2JWYA

Solution nmr structure of uncharacterized lipoprotein yaji from escherichia coli. northeast structural genomics target er540
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
168
structure length
168
Chain Sequence
MVQQSEVRQMKHSVSTLNQEMTQLNQETVKITQQNRLNAKSSSGVYLLPGAKTPARLESQIGTLRMSLVNITPDADGTTLTLRIQGESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAPASVLAPSDVDIPLQLKGISVDQLGFVRIHDIQPVMQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of uncharacterized lipoprotein yajI from Escherichia coli.
rcsb
source organism Escherichia coli
molecule tags Lipoprotein
molecule keywords Uncharacterized lipoprotein yajI
total genus 29
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1620 Mainly Beta Sandwich Immunoglobulin-like Lipoprotein YajI-like 2jwyA01
2JWYA 4C47A
chains in the Genus database with same CATH superfamily
2O72A 3SD2A 2OP4H 5DJZB 2HG5A 4AG4H 5I6XB 4DPCX 1XGYH 1AQKL 3K72A 3MJ9A 2RCSH 3PWLA 4JFDD 5DRXA 1E50A 4X4KA 1DSFL 4E41E 1ADQH 3AWEA 4BSWB 5D9SB 1AMXA 4Z8FH 3PJLA 5KVDE 4ANKA 4FFVC 3BUPA 2R2EB 1X7TA 1DJXA 1BG9A 1JMXA 1CTNA 3AFLA 1WTGT 2YPLB 4J3TA 4OIAA 3RGVB 3H7BB 2YO3A 2G9HB 3Q2CA 5FFLA 3HC3H 3GO1L 3LMJL 2YOAA 1RZKC 1H3PH 2P49B 2BP3A 5E2UH 1KB5B 4P2QB 2RCSL 2ZWZA 2Y36L 1FVCA 4LPXA 1MWAB 4WU5B 3W37A 3S3PA 2VW6A 3CFJB 1NCAL 5DS2A 1ES0B 3IDUA 4BCZA 1L3WA 5LGHH 4GBXC 3CFCH 4KNQA 1GR7A 1DBKH 2MQ3A 4TUKL 1FHGA 2YD6A 5J6HA 5GGRA 2WXFA 2DKMA 1X5FA 3FL7A 4JFSA 5FLUA 2YWZA 5T1LA 2NSQA 1R24A 1OXYA 3HZYA 4DQOL 1YEGH 4O58H 4BKTC 2DV6A 3EBHA 3W56A 4M7LL 2X40A 3UJTL 3LQAL 3HG0A 1I75A 1VIWA 4PP1D 2NSXA 1DBML 5EOCH 4UT9H 4XP4H 5E7FA 3VDBA 3TC9A 1EDHA 3BUBA 4OZIB 1NGYA 1I85A 2HKFL 5ICYB 3ARFD 4M8QA 5A2AA 4H44C 2Z4QB 1BQLL 4TNWF 3MRIA 3F04A 3HJEA 3U0WL 1KCRH 5IOPA 4LFHD 3KPRE 3G6AB 1A7NL 4NO0A 5JYMA 1XGQA 3ZX1A 1S78D 2F53D 3CFKB 2GAZB 1LXMA 2IAND 3OLDA 4RFNC 2OTPA 1F3DJ 1CICC 4I4WB 5C7ZA 3NOIA 2X4PB 4PGCA 15C8H 4IGBC 3VCLB 4UAOB 1WK0A 4XC1H 2BOBA 2YBGA 1CS6A 4YDNA 5IHUH 3UEZA 3ZKXC 1ASQA 1A6UH 1HVXA 5BZDB 1U8JA 4LEBA 3Q2WA 4XVOA 5D1XC 4AL8H 3IYLW 2JCCF 2AGJH 2AQRA 3AWFA 5E8EA 2GJJA 1C5DA 3AMLA 1MRFH 2V5TA 1MCKA 3OB0K 5JORA 4X9HA 2ESVA 5EUOB 2WLIB 1EK3A 1Q9LB 4FHBD 1JG9A 5AVQB 4RISL 1LE5B 4QRQA 4EDXB 3N1QC 1WC7B 4JRXD 1RPKA 3BYYA 4WY7L 3ARWA 2A5UA 4PS8A 5JR1L 5J8OA 4J3OG 4WO4D 1RK0A 4LASL 3QFDB 3PS6A 4A1RA 3W0WB 1CZ8H 2YMXH 2O5NA 2EEXA 3DURA 3KD4A 5FFOA 4MWFB 5FYJH 5A6MA 5DJ2A 1NC2D 5D7LB 5ID1A 5J1SC 2P8MB 4XPGL 2YZ1A 3HI6L 3IGFA 1RMFH 3MCYA 4JGMA 3GEWB 5SWQB 1OK0A 3KDPB 4D7PA 3ARYA 1JPEA 3A21A 2F5AL 1CR9H 1NCDL 4L4TD 2JLLA 3RIAK 3ILEA 2AQ1A 2RB8A 4R0LB 5D1XE 5I1JL 4ODSL 5F70A 3WKPA 2VLLA 3PQYD 3FS9A 3NJMA 2WZPD 3TO4C 1K6QL 4KMLB 1C7TA 3GB7B 1FVCB 3HN3A 4TSBH 2VXSL 4A67A 2FHBA 3MOQA 4MSWA 2VDRL 2NW3A 1SXAA 4IEFA 4LLAA 5ADPH 5BW7A 1MRDL 2GTWB 3O3AA 4X2UA 3ZL4L 1FIGH 2IJ0C 3MV9E 3S36L 2LU3A 4PSPA 4FADA 3TJPA 5FOJA 2X53A 1WHOA 1E9QA 2DEYX 3VXRE 4MQ7B 4U6VH 4FXLA 1FBIH 3HBQA 5I8KL 2IOIA 1INEH 3T0EC 4K7FA 2CHXA 4GRLD 5KSBB 3HZYB 1CT8A 3RI5F 1OAQL 4K55A 3AGVA 1TO4A 4RISH 4R5XA 4WI9A 5FYKU 2ATAA 1FRGH 4HMDA 5B1KA 1IEBB 3FU9A 3KHQA 3UAAA 1ZVSA 1R1CA 5I6XC 3QYCA 1TPXC 4G43B 4FNUA 4HQQH 2AEQL 5CINL 4N8CL 1DBBH 1PX3A 1N70A 3WOVA 1A4JB 4JZOB 3GNML 1T66C 1JPGB 2R1XB 3SDDC 4GFTB 3U0TA 2Q3ZA 4FABH 2HKFH 5CUSH 5AZ2L 3RU8H 3S96A 3ZYIA 4G2AA 2L7QA 3G6AA 4BRJA 1U8KB 3VE0B 5IJDC 4N2MA 4J4PD 1I8KB 1R5WB 2A6JA 4ZNEA 2QZQA 2CKBB 1M7DA 4JJ5A 1TTAA 5DRWA 4YE0A 1S7VB 3BT0A 3DBXA 3P4OA 4KAQL 4XCFL 1KTDA 4L05A 5FYJD 3KPRB 1RIUH 4IW4C 5DD6B 2ICWI 1XSOA 4HBCL 4QRAA 1UACL 2KQNA 2VLKB 4GXVH 3E1ZA 3WS3A 4Y4HB 4LCUA 2B0SL 1EDQA 2FYYA 1CUOA 4X7SL 5F7AA 5BV7H 1A6UL 5CEZD 1RJLA 4X5PA 5JPMA 1N7ML 3AXLA 1N67A 1T6VN 2YK1H 5JIKA 3ESOA 2LE9A 3L7EB 1ZSDA 4NP9A 5DQDL 2QDWA 1MNUL 1GGCL 2Y25A 3A4FA 3MV8D 2DM4A 5EBLB 1IAOB 1J5IA 2LGNA 4AIZB 4EDWL 4LRIC 1H6UA 4WV1A 4QRQB 2YKLL 4EDXA 2KZKA 3QG7L 1BLIA 1AC6A 4KHTH 3RNKA 4UAHA 2Z31A 4MXQD 5GRUL 4AGQA 3HG4A 3BUDA 3HJ0A 2WBJA 3NSCA 4PRPE 1WV7T 3C9NB 5I74C 4ZOCA 2QKIB 1FC2D 1KCBA 4NRZA 3LZLA 3L45A 4Z7UF 1GZHC 4YFLF 3KYNB 5CZRA 2C9PA 4YAQA 1NGWB 2UXGA 5SWQA 2ICWA 2CIIB 2GT9A 3A67L 4PLJC 3K8LA 1USZA 4HS6A 4G11A 3VSVA 5LLIC 4P2QE 1RKRA 2BVYA 2G2RB 5DA4A 5IVZB 3MRRA 1ACYH 1CLYL 4BBWA 1IBZA 3F6LA 3CC1A 3H9ZA 4JHAL 2Y22A 3BP5B 3HG2A 3KW7A 2BOCB 4N0UE 4NC2B 2B20A 2O6CA 3HRPA 3AC0A 4POZC 5CO1A 3AITA 1QOKA 1JPSL 2XN9D 4GMSH 1E4KC 4D3CL 1UJ3B 1YY8A 3HEIB 2ICCA 1CLZH 3EGSB 5D7JD 1OY3B 1EHKB 5IEKA 5CILH 4OF0A 5T1DH 5E00A 2VXUL 3OR7B 3WKNA 2VUKA 2X4OA 5F1IA 2CJUH 2WM0A 1J10A 3GIZL 2DLEA 3A67H 4XCNB 4C4KO 1JGLH 1A6VL 5EDSA 1L0PA 3RI5K 2P80A 5DC0A 3H2QA 4AY0A 4N0CC 4ZQKA 5ETUA 2L7JA 5TFSH 1S5HB 3RWGB 2XYBA 1XF5A 3L16A 1XB6A 3X1EA 1GHFL 5MEOA 2DM7A 3WG7B 5HYSB 1C5BL 4GXUM 5GS0L 2YC1A 1BCIA 2DJSA 4ABWA 2EYTA 3GD1C 4AK1A 1Y18B 1RI8A 4NZ8A 3BD5A 3FU5A 2O5ZH 1ODUA 1XTLA 2VYRE 1P4LA 3CDYA 4AMKH 2ZUUA 3P4NB 5ESQB 3K1KC 2WIIB 3DPBA 4X80L 2DQIL 1MRCH 2WTPA 1XHHA 3IB4A 4TLKA 3H7BA 3EYSH 2BNRD 1U93B 4GMTH 3EO9H 1NWOA 5I16B 1RULL 4J1UB 4JB9H 3FOLB 3C8KA 3KPLA 3ULUH 2WK2A 3DK2A 3K4AA 4KKCC 