYL 4KY1L 3N55A 4ZSOA 4UZSA 1CLYL 3U0TA 3QIUD 2PCFA 4XX5A 3EF7A 1CGUA 5IB2A 3FB7A 4LNRA 1R3IL 1ZK5A 2WANA 3CVBA 1MZZA 4FQCH 4HUNB 3SD2A 1E27B 1W6WA 3PWNA 1ZANL 3ATDA 2J8UF 3N1PC 2EVJA 3R06B 1MJ8L 2WTRA 4AVJA 5FHBL 4XO3A 1FGNL 2IG2L 4IM8A 1TMQA 4HH8A 1UWEL 4PQXA 1OPGL 4LXFA 5BRZD 2A74A 2NR6A 1A0QL 5GGTL 4UV7L 4WFHD 2XFXA 4MXWL 4XMVA 1QI5A 4Y5XB 5AAWC 4MCZB 2WQXA 1XH0A 3W9DB 4XPFL 1DANU 1TITA 3DVNB 1FHGA 1K4CA 3EUDA 2B4CC 4J3OD 4Q6KA 1T66D 3OKYA 4FHKA 5AW9B 5KVDL 2PO6B 3VD5A 1DQTA 4NFCA 1TFHA 4MNGE 4BZ1L 1TTRA 3I9IA 3NJLA 3PPEA 3SE3A 3V0EA 4YHIA 4N8VB 3C5ZD 1MCSA 2VTFA 2YQGA 5HJBA 4ZUSA 1NIBA 4ES8A 1YHPA 4GSDH 3V7AE 4Q9RL 5FUCC 3GDCA 3FTGB 3UO1L 1PD6A 3REVB 1S9WB 3P9LA 3UPAA 3VWKA 2CG9X 4M43H 4MD4A 1SF3A 2PN5A 2GITB 4XCCH 1A8ZA 4HD5A 4GUQA 3F85A 5DTFB 4AQ1C 3LN4B 4JKWA 3PHOA 5K9QG 4PAZA 4KVCH 4JQVC 1LO2L 3C5XA 4MAUL 2W0FB 5DJDB 4ZFQA 1RZKL 5F3HA 4OZIF 1T80A 1TTAA 2H6PB 3VD2A 1CBVH 1H15A 3PREA 2DDQL 4RFEB 5EIIB 5AZUA 5ITFB 4NRZB 5DLMH 4DETA 2WWMD 3EDDA 3JWOH 1MCJA 2NUPA 3MRLB 1FE8H 1U8IB 4FQQB 4JY5L 3HMXL 2VMCA 2Y7QA 1EANA 1WZAA 1GGIL 3HC2A 1OP3K 4GUPB 5E00A 3MOAH 2Z1PA 1I4FA 3JTTB 2APSA 1NEZB 1JNLL 3MRFB 1JI2A 1JF1B 1TQBC 4DPBX 4OM0L 1YMMB 1L7TH 3CLEL 3CQPA 2Q87A 1F1GA 3WNMA 3P2DA 4M7KH 1CFVL 4TMPA 3MJWA 1YPZF 3DTUB 2Y2WA 4IU2A 3US0A 2CLRA 1QR1B 1BFOA 4H26B 4PJBB 4PEEA 4Z8FH 5F6IB 3QFDA 4PJCE 1UATA 4Y5YB 2E75C 5D2LE 1DUZA 4W4OC 4OQ1A 4XBGA 2CUMA 4OGXL 5CIPB 1IEHA 3QJFB 3TX4A 4PJXA 4BELD 2YAQA 4M56A 1L9SA 4NKMA 5KSAB 5GGVL 1FH5L 5GSVB 5GS1C 3WHE0 4AQ8A 4QXGH 4RGNC 3LIZL 3C8HA 4CBPA 1DCEA 4YOKA 1FZKA 3NCBB 1UA7A 3FCBA 1B0RA 4LP8A 3VX1A 1I9JL 1EHLH 4AJYV 3U9WA 4PV9B 4GIAA 1Z1WA 3KNBA 4NUQA 1CGWA 3UJTH 4JPKH 1T2QL 2UZXA 4EN3A 4N3UA 5FCUL 1S9YB 3CSYA 1UOKA 5IUCA 1RK0B 2ENYA 3O2VL 5HDBE 3KPOA 3Q2CA 4WRLA 5DD5H 3RWCA 3PGCB 2G2NA 4NO0B 1YEEL 3IB4A 5JW4Q 1W72A 3UTZA 3SGJC 3P1VA 1ZLWH 3LS5H 1CICD 2BSSA 3IDYC 3MRPA 1IBHA 2AZUA 3ARBA 4XHJC 4MCNA 2GBAA 1UWGL 3BVXA 5EF0A 4FQIH 2Z92B 4C47A 4G6MH 2D7OA 5LNEA 3TU6A 3MLVL 3WJMA 1J1PH 4DGVL 1MFEL 2QQQA 4KO7A 1CLOH 1C08A 1I7TB 3CV5A 2VQUA 4M7ZB 3T2PA 4D9RE 2AJSL 4PJ7A 4ZG1A 3F7LA 4HH9A 3FT3B 4XPAH 