2JWYA

Solution nmr structure of uncharacterized lipoprotein yaji from escherichia coli. northeast structural genomics target er540
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
168
structure length
168
Chain Sequence
MVQQSEVRQMKHSVSTLNQEMTQLNQETVKITQQNRLNAKSSSGVYLLPGAKTPARLESQIGTLRMSLVNITPDADGTTLTLRIQGESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAPASVLAPSDVDIPLQLKGISVDQLGFVRIHDIQPVMQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized lipoprotein yajI
publication title Solution NMR structure of uncharacterized lipoprotein yajI from Escherichia coli.
rcsb
source organism Escherichia coli
molecule tags Lipoprotein
total genus 29
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1620 Mainly Beta Sandwich Immunoglobulin-like Lipoprotein YajI-like 2jwyA01
4C47A 2JWYA
chains in the Genus database with same CATH superfamily
3SE6A 1E5AA 3GDBA 4Y4KC 1T04A 1RZPA 4OQTH 1BAFL 4QHNA 4JFFE 4D0CA 2YARA 2B2XL 4UOJA 3WOVA 5C0GA 1HSAA 4UZSA 1UJ3B 3L7EB 2DYPA 2HJLA 5JTWA 3CZEA 5D1ZI 4CVUA 5GS1C 4QXUL 4KJYB 4PJFB 1PX3A 4UDTA 3RKPA 3VG0L 3O3AA 3S35L 1KT2A 4Z0XA 3ATAA 5EF2A 1RHFA 4S1RL 4QRQA 4LXFA 2ED8A 1E4XI 4PJ7B 5GSRA 4KKBD 1XBDA 2P7TA 3FO1A 2X4UB 3D3VB 5MENA 3QDJE 5CM1A 3V4VA 1SHSA 5ESVA 4KK5C 3VA2C 1CE6A 1V7NL 4CSZA 4OQ1A 4U7SA 2VLJD 1RZFL 3G5VA 1DQLH 2OTUA 2VMJA 3JVFC 4E9RA 3ZTJH 2YJQA 2XUWA 4J4PD 4F9PC 3C2AH 3MYJB 5EORH 3IJEB 3VWJA 5KOVC 3V9EA 1J8HD 1EJOL 1OKEA 1U58B 5TQ0L 2R23A 4AGPA 5I75B 3IAGC 1SF3A 4WTZG 4P2QE 4Z7VB 1G7MB 2KS0A 1OCCB 1BZDA 4JM2F 4ODUA 1EANA 3ZE0E 5LBSA 3QFJB 1WFIA 2BIOA 2P26A 4JZJB 4WHTA 3QI9D 4R7LA 4XVTL 4G5ZL 3C9NA 4L1HA 4LCUB 1B3JA 1KTDA 1W0VA 2WP3O 3FFCA 4HUUA 4BH7A 4TM9A 5JXEC 3QUMH 1S5HB 3EDEA 5I8CA 4LO9A 3VXUA 2OYMA 4HS6B 4FE9A 2QSCH 4GT0A 3U36A 5JW4M 43C9A 2FIRT 2Q3ZA 4I9WE 5J13B 3SJVA 1SXAA 3IXAA 4KKRA 2RQ8A 4YHLH 3NCXA 5D1XE 5LCVA 4ATTA 5GGSA 1JZGA 1VADB 2AV7B 4H4NA 1AXTH 3DWTA 4Q8BA 2VXUL 2YGNA 3OWRA 4PG2A 5SWSA 3EYUL 2C5DC 4R4BB 4XCCH 3PP4L 2NXZB 1SQMA 1FHNA 2F6AA 4OIAA 1E5ZA 3MJ7B 4JPVH 4IDLA 2Q8AL 5DVNA 3VB9A 4NKOB 3ZKSD 4IK7A 4Y4KA 3D69A 4ZUWB 5C1MB 1JN6A 3FH8A 4PEEA 2EE6A 4I4WA 1NA8A 4RMSA 1RJCA 2PUQT 1TQCC 5EU3B 3ZN6A 4OFKA 1DQIA 3QZOA 2VLLB 4GKZA 5FA4A 4WI6A 4RA0C 1WZLA 2OZNA 2X42A 5INCA 4ZX4A 4NWTL 4IBYA 1FDLH 4KMTH 3UEZA 2ARJB 5I6MA 3WFCL 4XGZB 1KB5H 4PRNB 3VFSB 4HAGA 1AHMA 2CK0L 1URZA 4ATWA 2EECA 2J5LB 3OV6A 4AJVA 4QUOA 4MQ7B 3SDYL 1ERNA 4IOIA 3WI9A 2BOCA 3IDGB 2MFNA 3QUMB 3RUGA 2E8YA 3B2UD 1ILUA 2WM0A 5ACMA 2FZ3B 2KQNA 1ZA6B 4NQVA 5IQNA 3LV3B 4XC3L 4YXLH 2AQPA 4K8RH 3V5DA 2A9DA 2WXLA 5IQ7L 3HI1A 4MJ5B 3ZY7A 1CYWA 5TQ2H 4PY7B 2Q8BL 3QZWB 4HFWB 4Y5VB 2CHXA 5JNYA 1UJTA 5AVWB 1IC7H 1PNDA 4K94L 4ZX5A 1ZHKB 5BO0D 1I8KB 4PYGA 3HFFA 1S78C 1YYLH 3BAKA 3QNZB 5EN2A 5I66B 1T89C 3WFHA 1KACB 1P7HL 4K71C 5IROD 1NGQL 4Z9KB 4Z3JA 2HG0A 3K1KC 1QNIA 2J72A 1JK9B 1EV2E 1ZT1A 1PCSA 2WBJA 1WBZA 4PS7A 5D7JD 3AB0B 3BP4A 3I9GH 2F5AL 3DMMA 4M93C 4PJ8D 4XAKD 5CINH 3HJ0A 1QSVA 5FFLA 2OM5A 3ZO0A 4P9MH 3GS7A 4X9YA 4WGVB 3SODB 2CGZA 5JXEA 2OFQA 4HXAH 1BOYA 5D93C 1JZEA 4F58H 4EDXA 2VQUA 1F58L 4POZD 5ILTL 1FIGL 2D7MA 4UU9A 1JS4A 1KB5B 1XGRA 4NP4H 5JIDA 5I0ZA 3TBSB 4ERSH 3HN3A 1SFDA 3G6DH 2Z8VC 5T3XH 4L18A 4XNMA 3C5XA 1J0JA 1YC8A 1JDAA 4MNHA 5MEQA 4GO8A 1P7QB 4N2EA 3FS9A 5DMKB 4Q2ZA 4RGMC 4QRPD 1WK0A 1SDYA 5TPWH 5I6NA 3GWJA 1JNLH 5KWYC 3ZDXB 1MCCA 1W72H 2AXJA 3APMA 3HE6A 3MOBH 4HC1A 3RPIB 1Z9LA 4Y7MA 2V8LA 2N1TE 4ZUSA 3ZIYA 1H8NA 3QWNA 4OB5H 3VNZA 2NCEA 5FB8B 3QCVH 2UWEA 4ZMVA 4BDVB 2L04A 1GIGH 1NAMH 1F8TL 4IRSC 4X6DF 1XCQB 2APXA 2EDNA 5L8LB 1MG2C 1FL6B 1PY4A 1JUFA 1UA3A 3U9WA 3V4PL 3SBQA 1KBKA 3JV6A 3K0WA 5ITFA 4I9XA 2BCKA 2GIMA 4YL9A 5GRJH 3VA6A 1M6OA 3LIZA 3PWNA 1NUFA 2DLHA 5AW4B 4DP7X 2AQ1A 4LARH 3VD0A 1I82A 1FZJB 4PLKC 4P23C 5AUMA 1ZTXL 2C4FT 3VFMB 3FT0A 2HKHH 1OARL 1INDL 2P8PA 2NX5B 4LHUG 3VX1A 4AK2A 4JDZA 5IEHB 2WB1A 3PAVA 4PI0A 1OAYL 4HS3B 3K6SB 2QMKA 5F89B 5EBWB 4XH2A 4BQ9A 3G04B 1FLTX 3ZJAA 2F0CA 2A3TA 1Z3GH 1WFUA 1MWAA 4JY6B 3X1BA 1AC6A 2WCGA 2Z31B 2GITB 4KTEL 4B95C 1NICA 4ZFOA 5C70A 1OEZW 2EVHA 4IRJA 1Z6JT 2Y3NA 3CZGA 3II3A 1A9VA 3ZL1A 3SBWC 3ZYJA 1W72B 3D3VD 2Y69B 3BEVA 4NZJA 2ZIDA 1CDBA 5G5DA 3VFNA 3HN8A 3LH2H 1CU4L 3GMQA 1PQZA 3AS1A 4Y16C 3QRLA 2AK4E 3MLXL 1AH1A 4LP8A 1NAMB 5DJXB 5KSUA 4PJFF 1M7XA 2IMMA 3BHBA 5EBLB 4UUJB 2JB5H 2V3DA 1XAKA 3TPUA 2LV4A 4R7VA 4BKTC 4YBQD 2FBOJ 3VXUE 2WQ8A 4M7KH 2A9ML 4PREB 5C0AE 4AOFA 3CHOA 3RB5A 4NPYA 1AS6A 2OMUA 5D7IA 5AZEL 5IMOA 2VM9A 4H8WH 4B9IA 3HNTL 1A3LL 4DCQB 3RWHA 5J1AA 4UMGA 1U8LA 4KI5F 3QFJD 3E0GA 2QBWA 2F18A 4AEHL 3LVTA 3REWB 4OGYH 3NJMA 5DZ9A 3AROA 4XPBH 1WHPA 3PV6A 3BWZA 1CK0L 2YOCA 3II2A 4Q56A 3CN4A 3MTRA 3PDOB 4GW5B 4D9LH 3NAAL 1I7RB 3A22A 2CE6A 4GRLA 3VU1A 1OCWH 1A6AA 3IKKA 4DP2X 1KJ2L 1LO4L 5I73C 4CVZA 4K4KA 4AENA 4F5CA 1YO4A 1UD4A 4OFYD 2UXFA 3OMNB 5FO7B 2JJVA 2YXMA 1KMGA 3EZ8A 4BZ2H 2OZ4L 4NXKA 1L0XA 4X5XA 1G7JA 4JFXA 2NXZD 3WL9B 3SGKA 2AQRA 5IK3B 4PRDB 3NFPA 2IXQB 6PCYA 5SX5K 4X80H 3F12A 3IETA 3OKNB 4JUTA 4NFBA 1WGVA 4PJHF 1FFOA 5HHVL 3ULAB 4AEIH 5DF0A 4S1SH 4LGRB 3K71B 1HXYA 4HU8A 