4LESA 3GJFA 2CALA 3NDYE 3NIGF 1CLZL 2JXMB 4ZODA 3BRGC 3NSJA 5DLML 3MFGB 4OGXH 3GMOB 5ANME 1GGIH 4GKSB 4DH2A 3PFUA 5KW9H 5CGYC 3N04A 5ESAB 4NQCE 3ZDYB 4A6YH 2H2PD 2O5ZL 5D7IB 5I1DA 5KJ4A 2WBKA 4EN3C 4BV1A 3VRLF 4KV5F 3SKJH 4PV9A 5FK9A 4KRPB 4C57C 3FFDA 2XC8A 2VDMB 2RGSA 4XP6L 5E1AA 3OAWA 1IGML 4DN4H 3MUHL 3V5HB 1CGSL 2CPCA 2FJGA 4EBQL 1EGJL 5B3NA 1IM3D 2GK2A 2ICWB 4UM8A 5FF6B 3RAJL 4S1DD 3IN0A 4M8QB 5FYLH 5CIPA 4ZFZA 3FQ1A 4PRNA 3LEXA 1IGCL 3WS6C 5KW9L 1E4HA 3LH2H 3TVMD 1JYWA 3TIEA 1QSEB 5EBMB 3QXVA 4X8GA 1FO0B 3FQTB 2F8XC 4KTYA 2PNDA 3KPNA 3LNIA 4UZSA 1KN4L 2P46B 4B97A 2R29H 1E42A 1UADC 3TZVC 3VXRB 2P43B 2GSGA 5ERWB 1PTZA 1FL6B 1OGSA 1J0HA 5FA4B 4PJHB 3CXHK 4M8UA 5BV7C 1IBDA 4UWQB 2PWDA 1MJ7H 4F80A 5KVGH 1EMTL 1UWYA 3IJHB 3DSNB 1H15A 4LPVA 1I7TB 2DQHH 4TLTA 4DKTA 3PWPB 5D7LD 3S4SG 5IB3B 4JY5L 5HDOA 4FI7A 5KSUA 3PHQA 1RK1B 4BQ9A 1E4WH 4LB8A 4NQEA 3LKNA 1F4AA 1WFMA 1XCTA 2QPUA 5E8DL 4QCIA 5EIIG 4PJIB 3KWUA 2D9CA 2R56L 1ZOXA 2EIMB 2ZUYA 3AY4A 4XX1G 3EJQA 5D7LE 2NQCA 3W39B 1E5ZA 2NR6D 3I9PA 4XB7A 1ZXQA 4P5MA 1I8IB 1DDTA 4WZ9A 5E08H 1O5PA 4OM1H 3FQRB 3SJVE 1WITA 3QHTC 2K4AA 2XSKA 4PJ7E 3GJFB 4JHZA 5EUOE 4PD4J 2ICEB 1ZT7B 4I2XB 2FGWL 3MFFA 4HCFA 1XF4B 4LKXA 1NGQL 4RGOH 1Z0NA 5CFHA 4GIAA 1DLFH 2CO6B 2EIBA 1UA6H 3GMMB 4MAUL 4P9MH 3IEAA 2ZAGA 2FQGA 4X4XA 4OLYH 1JL8A 3EJTA 1TTFA 2FJUB 4QO1A 3FN0H 2GC4C 3G5ZA 4WW2C 1QFWI 2OSYA 3QUYD 4JFZL 3QXDB 5HGAB 3SPIA 4CAGA 1QEWB 5AWNH 3CN0A 3K4ZA 5AOIA 3VFUB 2O5YH 5SX5H 4N8CH 1CG9A 3R06A 4HQQL 4FYQA 5JHDB 2NY3D 4P49A 5J3HC 4ETQB 1TCMA 3HOGA 4NQEE 1FDLL 1IKFH 4MA8L 5CHNA 2WYTA 1QLEH 4H5SA 4B41A 2E7LC 1LP9F 2HLFC 5HHNB 3UTSD 5F7UA 2PWGA 1KGYE 4U6HA 3ROLB 1AOHA 5IQ9A 4R4ND 2GPZA 2UYLB 1IX2A 1RZJH 1Z3GH 2XBTA 5TF1H 2CK0L 1U8KA 3EOAB 2AEWA 4FXGA 1NC2A 3VE0A 4EI5A 2B15A 4LVHB 1CXFA 1KPRB 3TVMC 1RZIA 4TV3A 4KKAC 2MOVA 4JFZH 2VDRH 3MRNB 1HSBB 3L3GA 3ARED 3CSTA 4MAYC 4F58L 4HJEA 3LPGA 4QT5B 3S4SA 4LCUB 4HS8L 2WUCL 2ESVD 2H41A 1SN2A 1T04B 3FO1B 1RJLB 1FDLH 1HH6B 2MWCA 1UA6L 2KZ1B 3PABA 4B3VA 5HXMA 1ZA3A 1JZHA 2VABB 1F1GA 1TTUA 1MFEL 3DECA 4W6YB 3CN3A 3LKPB 4ILDA 1J86A 4OB5L 3RWCA 4RGNB 4ACTA 2JI1A 2P5WB 3UTTE 3VRJB 2AJXH 2APVA 1PCXA 3HE6B 1G9MC 1I1CA 1RZPA 1XGUB 1ZS8B 4U1NA 1OTSD 3TEYA 3MCKA 4IHOA 3GZPA 4IK6A 3ZZLA 1BA9A 4XCEB 3MRDB 1TQTA 4O2FB 3T2QA 4FYSA 1PKQE 4KVCL 4CGTA 4G6MH 4OVUA 2W60B 4YK4B 1CI3M 3V4LA 4JFEB 2PW2A 3N3EA 4P5TB 2AXWA 2KL6A 4JFVA 5I8KH 2VR3A 3F12A 5F6IB 3UYPB 4KKCD 4JG5A 5IF0B 1TPXB 4QLWA 2EXTA 4IBLT 5AKTA 3TGXA 1IM3B 2N4IA 2DD8L 2XIDA 4M61A 4XMKH 2XHNA 5HDBE 4FQXD 3LAFA 1BQSA 4GEIA 4PGCB 3KBPA 3EXJA 4ZUWB 2APFA 2GQHA 4LLMB 43CAA 3KEDA 5CAYB 3N2JA 4HAGA 3HN8A 32C2B 2EDHA 5D4IA 2J5WA 1K2DB 4PJ8D 5HYJD 4G8EA 1EHXA 2WUBL 4EZMA 2HFEA 3VYPA 2E75C 1M9SA 5GRXG 3MRCA 3O45B 5C08D 2C9XA 4ODUB 3QJOA 3VRIA 2PO6A 2ESVB 5C3LD 2NY6C 2Z91A 2VR5A 1JZ8A 2QELA 1A4KA 3ECBB 2VLRA 2CG9X 5GS2D 1QFPA 3X13A 3RVVD 4HIPA 4CC4A 2YN3A 4P2YA 5DD5H 4BJLA 4DP7X 5FYJL 5DLLA 1Z9LA 1HHGB 2CWRA 2XY2A 1GH7A 1ZK9A 1HYSD 5IBUG 4M4RB 3ZTJG 1MEXL 5HGGS 2QGCA 5E2JA 1FVEA 4WFFE 4AEEA 2A9NL 3LH8A 2BP0B 5E51A 1OM3H 1TNNA 5DHVA 4XHJC 2R27A 1WBYB 3ROLA 1FNAA 4GRWB 5E6RB 4G7VL 5IROD 1INDH 1RHHA 4F92B 3QSKB 5AENA 4TTDC 4JY6B 3KPQB 3OQRA 4JHWH 1JGIA 4MX7A 4OI7A 1WA1X 5JDJA 4R97B 1ML0A 2E27L 4QF1B 1HHJA 4OFYA 4LSTL 1J8HB 5IQOA 1KT2A 4I0PA 1U6AL 2P5EB 4HFUH 3NJLA 4L4VB 1LEIB 4QRTA 4OZFH 4FXKB 2JQAA 4OI8A 4Z7WA 2FT6A 1WBXA 2VITB 5BQ7A 2HJLB 1YA5A 1F1AA 3FMGH 5DHVH 5JZ7C 5IQ7H 1MFBL 5F0PB 5KVEE 5K93A 2WNKA 4W68A 1GMEA 1BZQK 1VDGA 1XD0A 2FIKB 4NKOA 2V3DA 1A7RH 3TM6A 1G5AA 5SWZB 1JOIA 4Z0XA 3RGVA 3VD7A 1NFDF 3E2HB 4YQXH 4PJFB 5CJ5A 3NBNA 4WI3A 4HPYL 4JHAH 4WV1C 4F3FA 5E08L 5AVSB 2O6DA 1SY6A 3TJHD 2W81C 1W8NA 4NZRL 1XGUA 4UDTA 1XEDA 1MJUH 5HYJE 4XCEA 3B7UX 3BHBA 1PZAA 4F5CA 5ACZA 1YY9D 1R4XA 2R1XA 3APCA 4PCYA 1HH9A 4ZS7H 4WK4B 1MZZA 3RL2B 1X5KA 4IU2B 2WP3O 2OXHA 3G9AB 3MTXA 2B39A 2ZXEB 5EEXA 2J8UE 3ZBMA 3WIFA 5LO7A 5HYIA 5I1KL 2ZWSA 4TUKH 3B9AA 1AMYA 1BEXA 1I8KA 4ZX3A 2WN3A 2P7TB 1F3JA 5DRWB 3BDYL 1KLUB 4W70A 1YPZB 4G5AA 3VX0A 3FO2B 1CD9B 1QSEA 3KPRA 2YEZB 3I2CH 1ZGLB 1Q0EA 1R5IB 3HW7A 3RHWF 1JZJA 2VDOH 5IFHH 1R3LB 5J0BA 1KGCE 2P47B 4MBRA 3SDAB 3JTBA 1CZ8L 2VGLM 1WLHA 1S7QA 1N6QL 3EH3B 3BKJL 2COQA 3PP3K 1GGYA 2EDBA 4MAUH 1XIWB 4P9ML 5J5EA 2AQ3A 1G9HA 5DJCB 3KCPA 1Z5LB 3OAYH 4N3UA 3WUZA 4D8PB 5KBPA 5DC9B 2ZOUA 2WLYA 5TE6L 1UJTA 1NEUA 4YQXL 5DMJB 3DRTB 2X0VA 3RNKB 1G9NL 2I9TA 4FHJA 2ESVE 2W59A 3SD5A 3NJHA 4Z7QE 2HX8A 2AI0H 2J44A 4PUBH 4M4RA 5J1TC 2R23A 4I1RA 2MH4A 2GITB 3ME0A 1A3RL 2AQQA 5EG6C 3N1FC 1NPUA 2B5IC 4KI5E 4XN5A 1PG7H 5D2NE 1OF2A 3AG4B 5DT1H 3G6DL 5DWPA 2IAMA 2VDLB 5L8JB 4ZRGA 4DIXA 3MC0A 4DZBA 2DWDA 4WW1A 1NJ9A 5D2LA 1YLBB 5ISZB 4FLOA 1WC7A 2WVTA 4OQTL 4HEPA 5BS0A 2V7HB 2KQMA 5I6OA 4PB9H 2QPFA 2F7PA 1KXTA 1JZGA 1TO5A 4FDWA 1NCCL 1OAXH 1T1YA 3NJIA 2NLJA 2H8PA 2W0FB 3KCWA 3LRSA 3KLLA 4JS7A 4KUZH 5HGDB 3CFQA 4UQCA 5AW9B 4C4UA 2DBJA 2N0MA 5IFHL 3RJQB 5DYFA 4DK3A 3CPUA 4I3SL 3ZE2E 3PJSA 4LPUA 4G71B 1AIZA 3C2AL 1X4YA 4NKMA 5CR8A 4WNQB 3DRQA 5CM1A 2LV4A 3QUZD 2PCPB 5INCA 4GKZB 