3RUGF 3PS6A 3R4RA 2IDTA 2J2ZB 2YLKA 2F61A 1TDQA 1ZT7B 1FSKB 4PLKC 3AT0A 3HNVL 4M1CD 1JZ6A 2F5BL 5CZVL 1LLAA 2R1XA 4LSDA 3I9GH 1ROWA 1ZTMA 1FP5A 4BH7A 4YHYC 1HL4A 2WLNA 3AQYA 4ODTH 1QSZA 4TSBL 5HDRA 1MY7A 3SBQA 5B3NA 5E99L 4NZFA 4XNUH 4JFQB 1BQHA 3V4VH 2ZXQA 4BUQA 4HJ1A 1NFDF 3PQYB 4I18B 3X1NA 3KYKL 2B1HH 5EDXA 1T0MB 1QWNA 3B2UC 2DMGA 3MJGX 1A8JH 3PL6B 4MLSA 4ODBD 3Q48A 1SBBA 4KMTH 5D7SH 4P2YA 5JHDD 2NW3B 5CP7B 5AVVB 2OXHA 2IXQB 3WKPA 1MAKA 3UC0H 2J88H 2CMRL 3D25B 3CH1B 3VGAC 2LLGA 3DOIA 3QJUB 2O5XL 3DK0A 5D2NB 2AQNA 1U0QA 3SDCB 3JV4A 4JRYB 4JR9H 1M57B 2YUXA 3V4PA 5EC2A 5CJXC 3DX3A 2CBMA 4Z0XA 1BP3B 3GSWA 5IVZB 2VC2B 4QT5A 2FEEL 4WO0A 3UTQA 1OAKH 1WAPA 5TQ2H 4FJZA 4TPRH 4MCYA 6TAAA 1YC7A 4P2QB 4UTBH 4IBYA 4FG6D 5ELIA 4KKNA 3CBJB 4U1LB 3P3RA 5MEQA 3CK0H 1IGTB 1TYEB 4JM2C 1HEJC 2X6AA 5TF1H 2XQYK 2OMWA 3OHXB 4OCNC 3WIAA 3V9CA 1TU2A 2BZ7A 4HSQA 3EJYC 4X6DB 4P5MA 5K1NA 1E9OB 1MFBH 1U3HB 4HWBA 5I0WA 1UD3A 3UTPD 4RISL 1Z66A 1J1OL 4WFGE 2PR9A 2X4TA 5F6HJ 4TS6A 4PMEA 4PJ8B 3QXWA 5I18L 1QX1A 4DOHE 1I31A 3NCCB 3SYOA 3VM5A 1PKOA 3FHAA 4L0PB 3C75A 1JV2A 4IGBA 5JPMA 4UM9B 4Z7UF 1DQIA 1J1XL 2D31B 2AK1L 3F7VB 1ID5I 5DS1A 1JGDA 2LW3A 4L3AA 4JG0H 2GJRA 3ZPDA 1S9VA 5DC2A 3O3UN 3L9RA 4WUUD 3CMOH 2XQBL 1KEGH 3JT2A 3VDAA 5FHAH 4F20A 5HHOD 5GJTH 5DF0A 1EO7A 4JFEA 4BQ8A 2HRHA 3ILQC 3B5TA 1MFVA 1TQSA 3TPKA 4KRLB 4ZSOB 3NEXA 4KDWA 5AG8A 3U0TB 2PCFB 1NCWH 1KYOJ 2H1LM 3R8QA 4Z3EA 2ED7A 3MHZA 3FB7B 3PDGA 4LNRB 1P9MA 3ASNB 5FYJU 3PP3H 4JQIH 2ZUWA 3PWNB 4G6AC 1MHCA 2LU5A 2XIIA 2RFXA 4KNTA 1YYCA 3RWIA 3PHAA 1FO0L 3SDAB 2YC1A 5GIRA 1URLA 1W8NA 2JFCA 5I73C 3HAEH 2H41A 1KTCA 3C5JA 3AWGA 2A74B 1WT5C 2J56A 2EILB 5F71A 5LLIC 3QUXD 1E6JH 5K1JA 1LE9A 3E0GA 3LZRA 5T3XE 1JGLL 4K3JL 2W80C 4IDLA 4K8RC 1K4CB 4XN7A 3Q8BA 2JI2A 4Z76A 2UVFA 3ALWA 3LNFA 2OCFD 2NZ9D 3QIUA 3PUUA 2J21A 3SGKC 3EADA 4GKNA 1XTLA 3HS9A 4OFPA 2WUCH 4YDVA 1BQHG 2GHWB 4YHIB 4XP9H 4GEJA 2NXZC 4RGMC 2Y1YA 4ZUSB 4LL4A 4Y4KC 3S34L 3FQXA 4ZMLA 4MA1C 2WLZA 5GZOD 1IBYA 3GPEA 4ZFOA 5JA9A 3LQAC 4JGMA 1KPVB 5AZEL 3NPSC 3BUTA 5B3JE 1I1AD 2BERA 1P84J 3P9LB 3VWKB 4EZJA 3RFZA 4MD4B 1WIUA 1UB5A 2QPUA 1IEAA 2VLJE 