5DU7A 3PL6C 3RUGE 4JO2H 3V6FB 4W70A 1HH6A 1NGPH 1ADQL 4JZNB 4OD3L 4IRZH 25C8L 4P23A 2VXQL 2VDRH 1H8SA 1RLBA 2WHVA 5CBAA 4R96B 2A4ZA 4Y1TA 3VH8G 3MQIA 4NNYB 3UIZA 1VZGA 4KKCD 4XNAA 1N7MH 3L6FA 3CPLA 4H8PA 1AZCA 3D08A 1F18A 2Y2YA 1D7BA 1AKJA 2P46B 3VMOA 2ZUQC 4RDQF 3UTSE 2OP4L 3SBWA 4J6RL 4N2CA 4L8BB 3SKJL 2BS8A 2OR9H 2DEWX 3T6WA 5JW3L 3NH7L 1ZT4A 3TYFA 4HX1A 4JE0A 1BFVH 2APSA 2I07B 2X40A 4R26L 4FQPA 1JZ8A 5IJVB 2OK0L 1Z1WA 1BQUA 3P2BA 4FTVB 4Y2LA 3ZDZE 1TO4A 1EO5A 3BLKA 3HNSL 4MWFB 2VC2L 1H6EA 2Q87A 1DYZA 4NUJB 3LEXA 5J9PB 2XPZA 4AL8C 3MO1B 2ZUSA 4Y5XA 2HUHA 1TZIB 5HGHB 2X6UA 1S7VB 2A5UA 4M8RA 2FQDA 4NUMA 1X5XA 4D8OA 4KK6C 4JFPA 2EJ1A 3EJQA 5HGAB 5E99H 3FO0H 4OLYL 5A2KH 2DQHL 3GI9L 5D6DC 2XV3A 2VDRB 3JWDC 3MN8A 1MREH 1WRFA 5A43C 3LNGA 3QIUC 2PTTB 3B2XA 3D0VA 4LOFA 4XPTH 3GFUA 1G9NL 3KS0H 2EDRA 3NRQA 1KXQA 2DM7A 2WINB 3GO1H 1FRGL 2UWEE 3EH1A 2PCXA 3NPSC 4FG4A 5C0CB 3WHE1 5I6LA 3UO1L 4R4ND 4KRPD 4M3HA 1S5IH 1YEFL 3O3UN 15C8L 2O5NA 1P7QD 2EVGA 4HEMA 1I9RH 4AH2A 3SBPA 1B4JL 5L2JB 1BQLH 3WY1A 4PTTB 4K8RD 2VDLH 3APDA 2VM3A 3T77B 4PV9B 1UM4L 3LKRA 1QEXA 3WFBL 1CO1A 1GGIL 2XN2A 4QJ3B 2CDEA 5IGXH 3ABGA 2RCSL 4TULL 2IWEA 3TNMA 1OY3B 1CXHA 4L4TA 2GB2A 3U30C 4AVJA 4GO9A 4BQBA 5D9SB 4UOQA 2IAAC 2CRZA 1S7RA 2ZJSL 4G8EA 1YYML 3PL6A 5BZWB 4F7MA 1J0HA 4R5TA 4H1LH 2YEZA 4KXZH 3CXHJ 1DBAH 3M1BB 5FGCE 3F7YA 1NCWH 3L16A 3WY2A 5D8JL 3GMMA 4OLUH 4NNXB 4AG4H 3EG9B 3LQAL 3P4MA 3WS6A 1ZA3A 3IMUA 1MHEA 1AHWC 4G7QB 5SX4H 3LPWA 4XB3A 1AGFA 1TZAA 5CKAA 3I9PA 1Z3RA 4ETYA 2NX5D 3CWGA 1NEZA 4W9LC 1K5NB 5IFHL 3NGBC 1EPFA 4GAGH 1T66D 3CZSA 4HT1H 4U0RC 4LDOB 4AIZB 5F71A 3HLAB 5T3XD 5EF1A 4JPWH 4KZCA 4U6XB 2Z31D 1XF4A 3QJOA 5GSVA 4KKNA 2V7HB 1VCBC 3FB8B 1K4CB 3GXTA 2V2WB 3LD8C 1D7CA 3GXPA 2N0KA 2VDLB 5TDOB 5IB5A 3OR6A 3E6HA 5JUEH 3WJMB 4CA4A 3UYPA 3V5HA 4WF7A 3MOAL 3L9YA 4G7YH 3NABL 4U3HA 3UJIH 4AYBA 2Z92A 2E7CA 2CH8A 3W57A 4JQXC 1P4LB 2Z4QB 5FXCH 1CLOL 2WSPA 3O2WL 3OAZH 4WNJA 1WS7A 3CSTA 3Q2WA 1NOLA 1AC0A 3U0PB 1J5OH 2JQZA 3P77A 4H1LB 3D2UB 3IF1B 4LHUA 1QAWA 3IDIA 4QY8B 2FO8A 2FR4A 4NLHA 4RRPM 3GNMH 4K9EL 5GRVK 1MCNA 1HHIB 4AJYV 1A9EB 2PCFA 2R7EB 3KAAA 4R9HA 4PGBB 3C12A 3DDFA 3LNEA 1T04B 1MCWM 1XH3A 2BY1A 2BHUA 2HT3D 2C1PB 1K3IA 4KY2A 3MV8B 2LVEA 3BLBA 1M57B 3WMPA 4RIRA 1P7BA 5CZXC 3WNKA 2IPKA 5ECGA 3TA4D 4GW1B 1AD9B 1JXKA 2Z4TA 4YHMH 1DFBL 4PGCA 2HX7A 1PCXA 5B39B 1XF5B 3VRIB 4A7VA 1F4XH 4P48A 4AKPA 2CLVA 1XF3A 5GSRB 3WS3A 3Q5OA 2AEIT 4AQEB 2CUMA 4RGNB 5C6TL 4OT1L 2W0FA 4Y9CA 3EXJA 3MRJB 3GHBH 4GRMB 4F57H 2OA9A 3ECVA 1K3ZA 3MZGB 4PI2A 2DQMA 3MLPA 4J3BA 5J8OA 5TK2A 1ND0B 4LCIH 3LB6D 1R5IA 1S3KH 3MRPA 1NMBL 5IR1A 4XMPL 1AHWA 4JVWA 4A67A 2YAFA 2XT1B 1KIQB 4NQDB 2CSPA 5C0IB 5I1DB 5J7CC 3C6LD 5FGBC 1KIUB 4WI2A 3ML8A 3VG9C 2CQVA 5LWYL 2X28A 1AMXA 1G7IA 2CBOA 5DK2A 3ZRFC 1VF5C 4YSAA 1R3LA 4TN9A 3V0AC 5EEVA 4N0UE 4PD4J 1E4KC 2JTYA 1A7NH 3AQYA 3BPOC 3ZL4L 5C0JB 2AI0H 4X8CA 4JFWA 3MC0A 3MUHL 3RIKA 4FQCL 3HG1A 5DQJA 3WFEL 4BH7B 4TSBH 1IGFH 2Z8SA 3JUZA 2R69H 2Z35A 4Z77B 2Q5BA 4ZXBA 4OTXH 5BV7H 1SBSL 3BIBX 3VXPB 2NZIA 4LPCA 3SBRA 4MJIA 3O6MH 1F45A 4IKLA 3VJ6B 2FIKA 4YGAB 2UZYA 2XV6B 4NXSA 3SDCA 5JW4Q 1HKLH 2G3MA 4JQXA 4FTVD 3RL2A 1X5AA 2XJLA 4D2NA 1JBJA 4H0HB 4YHIA 2VMDA 1MRDH 1FAKT 2K8MA 3QFDA 3PXLA 2BIPA 4F7EA 3MJGX 3GXMA 1I1AC 2AQ3A 5F9WB 2H26A 5ISZE 1KXQE 5HGGS 1BD2A 2XU9A 3TEUA 5FOBB 2ZXDA 1JVLA 1JYXA 1G7LB 1DSYA 3C5ZB 2QKIB 3ET9F 4FNLL 3MBEA 3CX2A 1JN6B 1Q94A 1RMFH 5E08H 1KLFA 1QSEB 4I4WB 3IS0X 1ZXKA 3CFIC 1MCPL 5KVGL 4QRUB 4FNTA 3B4NA 5FA4B 4P99A 4NZRL 4TQIA 2BIIA 2E76C 1M7DA 2I32A 2PPDA 4I18C 5F1IB 3Q5YA 4P5TB 5C0CD 3BC9A 5CD5C 3CN1A 4IOFD 3B2DC 1AFVH 1MG3C 4J7RA 3HMWL 3WIHL 1IUZA 2E0PA 3MNMA 3QXVA 1HE7A 1IJ9A 3ARGC 1UXWB 2ZAIA 5D1ZC 2NW3B 4XBMA 4HISA 1ETZB 2OMXB 1KJVB 3D85A 3PQYE 4YDIL 3JZYA 1KBGL 2WWOA 4LLDA 1MFBL 2V2TA 4GAJL 3C6SA 3PAUA 4LSVH 4NQVB 5BV7B 2WGNB 3SKMA 4DN3L 2QQKL 5I5MA 1MAML 2DZEA 1L0QA 1H3VA 2BNRB 2PWGA 2WVTA 3M8OH 4LEBA 4EIBA 1T03H 3KNBA 3MSPA 1F41A 2F5BL 1H5BA 4Y4FA 43CAB 5AENA 1U8IA 3FU9A 5K39B 4OQTL 2FJFB 2QADB 2VLME 2E6JA 3L5WB 1JTOA 1LXMA 1T3FB 2EEFA 1E7UA 5GIRB 3E8VA 3ARFC 1BX2A 1KGCD 3WMQA 3GTTA 3KCWA 5EUOE 1UOVA 2WBJB 4A2GA 2YKLH 2X89D 4Y2DB 3ALWA 3D4GA 2WKOA 3WENA 2QHLA 3THMH 2YD5A 2E7LC 3EJUA 2R9HD 5EB9A 5GGUB 2HLAB 5KS9A 5KSAA 2RFXA 4WDIB 1HHJA 2BNUA 3RY4A 5JHDA 1PBYA 2ZKYA 3N1FC 3P4OB 5BJTB 4UU9B 4LKXA 1XGRB 5H4ZA 3IM1A 4HWUA 4OAWB 3SB3A 3IJHB 4IIQC 4DT2A 2WUBH 1ES0B 5I0YA 1BMWA 3DJRA 1J7VR 4MNHB 2WSKA 4RNRA 1DQLL 2FWLB 3TJHC 1PNCA 2EADA 4RFEB 3T04D 1F4AA 4Q2ZB 1XIWB 3C2AL 4FYTA 1X5KA 5EORL 2EDDA 1BQRA 1S9VA 1I1AA 3HE6B 1DLHA 2ATKB 3TPKA 2HRHA 2WUCL 5IB2B 1TT6A 1EUUA 2CM6A 2DY2A 3ESMA 4O00A 4ZMQA 1MIEH 1E67A 2XQYK 3RWIA 4DOHB 1FHGA 1H0DA 3B3BA 3D2UD 5LDUA 3U9UA 2WWMC 3N9GH 4MMZA 4OZHB 3DTXA 4YOKA 4U1HA 3DPBB 5TGBA 5AOJA 2HVKB 3NDYE 5JIHA 1SOXA 4N26A 3UC0L 3QUML 5A3IC 5ICYA 5IBTH 1AKPA 1SF5A 1FL5B 3P73B 4Z7WF 4L1BA 4P3CH 1KWGA 1PY0A 1N6QH 4I18A 1WZKA 1N8OE 5IW1A 3ASOB 1TO5A 3FTGB 1IKOP 1P6FA 2Y6SC 2ZCZA 2BXYA 3GRWH 2FJUB 2AC0A 3MV8D 1ETB1 2X4TA 4W1TA 3N44B 3HC3H 4BXSV 4YHLL 