2JWYA

Solution nmr structure of uncharacterized lipoprotein yaji from escherichia coli. northeast structural genomics target er540
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
168
structure length
168
Chain Sequence
b'MVQQSEVRQMKHSVSTLNQEMTQLNQETVKITQQNRLNAKSSSGVYLLPGAKTPARLESQIGTLRMSLVNITPDADGTTLTLRIQGESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAPASVLAPSDVDIPLQLKGISVDQLGFVRIHDIQPVMQLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized lipoprotein yajI
molecule tags Lipoprotein
source organism Escherichia coli
publication title Solution NMR structure of uncharacterized lipoprotein yajI from Escherichia coli.
rcsb
total genus 29
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1620 Mainly Beta Sandwich Immunoglobulin-like Lipoprotein YajI-like 2jwyA01
4C47A 2JWYA
chains in the Genus database with same CATH superfamily
1U3JA 4R2GB 3O6ML 4NHCH 4QOKD 2DOCA 4MXQC 1PAZA 1WIUA 3EO9L 4DGIL 2J88L 4FZEH 4QRUA 1ADWA 3JZYA 4OD1L 1B4LA 4Q0XH 3QUML 3T4AA 5TE6H 1N6VA 2MTAA 3OXRA 4QJ3B 2IDFA 4JGMA 1NCDH 1LD9A 3ZMRA 2NXYC 4HIEB 3WLWC 1SLVA 4P04A 1YJDC 4GAGL 1JWMB 2R56H 4LHUG 4MA7H 3PAUA 4L0ZA 3K0WA 3KLQA 3LD8B 4X7TB 1L6XA 2WLLB 5E2UH 1JGVH 2OI9C 3L3GA 1FN4B 1CT8B 3R4DA 4GRWE 4LPWA 5L6YL 4XP5L 3MGAA 2J20A 4X0KB 3CZFA 5D7HA 4GW4B 1CI5A 3QEQE 1X5GA 3UCQA 3E6HA 4O58L 3HI6L 4B50A 4HWEH 1YYLH 4NZDA 1PSKH 2G75A 2X7LA 2PO6A 4PM1A 4NQSB 3SGDI 2YARA 4XP9H 3HI5L 5BZDA 5E08L 1UOVA 4IMLA 4XNUL 1ZY9A 2IWFA 4PJDB 3ULVE 2VR8A 3TBYB 2OX5A 3UTSE 1AACA 5DR5H 3BVXA 4XCFL 2YN3A 1FO0B 4MDJB 4DFIA 1UYWH 4KTEL 5DFAA 1ORSB 4HP5A 3DX7A 2VAAB 4OSUL 1UASA 1MOEA 5I1CH 3KBFA 3P4NA 3FH5A 3D2UB 4LVEA 3GBEA 3QULA 2X44D 5IBTL 1WFUA 5FDYA 4R96A 1RZ8B 2ZX5A 3L4WA 3PDDA 1E8YA 5JQ6L 1RUPL 4JAMB 1SJHB 3WS3A 4A7GA 2HMIC 3OAZK 1N18A 3K2UL 1KTBA 5KVEE 3ABKB 4L3ED 4F7PA 3HNSL 4LSQL 1ZA6A 4OLXH 3CHQA 2E7HA 2ENQA 1SJVA 3QRGH 1M1XA 4WW2C 3QJZA 2VITA 3FQNA 4F9PA 2EO1A 2NY5H 5CILL 4Z3GA 5AVXB 2X41A 3VYOA 3DX4A 5HHMD 4RMQA 4D7BA 1R3KA 5SV3A 3RWDB 1ZE3H 3LIZL 2HRPH 4EOWL 4YSAA 1T6BX 3WKML 3REVA 3B2UC 2J44A 4K3JH 2Y7MA 3RQ3A 1MFAL 3WUWB 2E9GA 3CHSA 4UQ9A 4YSDA 5C0GB 3UXFA 4F20A 3C5JA 4X9FA 5GSRB 2G9KA 1RZGA 4I4WA 3SKNB 4MCZB 1HKLH 3SE4C 3D09A 5DFVC 1AKJD 1OAJA 3NEXA 1CD1A 3UPCA 1NCIA 4X6DA 3MLVL 3BUBA 5ANHA 3UTTB 4G80A 2F53D 3QO0B 5A2CA 4FS0A 3L5WB 1S9XA 1E6OL 3TA3D 3OKYA 1KGYE 3FTWA 3V8CA 5KSAA 1RXLA 1XFPA 5FOBB 2EYTB 2H6UA 3SKOA 2PTVA 3J07A 3TOPA 1FNGB 2CR0A 2NNCA 3MSPA 3WMPA 5G2NA 2V5MA 5C0EA 2Y7QA 3TO4B 1X5IA 1H8NA 4W6WB 4OQTA 1MFUA 4K8RL 4JFWA 3OSKA 4PJ8A 2VXQL 3X11B 2R1XA 4A7TA 3KPLB 5FF6A 2VQ1B 5I1CL 3VXRE 2LTQC 3FOMA 3GUTA 4DK6A 5ICYA 2BOBA 1AGDB 2ORBL 3IPEA 4OD3L 3B8YA 4LBEA 4HKBB 3Q48A 3P2BA 3M17A 4KOCA 4P59L 2Y1YA 1YPZB 5F71A 5IT2L 4X7EC 2EYRA 3P4MB 5FUOH 3UBHA 2PPFA 4LNRB 1BZ7A 1UM6H 1J5IA 5I5MA 1MKFA 4Z5RA 2OYKA 3WNKA 1UVQB 3Q8EA 1UGNA 4X5RA 5DQJB 3RDTB 2KDGA 4K5LA 3WTUA 4KRPC 2AQPA 4FTVB 3SD2A 3KPPB 3P3RA 1JTPA 4BQ6A 1BREA 4WI9A 5T1MA 3DLQR 3H85A 3ZZ1A 4KKCC 2NQDA 1M7DB 1GC1C 3IJSB 4IU2B 1RZJH 4MQXC 3OAZH 1OEZW 1H3TA 3E2HB 4R9HA 4M9PA 4PRPE 4KKBC 4AYFB 2IGFL 3R19A 2PTTB 4XPAH 3RE0A 2GW5A 4WSKA 3RL2A 1ZLSH 3TEXA 2Z3FA 3MRDA 2JI3A 3OF6D 2X9WA 1NBZA 2ZYRA 4XCYB 5CCJA 1A47A 5KSUB 1LO4L 1UM4H 2R39A 2J1ZA 5AEAA 3QHFH 3TJEH 5LGHL 5D55A 2GI7A 4D0BB 1MJ8L 43C9B 8FABA 3KZ8A 5D7IB 1V8HA 3SPCA 3MRJA 2V37A 4LLVB 1DQML 5K9KB 2DJUA 5F88B 5GGSB 3GLDA 2GTZA 4PJ5A 5BZZA 2IOIA 1W80A 3UIZA 4BK4A 1RERA 5C0IA 2DMHA 2ATPA 4UNIA 1JV5B 2YKKA 1LEKB 4NYLB 4OCRL 3PDOB 2OR9H 3K6FA 4MFHA 3F84A 2H4EA 1LQSR 3GXDA 2AEIT 2FNBA 3X13A 2O93L 3LMJL 1F3JB 2W94A 2Y36H 4IRSA 3BCDA 4ODUB 1FVDB 1JE6A 1KT2A 3N0PB 3BAIA 5BO0D 1WEJH 3FQ1A 1X5JA 3GSUA 2VLKE 1W8OA 4Y8DC 1IKNA 4WIQA 2FDBP 5DZJA 5FUCE 3BUIA 4FDWA 1H9DA 2HG5A 2EH7H 3FB7A 4OI8A 1AD0A 3P11L 4S1RL 3B9EA 1NMAH 3GIZL 3VFTB 2KH2B 3O6KL 4M3JA 2ZWYA 5EA0H 4RZCB 1YUKB 4YDMA 3U7WH 3N85H 3KNBB 1FLTX 1Q0XL 1DZ0A 2CRMA 3GGWB 4N0FA 4MCMA 3EAKA 5IR1B 2HWZH 4YSCA 2J6EH 4G9FB 4MA1C 2IAAC 1KB5H 1RH8A 2FLRT 4LAJH 2ATAA 2X9YA 4EN3A 2VM3A 1YRKA 2X9XA 4DN4L 3Q2WA 4PY7B 4E41E 2OYMA 1OP9A 1LO4H 1UM4L 4HIJB 4LMQE 1U91A 4KXZI 2GG1A 3P4OB 4UT9L 2X40A 4YDJB 4YN3A 1N4XL 3SDDC 4PJXE 5I5IA 5I76A 5F9OL 2QQKL 5MP6H 3MA7B 3WEOA 3CDCA 4JMNA 4BINA 4MNGB 5EIIA 3DGDA 5JPMB 4ZFZA 4PLJC 2V3DA 3NK3A 1XIWD 4HETA 4JFPB 1SHWA 4HOWA 1TU2B 4O5LH 5CGYD 3ZKMD 3H7LA 3LPGA 2WY3B 4RZKA 4XPBH 3VVVA 4PB0L 4GRWF 4N26A 4ODWB 3KDPB 2I5YL 4JZJA 4LFHD 4Y19D 1Y1DA 1BZ9B 4NI6A 5DHDA 1LDPL 3HEIB 3MJ9L 4LF3B 5G5DB 2ZYSA 3BEVB 4A38A 3FONB 5EIIG 2J21A 4GAAA 5EFIB 4JCMA 4ZS7H 4GNKB 4M4RA 1QX1A 4ETQB 3OKMA 5I8OH 1THAA 2R29H 2YFNA 2CGYA 3HNVL 2C9QA 1UT9A 2Y06H 4RGNE 3ZTJG 1JRHL 2VMCA 3ULSB 2IFFL 2QKIA 1MWAB 5BOPA 4Z7NE 2G3NA 3F7VA 1CXFA 3AUWB 4AQAB 3VD2A 3IPFA 2F5BH 4UNTA 3C8KA 5AVQB 4YUEH 2IMMA 2NSQA 3SDDD 4PCSA 5CSZB 1MNUH 1XF5B 1AJ7L 4JREC 4MBRA 1N0XH 3UO1L 2A9BA 5HHXL 5GZOD 4U3SB 2JQMA 2QR0B 1CICD 4JR9H 2V7NB 1DR9A 1P4BL 4ZO7A 2WKOA 1KCKA 5EPMA 4FNLH 3V2AR 5I6NA 3KLAA 5DJDB 1YA5A 3W9DB 1OCRB 3I3DA 5DR5L 3Q2VA 4ZO9A 1HESA 1MPAL 3BH9A 