3TURA 5ETUA 3VXNA 2LU4A 3PHOB 2HTLD 1WS7A 3QDGD 3DUSA 5F3HB 3HE6A 4XNXH 1TZGH 2DM7A 2ARJQ 4JO3L 1H15B 4M8RA 2FWOA 3ULVL 2LV4A 5HHVL 3FN0H 32C2B 1O9ZA 4HEPA 3SB3A 3UEQA 4W9ZA 3SEPA 2WKLA 2NUPB 4IRJA 1L9QA 4ZXBD 3QJZA 1CFNA 1W80A 4OCWL 1OE2A 2NTSP 2Y7QB 2W9EH 3HB3D 5JHLA 3CZEA 3STLA 5I1AA 1X9QA 2OBGA 2G2PA 1RJZA 5E00B 4QOKA 5DMYA 1I4FB 4IHBA 3T3PF 4XWGH 1J8HD 3QPQC 5CD5C 5A2IH 3A6BH 1AR1D 1B0IA 4GO8A 3ZZSA 2GIXA 1BJ8A 5KVFL 2BSTA 3Q5OA 2DIBA 1J5OL 3KJ4B 4IU2B 4NUGL 2CLRB 3WDHA 1BFOB 1SPDA 4LVOC 3T2NH 2BXYA 3BMWA 3DX9A 4ABUA 1YEIL 1MLBA 3QFDB 5T33L 4XPBH 4CUCA 1BXAA 4L3EE 2QKIC 1DUZB 1IGIL 5TDOB 4XBGB 2NZ1A 3NZHH 4YHOH 4ELMF 4PJXB 2H4EA 1RZ7H 4RGNE 4NKMB 1R1CA 43CAA 3WTSA 2WBJA 3CSPA 1JD7A 2VJ8A 1MFNA 1N7ML 1FZKB 2ZX9A 2K0RA 2R4SL 3DX7A 3NA4A 1B0RB 4A39A 3TFKC 1KELH 2H1XA 1Y6NR 2LTQC 3AUWB 1DSFL 4Z3IA 1QNZL 3KNBB 1JV5B 5K9JL 2OMUA 2UZXB 4NEHB 4EN3B 3CSYB 3HNSH 3KPOB 3V4UH 3RWCB 3DJSA 2Y3NA 1SFDA 2B8OT 4HJSA 5DJ6A 5HYFA 1QP1A 1W72B 3UTZB 4XAKD 5GZNC 2E56A 3DHPA 3GRWH 3NIGF 3MRPB 2BSSB 4U3SA 3ARBB 2BRQA 2J8HA 3CX5K 4FCHA 4PVLA 2HCZX 3QUYD 5KBLA 4PBVC 4YK4C 2OK0L 5GRYA 3WJMB 1WUZA 3ZHNA 1C08B 5CEZL 4PJ7B 3QCVH 4GYBA 4HH9B 5CJBA 4FG2A 1JNJA 1HYRC 1MSPA 4UOW1 3JXAA 3UG3A 1PLAA 4AEHH 4JFPA 4ZMNA 4MX7B 3HZKA 1H6UA 4FJYA 4Z7WE 1JRHH 2DLGA 5EBMA 5I1EH 1A5FH 2BINA 5GGRY 5KYUA 3OKLB 3STBA 1ZV2A 2VQTA 4FRWA 3GI9L 2E76C 4MJHA 3ZDZF 1OAYH 3RIAK 1KMGA 3EH5B 1WFMA 3FOMA 1U2HA 3P30L 5TE6L 3UX9B 2CALA 1BQHB 1YN7A 2R29A 1CICA 4U1GC 1KT2A 2H45A 3V2AR 4WCYL 3DX0A 2ESVD 4MRCA 1PD0A 2EUWA 1J0HA 3L4CA 4JS7A 2NY0D 1CDCA 5MEPA 4P99A 5EN3A 5DMKB 1IKNC 4OCMC 1A7PL 1QBML 4XZUA 5JXAL 3Q8AA 5FX3A 1F4HA 2OXHB 5DR5L 2CHNA 5FAAA 2D03H 2RJMA 1DVFC 1ETJA 2NCEA 2VDKB 2XV3A 5C6TH 3V6OC 1R34A 3ZDYF 1BAFL 1SUHA 5H4YA 2PPFA 3MA9L 1E4XI 1GY2A 5L0QB 5IJCC 3QEGL 1EA9C 4J3XA 3JV4B 1P7KA 2B77A 3CGTA 1T4WA 5GRJH 5I82A 1MW1A 3GT6A 4J3OG 4UBDC 2CZNA 4Z0XB 1PSKH 3GSWB 4HEPG 4QT5B 2F7QA 3CFKA 2I9TA 2YMXL 1CXEA 1UYWH 3OX8A 3UTQB 4MCYB 2FB4L 2XICA 5EEXA 1ZV9A 3R0NA 4RMUA 3NSFA 4KUZL 1OP4A 1XVSA 2CLZA 3F6LA 1AC6A 3AITA 1OARH 1ZT1A 3DO4A 1M05A 4YXKH 4ES9A 2Z8RA 2BS9A 1VRSA 2OMWB 3MODH 