2ADYA

Structural basis of dna recognition by p53 tetramers (complex iv)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
197
structure length
197
Chain Sequence
b'SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*GP*AP*CP*AP*TP*GP*TP*CP*CP*G)-3'
publication title Structural Basis of DNA Recognition by p53 Tetramers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/dna
total genus 53
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2adyA00
5G4OA 2IOIA 4XR8C 4L0ZA 3WTTA 3IGKA 2BIMA 5AOIA 4L0YA 2J21A 1UOLA 2IOMA 2J6WA 4IBYA 1KZYA 2BIPA 1EAQA 4G83A 2BIQA 1HU8A 3D07A 4MZRA 5A7BA 1T4WA 2IOOA 1HJCA 4GUOA 1YCSA 5AOJA 3QYMA 4IBTA 4LO9A 3WTSA 3D05A 1HJBC 2J1ZA 2FEJA 3WTYA 4AGQA 3WTVA 1GZHA 2BINA 3ZMEA 1GZHC 4IBQA 2H1LM 2XWCA 3VD0A 5G4MA 2AHIA 2PCXA 3Q01A 2VUKA 2X0WA 4IJTA 5KBDA 3EXLA 4AGOA 5AOLA 3KMDA 2XWRA 1LJMA 1H9DA 4AGPA 4IBUA 5AOMA 4IBSA 2WGXA 4LOFA 5BUAA 5LAPA 3US0A 2BIOA 3EXJA 1TUPA 4QO1B 4KVPA 3IGLA 4MZIA 3US1A 1CMOA 3D08A 1TSRA 2J1WA 5G4NA 3KZ8A 4IBWA 2YBGA 5LGYA 4L18A 4LOEA 4IBVA 3TS8A 3WTWA 3WTXA 5ABAA 2J20A 1E50A 2ADYA 4AGLA 2GEQA 5AOKA 3D06A 3Q05A 2MEJB 5AB9A 2RMNA 3D0AA 3VD2A 4GUQA 2X0UA 4AGMA 2J1XA 3WTUA 2J1YA 4AGNA 1CO1A 4A63A 3Q06A 2OCJA 1EANA 2P52A 3QYNA 4IBZA 4G82A 3VD1A 3D09A 1IO4C 2AC0A 5ECGA 3WU1A 2ATAA 1EAOA 2X0VA 4HJEA
chains in the Genus database with same CATH superfamily
5H35A 3IKCA 3D3VE 3FUDA 1S7QA 4AVIA 4OLWL 4WVRA 2Y2YA 3MRDA 3QJOA 4PTUB 1CLCA 1JPSL 5IB3B 1FG9C 2OJZL 4TUOB 1O75A 2D31A 3ZRCC 3SQOL 1YAIA 2MRYA 4WI9A 1T03H 4LPVA 2H9GB 4HS3B 4MB3A 3GLDA 5C3TA 1J0KA 1A47A 1WEJH 4HK0B 4U6XA 1E9PB 3T4AB 4PWKA 5FKPB 2AXFA 2WIMA 3BUPA 2ZKWA 1QR1A 1FE8L 2H26B 1R5IA 1XL4A 1T7ZA 2K4AA 4G71B 4UMGA 4ZX6A 1KELH 3DSNB 1HYRC 1ZLVH 1T21B 3ATBA 2Y7QB 3B56A 2WNGA 4N0UA 5EIVA 4GSUA 1UYWH 2LLGA 3CC5A 1FFNA 2X12A 1AGCA 1MF2L 3NSXA 3GINA 4FG2A 3V7AE 4HBCL 4J4PA 1IAOB 1FFPA 3DGGB 1M7IA 1MCOH 4WWKC 4HUWA 4WSGA 2BZCA 2WSKA 3B9VA 2WM0A 2XWRA 4JHBA 4JHVA 3IDIB 3T6ZA 3F2LA 1FPTH 5TDPA 1CDYA 2IPTH 2N59A 3KGRA 4AKOA 3O0RH 1V05A 1N70A 5L8LB 2HPOA 3L7EA 4XCCH 2PCYA 3RWCA 1CL7H 5I0WA 2GCYA 4H8UA 4XO3A 3LKSB 5CUSL 2BVPB 2A0LC 4YBQD 3NCYS 1MCKA 2I07A 1J05B 1TIUA 2QKIC 2JCCB 1VENA 3CJJA 4F80A 3GHBH 5KSBE 4R8WL 3WTXA 3AQDA 4BWUA 3S4SA 1BEXA 4IOIA 1TEYA 3RVUD 2BW4A 5CCJA 4X0KA 3K4DA 4JDTH 4K7PL 1YEKH 2YBRB 1VACA 1A7QL 5CJOH 4JGJA 