3ARGA 4N90E 5D1ZA 4Z1PA 5IWLA 3QDHA 1QABA 1SJEB 1DSFH 1BXVA 4A66A 4JFOB 1AXTL 3TA3C 2ZT9C 4P57B 2AMGA 3J8F7 2HPOA 2LHAA 4XH2B 1P5VB 2CHZA 2OSLA 3DX6B 5E6RB 3MNWA 4DETA 5L8JB 4XCCL 2DBJA 5F3BA 3H85A 4BFEA 3ETTA 3ME0A 1C1EH 1KEGH 3T4AC 1ZJAA 2A99A 3L4TA 4DO6A 4PMFA 2ZD0A 1TENA 4DNLA 3W38A 2YAPA 3K72A 4KJWD 3RL1A 4RGND 3T3PE 2GSIB 4LOUC 2VABB 4BJLA 1KPUA 4PG9A 1G0XA 3BEVB 4FI8A 4R7NA 4OM0H 3IGKA 1K4DA 3VFNB 4N2DA 2O6EA 5I15H 3IWVA 3G08A 1FG2B 4GBXB 3M45A 2DMCA 3FONA 1B3IA 4LCCC 3GMNB 1FDLL 4KMTL 1L6PA 3N50A 1KB5L 5CP3H 5MHSD 1HYRC 4NQDD 5C3TA 5E6UB 1X4XA 4A39A 1YEEH 1LE5A 5DS1A 3J2PA 1M1XA 4YNYA 2YA2A 5L2KA 4H2AA 5LXGH 3B9KB 4A7QA 3IMVA 4KVCH 4MJIE 5IB3A 5I23A 3RX7A 3OHXC 3AREC 3IJ8A 4YXLL 2IOOA 4ZZKA 1T22A 4K8RL 4W93A 5J1AB 1OGAE 4JJHA 2ZCKH 5JMOC 2VDQH 2G3XA 2ZPKH 2W9LA 5TQ2L 5HGDA 2WY3B 5DVLA 1REIA 5ELIA 1IC7L 1FNAA 1JXGA 2XX1A 3N3EA 3O3EA 1MCBA 3ML9A 3PV6B 3SQRA 2ITDB 2WAQA 1YYLL 3GSNH 3DK2A 1UCBH 1F90H 3VI4F 1SUHA 3VFPA 3LEYH 4ETQA 2IPTH 3QB7C 2OV0A 3MLRH 1Q9LA 2X12A 3I9GL 1GY2A 1HILA 4NO2A 3S3PA 5CINL 2P1YA 3TV3H 1NWPA 3V6ZA 3PRZA 4MXQD 2PP8A 4GQRA 2QHRH 3DGGA 4P9ML 5C0NC 1HQ4A 3L3GA 4HIJB 3WD5H 5JHBA 2LAAA 2IGTA 1LEKA 3IGLA 4UF7C 3NMEA 3P0GB 4HXAL 4AYSA 3C6EA 3HHSB 2EKSB 2F7RA 4F58L 3C5ZD 5JLZA 4ZRGA 1DO5A 3F12B 3WE6A 3MRBB 4FNUA 3M7OA 5CFHA 4NP4L 2GJRA 4ERSL 3G6DL 4TQ8A 5T3XL 1QSED 2DF3A 3NCCB 4AVIA 3KLSA 2CO2A 3OG4B 4LIQH 2WO3B 3KGTA 4UI2A 3TCXA 3A4EA 3IDUA 4MX7A 5CR8A 5TPWL 1ZGLA 2K45A 1JNLL 4EZMA 4F15C 2H32H 2XVLA 2EEBA 3IGAB 3OX8A 3PWJA 4P5TD 3CH8A 4L5FH 3MOBL 3VI3E 5KTEH 2VDQB 1YY9D 4OB5L 1PD1A 1OF2A 3QJXA 3QCVL 3ZQXA 3G6JE 2HPTA 4N85A 3B6SB 5F6IB 2YBGA 1UM6H 3U79A 1GIGL 4XCEA 2DMBA 1NAML 3WAKA 1J05B 3G5YA 1FYTA 2X3CA 1O5DT 1XXDC 3GSNB 3CSFA 1WEJH 3BP6A 2EE3A 1VFOA 3HS8A 4QRAA 1MJ8H 2BNRD 5EZIH 1ZT4B 1TJGH 2ADFL 32C2A 3KLHC 3GC3A 2DWEB 4LCCA 5GRJL 4IGBA 2KHAA 3HR6A 1IC0A 2B3RA 2ZSWA 4LB8A 1HZLA 4N1CA 4M61A 5LAXA 1FC1A 1MPAH 1Q0XH 2QADD 4LARL 4PJIB 2NY3C 1JI2A 4ESKA 3E8UH 1FL3B 4MD5B 1UWGH 2HKHL 2WXHA 4KZ0A 1OO2A 3BH8A 4CUCA 2PYEA 2NY2B 1BVLA 2WBJD 4M56A 4RSVA 4Y2DD 3ULUF 2CO6B 4PJCE 3QDMA 2Q9OA 5EU7C 2BC4B 2WQAA 1Z3GL 3BPNB 2ZG1A 4R2GC 4U6YB 5HDOA 3QULB 4W81A 3FB6B 1BEYL 1QFUL 1VPOH 4LSDA 3PS6A 4P5KB 4WNSA 4XP9H 3SDXB 2Y23A 3MREB 4MJ6B 5CP7A 3RIAF 2EO7A 4B7IA 2PPFA 5BUGA 1A4KB 3PPEA 4N8VB 3DX8B 5HXMA 4PP2B 2H32B 2BDNH 4ZS6D 1CS6A 2ZCHH 1BQ5A 1TYJA 1TEFA 3BDBA 3V6OA 2HFFB 3LH2L 2VLKA 1VGKA 4B9FA 4EBQH 4QXWA 3HZVA 3VQ2C 1MFUA 1TETL 1XIWD 3QEQE 1X4YA 2W9DH 2P24B 5AB9A 2LU3A 4M7KL 3ZMNA 3HE6D 1M4KA 3NCYP 1FUNA 2JCCE 2EH7H 4B9ZA 3KZ8A 3DRQA 2FQGA 3EFFB 1DJSA 4H8WL 4OSUL 4LKCA 4UT9A 3PWVA 2VW4A 3UBFA 2V9QA 4TF4A 1KY7A 5DDHB 2VXVH 3D2TA 4KK9D 4MDJB 4OGYL 2R4RH 4FHKA 1SYSB 1WWCA 4P49A 2VKXA 4NQXA 1M56B 3WUWG 4YHNA 1ZLUK 3GMMB 3WNNA 4PBDA 4UBDC 4XPBL 4YAQB 3CMOH 1L9TA 3AADB 2VR8A 3WLBA 5CZVH 1U41A 2ILLA 1TQTA 4PV8A 1YAIA 3BWUF 4D9LL 1GOFA 4LNVA 2WXMA 2CPUA 3KE0A 5I9QB 1AGFB 1OCWL 3P30H 1BWWA 2KLSA 2FX7H 2QZ5A 4GP8B 4O2FB 1NBCA 5IM7B 4ECNA 1W0WB 1SZNA 1IBFA 5IMKA 2ZYHA 4BZ2L 3DO7A 5IG7B 4KJPC 1IZKA 2VH5H 3P9WB 4OZHF 3GGWA 3VUAA 4ZTEA 3E1F1 3SSGA 2E9JA 1QYGH 3TZVA 2Y7LA 4BFGA 3ZSTA 2YAOA 4X80L 4JM2C 1N6VA 3ZT7A 2WTOA 3CFKB 3NDZE 4AEIL 5H2BB 4S1SL 4BKLB 2NY0B 3KEHA 5DJZB 3WFZA 3HE7C 1XGTA 4JO2L 2UVEA 5GGTH 1NGPL 2R1WB 1HDMB 4TXVB 1JPTH 4IRZL 4LHQB 3OR6B 2VDRL 2VGLM 3GSXB 4R83A 5IHWA 4GBXD 4GI6A 3B5GA 1ID5I 5F9OH 1P9MA 1NANH 4OZGA 1SY6A 1Q9KA 2J8OA 2V3FA 4HA1A 3ZKMC 3ISWA 2NOYA 3TBTA 3HPLA 1SMDA 2WBKA 3WLWD 2FQFA 3MLYH 1N7ML 4LPXA 4LHUB 1G7PA 3FCBA 2W60B 2KZKA 1HEZA 4NSKA 2FCBA 4JVPA 3B9KD 3FSZA 2DAVA 1PF3A 2PCFB 3DHUA 1NBYA 4UIMB 1IAIH 4U2ZA 1OAUH 3WTVA 2OCCB 3HCVB 4UIKH 2OR9L 1MDAA 3PDDA 4LLVB 1XH3B 3FHEA 4L23A 4XN8A 5T1KB 1MCDA 3H2QA 5E8DL 5LGHH 5KJ7E 2D7TL 1TVHB 3GDCA 5KBLA 4PJXB 1D5XA 1I85C 3UAJA 2NY1C 3AGWA 4B5ZA 4CC0A 1HHHB 1E50A 5B3SB 1ZS2A 2GEQA 4NO0B 5AZUA 4FA7B 1VHPA 5BZZA 2B4CH 4CJ0A 3E9TA 1ZVHA 2E5EA 1B88A 4ZDHA 4WI3A 4KXAA 2ALWA 5D1QA 4KMQA 4PWHA 2H6PA 3ZZQA 1XF3B 5FO2A 2NSQA 4W9CC 5DLMH 5E99L 3DRTB 3FO0L 3SCMA 2EQDA 4KDTA 4XOEA 2XXGA 5IVXF 4LSTH 5J11B 1CFQB 1MREL 2R39A 4PRPE 4X2UA 1X9RA 2C7UB 1U8MA 2A38A 2XWRA 4NWUH 4O02A 4RBPH 4XPTL 4WFGE 1XAUA 3S4SB 1EAPA 3ARDB 4W9KC 3V52H 2K6YA 3JTTB 4R7DB 3GO1L 3N42B 2CIIA 1HJBC 4IEFA 1P69B 1S5IL 2NRDA 2ZUUA 3OGOE 5E1AB 1UTDA 2P45B 2WNGA 2DWXA 4QOKB 1I9RL 4OI9A 2CLRB 2HRPH 4UINH 4NPJA 1PLAA 1NCBH 3L45A 4F8TA 3GZKA 2K9UA 2VDLL 3AACA 4JCMA 4UOW0 5EO0B 2N3JA 3OKDB 2K4AA 5I1LA 4PWIA 5IGXL 4KROC 3HG1B 1E9PB 3PNWA 4APQB 3RHWF 2EIDA 1P1VA 2VZ3A 3E80A 3QUZB 1G5GA 1Q9OA 1QO3A 3IMWA 5E7FA 4ANKA 4KY1H 5C0FA 2PYEE 2XKNA 1DBAL 2VSDA 1NCWL 2JLPA 1KIRB 2LFEA 2V4LA 3QDME 5JOFB 4OLUL 4ZAKB 4XX1E 4AG4L 3D30A 4ISVA 4Z7UB 1JTTA 1S9XB 5HJ3A 1JDDA 4N8UA 2H7WA 4DEPC 1UZ8B 2ZOOA 4F7EB 4S1DC 5DFVC 3ARRA 3NFSH 1IB5A 1OP5K 1BPVA 4U3SA 3VH8B 2NY2D 2VLKE 5A2FA 4B9PA 2NY7H 4GAGL 2Y7QB 4HT1L 4G70B 1NCCH 4KHTH 4AQ1A 3DKHA 1GMIA 3BKCH 4A7UA 2DLFH 1D5MB 4FXLA 4JPWL 5AAMA 1Q94B 2F7OA 1TTCA 1YNTF 3TURA 3KPQB 1T5XA 4OKVB 5E5MB 5IHBA 3RVTC 3T8MA 5TH2A 1CLVA 