1TU2B 2A0LC 4KJPC 4MRBA 4P5MB 4OF0A 4X0KA 1NJ9B 2KZ1B 1CTOA 1C12A 5I9QC 3ET9F 2CDGA 3H42H 1DBAH 2X4TB 4R96A 5CBAA 4KKPA 4OJCA 2CUAA 2AAVA 1NGZA 2J72A 4GQQA 4N2DA 4XPTH 5DHVH 3GB7A 5FYKL 1ZLSH 5L2KD 4KK6C 4X6CE 4R7DA 2AGJL 4IGBB 1JV2B 5JHMA 4LSSL 4XP6H 5JPMB 4RIRA 3NFNB 4X5XA 2VMEA 1CTNA 1GA2A 1CLZH 1JGDB 2E27H 4NQDA 5D1XE 5DHYB 1S9VB 4K55A 3L9RB 4KX7A 3DI2B 4Z78A 1X7QA 5D72H 4O2FA 2DJSA 5IBUG 3CFCL 2E4TA 3BAEH 1TJHL 1XMEB 4JFEB 2GAZA 3T5WA 4GMTH 4FFVC 1JZFA 1SNRA 3CZFA 1KEMH 3B8YA 4NJAL 5E51A 1WAAE 2B1AL 4W6YB 4MKTA 4P2RD 3CQFA 3TWCL 1BPLB 1H8OA 3EYSL 1HYSC 3BP6A 1YYML 2NYZA 2IBGA 1AYOA 4RBPK 5AW6B 4X5QA 1MHCB 1PZ3A 5J12C 5JOPD 1G7HA 3CXFA 4HAGA 3KLKA 3RWIB 4R4NC 2WQWA 1HHIA 2XXFA 2HLFD 1PG7X 2YC1B 5GIRB 1G1YA 4HWEL 4N22A 5HDOA 1NANI 1IZKA 3VFTA 3FQNA 1Z3RA 3C5JB 3ISRA 3NSCA 3MC0A 1KB3A 1KULA 3HS0A 1FC1A 3ARFB 1DQDL 3IFLL 1LE9B 2RALA 2AK4E 5IFAH 3CN3A 4JHWH 4LDLB 4HPOL 3ESMA 2P7TB 5C2BH 4Z0BL 3L1OH 4IBWA 1JXDA 4OAWA 4Z76B 4KI5F 3EH2A 3QIUB 4ZTPL 1UWYA 5IEHA 1NCNA 1MHPL 2GKIA 1YNTA 3DI3B 3KBPA 4GKNB 2YAHA 1F6FB 1WWBX 2ZCLL 4YDVB 4M6MH 3ZDXE 2NXYD 3CNKA 3FQXB 5EU6E 4Y9CA 4N86A 4ZFOB 1T89C 3EOYG 4HXAH 1H3XA 1MW0A 5D96B 2HKHL 2XYCA 3PV6A 3NT0A 3T0EE 4CVXA 3RFZB 2P48B 4ZJ9A 1UB5B 2AXWA 3X14A 4PRIE 1IEAB 5C7ZA 1LEKA 5ETUB 3HG5A 3VXNB 1AI1H 3WEXB 3IVKA 4XP5H 1GKOA 1P5UA 4LSRH 2ZYHA 3KH4A 4I0CC 3DUSB 3HE6B 1FL6A 2GW5A 3E2HC 5HI4D 3WFEH 1RFDH 2EDMA 5F7UA 3H3PL 2FWOB 1A3RL 1E40A 4NNYA 5IHBA 1PZCA 2FBRA 5EORL 2YAMA 3BIBX 1PD1A 3KBFA 4IRJB 4K23H 5A3ID 4Q9QH 1CF1A 3INUH 1CFNB 4N0YL 4FN0A 2MTAA 5LQBL 1E9QB 5HGAA 5T5FH 2NQCA 1A4BA 1MQKH 1XX9C 3MRNA 4JFHD 4ZD3L 2GVYA 3STLB 1YLBB 5I1AB 5I75C 1RJZB 5GZOA 4QOKB 2APBA 2FT8A 4NQQA 4W9LC 1NCIA 3H8NA 1PG7H 4LKXB 1RUPL 1I1AA 4LOUC 4GAGL 4LSVL 3TBBA 2NZIA 4KJQC 4N1HB 2BSTB 4F8TA 2MCAA 2VDPL 5D7LA 1JERA 4X99A 4EF3A 4KAQL 2YD2A 4H8HA 4K3EH 4LCCB 4BXSV 1CDUA 4ODVH 3KS0J 5TDPA 3C60C 1ERNA 3DX9B 3I85A 4MMZA 2WLYA 3H3KA 4JDEA 1IAIL 1U8OA 1S6NA 4DGYL 3O3DB 1NIEA 1TZHB 2WNXA 3FUKA 3HBZA 3QJHA 3RP1A 5I15L 2Y4SA 5D5MF 4X4XA 4LAQL 4N8CL 3QIBD 4PBXA 5I1KL 4QMEA 43CAB 2X9ZA 2XBDA 1O0VA 1KFAH 5D1ZC 2WBJB 4XBEH 