2JWYA

Solution nmr structure of uncharacterized lipoprotein yaji from escherichia coli. northeast structural genomics target er540
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
168
structure length
168
Chain Sequence
MVQQSEVRQMKHSVSTLNQEMTQLNQETVKITQQNRLNAKSSSGVYLLPGAKTPARLESQIGTLRMSLVNITPDADGTTLTLRIQGESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAPASVLAPSDVDIPLQLKGISVDQLGFVRIHDIQPVMQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of uncharacterized lipoprotein yajI from Escherichia coli.
rcsb
source organism Escherichia coli
molecule tags Lipoprotein
molecule keywords Uncharacterized lipoprotein yajI
total genus 29
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1620 Mainly Beta Sandwich Immunoglobulin-like Lipoprotein YajI-like 2jwyA01
4C47A 2JWYA
chains in the Genus database with same CATH superfamily
5I2IA 2AJYL 5EORH 1B6UA 1E4KA 1FORH 3TP4A 3UTTE 4IOIA 5HHOE 3CQFA 4FTVE 1O6SB 1QX1A 1Q38A 2EDWA 3SDDA 1UB5A 3EYOA 5T1LD 1N6QH 4L18A 4WKZA 3JV5A 4G9FE 5GS1B 1C16B 3GXPA 5D2LF 4MXVF 2WWKO 3OSKA 1CE6B 1J05A 4UM8A 5EUOA 3P4OB 1KEML 1CT8A 3FRPG 2YAHA 3EJRA 5I6XC 2V7HA 2CKBH 1UXWA 4MLIA 1MF2H 1H3PH 5B1BB 1TETH 2C7FA 4U1LB 3STLA 1BVLA 3VWJD 3WUWB 1OTSD 2NR6A 2ZUUA 3PXJA 3EJZD 4NRYB 2CUMA 5D71L 1OAKH 2LU7A 3OJVC 1DR9A 1PZBA 1ZTXL 2H3XC 4H8HA 5CP7B 3BYYA 2JB5L 2O72A 4I2XA 1FV1A 3KWWB 4WJ5A 1W72B 3PJNA 4PJHA 5D1ZI 4HXBH 1Z2KA 1J12A 3GMRB 3EO9L 2OFQA 2ZWZA 4Y2OB 2OJEA 4X6CF 4LZKA 3U4EA 2VDQB 3SD5A 1JG9A 1SXAA 4C56D 3WIIH 3UO8B 1B4JH 1NTDA 4JVUA 2N1TE 5FGCE 4W9HC 2TSAA 2ZT9C 3ENEA 4N0YH 3VFTA 4CMMB 2XXFA 4JFUA 4PJGB 1DSWA 3D0VA 1DL7H 4LARL 3IJHA 1ZGLP 2X2UA 1IBFA 1UACH 3O2WH 1BF8A 2G2RA 3DRTA 1FL6A 1EAQA 3CH1A 3RGVB 4DUVA 1VIWA 1NFDE 1S9YA 2YRBA 4HEPA 1RIUH 2DD8H 5EZOL 1J48A 4Z7AA 4Z77A 4RESB 2GJZB 2PN5A 1T4KA 1GGCH 3B7YA 4FA6A 1ZK9A 3GSQA 5I19H 3BESR 2GIMA 1NBZA 3DTDA 3E38A 2OXGA 1BPLB 1C12A 1V7NL 3AROA 2QKSA 3AT9A 2YPLA 4FNPA 4Y8AA 3WNIA 4ZMNA 5L4FA 3EOAB 5K69A 1BD2B 1VF5C 3HN3A 1T5WB 3P54A 4XNYH 3O6LH 2AW2A 2H3NA 3RFZA 1B2YA 1INDL 1AZBA 1LO4L 3QUXD 3L3DB 4N0RA 3QHFL 4PAZA 3RU8L 4Z95H 1IKOP 3BKCH 4ZO9A 3SDXE 5I1AA 2CJUH 2COQA 3KXFE 5LCVH 2WZPA 2MH4A 2EXWD 2IVFC 5E23A 4PJXF 1JRHI 2AJSL 3V52L 5CMAA 4OZFH 2H1PH 4HAGA 3K5RA 1FFNA 1AFVH 1KB5B 1M42A 4HV8A 1HHKA 5CZXD 1IEBA 2NNCA 1KNOB 3RIKA 2VDNB 3ML9A 1HFUA 3ZGHA 4MSWB 1JBJA 3CCHA 4FADA 4LKCB 4BWUA 4BEIA 1QI4A 1ZIBA 2OCJA 4XMWA 1T1ZA 1G5GA 5FGBA 1L3NA 4U6TA 4ZPTA 3SJVA 4ZTOH 1YUHA 4WWKD 4X6DE 2GIYA 2H1LM 3VQ1C 1G7IB 3IDXH 2LTQC 4WNSA 2YPVL 2NZIA 4PS4H 3V7AG 3FT0A 2UUDK 4X9GA 1JPGA 1J5HA 1IKFL 4YHZH 4LARH 4O2FA 1X9QA 4HH9A 3RL1A 5DS1A 4QI3A 1HL9A 2X38A 5AG9A 2DJMA 4OLZL 3RAJL 5DD5H 3IFOB 2X6MA 3DI3B 5ANME 2EACA 3N42F 3FRUA 5FDYA 4KVNH 4P5TD 1P7QB 2BVOA 2BHZA 2C9QA 4YHML 4Y5YC 1XR8A 1Z5LA 3MDJA 3SKMB 3SDCB 3QDJB 1KT2B 2TSBA 3IRPX 3JZYA 3QUGA 3O6FA 1LWJA 5F89A 5IV2A 4RRPM 2CDGA 3TOPA 3W0WE 1FZOB 5ID1A 2BHUA 1RFDL 4K7FB 3SO3B 4L48A 3WKPA 5GRVK 3MLXL 4WUKL 1L9SA 2C9AA 2ZCKH 2X2IA 5JOPE 2Y2TA 3LS4L 3VRLE 4BUQA 2Q7YA 1LK3H 2XG5B 3RDTC 4Z7WE 3HS0B 3ZDXB 1NQBA 4PTTB 5E9DA 1GGBH 3AG2B 2VN7A 1PNCA 2Y5EA 2BRRL 3VTAA 3L1EA 5EULV 2Y1ZA 2Z7UA 1X7QB 2BNQA 4JGJA 3S97C 4ERSH 5GZOD 5HBBA 4FZ8H 5HP5A 4N85A 5JW3L 2PW2A 2FECL 1NDMB 2FHBA 4Q6YA 2FD6H 4YDLB 3KPMA 2VDLL 5CN1A 2XLLA 5AVWB 1BFVH 1G7QB 3KPOA 1WIPA 3Q3GA 3ROOB 4HOZA 2DQCH 5E1AA 1W72H 2VWEC 3FUDA 4M1GL 4NO5A 2NR6C 4HETA 4NX0A 3GF8A 4FLSA 2CO7B 5DK2A 1WBZA 5EZLA 1N5AA 1UM4L 1NFAA 3D18A 2O61A 4YSDA 1K8IB 3CVHL 2KDGA 4NN7C 4U0RC 4ESKA 1YJDL 2DM7A 5ESAA 5BVJA 3ILDA 5DC4B 1YN6B 4OV6F 2Y36H 4Q9RL 4C56A 3WXWL 2QTEA 3VD1A 2WXNA 1Z9OA 1A7BA 1I85C 1OW0C 1J0ZA 2X89D 3SCMB 5GZOC 1HQ4A 4X99A 5GS2H 3BI9X 2W9DH 2LLLA 4ENZA 3L9RA 2MIZA 1ZA3B 4AWJC 2WNKA 5ES4B 2V7HB 4XNQA 4ABUA 1NGWA 3VAEA 5A2KH 4HWUA 4RAHA 4AZ8A 4KKBC 1LE9B 2Y22A 3VB9A 1EO5A 1O6VA 4G11A 1RJLA 1SXCA 1B3IA 5TE7H 4YE0A 2EYSA 1OZTG 3RUGB 4XXWC 4M3JA 2HTLC 1NANH 1DBML 1URZA 4YUEL 5I1KL 4YSEA 1YY8A 3T2OA 3BAKA 3LOWA 4LBEB 4Z23A 4X6CB 5K9QI 1GZPA 2A6KB 2XWJB 2DKUA 1TF4A 2EH8H 4LASH 2XG4B 1CQYA 3EZJB 4UT7H 1EJ8A 4BQ8A 3AREA 1OW0A 2DI7A 2LV4A 4QXWA 3F5WB 3I9IA 5J6SA 3OAYK 3WN5C 2FD6L 3QXUA 5KSVA 5EWIH 5DZPA 5F6HI 1YEEH 4DN4L 2WINB 3HW7A 3P11L 4ETQB 1P84K 1F90L 4ADIA 3VD7A 1IO4C 4I0PA 3CZGA 5KVFE 2BMKA 5H94B 4Z6AT 4L8CB 3V0VB 3BW9B 2VR3A 4JRXD 5ISZA 3FUMA 4W9LC 2FX8H 4LOVA 4AV4A 3PP4H 4JFFE 1MJ8L 1F58L 1JSYA 4WV1A 3E2HC 3KG5A 5ICZA 1AO7A 4ILDA 2AI0L 4LLDB 3T2NH 1GVIA 1RIHL 4W70A 1S7RB 1WAAE 2X6BA 5DJ2B 2PP8A 4NO0B 3HRZA 2VNCA 2QSCL 1QQDB 1USZA 1PD0A 3O8XC 4RGNC 4Y5YB 3WN5A 5B3JF 3RWCB 4Z76A 4AGLA 5D93C 5D4IA 4UBDC 1T1XA 1E3XA 3D2UD 3MRCB 3GXDA 4LVNC 3GI8L 5CMAB 1C7TA 1DVUA 4P5TA 4OFQA 4OJFL 2BVEA 2H41A 1KFAL 1H3TA 5DD0L 3EHBD 5F0JB 1AXTL 2ZOTA 4YFLI 1IARB 1WISA 1QWHA 2FECI 4MX7B 4TRPL 1NCDL 1HIML 3HR5A 4YL9A 4XNMA 3BC9A 3ULVL 1A4JB 1ZVSA 4LSUH 4J39A 1QSEB 1QMUA 1RIUL 4XTRD 5DZAA 3QUKA 1NCAH 3SDDD 3UAJD 3ZGIA 2F53E 5IW3A 1L5GB 1G7IA 2H32H 3UOAB 1AXSA 5I1LB 3FTGA 4LP4A 4E5XG 1OHZA 1ZTXH 1JPGB 1KYDA 1BQHA 3MLUL 4N2CA 2NLJB 3KXFB 