3RWFA 1SNRA 5DRWB 2APTA 4PJIF 3ULVE 1YMHA 2YD8A 2WXKA 3QQ9C 1BBDH 4WEBH 3U25A 1WUNT 5JUEL 5HHQA 1F4WL 2VERN 1IKFL 4OZ4B 3T0XA 4G7YL 1IL1B 5CHNA 2CCWA 3UJIL 5HGBB 3SO5A 3GRGA 1BIHA 3WEMA 4FS0A 4KTGA 1EEZB 1IAMA 2PETA 3KVQA 1F3DH 3EXLA 3KVDD 1S7SA 2FD6H 3PGFH 2VZVA 4P5SA 4F27A 5GS3A 4YSPA 1RU9H 2VXTH 3W9EA 5C0BA 3T0EC 2FYYB 2XV2A 3GNML 2NUTA 2H41A 3BOVA 5E8EB 5AB2A 1F3RB 4L4TD 2JXMB 1NTDA 1T5KA 4FI6A 4CKVX 4Y4FB 4L3EA 4HOZA 4EN3A 1U8IB 1YPZA 4W9IC 5I71C 2DQJH 1QEWA 3U46B 1I3RB 3MTXA 5B8CC 5CGYC 2EVIA 1DZBA 3CQFA 2DIEA 4X4YB 2HZHA 4XMKH 2Y4SA 3GD1C 2H8PB 3O4LB 1D2OA 1SDDB 1EXHA 4YDLC 1CXLA 4WV1C 4ACTA 1KFAH 2HRGA 1QI4A 1FO0H 2YPLB 5DJCB 3VB8A 2YZ1A 4YHML 4ZUVA 3HHRB 3W0WA 4WJG3 1FP5A 2YGOA 5DC4B 4U4IA 1KJMB 3LKQA 1F4XL 1UD5A 2BP5M 5IESH 3QUXC 2G75A 1G43A 1JWSA 4WHYG 3D39E 4AW7A 4DZBA 5I8EB 1QSZA 2XA3A 5I16B 3GHBL 5DEGB 3TVMB 4OZGE 5B7FA 2F54B 3ZDYF 2ENPA 4N0YH 2NZ9C 1IBYA 1G7QB 4OU3A 5EU7E 3TEZA 2IADA 3DJ9A 3ISYA 1S3KL 5DFAA 2BK8A 1KG0B 2NY0D 4UQ3A 5DT1H 4ONHA 1CPUA 4Q9QH 3BYYA 4HK0A 1I7TB 3V0FA 3FQ4A 1A1MB 4JMNA 1DVYA 4OD2B 4A63A 2NW2A 3R18A 1HINH 1J10A 3X14A 2I9TA 3BSZH 1HQRA 3I02A 3UERA 1A7NL 4TNVF 4WK2B 2AI0L 3SE9H 2AABL 4LHUD 4XNQB 3BQUA 4JO5A 4W6YB 2GQHA 1QLFA 1HHKB 1W8OA 3Q1EA 2P5EB 4TSBL 1UUSA 5AYQA 5C9JB 4L0YA 4Y1AA 1IGFL 2R69L 3CIQA 1FO0B 2G5RA 3L3OC 4OTXL 3B2VH 5BV7L 4UTBA 4HIIB 3O41A 3ABKB 3O6ML 4JLRA 5T1KD 2WMPB 4MA7H 4OIBA 2EXYC 2X4TB 5ABDE 1HKLL 2ZX7A 2NY5C 1NIBA 3QJFB 3BPLB 1DVTA 4TNWK 2B9AA 3REVB 4NQEB 5KSBE 1MRDL 3PABB 2WXQA 4CSTA 3FBQA 4NO0D 5F7HA 4YDNA 3QW9A 1OTSC 3U9PH 4Z3IA 4XZUA 5F3BB 3H9YA 2PWFA 5DJZA 4AV0A 2C34A 3NIDE 4GUQA 1OOAA 1JF1B 3RFRA 4HKJB 3W11D 2JKTM 4PB9H 5FYJE 2C9PA 3WELA 3E3QC 2K8QA 4AYFA 1YLBB 1JZJA 1KC5H 1RMFL 1M05B 3INOA 5E08L 4WNQB 1KPUB 2W81C 3GMPA 5DJ0A 3SY0A 1IAOA 2F8OA 3OQ3B 1NFDB 5EO1B 4B5EA 5F93C 4RRPG 2VDMH 3O9WB 2P80A 2UXTA 2HJFA 3G08B 4G80A 2CO3A 3ARDD 3NEXA 4WV1A 3FFDA 4M1CC 1AFVL 1EXUA 5FUOL 3GSOB 5F7UA 3UZVB 4ABQA 1DE4A 2XETA 4ZPTA 4X50A 2F58H 4F91B 4QOKD 4G43B 5KYUA 2VRKA 1AOZA 4PS3A 3KGUA 2R2HA 3EYSH 4K7FB 1R24A 4LSVL 1ZHBB 2ESVE 4KWUA 4QRBA 5DJ6B 4D9QE 3A6BH 1T5WB 3RNQB 3X17A 3NJHA 1X6LA 3M8OL 1CMOA 1T03L 2ZOLA 5DD3H 3N04A 3VD2A 3HG1D 4APQD 2Z1PA 3LKPA 3QUZD 4WTWA 5ABAA 5IBLC 2ZX9A 2HUEA 2QGEA 3C2SA 5LDSA 1AI1H 5AVYB 1G6RH 1IEBB 2WK2A 3CLWA 2X41A 3FCUB 1S7WB 2IWFA 1SLWA 4ZAKD 2AEPH 3CDZA 3ZTCC 4KAQH 4PQXA 3RTQB 2YKLL 1KB3A 5JORA 4PGJA 2DQGL 2X4PB 4PVLA 4YSEA 3KJ4B 2ZONA 4H7VA 4BQ8A 1CQYA 4HV8A 4M7ZC 2C3XA 2VDMB 3Q06A 3VXSA 1LEIA 2E6PA 4JQIH 5DLLA 5A1AA 3BGMA 1UB5A 3L5XH 2BP0A 3WE6B 5E94B 2J88H 2ZP0T 3N41B 4X7SH 4CVWA 4NQCA 1PS3A 5T5FA 3FO9B 1NFKA 2JSFA 2DMKA 2WUBL 2A9BA 5E5UB 4K5MA 3KPRE 4NBYB 2XIDA 3E2HB 4NKDB 5ICUA 3X2QB 4BYHA 1WZMA 4MNGB 4N0FB 2WBWB 1A7QH 4MVBD 1IEAA 1J5DA 3QO1B 4OI7A 4M6OH 1AIZA 3SKUD 4H0LC 4JJOA 1VKXA 4L3EE 4R90H 1YPZE 2XN9E 1J87A 4GKLA 1IGYA 2PTVA 1Y6NR 2X4OB 4QHLA 1MIEL 4LLQA 1KLUB 1U21A 1XGUB 3B43A 5BOJA 4MMXC 5HVWA 1MCEA 2HVJA 4JS7A 4ZQTA 4BZ1H 3N9GL 1G6RB 3R8QA 2WXJA 1OZUA 4NN6C 1OCOB 1ZGLP 1ASQA 2OXGB 1LO5A 1DCLA 3SPHA 5IBTL 4P46B 3VGGA 4IOSA 3IGFA 3D7PA 1TF4A 1CD8A 4P3CL 4IGBB 4Y4FD 1N6QL 3JWNH 4NKMB 2YFOA 5LUMA 3SKNA 4JFQA 5F0MB 3S6CA 3X11B 3WNPA 3GRWL 4OZFG 1OXYA 3KPPA 3RKDD 1W0YT 3QGVA 4L2LA 3HC3L 3SE3C 3HC0B 3O4LD 1DSFL 2X6VA 1N59B 4AXWB 3BN9D 4XN5A 3SGDI 2YPLD 1CB4A 3V55A 5IMMA 1U36A 1WIOA 4J5VA 4X9BA 4HHAB 5BOZG 2D3VA 1C1EL 4WFFD 4YBLC 4JKKA 5ANMA 3VTTA 2ZX8A 3FQUB 3HBPA 4O2EB 3CGTA 2RALA 2X09A 3UDWA 5BS0B 3ARBC 2A83A 5BVJA 1TSHA 4KGLA 3RWEB 3TVMD 2DQTH 2F54D 4OM0L 2RHEA 1WA2X 3BT2L 2ZYSA 2EC9U 2GK0A 5I15L 4PSPA 1XEUA 3CQQA 1R33A 3ATDA 3UJJH 3K8LA 3QXAB 3PP3H 5K9OB 2YEQA 1J88A 1JGUH 5EBMA 4GS7B 1YEEL 4NC2B 4BCZA 3PHQB 1OW0A 2OL3H 4X6DE 4ALAC 3VFTA 2AXWA 1DBKH 5LXGL 2VSMB 3CN0A 4KVCL 3OLEA 1S7UA 2XQBH 4MQTB 4YE4H 2ZCKL 2GT9B 2VDQL 2YGVA 2ZPKL 2XVBA 1LMKA 1D5ZB 2X4RB 2X05A 2WLYA 3MRIA 2G5BA 3WTXA 5CN2A 2GUOA 5E1IA 5DJ8B 5F7FA 3UROR 2P5ED 3T0EE 4X5RA 5DD5H 4XCYB 3QWQB 4HUMB 4RSYA 5GGRB 4I1RA 1FN4A 1WG3A 3RJDA 1KGUA 3NTCH 3GSNL 4HCRH 5EH1A 4XXDB 2A0LC 4MMYA 1UCBL 1F90L 1I4FB 2XKUA 5B22A 3OZLA 4GNKB 3LEYL 2IPTL 3EBGA 3O0RL 5SV4A 5D4IA 4JFFB 5B3JF 4HGWA 4UDUB 4FQLH 3BAXA 3GSRB 4HG4J 3KBEA 3FOMA 4NQED 5HYIA 5D2LF 2X9YA 1UXLA 2JI2A 3HG0A 5AW5B 1PPIA 1NGYA 5ANHA 2QHRL 1PU0A 4HH9A 3WD5L 1E4HA 2P49B 4S11A 1EDYA 1UKTA 1HT6A 2QEJA 4OLXH 3SYQA 1D6VH 3UIYA 1BA9A 4G6AC 2XFXA 2X2JA 5MERA 1N68A 1SEBA 3SDDC 3E7JA 2SODB 1NGXB 4G1EB 4ODWA 3BISA 1D9KC 2OL3B 4LIQL 3EGDA 4QCIA 3PLYA 4H8HA 3OAUL 3O9WD 3R1GH 1I9JH 4F3FA 4HUVA 2I24N 4NRXB 3H8NA 3IFPA 4CILA 2OLDA 1JHKH 3M1CA 2IANA 1OP3K 1UFUA 1NPUA 4L5FL 4EI5B 3FRPG 5HYSG 3OC8A 3U0WH 2C9QA 2BWQA 4S2SB 1Q9WA 5F6HI 2F8IA 4WKZB 4FEIA 3QJVB 1UM6L 3GMRB 2G0KA 4Z7OF 2WNXA 3EDDA 3VXMB 3ARBA 4Y4HB 1KLGA 3O6FA 1DUYA 1U93A 5AKSA 1WFJA 1WEJL 1NFDF 3OR7B 2MCAA 2DQFB 3ZE0B 1NCDH 5EZIL 1W8NA 5DYOB 1P6AB 4HZLA 4GQZA 2DKSA 4ZQKA 1LMIA 1MFNA 5CSZA 4MD4B 1Q0XL 3KPSA 4HZ1A 1EVTC 3DA0A 3E8UL 4M9OA 3VXSE 3MA7B 1WA1X 4RRPA 4YZFE 1UWGL 4X98B 1V27A 4CBZA 5B38A 3LKSA 1JGVH 3HC4H 