3RVXC 3X3FH 5JXAH 4AV5A 1JNJA 3V4UL 2GEEA 3A4FA 4FZ8H 1DVYA 3GSWA 3L3IA 1A3RL 5L7XL 3C5SB 3B9KB 3IFNL 3OKEA 5B38A 4BH8A 1FL3B 2D3JA 3L48A 3V6FA 3T0DA 2E47A 3EZJB 4K7PH 2BNQD 2CM6A 2YGNA 1D9KD 2H45A 1D5ZA 3UOAB 3VRLE 2HB0A 3QIUB 4D0DA 2PP9A 1Q1PA 3NJIA 1O0VA 1K5NB 2YQGA 2QQQA 3HZKB 4MD0B 2PXYA 4PJEA 2ZP8A 3FT2B 3HA0A 3PQYA 1DE4A 2VQ4A 1L9PA 2EXWC 4O51B 3IDNA 3LZRA 4OCLC 5I1GL 1MCHA 3LIZH 2DQHH 2C1PB 3LEXA 2HFGL 3A24A 3G5XA 3T65B 3S9DB 3G04B 1B0WA 3KPRA 4XZUA 1H15B 1UQSB 4BIKA 4PJ8D 2AQSA 2B1AH 1K8IB 5INDB 3TYGH 4M6MH 4E9VA 1F58L 4F7EA 3RWFA 1XZ0B 3VW3H 4PJFE 3MLUH 1ZT7A 3K1KC 4L2LA 4YXKH 1L9MA 4IGBA 4PN6A 1YQVH 3QUXA 1ZLDA 4LVNC 4YZFE 1HI6B 2BSCA 5DDHB 4JRYB 3BQVA 5KVEL 2NY5L 5GGTA 4AGLA 3EOTL 4OZHA 2Q5BA 1Q0XH 2X1QA 3DX2A 3EFOA 5J9PA 4JHWH 1MHEB 1AY1L 4JFDA 4AZ8B 4Q9RL 1OANA 1OGTB 1MFMA 3F7YB 1GTNA 4YIQA 3ETTA 2VDMH 1BJ8A 1ZWIB 4KPHL 3BPNB 5JOPE 1L9SA 1Z32X 2C9XA 4M5SA 4WV1B 2JTYA 2R2BB 1KBWA 3STZB 4GQPH 2BW5A 2XIBA 4I8DA 2R1WB 3ATBA 4JFSA 3WKYA 5E9DB 4YX2H 4OD2A 1A3RH 1LWJA 2NUPB 4P05A 1NSNL 4BFRA 4NN7C 3FO2B 1FBIH 3S6CA 3U1QA 4AKOA 3LSOA 4L5FE 4YEFA 3TF4A 3ZN6A 1LDSA 4RRPA 4P3CL 4YHZH 4CW1A 1GGIL 3A22A 4Y16C 4M43L 4GMTH 5HJGA 4HOMA 1HHHB 2B15A 3EYUH 3RZCA 3HAEH 2WKOF 2DJSA 4LK4A 4N2OA 5DHYB 3DMMC 2W0LA 1G7JA 4I5BB 2FATL 1GZPB 3S5ZA 4TUOA 3SDCA 2ZX6A 4QTIH 2WXFA 3O8XB 1VFAA 2X2HA 3TIEB 4HCGA 1HCVA 4Y1AB 1GA2A 1GL4B 2UZXB 1TYJA 2XC8A 5FXCH 5L4IA 3RWIA 4NO3B 2R0KL 3QUMH 5A3IC 5EU6D 3US0A 1VGEL 1IQDA 3BFWA 3NP4A 4ZK8A 4BZ2L 2AJXL 5D1XA 1NBVH 3NIDE 2ZWLT 4QHNA 5IB1B 1X5LA 5FYJH 1AO7D 1KG0B 4GBXD 4ZFFB 4K0OA 4OAWA 5EUKA 4DP6X 5I15H 3ZTCC 3IBOA 2QPSA 2WQXA 2P44B 1IAIH 3DMMA 2XG5B 5DZVA 1JNNH 5K93A 5SWZD 3U7WL 4XNZC 2A6JA 3N1PC 5FCSH 4NO0A 3L4XA 2XVBA 4PRPA 1KGUA 1VFBA 3UCRA 3QG7L 1FGVL 2J5LB 1G9NH 2AEWA 2J56A 5LNEA 5HDOA 2F1BA 4X6BB 2JLPA 1MCQA 5C0AA 4YS4A 5FDWB 4HCRA 4NN6C 4RAUA 4Y4HD 3QYNA 2FR4A 3GJEB 5EORL 4MTMA 3EJTA 1N6QL 2IWKA 2JJWA 1ML0A 2FJHA 4HJGB 3L4TA 4Z95H 1SHSA 2HP4A 3PUUA 3VFOA 2DKMA 3FSWA 4DP9X 1AXSA 5F6IC 5GGVY 1A4JA 2WWMD 4TL5A 4IOIB 3D0VA 4NRXA 5FUZH 4UV7H 2VE6A 4XO5A 2VQTA 1IGTA 4L1BA 3W5MA 1G1CA 2IOOA 4OGXL 3DNKA 5D6DC 1T6VN 4ZUVA 3T8XB 2VDKB 1II4E 1J8HD 2A5UA 3O6FC 4JKKA 1E3ZA 2EIEA 1J87A 1AC0A 1UB5B 1LO2H 3ARGC 3CHXA 4H26A 2DQHL 3GMMA 4B0MM 3X2QB 1S9WA 3IU3A 1WFNA 3OMAB 4U1NA 3VI3B 4J8QA 2E0PA 4S10A 4PJXF 3LN9A 4QGTA 1UXWA 4XNXH 1FYHB 2VSMB 1EMTL 2VISB 4D0CA 2XWEA 5IB4B 3SZ6A 2X09A 4KY1L 2A77L 2IH1B 3FHQA 4PHZA 4WEBL 1OSPH 2X05A 4HUUA 4R2GC 1RPQA 4GMSH 2B4CL 2VXTL 1DVTA 3A6BH 3W81A 4NSKA 1OW0A 1B3JA 4H5SB 1TENA 4C4BA 4CRPA 3C2AL 3QPXL 1NFKA 4QAWA 5EU7C 2HPTA 4BKLB 1KJVB 2B16A 4UTAL 2X70A 5HHPB 1M05A 1JNNL 1UD8A 4QRQA 5C07E 1VKXB 4MA1B 1FF5A 3QXAA 4MHHI 3WIFA 2CCLA 1BEYL 3D39E 3JWNG 2WTRB 4OZFB 3RA7L 3HE7B 4NUPA 3VFPB 3UTZA 5IB2B 5IVXA 4RFOH 3OSVA 4UM9A 2NY3D 1HIML 4G5AA 1CQKA 1R9FA 3WDJA 1GGTA 2ZPKL 5BRQA 1PD0A 5CJOH 4AJ0A 5L0QC 2CRIA 1P0SE 2NLJB 4N24A 3H42L 1PZSA 3I2CL 3I9GH 4LCCA 4B53A 3SDAC 3T77A 2J55A 3VNYA 4LB8A 5GISH 4JFED 2C9VA 5JOFB 4Q58C 5JDJA 2ICWJ 2WK2A 3EUDA 5BQ7B 5KVDH 4G9DA 2EXWD 2R0ZL 4FFYA 4B9CA 3EO1A 2XN9B 3ARFB 5DQDL 3BP5B 4L3FA 1E4KA 3FT3B 4IU3A 3ZUNC 4MMYA 5HYJE 4CN1A 4JQVA 3JVFC 2AQTA 3PGFH 5DS8A 5JLZB 1IARB 2V2TB 5DLLA 2VR9A 2OL3L 2V2XB 5I1JL 1U0QA 3VXPA 5DJ8B 4Z0XA 4EXPX 1N8OE 3L9YA 1IC5H 4AUYA 3B5GA 5IF0B 1HINH 3DHJA 3WMSA 3MRQB 3NZ8B 4P9HH 1DEEB 4CDHA 1TJGL 4DFHA 4ZNCD 2DD8H 5GGVL 4BZ1H 4KNTA 1LXMA 4Y2OB 2XPZA 1KCWA 1BOGB 2PYFB 3BDXA 1N0XL 3UO1H 4IJ3C 4LP5A 4NZTH 3BRGC 2PW1A 5FO2A 2XG4A 4PJAE 3AT8A 4Z7OB 4J1UA 4J3OG 1JZEA 3E1ZA 3MLYH 2CLRA 5LCVL 1GIGH 4XHQA 2BS71 4QF1B 1ZLSL 4J1UB 1BD2A 3ILQD 4LP4A 3EJJX 3QDJA 2OA9A 2PW1B 4TQHA 1FVCA 1TSRA 3Q8BA 4P2QE 4NDMA 4RSVA 1Y6KR 4XH2B 1HXMA 4RGOH 3BH4A 1DEEA 1VFUA 4EZKA 1A1NB 5KJ7E 4FD0A 5I8CA 2OK0L 2DQUL 4RFEB 1XCQA 4MXWL 5AW6B 3TBWA 1HH6A 2JKWA 1RZKC 2GTQA 1UXLA 2M1KA 3T1FA 4QXVA 1OT1A 4PJ9D 4F8PA 4WUUE 4MMYB 1JHKL 1R3IH 3VFMB 3V5HB 4TRPH 2ZCLL 1I3RA 3MX0A 1YC8A 4M9OA 4PBDA 5JOFA 4HXBH 2H6PA 3MNMA 4FA7B 3QIBB 4YZWA 4FG0A 1OTTC 1B4TA 12E8H 3SIKA 1DZBA 1RZIB 1G84A 3HNTL 1J9QA 3T09A 4JG0L 4JVUA 4CBZA 2XU9A 1KBVA 3NFPA 3NJNA 3V79C 4K2UH 4RGNC 1BYOA 2EECA 2COVD 3UH8A 2ADFH 3HPJB 1MVUB 2DTMH 4F1ZA 3UJJL 4EAEA 1QFWI 4Z7QF 5C6TL 4RAVB 1IX2A 4X7SL 5TDPB 5TDNB 4IDJL 5HDBE 1OSPL 1HOCB 2BP5M 4YHKL 3A0OA 5GZNA 3BWUC 3LJ3A 5BJTA 1Y18B 4POYA 5AW3B 1VKXA 5KBMA 1M05B 4TSCH 4PG9A 4LNVA 1KNOA 4GRLB 1UURA 3BESR 4BKLA 3IDGB 4G83A 3M1BA 2BNRB 3GYRA 3RGBA 3VTMA 5CFAA 2ODIA 1VACA 2VZOA 1AGFA 3IJYB 4HK0A 5H37A 2F8VA 4YHIB 3FAXA 2EIZA 5HI5D 2IAMC 3AWFA 5IB4A 4X8CA 4D0CB 1CE1H 1DUYB 1TTAA 3P3TA 3ZX1A 5HGAA 4ELKA 1BD2D 1A3ZA 1ZS8B 5C2BL 2DS4A 1UH3A 2J5WA 2GFBB 2UVEA 1IJNA 5DUBB 4H26B 4DW2L 5CLWA 1WC7B 5DJ6A 1GGYA 4M43H 4Y5XA 3WXWL 1JN6B 2W65A 1KPVB 2E4TA 1YNLH 4I2XE 3UTSD 2WB1A 3HTLX 3VXUB 1IO4C 4W6XB 5H94B 5CGBA 1A4JB 3CK0H 1TQWA 3K2UH 4OLWL 1J1XL 4JG1H 2EYSB 3GK8H 1WUZA 1ZV5A 4AENB 1XF1A 2FJHB 4XN1A 4NZ8A 2ITCA 4XMZA 2GJRA 1AVAA 3IRCA 4HISA 4CN4A 2YAMA 4M5ZL 4UOW0 2OW7A 2XTJE 1YMHB 5E6IB 4ZTPH 3IS0X 4WY7L 4XRCB 