4K94C 3RBGA 4LE8A 1I3GH 1N64L 3QEQE 5E8NB 5EIIB 5JW5B 3WFCL 5IJKC 1RK0B 3HUJE 3FF7A 3BZEB 8PAZA 3AM8C 1OTSC 1YJDC 2XZCH 3LD8C 2X1XR 1VADB 3BMVA 4AYDC 4WW1A 4HSQA 4XN2A 3RY6A 5AAMC 2F5AL 2QQNL 1MCBA 3FB6A 1P4LA 3RIFF 4JFZL 3TO2A 3T08A 5I1JH 4QF1A 4KROC 4LVEA 3L4WA 3T5WA 3DIFA 4EDWH 1SVBA 3O3DA 3VVVA 1XF2A 4D3CL 2YUZA 4L8DA 5GGQH 1A8ZA 1A5FL 3BP4A 3FSZA 1FVCB 3CFCL 4HUMB 4U3HA 4JJ5B 4L4VA 4FL4C 5IOPA 1CC3A 2V2XB 3FAWA 5IQNA 5IP4A 4U1SB 4J1UB 4UF7C 5GS3A 4HOWA 1B0GA 4YHKL 5LG1A 2A5UA 3PWPD 4XBMA 3FO1A 3W9DA 5CEZH 4PY7B 3MJ8A 2B2XH 3VG0L 1D2OA 2VUYA 4HZAA 1IU1A 4JFWA 2E56A 2OL3A 3RA7H 3B2DC 2JV6A 3NAAL 1IQWH 3B8YA 3MO1B 2AK4A 4HQQL 4CBZA 2JKRM 4NHCH 2YGPA 3QC5X 3NBNA 1QPXA 1E4WL 1SYSB 1VGEH 5DHEA 3V79C 3RY6C 3FUJA 2IG2H 4C55A 4CBPA 2YD7A 3GZKA 3FFDB 5F7DA 4N3TA 4DCQA 1T5XA 5T3XD 3ZX1A 4GEJA 3TJPA 2QZ5A 3P3TA 3CG8A 5DQDL 4OLZH 3TO4D 5I76A 3FT9A 2Q0ZX 3MACH 3PP3K 2A38A 3FO2A 3FTWA 2PXYB 3AXHA 3CDYA 2YPLD 2L04A 1NSNH 1FNAA 2UV3A 1WEJH 4ZFZB 1FFRA 4ES8A 2GJ6E 1PF3A 4PLJD 3RNQB 1EANA 3F3HA 4GQ9H 5ESAB 1KBGL 2G75A 5G4NA 3BH9A 2HFEB 1NINA 1KJ2A 1J18A 1LGVA 2A2QT 3WKQA 1F00I 1GOFA 4OU3A 3ZE2B 1A9BA 5LCVA 3LKSA 2WZPD 4F7PB 2GY7B 5IVXE 2F9BT 1BQLH 1DJZA 1JHKL 5D96C 3W3BA 1OSYA 2C26A 5D7LB 3IDMA 1BIIB 3NIFB 2IALB 3O6ML 3GSVA 4AX3A 4RAUA 5IG7A 1AE6L 1KB3A 2WLLA 1J9RA 1IVLA 4NCC2 5IROC 1EH9A 3N5AA 1LMKA 1TEFA 3WHE0 2HKAA 1KEGL 3WBDA 3NESA 3WKMH 5IMMB 4NFCA 4F2MA 3VQLA 2VLRB 4MKMA 1KCBA 1G0YR 3ARGC 3FU7B 2PCFB 3KYKL 4OF0A 5KYXB 1NCWL 3UTSA 3MCKA 4F15B 2WLZA 4WHDA 5FK9B 5KSUA 1MFNA 2QGBA 4CU8A 1NMBH 1DEEA 4HUUB 7PCYA 2OCCB 2FYYB 1T83C 3OXRB 4R0LA 3LYRA 3GK8H 5FUOH 4M6AA 2A4CA 4NP9A 2WVTA 1E4WH 3JV6B 1KACB 2XT1B 1R3HA 1G87A 4IEFB 5HGDA 3VX0A 3BLBA 3AABA 3OTTA 5L2KB 4JB9L 3FYIB 1CFTA 1TYEB 2A6IA 4Q7DA 5EU3A 2VUKA 3IM1A 3WLWD 1V7ML 1I1AA 3WIFB 2JB6A 4IGBB 1UCTA 2BM3A 4YSAA 5LWYH 4XZUA 4MXVE 4X4XA 5F70A 4DEPC 2YRPA 5MERB 5JORB 4KI1A 4DEUA 1DUYA 1GW6A 5A7BA 4BELD 3WFHA 3LQZA 3ZR6A 2BMKB 4TN9A 1IIKA 2VW6A 4OCXH 4OZGA 1KB5H 2AAAA 1M57B 1D5BA 5LBSL 2NDFA 2YQ2A 3FCGA 4WEMB 1AP2A 1NICA 4UV4H 2GBTA 4A39A 1HS6A 2R23B 3EH2A 4JQXC 1T0OA 4W68A 5GZND 1J5CA 1DVTA 3QFJE 5I18H 2UYLA 4B9GA 4MD4B 1MRCL 1QI5A 4BH7A 1EAPB 2DIEA 4J3WA 5LAXB 3FQWA 5I71C 3I3EA 3G04A 3QAZB 3DJ9A 3D12B 2ALWA 4P3DB 5EH1A 1QG3A 3NPZB 1WO2A 4XNUL 1UZ6F 4JRWA 5FYJD 3F83A 4PLNC 2WQAA 1KGYE 4ABWA 2F2HA 2UY6A 4A2MA 4OCWL 4WTXA 3U6RB 3U30B 5FYKL 3OAYH 1ZGLB 2JKWA 2UWEA 3LNFA 2VERA 4I2XB 2YJQA 4JPQA 5I28A 1W72A 3IMWA 4MB3A 5LQBL 1HSAB 1WP6A 4JFFB 4QXGL 4MJIB 4KJQD 1B90A 2Q2EB 1H15A 5DZNA 2CBQA 4JHWL 5IHLB 3ZHFA 2H9GB 3NIFF 4FRWA 4WUUE 1MRCH 3HRPA 4I77L 2BNRB 2ZE0A 4N2BA 1FFQA 2I32A 1DFBH 3CU7A 4JL1A 1E65A 1C7SA 1SXNA 2VXQL 1TTRA 1SJEA 3GTVA 1XR9B 4QCIA 1UJTA 3QA3B 4TNGA 4GRMA 4IMLB 5C3LD 1HEHC 5DMKB 1OGPA 2HN7B 7CGTA 3FU0A 1XH0A 4QRRB 3CX2A 5E8NA 5F9JA 2M2DA 4BD4A 2K4WA 2LVEA 4JN2B 4JQVA 5CCHE 3N0AA 2A0LD 1HHJB 4IIZA 2ZKMX 3RX7A 3GS0A 3MREB 3N44B 4C8XA 1GJWA 5DJ8B 2E9JA 3NIGF 1AQHA 4DFHA 4QRPE 5CJ5A 2PO6B 5J9PA 5C8JB 5T1KB 4DHLA 3IDGB 2VDOH 3VA2C 4JFFD 1RP8A 1N6UA 3UIYA 3VXQB 3WNOA 3NCYP 4Z7IA 3CXFA 5C6PB 3ZTNH 2AHIA 3HG5A 4XVJH 2XWXA 4Q58C 2YQBA 4R97B 3L3HA 1EJOH 3M1OA 2VDLB 1TMCB 3CQPA 4ALAH 3OAZH 1BQUA 5BOZG 1AQMA 3AWEA 4TUUA 3BFQG 5DQ9A 1OQXA 5I1AB 3ZHDA 1A6ZA 2JCCA 1OF0A 4J1UA 5E2UH 3A4FA 1JAEA 2DD8L 1VFOA 4HJUA 2UZXA 5FO9A 3WMSA 2QQLH 1YEGH 4BZ2L 3VXUA 2ENPA 1N2RA 4PY7A 4XCFH 8FABA 3FZUC 1YEKH 1RK1B 1ODUA 1CFNA 3L3OC 5J0BA 2W65B 3SPCA 1VSCA 3GPEA 4JQVC 1TJHL 4AENA 5A6IA 1G7HB 4L3CB 4PBWD 2VKXA 4G8AC 1DVFD 1DQMH 4ODSH 5CLWA 4DP7X 5I66B 1IAIH 4LO9A 5DJAA 5MEOB 1TQSA 2H2PC 4QXTB 5TE4L 4KKCC 2Z92A 4KKRA 4P2AA 5DO2C 1DANT 3UTZA 4PJ9D 1AD9B 1NMAH 4YLCA 5AVYB 5T3ZL 1YUHB 1TZGH 2BIPA 2VN4A 3P0VL 3U2JA 4CW1A 4JRXA 2GUOB 5ISZD 4JHWH 4CVUA 1AKPA 5JYMA 2E9BA 1XV8A 2NY4B 4AYFB 5IT2H 1AO7E 1KIQA 3MRFA 2FT7A 2Z35B 5ETUB 2DEWX 1ZGLM 1OGTA 1SEQL 3WTTA 1XFPA 2DKMA 3ILQD 4LRNL 3DOSB 3HA0A 3WE6A 1N10A 4WCYH 3T0WA 2QT6A 5IQOA 4LVOC 2C4FU 5HYJD 3C9NB 5GGQL 1FL3B 3WTVA 3ULUE 1HIMH 2H2PD 2FX9H 1ICTA 5DI8A 4C4KO 3FRUB 4JY5H 2J57A 3T6ZA 3SDAD 2DQEH 2Z65C 4P2RA 4PJ7A 1OD9A 1VEMA 3WD5H 3NTCH 2Q86A 3LAFA 3IJYB 4YHKH 3DXAD 4TPRL 4WW2B 1TZGL 3PQYD 3ESPA 3K1DA 4XCNB 3TBVA 1N59B 5L88H 5IBUB 3BAIA 3A47A 3ZTNL 1URIA 3DX9A 2WQRA 3BQUD 4JCMA 2X1QA 2FNBA 2HP4A 3PPSA 4L5FH 3O4LD 3FO9A 4KGJA 4G43B 5F9OL 4ZNCD 4NQSB 4OLUH 3ARDD 3H4FA 3I74A 4N2OA 2IANE 2YAMA 2DWEA 2F5AH 4XMPL 1G9MC 3QDHA 4FFTA 4YFLF 1YEGL 2H2SC 3IE9A 4BZ2H 3KE0A 3PWPE 4OI7A 4XWGH 4JM2A 3QH3A 4HIEA 4DKEL 3T3MB 5CS7A 4G5ZL 3QDMA 3D9AL 3BHBA 1L7IH 1MCWM 2ZUYA 1E4XI 1Z0NA 4I8DA 3NEXA 2P48B 1A1NA 3C5JA 1AD0A 5I73C 5G4OA 3CFNA 4HHGA 2EADA 5L0QC 4PTUA 4GO8A 4Q4IA 3VXOA 4B53A 1BBJA 1T22B 1ORSB 3LTVA 1KDIA 5A3IC 1OPGH 2AGJH 2FB4H 1I8LC 4G8GA 5EF3A 3UP1A 4PRPB 4CL7A 2ENJA 1VA9A 4I3RL 5INDA 2VTFA 2VM9A 2MCAA 3VQ2C 5DLMH 1MWAH 3AQDA 5DZ9A 3QG7H 3LZRA 2H3KA 3O3UN 1JTPA 3LH2L 4XXCC 2JXMA 4KJQC 3ZW3A 1KB9J 2VDPL 4HXAL 2DQMA 1YYCA 3OB8A 1MCSA 4C56B 1PX3A 1UH2A 4I1PA 1RULH 2R59A 1QFHA 4ZUTB 1RJCA 3TNMA 1JZ3A 2ZX5A 4LQ1A 