1K85A 1VGKB 3P9MA 4KDTA 5DJ0B 4X4XB 1MCJA 1VFAA 4S0HA 5FYKH 2OCCB 4M6MH 4XCFH 3MLPA 1EIBA 3QISA 5I1HL 4F7TB 3OKLB 2ZPKL 3ABLB 1KB9K 4CSTA 2MCPL 1W91A 1CD8A 3SJVD 4WWKA 5AW0B 5D2NA 5IR1A 3BH9A 1L7TH 2R29A 3MRKA 1YJDH 4IS6B 4KVNH 3O4LD 2XWBB 1UH3A 3ARDB 1KJMA 2OQJA 2VMJA 3BKML 4HPHA 4NO5A 3T8XB 4NC1E 4E42A 4MNHB 4PYHA 5HHVH 5K9OB 3X1FA 1A0QH 3K74B 4AJWA 5JXED 2ZKHL 2NY0B 4C47A 4NKQB 4XNXH 3ATDA 1RZIB 2PYEA 3CQQA 4OGYL 1XD1A 3T1FA 3P0GB 5JPNB 2V17H 3JWDC 4JO2H 3QUZC 4GAYA 4Y2OB 3DETD 3RVUC 2X1XR 1GYVA 2AS5M 2JJTA 3SGDI 3V6OC 3WL9B 2I85A 4N9GA 4MMYB 1T04A 1R3JB 4U7MA 4XRCB 1F8TL 3RDTC 5JHLH 4XO4A 2VO5A 4PV9B 1XBRA 2TAAA 4IKIA 3NIFB 1KTDB 2NXYC 1ACYL 1IZKA 1UHVA 2ZIDA 4X6DE 2DQJL 4X4MA 4YSOA 1IMHC 4Y7OC 4YSQA 5CEXA 2Q10A 3VFGH 4TSAH 5HJ3B 4GQ9H 1AG6A 3MZGB 2H3NA 1J0ZA 3VXMD 4JZJC 3KGUA 1RIHH 4O2FA 2PXYD 3N6YA 5L2KD 1MFDL 3PP4H 4X7FC 4OTXL 3ULSA 4F2MA 4M93C 1LEKB 4U6TA 5CIPB 4ZFZB 3ESMA 1IAOA 1IIIA 3MGOA 3CZEA 3PF2A 1AKPA 3B3IA 2Y1ZA 3C60B 3TLRA 4D0CA 5F88B 5MP6H 4LSUL 4KAQH 3MREB 5HDQL 3KPNB 1Q0YL 5DZOA 3Q8AA 1VERA 1ZLWK 3L3HB 2EIEA 4G6JH 4RA3A 5MEPB 5IQ7L 4FFVD 1NWPA 1FNEB 1ZHLB 2FWUA 3PREA 2WXRA 5HHVL 4JFTA 2C9RA 2JLPA 4PG9A 4WCYL 3K2IA 4L48A 4NN6C 4LU5L 3K80A 3DWTA 1G7HB 3X12B 2YUXA 2BOCA 4WWOA 3UBXB 1MHHB 2CD0A 3D9AH 4D0BA 4AV0A 5I19L 5B1AB 1QHQA 3L4WA 4RDQF 3RWIA 3FSVA 3EZ8A 1ETJA 4MCZB 2A9NH 1Z2KA 1CDIA 3FTGA 3OR7A 1U3HA 5HD8D 1IBBA 3G5YA 1BQRA 5C8JB 1J18A 3PU7A 4GT0A 3QIBA 4DF9A 5I30L 3TU6A 3DGGA 3IWVA 4M3JA 4GUOA 4Z23A 1O7SA 4IRSC 2IMMA 1JTOA 3ARDA 1ZLDA 2OZNA 2IDCA 4AVKA 2OK0L 3OD3A 3GEFA 3ARDD 3V0VB 4FXGC 1GPOH 4YSPA 4FG6D 3WNLA 4MB4A 4BA8A 2UX7A 4RSVA 4XMPL 2AJ3B 5EU4B 4OZFB 3U82B 3K46A 1IT9H 2J12B 5FW8A 4V1DB 1KEGL 1NKOA 4PP2A 2WUBH 1RERA 4B9ZA 5A16B 5I1AB 2XFXB 5DS8B 3W81A 4O9HL 1BYNA 1THAA 3U46B 1BAWA 3B5GA 3F01A 5BVPL 3FTXA 1RZKL 4U4BA 3V6FA 2V2WB 2QVMA 1ZT1B 3HNSL 4TVPD 4RZKA 1NUNB 1SDDB 4PLKC 1C08B 4PJ7F 2Y7QA 4JR9H 5DWUH 43C9B 4KZEH 1ZANL 3MUJA 5GZNC 5T5NG 3VMNA 3UBXI 1RIUL 4UM9A 3MRJA 4YZFE 1LILA 1M7XA 1NFIA 4IIQA 1A3RH 1S9XB 2WMPA 2UZPA 3PV6A 1AVAA 2F58L 4JRYE 3RUGF 1BX2A 5J9PA 5DZAA 2BK8A 3VXUE 3FSZA 4X6EB 1OEZW 3I9IA 4PS7A 2EVHA 3EADA 5IROC 3ZOAA 3FF8A 3IDMA 4ZT1A 2OMYA 5MEND 4AQAA 5C7XH 5C0AB 4MJIB 2ATKA 3MMEA 1NC2B 1MFCH 4Y1AA 5I6PA 2OM5A 1RZGB 2BCKB 1YDPA 2G5UA 1I3GL 3CSGA 4LVNB 4OZFG 1U95A 3CTTA 4QY8B 3CVCA 1KLUA 5C09A 4F7EB 3UO1L 1SLVA 3HLAA 4FLHA 1B0IA 4OKVA 4NQDA 4QHPA 2TRHA 4XVJL 3DTXB 2WIMA 1MFMA 3QIUA 3JV6A 4PREB 1JCKA 2XU9A 1JHTA 1YYMH 3D2UB 2IEPA 5EU5A 3SDAA 3T8MA 4U6VL 1EHLL 2OKMA 1S7QB 2WLMA 4GSUA 2R2EA 3M7OA 4KNTA 4NQSB 4GB9A 3ULVD 3E7JA 4D7BA 3MJ6A 4RIRB 2VC2H 4FYTA 4UTAH 2MPAL 5CJXA 2FEDD 3TIEB 5E8PA 1G7HA 4UOQA 5FGRA 2UY7B 1KJ2A 3CBRA 5ECGA 3DV4A 4DERA 1UD2A 2EEAA 1J8KA 4KKRA 5JYLA 3QJTB 3FTYA 2ICEC 3QUMA 3AXHA 1Q0YH 3US0A 2FECL 3UBXG 1M7UA 1M1SA 2X28A 1TEFA 1BGXH 4HUKB 2X4SA 1KULA 3HPLB 5KZCB 1AAJA 1JP5A 1L0QA 5FYJE 3VXUB 1D7DA 4P5TA 1RZQA 4X9IA 1Q9WB 5DUBA 1NCHA 1DQMH 4KK5C 4EJ1C 1IBYA 4WI6A 2EO9A 5I0DA 2N7BA 2CLZB 1MRCL 1NBVH 3NFPA 3WHXB 4RSYA 1TYRA 2FWLB 3NP3A 4XBEH 3NJJA 3HG1D 3BGAA 1U8MB 4MDJA 3QBTB 4WWKD 5JDSB 1OTSC 1WIOA 4WO4A 5K59E 2V8MA 3IDXL 1GZPA 1V10A 5I18L 1BMWA 1PD6A 3NCEB 4NM4H 1UH2A 3BGMA 4PJIA 5BOPA 4RFEA 1EO5A 3UJIL 2EAEA 1XVSA 1W0VB 1FZMA 4ODUA 3VRIB 4RZCB 3QG6B 2UZYB 2VMEA 2OSLA 4K3JH 2W95A 4XBGA 1J1XH 2P3YA 2PR4H 3JWNH 5C0CE 4BUHA 2XLLA 4PJ7A 4KTEH 2VR9A 5HVHB 3VXRD 1AE6L 3IF1A 2ADFL 1QUNB 4MHHI 1LL1A 2BFVL 4IIQB 5E8OA 3CMOL 4LPWA 2J6EH 4UV4H 1AY1H 4DVBA 4EO5A 4BFBD 5EZJB 5F7MC 5T5FA 3PNWA 1B0WA 1JF1A 2IH1A 3D4GA 3MRMB 4J3OC 2V5RA 3IMWA 2YPLD 2CBQA 1FE8H 3FZUD 4P2RB 4X7EC 4XP1L 3FN9A 4PD4K 3S5LB 2FIRT 4B53A 2J56A 1XCQB 2P5ED 2NZ1A 3KVDD 4NWUL 2HLFD 4KVNL 3ARFA 2WLIA 3KL3A 4G8IA 4OF3A 4HHWA 5E6UB 5HGHB 3QAZC 3MRKB 2A6IB 4OZHF 2VZOA 3FFCB 4FQQB 3QXDA 1UXMA 4O02B 4M02A 5CSZA 2CRYA 1KT2B 2IMNA 4I0PB 4AH2B 2QQLH 4AYID 3WTTA 3JUYA 4LCVA 1MWAL 5C0IA 1JFQH 4HA1A 1IIKA 5J06A 1LWRA 4P57A 3DSFH 1I82A 2O5XL 1RVFH 1ILUA 1EVUA 4NM4L 4R4BA 3SZ6A 4FQIL 1G7LB 2WN2A 3BE1H 3DJ9A 3GS4A 3TA3B 5LQBH 4L2LA 5B22A 3KPOA 5IQ9B 1BF2A 3F84A 4WI0A 3RZCC 4PJ5D 2VERA 4PAZA 5CSGA 4QMEA 5DUMH 2F68X 4UQIM 1KPUA 1FORL 1CK0H 3E3QE 1CQYA 4IM8A 4MNGE 1P7BA 2ALAA 3T0BA 5KBDA 3CD4A 4M1DH 1AE6H 4Z7NE 4MXVF 3JV5A 5D5MA 2Z8VC 4GNKB 2PETA 5FKPB 3S7GA 4NUGL 1SHXA 3QJHB 2LLLA 4N8UA 4EN3A 2H3NB 2ZICA 3KPSE 4F7PA 2Z8RA 4XP1H 4B9GA 1FH5L 1P2CB 1INQA 4U1MB 2IANE 3DPDA 3BQVA 4FQXB 3FFCD 2EE0A 2NY0C 2Z65C 3LNHA 3X14A 1TMQA 3MUGA 2H2SD 2ORBH 3PUUA 5F96H 4N2DA 2IDSA 3I6GB 1NOAA 3BVXA 5CMAA 1KYOK 1ZE3H 3IKCB 4F7MA 3QR0A 1DSFH 4G1MA 5JNYA 2ERJC 4NZFA 1QLFA 4WI5A 3INOA 5KSAD 4BYHA 1OB0A 3MRDA 4IQHA 3MVSA 1BQKA 4CMMB 5C0CD 4OGXL 2JI2A 2I7OA 5I15H 3U0TB 4PRAB 1DUYA 1TFHA 2ZSVA 2PW2B 1DN2A 2IGFL 1FZMB 2V9UA 1Q9OA 5E99H 1CDHA 5DJCA 4RAUB 1QR4A 3UYPA 1OM3L 3V4UH 2CIKB 4B9FA 3RTQA 1IAMA 1Q1PA 2ZWNA 3P73A 3SEPA 4MMXA 1UQSB 3BWUF 3TZVA 4MZ3A 4F9LA 1FBIL 3VSTA 1VCAA 3HMWL 2FSEA 4G5ZL 1KIQA 3DOHA 2E9WA 4K8RD 3OBAA 2GC7C 1F90H 3WXVL 4HIJA 4HW6A 5F7WC 3GSOB 1QBLH 1G6RL 1N59B 