4UINL 4NNPL 1J8HA 5DQDL 3QCTL 5KJ7E 3DX7B 2UX6A 2V9UA 4PJBE 4PYHA 3U9UA 3RGVC 5IBUB 1A21A 3BZ5A 4P3CL 4LCIH 4XWOC 4HWZA 2D3VA 3H2PA 2OMUB 4GLRI 4BZYA 3MO1A 3QDMA 3SBWA 2XLLA 3QJVB 4K3HA 3ZLQC 5IB4A 1E0OB 5ACLA 3T8VA 2HLEB 4LLAA 4K73A 3DHUA 3FHQA 1ROCA 1NMCC 5DJ6B 4A37A 3HVDA 2A4EA 5C6WH 5E8DH 2MJWA 3Q7JA 1DL7H 1G7MA 1M1SA 1P2CA 2IAMD 4U3SB 5DQJA 4B97A 3T6ZA 6PCYA 3CN2A 3PIQA 3T77A 3U7YL 2GK2A 1QFWH 2E8YA 2VMJA 5ALBL 4DTGH 2Y7SA 2JJSA 3Q1EA 2V33A 3DHJA 4JFPB 1ZGLP 1NUGA 4F93B 5GGTA 3HZKB 1UFGA 1Z9SA 2IWEA 2X9WA 2ZWSA 3DMMC 5I8OL 1WZ1L 4J4PA 5EBMB 4NYLA 1MFAH 4UU9A 5KYUB 1EHAA 5CJQH 1A9BA 2VW7A 5E1HB 3ULVD 4Q6YA 1L0QA 5F8QC 2DQUL 1CLCA 3L1FA 1CQYA 4O4YH 4DIXA 3FOMB 1TJGH 4BZ1A 1YN7B 1W91A 1KT2B 2I7OA 4ZAKD 2IGFL 3KVPA 2I27N 5DUJA 4HOXA 5AW1B 3C12A 4I2XE 3RJOA 3IJ8A 3MROA 2VL5A 5FM5O 1N9PA 5MEPB 5IT2L 4S2SA 3PXLA 2GQHA 4MAZA 5F0PB 3V6OE 4ANVA 4XZUB 4PLJD 4YDIH 5C09D 4UB0L 3VSTA 3ZKMD 2CJUH 4YEFA 2FEJA 4JJOA 4LRIA 2VXVH 2M26A 4O51A 2XTJC 3GSNA 4YZFF 4PRHA 3PABB 1MG3C 1JFQL 3QI9D 1P7KB 2AQ2A 5J11B 3FH8A 4NGHL 1YZZA 1I3GH 2UXVA 4GINA 1A22B 5DJXB 3CFKB 4WO4D 2I9TB 1YVLA 3PGDA 1UM6H 3HMXA 4U4BA 3OX8B 1BMWA 3QDJA 8PAZA 1MAJA 3GMMA 1HXKA 3SQRA 2ESVA 2XUWA 2P46B 3WCYA 2QV4A 2HP4A 4C4KT 1ZT1B 1M05B 2A38A 3M45A 1PKQA 12E8H 3WTUA 4JKLA 4PW3A 4BWTA 2DM3A 1A6VL 4KROD 4OB5L 1U8CA 4X0KB 4J28A 1C12B 2N0MA 2P5EE 2CDGB 3HJ0A 5CBAB 4IIQA 4R96B 2XG5A 4K9JA 1OSEA 1NGZB 3RDTD 4N24A 4FFTA 1MRCL 3VDCA 3NN8A 4XMKL 4DH2A 2Z3FA 4KDVA 3GIZH 4R7DB 2OYPA 5DEZA 2IDQA 3HI5L 4RIRB 1WE5A 1T3FA 4ODHL 3UAJA 1TO4A 1EHNA 2BCKA 4X5XB 4JFDE 3UGUA 4DSYA 5CR8A 2ILLA 1CT8A 1RIHL 3LIZA 3RL1A 1OB0A 3D06A 3RNKA 2Q7YA 2R0KH 4NQDB 4PJFA 5KJRH 4TLUA 5GGRB 1DQLL 4Z78B 1X7QB 3TEUA 1QWUA 1V3LA 4C4BA 5T3XH 1PX4A 3P73A 4GBXD 1KXVC 5BZZA 3SJVE 4XCNA 3PWUB 3TZVC 1YQ2A 3OBAA 4X6BA 4M6AA 3L5XL 3GMLA 1AO7D 1X5IA 3VXMD 3DTXA 3BPLC 3CZFB 1SHWA 2W9DH 2YKLH 4PGJA 2XBZA 4WI5A 4CGUB 3FSWA 2IANE 1FZJA 4ZX6A 2IWFA 4AUYA 5FK9A 5IBLD 1U8LA 2YARA 4IKJA 4ADJA 4YE4L 3NMEA 2DH3A 1QYGH 2KLSA 4ICWA 2N56A 3BP6B 2IF7A 4PRNA 4EXKA 4Z7VA 5CGMA 2H2SC 1YEGL 1G7HB 3RAJL 1AP2A 2EEFA 5EUOE 1HHIB 1D5ZA 1HTYA 2AJUL 