1Y1DA 3B9VA 3CAFA 1LE5B 4M48L 1CXIA 5TE7L 3G04B 2ZAIA 5AW5B 2E75C 4LLUB 4ODUA 4RFOH 4BK5A 2WD0A 4U1HA 4HX1A 2Z1KA 2VDMH 1Z5HA 2VUOA 3NCBB 4NJ9H 5FA3A 3LS5H 1EXGA 1YEHL 5J6GB 1RJLB 2DWTA 1XGQB 1IAOB 1P0SE 1T2QL 2DQFB 3X3GL 4GKNB 1QA9B 4KKNA 1YMME 1MG3C 4FLHA 2AZUA 5H4ZA 4N0UA 3MOBL 1RSYA 3P4OA 4NC1C 4ZYKA 3ZKND 1II4E 1CL7I 4E9XA 4W9GC 3UDWA 1IM9D 5EIVA 3MZGB 1BEXA 4OZHE 3DARA 1A3LL 4BFIB 4U6XA 2NDGA 2V5YA 3QXDB 4MTMA 4Q14A 1PEZA 3TT3H 4U4BA 2FUQA 1W8EA 2A6JB 3VGFA 4F8TA 1G7JB 1Z6JT 3CXDL 3H85A 5AVTB 1AC0A 1F4YH 1OWWA 2FGWL 4UQ3A 3SKNA 1JWSB 5H94A 1EA9C 4L8CA 1WAPA 3L4UA 2QDVA 4JO4L 4K8RL 5BV7L 4KK6D 1HINH 5JLZA 4NI3A 2QEJA 3COOA 4TUOA 1A7PH 4A63A 2HWZH 1XMEB 5BPPA 5IESL 4CVXB 3RDTB 3KW8A 4PJGA 4FZEH 2O61B 3B2VH 4X4YA 4YSCA 1I7ZB 3UGEA 3GXTA 1T0MB 3MLWL 3TBSA 3VXSE 1YO4A 2BZDA 2G2RB 3P3YA 3Q6FA 5D72L 5HPOA 1UB6A 4Z8FL 4UT9A 4KQ3H 5B39G 4KVCH 5BV7C 2H7WA 1WFMA 5B39A 3E8VA 3ILPA 4KV5E 3VXTB 4J3OD 2X53A 1P7KA 4HJSA 1SEBB 1WD9A 1SM3L 3O0RL 2OMBA 3BIKB 3V4PL 4YXLL 1CXLA 2VDPB 1T2QH 1F6AA 3E80A 3FBKA 1N5YL 1LEGA 4Z5RA 1ZXQA 5BV7B 2ZOLB 4AW7A 4R2GD 3WG7B 2ZXCA 3FT4A 3MRHA 4Q89A 4H25B 1AGEB 2APSA 3CZFA 3LEVL 4RA3A 2GSGB 5DT1H 3RWGB 5AW0B 2NTSP 3TVMB 1CD0A 4OLYH 4KDTC 5C0BE 4JG1L 1UOKA 4CW1B 1IUZA 1DQDL 2QPSA 2FWOB 4RIRA 4XVOA 3MX0A 1P7BA 1NLBL 1CS6A 1PLGH 3DTXB 4CGTA 3EOTH 3KPRA 4K07A 5IQMA 2A6DA 2J4WH 2RD0A 3IDIA 4Y1TA 1ZV2A 5DQJA 1MRDH 3KCPA 4PSRA 2X1WL 5EU4A 2HCZX 2F8XC 1U8MA 4TUJB 4UQIM 3D34A 1T83A 4R0LC 2P3YA 4K5PA 4AIOA 3NA4A 1SM3H 3IJEA 1ZHKB 3P30L 5ESVA 4AZUA 1AR1B 2LAGB 5IM7B 2KS0A 1IMHC 4MCYB 3RJQB 2V17L 2AQ1A 4D7BA 2F54E 1A66A 1JNJA 1YAIA 4WWKB 4U1MB 1MY5A 2RIKA 4OIBA 1EWHA 4IRSC 5GISL 1UVQB 4Y5VB 2B39A 1DJWA 1UH3A 2DI8A 5CJXA 4QRPD 3UGXA 1QYGL 5CLZA 4FEMA 1XDTT 5F0LB 4AKOA 4G6KH 4TVPH 2EIZB 3ZYJA 1XAKA 4MMXA 4XB8A 2JJTA 1BECA 4UU9A 5IMLB 3EHBB 1AO7B 5FX3A 5B1KA 4MNGB 1IX2A 3T0ED 3UCQA 3WEXB 4IBQA 5IBTH 5J1AB 1FNHA 1PJWA 1OV8A 4U3SA 4GMSL 1MQKL 3T2LA 4A68A 3OL2A 4L3FA 2DYPD 4HC1A 1UD5A 2XKSA 4V1DD 4ZUWA 3KPPA 2VDMB 5BRQA 1REIA 3V5KB 4BDVA 4QKXB 1XF3A 5IVNA 2ZSWB 1ES0A 1R4XA 5A2IH 1JIBA 4KPHH 3U9UA 3X12A 1A9EA 4LCYA 4ONHA 5B22A 3C75A 4UV7H 4MJIE 4NSKB 1IGYA 3SE8H 5IHHA 3GSWA 3W11C 5BZZA 5HYQA 4JY6B 4P3CH 1T5XB 1RURL 1UJ3A 4UQ2A 1AYRA 3IMBA 1F4HA 5KVGL 3U25A 2AJXH 2BNRE 1JZDC 3IU3B 12E8L 3MRQB 5IB1A 3MGOA 1JNLL 2Y5QA 1SHSA 2PPDA 1JWUA 2DQEL 1JMZA 1EBPA 5IR1B 4XTRC 4OFVA 1NGYB 3QYNA 4XMTA 3HE7B 2FSDA 5CGBA 2XY1A 1EZSA 5J13B 2L7JA 4XNYL 2Y3AA 2DY2A 4IM8A 4OZ4B 3DX3A 3VYOA 4HIPA 5A1AA 3UTPD 3TBBA 3RB7A 1JZ8A 1AIFA 4Y16D 2GKIA 4IRJD 2P46B 3T3ME 2CZNA 3GI9L 5AVUB 1MWAA 3GS4A 4FD0A 1JZ5A 3TNMB 1I7UB 3VG9C 3GIZL 1GTNA 5LN4A 5KYWB 3VMNA 5E4EB 5IB3B 4CU6A 3BIAX 1FV1B 3KWWA 3D18B 1HSBA 2N0KA 3O0LA 4MNQD 4MQ7B 4UZUA 5I6XB 2KPWA 2UWEE 1E9PA 4AYMC 4UANA 2SEBB 3POCA 4WLCA 1KIUA 2WXPA 5EZIH 4KFMA 4L8DB 5KANI 3GTNA 5HHOB 5L2JB 3QCVL 3VGDA 3S7GA 4KZDH 4C54A 2R2EB 5HI5C 4CMMA 3U46A 2VKWA 2EIBA 1NUFA 1ZDQA 2OPCA 2EIKB 5IQ7H 2ESVE 4LVHB 1BBDL 1DCEA 4ZYKB 4FN0A 4IBWA 3ULUD 3CFTA 4KY1L 2Y7MA 5KYUB 3TYFA 1IFHH 4H8WH 4XNQB 5BZXA 2J5WA 5EC2A 3QJUB 4KUCD 2C7UA 4KJPC 5IKCB 4P3CL 1CVRA 1NIBA 4B9ZA 1JTTA 4M9OA 1FI8C 2UZYB 2C1OB 2R0WL 1QHOA 4KJYA 1A65A 4LT7A 2JWYA 3IF1A 3G6AB 4N6RB 3VI3B 1HEJC 2I60L 4LSDA 4M1DL 1T03L 5DEGA 2AERT 1JNLH 3PQYA 2HXAA 4HHAB 1AKJA 1UT1A 4XODA 1R5WA 4JZJB 1F5WA 5D7SL 1AIZA 1R1CA 2C1PA 4M5ZL 5I9QC 2EUZA 1MOEA 3GO1H 4AQ8A 5K5YA 2G2NA 2BP0A 4N26A 2CRZA 1FBIL 1IC4H 4EJ1C 3BWUF 1HXKA 4TM9A 3RDJA 4MD4A 2HH0L 3G5VA 4AQAB 5K9JH 5CJOL 2VH5H 2AJVH 5A2JH 3ECWA 5CWSA 5INCA 4HPYH 1E4JA 1O7VA 4POUB 5FC9A 2Z31C 5IJBC 3ILPB 1AS8A 4TNFA 2CHNA 3CCHB 3KYOA 4LKCA 2NY3C 5D1XB 3PLYA 1C8PA 2WXGA 1TEGA 4Z7UB 5JHDA 3G6JA 3LN5A 5D70L 4AV0A 4W9EC 2P5PA 2WOBA 1F6AB 2OMZA 3SD2A 1TT6A 1ZTXE 5FW8A 2XRAL 1UUNA 2HJLB 3NRFA 4PGJA 3UG4A 4W4NA 1F18A 1QSFE 5L6YH 3UZVA 1G7PA 5DMJB 1W0YT 3B2UD 2IWGA 2NY5L 2WUCH 3MCKB 2EVFA 3PGDA 3QNYB 2X4QB 4LFHG 3GMOA 1A4AA 2XN9E 3GNML 4N8VG 3ARUA 4CKVX 2FYYA 1KTJA 3EYFA 1NC2B 1ZHLA 3QO1B 4P2QD 4OGAC 4OAWB 2BVOB 4JO3L 4JZJC 2P28B 4P9HC 4UUJA 4YZFE 1TG8A 4OQTH 2OTUA 5CZVH 3ZSSA 3LPGA 5CFHA 4JCWA 5F7AA 5D70H 5C0JA 1NKOA 1RMFH 2PYFB 1KT2A 4YBLC 4UDTA 4MBRA 4OR1A 1ORQA 3LN4B 4GRLD 4R4FL 4HWEH 1D9KC 1YY9D 2JQAA 1HZHH 5I1DB 5DTFB 4M1GH 5DUMH 1XZ0B 2VW7A 5C3IA 3EJZC 1GW0A 4WI4A 1BWWA 1UQSB 3PP3H 4OSUL 2W9LA 3FTGB 3E3QC 4ZOCA 2WWKT 5KSAA 1A22B 1I8MB 4AVKA 3FT2A 4AJWA 3GSUB 3GNMH 3SBQA 3SYPA 4UTAL 1OGSA 3ZT7A 3C6EA 1OB1A 2WTRA 4X8XA 4TQHA 4XBGB 3VXSD 2FTAA 4BA0A 3U0TB 4FTDA 3U30C 4CGUB 3UROR 1T5KA 1A7PL 4U05A 4PUBL 3HZYB 1LDPH 4TQEH 2X3CA 5DUBB 3VO0A 3WO4C 5IFAL 2JMRA 4AEFA 1VPOL 1FA4A 1FNSL 1PQZB 5F6HJ 1N7ML 3S96A 5C0RL 3QR0A 2KH2B 4KC3B 3QVAA 3HZMB 1BXXA 1KGXA 4N8CH 4CMHB 3L45A 1ETB1 2GITB 3SQOL 2NXYD 2QSQA 3DMMD 1D9KD 2WIIB 5E2WL 1RUQL 4LP5A 5FYLE 4ZMVA 1K8IA 4DN3L 2UVFA 1PG7H 4GKZB 1S6NA 4YSTA 4AGNA 4JO2H 2WYTA 5D7JD 4X42A 4FI8A 4AT6B 4XNZC 5CU5A 2ATPB 5EIIG 2FATH 4H40A 1P4IL 4GW4B 4NENB 3I6KB 4JFPA 5DRWA 1UCBL 2WQWA 5IB4B 1JWUB 1TQBC 3AGWA 1DO5A 4MS8C 4CRPA 3BP6A 3UC0L 1HCZA 