3MHZA 1UACH 3MRLA 3RTQD 5G4MA 1RZJH 2H6PB 4GUPA 1FSKC 2DWSA 1A7RH 5AVZB 3LKOA 1VPOL 4XP6H 4K3JH 4XP9L 1XEDA 3BRFA 3DK0A 2XWJA 2NLJB 2MJWA 1JVOA 1MHCB 4Y5YC 2YC1B 4AGOA 2BDNL 1TQBC 1AG6A 2ZCHL 1B4TA 3MCKA 3FSAA 4UCFA 3IPFA 3B3IB 1GZQB 3M07A 5IB4A 2A2QT 3N5AA 4EBQL 4P8QA 3E3QE 4EVNA 4LLUA 3FO2A 5HP5A 4P05A 3UTZA 4YXHH 3HMXA 1LP9E 2HLEB 3GSUA 4OJDH 5BRZB 2W9DL 4FC3E 3AXIA 1Z7JA 3HAEA 1T80A 2Q0ZX 1K2DB 2ERJB 1P4IH 2D9QB 4G42A 2Q7YA 1BZ7A 4BK5C 3MJ8B 3RDTA 2CHNA 1QFPA 4M8QA 1L9OA 4N0CD 5KYWB 2R2BA 5CSBA 5F7LB 3BGFC 3PNWB 5JW4R 2VXVL 4PJBB 1RHHB 2IOIA 2NTFA 3KGRA 1VACA 4R97C 2R4RL 2RAMA 1D9KA 3K6FA 5CIPH 1N3NB 4WWOA 4PP1C 4P46D 1PDKA 4J3OC 4J39A 5DZVA 4JMXA 4ISVB 3CMOL 2DLEA 4IGBD 2Q20A 4JX0A 4RFOH 4A04A 5CZVL 1OE2A 4FFWC 1MUJB 5I1AB 3C60B 4ZMWA 1OSPL 2B5IC 1MJUH 3P30L 5AWNH 2FX7L 4FQQB 2ZXWB 5DZPA 1ZPLA 5AG9A 5HI3C 5H37G 2FSEA 5B1JC 1PLGH 5G2NA 2VH5L 4OF7A 1F6FB 1QKZH 4GI8A 1R3JA 1DHKA 3NOIA 2GJJA 1FNEA 1IVTA 5GZNA 1VRSA 2VDNH 5BS0D 1KXTA 3RFZC 1H15A 3QC6X 3MLZH 2XG4B 4BFFA 1XGPA 4G6MH 5GGTL 5CXPA 4UQ9A 1JPTL 4UYQA 3HG4A 3UBXA 3TBVB 1FE8H 2AJYL 3HI6H 5E2WH 2CBTA 4Y2NA 4Z7QF 2OCFD 5DUJA 5F9OL 2YMTA 3MRHB 3F00A 3GSQA 1KCSH 1ODAA 2RGSA 1CI5A 1IBHA 1YJDH 3V5KB 2HXAA 1S9KC 3PWUB 4Q9RL 4JEGB 3Q13A 3MLYL 1A6UH 5JDSB 4NENB 5CIPB 3QPKA 2VDKH 1S6NA 1Z0NA 2AEWA 2OMTA 5C0BB 5CR1A 2V7NA 2WN3A 4ZMLA 4PN6A 1AO7E 2Q1EA 2ICEA 4FG2A 4F33A 1FZMA 5E70A 4ZYKA 2X70A 4UIKL 3F01A 1QEWB 1G9EA 4YFEA 5IHLB 1JGEA 2FO4B 4GIPD 4M1GH 2Q2EB 3ESVF 5I1CH 4RISH 5LGHL 4MCYA 4M9PA 3HZKA 4GXVH 4AUJA 4EXPX 4FGMA 1DVFA 3ILPB 3MXWH 5BOPA 3A24A 4LRNH 4HIHB 5A2LH 4FQIH 3QDGA 5EUKA 2BJMH 5D6CB 1A5FL 4X6EB 2B4CL 1JZDC 3TN0C 5BMFH 4X6CA 4BK5A 1GMEA 4BA0A 5C0DB 5FAAA 2ZUXA 4JFFD 2G2PA 2G2RA 2VDNB 3O8XB 2BPBA 4WENB 4M4RB 2YD0A 3VXRA 2F7IA 1JWSB 4JHUA 5DLML 2YWYA 3TYGH 1YDPB 4GG6A 3L81A 1OD7A 4MYWB 2X2YA 3OKLB 3F65A 4NWUL 1BEXA 1D5IL 3II1A 1BFSA 5C08B 3VU2A 3UAAA 2XBTA 5KG9A 3V52L 3VMNA 4PTUB 3U0TA 3BPCB 4HPHA 2XI9A 3B34A 4ANUA 3SOBL 1SOQA 2A6DB 2XTJE 3NCJH 1NH6A 1XO8A 1TQUA 2VDKB 3WUWB 1GC1C 5E8NB 1AAJA 3LQMA 1I1CA 5FX3A 2HRPL 2G4GA 3MBWB 4UINL 2OTPA 3ENEA 2ADJA 3P3RA 5EZLA 4ZUTA 1NCBL 3JVGC 2PCYA 1R9FA 1T1XA 4AIXA 1ML0A 2E7HA 2AJSH 2XWZA 3X14B 4TUKH 4EI5D 1OL0A 2AK4B 5FKAB 3BD3A 4HLZG 2H9GA 1HE8A 1RP9A 3DARA 6PAZA 1GS8A 3CSPA 4HK3N 3VFGH 3BQUB 3KPSE 3A0OA 3GHEL 1C5CH 3BVVA 1U3HB 1OAXH 4ENZA 3BXNB 1GVIA 3VXMD 3FT4B 1MVFA 2XLLA 3AXLA 4L9LC 3D4ZA 3RFZA 1BJMA 4Y4HD 3IXTA 1BFOB 1ZTMA 4E9LA 4APXB 3G5ZA 3BH9A 1G1CA 2JI3A 3CBKB 4PSRA 2X6BA 1DQJA 3TBYB 3B9DA 3HBZA 4UANA 3BUIA 1O6SA 2PCPA 3LJ3A 5C2BL 2N7SA 2HTLD 4K5PA 3PWPA 2ORBH 4QYOB 2JKLA 4HOXA 3CX5K 1UWEH 1HOCA 4LMQE 3ZYZA 3HIZA 2Z0BA 2NYZA 1DEDA 4YO0A 3NJVA 2NYKA 4P4RA 2OYLA 5IV2B 5DSCA 4O5LH 5FYKU 2ADIB 1AE6L 2XBDA 2NY7L 3L3IB 1LO0H 1RUPH 4I9WD 1NCCL 4KHTL 1WHOA 3FRPA 3C08L 1I8IA 4UNUA 3TP4A 1I3UA 4JFYA 3ZE0F 3HB3C 4AYFB 2F7QA 2N59A 2PXYA 4NYLA 1CL7I 2B0SH 2DJMA 4D0BB 5HI5C 1OPGH 4WWNA 2MQCA 1IKNC 2QV4A 4HJUA 2GHWB 4H5SB 4IKIA 3FUIA 2DQUH 4ODHH 2G3NA 2OMBA 3MGTB 4RZCB 5GS1B 3QO0A 1BBDL 1IM3A 4WEBL 4XHQA 1JSYA 2VJ0A 3I74A 5FDWB 1I3GH 1JHTB 3QCUL 2VN5A 2HB0A 1OWWA 4AMXA 1CBJA 3KW8A 3PGFL 3OAZK 5BRZD 1QI3A 5E8OA 1RU9L 2VXTL 3MRDB 4CMMA 3OC5A 3QJHA 3BE1H 4TTDC 3ERXA 4HDIB 5EZJA 2JF1A 3MODH 1JV2B 4PRIB 2WKLA 3QQ3A 4GEJA 4YR6A 4PGDA 5MEOB 5C2UB 4K7PH 3O6KH 3EYFB 3UTSB 4YEEA 4NRZB 4M3KB 3L95B 3BIKA 5EO9A 1GOHA 3IS1X 4ZO7A 3FCTB 2XC8A 2VR7A 1KFAL 5DHYA 3JVGA 3MRNA 2JJSA 4BZYA 1FO0L 1N2RA 3UACA 2EZ0C 4V2BA 3C60D 4Y19E 4TLTA 3ZDZB 4MB1A 3KLKA 4CADB 4J8RA 5LBGA 5KVDH 1NMAH 3CN2A 1BW8A 1F3JA 5IESL 3HZMB 2OXHB 3BKYH 3MRGB 3T0VA 3EF7A 4ZO9A 2MNUA 4X5WA 4FLSA 4JO3L 5HI4C 2FJHA 2VITA 1MXDA 2IVFC 3WXVH 1ZAGA 3QUKB 3MFGB 1DQQB 3NK4A 2QR0A 1CF8H 4U6TA 3CLFH 4BFNA 2H1PH 1WCBA 5DT1L 4RWYH 1OTTD 3SPVB 2VDPB 3Q2LA 1T83C 4Q9QL 1O0VA 1IC4H 1CD1B 2UX6A 4BKSC 5DZJA 3N1QC 4M5SA 1HINL 4CNIA 2GEEA 3BSZL 4PVNA 1ZIAA 3EW3B 2IH3A 1TQCB 2BP3A 4YC2C 5GZOA 4LDLB 5BQ7A 4K94C 4Y89A 5C0BD 1LDSA 4OGAC 4F7PA 2H6UA 1KTBA 3CDGA 4U1LA 3MCLH 2VCOA 3QORC 4FA8A 3VXTA 3B2VL 3DX7A 3DIFA 4HEPA 4PJEB 4YSTA 3SKNB 3GXIA 3ESNA 1YEKH 5KYYA 4XRCB 3BJ91 3VXRE 5D96C 2J4WH 2J43A 2MCPH 4MA7L 5AW2B 5K9JH 3FJTA 1HS6A 2DMHA 5C0EA 2CUHA 3A4AA 1CURA 2GJ6B 4WHYH 2HFEB 4F93B 3MV9E 1ZXQA 1PKOA 2VE6B 5IMMB 1RZKC 3PXHA 4XCFH 2JKRM 2I7SA 3IEAA 2ZXCA 1MDTA 1XZWA 1PKQE 3U9PL 2QSVA 3DO4A 7CGTA 2G0LA 2WVVA 4OZIE 1WWBX 1NBZB 2OTWA 3O8XD 2ZUWA 5IBUG 1YNKH 2H2PC 4E41A 4CAGA 5CWSA 2E9WA 4B9YA 2W1NA 1KC5L 1SGKA 3L3HB 2WLKA 4QRFA 1E5BA 4LEEA 2KUTA 3GQFA 1PYWA 2VDML 2H2SD 2MOGA 4POUB 1MCLA 1ETA1 5C08D 3VRJB 5K9QI 3Q6GH 2FTAA 4M93B 1RK1B 3FF8A 2VYRE 4PJ9A 2ED9A 3Q8EA 3S9DB 2ZAGA 3LZNA 4RQQB 3FMGH 4MJ4A 3GSWA 4CBPA 1XMWA 1RD6A 4AW4A 1CE1H 3CZFA 3EYSL 3M46A 4GRWE 1L3NA 1EEQA 2DDQH 3H9HB 4WAFA 2AQSA 5ICXA 1Z5LA 4XNYH 5ETUA 2AK4D 1ORQB 1NCOA 2IAMA 3A6BL 3DX2A 4LLAA 4B97A 1L6ZA 3O3BB 4HGKC 4WW2C 3H42H 3KYOA 4AI7A 3BQUD 5DD3L 3L4CA 1WDAA 1U3HD 3UMTA 1DJWA 4I8DA 4RGMB 4AT6A 1BVKA 2HRLA 2VL5A 5A7BA 1AZUA 3LH9A 1ZLWH 1AI1L 4G8GA 1G6RL 2MTPA 3RZCA 1OB1B 1T83A 3VSUA 