1MFEH 3CVHB 2IPTL 4U1HB 1ZHLB 5DHXB 4QY8A 3SOTA 4EZMA 3AY2A 4P2OC 5D1ZB 2GCYB 2VDQB 3IF1B 3LKQB 5AW1B 1WGVA 1MN4A 4LSRL 2C7UA 3QZWG 3EBAA 2IG2L 1EFXB 3VFUA 1NPNA 2PCFB 4GSDL 4RLDA 3POHA 2WXIA 3WO3B 1BBJA 3SDXE 1AIFB 1A4KA 2B9AA 2BO0A 4OZHE 1SY6H 1GKOA 4M3KB 2H3KA 4ZSOA 2GK0B 2LLGA 4MA3B 4W9EC 3BZ5A 3EH3B 4FQHB 4RMTA 2VLMD 2ZG2A 1YYLL 1CFQA 5D7JD 4DN3H 2NZ9D 2IANA 4PJFA 1YDPB 1BF5A 4MASA 5I8KH 1GZQA 2YSSB 1M53A 2P4AB 1PG7H 1NCBL 4JW3A 4KO9A 3QDGA 3W0WB 1SYVB 1ZAGA 3GJFK 4JZNB 4YXLL 4QHUB 4HK3J 3O8XA 2RD0A 4PRIB 5DK2B 5IEHA 1YEKH 2WWMC 1GAFH 5F44A 1EX0A 2EKJA 1FG2B 3H2QA 1YNLL 3EG9B 2RR3A 5F9JB 4EUPA 3RI5K 3C6LB 3UAAA 5D1ZC 3DOIA 4JM0A 4TQ8A 5C9KA 2QADD 3O6FB 5I1GH 5KVDL 4WWKB 4GXVH 1ET7A 3WNNA 4JFXB 5HGBA 3MHZA 3LSOB 4WKXA 4XAKE 5I0DA 2BOCA 1YUHB 1ZLWK 1W16A 5C0NC 3SE6A 2PWFA 5LGJB 4I9WE 5B4MC 3OWEA 1NC2D 3VE0B 4F80A 3EGXB 1ES0A 3N41B 3WIIL 4MA7L 3SQOL 4HS3A 4YFEA 1IKFH 3OZKA 4WV1A 1CDYA 1F86A 2V5YA 3KG5A 5ENWA 2OMBA 1KEGH 3UYPA 3STBA 4M6AA 4C83B 1G5GA 1G7PB 5GIRA 4EI5B 1RZJL 3FCUB 3F7YA 3FFCD 4PRHB 4PW4A 4WCYH 5K69A 3ESPA 3EFOB 3JWOC 4MA8L 3RX8A 3VDCA 3E2HC 1LK2B 3GTVA 5IMOB 4XTRC 3AABA 3FQUB 5E5MB 2FTAA 4IGBB 2BS9A 4R7NB 3MRNA 3L08A 1GW6A 1B2WH 2Y25A 3PL6B 4LOVA 4HLZG 2KMWA 4L4TE 1JPGB 1G9MH 1KEMH 1SMOA 3BW9A 3ZZSA 5A3ID 1A6WH 3K4ZA 5EU3A 3UJIH 2DWXA 2BSBA 3QYMA 5LHDA 1P7BA 2P49B 3AACA 5KW9L 5C2BH 1UQSA 4WWKC 3BWAA 4D9RE 3G5XB 2CRZA 3QIWC 2PWGA 3QORB 1ITCA 5ESQB 1YUHA 2Y1VA 5CZRA 3DWTA 4EDXB 4HUCA 1WDAA 2WSDA 4JFXA 4QNPE 5SX4I 4ISVA 1OZUA 1TZIA 3QI9D 4PJEB 3CC1A 1JL8A 4H8WC 1YEHH 2MIZA 2NY5C 4D0DB 3RVVD 1BQ5A 4FI7A 3LZFH 1JZIA 1Y0LB 2Q1EA 3MRIA 1T89A 1UD4A 2EE9A 3QP3A 4R3SB 1UD3A 2NY4D 2QLYA 1XD1A 4P23D 1NDGA 4BJLA 1IC4L 2WOYA 5B38B 2WQ8A 4OCNC 2K9UA 4JZNA 1R5WA 3C5SA 4QLWA 4U1KA 1FZOA 1G9MC 2FAUA 2JELL 3BIAX 2D4DA 1HWHB 3AMKA 3I6GB 3LZQA 5T1LD 1YDPA 2W0FA 3N43F 4FG6C 3GMLA 1KF9B 3ARGD 3FO1B 4TQEH 4L9LA 4E41A 1C12A 3JUYA 2GK0A 2VSCA 3KR3H 4JJ5B 4MA3A 1ERNA 4ZSOB 5MHSE 1I9IL 3RKDC 5JHLH 4WEMB 4AIEA 4U3SA 4HX1B 1V05A 4J6RH 5I75C 2I9TB 2DAVA 4TUUA 1U8LB 5FGCB 5BRZA 4F8OA 5C07D 1GMEA 1IEHA 2DD8L 5GGVH 4NFBA 4BZ1L 4RNRA 3KBPA 2C7UB 3QXTA 2JIXA 3F7VB 2ARWA 8CGTA 2FHBA 5JW4Q 1A21A 1UENA 4MAYD 4GP8B 1OM9A 1FYTB 1UWEH 4QTHA 4OJFL 4QY8B 7CGTA 1QA9B 4B9KC 3TJHC 3O2WL 5T1KB 1T03L 3VWKC 2K3HA 2ZYHA 2YD4A 3MYJA 3WEXA 1M1SA 2QSCH 4NAJA 5CEYB 2B9BA 2FNWA 1BVNP 1L3NA 3CZGA 2C1OA 3ZHFA 1IEBB 5J13B 3CLEL 3AGVA 1NEUA 2P7TA 4H1LB 4WO4B 5HYQB 2ITCB 2X6CA 4HIXL 5IKCA 2JKXA 4GJTB 3BGFB 2QV4A 2C4XA 1JV2B 2QKIC 4N2NA 2ERJB 4YQXL 1NGZA 1E67A 3RTLA 2EDYA 1JUFA 5K9JL 3IK2A 3JZ7A 2ZKWA 4EVNB 4MJID 1L7TH 1OTTD 1KXVA 3TA3C 4O2CA 4P07A 3CN1A 4U7SA 1FRGL 3BPOB 1T0NA 1FIEA 2G3XA 2NDFA 1B3IA 4PJ5E 3NUKA 4ONGL 2G3ZA 5TE6L 4DPBX 1OAZH 3GZPA 5MERB 1U91B 4CU6A 4HIJA 2BOLA 3AU0A 4C56D 2FGZA 1FDLL 1HH9B 1RUQL 3IXTB 1AP2A 2XN0A 1VHPA 3X14A 4FP8L 4KK9D 3MUUA 3TBSA 1FNSL 4FFTA 4YHIA 1NMAL 5DRWB 4A2EA 4ODTH 4I9XA 1VACB 3RWHA 3MRHA 5AKTA 1P7QA 4JQIA 5IMKA 1ZSHA 3QDMA 1DJXA 1QFHA 1UACH 3IKKA 5GZOA 2HAZA 2YFOA 4GW1A 4JPKL 1MREH 1TVHB 3IDUA 3RY6A 2OMUB 4PJ9B 5KS9A 3RWGA 4P2QD 3KHQA 2H8PB 2Y2WA 4YHKH 3ZE2F 2JWYA 1A6WL 4UT6A 4PGCB 2HMID 5DRXA 1SJXA 2DQ6A 1HEHC 5AOKA 4NQXB 2WD0A 2MMXA 1KYFA 2V33A 4HEME 1UYWL 4N6RA 3WE6B 5L4MA 4GAYB 2ZF8A 3UZQB 4U3HA 4MJ6A 2ICWB 2YQ3A 3FN0H 3NFPB 3TBTB 2ZXGA 3ISRA 1IGYB 4K7FB 2YD2A 2VDNB 3AROA 1F1AA 5FM5O 3WIHA 4Z78B 4ORGA 4IBUA 3QS3A 2BXZA 1M7IB 2B2XL 1NM9A 4JM2C 3FUKA 3MU3A 4QHKJ 3MBEC 3X13B 3WEMA 3I74A 1ND0B 4N8VA 4NFCA 4NJAL 3TEUA 4PS4H 2ATPB 5IZ7A 5IROD 2O6DA 3GM8A 1UJ3A 3WKPA 1Q38A 2NY7L 3BIBX 1YY9D 1A7OH 2ITEA 3NAAH 3ZE1E 1KIUA 4IBQA 3M7OA 4WY7H 4XNZB 2Q2EB 4HFUL 1UCBL 4IS6B 4MJJA 1HKFA 4OF6A 1ANUA 3GSVB 1P2CB 4GIOA 3TBWB 4A2FA 2O26U 3TCTA 2OCJA 4PBVC 1BJMA 4YC2B 4ETYA 1M71B 2NQCA 1I1AC 5EN2A 1Z2KA 2BNRD 3TBBA 3H9HB 5FO9A 4RGMC 1UG9A 1J1XH 4F8TA 5I1KL 1Q9LB 4YXKL 2XKNB 1UCTA 3NQIA 3TF7C 3Q44A 5CO1A 1JK9A 4G8EB 1JD9A 2NXYD 3GSNL 1D2PA 1XIWA 4LPXA 5C6PB 3NIGE 3QDJE 4HC1L 4JFEE 4JO2H 2FL5A 5T5NG 5JHLA 5EF3A 3UZVB 3MJ7B 5DD3L 4QF1A 1NJ9A 1P9MC 4W9ZA 4UILH 3U6RB 4UOW1 3IRZA 5D9SA 4HZLA 5CUSL 3O9WC 4JM2A 4WFGE 5BRPA 2H2PC 5JMRA 2Y7LA 2ZUVA 4PJAA 3S3CB 4E42A 2APVA 2OI9B 5BXFB 2QZ5A 4QJ5B 1XMEB 2I07B 3PV7A 2HX9A 4N2DA 5E23A 5DEJA 2XNAB 1BAWA 4DVBB 3OKDB 2FVNA 2GUOA 1E42A 2XX0A 2ZWKA 3MRQA 2EZ0C 3NZ8A 5E8NA 1QFUL 4NOBA 5TD4A 5CWSB 3UJIL 2QTVA 4JY4B 3RTQC 3F3HA 3WTWA 1E43A 3WG7B 3OAYK 1NCAL 1T5XA 1WZMA 3OKNA 1GC1L 3P02A 2R23A 4OGAD 3LNGA 5CEXA 5J3HD 5A6IA 4B95C 2NR6D 2O6PA 2RCSH 3BP5A 3H4HA 5GZOC 5F7DB 3EO1B 3N40F 3KPQB 1MFVA 1PL3A 1JPTL 2YEVB 3BAWA 2WIIB 5FF6B 1P4UA 3X11A 2K8QA 3SCMC 3T0ED 3S88L 2G60H 3WFDH 1ROCA 4LCWB 4N2CA 4LCCB 4Y5YC 1E65A 2HJFA 2WNKA 4XPBL 3DJZA 3DETD 3FTVA 4JCLA 3AWGA 4NKOA 3RUGB 2WOBA 4KBPA 3P73B 1AQDB 2WWNA 1JS4A 2VDOL 1T1YB 1TQUA 2CH8A 2MNUA 2ZX8A 3LNDA 4DAGH 1V3KA 3RNQB 4Y5VB 1UOKA 4RAHA 3QXAB 1C5CL 3D4GA 3G08B 3DV4A 2CJSA 3I02B 4V2CB 1GKEA 5HHPA 3BVVA 3QEQA 3FB8B 5EEUA 3H3PL 3O3DA 5TE7L 2D7OA 1TZ8A 5CP3A 5EB9A 2V8LA 3L4VA 2R9HC 5I0ZA 5DJ0A 3SKMB 4PLNC 4FNLL 