1J0KA 4Y1AA 3B2MA 3ZVVA 3V4VB 5EDXA 1TKWB 5JPMB 3AY4A 5C0AD 3OHMB 3I6SA 1PZ2A 4RX4A 4DSYA 3NACL 2VZOA 2X2YA 3TZVC 3SE4C 3EYVA 3W2DH 1NMCB 2B59B 1TZ8A 2IDSA 3AMKA 2OMUA 5EO0A 3ZDXF 1Z9LA 3TN0D 3ME0A 3QORD 4HW6A 3FQ4A 1RUQH 1SBBA 1J9CT 2DQJH 4BWTA 5IT2L 4YWGH 4RMUA 2WSKA 2VLKB 3ARBD 4G1MB 1FZKB 4S0TD 5F2FA 3CDZA 1BZQK 1WFUA 5A16B 5BXFB 4MAYB 3UBFA 2F7QA 4L1HA 3ROLA 2G5BB 1MCRA 3BAWA 3OQ3B 4XVSH 4PWEA 4NRXB 4FQPA 3ARGB 1A6VH 3NDZE 3SGDH 2F5BL 4P9HH 4Q0XH 5J89A 4JRXE 1BXUA 3FQ2A 3M46A 1OIOA 4P59H 2FEDC 2NX5A 4B3VA 3K6IA 1V54B 1PU0A 4NKMA 2VDKB 5TK2A 4PQXA 4X98B 3EH5B 3X14A 3D52A 2X4UA 3O6LL 3H9SD 3MJ7A 3ZMRA 1DFXA 1FVDA 3MNZB 4AXWA 2FJFA 2KZKA 4Y5VC 5JR1L 1VKXA 1I7TA 1WV7T 1MREL 4LPXA 4AE1A 1RUAH 1IGJB 4M62H 4U33A 1MWAL 1KCRL 4BKLA 4Q9QL 4RFNB 3F12B 2A83B 2CG9X 4K71C 4XO9A 1U95B 3MXWL 2D3VA 2ZG2A 3OKLA 3U7YL 5I0XA 4KK9D 4QYAA 3BT0A 4S1DD 1IBZA 2CRIA 1PKQE 4HCGA 5AAMA 3PQYB 2EDYA 4R0LB 3VGGA 5EG6C 1PSKL 5AOJA 4F57H 5HGAA 4YAQA 5J12B 2CDEA 1AHMA 4F8LA 5SWQA 1FGNL 3H4HA 3JQOB 3VDAA 1A14L 2ESVB 3BD5A 1BQSA 4MNHA 5SX5K 3CTTA 4KH9A 1NFIA 3U9WA 1H3VA 3ZN6A 2YQ3A 5F1SA 3EDKA 3LRHA 4GUQA 3D39A 5JXEC 2I9TA 4HFWA 1KTLA 5T3XL 4IBTA 3BVVA 3CMGA 2B1AH 2X0WA 4O58H 1AS7A 4FI7A 4DP9X 5IGXH 3SPIA 4G71B 3CVCA 3ZDYE 4YC2C 4GINA 2IG2L 3V5HA 2UVEA 4PJ8B 2QZQA 4IDJH 1G4RA 4PRDA 3IFPB 2ATKA 3VM5A 2AJZB 4R5TA 3RWJB 1W2KT 4K8RD 4M7LT 5F7UA 5I1GH 1KYOK 3REWA 1LK2B 3NZSA 2H6OA 1T0NA 3MA9H 1TYJA 4XC1L 3UERA 1VHPA 3ZL2A 2D7QA 3TPUB 4PJ5A 1KG0A 1MY7A 3DROA 3FT3B 3FQRA 4L8BB 2HA1A 4DERA 2DWYA 4KKBD 1BHGA 5FOBB 4M48H 4BFIA 4ZFOB 5JW5A 2HG0A 3IJSA 1FGVH 4NCDA 3W82A 2V2WB 5DRZB 3VXSA 3ZR5A 4CN6A 4APQA 1J88A 2YUWA 5AUMB 3ZE1F 3RIFK 4KMQA 4EN2A 2D0GA 3QNXA 2AXWA 1JE6A 3PIQA 3LV3B 4HS3A 4GI8A 1FYTE 4BRJA 2D2CC 1AY1H 1UM5H 3PAUA 2EC8A 2ZOWA 1GCFA 4LHUD 2YGVA 2R1XA 1AD0B 2OXHB 3QQ4A 2B77A 5CEYB 1J1PH 3QJVB 4B50A 4UT6L 4IIQA 2A9MH 2X0VA 3X1EA 5IVZB 5I1DA 1EFXA 2IPKA 3GZPA 1UZ8A 1E50A 1XZ0A 2V6HA 3GC3A 2K9FB 1M05B 2HT3C 1KTDB 1YN7A 2O6FA 5AZEH 2E27H 4KMTL 3C09C 1RKRA 4ERSL 4X5RA 5FO2A 5IROA 2VDKL 4PM1A 2D7OA 4UQBA 2J7LA 2YFNA 5F9JB 3BN9D 2PCXA 1UOLA 1CDJA 4PWIA 4MFHA 2XBDA 1SYSA 2J73A 1P7KB 1CCZA 3M17A 1TETL 5TQ2H 3QQ3A 4K7PY 1UM5L 4UQEA 4JDVB 4RX4D 5JZ7D 5AW2B 3BD4A 4BE6A 2BOLA 5FHAH 4MYPA 4JQIL 2WZ6A 4MQTB 1UM4H 1E5UI 5CJQL 2Q6WB 4KK8C 5HDBB 3TN0A 5EEUA 1FORL 5F3BA 1I9RH 3ECVA 2I9LA 4FQLH 1TSHA 3BJLA 4OIFA 1U58B 4HIXL 4ZUSB 3V4PB 3NJHA 3VGAB 1GKEA 3TA4D 1I8AA 2MQ3A 4E9QA 4I3SH 3KVQA 4GKNA 4FFZH 3MTXA 43CAB 3F00A 4ETYA 2WTPA 3DTXA 4I0PC 4AYEC 5C0CE 3NOIA 1QPPA 1XCXA 5TF1H 3HN5A 3KCPB 3ZSTA 4JKWA 4L3CA 4AGQA 1UGKA 2V37A 1LM8V 3KPSD 1LEKB 1IGIL 3S34H 3IDMB 3W5NA 2VO5A 1THAA 3VD2A 2R0KL 4U1MA 1QYGH 2C9RA 3EO1A 5E8PA 1FH2A 2GC7C 2B8OT 2NY5H 3UZEC 5C9JA 4M8VA 5A7EA 4NN6B 4Y5VA 4X7CC 1D2PA 1DDHB 3DBXA 4Y19E 1VZGA 4L4TD 5EWIL 4AVJA 3TBWA 3OZ9H 1KGCE 5DUJA 4H44C 5KYXA 2FUTA 1PJ9A 1U8OA 3WE6B 5KVFH 1W0WB 2VYRE 3T8MA 5HYJB 3MYJB 1FFPB 2G5BA 3C9NA 1N6VA 2BSSB 3B2UC 1MI5D 1HYSD 3PP4L 1XF1A 2JVUA 4QY8A 2X2JA 3KEHA 3MOAL 1HZHL 2XN9A 5AYQA 4E42B 4X5XB 4JS7A 1QLRB 5CBAB 4JFQA 1KBVA 3BN3B 2A6IB 5EU3B 4ODVL 3VD3A 2ZWLT 3NSYA 4J6RH 5GRXG 4AQ1B 2ZF8A 2OS7A 1AG0A 4QYOB 2XWDA 3FQXA 4KRPD 1UYWL 3JBG7 2MCPH 2VCOA 4LEXH 1Y1UA 1P4BL 4H1LG 3B1TA 2EC9T 4IYKA 3BVXA 1HOCB 1QOKA 1UM6H 1LEGB 5FUCE 1GC1H 2VAAA 4NS0A 1FYTA 4ZZKA 1S7TA 1FH5L 3RURA 1S7QA 4PIRF 4HT1L 2YHGA 1GZQA 3VCLB 4WFED 3ZDWA 3C8HA 3C8KA 3LXBA 3F7YA 2WIMA 4ZTPL 1IGMH 3HE7A 4P5KA 2RBLA 4RA0C 3ZDZF 4YHLL 5KAQG 1NBVH 3T6VA 4NO3A 4FG0A 1T04B 1BMGA 2XTJB 4U1KA 5TGBB 5D1ZB 4F2FA 3SCMD 4WO0A 1NM4A 4I77H 3O45B 3NH7H 2Y24A 2Z3FA 3UAJC 4P23C 2CK2A 2DBLL 5A2BA 4BFEA 1DFBL 3A6BL 3MQIA 4F7KA 4YDLC 3DJTA 4N2EA 4XCFL 3TLRA 3Q5OA 5TF0A 3DJRA 4KNTA 3WLBA 1CLOH 4PU2A 2CUAA 5J56B 2K9UA 2VQ4A 4N2MA 2HVJA 5L8JB 3MR9B 1NCCH 1HSBB 2NXYC 1QD0A 1K6QH 2H5UA 2OTWA 5AYUL 4JFOB 2LHAA 3VGBA 3FCSA 2HRPH 1H15B 3ZIMA 1FAIL 3TF4A 4W4OA 3VMOA 1XZWA 1CGWA 3AG1B 4X0NA 1QRND 5CLTA 2B7DT 1I3VA 2DLGA 2H9GA 1NBVL 3KBHE 2YAPA 3PNWB 3PQYE 1DUZA 3QUYC 4GIAA 3MRIB 3VD9A 3CMOH 5D7JA 2G5UA 1OCWH 3FCUB 5EZOH 3SE9H 1ZTMA 2EZ0C 2XZCL 4UB0L 1A4CA 3NSCA 3ZIYA 1CU4H 3VH8G 1IIIA 4JPIA 2X9XA 5E9DB 2QQNH 4WWNA 5F0MB 4AJ0A 1XSKA 1BYOA 2H45A 3FQYA 4IBUA 4EZJA 1IC7L 3ZHLA 2E7MA 3IJSB 3V2AR 5HD8C 2K6ZA 5C0AA 3SQBA 2F5BH 3PWPB 4P9HL 4I9XA 1T3FB 2ZSVB 4JM4L 1UWEH 1NBYB 5AYUH 4DFIA 1QPKA 3G6AA 3HBPA 3RQ3A 3RFZC 5J9PB 5I5JA 3G6DH 3HNTL 1UKTA 1XH3A 5GJSH 1M9WA 4MDJB 3ETBJ 3VXPA 2X6VA 3CC5B 3MLSH 3ARBA 1UA3A 1Y6KR 3BGAA 4I89A 4XNAA 1QBAA 3RTQB 5H2BB 1R0AL 2QTVA 3KL3A 2W81C 3TT1L 1LYQA 1NCBL 3D6GA 3WNJA 3N91A 1LK3L 1N5AB 4LIQE 2PTTB 4CJ1A 3ATBA 3QFDB 1MREH 1UZ8B 3TO4C 4OCMC 1A3RL 5T1JA 2IBGA 3FB5A 3FDWA 1MVUA 5C6WH 3VWJB 3OLDA 2NX5D 3DRQB 1RJZB 2YOCA 2IDQA 4PV8A 4OCLC 3GHEL 3FQUB 4QRTA 2XA3A 1JGVL 1U92A 1UD2A 1QBML 4FQXD 3C2AH 5HVWA 1NKGA 1NMBL 2TRHA 4UM9B 2Y07H 2FEEL 3ARDB 1MKFA 2AQ3A 3H8NA 2F15A 2PCPA 3PHQA 4XVUC 1SUHA 2XUWA 3WD5L 3EOBB 2JIXB 3HZKA 2EAEA 2DQUH 3X2QB 2HX8A 1KCSH 4ZD3L 1DVXA 3HMXH 3TA3B 3GLEA 1LE9A 4JPKL 2B15A 1MFDH 4JE0A 