5KANI 1SXCA 5E2TH 2AEPL 1L0YA 2H0EA 4KAQL 1A66A 5FKPA 1PZBA 4KK8C 3QXTA 4WI0A 3VYNA 3EOBB 4IRSB 2CBPA 2MCG1 3ABLB 4U1JA 5HDQH 4UAHA 1FNFA 5LGJA 1TPXC 2ITFA 1DFXA 1IRAY 3LXAA 4NZUH 1IVLA 2WNKA 2M2DA 3ATBA 2LLGA 5FHAH 3QP3A 4TSCH 5JQ6H 3AGVA 4LLWB 3SE4C 4JQIL 1PAZA 1T7XA 2IV9A 3AY4C 4LEOA 2BVYA 3L5XL 2W92A 3KPNA 2J88L 2VM4A 4X7SL 1WE5A 4P2RB 2YLKA 2WZPA 4JHZA 1EJ6A 2MCMA 1F00I 3K74B 1OTUC 4Z7NE 4ODWB 2VQTA 3FQYA 1KUMA 1ACYH 5DTFA 3RTLA 5F7DB 1CDIA 2JIXA 4PLJD 1FBIH 4LRIC 4EQ3A 4B9CA 2XSKA 4Z78B 4DTGH 3O3DA 4PJ5E 4CJ1A 1DEEA 1T1WA 5E4EC 3RIFF 3ZW3A 5JXAH 1P5UC 1U8HB 2CMRH 4M6OL 4YUEH 3IFLH 3Q2NA 3ECQA 4YHKL 3P2DA 4NO3A 4YHYC 2XTSA 5DC2A 1COBA 4C56B 1EDHA 3CHPA 5SWZA 3LKNB 3T2PA 5CN1A 3FB5B 2NUPB 1GGCH 1E2VA 3MXVH 1J8RA 4BZ1L 2L4OA 5ESQB 1U93B 3BIAX 3RAJH 4KZDH 2UY7A 1GJUA 4N0UB 4NKIH 4Y16B 3EJTA 3CXDH 3JUYA 3UOAB 4PRID 3VI4E 3RWDB 4X83A 2ZKXA 1KTJA 3QXDB 5CSZB 1M3IA 3UTSD 3RUGF 4NUPA 1N0XL 2O6DA 4DO5A 2ATAA 1D7DA 3FCSB 3WKPA 2UZIH 3KWVA 3MRLB 1NDMB 3BVNB 3L9RB 4M8VA 1NLDH 4QPEA 3V4PA 2FGWH 4GUPB 1PJ9A 4AGLA 2LU4A 4HPYH 2VR3A 4WW2A 3LKOB 4WWKA 3KYNA 5HJDA 3LRLA 4YVUA 4HF5H 4QJ5B 4LPTA 3KBPA 4Q6IC 1J18A 3IFOB 5ISZB 4XE5B 4B9GA 3BO8A 4UOZA 3AG4B 2DQTL 3GSVB 9CGTA 3S7GA 2AKRB 1UT9A 4PS4L 5I73B 2IC2A 3OKMA 3EYQD 4X5PA 3UJJL 4PGEA 3C5JA 1C5DA 5DD1H 1CGTA 4PJDA 3UAFA 4GSQA 3I3EA 3GSUB 4LDCA 4QO1A 1JGUL 2UZXB 4AL8H 5JPNA 2OL3L 2FT7A 2JFCA 3H9ZA 2RACA 5E4OA 3GLZA 1DBKL 3D1MC 4DW2H 3IE4A 1P7KA 4L8DA 5HYJE 4NQSA 3SE4A 1TU2B 2CIKB 4WCYH 5DRNB 4TUJA 2XQBL 3T3ME 3PU7A 4YE4L 2VLRA 3D18B 4OZFH 3D4YA 4QRSB 2W07B 2P3YA 3JWDH 1Z2KA 2EIBA 5C3LD 4U6HA 3WGVB 5B4MC 4LRIA 5DD5L 4JFDB 3ZHLA 2RA1A 3L13A 4BSWA 5DJDA 1G0DA 1EBPA 3NTCL 4JHVA 4C54A 5FO9B 4MJHA 1VJSA 2UWEF 4TPRL 4E41E 4PJAA 1CUOA 1A7OH 2JKNA 3KXFB 4FQLL 4R4FH 2ZUQB 2GJ6D 1RUAH 2CKBH 3JT0A 1FVCA 4HMCA 5EUOB 2EICA 4KKBC 3ZMEA 2D31B 5FEBA 4GAYB 5EEXA 4OLXL 4QMEA 4PJ5B 1D6VL 4E36A 1LGVA 1ORSA 2CRMA 2RB8A 5ITBH 4ZOBA 1KXTB 1SLUA 1S78D 4GI9A 1KJ2A 1AZBA 2BFVH 4HMEA 3RGVB 1SLVA 1FV1A 2J44A 3R1GL 2OZ4A 1I9JL 5LAPA 3KWXA 5EOCL 3IJSA 3CG8A 1JHKL 3QS3A 3NIGE 1YCSA 1UGNA 4OZFB 4R0LA 4XXCA 2ZSVA 2L7JA 4PRHB 2ATPB 3OL2A 1EHKB 4DP0X 1KTKE 2VT0A 4C47A 1SJHA 3QIUB 1S8DA 1EFXA 4G8GE 4AQAA 3PGCB 2GUYA 1Z5HA 1ZK9A 1TQWA 4HETA 2CPCA 5JA9A 1ADQA 4Q6IA 4RX4D 4MSWA 1E5CA 1FGVH 4PJGA 2VXQA 1A2YB 2ICEB 3NK3A 3NPSB 4JFEA 2FLBT 3ZUNC 5AALA 5FYLE 3U1PA 5E9DE 4BQCA 2IALA 4JDVA 4OFVA 3ESUF 2XIBA 1OSEA 3AG2B 5EOTA 5CJOL 5KSVA 3N43B 4XNUH 4QHMB 2CKBB 4FQXA 1NPNA 1CDHA 1G9MC 4GB9A 5AAWC 1HFUA 2HJKB 5A40E 2X4SA 1EQWA 2EEXA 3QDGB 3OJDA 4WSKA 2A77H 1NDGB 5C8JA 1JGVL 3HC4L 5DHDA 5TE4H 3WSQH 3QK0A 1CBVL 3MV7B 3U30B 3H0TB 1U91B 1AQDA 4V2CB 3TNNB 3FUNA 3RZWA 1RZJL 3H9SB 3IAQA 3MRFA 4IRSD 3TF4A 1TSRA 5BW7A 4KXZI 5I17B 1A7RL 3BVUA 3OM3B 4PR5A 5H35B 4G9FE 4YPGA 4XP6L 4AZ8B 5HPMB 3WTUA 4K3JL 5JPMC 4B50A 2XX0A 4AITA 2NDFA 1MW2A 1ET8A 1TZHA 5GGVH 4IU2A 1C9SA 4JUSA 2C1OA 4BFJA 4P2RD 1A4JB 2E7DA 3FOLB 3QPQC 2B08A 4IBVA 1CICC 1IE4A 4HWZA 4PIRF 4L4VE 2CR0A 3UPRA 3OVUB 2OMVB 3NGBB 4YXHL 4NC0B 4J6IA 4OJCA 2Z7UA 1TOXA 1VFBA 5DRZA 4U0RB 5DMJB 3RNKB 2XN1A 4YSDA 4ZI8A 1JRHH 2IAND 3B2UC 1P4IL 2ROXA 3I9AA 3O0LA 3QNXA 4FFTA 1RZ8B 3H7BA 2H9GB 1JXFA 1RZGB 1ZT7B 3DI3B 4YDVB 1GHFH 4UQIM 3VE0B 5IJDC 4C56D 3OMZA 2NR6C 5ID1B 3QYCA 3LD8B 4G8FB 4W9GC 3AXLB 5D5MA 4U33A 3Q8CA 4MYPA 3VDCA 3KCPA 3LZLA 4MDIB 5E8PB 1B0RB 1XB6A 2YXWA 4LSUH 2MQGA 2VLJA 2EDKA 3VFWA 4AGMA 5J4MA 3MGAA 4Y16D 4L8CA 2DBLL 1OGAB 3J07A 2P5PA 4L3CB 3CVBA 4J4PA 2WIIA 1MZZA 3P1VA 4F37F 4HIEB 5LHDA 1J8HA 2YBRA 3CUPA 1A8ZA 2MHAA 1CJYA 1MJUL 3IDNA 5AWNL 4FP8H 1ZTXE 4TL4A 1X5FA 4PJ8C 4XNXH 2R15A 5DSCB 2XY1A 1PLGL 3QI9A 3WIFB 2FLMA 4K5NA 4RDQG 4BA8A 3F5WA 5HYSB 4F2EA 5JOPE 1JK8B 4LSSH 1I8IB 3ARQA 1QKZL 2FWSA 3AAZA 1OM3H 4UQAA 4LLYA 1A9BA 1MHHA 1ASOA 1IARB 3TIDA 2VWEE 4NYLB 3TT3H 2GC7C 4PJDE 1NQBA 1P84J 4L0PB 2VDNL 5AL8A 3GINA 3MLZL 5ISZD 4OV5A 4QIRA 3H54A 1V54B 4G6ML 2AQNA 3DI2B 3EYOA 3EJRA 4QTHA 1UM5L 4JPIA 4A2EA 3TJEH 1FE8L 3HI6L 3ZLQC 3SZ6A 4WU7A 5AD0B 3QH3A 3NCMA 4HKBB 2DJ4A 2CAKA 3GLDA 3H7LA 1ED3A 3DV6A 2FRGP 5GHWH 1YJDL 3QG6B 1BXAA 2FK9A 2PLTA 1ZV9A 4IJTA 4AK1A 1AR1B 1A6UL 4CMMB 2VDKL 5JPMA 4CW1A 3G5XA 4UMSA 4P4KC 4L8SA 3VI3B 3BUTA 2E47A 5ADPH 3LDBC 3FAXA 4S0TD 1SXSA 4M5YH 2XOTA 1ZLVK 1F1DA 3G6JB 2N01B 4F80A 3ETBJ 2MNWA 2Y25A 4M1GL 5I1CL 1A02N 3L5IA 4RISL 4DZ8A 1IGTB 3VG9B 5H37H 2A7BA 3BIKB 4LSQH 4QLWA 4JFDD 4BXVA 3U6RA 2X1PA 4WUUE 4FQIL 1QTPA 1U8OB 1UOWA 2DIBA 5EIIB 2BJML 2F53E 5IMLB 5TFSH 1I3VA 2DLGA 5BMFL 5DHVH 2W5PA 2CALA 1P53A 2VLMD 3KXFD 3RYMA 1UC6A 4IMLA 2WJ7A 3KS0J 1VERA 1L9RA 5DD6A 1A0QH 1KOAA 2J1KA 5HDBE 3TYGL 3IFNH 2O30A 2OYPA 1EEYB 1E4XH 3BZFB 1LYQA 1OCZB 4PJCB 4PJ5D 4U1SA 4CN4A 5I8KH 2HG5B 5IROA 2HLFC 3STZB 4WU5A 4TRPH 1P1ZB 5LLIC 1T20B 2LT9A 4RA3A 1D6EB 1ACXA 3NCJL 3RGVD 3RRQA 1L4IA 2ZXEB 5D7JA 3BW9B 1GYAA 2Z0UA 1JXJA 2XRAH 5M94B 5KVEL 2C3WA 4EIZC 4GW4A 3X12A 1U92B 2WVSA 4G11A 4KK6D 4XBGA 2ZWLT 2Q2LA 3RWCB 5I75C 2AJSL 2QGDA 4TUKL 3CAFA 5LGYA 2JTDA 3FQ2A 4PRHD 1E9QA 2H3XC 3ARPA 3LTVA 4ZK8A 3VFGL 3DUSB 3QEQB 3QIUD 1C5CL 