4JRYD 2VLME 5D6DA 1P5UB 1TTUA 2WYZA 3UP1A 4S2SA 4PRBA 4LLMB 3HG3A 4YDIH 3U9UB 4ZDHB 3DPBB 1X4XA 2AI0L 4YNYA 3OG6B 1S7TB 5CEZL 5HVWA 3QORC 3L2MA 1FHNA 1S9WB 4W4NA 1KLUA 4A2LA 3CIQA 3E38A 1WFMA 2DIJA 5DK0B 1ZRUA 1RK7A 4R0LC 4KJWC 3CDYA 5B21A 2Z1KA 1ZLUK 3X1NA 2P28B 3QEHB 3JVGC 3BD3A 1U3NA 2OM5A 1QFWL 4F91B 5M7QA 1CXKA 3CFDA 4PS4L 3TL5A 3TN0A 2ZXWB 1AANA 2QPFA 1S7UA 4NRXB 4ALAC 2FJUB 4KKLC 4KROB 5JYMA 2VDOB 2ZKYA 3GRWL 2FE0A 4TNVK 2ICEC 4Z18A 3SDXF 4ZMNA 1K4DA 4Q6IA 1LO2L 2ZZUT 3BKYH 1LO5B 3IDJB 3QAZB 4RX4A 1YNTF 1KV3A 3CPLA 1NM4A 4ANUA 1S9YB 5AAMC 1SFDA 2WNWA 3SZKC 2FR4B 1TZAA 5HGHA 4ZUUA 1I1RA 1CBVL 1XBRA 4QKTA 5BZDB 1EVTC 1U8KB 2EE0A 4XVUC 5C0AE 1S7QA 4NN5C 4EE2A 2YC1A 4MQSB 3IDXH 1N70A 4Y1TA 3RDTC 1VFBB 4YDVB 3TS8A 3Q0HA 1TTCA 4BFJA 1ASOA 5JIIA 3B9KD 1QYGL 4HCIA 4BSJA 2YIHA 4X7TA 3FO0H 2A6KB 4DSYA 4ZJ9A 3NCYP 3MOBL 4KMQA 3IGLA 2ZSWB 1JWMA 1LK3L 4IHOB 4BWUA 2HT2C 3JXAA 5KSBE 5DJYA 3FMGL 2WBWB 4GSQA 5GJSH 4RFOL 1CFMA 4KZ0A 1O7SA 3ZE0F 2GBVA 1R34A 3HAEG 1QASA 1XGRA 3FTGB 3HE7C 3JWDL 1MRFH 1ETZA 3MOAH 4XZ4A 1UFGA 3H2WA 2EVHA 4PG2C 1I1CA 3BO8A 2WXMA 2MOQA 4ILDA 4LEXL 3RJOA 2B5IB 2Z35B 2DZEA 1GC1H 1J10A 2H6OA 2JJTA 2B3IA 4X4YB 1OLZA 5JYLA 4RMVA 3HE6D 1G7JB 4I5BA 3RX5A 4BFIA 5A1AA 3KYOB 2XA8L 2NTFA 5HYJD 1HHHA 3RZCB 4WGVB 5DJXB 2CDGA 4A04A 4QOKE 2YA2A 3MBWB 4CW1B 1T1XB 4UT6H 5CLXA 3AGWA 1KXQA 1JGEA 3LCYA 3IE4A 4WFEE 2YD5A 2M83A 3F01A 1XR8B 4H25B 3IDMA 4KI1A 4KK8D 3W1ZA 2K4AA 3ET9F 3K2KA 1F2XK 5LGYA 3ZL4H 4OV5A 5HI5C 3HBQA 4HW6A 1FO0L 3Q6GH 5JORB 1H5BA 4UQBA 1ZS2A 1T4KB 2I7SA 1QFOA 1NGWA 1J12A 2J8UA 5I1KH 4TUJB 4M6OL 1KYAA 2XBDA 2Y7SA 1TTBA 3BHBB 3D18A 4ZD3L 1WFIA 4CVXA 4OFKA 1ZTXE 1WHOA 4V1DE 2FT7A 2OJZL 5LO7A 4BE5A 1OAYH 4XVTH 3FU0A 5HJBA 3KGSA 4GKZA 4RBPH 5CZVH 4C54A 1SZNA 1UT1A 3HZMB 4IKKA 2QMJA 3U0PB 4E0RB 4XCEB 4GG6B 3ZR6A 3DSNA 3WTSA 3JV0A 2UYLA 1GJIA 2C9PA 4U1JB 4P2CG 1A5FL 2BVPA 4P46D 5INDA 1U3YA 3BKMH 1OALA 3KPRB 5DZAA 2C1PA 4OF8A 3D30A 5BZWB 1J8KA 1XZWA 2R2HA 2LU3A 3QUZB 2EXSA 2H3XC 1DE4B 5GISL 1QSFD 4WNJA 3LZPA 2OXGB 3NIFB 1K5NA 4MD0A 3LNHA 3FYIB 4YE4H 3PV6B 4MD5B 5D1QD 4FNSA 2I60L 2HFGH 2GC7C 3MLTA 1SLWA 5IHWA 4NM4L 5B1BB 1TUPA 2JB6A 2VDLL 4P5TB 4KVNH 4P2OA 4TVSa 3S88H 4GI8A 3HS8A 1V7ML 3LQAL 1CDGA 2YUVA 4FJYA 5DHVA 1CBVH 3QQDB 3KPTA 4O02A 1ICTA 4TQEL 1LNUA 2X6AA 2AANA 4WI3A 3QQNA 5T5FL 3WDIA 3W9DA 2YK1H 1I9JL 2PW2B 4NNXA 1OAKH 4WGKA 2OYPA 2F08A 1O9ZA 2BCKA 3CZNA 1U92B 1BA9A 2FH8A 2WUBH 4Y88A 4AIXA 4AUJA 1J11A 2H2SC 4Z7IA 3MOBH 2A1WL 3P3YA 3Q3GA 5IBUB 5IHZA 4RWYH 1PKQB 5TF0A 1NFDA 2AFNA 1FAIH 1OCZB 2H0PA 2A9NH 1F5WA 1BQLL 1KB5B 4LRNH 1QLFA 2Y3AA 4URTB 3BUYB 1USZA 4Y1SA 2XXCB 1UGKA 3AXIA 2QKIB 3QW9A 1AXTL 1MQKH 4AVHA 2CKBH 2AK1H 4FQXB 3L9EA 2F53B 3OHXB 4URKA 1SGKA 2ALAA 4U6YB 3POCA 1BJ1H 4G6KL 2WZPD 2TAAA 4G8GA 3SGJA 4UDTB 4R4BB 3KXFA 4MS6A 1QNIA 1XTLA 3VXSD 4ZQTA 4A7SA 4ZX6A 2AS5M 4NNPL 5AOZA 5CJQL 1DBAH 3BEVA 4F7KA 4LF3A 1SBSH 5I30L 2IOMA 1BZ9A 5LWYL 1EAJA 3ILPB 5D1XD 3IU4L 1KB9K 1Y1UA 5HJ3A 5LQBL 3CBKB 3CZKA 3QJUB 4LCYA 4W9FC 5I1DA 4OLUL 1N10A 2XWXA 5AG9A 5IM7B 3FB5B 4FG4A 2CUAA 2KS0A 4DTGL 3VXTA 1RJCA 2CK2A 4KJQD 3L13A 3T08A 2O5NA 3KGRA 1FGNH 3WY1A 3VCLA 3H7BB 4M56A 4QDGA 1CURA 3C87A 4BXSV 1MFNA 3TPUB 4ESKA 2QJDA 3L9RA 1IC1A 3LEYH 3C6SA 4JO3L 4QTFA 3RNKA 3RRQA 1N5AA 3GSXA 1DVFD 4U1LA 4OZIB 4LSTH 1WIOA 1INEH 2L04A 5EHFA 3V0VB 1A4BA 2IH9A 2KC0A 1U41A 3MNWB 2V9UA 4LSRH 2Z31D 4NM8H 4Q56A 1QLEB 3WFDL 2IADA 2DM3A 3IFOB 5IQMA 2CO7B 1IC5L 4J3VA 2PO6C 4M1DL 4K15A 3NVQA 3LVEA 4OIIL 4R2GD 3NZSA 1NCUA 2HLFD 1ZLWH 1EVUA 4GQRA 4XVTL 5MEOA 5HYSB 1CDCA 2G3MA 4DO4A 1JXFA 5IEKA 1P5UC 4IBVA 3KDMA 1E4HA 5C3IA 2BM3A 2Z64C 1XEDA 4U4IA 4YSRA 5DU7A 3BQUA 4Y9CA 4G8IB 3TT3L 1TVDA 1KMGA 5AYQA 4XPHL 4M7ZC 2HN7A 2W9EH 2VGLM 3HW7A 3UFIA 2VLKA 2VDQL 3OJDA 1KBKA 1WS7A 3IJHA 4D2NA 1DFXA 2IFGA 3ZDZE 5IV2B 2NW3A 1BHGA 2HRHA 3CGTA 2XYCA 2ZOKA 3MJ6A 1QSVA 5H37H 5SWSB 3QH3B 3WI9A 5BS0B 2X4PB 4Z3HA 3MGTB 1ZV9A 1JZGA 3EGDB 4KHXH 3MNZA 1D5IL 3VRIB 1R3HA 2WXKA 5CIPA 3S37H 4Q97A 2WVTA 1WHPA 5HYSA 3WUWG 5C0BB 3B7TA 4LLVA 1MY5A 4HU2A 4G11A 3AT9A 4Z95L 4D0BA 5DD0H 4JFVA 1USQA 3LEYL 4KRLB 3MA9H 5DJ2B 5E8PA 4ZFOA 2BVEA 1HDMA 4GMSL 3BIKA 4KI5D 4U0RB 2CO7A 2BNQA 4XAKD 4M3HA 3R06B 1N12A 2ZX7A 2F7RA 3CFMA 5FK9B 4KTGA 3ARDB 1XWVA 5HI4D 4U1LB 4N25A 1T1ZB 5E6ID 1YAZA 4F27A 5ADOL 1S3KH 3O2DH 2IH3A 3M8OL 3C6SB 1G4MA 2PTTA 3IBEA 1VZIA 1N3NA 3H7BA 4H2AA 3VCLB 2VZ3A 2Z8RA 4X6CF 3L1FA 4TNEA 1NEZB 3AZUA 1X9QA 2OLDA 3Q2CA 4OCWH 3T4AC 1JFQH 1PQZA 1CYWA 2EDRA 4CDGC 4F9PC 1TQCB 2AK1L 4JANB 5HJ3B 2GITA 3MRFA 3GDBA 2VKXA 4UTAA 2J8HA 1F13A 5I8KL 1MWOA 4NUMA 1HDMB 4Z5RB 3CSGA 2W9LA 3D0LA 3JTSA 4O58H 4FFZL 2BWDA 1CL7I 1JAEA 4DEPB 2K7PA 3NTCL 3RLSA 4NERA 3CU1A 3QDJD 4F58L 5IHUL 2OQJB 2QPEB 4J4PA 3OHXA 2NUTA 5CIPB 2JKNA 4KVCH 4HKBA 5EUOA 5AW5B 3US1A 2B20A 2AAAA 2LT9A 4KRPB 3DVGA 3QJFB 3VMPA 2ZTBA 2G5UA 3LMJH 3L4YA 3PYCA 5EZJB 3BUYA 3VXRA 4FYQA 3QCVH 1T0MA 1LL1A 3PAYA 4YE4L 3S37L 1Z9LA 5SWSA 5JA9A 2ZOKB 4WJ5A 3Q3GB 5IHZB 1P1ZA 2NTSP 3PFQA 4XHJC 3O2DA 2E7DA 9CGTA 5D6CA 5FUCC 3TZVA 4AJYV 5DD1H 3DO7A 4GG6F 4PMFA 4ZTPL 3N1FC 1KCUH 4DGYH 