4JDZB 3P2DA 4AL8L 3US1A 4ONGH 2BVPA 4TSBL 2IAMD 4N28A 1S7UA 3OG6B 4PJAA 1M6OA 1ZHBA 2EXYC 1Q9KA 4HA1A 5PCYA 1WWAX 4HKXB 3HRZC 3G5ZB 4J3BA 1SEBA 2VDPH 4KO5A 1NPNA 1CT8B 4P5MB 3TTYA 5F9WC 1L0QA 4MAYC 2QPFA 3UGUA 1UEYA 4FI6A 4JDEA 3TYGL 4QHPA 1TSRA 3NCYS 1EO7A 5C0JB 3RGVC 3UO1H 1J5OH 4H25A 2M83A 1GS8A 4OSUH 4PG9B 4LIQL 3K8MA 5L9DL 2CWRA 4KTDH 1Y0LB 1BJ1H 1HC1A 2JJUA 4GMTH 4JEGB 1NCGA 3C5ZD 2E3VA 2VR5A 1W8OA 2P45B 1T7XA 4HHAA 2GAZA 3OR7A 4ZDHA 3T6WA 5H37A 2WKOF 2IGFH 1T4WA 3LH8A 1P2CB 4F2EA 2AXGA 2I5YH 1GGYA 3L9BA 4IOFC 4B5EA 5I1EL 3O6FD 4XBGA 4HIEB 3LH2H 4PRHA 4ZT1A 1FJ1B 4KQ0A 4MCYA 1I9RL 4KAQL 1X5FA 4PLOB 3ZTEA 1A9VA 1OGAB 2NY3B 1GGUA 5D1XC 4N2FA 2H0FA 3C5SA 2OV0A 5DVLA 5L4IA 3D48R 1W72L 1BEYH 3BVDB 4NHUB 3BZFB 3BX7C 3RGVA 4KX9A 3RKDC 1PZ5A 3NA9H 3QCUH 1ADWA 3VA6A 2R69H 3QXVA 4ES9A 2A74B 4NZFA 1WZ1H 2R51A 3C6SB 3O3EA 1TITA 5BO0D 4LCIL 4GIOA 4NZJA 4GKZA 1UURA 2BK8A 2A74C 2P43B 3OD3A 3MRNB 2EP6A 4MQXC 5IJDC 4K9EH 3OX8A 1AANA 2JI1A 3VG9B 5FGCB 3FS9A 1QRNA 1OAZL 3GSNA 3LVEA 1HCFX 1HYRC 3TNNA 4POYA 1A4JA 1ZVSB 5EUKA 3WFDH 1A7QH 1SQMA 3GMQB 3Q1SH 4ANXA 2FO4B 3QS2A 5DD1L 1YEJL 1S7XB 5E6ZA 2ZKYA 3DYOA 3Q06A 4YZWA 3WE1A 1DP0A 3QZPA 2K4AA 5CHNA 2V5TA 2MOVA 4JY6A 3V7AE 4LLUA 4ODUB 2JIXD 3G5YB 3EBAA 5GRUL 1U0QA 3S37X 2H0EA 5GHWH 5H8DA 4Z78B 3IFNH 2CD0A 4QXGH 3NZHH 4YBLB 2VXTL 2QQLL 3MRBA 3IXAB 4G42A 4J3OF 1AOHA 2CKBL 3IPFA 4UNIA 4YPJA 5FO8B 4GS7C 4NLAA 1N5YH 1X5GA 2CE6A 3FB6B 3K74B 1Y18B 3TO2B 1BD2E 4N8VA 4GP8B 3SGJA 3CFCH 1JGLH 4JFOA 4NIKB 4H26B 3DIFB 3W5MA 3BDYH 4FXTA 2XPGB 3KMDA 4AIEA 5DWUL 1NMAL 1UYWH 4UAOB 3QUYB 3QXDA 2AEPH 3L1OL 5AB2A 1KLGB 5HDRA 1NJ9B 3UBHA 4E41D 2K1MA 2D7PA 1SDDA 5IW6A 4XVTL 5C2BH 2ZUSA 1T89A 3KPSE 3MRRB 3HMXA 4FL4B 5JDSA 2DPKA 3QZWA 3T0XA 3TURA 3MUHL 3S6CA 1E2ZA 3D3VA 4DKDC 1F58H 4B9KC 1Z3RA 1GSMA 2PR9A 5DXWA 3ARED 1HKFA 1QFWH 1MDTA 3Q5TA 4I4WA 4HJTA 2WLIA 4XVSL 3V0FA 3QDJA 4GSXA 4BQ6A 2D31A 3SGJC 5FEBA 1F42A 1TJHH 1U2YA 4JX0A 4NXKA 5D2LB 4KK5C 1DHKA 3GZOA 4X9YA 5DO2D 3TPKA 4J6RL 1MCCA 1GGCL 2O5NA 2J8UF 5GS0D 4OLYL 1OLLA 1U2CA 2Q7YB 2XZAL 3QEGL 1RY7B 1XGTB 2NY3D 1UB6B 2P5EA 3HS0A 3JWNH 5GIRB 3QYMA 1C16A 4LFHD 2MNUA 3VE0B 4GQ9L 2NOYA 3FHEA 5GQBA 1M1XB 2YUVA 2CRYA 4DKFL 3SOTA 3MFFA 3QYCA 4NQXA 5D7IE 4FS0A 1XIWC 2N59A 4YGAB 3Q6GH 2BIIA 5LVEA 4K9EC 2VIRB 3Q8CA 2RR3A 1AKJB 4HZLB 1PL3A 4V2CB 3V5HB 4WTWA 4JREB 4JM2C 3TIEA 3BVTA 4A2HA 3LRKA 5AVQB 2ZUWA 3KJ4C 5MEQB 5DC2A 3SKJH 3LQAH 2IANB 4IRSD 3F58L 4GRWH 3ISWA 2YO3A 5KBKA 5GRZA 2XSKA 2GEQA 4LPYA 4CVZB 2P5WD 3GKWL 4MXWH 1ETZB 5F1IB 1AI1L 3FCTA 2RA1A 1C5DB 4MA3A 1U8MB 5JA8B 4YDZA 5EU5A 1LO3L 1UEMA 1U8LA 3ARDC 1S7UB 4PJAB 3FL7A 1G1KA 3TESA 4M43L 5FK9A 5KSUB 3B9EA 1UC6A 1MW1A 4OM0H 4X98A 4UNVA 3AB0B 1MLBA 1NUGA 3E2HB 3ZPDA 4P5MA 2ZJSL 4PJ6A 4RZKA 3HTLX 5FKAB 3UMTA 3LIUA 5ACLA 4Y4FA 1AZUA 2GG1A 5FYKU 3MJ7B 3EUUA 2WP3T 3MROA 3GWJA 3IGLA 2OSLB 5MP6H 2H32B 1I8UA 2GJRA 2YRLA 1AGBB 4N2GA 2XWEA 3G6JE 3SKJL 4DKEH 3RVUD 3F64A 1Y6MR 2W80C 2FSEB 4K73A 1DDTA 5AYTA 4XMPH 3TWCH 4NQQA 4DOHB 2NNXA 3SPVB 3L7EA 2O4EA 2YPLB 4CSSA 1BD2A 1IZJA 3OG4B 3U1PA 1EEUA 4PPTA 4FFVC 5BJTB 1D6EA 3HE7C 3KNBB 2PW1A 5FYJU 1YNTA 3RFZB 4XMZA 4KNQA 4WAFA 4FQHB 2AV7A 1G7MA 2EDEA 4U6VL 5D1ZC 3S0PA 2QKIA 4QR7A 4K3DL 2CGYA 4JKPH 4EVNA 2MPVA 4S1QL 2WLKA 3BUBA 3TT1H 2GUYA 1MFDL 1JZ4A 3C5SB 3TFBA 3AU1B 1IM3A 2Q6WA 3T3PF 2FO1A 3DVFA 2D0FA 4WUUD 1YMMB 1BM3H 3JTTB 4Y9GA 5DA0B 1DN0B 2OLDA 3VWKA 2Q8BL 3ABLB 3VRJA 1JK9A 1HWWA 3T3MF 1XBRA 5B4MC 2FCBA 4PGCA 5ID0B 2Z7ZA 1KB5L 2FE0A 4GEIA 3C2AL 3QUYD 1ASPA 5HHXH 4K2UL 3VXRD 3QDGD 3MLZL 2ZOOA 1IBGL 1OD7A 1JERA 4ELMB 3GSXA 2KT6A 4L8BA 2I27N 2EDLA 1SY6H 1TTAA 2J55A 3CN2A 5J1TC 3M6DA 2VJ0A 2BIOA 1XQ4A 2R0KH 3HNVL 3LVTA 4FC3E 1SLUA 4HP5A 5CIPA 5DYOA 5CEZD 5GS0H 4AMKH 3HI6H 2BY1A 2FO4A 1N4XH 5K39A 1CTNA 3CSYB 4MB1A 4GP4B 3DHUA 2WIIA 2ROXA 1L6ZA 3DI2B 4FQXA 4UTBL 5HJ3A 5DFTA 3RZCD 3BGMA 2QJDA 5L8LB 3F05A 2ICES 2OL3L 3BZ4B 3TWCL 7FABL 3TBYA 5KJ4A 3NCCB 3NIDF 3JWDH 1YC8A 3ULSA 3MREA 4P9MH 5IB4A 1S3KH 3CUPA 3QDAA 1BV8A 3FKUS 3MFGB 3BT2L 3TYGH 2PO6A 3DVIA 3K6SB 3UPRA 5I6NA 2XRAH 3QG6A 3NGBB 3VXQA 2DZEA 4NC1E 1EK3A 3S35L 4XBPA 3KVPA 1P4UA 1XO8A 1X5XA 1QVOA 4ZFGH 4NPYA 3ISRA 4YUEH 3GBML 4RISH 1KLGA 4ODTL 4K0OA 2DH3A 4FCAA 5E4OA 2G30A 2ICEA 4IHOB 4JUSA 1A02N 2Y72A 2L8AA 4O2EA 3DKHA 3GRGA 4DESA 1X7QA 5J4MA 2UZYA 3NN8A 3MRRA 4GG6F 4L23A 3FONA 4HS8H 3INOA 4NJAL 4AIZB 3GMLB 3K7UA 4QTHA 1RMFL 2BS71 5EOQL 1DLHA 3O8XD 4RGND 1F4WH 4JZJA 3EOAA 4J12A 4YK4C 1BX2A 4K5LA 2W9DL 2MQGA 2BVTA 1GS6X 4MJ6B 3GGWA 5KVEE 2NY2D 3TGXA 2BLFA 1HAWA 2ZQKA 1KUMA 3CPLA 4OZIB 4TULH 5GGRY 4PJDF 2P24B 1O75A 5HHVH 4C83B 3JWOH 5L0QB 3REVB 2QDWA 1YNLH 3S98A 3ZTCC 1TZIB 3GMMB 5F1NA 4HIIB 4LVOB 4HLEA 1KCKA 2ZONA 3Q9PA 5T1DH 1E5YA 3P4NB 4O02B 4OCWH 5I1IL 3FHQA 4YXLH 3UP6A 4CA4A 3K81A 4FHKA 3BWAB 4PREB 1GYCA 1KLFA 3KYOB 4GQRA 4XT1C 1LQSR 1D7BA 5FECA 3MFFB 4GI6A 4JFVA 4JANA 1NEUA 3L9RB 4OGAD 4UIMA 4F24A 3ARYA 2W94A 2MCG1 1IT9H 3SJVB 3N1QC 2Z8RA 4I0CC 1TVHA 3CLFL 4JG1H 3T65A 5HXMA 4OH2A 1NAKL 2LU3A 2IAMB 2ZCHH 4AZ8B 3FW6A 1F8TH 3IJYA 2CA3A 4YDKH 4UTCA 5E99H 4UOZA 2HFTA 