3QEHA 5TDNB 1OAXL 2K78A 4GSRA 1U2CA 2WQRA 2JCCB 5FGRA 1NEPA 5CZRA 4U1LB 3I6LE 1KBVA 1KPVB 3DX7B 4X5LA 2EYRA 1EGJA 2YKKA 4GO6B 5DHVB 1MFDH 5DJAB 4QRPA 4W68A 1WD9A 1J48A 4MBOA 3HZYA 3V2AR 3ZYIA 1NKRA 4ELMA 1T2QH 2R29H 4NI6A 1W80A 1ZDSA 2ORBL 3KYMA 4OFPA 3JQOB 1S7TA 2CHDA 3MRKA 1UWEL 5ESAA 3WHE0 2G5UA 4W6XB 4JR9H 1IFRA 2N56A 3P02A 3QDGD 2UY6B 4Y8DC 4MCZA 4BFBD 1IGIL 5L9DH 1SJXA 2I69A 4O5LL 3L3JB 5TF1H 3MV7D 1EIBA 1LO0L 1RUPL 3H3PH 5CBEA 1GGTA 1XF2A 3H9SD 5F96H 2ITCA 2YPVH 2A9AA 2NXZC 4GJTB 2GJZB 3PG2A 1U8QA 3BP5B 4UM9B 2B0SL 1BDYA 1OPGL 3ARFB 3K6NA 3I6KB 3R19A 2VKWA 1X3DA 2DQUL 3RLSA 3TO2B 4F7TB 4G7VH 3L4VA 1BQHG 3VXQA 3V9FA 3DIDA 1NUNB 4MCNA 5IKCB 1UJ3A 3L7EA 5E9NA 5AYTA 4CDGC 5T5FL 2X4NB 1JOIA 5BQDA 5AEAA 3GSWB 4KJYA 4PJFA 2BSCA 1HEJC 2VLJE 4WRLA 4NLAA 2C4FU 3DHPA 5B1BB 5ALCH 1N12A 1ZV5A 3CVIH 1ONQB 5ETUB 2VDPL 3BE1L 1OGTB 4NN7B 3CSGA 1J8HE 2X4UA 5AZ2H 3EJCA 3WIHA 1MCKA 1TFPA 1RXLA 4AT6B 1BVKB 5HDLA 4Y5VC 4Z76B 1N64H 3S37X 1E40A 3T3PF 4K7PL 4L9DA 3O6KL 1G84A 1XCTA 2G60H 1KYDA 1OGAD 3GBMH 3SPIA 3G7TA 3MYJA 1CVSC 3IJEA 3F7VB 2KERA 3JV5A 1U4FA 2WZAA 5JYLA 1U58A 4RETB 2BSED 1TMQA 3X3GH 4Z7VA 1G7MA 4L37B 4F2FA 4G6JH 5JQHC 3KG5A 5KVDL 1NMAL 3INUH 1AXSB 3QFJA 4OQTA 1I1FB 2ZYRA 3MR9B 4JZJA 3WMSA 3LRGA 3WJJC 5CILH 3LPGA 4LCUA 4LEOB 3SPGA 3WJLC 5I6OA 4PHXA 4BFOA 2QQQA 2E7MA 1CFVH 4GFTB 3OXSB 1GSMA 4HS6A 3WXVL 4OF3A 1PSKH 5CZXD 2R1YB 3LSOB 1CF8L 3DYMA 4ZT1A 3CLFL 4JDTH 4KRPC 4KNQA 4O4YH 2H1PL 4PRPB 3I2CL 4Q52A 1J9SA 5L88L 3GTNA 4RWYL 2GSGB 1CFNB 1SN5A 3ZE2B 4LFHG 3L3KB 4JG1H 4OFYA 3T2OA 1VADA 2AV7A 2BZ7A 4FFVC 5EEWA 3T4AB 1DR9A 1IC4L 1VB9A 2HWZH 3IMTA 4YDZA 3T5WA 4DP6X 1G7HB 3N06B 4P2OC 2VQ1B 2PWEA 4R4BA 1C08B 2OSXA 4ODXB 1BJ1H 2VB5A 3O11B 1AR1D 4XVJH 4CSSA 1E65A 3LXCA 2KYIA 3MJ7A 3MLWH 5I6KA 5D2NB 4NKOA 3SIKA 4Z5RB 2AITA 1KXHA 2N7BA 3QZBA 4YHPB 1BWMA 2OJ1A 5EU3A 3MCLL 1U8PB 2VLLA 4XNZB 5AL0A 1DVZA 2J8UB 1NUDA 5EU4B 1HIMH 4GLRI 5EZPA 1YEKL 2LGNA 1HI6B 5AG8A 2CR3A 3AT8A 5K9JL 2MCPL 4AM0B 4XHJC 4XGZA 4PRNA 3VFSA 1KYOJ 4M48H 3EO1B 2X9WA 3OHXB 3AREB 4MQ7A 2P28B 4WWPA 5HHOB 4XCFL 4H0GA 3IDGA 3QUMA 1BIIB 5AOMA 4DWHA 3AUWB 4NP9A 1XZ0B 2FZ3A 2CD0A 1ZA6A 1RJZB 1T66C 3VI3F 2AAVA 3LV3A 5EBGA 5B1KA 1I7UB 4KJQD 2AQQA 3VFOB 1YNKL 1AIFB 3G6JF 3DLQR 4MJ5A 4XN2A 3NCEB 4P3DB 4XAKE 4PY7A 3QZWA 5GJTH 4HFWA 3UX9B 3HVDA 3NACH 5EG6C 1OP4A 1CLYH 1I8KA 5I1JH 3QNZA 3Q6GL 2WKOF 5DZOA 5I66A 2F8VA 2CRIA 3BQVA 2H3KA 3MA9H 3GJEB 1EBAA 2VJ8A 1QWUA 2W88A 4QO1B 4UTAH 2EINB 5KEZA 2DWDB 1UT1A 3S37H 1CE1L 1RSYA 3H55A 1MELA 4N24A 2X6AA 4ZPVB 1R3HB 2DDQL 3WJJA 4QRPE 4XNYL 4YIQA 3P3TA 3TU6A 4HMDA 4ELME 1PLCA 4PJCF 1GXEA 3ZE1E 1KYUA 3H42L 4Z18A 5GZOD 4E68A 2O72A 3QEQD 1KB5A 3DIVA 2D3JA 2PPEA 5DRXB 4BRVA 2ITEA 3TBSA 1AZVA 4FXKC 2Y9RT 2HT3C 4F15B 1Y6MR 5CD5D 2YUWA 1PZAA 3UGEA 4X8GA 4FJYA 1P7QA 2YRBA 2GBTA 5DMKA 4K3DH 3HUJB 5F7WC 1FG9C 3X13B 5AW0B 1IGJB 3MUJA 5AOIA 3VXNB 2H45A 5FB8A 3Q0HA 5HDQL 1NBVH 5I1KH 4IK6A 3OKKB 4NZUL 1DQTA 3MX0B 4JPQA 4JRYB 5E6YA 3T8VA 3IPBA 5FHAL 4KKQA 2LU5A 4X9GA 5JQ6L 1XCQA 4I48A 5C07B 2JCCF 5KW9H 2TSBA 4YWGH 1FL6A 4UT6H 3WN5C 4HXBH 2YQ3A 3Q8FA 1U9KA 4M43H 2XWBB 2NY3B 3MJ9H 3QJTB 4UM9D 5F7BA 5AVVB 5A16B 1YEHH 2Y06H 1ACYL 1IGMH 5E0FA 3ARFD 3D39B 2JKSA 3OKOA 1WIUA 5FIEA 4MBRA 1FBIL 4PJ7E 1JE6A 1FZJA 3C6LC 3GJFH 2DOCA 1OT4A 5FM4A 3VFMA 4AQ8C 2NX5A 3D3VE 5IVZB 5JXAL 1QBLH 3CNKA 3K6DA 2CMRL 2WYHA 5IEHA 3IFLL 4WO4C 5C7XH 4B0MB 6TAAA 4LK4A 4HS3A 4UNIA 1I8LC 5D4QA 4IHOB 5F89A 5FYJH 5EBWA 3G04A 2J73A 4B3VA 1ZS8B 2J57A 4JY6A 3O2VH 2HT4D 2Z31A 4R5XA 1Q0YH 2GITA 1GGCL 3MXVL 1JAEA 4NC1C 4KZDL 1ZSDB 3MNVB 2UYLA 4NHCH 4NKIL 4DEWA 1W72A 5IBUB 3CXDL 2IALB 1K85A 4WZ9A 4Z7VE 3ARTA 4JDVB 3SQBB 1E30A 1KCWA 3K5RA 4OV6F 3P40A 5J1SC 2BW4A 4BINA 1VCAA 1AQHA 4UM8B 4Z3GA 2EUVA 1NAMA 2Z3FA 2QSTA 4QAMB 2IDFA 3BZ4B 4UUJA 5EBLA 1VEOA 3MUZ1 5B1CA 1HESA 1X4ZA 2UZIL 1KELH 2OMWB 2NXYC 1HVXA 2HKFH 2R56L 3MCYA 3MLVH 4AGQA 4C4UA 1NLDL 3DHMA 4QHUB 2FGWL 2NNCA 4XO5A 1I8MB 5FCUH 4PR5B 3UABA 4HPYL 4JN1H 4ZX3A 1PJWA 2WQWA 4HJSA 5KSBB 4DCQA 1O9VA 4HF5L 5A3ID 1S7XB 3OQRA 1BVZA 3LXUX 1OQOA 1QSFE 2FEEL 3W2DH 3GJFB 3REWA 1FFPB 3S96B 4GH7B 1OOWA 1TTRA 2Y6SD 2FJGB 2ISDA 3BD4A 3H2WA 2ALAA 4D9RE 3BEWA 1LE9A 4ODVH 3I75B 4GW5A 2TAAA 1MH5B 1I7RA 3W39B 1IQWL 5DD1L 4PRPD 2A74C 4OLWL 3CXHK 2CLZB 3PP3K 2YAHA 3ZO9A 4AL8L 4WFGD 5F1KC 2BY3A 5C09B 1UD8A 3QNXB 5FO7A 4HAKA 5DS2A 4CC1A 4DW2L 5F0PB 3ARWA 4S0HA 4JM2B 3D5OF 4WCYL 3QIWB 2UVFA 1UWYA 4MASA 3WL9A 4LOUD 3HE7B 4PRDA 1LHZA 4Y1SA 5IK3A 2IXQA 5IQ9B 3IDYC 1KCUH 4MAYB 3LN5B 3PDGA 3OKNA 3FPXA 2IGFH 2BHZA 3VNYA 1NGWB 2D0HA 3JWDL 4V1DE 3K71A 5GXBB 2ESVB 5CCKH 1XSIA 1PL3A 8FABA 1NANI 4RMVA 3UAEA 4CL7A 3V6FA 4TTGA 4X99B 4JZNA 3ZT5A 4E9YA 2XYBA 3SE8L 3OZKA 3GIZH 1CZ8H 3Q2VA 4R96A 4QGYA 5E00B 1A7OL 3LHPH 4R4FL 5K9KB 4WI4A 3FHAA 3B9AA 1RUAL 3ARED 1PLBA 1BREA 2CKBL 1DJHA 3SPJA 4YGVB 3RVWC 5HHOD 3H4HA 3BAEH 3KDPB 5CJQH 3TIDB 1FFNB 2V17H 1YZZA 1OHZA 2WO2B 5ITBL 3KDMB 1JYVA 1O75A 2CBQA 2NY1B 4DGVH 3I3DA 3KPLB 3GEFA 4UNVA 2XBZA 2I07A 3DVNA 4PBXA 2BFVL 1KYFA 4ZTPH 1TZ8A 2AVGA 3ZRSA 4FTVA 2DM4A 1XQ4A 1RERA 4BZ2A 4MWFA 