1BPVA 2X3AA 1RUML 4HIHA 3VFGH 4LE8A 3VFTB 4ZSOE 3NDYE 3D85D 3FQNB 2X2IA 4MAYA 1DBKL 2WB1A 4H88H 3ZKSD 4NKIH 2KZKA 3MXVL 3HS0B 4PJEA 1KZYA 3OF6D 5JUEH 2EVFA 3P54A 3ILDA 3CC5A 5DVPA 1JUFA 4QI3A 1FFPA 4UYPA 3I2CL 1JBJA 4OAWB 1CL7H 5IEHB 4P2RA 4ZO8A 3EOBA 4U1IA 1OGSA 1Q9WA 4W6WB 2BPBA 2I26N 1BJ1J 3FTXA 2XZZA 5DMGC 2AQTA 4MB4A 3SZKC 1XHHA 5KUMA 1MPAL 1HEZA 4J3VA 1MCPL 2W0LA 5CZKA 3A0OA 4IRZH 1YEKL 4HHWA 3DX4A 4JHAL 5CLYA 1WHOA 3PV6B 4TUKH 5TE7L 2BC4A 4CVXB 4LT7A 1GW6A 2VN6A 1IARB 2GJZA 3X14B 2VDML 3SCMC 1KCBA 4Z3TA 5CSGA 2ZD0A 5IVXE 4BXVA 1WISA 3OKOA 1DDTA 4OVVA 4EI6A 4YSPA 1P5UB 2VAJA 4WTZA 4XOAA 3H9SA 5C71A 5T3ZH 1BFVL 1U4FA 4NNYB 1RI8A 4IKNA 5I0VA 3IDMA 3ZQ9A 5DJAA 4N5UA 5DDHA 2TRYA 3DIFA 4NHUA 3BGMA 2ODIA 5HGAB 1OIOA 4NAJA 1PS3A 3MRNB 3O2WL 5BRPA 4ZW3A 2G60H 2FD6L 3CHXA 4AK1A 3AUVA 3B1UA 4WIQA 1I1AB 1MWOA 5IWLC 3BC9A 5D7LB 4X99B 3QEUB 3BSGA 4QXUH 2K4AA 3LY6A 3BKJH 4UQIM 2X4UB 3K6DA 1UC6A 2DYPD 4MMZB 3SY0A 4C54A 1MRFL 1OCCB 5CR1A 4JDEB 2YUWA 3BWZA 3ZTNH 4LSPL 3C5ZC 3QJHB 2XZCL 4X4XB 5GRVK 3DSFH 4OUUA 4BKLB 3SE9H 3ZE1E 3HB3B 1UXLA 3OJDA 4N5EC 1UD4A 4KZDH 3I3EA 3U9UB 4A2MA 2GUOA 4EKJA 4LAJH 2NUTA 3X1BA 3LRSA 3LZFH 3UGEA 4HWZB 2F9BT 4RGOL 1Y18A 3NGBB 3MO1B 3QDMB 4PJXE 4ZTOH 5IB4B 1BQKA 4FA6A 4LLUB 2VABA 1DANT 1A6WH 2WWMC 1CXFA 2VR3A 4JJ5A 4APQA 5DLML 3Q5YA 3AQXA 1GIGL 3JWOL 2Z6FA 3HMWH 2H2PC 4KPHL 3BT2H 1G7MB 2QHLA 1P2CB 5DQJB 5ISZA 3UOAB 2ZUUA 4GS7C 4NAQA 4Z7NB 5J1SC 1QLEH 4LB8A 3D09A 4FC3E 1NPUA 2DEYX 5IZ7A 5DVLA 2WVUA 3RVTD 1FO0A 4KHXL 5IY5B 5DZOA 1BQUA 2AFNA 3B43A 3TO2A 1JMZA 3WFZA 4IHOB 3T4AC 4R7XA 2IPUG 4GRLD 3WS6C 4UT7L 3MLUH 2MKWA 1Z9SB 3PGFH 4LSUL 5E2WH 5K1VA 2HLAA 3UJJL 2B5IC 3FCGA 3QWOA 1XF4A 2W0PA 4NYLB 2C3XA 4UU9B 1UKSA 3MRCA 1A9BB 4ERSL 3KHOA 4OV6F 3CVHA 4Z8FL 3B2VL 2H3KA 2KYIA 1IFGA 5E0FA 3T2LA 4P5SA 1MCWW 4PWHA 2EEDA 3IE4A 2FECI 5B7EA 4FTVA 1S8DA 1FVDA 2H3NB 3L4WA 4D9QE 2WW8A 2EDFA 2HJFA 4AV4A 3R8BB 3MROB 1KBVA 1L6ZA 2VL5B 4QXGL 3RX8A 3SE4A 3KPMB 4S2SB 4LLMA 2OMBA 1IC0A 1IQDB 2J25A 3EOAA 3FFCA 4HUCA 2BDNL 1KGJA 4U6TA 3APCA 1XT5A 4KQ3L 3CFTA 4UT6H 1FFNA 2VZVA 4HAFA 2AXGA 2HPOA 2N59A 4YXLH 3QG7H 4O51B 4JW3A 5AYTA 