4JAMA 4LARL 4H26A 1YN7A 1ZPUA 3HE6C 5L4MA 3UDWA 4O2CA 3OMIB 4OTXH 4O5LL 1JWUA 3FTSA 4KKNA 5JQ6L 5MERB 3BD3A 3K6FA 1UD6A 2AXGA 3AT9A 5L6YL 3GRWH 4URTB 3QAZB 1H0DA 1KG0B 2JTYA 2VH5L 2BY3A 2CR0A 3GMRB 3DX6A 3M88A 5DEGB 4K3GA 2JKXA 5LAPA 3GM8A 1O9VA 3V4UL 4XMLH 1KN4H 4H0IA 3VFMB 2FLBT 3CVHL 1NANH 2CDFA 4YLBA 3GHPA 4Q9RH 2FD6L 2GW5A 4BWWA 1NMAL 1X44A 4IIQC 1MCQA 3MJ7A 2YMXL 2OPCA 4RMQA 2EO7A 4JFDE 3L6FA 4FD0A 1QSFB 3II3A 5IBLD 2K6WA 4KK5D 1IKNA 5D4JA 5HDQH 2PO6D 5MEQA 1Y7VA 4M56A 4G9DB 5TPWH 3QDGD 2W5PA 4L4VA 4AK2A 1CPUA 3N85H 3VFOA 5GS1B 4ANWA 1WBXB 1DJZA 1V27A 1O75A 3G04A 2HRLA 3ASNB 3TV8A 2VB5A 3VACA 3WBDA 1E7UA 4YDVB 3ZKSD 3SDAC 3FN3A 3U1SH 4G7VH 1VF5C 3EO1B 2XWBA 5D1QD 3W2DH 2FEDC 3DVNB 3VI4B 5I1CL 3AACA 5FO7B 1AI1H 4JRYD 5K1VA 4L8BB 3KH4A 4DQOH 3CDFA 1GY1A 3ULVC 4ZQKB 5ETUB 3SE4A 1B88A 3LIUA 1DJWA 3B37A 4AVIA 2EE6A 3EOYG 3PV7A 2QKIC 2R29L 1U95B 1LO0L 3L3KB 4LCYA 3L3OC 3B34A 5H8DA 4N85A 4XXDA 2YC1B 2W07B 2F54B 5B7EA 3D25B 5I73B 1AO7D 3QS2A 4AT6A 4E41B 2CK2A 2LOEA 1MH5B 3LQAC 1M9WA 2NCMA 2CO3A 5D8JH 5DMYA 1YG9A 1YPZA 4YPJA 1G7IA 2PKDA 4Y1TA 4D0DB 4LPCA 3IBOA 1DFXA 1YPZE 4NB7A 4QHMA 1KJ2B 2FBOJ 3AU1B 3G5VB 3E2HC 1OP5K 2VDPB 4WNSA 1H3VA 4N26A 3L3OB 2DQUL 4G5ZH 3VXSA 3MRFB 4I77H 1C12B 1MCWW 4BZ2H 3VGFA 2GKIA 2XWEA 5DC2A 3B7RL 4GKSA 1OT4A 5GZND 1LEKA 2AK4A 1DE4B 1I1AC 1ZS2A 4PLJD 4XMTA 1MFAL 2WBWB 2EO1A 3ES6B 4FQHB 5DYOB 4BFNA 4L23A 4UTBH 2XWJB 1MOEA 4O02L 1BWMA 2N59A 2JIXB 4RX4A 2FL5B 4ZAKA 4HWBL 3RIFF 2BVPB 1TQBB 5JHLA 4TLUA 4MCYA 5JW5A 2JCCB 2BWIA 3QDJA 3HFMH 1V3JA 5C0EB 4I48B 2OULB 4PJAE 2VKWA 4X50A 1H8SA 5HY9A 3HCVA 2W80C 4GP5B 2VLJE 1CD1B 1IFGA 4GT7A 1JPTH 1W0VA 1EZSA 1F6FB 1PDKB 1S3KH 4YBHA 2OMTA 4U2YA 3MUY1 3DNKA 3SGKA 4KH9A 1GGIL 5DDHA 4IRSD 1T1WA 5MEQB 4O51A 3MLVH 4ADIA 4KH2A 2GJPA 4S1RH 4DVRH 1CIUA 1M2VA 4FULA 1BYOA 1RK7A 1CDUA 4DFHA 5ERWA 4A68A 3CHRA 2YSSB 3U6RA 5B3JE 1MCOH 3PAUA 4NQTA 4AXWB 2DTML 3DUSA 2DI8A 4GUCA 4ABVA 5ABZA 1XH0A 4LSSH 3RVTD 5J56B 3UZQA 1R3KA 4Y4KC 3L48A 4H8QA 1JPTL 1RUPH 1USQA 4FLSA 4ESKA 3PWJA 2YXWA 3L9RA 1JGVL 5DVOA 4NKDA 5IQNA 3RPIA 4PB9L 2NR6A 3ZKND 4NZRH 1XGTB 5C08E 3B1TA 2D2CC 2XQBL 3LKNB 4Q6YA 3SDXB 1ODAA 4JKPH 4HKBA 2HVJB 1JNNL 1U42A 4FI6A 4XR8C 1P1ZB 4XX1E 1G6RA 5FCSH 4YDJB 5HYQB 4KOBA 4R26L 7FABH 5LB1A 5CEZL 1KOAA 3O6FB 3U36A 2NXZB 4E42B 2V3EA 5EORL 2Y69B 1ETZB 5DHYB 3QFJE 3FPXA 4WFHD 2R8SH 5DK0A 1RIVH 4N2BA 4PRDB 3RURA 2AVGA 2ICEA 3MRFA 4NLHA 4NQUA 5HHOE 1AGCB 3O4LE 3BKJH 5DFTA 4HIEA 1MHEA 4H0HB 1X5HA 2NXYD 1EFXA 2H26A 4N9GB 5T3XD 3U2IA 4ZUSB 3NIDB 5F3BB 1AXSA 3JWOC 5SWSD 1GYCA 2BY2A 3MMEB 3TJEH 3WN5B 4YGVB 3JWDH 1JRHL 1D5IH 3D87B 3QARA 2GTQA 2VZTA 3QIBD 3Q0HA 4L8SB 3ZDWA 3IMVA 1PZUB 5AVYB 3SKJL 1WBZA 4GXVL 4Y5YA 1DZ0A 3ARQA 3KM1A 2OMUA 2DMKA 2GJ6D 3O3BA 4JFDB 5I5IA 1CD1A 2IDFA 3H9HA 4ZMVA 4HUCA 2I69A 4W9FC 3QQXA 2DM2A 1AGBA 5IESH 4H5SB 1UVQB 2J8HA 2R2BB 5D1ZB 1ZGLP 1UOLA 5D7IF 5IVXF 5KYXB 4F7CA 4LOFA 2P28B 4OLVL 3DV6A 2XTJC 5ICXB 2L8AA 1P5UC 4K7PY 5FYLL 1A1MA 3WY4A 3OX8B 1FLRL 1MHPL 4S0SD 2QHRH 1AO7B 1NCCH 1OAXL 3MQIA 4I5BB 3VH8G 2XTJD 3QZWA 4JFFE 4WI4A 4M00A 4N0RA 1E5YA 2NW2A 1ZV5A 1RK0B 4K2UH 4QT5A 5I74B 5KWYC 2XZAH 1UWXH 5IW3A 2Q8BL 1OB1A 3HE7B 2A74A 4LCWD 4DGWC 2YOCA 2J1KA 3TO2A 2XZCL 4JKLA 4IYKA 5J57B 3FUDA 3BWAB 4W9JC 4O2CB 1IGJA 2R51A 2AJSL 2DRUA 2RALA 4MHHG 3T6XA 1UT1A 5C07B 1UWEL 4GH7B 1NCTA 3B2XA 4LU5H 4OCXL 1E5BA 4HEME 1AANA 3BJLA 2A0LC 5F7NC 4PBWD 2RA1A 1HSAA 4AG4L 3LB6C 3MHZA 2LT9A 3Q6FB 1BAGA 3ZMRA 1J0JA 4YR6A 4JGNA 3B43A 4MCZA 4MA3A 4P05A 4RFEB 1OP9A 4DN3H 4P99A 4G6FD 4JK0D 4Z7OE 4NRYB 1LD9A 3MJ7B 1OLZA 2B59B 3CSYA 2Z34A 4KNSA 3T4AC 3VMOA 1S9VA 4GBXD 3WGUB 4PJ7B 4MQ7A 4AI7A 3OG4B 4R90H 4IOIB 4MMZA 3MOAL 3A4DA 5JPMC 1HHIA 4JCWA 3VI3E 3ULUL 1GGBH 4OCWL 3QA3A 3RA7H 2BP5M 4R7DA 2IANB 3M1BB 1HT6A 3WN6A 3JTTA 3VU1A 1IC5H 4LLVB 1HCVA 4G8EB 5EU6E 2IH1B 3MRMA 4DP9X 1PZ2A 3MRBA 1JZ4A 4G83A 4JQIA 3ZE2F 2AVFA 5IREA 2VDQB 3PGDA 1ZHKA 2PO6B 1P9MA 5D6DA 4QXVA 5F7YC 1KTJA 3BMWA 5J89A 3GSNA 4NQVA 3WN5A 1F8TH 3TFKC 3Q9QA 1XF2B 3RRQA 3BKCL 1AXTH 1D2PA 1QSFD 2HA1A 1X5IA 4XGZB 1UM5H 2JELL 2J57A 3GDBA 3QHFL 4GKLA 3R4DA 2WYHA 3K6SB 3EDKA 3IJSA 4OLYL 4ZMPA 1KMGA 4OI9A 3R7QA 1B2WL 2XG4A 2OMUB 4R3SB 4LHJB 1WH0A 2OJZH 1QRNB 2ZUSA 3BPLB 4P2OC 1NUFA 3EYOA 4ZPTA 3JZYA 1OE2A 5CEYA 2VDKH 2AV7A 4AQEA 5LN8A 2GEQA 1VESA 5FM5M 2IBZY 2AFNA 2RFXB 5AKSA 1IEHA 4U1HB 4B3EA 1HJCA 3P0VH 1I1AA 3O6LH 4MJJA 4PWFA 4PMFA 4QF1A 1K8DA 5IGXL 2M26A 1YVLA 4Z7QF 1FNLA 2P5EA 3N44B 3FFCE 3ZVVA 3DYOA 2CK0H 5JLZB 5L0QB 4HH8A 1ZCRA 2V6HA 3O9WC 1FQ9C 1DBJH 1IAIH 1F4XH 4TNWK 2OMXB 4PJ9C 4F58H 1MFAH 4U1MA 2XN1A 4JRYA 3QXTA 4UT7H 4F27A 1DE4A 4P4RA 2VXTL 3B8SA 4OZHB 1ZTXH 3ZTCC 4BQBA 4KJQD 3FCTB 1UB5A 5F9WC 3IVKA 2MRYA 3SB3A 4M1CD 4JY5H 5E6ZA 4GG6E 5EBWA 3S88L 4UUJB 3RWJB 4LCIH 4M62H 4W9CC 1KY6A 4WK2B 3BD4A 3SY6A 1XZ0B 2BH0A 2VDKB 4YGAB 2YQBA 1D6EB 1XL6A 2CKBL 2HRPL 3ABKB 3HPLA 1CLOH 4IRZL 4A2FA 1HWGB 5HDLA 2X1WL 5JIHA 4EOWL 4PJAF 2Q3XA 5FX3A 1KNOB 1K8IA 1RY7B 3TBTB 1BWWA 5HPOA 3QYNA 3HI6H 3H6AA 1QPPA 4EE2A 4C56B 4FFZL 3NA9H 2OMTB 4DP6X 4AW7A 5CP7A 2Q7YA 5IUCA 3K71A 1S9YA 