4BK5A 3A6OA 5LG1A 5HDRA 3LQAH 1B0GA 2VLJD 3SQBB 1SJEB 3EBIA 5D1ZI 5HYSG 3GD1C 3L5WA 4NQCE 5I1AA 3EHBB 3QRGL 2AQ1A 2XZCL 2NMSA 5DHEA 1CD1B 4DKFH 4NKDB 4O02B 4AQ8C 5DRZA 3TBVB 5MEQB 2CGRH 1XB8A 1BBDH 1RZGB 4N2EA 4NC0B 4UAHA 5ANME 3B6SB 3MBXH 4LIQH 5DUMH 5FM5M 3SCMA 3VXOB 4PRHD 5DJZB 5EC1A 3PP4H 1A6VH 1MFAH 4HUNB 3K4DA 2HJKA 2ZUXA 4Z7QB 4M6OH 1R3KB 3F7KA 2ZKHL 4PPTA 4HPHA 1JMZA 4JHUA 4D3CL 2W07B 5IJVA 4JGUA 3MBEA 2C3VB 2XV2A 2R2HB 3QUZA 4XB7A 1RVFH 3FQNB 4NWUH 3ZDXF 2ETWA 3N9GL 4NRZA 1RK0B 5JHMA 4XTRD 3TPUA 3KLLA 5ES4B 3DARA 2K8MA 1I9RH 1ZPLA 2PYEA 1E2WA 3K3QA 3FUFA 3SYOA 5FECB 4NZRL 2CGZA 5B8CA 4R96B 1QKZL 4WFHD 1AD9A 1LWRA 3Q1SL 3SQOH 5FO8A 3MCLL 3AXHA 4GG6A 4XCEA 2JQZA 5HSFA 5D2LF 2VAAA 3DX7B 2NX5B 3RAJH 5I18L 2XYBA 4GKZB 1OGAE 3KW8A 4MDJA 1UH2A 1IE4A 1TYRA 2LVCA 5ITBH 3VH8G 5C09B 4J28A 3PWUA 5DD0L 3C09B 5HVHB 3D18B 3KXFB 2Y6SD 1IJ9A 4MYPA 5HHQA 5CZXC 2AEPL 5J1AB 2E7LA 1QOKA 2X7LB 1I8KA 1X9UA 2EDLA 4NUGH 1QNZL 4LPTA 3A3YB 3J2PA 4NHUB 3I9IA 1CLYH 4OZGF 2K6ZA 4IK7A 2WQWA 5HI3D 1XGZA 4CU7A 12E8L 5JORA 3DX1A 1VAHA 3B3IB 5IW3A 1FN4A 2Y1AA 2YQBA 4UQIM 1ONQB 4WI4A 1ODAA 1SDDA 2YD0A 1BV8A 2ICWI 3L7FA 5E4AA 5JIPA 1KEGL 3S34L 2F6AA 1EUTA 5JPMC 3HAEA 3B7RL 1OVZA 3NGBC 4OLEA 2CLZB 3T2QA 4KU1A 3SGEI 3BWUF 1BWMA 4F9LA 5LXGH 5DJXA 2EEXA 1R5VA 4TSCL 5H35A 3KCPA 2OSXA 1SBSL 3OD3A 2E7LC 4Q2ZB 1BZDA 2BY0A 3WNOA 4NUQA 4ICWA 5KW9H 4PIBA 1RSYA 2V7HB 3P1VA 4K71C 4QLRA 5J89A 3MLZH 3K46A 4PV9A 5E9DD 3QFDB 1HQRA 4IBTA 4P5TA 4XP4H 5EZOH 2ZJSH 2E75C 2BSSA 3VD5A 1CD8A 1GGCH 5IOPA 3L81A 5T3XL 2IIJA 4CADA 2G0LA 1QRNB 1OTSC 4OFYA 3BN9C 4OZFH 4X8JA 3T2OA 3BZEA 1DQKA 3QCVL 1JZHA 2BDNH 3T6QC 1BVOA 3MV8E 1B88A 4ZAKD 4I77L 2ZSWA 4IHOA 1KIPB 4JDVA 5TGBB 1MIMH 1U3HB 3UZEC 2FWUA 4GRWH 3MLPA 4N1CA 4ZUTA 1WPCA 4KMTL 3SJVE 2LVEA 4PP1C 4QCIA 1B9KA 5FCUL 4YDVA 1L0XA 1QLRB 1MELA 2WLYA 3FDWA 4GQ9H 3ABMB 2WVUA 2ESVB 3GO1H 3VMOA 3FO9B 5C70A 3TFKC 5EF2A 4L05A 3GHEL 3ISWA 5HGHB 1UEMA 2D03H 1JJUA 1F11B 2YXVA 4Z23A 4LOEA 1V27A 1JGUL 1PZ2A 2P46B 3B9KC 1G7LA 3VXSB 2IPTH 1P5VB 4G8FB 2AP2A 2VABA 3GHBL 3VSTA 4TYUA 1LO5A 3IDJA 3V10A 3HG1E 2NT0A 4MCYA 1EJOL 2XZAH 1WCQA 4LCUA 3FUDA 1ID2A 3TN0B 3U4EB 3CFDB 1T4KA 5KVDE 1S9KC 1K85A 3FTZA 1YPZF 4YHMH 5C08B 4G43B 1XF4A 1FFPB 1KCVH 2WXPA 1SXSA 1QMUA 4K5PA 2Z4QA 4QT5B 5GGUB 1E0OB 4OZGB 1SY6L 5F7KC 1WTGT 5C0JB 4KC3B 1DO6A 4XP4L 5J8OA 4HC1A 4G6FD 1KIQA 2HX7A 2A9MH 5I6MA 3HLAA 4DK3A 3SY0B 3WLWD 4S2SB 2CE6A 3V52L 1U8CB 2NY3C 1FNAA 4KQ3H 3R0NA 2CDGB 2OTWA 2VZ1A 2OTPA 3G6JE 4TQPA 3FTSA 4X6CE 4Y7OC 1WRFA 2YGVA 4CMHC 4RESB 1AZUA 1TMQA 4RDBA 4UQEA 2GUYA 2EDNA 3FB6B 4NKMB 4H2CA 4NQEE 4CMMA 4RA3A 4ONGH 3L4CA 4CBPA 3UL4A 1MLCA 4QR7A 3FZUC 3ELAT 1TDQA 2UWEE 4XP1H 1G0YR 5L8LB 4S0TD 2E7MA 4YHLL 1AO7B 3QDAA 4KV5E 4FXGC 2BRRH 3HZVB 1UKSA 2F7QA 2XBTA 4JDTH 4L4TD 1FYTD 3RNQA 3JWNE 2IQ9H 3ECBB 2P43B 3BQUC 4L3AA 2EE2A 3I6LE 2EE3A 4ELMA 5IFHH 2YUZA 3P73A 5D7IF 3I50H 4KNSA 3S5LB 1J5DA 1FDLH 1XGUA 2NY4B 3E8VA 3MMEB 3QDHA 5ID0B 2HJFB 3T0WA 1WT5A 4WNQA 5BW7A 3IT8D 2ZICA 2WCPA 1QZNA 5IIEA 1J9TA 4MQ7B 2WIIA 2F54B 3X17A 2W5PA 4ZAKA 4XXDB 2J1XA 3MLWH 3BVDB 3M8OH 2WSPA 3VB8A 1J1OH 3LXCA 1NGXA 5D4HA 5B3JF 4JPKH 1RHFA 3EYOA 4JFFA 4CL7A 4UUJA 1A0QL 1GZHC 2R23B 4Y4KB 1JXDA 3ILQC 4LDCA 4N68A 5F2FA 4AYBA 3K6NA 2VJ8A 3H3BC 1WCBB 2ZCLH 3HUJF 3K2MC 4JFHE 3MTRA 3VGGA 4MZRA 5J12C 2XRAL 3S2CA 5JHDD 4R0LB 3K72B 5DEGB 3CPLB 1KEML 2JXMA 3BVUA 1HFUA 2GUOB 3OKDA 5FUOL 2C3WA 3QZMA 4FZ8L 3UC0H 4LRIA 4J3OC 4JKMA 5D2LA 1E90A 4YC2C 4B9FA 4HG4J 3H9YA 3AAZA 5F7EL 1EJ8A 1A25A 2WZ6A 4PJAB 3COOA 4OB5H 4AIOA 3LKRB 3WE1A 2XN9D 4HZLB 5DZNA 5E1AB 3BVNA 1G7HA 3MNDA 1NJ9B 3TH2T 5L0QB 4PRDA 1YG9A 5DYOB 1E27B 1OGSA 3AC0A 2RQEA 3DSFL 4LCWD 2C9AA 1AHWC 2B7DT 2X4OB 1GVIA 3BYTA 3NCJL 3T6VA 4ZDHA 1JG9A 5AW7B 1URLA 5DO2C 4YWGH 5JO5A 4PJBE 1G9HA 4X9YA 3VRJB 1QYGH 3CX2A 4PVMA 2IQAA 3IMVA 1DN0A 3DURB 4W81A 3VFSA 1O6TA 4FHJA 4JPSA 4LKXB 3K1DA 2JELH 4DGYL 3K74B 3HCVB 1PFCA 1UWGH 4JGJA 5B1AB 1PZAA 3FB8A 4J3OH 4LFHG 1WE5A 2VZUA 1BEYH 3V5DA 2FHFA 3DV4B 3G08A 5ILTH 2EDQA 3BT0A 1LP9F 4L3EE 4R8WL 1UJTA 3AFLA 4IM8A 1AR1D 3VU1A 4LU5L 2NOYA 1ND0A 2EO7A 5C0CE 2GJZA 4G7YL 1GGIH 1SN5A 2PF6A 2HVKA 2FCBA 2RMNA 5DD6B 4AEIL 2DLGA 5AZUA 3SE4A 1A1OB 3MVSA 2F1EA 4OGZA 2NY2C 3QVAA 3UZQA 3N91A 5BV7B 4GAYA 3D08A 4GYBA 1M7XA 4O9HL 4J5VA 4LCWA 2AV7B 1RMFL 4QTIL 3TH4T 4C56E 1AHWB 4KXCA 3T0BA 2FLBT 1NIFA 2EDXA 4JPIB 7TAAA 2X89A 3UTQA 3SDCD 5E6RB 3RWGB 3NZHL 1I31A 3MRPB 2YWZA 3VH8B 4UTBA 4YHZL 5J56B 5L2KE 5KVFH 3H1ZA 1RK1B 3BPNC 3QDMB 2VMDA 1HEZA 3OKNB 3BKJH 2BFGA 3DUSA 3QNZB 5DEZA 1P7QB 4Z7UE 3FRUB 3MRHB 2BFVH 3ZPDA 4ABUA 43CAB 1W15A 4JQIH 3ARPA 5E8NB 4M93C 5H2BB 3ARZA 3X14B 2YA1A 1S9VA 3KYNB 3X1EA 1MWAH 3N55A 4TVPH 4K3EH 5I71B 1B4JH 2NNXA 5ITBL 3ERXA 5JHDA 1AQKL 2QVFB 5TFSH 2X10A 2VLJA 4WU5A 4UM8B 1OAXH 2F8OA 5BMFH 3HG2A 1NBCA 1KDJA 4WTZG 4A37A 4I13B 3ULUC 2LOEA 3UZVA 1N4XH 1QAWA 2X4TA 3LH2L 4D9QE 3CDGA 1YY9C 2WPGA 4G8EA 3MV7D 4ODTL 4Z3JA 5ADPL 3HN5A 3H9ZA 3PNWA 4NZUH 5FOJA 2WQSA 4PTUA 1JV2A 1DVZA 3S3PA 5B3SB 1KJ2L 1ZA3B 4H1LA 4WO4A 1PZBA 2AABL 4LSVL 3THMH 1SBBA 4CJ1A 1MCRA 1BOYA 