4YQXH 2HUHA 5HHXH 4PRHB 4WTZG 5DD5L 1W8OA 1I1FA 3KBEA 5HPOA 2R15A 1IO4C 1CN4A 1F58L 4PGBA 4UDUA 2FK9A 4WAFA 3PXHA 1GPOH 5FYLE 1G1CA 3Q6FA 1E4KC 3G08B 3KEHA 3OGCA 3PGDB 2FX7H 1HH9A 3QDJB 4FQIL 4DJMA 3GMMB 2HWZL 1QPPA 4B9JA 4F37F 4ZAKA 2A6KA 2NNCA 4TQIA 2NY0B 2OP4L 3ZTJH 1ZTXE 3MLRL 1WZLA 2BSDA 3GXMA 3JVGC 1SXSA 5C09A 2BY0A 2K3TA 1KCSL 1VCAA 1P7QD 4LEEA 3THML 1PKQB 3O4LD 4JO1H 1XIWC 1U8CB 3UYRL 5I19H 1Q9OA 2WBKA 3BUQA 4IIQB 3MV9D 4URKA 4NKDA 5HVHC 1R3JA 4LIQL 3FJTA 1MCKA 3RI5K 4CMMA 1UD8A 1H5BA 1IILE 2OCJA 4ODTL 3NN8B 5TDNA 2OL3H 1E4HA 3RVUC 4XNUL 4F58L 3G5ZA 4AV0A 1TOXA 1KBKA 2DS4A 1T3FB 4WO4A 5CLZA 2BCKB 4OD1H 1VEOA 1JGVH 3ZQWA 3S37X 3LRKA 4DVBA 5D7SL 4KMTL 3RNKB 5FFLA 5E24E 4PJFB 1X7SA 4WLCA 1CC3A 2AJYL 4LCUA 4GUCA 1RMFL 4N2IA 3FQYA 2Z64C 3UZEA 3PG2A 1ZLEA 1FN4B 3WXVH 3ECBA 3AACA 4MXVE 4G11A 1SEBA 2FX8L 4X6BB 2DLEA 3GMLB 5LGYA 4CMHC 3ES6A 3L4UA 3DTXB 5GRUL 4JR9L 4NQTA 4XVOA 3K3QA 4OW6A 4XPGH 5ALCL 1TETL 4L4VE 1CD0A 1FZJB 3RDTA 2XBTA 3L9EA 4LCVA 5FK9B 1GR7A 1U8LB 5D6DA 4B7IA 4PD4J 3A22A 3EOTH 4WI0A 4PWGA 2CO3A 4ADGA 1KXTA 4TVUA 1BZ7A 4Y7OC 3L3OA 4KITB 4Z7VB 4K9EC 2XWDA 5I1DA 5B7FA 3K2IA 1AP2B 4F7PA 2VDRL 5FGCB 2QLVB 3LZPA 1CR9L 1D5ZB 2QPEB 1BEXA 2ROXA 4HIHB 5IROC 2BOLA 2X10A 4ODSL 4GQ9L 3SKMA 2BNQB 4MAYB 3JWDC 4HALA 3MN8A 1MFBL 3RY5A 1BXUA 2LFEA 1EEZA 3CC5B 3NJNA 4FMFA 4PRBA 4EE2A 1JUFB 5J5EA 1FFPB 3W37A 3WEAA 5T1JA 3LQZA 3EFOA 3VXMA 3T6VA 4BSVA 2P52A 2F8VA 4B50A 4OJFH 1JVKA 2A6JA 3EOBB 2AQSA 1T2JA 3KXFE 4UILH 1ZVSA 2V37A 1Q9WB 3KBHE 1J0YA 3AT9A 5DFWH 4N90D 4EDXA 2NY2D 3RQ3A 5ABDE 2WXLA 1HEZB 3VA6A 4D3CL 3FQUB 1NBVL 3P3YA 1FV1B 3V9FA 1C5DA 4OLVL 3VI4E 3O9WD 3S9DB 2GUYA 2BC4B 3JZYA 2BVUA 5GQBA 1A6UH 3TP4A 1KTBA 2GJZB 4Y1TA 4BINA 1J9QA 3D85A 1VFMA 5GJTL 3ULUD 3NCYS 3OKOB 4EI6B 2Z31D 3ZSSA 1RULH 4HS3A 4ZMOA 1KACB 3OF6A 1RURH 2CA4A 4NN6B 3H9SB 3GSVA 3HZ3A 3RIFK 4PJHE 5CN2A 3KGSA 1B4JL 5AVZB 4QRRA 4EQ3A 4XI5D 4EPSA 4RFNB 2ZSVB 2HZHA 3IDMB 1KPUA 5DJAB 3EYOA 1VACB 2WZ0A 5DDHB 3DIFB 4NHUB 3BGMB 4JQIL 4M8QA 2Z65C 4X4ZA 3N42B 3ZE0E 2YJLA 4FYTA 2VZ1A 4JREC 5BRZE 3MBED 3UERA 2PETA 4D9LL 4WFHE 1X6NA 1HU8A 2APFA 2W5PA 5CIPH 1FVCB 2F7RA 