4OM1L 1CDYA 3NK4A 2Q1EA 4OZ4B 4ODVL 1JNLL 2AHIA 3GSWB 2H1PL 1R3LA 1NMCC 1RL1A 4ODSH 4RFOL 4TVSa 5E9NA 3ZTNL 4LP5A 4E2OA 4S2SA 2IG2H 3SYQA 5BXFA 3BSZL 2WNXA 4RGOL 2R56H 3REWB 4ABQA 3D6GA 1DQJB 2C3VB 3KCPB 2DMCA 2EYSA 2A83A 4LOUC 2ITFA 4XPGH 5F89A 4ZFOA 1NGZA 1Z6JT 4E5XG 4JY4A 4LIQE 5EO1A 2IBGA 3DTUB 4GBXA 5DQJB 3U6XS 1CBVH 2NY6D 5G4OA 1MHPH 4L0PB 5ESQA 5GGVL 3DPBB 4KZCA 3IF1B 1I31A 2IQ9H 4JFED 1W0WB 4PTTB 5EH1A 1OCOB 1WWBX 5D1QC 1MY5A 4PJ8C 4R3SA 3NCJH 2BSRA 4YXKH 3ARBB 2NMSA 4X99B 4TSBL 3RG1C 1VJSA 1UCBH 4KXZI 5HDBF 2WQSA 2UVFA 1WZ1L 3V95A 2W0PA 5FO9B 2N7AA 5E9AA 4QHKJ 2QQNH 4KJYA 1L6XA 1NJ9B 1YEKH 1OTTD 3R8QA 4K5LA 3QEQE 4Y5YC 4ADJA 1V3MA 5DJXA 4ZG1A 6TAAA 3O6FA 4HK3J 4GAJH 3LNEA 1R9FA 2XXGA 1KIUB 4NI6A 4B0MB 3AT8A 4JFQB 5FV2A 4F1SA 5JA9A 4M5YH 1IC4L 3UG5A 5CJQL 3NJNA 4WEBL 1WFIA 1YYLL 3F2LA 2OI9B 4UQ3B 5I8OH 1GYAA 2XQYK 1LO3L 3BXNA 2FJGB 2VZ1A 2ARJA 3BE1L 5GXBB 2K8QA 5DJAB 1XXDC 3CFCL 2HG0A 2A3TA 8FABA 3MLTB 3RFZC 5E1GA 3DRQB 3OKMB 1XMEB 3QJXA 3VFTB 2IOMA 3OKDB 5BQDA 4Z3EA 2J2ZB 3HNTH 3JWDL 1AXSB 1OCWL 4LLWB 3UAJC 1L6PA 1PY9A 4BUGA 4ATWA 3O3EA 4P9HL 4R84A 1OGAE 2XTLA 3VXTB 5K9KB 4AQ8C 4TN9A 3L3KA 4MAYD 3DROA 3Q05A 2FJHA 4F7TA 1FGNH 5E1HB 3V9EA 5C0DA 1G0DA 1I9JL 3A6CL 3BIAX 3A3YB 1ZT4B 3FO0L 1S9KC 2NUTB 3BH9B 3JT2A 4ZUTB 2QV4A 3UOAB 5DMIL 2BDNH 1KJMB 1IAKB 2QSQA 1FC1A 4R4NC 4G7RB 4PR5A 1FUNA 5PAZA 5T1LD 1KWGA 1O7DE 3FB5B 5E2UL 5DJZA 5MENE 3WMSA 1ETA1 2AJUL 1E43A 1UD8A 2YEQA 2NY3C 3TXAA 5E2WH 5D7HA 1T1XA 4BSWA 2QVTA 2ZXCA 4OW6A 1IAIM 3OSKA 4J8RA 4V1DE 3HE7A 3FRUA 4V11A 4JNXA 1PGRB 4MMZC 4F57L 3LRKA 4ZSOB 1A8JH 1I9JH 3A6CH 4FC3E 3UAFA 3WNJA 3BKCH 3MZTA 4MCMA 5K39A 1CL7L 3A24A 4KFMA 4PTTA 3NZ8B 1EXGA 1UZGA 3APMA 2ZG1A 3VX1A 4E9XA 2IGLA 5E5RB 3ZY7A 4CVZA 2DYPA 1MAJA 3OAUH 3OJVC 1FO0L 3T3MF 4AYDC 4AMWA 1I1AD 4PM1A 4WW2B 4X7SH 4X98A 3IFPA 1AYOA 3PP3H 1TZAA 1OGPA 4HUWB 3FNKA 5J11C 2AV1A 3L3DB 4O2EA 5KJ7E 5GJSH 5CIPH 5IVXA 3VM7A 4ZD3L 1L9SA 3ETBF 4OUUB 4FG0A 5JW4R 4FZEL 1HZHL 2CDFB 4KU1A 3TBWA 3I75B 4UINL 5DURD 4KQ3H 1CG9B 3R06B 2DL2A 4LP4A 1P4BL 1BZEA 2Y5EA 3I02B 1MREH 3HMXH 1J8RA 1OD9A 4Y4FD 4EI5D 5C2BL 3WELA 1SEQH 1BPVA 4NHUA 3T0EB 2HH0L 3OKMA 3H3BC 4Y4KB 1IJ9A 3CDGA 3UEQA 3NAAH 5EFIA 4KI5F 1XSKA 3GTVA 2NPLX 5D8JL 4BELD 5DJ8B 5K9KA 2DLFL 3QG7H 4XB8A 2HZHA 3L5XH 1T5WA 2DZEA 3EYSL 4JVUA 1UA7A 2EDXA 4NKIL 2AEPH 4NYLB 3IJSB 5GJTL 3WD5L 2YWYA 3RJDA 5MP6L 5CJQH 3MV7D 4XZUB 3TO4B 4I77L 4UU9A 1EHLH 1E27B 2FVNA 3G5YB 3QDJD 2Y6SC 4K3JL 1O6VA 4R8WH 2L0DA 3QUYA 4H40A 4D8OA 1G0XA 2E6PA 2JCWA 3VI4A 1K72A 4K73A 3CZUB 1ACCA 5JOFB 3NCMA 1J11A 4X5QA 2XNAA 4JO4H 3VB8A 1MCHA 2ENPA 1JDCA 4WHCA 3EJUA 3KR3L 1SGKA 5D2NC 5EUOA 5GZNA 2N3JA 3T2NH 3O2VL 1MCCA 1TZIA 1GJUA 3K2UL 4KKZA 3KBHE 5INDB 3OMAB 2OV0A 3X3FH 2DWSA 4XPBH 4RMSA 4PI2A 2ARJQ 2X05A 2F7QA 3QFDA 2GHZA 4NNPL 4WUUD 1KJ3L 3IMSA 4E41A 5SX4I 3D3VA 4S1QL 2JFCA 5GS0H 1RJYA 2NX5B 3FOMB 1I4FA 2H0EA 2BIHA 2V2WA 1W15A 3S8GB 4LE8A 1EJ8A 1ND0A 3UPCA 1WEJH 4J6RL 4DNLA 5IMLB 2ZUTA 5DO2C 3WSQL 4JM2D 1FRGL 3D4YA 1OAKH 3NZ8A 4R7NA 4PJGF 1KIPA 2XOTA 1PYWB 3DHMA 3SGJC 5I1GL 5IFJA 4L1LA 3QFJD 2XRAH 2FCBA 3JWNE 4YXKL 2A73A 1YEHL 4X9BA 2GFBB 4PJGB 2DY2A 4AYBA 1T2XA 3ZL1A 4P9HC 1JD7A 4AUJA 1EZVX 2G0KA 3FT9A 4K3DH 1TJIL 2G4EA 5FKAA 4G6KH 1BZ9B 2AK4B 4Y9BA 1FNSL 1QTYT 4M7LT 1DFBL 3LV3B 5TE4L 1UOKA 2WXGA 1L7TL 1VB9A 2HT3D 3TNMA 1SFHA 4KC3B 4HUWA 3WNKA 1GVIA 2XKNB 5AYUL 4KO6A 4P5RA 1NDMB 1JGDB 4K8RC 5IHZA 1OAUL 5L7XL 3BKYL 3QP3A 4HKXA 5E6YA 3FUHA 2NW2B 1TSHA 4NNYB 3FYEB 4ZXBC 4N0FB 1HHGA 5D9SA 2CCLA 1TTBA 1FL5A 2P8PA 1ET8A 5GGRY 3EBIA 1JCVA 4F8PA 1IGJB 1PKOA 1QKZL 1W72L 4HKJA 1A1NB 1DYZA 4HZLB 4N2IA 1UXLA 2Q5BA 4G8GA 2AK1H 4JDTL 3UH8A 4JBSA 2JKJA 1EFXD 5CR1A 1MCBA 1AD0B 4GLRI 3WEMA 1F5WA 4ICWA 3SDXE 5C0BD 4JL1A 4BA0A 5ISZE 1XBDA 2K45A 4KXCA 5JHBA 4HJ0D 4LSVL 1IRAY 2E9IA 2FB4H 5HBBA 5TK4A 3QXWA 1OAUH 5L7XH 3VYOA 4X5XB 3H9SD 3UGUA 5I19H 1O6TA 1FPTL 3FSOA 1EGJA 2NY0D 5I24A 2YD9A 5HYFA 5IUSA 3WS3B 3U7WL 2BLFA 4XNYH 3F7YA 1ED3A 1YPZF 4OCNC 2QQNL 1NBZA 5HJBA 1H9VA 3GXDA 1IGIL 2VLJD 1HHHA 4MMZB 2P8LB 2GB2A 2KLSA 3G3LA 5CCJA 4H4NA 2R0KH 4MNQB 2BNQB 1A0QL 2CGZA 4U7KA 5DJXB 5IJBC 4HHGA 4N2OA 2A7BA 4DK6A 3RL1B 1QBLL 3J8F7 4LARH 3ZJAA 1T7WA 3BZ4A 2MFNA 1GOGA 4FQ2H 4K71B 1HQRA 2R1WA 4NN7B 5AWNL 3VFNA 5JHAA 2HVJA 5L4FA 3MBXH 3HBPA 3KLHC 3G5XB 3O4OB 3AM8A 3QYMA 2P48B 1FG2A 2XQ0A 4E9QA 4H8UA 4BFIA 4S1QH 4HPOL 4XBGB 4YAQB 4M8RA 1JZ7A 2ADGA 1MJJB 2AXFB 1E6JL 4BK5C 5MHSD 1WPCA 5M95B 5JTWA 2E7BA 2XPYA 1XGQB 4I9XA 5HI4D 3ZYJA 2F54D 1VEOA 4LCCA 4LVNC 2J1YA 4U1LA 1G4RA 4YK4C 4ZQTA 1AQKH 2VQTA 4RFOH 3MRRB 3K2UH 5FDYA 3ZTNH 3BLKA 2B1HH 1QWHA 1W72A 3HZMA 3BP5A 1KN2H 4R83A 3NIGE 3COOA 5GGTL 3BIBX 3EGDB 3T3MB 3U48A 3WKQA 4Z3IA 2PPCA 2H26B 2YAEA 1KFAL 4GSRA 3V0WL 1E8YA 1XZWA 4QR7A 1EERB 4NX0A 1UFGA 3ESNA 2FX9H 4TPRH 2HVBA 1XIWA 1UUNA 1F6AB 2YQGA 3FFCA 3LXAA 4DO4A 4Q9QH 2YAQA 3D7PA 4PR5B 4FZ8L 5IROA 3RWEB 1UD4A 1IILE 3S35X 1N5AB 3V0IA 1KYDA 3SBWC 2YKKA 3P11H 4YHZH 1BQUA 3AS1A 4HOXA 1NGXA 3REVA 3UZVB 3BPNB 3LKRB 3U83A 3DURB 3QZNA 3WGVB 4LLDA 4HKZB 1NQBA 1UA3A 3ARPA 4NQCA 2A6DB 2C7UA 5B38G 