5CEYA 1KN2L 2P5ED 4XOEA 1QBLH 3LQMA 5ISZE 4IEFA 1S4IA 2J71A 3FQ2A 1LEGA 5AOIA 1KCRL 3S98A 3VNZA 4KJPC 5BUAA 4Z7WA 5BVPH 3WHXA 4PREA 4WI5A 2A0LD 2FECL 5F7EH 3UYOD 4YGVB 4LEBA 4Y19E 3IFLH 4G1MA 4UT6L 4EQ3A 4RNRB 2CUMA 4JFQB 4P2RE 2BHUA 1M7IA 3H0TB 4FE9A 2BS8A 4G1EA 2QHLA 5BRZB 1IGYA 3MYZA 4O2EA 2F7OA 4UOQA 4FRWA 4MJ6B 4NJAH 3FCTA 3ZL4L 3DSFH 5C6TH 2UX6A 1GW0A 2W80C 3MLRL 1TTFA 4JQIL 1C12B 4E41B 4PJBF 4X9HA 2KKQA 3MV9B 5I66A 4RRPM 4PJXB 1ETJA 2EEDA 3MFFB 5KSAC 1PZ3A 5D96B 5EBMB 5D5MA 4P5SA 3TU6A 5DC2A 4TTDD 2BY2A 5CLZA 2OMUA 1BFVL 2F7IA 2XOTA 1CD0A 1TVHA 3MJ9A 2BVOB 3QUGA 4IHBA 1EHLH 3O41A 3V9FA 5IWLA 1TQCC 3GTNA 1WSST 2WQUA 4R3SA 4PJIF 4XMLH 1INQA 3AS1A 4ZYKB 1Y0LA 3MRIB 3ZE0E 4FYTA 1IM9B 2VNCA 1WBYB 5D2NE 1XGQB 1RZQA 3H9SA 3KGTA 1AP2B 5EUOF 1ESOA 3L5XH 3MOAL 1UZ6F 1K8DB 4FL4C 4FQIL 4JB9H 3QWRA 1J1OL 4ONHB 3SDCC 4EDXA 3ETSA 5CUSH 4M48L 3QHFL 2DLHA 3GKWH 3VG9B 4BZYA 5C71A 5E8EB 4KO7A 1T0NB 4HGMA 3VFGH 1F4AA 2RIKA 2OR9L 1CC3A 3I3EA 3ZTJH 1JXJA 4QRPE 5FW6A 1ZOXA 2AK4B 4DW2H 2YD6A 3E3QC 2NY2D 3K7UA 1IFGA 4LPUA 5K33A 4MAYA 2GT9B 2EO9A 2Y4SA 5F1KC 5I18H 2BMKA 4DF9A 1JPGA 3RGVC 3GB7B 5GRJL 1T66D 5JW5B 2C26A 4FULA 1I3VA 4X8GA 5DEFB 5BUPA 4W9LC 5HGDA 1TQTA 4WTQA 1SN2A 3PG2A 4BYHA 4LEOB 4AW7A 5MENE 4NZTL 5IKCB 4V2BA 4TV3A 2GIMA 1XV8A 1H6UA 4TSBH 1JGDB 2XN1A 3KR3L 4L1LA 1N59B 1H8OA 3MZTA 4GLRI 3HJ0A 2AJZA 3EOTH 4MAUL 1QSEB 4JN1H 4CVZB 1QA9A 2BRQA 3RU8L 4FFWC 3S4SG 3TN0D 3P11H 2J1WA 1D9KC 5FWQA 2FO4B 2VSDA 3NH7H 5AVWB 3K8KA 3ALPA 3PJLA 2O72A 4OZ4B 3WEAA 1NQBA 4MD4B 3VE0A 4H88H 4H0GA 4B7IA 1HU8A 3HBZA 2CUIA 1X5AA 3DYPA 2I9TA 2JK5A 1KJ2B 1LP9A 1ZVSB 3GRWA 4OBRA 4WWKA 4AYID 4GSDH 1NMCC 2VLLA 4JJOA 5A2JH 1F41A 1XSJA 4G3YH 3D5OF 4ZW6A 4LLAA 1MAML 3ABLB 3EG9A 3PL6D 5E1HB 3CC5B 4J27A 3QR1A 3O45A 2DMCA 1OD7A 2WZ5A 3E0GA 4MSWB 1O5DT 2F7PA 3ZZQA 3WSQL 5L8JB 1O6SA 2JNZA 4K8RC 5FHAH 4JB9L 1JF5A 1KGWA 1W0YT 4U1KB 4GUPB 1IIIA 3LRHA 4ZI8A 3BSZL 1SYVA 1JZ5A 3T3PF 2FZ3B 2DDQL 3S35H 1SMDA 2F8XC 2FATH 32C2A 2YSSA 3ARBC 1L0PA 1TFPA 3MLWL 3RVUD 2DQDH 1AZRA 3AB0C 5CEZD 4L8CA 3ATFA 1CFQB 1I1AA 3HC3H 1R4XA 2ZXAA 4RMRA 5CIPH 4WFFD 4U4BA 2LW3A 2ADFL 2EABA 2WINB 4ZS7L 5LAXB 2EVIA 1TZIB 4NQED 3V7MA 2CSPA 1I9JH 1LP9E 2EKSA 3AG2B 1A4KB 1MXDA 1ZVSA 1FQ9C 1AIFA 1TG8A 5I6LA 5I6XC 2PCFA 4G9FD 2EIBA 2V17H 4NCDA 1QFWH 2VJXA 1TLMA 3GRBA 2Y24A 2Z31A 2ZXDA 3QORA 4FFZA 4LL4A 5F9DC 4KNQA 2Q3AA 4P2AA 3MLRH 4DZBA 5E2WH 3D05A 3BLPX 5IBUG 1MRDL 3LXBA 2F8IA 4EUPG 5ADOH 3KEDA 4Z3EA 2MFNA 3GSOA 2WIMA 5I28A 3BW9B 4L23A 1E4JA 1EHKB 3CVHA 4XRCA 3FFCA 3IDYC 2XFGB 3AW5A 3MRNB 4ODHL 3U46B 3WN5A 2AQRA 4CNIA 1JGDA 2K7QA 2DKSA 1I8MB 3FQUA 5E5MA 1JF6A 1CFSA 2FEDD 3OHXC 2NY6D 2O5ZH 3KLHC 1OHQA 4MDIA 4C58B 2G2RA 1OT4A 2KI6A 1B2WL 2WM0A 3BH8A 2N56A 2YAFA 3GXUB 3HB3C 2L7QA 3NCWA 4AENA 5FV2A 3ZDYE 2X9ZA 3RBGA 3FZUD 4LPVA 1G7PA 4EI5A 4HBQA 3CFEB 3N44F 1CE6A 3VXUA 5L7XH 5J1SC 3W38A 4JZJC 4IIQB 4MAYB 3WJJC 4BFOA 2W65B 4WSGA 4C47A 4QXUH 5D1QA 3FO0L 1MPAH 3CFUA 3EOBA 2ZG3A 2J8UF 3L5HA 4DP2X 1MCJA 2IGTA 1ES0B 2OZ4L 3LPWA 2RFXA 4B60A 4DK5A 1NCCH 2EDMA 2X4QA 4Y5YA 2FJGB 2HX8A 2GFBA 3IXAA 2WUCL 4WWPA 4DQAA 1CVSC 4P9ML 2EDBA 5I1HH 4WK4B 3MUY1 2AXHA 3H9SB 5L4JA 3ARFC 3QUYD 4QYOB 1I82A 5F9JA 5KUKA 4G6JH 4HK0B 3IJYA 3CVHL 3P30H 1AGFB 4P46A 4LEXH 3FHEA 3FSZA 4EI5C 4GO8A 2X3BA 3CSPA 1VCBC 4DTGH 4I1PA 2FQFA 4XWGH 3UO8B 2EC9U 4LASH 1MCKA 3APDA 3E3QE 3P9WB 3WJJA 3QCTH 4QHUA 4XMKL 4PRID 3B2XA 5IJKC 1PNDA 1KELL 1OCWL 1CGYA 4ADIA 4LSPL 1HOCA 1XR9B 4HOXA 1GMIA 2B1AL 5ITFB 5EBWA 2CDFB 2IDQA 5TDPA 3KYKH 3MV9A 5I66B 3BCFA 1A6ZB 4RAVA 1QSFB 3WFHB 4KAQH 4XOCA 1QUNB 3I50L 1PMYA 3L9BA 3BFOA 3LXAA 3D25A 4G6MH 4MMXC 2X4UB 2NNAB 2XACC 3FH8A 1YMME 3WNIA 2CJTA 3UAJA 4DN3L 1W6WA 2YA0A 4RVBA 4ZX3A 4G1EB 3KL3A 4ZTOL 1SF3A 2J72A 2VDKH 5TE4H 3AADB 1NGYA 5CP7A 4BZ1A 2JCCE 4DUXA 5JQIB 2CDEA 5HPMB 3HI1A 3K6IA 1GY2A 1J7VR 2VW6A 3RVTD 2YD3A 3NFNB 2F5AL 4NWUL 3ZE1B 3D12B 1ZHLA 4F5CA 1K2DB 2X3AA 4OM1H 3BN9D 3EUUA 1YMHA 3RG1C 5EZPA 4Q6IC 4YK4C 2SEBA 3UBXA 5IUSA 2DDQH 1A6PA 2VLRD 3CH8A 4WRLA 1L5GB 2YZ1A 1D5MA 2C5DC 3VI3F 2OL3H 2WCGA 5ICXB 2ZOTA 5IVZA 4MLIA 3UABA 2K45A 3P2DA 5ACLA 1A64A 4UTBL 4XPTH 4NDMB 3X1BA 1FC2D 2WXGA 4OFQA 5CCGE 3CDGB 2W38A 1GSKA 4HEPG 4NIYE 2VIRA 1KY6A 4O02H 3EIFA 1BYPA 5D7LA 3Q13A 3QUYC 4P3WA 3SB3A 5DJ6B 4M62L 5HHOE 4UM8A 4AVKA 2FJSA 4K94L 5DTFA 3EFDL 3D39B 1I8IB 4M6NL 4AE0A 2DI7A 5F1OB 1YHPA 3GMQA 2I32A 3CE1A 5AOLA 1BOGA 2PYFA 5HD8C 1DUYA 5AW2B 5E56A 3RP1A 1NCWL 3L54A 5H2BA 1A14H 1CXEA 4W68A 3LTVA 3NIDF 2EIZB 4UCFA 1BSIA 1S3KL 1XGTA 43CAA 4RX4D 4ODXA 3NFSL 4MWFA 2AXGA 1DBBL 3EYSH 3DC0A 3TV8A 4A68A 1KXHA 3AQZA 4KX9A 2ZYIA 1H3VA 1UA6H 4D9QD 1LEIB 1G9NL 1R3LB 1NCTA 4IU3B 4MVBD 3U1SH 1NAMA 2J7LA 4WK2B 2WLIA 5G55A 3HB3D 4FKEA 2P8PB 2R7EA 1WWBX 1G7QA 1K72A 3BPLC 4JR9L 5H4YA 5TDNA 2OZNA 4ANKA 4BFGA 4JPIA 4U1GC 4W9JC 1GCYA 2VTFA 1MVUA 3HPJA 2B1HL 3D7PA 4HJ0D 1AHWA 3T77B 1MW1A 4P57B 1ZCRA 2IPKB 3B37A 5CZKA 2JF1A 3N43B 2G5BB 2ICES 1JFQL 1OE1A 5E51A 2XQ0A 5FUZL 3DROB 3IFPA 3G5YA 2EILB 2IPKA 1KTDB 3T0EE 1GYCA 3B2VL 2X0VA 3G7TA 5E6UB 5CSBA 4GBXB 1XL4A 3QIBA 3UTZB 3HE7A 4P8QA 3VFPA 