2NDGA 1OP3H 1J10A 4IDJH 4DQOL 3UBFA 1XEDA 5DA4A 4LPWA 2ENQA 3CDYA 4YSQA 5JIKA 5HI3C 3WV0A 2AC0A 1B88A 2G3NA 3HPJA 1SXCA 3SY0B 1U30A 3ZQXA 2UWEA 2W59A 3AB0B 4H8QA 1DQVA 3L45A 3S36X 3WELA 2L04A 4YBHA 5CCGE 3TVMA 1MDAA 4OI7A 5TQ0H 5CP3A 4R5TA 2LAGB 5BUGA 4Q97A 3D4YA 4WWKC 3OJDB 4HIXL 2E9JA 3HN5A 3NCFB 3OPZL 4GG8A 4NQCD 3W1ZA 3F83A 3VWJC 3DKHA 2GUOB 1OTTD 1NCDH 3P9WB 3PP4L 4G7VH 3DV6A 2NUTB 3E9TA 4KJWC 3S35L 3LRSB 1NOLA 3RWHB 3FZUD 4XMPH 1VFBA 3L6FA 2E0PA 4DHLA 4HOWA 1K6QH 3UAAA 4KNSA 2AERT 1F4YH 1R5IA 1I3UA 1TR7A 4ONGH 4OQTL 2VABB 3RWJA 1U2CA 3U2SA 1EJOL 4P4RA 2DYPA 4ZXBC 1LO5A 4APQB 5C0JA 5DUBA 5BZXA 2YXWA 4FLRA 4N2AA 5TGBA 4FNUA 1AJ7L 2WINA 5ISZB 1RHHA 5D70L 4HEMA 2H0JA 1UEYA 4AIZA 4L4JA 4CRPA 4PYGA 2GJ6A 4BE6A 5F0MB 1J9RA 1J0KA 1FO0B 2B08A 3CIQA 5HXMA 1OOWA 4WGVB 4DCQB 3D3VD 2ADFH 3TO2B 1RSFA 3WN6A 4P5RA 3GTVA 2EO9A 5AOZA 5IK3A 4D2NA 4Z7OB 4HHGA 5HI5D 1XGRA 1FBIL 3T0VA 4CSSA 3GSXA 3N85H 4M48H 3QWOB 1XF4B 1KJVA 4N68A 4NPKA 3MRCB 1MAMH 3NACH 5CLXA 3FFDA 5GS0H 2UZPA 4NZTH 2NY1D 5HVGB 3GINA 5FFOA 1NCAL 3QO1A 1OOAA 1CGSH 1EAJA 4KKBC 1UUSA 1HL8A 4MD0A 1FJ1B 2CUIA 1A7QL 3DNKA 3QJSB 4FTVB 1S8DB 5L7XH 4UV4H 1FVDB 1RZ7L 2ZXGA 4P49A 3U4KA 5BV7L 1UWFA 2HJFB 2VUKA 4H8WL 4H8VA 4HK3J 4P9HH 4BFRA 1M6OA 1SLUA 2MKLC 1P6FA 4NO3A 2QQNL 4LLMB 4ONOA 2YN5A 1SYVA 4F5CA 3FFCB 2J6WA 2VC2H 1QHOA 2OTPA 1WGVA 3DJ9A 5ESAA 1GRWA 3ABLB 3QNZA 1DQJA 1FFNB 5AOLA 4GRLA 2MRYA 3WG7B 2AXGB 5LDSA 1HFUA 3A4AA 5B1BB 1L3NA 4MB1A 4NLHA 1LE5A 4PPTA 1BQLL 3ZT5A 3V4UL 1I1FB 4GKOA 2Q8BH 5IOPA 4PGBB 4JLRB 4UDUB 3ESNA 5I71B 1NMAH 2DJUA 4I13B 4DWHA 1I7UA 4NIKB 1NCTA 2X4NB 3QUYC 3Q6FB 1FFOB 3OGCB 2EXYD 1IV8A 1HESA 2Q8AH 1HH9B 4CN4A 5FYJD 3MKKA 4B6ZA 1TG8A 3F8UB 4HZ1A 1NIAA 1PNDA 2A6KB 2PP9A 5I8KH 7TAAA 4I0PD 2D73A 2I85A 2Y1AA 4HLJA 1LD9A 5C09B 4M62L 2VQ4A 4A66A 4R9HA 3QXAA 4LZKA 3RPIB 4A7GF 4U3CA 1A5FL 2A6IA 1FZMA 4POUB 4K7PY 1Q9OB 4NC2B 4YN3A 2O5NA 4NKDB 5I2IA 1R3JB 4CMMB 4YSDA 4WI8A 5EU7E 1H5BB 5FM5M 5TDNB 1A47A 3F12A 3I3DA 4IRSA 5JHDE 4J3TA 1VEPA 2JCCA 5DGRA 5JIMA 1SEQL 2Y2TA 1MFCH 5HDQH 3SDDA 3S3CB 1EQWA 3U0WH 1UCTA 4DVBB 3S5LA 1YNKH 3ETBF 3TH2T 2H32A 3ARXA 4UQAA 1MVFA 2WZPA