2E7HA 2ZXQA 5D2LE 3RX8A 1F56A 3N0PB 2APVA 3RUGA 3B7UX 4XP9L 3X13B 1ZWIB 2R2BA 2A99A 3FULA 1CD1B 4FMFA 4PRNA 3FTSA 4ZFZA 3NIFE 4ZMWA 1AGFA 4I88A 1SHXA 2GBAA 2ZX8A 2FATL 3FO9B 2C3XA 1IC7H 1SXBA 3BAYA 1WBYB 2VITB 2X41A 4G6KL 4TVPL 4DO4A 4E0RA 2ITCA 2F53A 1M6UA 2PPCA 3BUYA 1CBJA 1G1YA 1D5ZA 2RH0A 4GB9A 4OD3L 5EU5B 3HE6B 1QLFB 5E2TL 3ZZLA 4ZTOL 4RCAA 2GHWB 1D7FA 2KUTA 4XO8A 3PWPA 2O1AA 4GMSH 4NUMA 4B97A 3SPGA 1F3DH 5IMKB 5HDQL 3GB7B 4YMPA 1MNUH 1A25A 3GHPA 3MLUH 4RGMB 2OMYB 5F72S 2HRLA 3N85H 4EEEA 2J1YA 3S2AA 4G9FA 3PHAA 3VXPB 1N9PA 1MQ8A 3WTYA 3V0VA 2W95A 3CSBA 3RTQA 4M03A 2XWRA 2GEEA 5E2UL 5D6DA 2BFVL 2CNZA 4QGTA 4BFGA 2YD1A 3FU7A 4DJMA 2P9RA 2LFEA 3EFFB 3FB5B 3PUCA 1QTYT 3QE5A 1PLAA 3P02A 1X4XA 2A9NH 5DUBA 5I8CA 4OJEH 5I8OH 4XAKE 4G5ZH 4X4MA 4ZAKA 1H6FA 1WYJA 2OI9C 2Q76B 3SYQA 1TO4A 3S96B 3BXNA 2DJSA 2V9TA 4ZW7A 2EKSA 4G7VH 4EI6A 2IQAA 3VG0H 4EVNB 4RFOL 1QFWM 2D3NA 4WK0B 4A7GA 1BOGB 4XPHL 5EZLB 1U42A 4G2AA 3QUXA 4XZUB 5CP7A 3I02A 4Z7NB 1KLUA 5DJZB 1ACYH 4OCRL 3P3RA 2FWSA 3GI9H 3WFHB 3EJPA 4DTGL 1H8OA 2E4TA 4OJCA 5SX5H 2Z34A 3QJZA 2KQMA 3VUAA 1CGVA 2D0HA 1FDLL 3GIVA 3L1FA 4HKBB 1OSZB 4IU2B 4BFRA 1QSZA 3K0YA 4JVWA 1KPRB 5C07D 3V9CA 1JGVH 2PO6C 5DQDH 3CHSA 3QAZC 4G8FA 4LESA 2COVD 2Y6SC 3OJDA 5D7SH 3HNSL 1SUJA 4ECNA 4E68A 3S5LG 3NEOA 5SWZB 3FB7B 3UYPA 5JA9A 4B95C 1KN2L 3HN8A 4X8JA 3NJJA 2DS4A 1I1FA 4JDEB 4JREC 4NQUA 1JWMA 2UXVA 4WHYG 3A3YB 1BWMA 1JN6A 2JI3A 2AQ2A 3BKYL 3DX2A 4GW5B 1FNGB 2C3WA 2VDRB 1ACYL 4OTXL 1XIWB 4GG8A 4JAMB 1IQWL 4RFEB 5JR1H 1TZHB 3X3FL 4TTGA 4WWPA 4NI6A 1XH3B 3B34A 3E1ZA 2VLJD 4EN3A 4P2RE 1NH6A 2VZVA 4EDXB 3SE3A 1RUMH 1U8KA 3L3DA 3MODH 4LLMA 3Q0HA 3QWQB 5E6IA 1E8WA 4NWUH 4R26L 5MP6L 1E67A 4MMZC 3NSXA 5IJVA 1NC4B 2WSPA 3FU9A 5AG8A 4M6ML 3QG6B 1I8IB 2NY4C 3H9SB 3WKNA 1G7LA 4OD1L 1AR1D 4W6XB 4F15C 4XNZB 3ESNA 4Y4KC 1U92B 2BXZA 4RMRA 4Z7OF 2GTWB 3LEXB 2XYCA 2GJJA 3N40F 1H3WM 3G9VA 4Y4FD 2NCEA 4TNVK 4PJDE 4YLQT 2BS8A 1T1ZB 3WCYA 3BSGA 4OF6A 2IBZX 4WF7A 4PJFE 5KSBF 2CKBB 1A6UH 2BDNH 3N9GL 4NKDB 5E0QA 4CMHC 5F7YC 2IPTL 1NAMA 4G6FD 4FZEL 2XN9B 4HD9A 4YHOL 1LO2L 4NDMA 4UOQA 4AL8C 2NY5C 3K2KA 5D72H 2LVCA 4DEPB 5MENB 1A6ZB 2JCCB 3EYSL 3H55A 3K6NA 3WEBA 1J11A 3V6FA 2C9SA 4HBCH 4J8QA 3ZQ9A 1N2RB 3MBWA 4O5LH 6PAZA 1A6AB 2UUDH 1FN4A 2HVKB 4P5TB 3EG9A 3EUDA 3BT2H 4E9TA 1E40A 3KLHC 3BKML 1MIML 4UT9L 5F7EH 5HHNA 3GUTB 3W0WA 3L3IB 4PMFA 2FX7H 1MHHA 3V4PH 5KUMA 1NCUA 3RZWA 2NNAA 3HAEB 1XBDA 2N0MA 2YARA 3K2UL 3ZLQC 1PCXA 4WHTA 1U41A 2RALA 3OB0H 2EH8L 4LASL 2AAVA 3N1FC 1Y18A 3N43B 1A0QL 3FUFA 2DLIA 5IFJB 1KG0B 3G3LA 5HD8D 4LCWA 3WUZA 3GFUA 4DQAA 3V4VL 3UBXA 5ETUA 3BPNB 5BNXD 1BQHB 2A0LC 4F2MB 3LDBB 1P2CA 1P5VA 1UWFA 3GI8H 3QDGA 2AJUL 5GRJH 4WDIA 1BSIA 4FQCH 4LSQL 4PEEA 4AITA 1RHHB 4N68A 4S2SA 2BNQB 2WW8A 5D96B 2HVJB 4FKEA 3HIZA 3OVUB 5DI8B 1S3KL 1CIDA 4LDOB 4UYPA 1MI5E 4HH8A 4LAQH 3D3VB 3OKOA 1D5ZB 2HKFL 3KPOB 2AI0H 1J8KA 1Z3GH 1RZGA 4YBHA 3O3DB 1LO5A 3MA7A 2X4PA 4OJDH 4EBQH 5B7FA 1OP4A 4I4WB 4BFFA 4LXFA 2BW4A 2RB8A 4XN1A 3BDYL 3DVGB 2QADB 3AY4C 4IIQB 4Y9BA 3QRFM 1ODAA 2J25A 5FYKE 3OAZK 3SE4A 3V4VH 3N2JA 4HU8A 1N7MH 3ZE1B 4R4BB 1UJ3B 4UQ2B 3FHAA 3INUH 1KGCD 2FEEI 3QZLA 4TTDC 4AEHL 4DVBA 4D9QD 5C0IA 3QCTL 3IU3A 1B6DA 2YEVB 4GAGL 1F41A 3GRBA 4DGVH 2B5IB 1DJYA 2OR9L 4WU5A 3V8OA 4EQ3A 3KPTA 2DMCA 2QQKH 3TIDB 5KS9B 3QQ9C 4K5OA 4XRCA 4W9FC 4I2XE 2XETA 1JPEA 2VMFA 3SJVD 1SN2A 3FFDA 4M6OH 3ZQWA 2EDMA 4LSPL 1PG7L 1O6SA 1RZFL 1SMDA 3BGFB 2BSRB 1EVUA 2DWDA 4BK4A 5HHMD 1RURH 1Q9LB 1U58A 2WXOA 4ZUSA 5F9WB 5GS1A 1YPZB 5D4QA 4HMEA 1P4IH 5GGRA 4KRPC 1KTKE 1NGQL 1NGPL 1WAAF 1UM6L 5LUMA 1V5JA 5JHDE 4MRBA 4ALAC 1X44A 3CFJB 1GHFH 2CM6A 2B9AA 4M43H 4M61B 5C70A 3LB6D 3PY9A 1IGML 3EHBC 3PJLA 4ZO7A 2DBJA 3UJTL 4Z7OB 2VGLM 2XQYK 4K94L 3MJ9H 5HJDA 1B3JA 2R2EA 3RVXD 2Y5TB 3O4LA 1XEDA 1JYXA 2KBGA 1HJBC 4QRQA 4YDKL 4KKLD 1AHWB 1DQLH 3N40P 5EBGA 4J6IA 5CJ8A 3PWUA 4XP9H 4Y4FB 4OLVH 1PCSA 3RFRA 4O51A 3RY5A 1BP3B 5D1QA 1WEJL 5E9DE 1JN6B 3L6FA 3UZQB 2R4RH 4AUUA 2BSEA 1IAOA 3B56A 1E5CA 4EUPA 5JXED 4DUWA 3MYJA 3MC0A 4KKPA 5M95B 3C12A 3OHXC 1HXYA 3VI4B 4Z1PA 4NT6A 4XXDB 1QRNE 2QV4A 3RILA 5IQ7L 1RAMA 1M53A 2P49B 4IRJB 4Y5YA 4DO6A 3WN5B 4CU7A 3JV4B 5AFAA 1IZKA 1JF1B 4LSRL 4X7TA 4XO4A 5C0CB 2BP0B 2ZAHA 1T1XB 1BG9A 1TQTA 1XH1A 1EX0A 1BJ8A 3GSQB 1GGBL 3BEVA 2YD6A 2IFFH 1CFQB 4DGWC 2CO4A 2YPLE 2CALA 2OXGB 4PJBF 2DYPA 4WHYH 3FSWA 1JXKA 2AJ3A 3QWRA 1IE5A 1CLOL 4UQ3B 3NJFA 1ZT1B 4G6MH 1QLEB 1TLKA 4XNXH 5F7WC 2GAZB 3OR7B 2BZCA 1IGTA 2QVIA 4LVHC 4R7DB 5F88B 3JTTA 3OGOE 3ZKSD 3SBWC 1VFAA 2XHNA 1SXSA 4JY5L 3TL5A 1D5BB 4NZRL 4XCCH 1A14H 4F8PA 2SODB 3ALPA 4NGHH 1G9MH 4OIIL 4KJWC 2D3JA 3J7HA 4ELMA 5HVHB 1K5WA 3NZ8A 3T0EE 3TBSB 3BZFA 2HH0H 1CE1L 1KB5A 3JSSA 4NWTL 4PB9H 4I3RH 1SHWA 4RMTA 2FJSA 2QPUA 5MENA 1X6NA 2NY1C 4MSWA 4KVNL 1A4KA 1B4TA 1VENA 2CR6A 4HPYL 3TO4A 4WTQA 1T7ZA 1NFDB 1AVAA 1AGCA 1BM7A 3CZUB 5I6PA 5LGYA 3A23A 3SGDI 1ZHLB 1WUNT 4F9PA 2RFXA 5KOMC 3TH3T 4MJID 3L3IA 2H32A 1CR9H 1DTUA 1KCVH 1KN4L 2J88H 3KS0J 5E5MA 3QNZB 3U36A 1SDAB 4N5EC 4PW3A 1ND0A 1JPSL 4QRUB 1A6WH 3QPKA 5B4MD 1FIGH 4NYLB 5C0GA 4DNLA 2ZCKL 3GKZA 