3VQMA 1GJWA 2J57A 4L3EA 4EEEA 3CLFL 5T3ZH 4PJHA 3LQAC 1E4XH 2WLIB 2FD6H 1GXEA 1NAMB 4YLCA 2P52A 2PTUA 3PY9A 4PCYA 2V2WB 4QRQB 5D4IA 2NNFA 1LEIA 3T2PA 3MI6A 5FEBA 3EDDA 1U8QB 1YEHL 1CGVA 3LXUX 1FC1A 1MCWM 4FYRA 4U6HA 5F1IA 4N6QA 2D2OA 5LGKA 3UTPE 3B9AA 3VFSB 3LRMA 3VXMD 3RVUC 1MWAL 2PWHA 3V6ZB 3U0TA 3CFNA 2HLEB 4XH2A 3H54A 1ZLVK 4N28A 4KAQL 4F92B 1SRDA 1UXWB 1NFDF 1FVCB 4ACTA 1CR9H 4LLWA 5DD3H 1KWKA 3S3BB 3VI3A 4GW5A 2QGEA 1YVLA 1I7RB 1E27A 1FJ1A 3NFSH 5DYOA 3GMMB 4UT7H 5E4OA 3GSNH 4D3CH 5E2TL 2Y72A 3BVNB 2CO1A 5J6HB 2WWKO 3SO3C 1I3UA 1W6LA 2RGSA 5KYXB 3G6JF 3LKRA 5F6HI 2D0FA 3AREC 2O30A 3F62A 2SODB 1D6VH 2A6DB 2XG4B 4HZAA 3U4BH 2VE6B 4F7TA 1BMZA 4TSAH 2VDQH 3ZKSD 2GJ6B 1QFUH 2E74C 2YD1A 2GJJA 2VERN 3I9GL 2ZAIA 2A3TA 2BK8A 4HJGA 5C3TA 1D5MB 1UZ8B 4HJJL 3MCLH 3A21A 1TFHA 3K72A 5DEGA 2X87A 5J11C 5FKAB 3ARFD 1HYSC 5HBBA 2ZPKH 3ZHDA 4Z0XB 5CD3B 5JQ6H 3U30B 1ASPA 1ZVYA 5I9QB 3VTTA 4UQ3B 1VIWA 2Y69B 4YSEA 1MFDL 2M26A 2R4RH 5DS8B 5LXVA 1JPTH 4X83A 1NGXB 4OJAA 2XN9A 1YYML 3O0RL 2QGCA 4YSSA 2FQEA 4PRPB 3OAUH 4XXDA 5JZ7C 4WENB 1YEFH 5D93B 1A6AA 4MQ7A 1PYWA 4XX1G 3ZT5A 4N0CC 4JM4L 4PP1D 4DKEL 2N59A 1NGYB 1D6EB 4FP8H 4WU7A 3DMMB 3PWPD 4IGBC 1RAMA 1KY7A 2RAMA 1QRND 1XB3A 4IRSD 3QFJA 1MRCL 1VLXA 1E28B 1OD9A 3NJFA 1IAII 3ZIYA 1FV1B 4K3GA 5I19H 4XO9A 5AL0A 1NKGA 5FCUH 4ELMB 3HFML 4NS0A 5IB1A 5IVXB 4XNXL 1BF8A 4HBCH 1QSFA 3MLYL 3A23A 6FABL 5KAQG 4MJIE 1Q94A 3KLKA 4N90D 1Q4NX 4N5UA 1AO7A 3VXQA 3DO4A 4EO5A 4PJAF 3NJXA 4Y1AA 4YBQD 4YL4A 2BWQA 1AH1A 5E2TH 4HKJA 2DF3A 3D3VE 1PF3A 3LN5A 4MDRA 1WIPA 1G1KA 4B0MB 5EOCJ 2OK0H 5I71C 3EDJA 3ATAA 5AWNL 3K5SA 2IH1A 2P3YA 2ZJSL 1FZJB 1OM3L 4K23L 3TP4A 3UPRB 2VT0A 3SY0A 3J7HA 4IYKA 3UJTL 3B5TA 3NSCA 4C8XA 2F5AH 3FRPA 3QIWB 1DLHB 5D71H 2X4QB 4Y5YB 1DBKL 4MNQD 4OH2A 5KYWA 3VQ1C 2NUPA 4OD2B 3P3SA 3BJLA 4G6JL 2E9BA 3CFCH 2R1WA 5CLYA 3HJEA 4FEIA 1A9VA 1JI2A 4UQ2A 3CNKA 4E2OA 3ULVL 4AK2A 3U4EA 4NO0D 1JIBA 3QPQD 5DT1H 2MWCA 3IETA 3CZUB 2WO4A 5I0XA 5J3HC 4UTBH 2NY0C 4P06A 2KYIA 4HH8A 3VFOB 1IILE 3NCBB 1GS8A 4DKEH 1CZ8H 5KYUB 5KSBF 5CJXC 4HMCA 5DDHA 4OGXH 4JG0H 3QNXA 4HC1H 2NY6B 5A2BA 3TEWA 3TO2A 1ZHBA 1JDCA 3PWVB 3U46A 1JZDC 1OAUH 2XLLA 2WBJD 4M62H 4UIKL 4XXWC 1LE9B 1EAQA 4MMXB 4ZODA 2H2PD 1RJYA 1UADC 1KPUA 5J13C 3IDXL 4YSPA 3VWJA 1I3GL 3TN0C 2DMGA 3LEXB 3N1MC 4KY1H 1M7UA 3IN2A 5TGBA 1UFUA 3SGDH 4MGXA 2J4WH 3F7RA 4TPRH 3QPKA 5F8QC 4NQDE 5EUKB 3F6JA 2EKSB 4OAWB 4N5EC 4O4YL 3KVDD 2DWSA 3KM2A 3F6IA 2LU5A 3I75B 3RI5F 4PD4K 1XF2B 4ODSL 1E8ZA 2UXGA 4G7YH 4PJ8C 1I1AB 4JNXA 2Y2TA 5DHVH 1QPKA 1WF5A 2ZAHA 3D3VD 3G5VA 4LO9A 4XB8A 5L2JA 1YN6A 5FW7A 1ECZA 1FL3A 4QHPA 4BH8B 3APNA 1CFNB 4RSYA 2CJUH 5C0CD 1MCNA 5J6SA 2FEJA 1Y6NR 1GZPA 2B3RA 1O6SB 2VSKB 2NYYC 4I7ZC 3SDYH 5J4MA 2VDLB 4Q2ZA 3RIAF 3O45B 1JHKH 1R3IL 1WZ1H 1T0OA 5DJDA 3KLAB 3JT0A 3DJTA 1RIUL 3TONA 3GC3A 1VPOH 1U58B 3SQRA 2VLLB 1AOHA 4ZOAA 1U8IA 3BPOC 2QR0A 3B4NA 3ZGHA 4Q8BA 3GMNB 2JK5B 2WW8A 3P77A 4RETB 1E30A 2BW4A 3NPSC 4RQQB 5CSZA 4KQ3L 1TSHA 1NCWH 3S36L 1QQDA 2BSRA 1BLIA 1SDDB 4P5TD 4XP1L 4A7GF 4Y9FA 5E9DA 4XGZA 2NY4C 5D7EA 4ANXA 1AR2A 3TWCH 1OPOA 2X4RA 4KX7A 3B8SA 5CILH 3GT6A 4Q0XL 5F6HJ 2HTKC 4OIIH 4X50A 4OM0H 4N3TA 1J8HE 1KYUA 1I8KB 4PGEA 1RU9H 2HRPL 4EOWH 2AJZB 6PAZA 1RD6A 3B7YA 3ROOA 5KANI 4YSUA 4UWQB 1PY4A 4BKTC 1MHEA 4JFDB 4Z7AA 2Q7NA 3RWJB 4D8OA 4JRYA 4LEOA 5AG8A 3ES6A 3MV7E 3AS3A 5HGDB 2NX5A 2YKLL 1ZT7B 5LCVH 1FIGH 1NC4B 3HS0B 2D7TH 2Y9RT 3BD5A 1WD9A 3NG5A 4A2GA 1U2CA 1UZGA 2AW2A 5DMKB 3ZBMA 1ET5A 2XXMB 2P5EE 3V0EA 5E08H 3G04A 2WBJA 1HXKA 2QDVA 1QBLL 4AMKL 4HALA 4KJPD 4RGMB 3BKML 3QEUB 3EJZC 4AC4A 4NFDA 4NRZB 3GXFA 2XY2A 2CHWA 3M88A 1B90A 3P4OA 3PDGA 4PTTA 4XCFH 3IDNB 4YDJA 1SHMA 1K8DA 2C3VA 4PY7A 3HR6A 5PCYA 2X1OA 5ICZB 3MROA 3FT2A 3PQYB 2NDGA 2XN2A 4TXVB 4JRYE 5JW4N 3MNVA 1OAQL 1XGQA 4NLHA 1T0PB 1IM9A 1MZYA 3FT4A 3WN6A 4MHHG 1MCPL 4A6YH 4BWTA 1NTDA 1O6VA 5DJZA 1H3PL 5ANMA 2BINA 2AEQL 1NGQH 3B6SA 3EJYC 3FT0A 3KNBA 3OKEB 3PWPA 2KZKA 3CX5J 3Q8FA 4HZ1A 4LLYB 2EINB 4JG9A 2GK2A 2BP8A 3T0AA 4BRJA 3TBVA 5MEQA 3MUHL 3UGUA 1AKPA 1QSZA 2FSEB 1Q8MA 2CRYA 4QIRA 3GHEH 5T33H 2OMYB 3WV0A 1T2QL 1PKOA 3EDFA 4JCWA 5I6KA 5T5FA 2OFQA 3SQBA 3DTXA 1B0GB 1TZHB 3CMGA 3P9MA 3O4OC 3H53A 2P1YA 1IAKB 1OAKL 1I7UA 3RX7A 1NL0L 3DO7B 4G71B 5DMGC 3V9CA 1XF5A 1NOFA 1P1ZB 2J4WL 4R97B 4TKWA 5HHVL 2VAJA 4WJ5B 1EO7A 3L3DA 1T0MB 2IMNA 1KCVL 2CNYA 3VXRB 3L4UA 1G9NC 4N2BA 3WHXB 1TF4A 3FQWA 1BW8A 5D7SL 4PRAA 5I26A 1D3CA 2DQMA 4KUZH 2WZPA 2OQJA 2DQEL 3B2DC 4KOBA 2FUQA 5K9KA 5I17B 4AXWB 3VD0A 4LL1A 4PUBL 3NJKA 1WBZB 1F3DJ 4P4RA 8FABB 2HLFC 3NN8A 4GS7B 4PJGA 4X7FC 2FX9H 5EFIA 5F8RC 1J86A 3F64A 3ML9A 3D0LB 3JTSB 4JQXC 4XN7A 3EDEA 1ZA3A 4Q52A 4UINL 3IMSA 4X4ME 3UX9B 5D7KE 4JZJB 4PTUB 3ULUE 3TVMB 4GEIA 2A74B 3O9WA 4Z1PA 4ZMOA 4CC4A 3NACH 3WFZA 3E6FB 3MRDB 4QRPD 4BHUI 5EOQL 1LDPH 3OHMB 5AZEH 5IQ7H 4XX5A 2HVJA 2QSTA 5EO0A 1Z6JT 1MCCA 4AYFA 1A65A 3VGFA 5CLTA 4MNGA 4UMSA 3LRLA 5JZ7D 3MA7A 5EIIB 1F02I 3S36H 3W2DL 1DBJH 4EN2A 5I76B 3QXDA 1UM6L 1CXHA 3DIDA 4XNAA 1U3HC 2EC9T 1RZJC 2AJUL 2F1AA 2LHAA 4HF5L 1Y7VA 5JHDB 2MRYA 2JV6A 1NOAA 5T1MB 3V5KB 1OPGH 