4UT9L 4W1TA 1OKEA 4NAMA 4FYRA 3B4NA 4EZLA 1OWRM 5E6IA 1AZBA 4X7DC 4YN3A 1ZVNA 2TRYA 2OMWA 2BNQE 5FGBA 5ICZB 3QZPA 2Z7WA 3KS0J 3B9VA 1IEAB 4DO6A 5BS0B 4JREB 4PVMA 4WWKC 3WIHH 4LKCB 3IGAA 3IAQA 3MLXH 1UEYA 5B38B 4LNVA 1PY0A 4PGBA 4J1UA 5EEYA 1DJGA 3TT1H 1BAFH 1CXEA 1OP3K 1FHNA 4Y2NA 4Q14A 3F7VB 4OAWB 4FF9A 3RZCB 3PRZA 3X14B 1MAML 4ZO6A 3DX2A 3BGFC 3WE1A 3DO4A 2ICWJ 3PWVA 1KXHA 2FDBP 5HYSG 1BW8A 4FXTA 3UTTA 3CHPA 2LLNA 5ABDE 5AQ0A 3RIFK 3OAZK 3AWGA 2XKSA 3LPPA 3O6KH 3H9SE 3ZE1F 3OJ2C 5DUML 5FWQA 3FSWA 5CFAA 1VFAB 2R1YB 5EZIL 4JL2A 4YR6B 1OGTA 3FU6A 5DD5L 3R0NA 4CSZA 5KSAB 5FOBA 1TR7A 5SX5K 3WY1A 2ED7A 5JIQA 3HZKA 5B3JF 1H3XA 4EZKA 3FQUA 4N8VB 3UDWC 4WO4C 1ET5A 2DQMA 5AB1A 3AQZA 4ODHH 3V0GA 1PKQB 4LAJH 4P4KD 6PCYA 3KH3A 1FA4A 4ZPVA 5LG1A 5LBVA 2ZPKH 2ZOLA 4GQQA 2IH3A 2JKSA 4IS6A 2J6EA 4JZJA 3A6BH 3WJLC 1ZLVK 1M7DB 2OR7A 3S3CB 3LNGA 3CZSA 2Q87A 1AR1C 4OD2A 2HVKB 4OZIF 2XZQH 1YNLL 3HNVH 2G30A 1KN2L 4H8VA 1UACH 3BDXA 4WDIB 5C0JA 3ARTA 2C34A 1WAAF 2ZWKA 3T0AA 1CICD 3LDBB 3OKEA 4PG2A 1WJ3A 3ZRCC 5I66A 3BVDB 4AIZA 4MMYA 5IWLC 2DDQH 3IJHA 4YDKL 3G6JA 5KBNC 3EO0A 4NLAA 4C83A 3EJPA 3DUUB 1U3JA 1I7TA 2R0ZH 5IBTL 3F85A 1WD9A 1NGXB 3REVB 1N26A 2E56A 3H2PA 1FLTX 4FQJL 3GSRB 2ZONA 3KJ4C 4OLEA 4UV7L 4AQEB 1U8PB 4HUNB 2XWDA 4NQEB 4LIQH 3IAPA 1CXLA 3QZBA 3EG9A 4HGKC 4HJIA 1RUQL 1VEMA 1WGVA 2AJSH 1QI5A 1S7UA 4OZIA 1R3HB 4YWGL 1E7VA 4KK8D 4JQVA 1OOAA 1CGWA 1GW6A 5FPIA 3QEGL 4P2RD 1BJMA 1KXQA 3GXFA 1KBVA 4H7VA 4OJEH 3VFOB 3IGAB 1ZVHA 4FG6C 3UADA 1UZ6E 2GAZA 5T3ZL 1OHZA 3IJ8A 3QIUD 5F88A 2HFFB 3SODB 3ZSSA 3ARDC 1H6EA 3NABH 3CHXA 3TPUB 1FFPA 3UYRL 2DI9A 3L3HA 3CQPA 1QATA 2DWEA 4L5FH 4RDQG 3LDBC 2NUTA 4RGND 4Y1AD 5DK3A 5GRJL 4IKKA 4OV5A 2VN3A 5HD8C 2BHUA 3TNMB 3B5TA 1H19A 1HCZA 4K4KA 3IJYB 3QDJE 3VNYA 1CR9L 1NCDH 4U1IA 3CDZA 5FHAH 3V0EA 2OYLA 3G6JE 2ZT9C 2WO3B 4P2OD 4ZTOH 3F83A 5H94A 5FOBB 3KLDA 4G8FB 4PGDB 4Y2DA 1RVFL 4NQED 1DN0A 3FK3A 2CDGB 6PAZA 1P6WA 1YECH 4OJAA 2WQAA 5IB2A 5JW3H 1WZ1H 1RSFA 4Z77A 2IALA 3FQYA 1XR9A 2AK1L 4JDTH 3AS2A 4U1SA 3ZQ9A 5DSCB 3PGCB 5HVWA 2DIEA 5LCVH 1X5YA 2Y07H 3VWJD 4X83A 2A74C 1I1FB 3H9SA 2UYLA 1MY7A 1ILSA 3L3IA 2Q76A 4Z18A 4UIKH 2XN2A 3ABGA 3R19A 4PJHE 4PJBA 3N43F 1JPSH 4PW4A 5I73C 1XB8A 4GFXA 4BKLA 4RNRB 5F89B 5CN3A 3EH2A 1F58L 4QTFA 2PXYC 4D9QE 1HTYA 3WSQH 3OGOE 3PDOB 3MKKA 1JSYA 3A0OA 3CN2A 3QEUA 5D7IA 2PWEA 5F6IC 4POUB 2JELH 3O3UN 3QHFH 4KK8C 1MHCA 5DR5H 1WS7A 4UOJA 43C9A 1FSKC 3NCXA 4MNGA 2BNQA 2B14A 3VFVB 4QNPE 3MLXL 4JRLA 2XACC 4P2AA 5HI5D 3T4AA 3NESA 5ICUA 2RACA 2VUOA 5JHDD 4G43A 3QJVB 1V8HA 4GINA 1XIWC 5I26A 3CZFB 1ZEAL 3OKKB 1MG3C 1BX2B 2IFFL 3CFJA 1Q4NX 2VJ0A 4OH2A 3KYOB 2F7IA 4RLDA 4Y4KA 4ELDA 3RVUD 2CBTA 1HEJC 3VFRA 3TEXA 2ZUQC 3IT8D 1QYGH 2VXQA 1P4IH 1QEXA 2IIJA 2Y24A 5EBMA 1OOWA 4MJIA 2L04A 3HHMA 3LZQA 4NM8L 3LX9A 3FULA 5EA0H 1T5WB 1DUZA 2VJXA 4E5XB 4XNDA 3ZZSA 3D07A 4IMKC 1X7QA 1DSYA 3MGAA 3DYPA 1W72B 4ZUWA 1HXYA 1OTUC 1YMMD 3P69A 4FN0A 1KJVB 3VXRA 1FGVL 1D9KB 4PJCA 5E5UB 3EBGA 2ZP0T 2CHZA 5EU5B 5DJAA 2K7PA 4RA0C 4R96A 3CPLA 3L3JB 5DRZB 3ZHDA 5CP3A 3S98A 2F5AH 4YDZA 2K3TA 4JRWA 5AD0B 1A4AA 4RWHA 1BZOA 3MRIB 5CXPA 1I3RB 2PPAA 1F13A 2Q6WB 1MN4A 4Q56A 1AZNA 4WV1B 3UXFA 2JV6A 4JPVL 4ELKB 3GSUA 2ED6A 1IZJA 4HMCA 3S5ZA 3SDXA 2YUZA 2VE6B 3S34L 1V54B 3VCLA 1RHFA 2XTJB 3US9A 3GLZA 3LKRA 1W0YT 3KXFD 3RY5A 5IEHA 5I1HH 5F8RC 2QKIA 3KWWA 4IRSA 4MXVE 4G6JL 1U8OA 3QORD 4AUYA 1LNUB 2NY4C 5IMOB 4R2GB 3BAWA 2AGJL 3LN4A 1ETZA 1KFGA 1P84J 3E9UA 3QHZH 3CCHA 1AS8A 2CLZA 3FKUS 3F7RA 4NUJA 1DQDL 5DRNB 4PJXA 2VDNH 2BVQB 3B3BA 3SQBA 4DFIA 3CVHB 2N01B 2WBJC 3AMKA 5BZWA 3W82A 1DSWA 1KBGL 1NMCB 3BT2L 4HIEB 3IGUA 3W0WA 3C6EA 2BHFA 4IKJA 4ALAC 2Z92A 1GKOA 3H55A 4YFEA 5LBSH 4HGMA 3GBNL 3ZHLA 3THML 5CJBA 2IPUK 4WU7A 1J05B 2WLLB 4AQOA 4LSPL 2UY6B 2VZ3A 4Y4FA 3RGBA 4G7YH 4QRUB 3OZ9L 3UG3A 1DBKL 4GS7B 3VWKA 1TJHL 2BHZA 5IHZB 4EI6A 1IUZA 4N2LA 3T08A 1AQHA 3VI3F 3KBFA 1D5MA 1VZIA 3L5HA 3PFQA 1QBAA 1F90L 3WXVH 1B3JA 4MD5A 2FT7A 5ANHA 5EZPA 4X6CE 5E2WL 4ZMWA 4DCQA 2CJSA 4CDHA 3AXIA 3BLPX 3CC5B 4MSWB 3V0DA 1HX0A 4JN2A 3WTVA 3VGGA 2GTWA 5JIDA 3D3VE 1A1NA 4KKAD 4PJDB 3AJ7A 4YWGH 4QRPE 4ANXA 1AHKA 1Y18A 3V6ZB 3BMVA 4PRPB 3KVQA 2E76C 3RVTC 1AHWB 3P9WB 4DSYA 3WIFB 3OHXB 2DQ6A 3IDYC 4XP9H 1G84A 3SPCA 2OYMA 1RUAL 1EH9A 2GIMA 2OAAA 2Y2TA 4YZWA 1E0OB 2B4CC 1ZDQA 5FA3A 3KPPB 3ARVA 1DO5A 4WGVB 1IGTA 3T9WA 2CDEB 2X4RB 4EVNA 2DTSA 3GHBL 1ZGLA 1OVZA 4LVOC 3IDIB 1U58A 1AQ8A 2Y2WA 3UC0H 3TX4A 2NUPA 5IIEA 2EKSB 3Q9PA 4UT6L 3P4MA 3OXSA 5J3HD 3GMNA 3NCCB 3MRHB 1ZHBB 2BY1A 2DQTL 3MBWA 3QWOB 3BH4A 1MPAL 4X6DF 4BZ2A 4EBQH 1I7UA 5KBMA 1HH6A 1JZEA 2ZYHA 3RGHA 4P3WA 3GJFH 4GXFA 1TZGL 1BLNA 1UGKA 3QGVA 2XN0A 4YHYC 4W9KC 5D70L 2FBJL 3RWCB 3KXFE 1DCLA 1KJ2L 1JGVH 3IMBA 1CO1A 4QKXB 4FNQA 5D7JB 3DARA 3MYZA 4IHOB 4M9PA 1MFVA 5TF0A 3ILDA 2A99A 3FFDB 4JPIA 5CGMA 2XWTB 4KXZH 5I1LA 5IFAH 4E0RB 1D2OA 2NDGA 4Y4HA 5AL0A 4ZBJA 3BX7C 1YEDB 1GIGH 4F2ME 4YX2H 3GSQB 1AIFB 2BRQA 2VLME 4P3CH 2EE9A 1UENA 2HT2D 3SO3C 1R3IL 5AVZB 1FAIH 2VJ8A 2YRZA 3U9PH 1BVNT 1KTKE 4LCCB 4U1GB 1VFBB 2BRRL 1A6ZA 2MKWA 4LEEA 4WW1B 3LIZL 2HJFB 3M1OA 