4H8WC 5I5IA 1G5AA 4X0KB 3JWDC 3JUZA 4AC2A 4LHUB 5JPNB 1S2EA 5DHVA 4AK2A 2A1WL 3IDIB 4PCTA 1OAYL 3WAKA 3MLYL 4AKPA 4WY7L 3FT2B 3GXNA 4M5SA 3QA3A 2MNJB 2NT0A 4FQHA 2MPAH 4NFDA 3W39B 4FJZA 4J8RA 1N0LB 5CINH 1T3FA 4IS6A 5DK0A 1P1ZB 1PFCA 1R5IB 1IGFH 3LXCA 5HDBE 2ZXDA 3JWDL 4Q97A 4OT1L 3ZT6A 3TCLB 1A2YA 4JR9L 3V9EA 4G7QB 3ARBB 2CUIA 4G6FB 3FUHA 4G80B 2LR4A 4P5RA 4R83A 3QARA 2CLVB 5I8EB 2E27L 4KMTH 5KVDL 5C0BB 4PTTA 3M88A 1T22A 2PCYA 4OIIH 4QXUL 1G0DA 2D73A 4ELKA 2H1XA 4OGQC 1GZHA 4ZG1A 1TCRB 2BC4B 2VDML 2VLJA 4EN3D 4RAVB 1VZIA 2AMGA 3UH8A 4YE4H 4C83A 1HINL 5IHUH 1G43A 1JF5A 4U3SB 4OQTA 2RJMA 4G3YL 5E6ID 4XE5B 2A9AA 4EZKA 1X7TA 2IAAC 4WWKC 4PJCF 5IVOA 1TTCA 3V6ZA 3D87B 3S37H 4KAQH 3GMNA 3IS1X 1PZUB 2YA0A 2WLIB 1F2QA 4JG9A 1XAUA 2BCMA 3EGDB 3PHQB 4JR9H 4ONHB 5IW6B 3EOBA 3HZKB 2X09A 3KBEA 4OZIE 4Y19B 2NUTA 2P5WB 2P8PB 2WYIA 5E8DH 2O5ZL 1CF8H 2EYTA 1CDYA 3QJFB 2WXLA 3QDJE 4QXVA 1QFOA 5GZNA 1DLFL 4PJFA 3K2MC 1C5BL 3AITA 4IDLA 4NO2A 2R7EA 5J6GA 1DQJB 4IRZA 4A66A 1PLCA 2BSED 4PVBA 3TVMC 1YPZA 5AOLA 3WHXB 2ID5A 5IHUL 1Z0MA 3H2PA 5A16A 5C71A 1JXJA 1F6FB 1K8DA 4X5PA 4MQXD 3HC4H 3UC0H 1J0IA 3BSZH 4U6HB 4OZHF 5ISZE 2J72A 4U1JA 5SWZD 3JV6A 3MV8B 4YSQA 5FDWA 4IEFA 5FUCC 4ELMF 3HFFA 4ZSOA 4PR5B 4U6XB 2Q86B 3P0VH 2NSXA 3KLAA 5J57B 5L8KB 2FHCA 2HRGA 3RG1C 4L29A 4AEHH 4A55A 2QADD 4AMXA 2J71A 5KN5A 4HUVA 1U8HA 5TD4A 1E8ZA 3IAQA 4FCHA 3KJ4B 2L7QA 5C0EA 3GMLA 3MUUA 1JGDA 2RMNA 3MJ9A 3VSVA 4AQOA 1MRFL 3QWRD 3SKNB 4GFTB 3T9WA 4NQDD 1IVTA 1AQDA 1C8QA 1FNEA 5DHMC 4EKJA 4F27A 4DUXA 1DLHB 3WEMA 2XX1A 4XP1H 3OKMB 3O0RH 4GAAA 3I9PA 1X5KA 2XG4A 5C0DB 3O41B 5JNYB 3C09B 2JLPA 2LTQB 1YEKL 3BGFC 5L2JA 5D7IF 4PYHA 1FO0L 2F18A 4YX2L 3SBPA 3STBA 1SYVA 4HU2A 4NZUL 3WY4A 4OLEA 2OYKA 5IB2B 1Z1WA 2VZUA 4OBRA 5D7LD 3VYPA 1FZJB 3FQWB 4BRVA 5IFHL 3I6GB 4WTZA 3MROB 4WFFD 3U79A 5DJYA 4DP1X 1MXGA 2EILB 2ESVA 1NLBH 2WYHA 2Y6TE 4YPGB 2CUHA 4J3VA 4X6DB 1TJIH 5EOCJ 3VFSB 4PGEA 1HI6A 3VFNB 3QEUA 1H6EA 4NKIH 3GEWB 5J7CC 2GJ6A 1XCTB 4KJYB 5GHWL 1HE8A 1XL6A 3EBIA 2FNWA 3D50A 3FPYA 5I73B 3A67L 1U93B 1DL7L 4PY8J 1RPKA 4WNQA 5DURB 4KTGA 1DBJH 2ORBL 2NY1B 3S36X 4JNXA 4OFKA 4TTDD 3K6DA 3WFEH 5CILH 3RWCA 2AQPA 3QQDA 4MNQA 1E6JH 2B4CC 2VDQL 1ZA6A 2BNRA 3EJSA 4X6EA 4ZUTA 5ANMB 3REWB 2H47C 3JZ7A 2AKRB 3J27A 4OF7A 1E0OB 4KI5E 4WHCA 5TE6H 1C1EL 1LE5A 1FGVL 4Z3GA 4PJ9A 2H26B 1T21A 3L2MA 3NZ8B 4E0RB 2X7LA 3PV6A 5EU4B 3T09A 2WHVA 2ZWSA 4ZFOA 1LO0L 2YGOA 1OCWL 3QULA 1MFVA 1EDQA 1PIGA 3FFOA 3SGEI 1PZDA 3VI4F 2IOOA 2WGNB 4MJ5B 4MNGE 4U1NA 1KENH 4Y1AD 5DD5L 5ECJE 1PS3A 1KCLA 1JHTB 4K94H 4WFGD 1JHKH 2EE2A 3VU2A 2DI9A 4K5MA 4WW2C 3CD4A 5E6RB 2ZNXA 2FJUB 2JTYA 4JE4B 3IFLH 2ERJC 5ADOH 3L3HB 2F08A 3QUHA 2I7OA 3DX7B 3MU3A 4PVNA 4Y2NA 4YDJB 3QPXL 4HCRL 2P7TB 5E6IB 1F13A 1NJ9A 2WKGA 2Y25A 4M4RA 5TE6L 5AKVA 4NUGH 1I1AD 3X1BA 4HIHB 5L7XL 3OKDB 3HFML 2HFGL 1F3JA 4P5TC 1KXVA 2OZ4A 5KVMC 3WO3B 4KI5C 3NJVA 4BHUA 1YYLL 4YDIL 3WS3B 4XAWL 3WNPA 5TPWL 5TJWK 2VSKB 1I1RA 4Q74A 1JPTH 1WC7A 4RZCB 4YJZL 5EN2A 3EADA 1BZEA 4P4KD 3MHZA 5GGVH 3S3PA 4LNRB 3GPSA 1U2HA 2DLFH 4F9LA 3CDGA 1MJJB 4UDTB 4IS6B 1F97A 5FA4A 2PWGA 1IGYB 1RZJH 4JB9H 1QR1B 1JFQH 3I6LE 3NCXA 4Y9EA 3RL2A 3PNRB 2AEOA 5I71B 4Y4FC 3F2LA 3BFOA 4MMYA 5GS1C 4JM2D 1I7ZA 3CE1A 5DLLA 3NFSL 1KC5H 4I1RA 1G9NH 1VCBC 2PWDA 4ZO6A 1QSEE 1XGRB 4ZQKB 3ZY7A 4WKZB 5B3NA 25C8H 4LKXA 1EBAA 3KM2A 3CFEA 2VLJB 4IHOA 3X1NA 3KGSA 4G8FB 5AOZA 3VTMA 4AL8H 2FQEA 4RRPG 5SWZA 2Y36L 1MHPL 4R97C 2VC2H 4KXAA 2HWZL 5IESH 1SLWA 3V6ZB 2ZX6A 1MJ7L 2VRKA 2MTPA 4EAEA 3FT4B 4GW5A 4TVPE 1FNGA 5DVPA 2KZ1B 4KY1H 4GKSA 5LAPA 5CIPH 1CK0H 4V33A 5I0DA 5JPMC 1EZVY 5I30L 5LJYH 3MACL 3D09A 1NIDA 3LMJL 3WXWH 2O26U 4MAUL 4YNYA 4H0LC 4PBVC 3DGCR 3D8MA 3WJJC 3BH9B 1KIUB 2NYKA 5HVGB 2MOQA 1OO2A 3U4EB 1WS7A 3QPQD 4OW6A 4PH8A 4NBXB 2JI2A 1U3HD 2XJKA 1RHHA 3VACA 1ECZA 1ZHNA 2WBXA 3KS0H 1NC4A 2QPDB 3L54A 4MJJA 3UTTB 1TKWA 5D7LA 2HLEB 3OGCA 4HJGA 2WXIA 3EYVB 4ADGA 3E3QE 3ZQXA 4CSTA 1LO5B 1F02I 3MA7B 3VXRB 1BYNA 4OF8A 3JWOC 1U3ZA 4P8QA 3G6JF 3I3DA 4PJEA 2WO3B 5DYFA 2R2BB 5ITFA 4M3HA 5KAQF 3CSGA 4WU7A 2R39A 1COBA 4LCUB 2NXZB 1AQDB 1L9OA 3MKKA 3CBRA 3L5WA 1WGVA 3EDDA 3QIUB 3HG1A 1BAFH 2PW1B 2BSBA 2F7IA 4L05A 3SE6A 3M45A 5C6TL 3KR3L 4F33A 3O41A 1EEYA 5FYJL 1KIRA 4JQIA 5TQ2L 3C8KB 4WENB 3VWJC 5J3HC 3PL6B 4XRCB 2ZUTA 3L4XA 4P5KB 5TQ0L 2WQUA 4HCFA 1EFXD 5IMKA 3UG5A 1U8JA 1D9KB 4NSKA 1OGAD 1T04A 4ZS6C 1NOLA 2IMNA 2E5EA 4W9IC 1MJ8H 2YWZA 4YQXL 3L3KB 1TJGL 2QHRL 1B4LA 5A6MA 3HHRB 3NFPA 2J3SA 2WMPB 5A2AA 3UJIL 1NCIA 1YEJH 2VLKE 3J07A 4NNPL 5FB8A 2D7TH 3LZPA 3PABA 3VRJB 2R4SH 4F9PC 3MRQA 4FNLH 2DQFA 1TZOA 3PWJB 4Q6IC 4QRSA 4TL5A 2GSIB 4UILL 5HHPB 3V0AC 2W0KA 1OWRM 3F12A 5DZVA 4KHTL 3X1GA 2EO1A 2R23A 2WXHA 1V3LA 4XP5L 3UADA 4MAZA 3S8GB 5LGKA 3V0HA 3ZTJG 4FF9A 3GDBA 5IFJA 2VLRE 4BH7B 4RGMC 4M61A 4XB7A 2MQ0A 2CDEB 2VL5B 5SWQB 3MZTA 5C3TA 4A7SA 1VRSA 3GRWA 4GLRH 4K3HA 4HH9B 2R27A 3L48A 4AM0B 5AKSA 1AR2A 1TVBB 1G6RA 4LOUD 4LCCC 2KHAA 5CSGA 2QHRH 3M7OA 3U7WL 3U6RA 3LH9A 3MUY1 1XHHA 1BOGA 3FTYA 3PDDA 3RPKA 2GK0B 1CL7H 3K8KA 2MEJB 3RBSA 2YC1B 2FLRT 4ZXBA 5LDSA 4F91B 3LJ3A 4C57C 1HSAA 