4WU7B 2JQAA 2KQMA 1A3RH 5J9PA 2XY2A 2OMYB 1BZ9A 3MO1A 1EAQA 1ED3B 4FNSA 1TKWB 1RIHH 5HGHA 4I5BB 1S7VA 4LQ1A 4ZSOE 3KPRB 4WHCA 5C0ND 1O9ZA 1YEIH 4Q58C 2QMJA 1KYAA 1UA7A 4KUCF 1W9XA 5HGAA 2J55A 4W4OC 5EFIB 2NQ3A 2P44B 2YFNA 1JERA 1BLIA 1WF5A 4IRZA 3UADA 4M62L 4BFRA 4X6BA 1BYPA 2XN9B 3ZDXE 5JMRA 3WEXB 1YEDB 4LSRL 2P5WE 4UB0H 1JF6A 3EOTL 2DQIH 1H6UA 2J1ZA 2J1YA 4S0SD 4ZFQA 3QQDB 2WINA 5C0CA 3DX9B 2A6JB 4XNUL 1QP1A 3VCLA 2EILB 1C12B 1AXIB 1AYRA 1IIIA 4KX7A 3ULVF 3QDAA 4KTYA 2A77L 4MXVE 2DLIA 2F19H 3JTBA 5I0DA 5TE4L 3WSQL 4PTTA 1KB9K 2P47B 3SO3B 4FG0A 3T77A 4PV9A 3FQTB 1MF2H 4AE1A 1R0AH 1EHLH 4AUYA 2IH9A 3CFBA 3VDBA 4JRYD 3R8BB 5HHPA 1NJ9B 5D9SA 2ZXAA 1CYGA 4RGNC 2NX5E 3KLHD 5C07D 5BZWA 5D7EA 5GGVL 2OS7A 3M1BA 4PD4K 4O2CB 1M53A 1YQVH 4PRBB 5AW8B 2NY3D 2QSQA 4IHBA 4CGTA 3D4CA 5HYEA 2H0FA 4NNXA 3EG9A 4C4BA 5T3XE 4JN2A 1KJ3H 3AXHA 2O5YH 2X89A 1H6TA 1BFTA 3D39D 2A1WL 2KPWA 5DR5L 5F2FA 5J3HC 3V0VB 4ZW7A 4MS8C 3V79C 3QRGH 1F6AA 2VNCA 3VWJC 1NDTA 4HIQA 1EEUA 5JR1H 4PVMA 1E9OA 3T9WA 2UXGA 1K5NA 2XVGA 2W65B 1F86A 1T2JA 1HL9A 1YN6A 1QA9B 1UQSB 2K6WA 2EDOA 2XHNA 1GHFL 3ELQA 3AFLA 3PJLA 4AIZA 5E4IA 3UYRH 1C16B 1BM7A 4X4KA 4X6DB 1G1KA 4U6XA 1THCA 1QACA 2V7HA 4GPVA 2BP8B 4LSUL 2ZNWA 3IU3B 4ORZC 1CD9B 2XWTA 2V2WA 1CGYA 4X9FA 1XGZA 1QPPA 3GXUB 4OZGF 2MWCA 4Y8AA 4NDMB 3DOSB 3HZYB 1MHPL 1BSIA 3TXAA 3WJMA 5L6YL 3Q1SH 1E8WA 5FUCC 2JI1A 3T0EB 5BZDA 1P4LA 2Z4QA 4LQFH 4FP8L 2GIYA 3AABA 4L48A 1H19A 4XNXL 4ELDA 3FUJA 4MCZB 2X2HA 3K6OA 4W4OA 3U0PA 4MXQC 4H1LA 3D2UA 3IF1A 1OB0A 1BZOA 5F9WC 4PG2C 4QY8A 3UO8B 4LSSL 2EIZB 1IM9B 2ITCB 4DK3A 3S2AA 1OCRB 3VRLE 3N91A 1R6VA 1TEYA 1A9EA 1MCSA 2R7EA 1OM3L 5B8CB 1TYRA 4QKTA 3C5ZC 2D73A 2NNRA 2QKIC 4DGWC 1FVDB 3MLSH 4PGBA 2ZKHL 1VZHA 2Y5QA 2WBXA 3D25B 4YDLB 2C1PA 1KXVA 4YHZH 1YUKB 2ZX6A 1DTUA 3MV8A 5E9AA 3R4RA 1D5BB 5E23A 3TJEL 1U42A 3VXQB 1INQB 2DV6A 3RI5K 4GW1A 1AD9A 5F1NB 5FYJD 1K6QH 4P5TC 3DVGB 4YL4A 5FOJA 2NY5H 4NN5C 4IBUA 4N9GB 3PAYA 4WFHD 4MCMA 5JHLH 1D7FA 5GHWL 5B39A 3L2NA 4MD0B 2H6OA 4K3HA 4KJPD 2AJXH 5DJYB 5I2IB 1EAOA 1XF5A 1ZV2A 3VRIA 3V4LA 5C09D 5KSBF 3VGAB 3RX8A 4AQEA 3QISA 3BUYB 3FU7B 2KT6A 3S3BB 2ZWZA 4EQ2A 3QXUA 2WQSA 4JM2D 5ADPL 1ZHNB 4FQJH 3QIWD 5C71A 3MRJA 4MQXD 1IFHH 4GRMA 3EBIA 5D7LE 3HE7D 3LMJH 2FX8H 3TESA 3NIDF 4AVKA 4MAYD 1ND0A 3APNA 4KKLC 4EJ1C 2ESVD 4KOCA 3UZEA 1XCTB 1AQ8A 4LSQL 1R5VB 4D9QD 2EVJA 5H4YA 1KIQA 2QADC 4JO1H 3KBHE 4NQDA 5C0IA 2G3ZA 5I1DA 4NC1E 4OR1A 3ZKMD 1KIUA 5DC9B 1UZ6E 1EO7A 1KPRB 4N2AA 5TFSL 3HPJB 1GAFH 4UAOC 2WBJC 1KZYA 2D0GA 4Y2DC 4GSDL 1UATA 3DMMC 4OGXH 1LNUB 3B37A 4FTVE 2YRPA 5C0JA 3BKJH 5KAQF 4MZ2A 3T09A 5J6GB 3IFNL 2BO0A 5C9KA 2ODIA 3RBGA 1E4XL 4KNTA 1XR9B 4ONFH 5F70A 1U8NB 1UXSB 1JPST 1BYNA 4Z77A 4PJHB 5I8KL 1N5AA 4J3WA 3VXPA 8PAZA 2XA8H 2NY1D 4TRPL 3Q8BA 3VJ6A 3N1PC 5EC1B 2VZOA 2K6ZA 4S1QH 3S3CB 4ELKB 8CGTA 3C5SB 1HK6A 3ULSB 3B7UX 1XSJA 4NZDA 1IFGA 3HE6C 2Q86B 1WYJA 1EHAA 3TBWB 4N3TA 3KPRD 4HIXH 5FOBA 2LU7A 1GKOA 1XGYH 3NSXA 5HHNB 1EZLA 1G7LA 3C5ZA 4YSCA 1LP9B 2QKIA 1UZGA 4ZS7H 4C4KT 3IKCB 2MOQA 4X7DC 4LOVA 4Y9EA 4K15A 1J9QA 7TAAA 3IRPX 1QSEA 3VFVA 5BVPH 2XN9D 4QRUA 2NYYC 2ROYA 3O6LH 5F21B 2LABA 1MFDL 3JWOC 5T1DH 3NZ8B 5AB1A 3TEWA 3CFCL 5F1IA 4P5TA 4L1LA 4ODTL 1NKGA 2R29L 3NJFA 1H3XA 3WIAA 4JDEB 1YEWA 4Q9BA 4FYSA 4LL9A 3EDJA 2VN4A 3L9BA 4M7LT 5JQIB 1UXWA 4HSQA 4JR9L 4JHAL 1ECYA 2NW3A 2ADYA 1ETZA 2OMXA 2ZOKB 2BIMA 5L4MA 1KJVA 3EJJX 1UYWH 3ZMRA 3LS5H 5L9DL 1OZTG 2R69A 5H94A 1KEMH 4FQHB 3LN4B 3QZPA 4HYTB 4XPFH 1KGCE 1PEWA 5TF1L 4WTXA 4N8VG 3EJPA 3H3PL 2MPAH 4U1MB 1YECH 1YPZF 5F96L 1FNGB 5LG6A 2YPVL 3FAWA 1YY8B 1WSST 2BNRA 2B39A 5D7KE 4A7GF 3S8GB 4JRXA 43CAA 4IRJC 5K39A 1JNHB 1MZYA 3QC5X 4AWJC 2FJFA 3L5WA 1PZ5B 1R17A 1T3FA 1F3DJ 4G7VL 2AEQH 5GIRA 1KN2H 2C9UA 4L2YA 4XODA 4GBXC 2VR4A 4G7SB 1RZ7L 4RMUA 1ZVYA 4S1DD 5DFVD 4KQ0A 1CF1A 4HBQA 4Y2DA 3TJPA 1HNGA 4ICXA 4M7ZB 1H3WM 3UG5A 2FSDA 4OKDA 1UVQB 2HVBA 2YSSB 5ALCL 5D7KD 2F1BA 3FSOA 3AITA 3CVIL 3FQ1A 5EU6B 2HLAA 5GGUA 4YIQB 3IDJB 3FN0H 4WDIA 3NN8B 4YFLI 2HT2C 5AVRB 4U1IB 3P4OA 4NCC2 5AZ2L 3RVTD 1MQ8A 5BJTA 3S36L 4QLRA 4LVOB 4OAWA 3IJHA 2XKSA 4AY0A 4WI9A 3QQ9D 1O6TA 4QHKJ 1ES0A 4RAHA 1N64L 2A4CA 3S88H 5EWIH 4HKXB 4LOEA 4RFEA 2G60L 1WFMA 2YA1A 2XWXA 1XIWA 3GBML 2JKIS 5DURB 4UT7H 1JI1A 7PAZA 4V11A 5DK0B 5HVHC 2ATKA 4X7TA 2LFGA 2YLHA 4GRLC 5IB2A 3X3GL 5CN3A 5FLVA 4C59B 3T0ED 4G6JL 1Z9OA 1B0WA 4HBCH 4HSCX 4XCNB 5BO1H 4NN6B 4ALAH 2CUIA 4H26B 3INUL 4TYUA 4XAWH 4ORGB 4I48B 1FGNH 1P4BL 1NMCC 5CILL 5J56B 4OZHA 1BF5A 3DPBA 4HD5A 1IM9D 3RE0A 2HVKA 3SGKC 1CFVL 4U3XA 4XWOC 1FL5A 2VZSA 3P73A 1PSKL 1GYCA 1RIVH 3IMRA 4NIYE 4P0DA 5DS8B 5C0RH 4B41A 2VR6A 1BXUA 3SD2A 3OKOB 1JHLH 5I1GH 3FTGA 4JDTL 3ZYOA 4O4YL 2D8KA 35C8H 4DH2A 4RGNE 3X1FA 3D48R 5MENE 1SJEA 1R47A 4JG1L 3E1ZA 5A2JH 2QPFA 1S46A 4JFOA 4WKXA 4YBLB 1OPOA 2HWZL 4JG0H 4P57A 3PGDB 1P5VA 4JY4B 2AK1H 4ONOA 3DX6A 1WBYB 1J5HA 1NC2B 3UTOA 1DSWA 4XVJL 1R1CA 4NBZB 5D4HA 1XB8A 3DROB 1BVNP 5E1GA 1I1YB 1W16A 3MLWL 2NZ9D 2PTUA 3VDAA 2UYLB 2GSIA 3OF6D 3OJVC 1WTGT 4FFZH 2VABA 4LPWA 4QJ4B 5LQBH 1WAAA 2XNAB 3GMLB 4KI5D 2ZUVA 1JPGA 3P0VH 2V9TA 4TOYH