3QO1A 1K9TA 2LR4A 5B7FA 5T3ZH 2BSBA 1TQBC 3JSSA 4NC1C 3A4AA 3IFLH 2Z31B 1AD9A 3PE9A 4IRJB 2G0LA 1I1YB 4CKVX 1C8PA 2Z92B 5KVMC 1S8DA 1XF1A 5GRJH 4XHJD 4YPGA 3O81A 3OV6A 2NZIA 2VXQL 3QO0B 4N8PA 2E8YA 1HOCB 3O4LB 5CWSA 5C6WH 3UGXA 3LKSB 3D0VA 2EXYD 2HN7A 4TKWA 1N5AA 2KDGA 2V4LA 4A7SA 5GS0C 1NFAA 3K6SA 3ZIMA 3UMTA 1QQDB 2R7EB 3TH4T 3BFWA 4OLWH 4DKDC 3P2DA 2BZ7A 4I89A 5EO9B 3F58L 2IG2L 4JO2L 1BYPA 3HI5H 4ORGB 3GKWH 1ONQB 4GS7C 4AE0A 2NNRA 1VLXA 3IDXH 2BNRA 1QFUL 2AERT 1WSST 4ZXBD 3TZVD 3BUTA 4KTDL 2ZX6A 2JJSC 3TOPA 3WTYA 3Q1EA 2HXAA 3V6ZA 5GJSL 4CVXA 2EE3A 4P9HH 4MA7L 1OCZB 5FW7A 4Z95L 3IKKA 2NTFB 1IE4A 4PRHD 5D1XB 2CRMA 4MX7B 3PGCA 1FYTD 1MW3A 4NXKA 2VRAA 3LRHA 2HT3C 1D5BA 3F7LA 5K1NA 2X4QA 2Y3NA 3O2DL 2ADIA 4UINH 2Q20A 4S1DC 2J25A 1AHMA 1B4JL 3TV3H 1U58B 4KPHH 3S5LG 4N6RA 4K94L 3L3IB 3GMNB 2P8MA 2PO6C 3UCRA 3ROOA 5I0XA 3ASOB 4LSSL 5HYSA 1KBKA 1S3KL 4JRYB 5TE7H 5BO1L 3RZCA 2WOBA 1NLDL 3EJYC 2CO6A 1E5CA 4WWID 2MKLC 5C6TL 2FUTA 4F1ZA 1TITA 1IKOP 2E9BA 2F6AA 4Y7MA 4EN3D 2DEXX 4E9LA 2FBJH 4KK6C 1FNGA 1AQDB 1DQDH 2H9GB 4JO8A 3WO4B 4PY8J 6FABL 3QULA 1MHCB 4PU2A 5D7JA 3I6SA 4QO1B 5CGYD 3ZSTA 4Q2ZA 1WGOA 2NYZA 4ANUA 3FUNA 1QEWA 3FQ2A 5F7BA 3JXAA 3H3PL 3VSUA 1NOLA 3KW8A 2GCYA 3LD8C 4OZHE 1HH9B 4AJVA 4G1EA 5C2UB 5KANI 5ALCH 2FUQA 2BIQA 5DUJA 5E1IA 5BV7L 3O9WB 3V0WH 4WEUD 2X6UA 4GRLB 5GHWL 3PJNA 4ONOA 4CSPA 3KNBA 3SY0B 1E9OB 2QHLA 2D03H 4PJAB 5A2LH 2P7TA 4Q0XL 3QO1B 5JOPD 2HG5B 2LAGB 4JHWL 4CJ0A 4JQIH 4XPHH 3NVQA 1CU4L 2AQTA 1A6WL 2QSCH 2Y6SD 4WKZA 4XOBA 4EUPG 3JZ7A 1OD7A 1KY7A 3BUYB 3US1A 1S8DB 5KVEL 2P52A 2CZNA 3V5HA 5H4YA 3C2SA 3RGVC 5JIMA 2A83B 4HDIB 4ZFOB 3OKEB 3MLZH 1MJJA 1BFTA 1VPOH 2W8CA 1KGIA 4YC2C 5IVOA 1QVOB 4FG2A 4WFEE 2Y07L 4N0CD 3UABA 4I85A 3M7FB 2P24A 3LRGA 2B3RA 3UJJL 4EI5C 1IO4C 1GKEA 1TQCC 1LHZA 2HCZX 3ARUA 3UJTH 3CUPB 3WDHA 1JUFB 5DTFB 4LHUD 4YFDB 2F18A 3E8UH 2XT1B 1WFTA 5TDNB 4MA1B 2CRIA 3EYUL 1OQXA 3H42H 2O61B 1I1RA 4WJ5A 1FYTE 5ALBL 1SVCP 4UQEA 4EKJA 5ILTL 2H2SC 4BZ2L 4DQAA 4P2OA 3HNSH 3ZDXF 2VQ4A 2XJKA 3RWFB 1PJ9A 3LTVA 4OCYL 3BP6B 4Z1PA 1HNGA 4I9WE 3W0WE 1RSYA 4OCRH 5I1KH 1ZLVH 4A66A 1VZHA 1DL7H 4JFUA 4YL9A 4DGIL 2NNXA 3QJQB 2Y06H 4KHTL 2W0FA 3HAEH 4F15C 4HFWA 4JG0L 3O2DH 4M43L 3GQFA 2OMNA 3DIFA 4FMVA 2ITDB 1U8LB 4XAKE 5BMFL 4JUTA 1LTXA 1BFSA 3ZL4H 5LNDA 1ZWIB 3STZA 2D0HA 2GJZB 3QAQA 1L9OA 3MYJA 1UXWB 2OR9L 5ICYA 1MELA 4JM2B 3CAFA 5EUKA 4MXQC 3GK8H 5JQHC 4LLWA 3NK3A 2BS9A 3QUKA 2MPVA 3EXLA 3FQNA 4XCYB 4PJ8B 5DMKA 5HYJB 1ZK5A 3KJ6H 4GI9A 5IV2A 4EI6B 3LQZA 15C8L 2W9EL 2VLRB 1BVZA 5IT2L 2C1PA 3K4DA 5DD0H 3S35L 1E90A 3II1A 1Y0LB 1Q0XL 2WZPA 2X38A 1W8EA 1DQKA 1SYVA 1BOYA 1TENA 3KAAA 1SEQL 2I25N 1NCJA 2WNWA 1XF4A 2B2XH 4W9ZA 1QLRB 3BFQG 4P5KB 3UTTB 3OR6A 1T2JA 4L9LB 5HVFB 2CHNA 1WA0X 3ZRFC 3Q5TA 3NACH 4Z6AT 4AQAB 5EB9A 1CK0L 4NKDB 4I7ZC 5TQ0H 3UP1A 4F37F 1SYSA 3QQ3A 4DP2X 4NQDD 4HOWA 2BZDA 4GI8A 4OSUH 4J8RB 1CCZA 2CPUA 3GSVB 3OJDB 1T66D 5K69A 2CA3A 2MOGA 3EZJB 2QFRA 4YE4H 2HJLA 5DJ2B 5ESVB 2QTEA 3UPRA 1LLAA 1P4LB 4H1LB 4RMVA 4BH8A 3LKQB 1IM9A 1XTMA 4UIMA 3GI9H 5F9JB 4LAQL 2OBGA 3DC0A 1AGFA 4GRLC 5DJDA 3T0ED 3RUGB 1FL3B 1S7SB 4B5ZA 2J55A 3MA9H 3QWNA 3NFSH 4GRWE 2YPLE 3K1DA 2JXMA 3S35H 4MB5A 3JBG7 1SY6H 3NIDE 4WW2A 4X98B 4ZFQA 4TSCL 3KYOA 4PRID 3MLRH 4RMWA 4F8LA 2ZSWA 2EXWD 1MRFL 1VPOL 3RL2A 2IQAB 3BESR 4Q52A 2MCAA 2N1TE 1TEYA 1N8ZA 1OIOA 1YEFL 1UKSA 5A6IA 5I1DB 1EMTH 3SQOL 4G42A 3U7YL 2MOQA 2VABA 1BFOA 3DTDA 3FQ4A 2LFEA 3LKPA 4LK4A 4JPKL 1A5FH 3SKMA 1F3JB 2VDKL 1WBZB 2JJTC 1ZS8A 4L3FA 3QORC 1J9SA 3T6QC 3O0LA 2DLTA 2F54E 3BO8B 3LS5L 4OQ1A 3TIDA 3OKOB 4UM8B 2OJEA 1NMAH 1OE3A 3KPSB 5E8DH 3HVDA 3IJEB 4CU6A 3BAXA 3D05A 4GUPA 2G2NA 1BEYH 2QR0B 1PZ5A 1T22A 2VSDA 5CCHE 3FQNB 3MCG1 1XMWA 4XCYA 4YXHH 1A1MB 1MWAH 4Z7VA 1IQWH 4NYLA 2J8UF 4FGMA 4AX3A 4XPHL 5FM5O 3P4OB 2QSVA 2FNWA 3UAJA 1T0NB 3V5KB 3U4BH 1BP3B 2AJVH 5E1QA 1C5BH 1SDYA 5EC1B 4ODHL 5D55A 5JW4Q 3NJFA 3UTSE 1U8OB 2XIIA 2AXJA 4L3ED 4QAMB 3TN0C 5J6HB 3MRPA 3RB5A 4IGBD 1R3IH 4BK4A 5D70H 2ZUQB 1CN4A 5D7JC 3ZO0A 5DQ9B 3LZFL 1CWVA 4HJ1A 2FWOA 2HPOA 3DJSA 4PJXB 4HZAA 3U2JA 3SGJA 1SYSB 5AB9A 3V4VA 2V7HA 3ZUNC 3QZWG 3RUGE 4BDVB 4L9LC 4X0NA 1U0QA 1M1XB 3ARFC 4QHNA 2VNCA 5AYQA 1XDTT 4ZFOL 1L5GA 5HGDA 5C0BE 2Y5TA 3NT0A 3TEZA 2EH7H 5DJ6A 5DLMH 4OLZL 2Z4QA 4W9HC 2C9VA 1BZ8A 1NLDH 3BSZA 3OF6A 4PP1C 4BZ1L 2JKLA 1B6UA 3EFDL 4LL1A 2CIIA 2DAVA 3LQMA 4TM9A 1YMHB 2KMWA 4FCAA 1SDDA 1N5YH 2WQVA 1AGFB 5DJDB 1U91A 1HQ4A 3VXMA 3AREA 3EDFA 1VKXA 3P3YA 4FAAB 5K9QI 1L9RA 2QQKH 2XFGB 1OAZH 4MQXC 2W94A 5EPMB 3CN1A 3N5AA 4MCNA 2VR4A 1CXHA 4N90D 4WU5A 4PJBB 5FCUL 2ZCLH 3ATEA 3HHSB 4ONGL 3JTTB 2EC9T 4QPEA 5EU3B 5IHHA 4YHLH 1LWHA 1CGSH 4J3BA 3GPEA 3LV3A 3TVMB 4ZZKA 4W9DC 4Q6IB 2C9AA 4Q7DA 1JZIA 2FT8A 3MRGA 1L7IH 3NSXA 3UTPD 3HFFA 5EF2A 2ENQA 2ZOOA 4YDKH 3SBRA 4OBRA 4NQVB 1NZRA 2D2OA 2YKLH 2EDDA 1I3VA 4X4YB 4N87A 1NOFA 4PJAA 2ZP9A 3SKMB 2FYVA 3HUJB 4PJXE 5IZ7A 5IB4B 1MQKH 1QBML 4MTMA 4LBAA 5A6LA 1P7KA 2DYRB 2P8PB 1OM9A 1SN5A 1E4XL 2J1WA 3BLBA 3QIUB 4BHUI 5JUEH 1OSPH 2OJEB 1A1OA 4LGSB 3MACL 5CHNB 5TH2A 5HDRA 3EOBA 5GS3A 5HTSA 3VFSA 4FL4C 4Z0BL 2CLVA 3ZT6A 