2OZ4L 2N56A 1MCPH 4V1DE 5EPMA 3DO7B 4Q6IA 4NC0B 3HC4L 1CN4A 3A24A 3ULSB 1K6QL 4OKDA 2X05A 4TUOB 1S9XA 1ZGLA 1KJVB 2BSTA 4WJG3 3CNKA 4Z7VB 5DWPA 4EIZC 1ILSA 1ET8A 1UFUA 2V8MA 1EXHA 3RDTA 3VNZA 1F8TL 3HKZA 1WFIA 1I1YA 3RUGF 1IKFH 3MUGB 5IHWA 1RZ7H 1ZANH 2G9HB 1BAWA 4NT6B 4XXDA 4J3OG 3QWOB 2APBA 5C0IB 5CGYD 1M3JA 1LILA 2CK0L 2HRHA 3MV7D 4I85A 3QUMH 2ZCLL 1TMQA 2Y06H 3OJMB 4IGBC 3ISYA 4WU5B 1OAUL 4M4RB 4ELME 5HPMA 1RUKH 3L4VA 3GSNL 2OK0L 2D4FA 3IE4A 2JKNA 2UZIH 5DJ8A 2WXQA 4CDHA 1TZHA 2KC0A 4X2UA 2PPEA 3C6LA 4J3OH 4ZX6A 3SGKA 1NDMA 4L1BA 3U4BL 3NUKA 4JMNA 4XHQA 2X6CA 1BX2B 4ORGB 1OZUA 1A1OA 3BPCA 2GSGA 1MJJA 3L7FB 2PNDA 2YZ1A 4I18B 1OL0A 3TM6A 4L4TE 1B0RB 1AC6A 5GGRB 1R0AH 1R33A 5IVZA 3O8XB 4RGNB 3GJFA 3H9HB 5EFIB 1I4FA 1KMGA 1ZMYA 3PL6D 5IF0A 3K71B 1INEH 3VXUB 1S46A 3GSRA 1KTDA 1JNHB 1CDCA 1R5VA 1YN7B 3RWFB 5CCKL 2DLEA 1UA6L 1NSNL 3I6KA 1UT9A 3MNWA 5CWSB 1H3UA 5INCB 1IKNC 3FQNB 4CSPA 3IRZA 1RLBA 3MRMB 5IHBA 2G2PA 1T0PB 1EO8L 4OFYD 3TJHC 1YEWA 4Y1AB 1LP9A 4FABH 3C6LC 5D1XA 3H9ZA 4IBLT 4QRQB 3TXAA 3VQMA 5T33L 4W9CC 4QHKJ 3EBGA 3ASOB 1U4FA 1NPJA 1I53A 3FH7A 3T0DA 2QKIC 1CURA 3MRFB 1IM9A 1U3NA 5F3BB 1RK7A 3LKQB 5C0FB 3FOMA 4JFEA 2D8KA 2YSSA 1TQVA 2AK1H 3AY2A 2GTZB 2VRAA 4X6BA 4RMVA 1JPTL 5J13C 3QIWD 1X5MA 1TYRA 4LHUA 5GGVL 5JPNA 3QJXA 1FG9C 2ETWA 4MVBD 3EO0B 3TFKC 5JXAH 3MBWB 4H88L 3SYAA 4C59B 4QOKE 5LGJB 3F6LA 5D5ME 2H3NB 2UZIL 3ZMEA 2F74A 2WSDA 4UYQA 3ZZSA 2NUPA 3Q7JA 3LZFL 3Q44A 5TH2A 3FSAA 3OBAA 3HLAB 4ZSOE 1Z32X 4YHIB 5ADOL 3GK8L 5AAPA 4TLUA 5BRZB 2ITFA 1MW2A 2JKSA 3VVWA 2OMYA 2ARJQ 3NTCL 3WKML 1ZOXA 5T3XE 1YEDB 5JTWA 1AJ7H 1KOAA 3HNVH 3GRWH 1VACB 1RVFL 1IBHA 5DS2A 5T3XH 1SJVA 4HC1H 4XB3A 1X9UA 3BO8A 1EDYA 1KJ3L 2FR4B 1INEL 1HH9A 3O3AB 1QUNA 1U8OB 3QK0A 4K9EL 1EHAA 3QG7L 3R19A 2QLVB 35C8H 1BVKB 5EU6B 1NGZB 2BOCA 2X1OA 4YL4A 1JHLH 2CO6B 1IGCH 2OMVB 2XWZA 4JW3A 4KROB 5HJBA 3VRLF 4NO0A 1HHIB 1N26A 3ETSA 4ENED 5AOMA 1U4EA 2EEXA 4XX1G 4EN3C 3OKOB 1SNRA 4PJBB 2R8SH 1DZBA 2WANA 2KERA 3P11H 5CKGA 5I18L 4DPRA 2EYRB 3VD4A 3WU1A 5F71A 4ATTA 1NIEA 1NBCA 5SWSB 1JGUL 2IAMC 1HH6B 3DUUA 5KVDH 4MGXA 4ZXBD 2ZKHL 4PG2A 3QJFA 1NPUA 2Q7AA 3KPRD 2J2ZA 1CYGA 1DCLA 4M7JH 4HJEA 1XR8B 3AG3B 1UB5B 2FB4L 3EYOB 2VAAB 4PJ8A 4AEIL 1FC2D 2VQUA 4DAGL 4DK5A 4GW1B 4PN6A 5F89B 5F0PB 3IXTA 4PUBH 1BMWA 4GNKB 4J4PD 1QSEA 3M7FB 4HWBA 3MNVB 4HALA 4HUWA 4GG6B 4DWHA 3GBNH 3NABH 4M8QB 5LNDA 3GEFA 2CM5A 4U6HA 2R69A 3D06A 3AB0C 1DYZA 4KFZC 4A2GA 5BS0B 4NAMA 2C9UA 2B59A 4JO5A 3QI9D 2WWMC 4PWJA 1TJXA 2LT9A 1YC7A 4N24A 3W39A 2BSRA 4TF4A 4NRYA 1LVEA 1XIWA 4GG8B 4JAMA 1C5BH 5DK0B 3X17A 4D2NA 1R5IA 1J8HE 2GK0A 3VI3A 5KANG 1CZ8H 3SGKC 3L9EA 2E4FA 4PJ8C 1RPQA 3V55A 3B9AA 5HYSA 3B37A 2HVBA 3S5LB 4CADB 1NAML 3IU4H 3FRPB 4EDXA 2A3TA 2GPZA 2V2TA 1S9XB 1BW8A 1K3ZA 1MIEL 2FZ3B 3A22A 3BJ91 3CSTA 3CZSA 4FG6D 4TQEL 1T66D 4XMLH 3VJ6B 2XV0A 2DMHA 4XN5A 3UXFA 4LSSL 3SY6A 2I26N 3MUGA 1P1VA 2F19L 3BLKA 4G7RB 4YHOH 4DF9A 2ED7A 1PG7W 3OPUA 1P9MA 4N4YB 1NIFA 2HUEA 1X5YA 4HJ0C 3N1GC 4IGBD 1MPAH 5K9OB 1TO5A 2JQZA 2D9CA 2XQBH 1W0VA 1CXHA 5HGBA 3LKPB 4QOKA 1GCYA 4W1TA 3CFBB 2ZKHH 3ZRSA 3VFWB 1HI6B 2BVUA 3FN3A 5D1XD 5G5DB 5I74C 1HVXA 5KSAD 3I85A 1HQ4B 3SCMA 2XQ0A 1NBYA 4UNTA 1CI3M 4NRZA 4JDVA 1YCSA 4NM4L 5T1DL 4PW4A 5IEHA 1MCIA 2XIDA 2MMXA 3M86A 4LSUL 4GUPA 4YX2H 2P47B 3PDOA 3WKYA 4F8OA 4WNQB 1T0MA 2EECA 1NCAL 1VEPA 1CPUA 1DQDH 4GUCA 1WHPA 2F19H 5F3HA 3N1PC 1J86A 1SXZA 1MCLA 1A64A 4A7VA 2WM0A 5E9AA 2C34A 3R4RA 5IY5B 3BSHA 4NFBA 4NN5B 1HDMA 1LEIA 1EJ6A 1BVOA 2EIDA 4HQQH 3RRQA 2N1KA 3GSRB 4LBEA 3VU1A 1JNHA 1R5VB 3OAUL 2G75B 4QWWD 1QP1A 1OCRB 5E24E 4PV1C 4PS3A 3VFMA 3UTQA 3MNWB 1ZT1A 4PCKA 2ZJSH 3MRDA 3SCMC 1BVLB 3MMEA 2J1XA 2J6EA 4EIUA 4PJIE 2B1HL 5I1HL 3HB3D 2VABB 3MRHB 4UAOC 3VDBA 4BKSC 1Q9OA 5A2LH 2IF7A 4PCYA 4HPOH 1PBYA 5M94B 4R6UA 1ACXA 1MAML 5DTFA 1A5FH 3JWNE 4HKZB 4RNRB 2Z0BA 3BRGC 2EXSA 5DRXA 4QHUA 1U3HB 4XMVA 2OSLA 1AQ8A 4PJHB 5IOKA 3VH8A 3ZDXE 4PJ7F 4GS7B 3KVDD 1AZCA 1I8MA 4AGMA 4QGYA 2IQ9H 1RPUA 5C0FA 1NBQA 4YDJA 3MBEB 4JFEE 2PYEE 1U6AH 1GGIL 4LLDA 4MLSA 5HI3C 5KZCB 1K4CA 3QCTH 5DRZA 3VXSB 5AWNL 5DDHB 4XMKL 3SPVA 4APQB 1SYVB 1RUAL 5IB2A 1AGCB 3P9LB 2WV3A 5TK4A 2WB7A 3H0TA 2DLFL 4U1IA 1Q0YH 3Q13A 4K5NA 3RE0A 5CSZA 1PQZA 3KPQB 1UUSA 2J8UA 4H8QA 4HK3N 3IRCA 5HYFA 2R1XB 4YPGA 4DP8X 3D85D 4N87A 1R6VA 6FABL 4LLWA 2F6AA 4AQ1A 2J6WA 2FQFA 3FN0L 5FA4B 1PZAA 5E08H 4OGXH 2IAND 1FC1A 1Y0LA 2ZCLH 1D5MB 3HS0C 5ERWB 3ULUC 1L6XA 3DC0A 5CUSL 1E4HA 3E6HA 5I16B 3FBQA 4J27A 4G7VL 1HOCA 3VI3E 3BKYH 4XPBH 2C4XA 2ZXEB 4A6YL 2XG5A 5KUKA 3ARVA 2KMWA 1XGRA 1FG2B 1RZJC 3QZWG 4OTXH 1L9PA 1GZQB 4MX7A 5AWNH 5DRNB 2AXGB 1QUNB 4DK6A 1HKLL 2ZYIA 2HRPL 4EZLA 5KSBE 2Z0UA 5ANMA 1AHWC 3H53A 5CZXC 4QJ3B 1AXSB 1P1ZA 3UJTH 3MV7A 1HZLA 5TGBA 1KXTB 3T04D 1BVNP 2E47A 1XB6A 2OP4H 3H3PL 4PS8A 2V5RA 5GSRB 4LCCA 3SE3C 1Q1JH 3HOGA 4BSJA 3G7TA 5DYOB 1DSFL 2EDTA 4V2BA 1QSFA 2CLVA 3IPEA 5I8EA 2Q3ZA 3NPSB 5C0BA 2OMNA 3F7RA 4PGBA 3VFGH 3T2QA 2WXRA 1W15A 4HGWA 4JPVH 3BD3A 5KVGE 2Q8BH 4FQXB 3N06B 5FV2A 2AQSA 5T5NF 1ECYA 5GGSB 1N3NB 5I1CL 1EERB 1UASA 3WIHH 2EKJA 1LWHA 1JS4A 2I69A 3RL1B