4LT7A 4EN3B 4TM9A 4BELD 2YPVL 4J3OF 3HPLA 3LOWA 4GFTB 3F6LA 4IMKC 2VLRE 4CA4A 2BNQB 4ADGA 6PCYA 4XX1E 1UVQA 3PHOA 3DGGA 2WXJA 2NZIA 5E8PB 4LLQA 4LNRA 1Z3GL 2ADJB 3QNZA 4AEHL 2WGXA 1HEZB 4FABL 1UATA 3F05A 3VQLA 3OMNB 4G82A 4AGNA 3ZKNC 4KKCD 3M17B 1N8ZB 4AH2B 1NMCB 4DNLA 3I3BA 4KXDA 4P23B 1NBYB 1TEFA 4LE8A 3ZE2B 3GS4A 3RPBA 3QRLA 2X4PA 3BAEL 2HG5B 4DGUA 2BP0A 2VXSL 3ZTEA 3CFCL 3WYRA 4NZUL 3GDCA 4F37F 1QD0A 3WUZA 1ZSDB 2VL5B 4GB9A 2AV7A 2EH8L 2VRAA 1QPXA 2D7NA 1Q0EA 3GSUB 2LFGA 4HD5A 3IJHB 4YSTA 1U36A 1TETL 1XH3A 2EYTA 2MQ3A 4I87A 3ILEA 3SKOB 4IRSB 4L2YA 4ODUA 3GSNA 3RIFF 3T3MB 2ZAGA 4F57L 3UMTA 1I7ZB 2P5PA 5I75B 3N06B 3NA4A 3UTTA 2K6YA 2APSA 3VSQA 4AW4A 5GGSA 5KWYC 5MEOB 2J1KA 3RB7A 5D7KD 1L9NA 2DQJL 4WDIB 1OTSD 2Y36L 3MRJB 2IEPA 1FRGH 5LBVA 2P48B 4HOZA 2ZUUA 3WIHH 4KKBD 5B39A 2I26N 4JO1L 4HGWB 3VO0A 3B2MA 5I15L 1VRSA 1AKJA 3PFUA 1F58H 4OI7A 1DN0B 4WUKH 3L3KA 3IFOA 2ZKXA 1AGCA 3NSFA 3R4RA 4G9FE 5D1QC 3ZL1A 4N1HB 4B9GA 1F8TH 1RURL 4ODHH 1SMAA 4NP4H 1Q9WA 4L1HA 5DWPA 4R5TA 4PR5B 5FFOA 3V95A 3GSXB 4JO4L 3C5XA 3GXNA 2IXQA 4JVWA 5IHHA 1CVRA 3LHPH 3NMEA 3EHBD 1SVCP 4HCRL 2WQRA 2WXNA 4PRDB 4FNRA 4J6RL 4YHPA 1KCSL 1TT6A 3P0VH 5TQ0H 3RTQA 1PG7W 3TZVC 3AUVA 3HE6A 5ACZA 1M7DA 3PHAA 2YD9A 5FFGA 3AAZB 4AEIH 3IMBA 5I1DB 1EGJA 2Z6FA 1TQVA 4DO5A 1RUAH 3VTAA 4HV8A 1WBXB 3ILPA 2WNXA 3BDYL 3RDTA 5DQJA 3TNMB 2JXMB 4MNQE 3FL7A 4B3EA 1I53A 2Y7NA 4DVRH 1P9MA 2HPOA 1QG3A 5A2LH 3PP3K 4JHZA 5J5EA 4XXCA 3TBYA 3BP6A 2FX8L 1Y07A 2EYRB 3P4MA 1RZ7L 4G8GE 4NLAA 1T7XA 4UDTA 3S35L 4UYQA 3VFGL 4MXVE 2CNZA 1FGNL 4JFFB 5IVOA 4FHBD 4U0QB 2OBGA 4M8QA 3MV9D 1AZZC 1AGDA 2BOBB 4TSBL 3OQ3B 4GRMB 3DVIA 1S3RA 2GIXA 4RA0C 4NO2A 3S3SA 4A2MA 1Q0YL 5G4OA 5CMAA 4X0KA 4BH7A 1AS8A 3GWJA 3OBAA 4R4FH 1HWWA 3QQ4B 5IFAH 5FS5A 2PO6D 4PV8A 1PKQA 2D3NA 2Y7QB 3TO4A 3VMNA 3CQFA 1LHZA 1SVBA 3GMRA 3DX9A 3OR6B 3NBNA 2Q8AL 2I27N 4J3WA 1S9XB 5IVNA 4NNXB 3F04A 2KQMA 2WYIA 3FUEA 3FN9A 3ECBA 4APQD 4G80B 4Z7NF 5I8EA 2B59B 1WG3A 4N2AA 4JO3H 4NAMA 1TR7A 3LH2H 3O4LE 3UERA 4RMUA 35C8H 1JF1A 1OK0A 1TKWB 2GQHA 4PJHE 4YUEL 1ZTXL 5ESVA 4MCZA 4WJKB 1MCOH 1Q9OA 4ENZA 4NQDD 1ZEAH 3C5JB 5FHAL 2FB4H 4CMMB 5KYYA 1E5UI 1BPVA 4ANWA 4X6EA 5D2LE 5CJOL 5HGGS 3W9EA 4L8DA 3OKLA 3REVB 4K3EL 1BVKB 4E41D 4B9ZA 4P5TC 2Z9TA 3OB0K 3ARGA 3Q2LA 4D9LL 3VFRA 3SGKC 3HLAB 5DZLA 2A9ML 4EZJA 1JPFA 4R4NC 4OJFH 2GY7B 4KHXL 1M1XB 1KCRH 4DP0X 1J5OH 4OT1L 3T3PE 1E5CA 2WTOA 2DM2A 1ET8A 5GGUA 4U2YA 1X5YA 3QWOB 2H0FA 1RUKL 3CZEA 2W9EL 1TQBB 4ZMAT 4JVPA 3HC3L 4UINH 1X6LA 3FU5A 5FM4A 5C09D 2WWOA 5CINL 4DP5X 4WWID 1XB6A 4E0RA 2ZOUA 5KVGE 3FW6A 1WD8A 3FPYA 3QI9A 1SOXA 5TF1L 3ZXAC 1QVOA 4YJZL 1P5VA 1DQVA 2AQ3A 2IQ9L 2Y5EA 3MO1B 3QUYB 1ACCA 4HK3N 5GS1C 2MCPL 4LHQB 4LKCB 4RIRB 5DJAA 2GSGA 3NEEA 5JIDA 3HC0A 1TO4A 2AAVA 1UB6B 2XDHA 4GLRH 4PHXA 4TUJA 2J8UB 4M5YL 1DCLA 2Z8VC 1WV7T 2V17L 3EJSA 3J27A 3O6LL 1S8DB 2HRGA 3BZFB 4JKPL 3UAFA 3CZFB 3AG4B 1TTGA 4JG5A 1S46A 4NQEA 4I2XB 4IJ3B 5AKRA 2O5XH 4ELDA 2LTQB 1RUML 1SYSA 2Y23A 5GRVL 4RGOL 1CGUA 2UXVA 4JDVB 4U2ZA 2QGDA 4PJIB 3G6JA 3PWNA 4JE0A 1KXQE 4HJEA 1YJDL 1PLGH 5GRZA 1JYNA 4PW9A 3R18A 2ADYA 2R83A 4HSCX 2RTTA 1JZ8A 2B1HH 1X7SA 1G0DA 2N0KA 4LVNB 1HNGA 3FXIC 2E6JA 3OXRB 1XD0A 4U1GB 2BJML 5C0RH 2PYED 4M03A 4MAZA 5DURB 3O3AA 3S96A 1KGXA 4F5CE 1XSKA 3SD5A 3QFDA 1ZT1B 1UEYA 2Z35A 5GS1A 3U2SB 4W9KC 4HPYH 1NKRA 1N67A 2QVIA 3PIQA 4QXUL 4EDWL 4MX7B 1X7TA 4GBXC 2XJLA 4PJCF 2VXVH 2YLKA 3QAZC 4IRZL 4LLDA 4ZUWB 3AQXA 3KCPB 2E3VA 1XGRB 1V7MH 3FTGA 4N20A 3W11C 4M1GH 2MPAL 4DPCX 3NTCH 4YAQB 4PB9L 2XVLA 4XN8A 4O02L 5IFAL 2D7QA 4I89A 5I23A 3RURA 2AQ2A 1O9WA 3IVKA 4LASL 4Y4FA 3UPAA 1BIIA 1V3MA 2X6UA 1GYUA 4N1EA 4YHYB 3LS4L 3PWLA 4Y16B 5FW8A 5JIKA 1ONQA 2W0PA 3WEBA 1AGBA 1L3WA 4MNGE 1E2ZA 3B3IA 3FU3A 3P40A 4A7VA 2CQVA 1MH5B 1PFOA 4W93A 5KSVB 3O2VL 5BVJA 2CD0A 4HAFA 4NHUA 2XWBB 1PZCA 5AYUL 1IE5A 3UBGA 5E0QA 4CMHB 1U8KA 2R8SL 4C4KO 4JN2A 3F7QA 1UB6A 1TZGL 3HC0B 1DANT 5E1QA 2NT1A 3GHBH 1BCIA 4JX0A 4LKCA 1X5MA 4RIRA 4S1QL 4LAQL 4X4MA 5C09A 5A2FA 1S9YA 3QEGL 2EVFA 2NY0B 3C9NA 4Q6IB 1K4DB 4BQCA 2WXHA 3NA9L 2L0DA 2WLNA 1FORL 3EGSB 1CL7H 4JFHD 3WY2A 1ZGLA 4WFFE 1BZEA 3DXAB 4X8XA 1AD9B 5F1NB 2F54D 4ZZKA 3GMPA 5FO8B 3SBQA 4Z7VA 3RZCD 3KCWA 4PJ7B 5B8CB 2DYRB 2R4SH 4M8RA 4NX0A 1IT9L 1CIDA 4YHNA 2E86A 4KV5F 4F57H 1GYWA 4U0RC 3LZOA 5GGSY 3HE7D 1JD7A 4R7VA 1L4IA 1KLUB 1RL1A 1IZKA 2CWRA 1CS6A 3QUMA 4IKLA 4DWHA 5CAYB 3G5WA 2XPGB 4PRHE 1R75A 1RUKH 4YNYB 1MCPH 4PRBB 3B9DA 1NMBH 3DUHA 3GF8A 4K5NA 1I8LA 3WFCL 4PW3A 2AEPH 5L4FA 1P5UA 3U7YH 1RZKL 3OKLB 3RVWC 2O6FA 3IGFA 5A6LA 3FFCE 1IEAB 4AV4A 3VXOA 2LU4A 5EO9B 1FO0H 3NRQA 4GRWB 4DGIH 5KYYB 5F97E 5K39A 1WH0A 2LLLA 3O3DB 5ESVB 4QRRA 1ACZA 3I02A 3CQPA 4L1DA 3VQ2C 5DVLA 5FFLA 4HCRH 4Y5VA 2XWZA 1I1FB 1E2VA 4YHLH 2HFEB 1FFNA 1HYRC 1SY6A 3JTTB 4NQUA 4F2EA 1OARL 3PJSB 1G6RB 1AQDA 1D7BA 3UTSB 2PR4L 4D9RD 4FTDA 1MF2L 5AL8A 3VGAB 1MJJA 3PGCB 1OGAA 3GNML 4PGDA 4Y9EA 4NUGL 5JQHC 5D6CB 3QG6A 1U3HD 5BQDA 3TZVB 4YBLC 4S1QH 4XBEH 3SDAA 1DHKA 1U8MB 5CBAA 3ARRA 4DERA 1EAPA 1CGWA 1C7SA 2DW5A 4P5MB 2IBZY 2BP3A 3QQ4A 3NA9H 2P8MB 2XV6B 4HXAL 3GLZA 5IK3A 3QJF