4TUJB 4G8GB 2J1ZA 5AAMA 3SDDD 2DIBA 1Q8MA 4I2XE 2BXZA 2L7EA 2NZ9C 1QVOA 2AJZA 2YR3A 1R3JA 2BCMA 1HEZB 4HUUA 1NMBH 3V0AC 4P0DA 3VG0H 2Z8WC 1IC4H 1BDYA 5G4NA 4YXHL 1KPRA 2MNUA 2X2IA 1A7PL 1U93A 3QNYA 3MNMA 4N2HA 3L5XL 2P26A 4I1PA 1NM4A 1QA9A 2FSEB 3FC8A 4HIIB 4YC2B 5IB1B 3BSGA 4ZUUA 3BEWA 4XVTL 3HS8A 3HIZA 1H8OA 1BMGA 1ID5I 1RZJC 2CHDA 1QRKA 4KZDL 3KYKL 4P07A 1IAIL 3ZDZB 1FYTB 1HHHB 2QADD 4ISVA 1WAEA 1KUMA 4K7PX 4AVJA 1F42A 4K7FB 1NEZA 3GMLA 5H37G 4D8PA 1IGCH 1N0LA 3CZGA 4J3WA 3QVAA 5JDSA 2Z35B 2DLHA 5DZNA 2CO1A 1HQRB 3DLQR 1JPFB 2AJXL 3LPWA 5FK9B 4BSJA 4M6NH 4AKOA 4QHLB 4B6ZA 4E9WA 5D7LA 2GITA 1SRDA 2W9DH 3ME0B 4ZOBA 3OSVA 5B8CC 1YC7A 2OR9H 3L2LA 5AVUB 3FB6B 1LE9B 2Z64C 2XA3A 4IU3B 2BVUA 1CFSA 2PF6A 3BWZA 4IKLA 2VN4A 5EMYA 5F0LB 3WMPA 3IMRA 5IMOA 3WMQA 5BW7C 3L9YA 4YOKA 3FT3B 1B9KA 3F7KA 1JERA 5EUKB 1DBAH 4M7JH 1SXZA 4NENB 3D0VB 4U1LB 1UM4L 3F65A 3QUKB 4PJ9B 3MX0B 3RYMA 1MFCL 1XX9C 4ONFL 3IS0X 3OLIA 1NKRA 2D3JA 2VQ1B 1S2EA 4ORGA 1TCRA 4WUUA 2F1AA 5DEFB 1HESA 3EGDA 4LSDA 4PB0L 4JFOB 1ECYA 2ZX9A 3TWYA 5LWYL 1I53A 3CK0L 4M5ZH 1P9MC 4P2RE 4RESB 5D6DC 4APQC 5IHBA 5JPMB 4CADA 1P7HL 1J05A 1RD6A 1U2CA 4PJGE 5F7DB 2GUOA 4U3CA 1KXVC 4YDVA 4JDVA 2NTFA 4PVNA 1AR1D 1J5DA 3MTRA 4X4YA 3RFRA 5AVVB 1ESOA 3EFOB 1KEML 4L1SA 4AYFA 2NYKA 1A65A 3UBGA 3B9DA 4MLIA 3DX1A 2CHWA 3CX5J 1RIHL 4YBLC 4P06A 1Z66A 4LCYB 3GXMA 4KJPD 4TNVK 5HYEA 3GNMH 1FIGL 1VENA 4FMFA 3CX5K 1TZHA 3WAKA 4LBEB 4DW2L 2ZUXA 4EF3A 1WUNT 4TL5A 4YUEH 3WS6A 2HLAB 1MH5A 3NQKA 1SN0A 4KJWC 1FNGB 1HKFA 2X1OA 4G3YL 4YHKL 3V55A 3VB9A 1R5WA 2A6JB 3KJ6L 1DJHA 3WKYA 2VH5H 3I6KB 4WFGD 1IGTB 5HI3D 4FQLL 1F41A 2YA1A 1CFMA 2WWMC 4L0YA 1CDBA 2XWXA 5IHUL 2D0GA 2ICES 3CFTA 1KB9J 3MRHA 4GMSL 4CU7A 3B1UA 1FPTH 4FTVA 5TDOA 3RTQD 2E46A 4L8CB 3N0AA 1HIML 2VSCA 3LVTA 4DK5A 4FTVE 3FU7B 1PJWA 4NZDA 1IL1B 3JYCA 1E9OA 3GBMH 2YLHA 2IQAA 4IHBA 4JLRA 5DMGC 2OMYB 3WJLA 2PYFB 1IGIH 3NIDF 3X2QB 3QC6X 1R6VA 3INUH 4WY7H 1F4YH 5EF1A 4M5TA 2BERA 5KSAA 1QWNA 5HGAA 4QHKI 4ZS6C 5F72S 1YDPB 4QJ5B 3BH8A 3TTYA 3VFUA 4QHLA 5F1KC 5LGYA 1OGAD 2R69A 3L4XA 2FJHB 4OFYD 4AEHL 2ZCHL 1PKQA 2CGRL 2BIOA 2LQRA 1SOXA 5EOQH 3WENA 4BFOA 3VI3A 3IJEA 2FH8A 1NCIA 5DU7A 2NNAA 5JOEA 4G7YL 2B5IB 4NQSA 2DW5A 4X6FB 1QHOA 4A7GA 3ZIYA 2UX6A 2ZKMX 2P24B 1UQSA 1Q38A 5I1JH 2OXGA 2WKGA 5CSBA 4XNUH 1GYWA 4Y4KD 4YHKH 1KSRA 1C7SA 1DVXA 2YN5A 5LUMA 3WUWA 1P1VA 1RPUA 1TT6A 1A6TA 2HPTA 3QR1A 3M45A 2ZP8A 4KWUA 2CO4A 5F1NB 3WEBA 3ZHFA 2V5YA 3HG5A 3ESVF 4PJBF 2WHVA 4BWTA 2KI6A 1NANI 3QUMB 4AE1A 5ILTH 2OSXA 3D4ZA 1T0OA 3BW9A 4L4JA 4YPGB 2XPZA 2JSFA 3EKCA 1KF9B 5FUZH 2X10A 2BNQD 3GMOA 5LBGA 4XMWA 4ALAH 5DHXB 4JPWL 4H8PA 2C9UA 4W9LC 4F33B 5IW6A 2QGEA 5CWSB 2MCPH 2X3BA 1I8MA 4YHPB 4MYWB 2ED9A 1KG0A 4HEMA 4WFGE 4B9KC 3ISWA 5H35B 2GSMB 5AOJA 4N0UA 1WT5C 3PWUA 1FNFA 2WD0A 2VKXA 1I9RH 3SBQA 4M43H 5HI4C 2WTRA 2B1AL 4KQ4L 4TUUA 4U05A 1YY9C 4JMXA 4OKDA 4GQPH 1TMCB 3KXFB 3MI6A 3Q44A 4G6KL 4ODVH 5F21B 3C5ZA 2ZXAA 3BZ5A 3D69B 2EUWA 1YC8A 3VD2A 3CK0H 4M5ZL 4NJ9H 3BCDA 3HC4L 5KOVC 1UTDA 2EYTB 4HX1B 4Z7IA 3L6FB 3OAUL 4XE5B 4ES9A 1EGJH 2DMHA 2CLRB 4Y5VB 2EIZA 3O41B 3BAIA 1YMHA 1FFTB 1IQDB 1R75A 3VNZA 1Y07A 4JANA 1J12A 3OGCB 4AQ1B 5EOTA 4P2CG 3VXNB 3WTSA 3L08A 1SHWA 1GTFA 4KKBC 4YSSA 4HAFA 3NZHL 1C5CH 4LLMA 1S7WA 4X6BB 1QUNA 1QTPA 3G04B 5I1IL 1G6VK 2F0CA 3EAKA 4I0CC 2WB7A 3DSFL 3ZE2B 2Y6TE 4XAWL 3LJ3A 4PJHA 4FEMA 2VN6A 3RNQB 4NIYE 4TTDD 3RZWA 3F00A 4YXLH 1ZHNB 4NO2A 5FO7A 1HN1A 3EBAA 3HI1A 5AAMC 4U1IB 1MCIA 4HJ0C 1AI1L 3PGFH 3B2VH 5J1AA 5JHLL 6CGTA 5AKRA 4BFEA 5AAPA 5F3HB 4O02A 4QRBA 2QTVA 4WWPA 5CSZB 4UM9B 3MRJB 4K23H 3QFGA 4O4YL 1ZVYA 4A63A 1R0AH 3ZZ1A 4KI1A 4ORZC 4YDIH 5JMOC 3X1GA 1S9XA 3C6LC 1YNTA 3ZN6A 2ZTBA 1N19A 2W07A 3WD5H 3L7FB 3FMGL 3WTUA 1H8NA 1WF5A 3TYGL 3BFOA 2R4RL 3P30H 3AB0C 4ZZFA 5J7CC 1XGZA 4X6EA 5FR3A 3KGSA 4YSDA 5D1ZA 3UTSA 1IM9B 4UIMB 4ZDHB 4LOEA 4P5MB 4PRNB 3I84A 1GYUA 4HWEH 2APSA 4WI0B 4K9EC 2YD2A 3IK2A 2X0WA 3KPQA 2AQ2A 4QLRA 4AYMC 2SEBA 3N1PC 3F5WA 3I3BA 5C0GA 3BAJA 5I75C 4NN6B 1MVYA 2R69L 3TBYA 2F53E 5DFAA 1DVYA 4OT1H 4BKLB 3QDAA 4FQXC 1O6SA 5FAAA 2QPSA 3P9LB 1MJ8L 5LNEA 7CGTA 3VVVA 1PG7L 4F15B 3BEWB 4QIRA 3PUCA 4E9RA 3WU1A 1CGUA 3WL9A 4HOZA 4H20L 5LAXB 1N8ZB 2H45A 2I60H 3DIDA 4JGJA 1FZJA 3DSNA 3V0JA 4ZI8A 4AMKL 5HHQA 2VZUA 1C1EH 3NA9L 4PCTA 4OQTA 5IMLA 5IBLC 1OCWH 2JKWA 2A9AA 3I74A 4LHUG 3QDJB 1N0LB 3AY4C 4YSRA 5EF0A 4Y4HC 5DO2D 4CC4C 2HMID 1OCCB 1W6LA 3C8DA 4LP8A 4MJ5A 3ARSA 4L1DA 4JB9L 4V2BA 1MI5B 1GHFH 3UACA 3D06A 4U6XA 1BVKB 4GQRA 2J8UB 3WHE0 1JDDA 1LO2L 1FCGA 3LZRA 4L0ZA 1UCBL 1GGCH 1A7QH 3N9GH 5EO0A 5HHNA 3JTSB 2FNBA 4IU2A 1CI5A 3MV11 1HU8A 1PZ5B 2MCG1 5ABAA 1BIIB 1ZTMA 2FZ3A 3SPJA 5DVPA 4FXGB 1T1WB 4M6OL 5CNHA 3NEXA 5CJOH 2H1XA 3OGCA 4Z7VB 5FW6A 4FA7B 4PBXA 3QIWB 2XV6B 3AREC 1ITCA 3FBQA 5H37A 1UG9A 4RETB 3ZL2A 3DIFB 2WCGA 3HE6D 3MAWA 4K5PA 4NDMA 2YD1A 1GZPB 1MCNA 3FCBA 4R7DB 2VDQH 4ETYA 1T83C 4LKXB 2GY5A 3FQXB 1EVTC 1N59A 4JAMB 1FFNA 4N90E 1GSKA 2ATPA 2DQEH 4ZW7A 4XNZC 2DF3A 3RAJH 4CBZA 1CVRA 4W81A 4HKJB 3UTTD 3QG6A 1I3RA 1TJGL 2FWOB 2Y7LA 2AJYL 2JKIS 3N1MC 4PGJA 3GMRA 3DX6B 5DEGA 1ZE3C