1TZGL 2CNZA 3IWVA 3NFSL 1RZPA 5I6NA 4P2AA 2UWEB 2EVGA 2AI0H 1F5WA 1IV8A 1LP9A 1RSFA 4D9LL 5FLVA 1AACA 5BS0E 4IMLA 3MCKA 3EO9H 4AL8H 2DMCA 3SE4A 1U9KA 3B9AA 4ZFZB 2DDQH 3IMWA 2YMXH 3EIFA 2ITCB 4DP2X 3GS4A 1UATA 1LD9B 3DOSB 3HMXL 3FHEA 1HCVA 3C5ZC 3JWDL 5INCA 1FNHA 3D0LA 4CW1A 3OAZH 1HSBA 3F00A 5AOIA 3DBXA 3KEHA 3QS3A 1Z6JT 3WY2A 1X9UA 3ZY7A 2NY2D 2QT6A 2VLLA 1GGIH 1UKSA 3EYVA 2CWRA 1J0YA 5EORL 5HHMB 1NGYB 5K5YA 4DUXA 5EC2A 2B8OT 5DJDA 1ZV5A 1LYQA 1GC1C 2R29L 4XBEL 2PN5A 3ZL4H 1DDHB 1N10A 1DCLA 5FYKH 3TPKA 4AMXA 3HMXA 1PZCA 4ENEC 1TVBA 3U0WL 2P24A 4Z77B 3HIZA 4KTGA 2XZAL 1AZRA 4PGZA 1H5BA 2NY2B 3ZIYA 3OB8A 3LH2H 2VMCA 4FNSA 5JW4N 1AGBA 2RCSL 1IVLA 4K71C 4EUPG 4ZMNA 4EO5A 2R29A 5FKAB 5E24E 1HH6B 1MLCA 3JTTA 2O5NA 3O2WL 1JS4A 3IETA 1DVXA 4ELKB 5KBDA 4UM8A 5AOLA 1FYTE 1QG3A 2P46B 3NEXA 3QHTC 3H9HB 3QR1A 2R0WL 4S11A 1N59B 5B8CC 1TFHA 4PG2A 4MNQD 4FZ8H 2XZQH 1WLHA 2VDRH 3E3QC 4XPAL 3QGVA 2XG4A 4D0BA 1S3KL 4WWKB 4QRQA 3V9EA 2A0LD 2C9UA 3FQNA 4OZ4A 1QEXA 3ZYZA 4RAUB 4WDIA 5KS9E 4LHUD 4M7ZC 4LBAA 3P3RA 5SWSE 5BV7C 1ZE3C 1L7IH 3F6LA 2W92A 2YARA 4LDCA 4MMZA 4AQAB 2VLKE 1Z9MA 4RWYL 2F8VA 3D85B 3SGDI 4PRHA 3QWOB 1JPGA 3DOIA 3TU6A 4RGMC 4CVWA 2ADGB 2WTPA 3NTCL 3LHPH 4MNQB 1KB3A 4D0DB 2FX8H 5DZLA 1FAIH 1XEDA 2C1OB 1Z3GL 4PRNA 5E8OA 3IMRA 1YN6A 2Z8VC 3KJ6L 1AP2B 5E2UL 2YD6A 3V0EA 2IDCA 5EMYA 5IW6B 2QKIB 2VC2H 4LHUB 4V2BA 5DHVH 5D1QE 3T0XA 4B7IA 4N8CL 2E7LA 1SM3H 2ZCHH 3MRKB 2BSSA 5JZ7C 3VFVB 3QE5A 5BPPA 5E1AB 3ZHKA 1IKFL 1KCSH 4HZ1A 4CUCA 3SPVA 4HJJL 2LTQC 3QEGL 4NQXB 4GO8A 3HZKB 2EDTA 2OKMA 4O51A 2FX9L 3QZOA 3C5ZD 4QRPA 4ZW5A 4YSRA 1OP5K 1XIWC 4HLEA 5D7JC 3S37X 3GSQA 1AR1C 1W0YT 1XR8A 3FT1A 3MLUL 1VGEL 3OKNB 4ZQKA 4KO6A 3VSVA 3O11B 1CXHA 3M8OH 2K7QA 3L54A 1NH6A 3OKDA 1A21A 1OAKL 5E1HB 1OO2A 4XXDA 3DOHA 2JI1A 1SNRA 1G0DA 4ENED 4AJWA 3C5ZB 2X88A 5E8NB 3F5WB 1SBSH 2H2PC 5F9JB 5CHNB 1D5BA 4QTIH 2X89A 2FAUA 1DUZB 2OMZA 3UDWA 4XNBA 3PLYA 2JH2A 4A2HA 5DR5L 1PD6A 5HPMA 1EWHA 2F19H 1DJZA 3VE0A 2ETWA 4BA8A 5B3JF 4L29B 4RNRA 1MOEA 3CHSA 4UYPA 4Y1AD 4TUKL 1KYAA 4LOVA 3RX5A 5DUPL 1N5AB 3FH8A 1RCYA 5FK9B 1DJGA 2ZOKB 3VD0A 1J0JA 1WRFA 4HUCA 4XBGB 4L1TA 2OAAA 3ZQ9A 1B0WA 1FNEA 2CRZA 1FN4A 3TT3H 1P2CA 1U8OB 3VDCA 4JDEA 4L4TD 3ZSSA 3TM6A 5SX4H 1C08A 1NFIB 1ZHBB 3EUUA 4K71B 1MCJA 1NIBA 4MQ7A 1SJEB 4U7SA 4Y5VC 5BW7C 3K3QA 5KWYC 3OKEB 4Y1AB 5LWYH 1D2PA 4GMTL 3U7YH 2MOGA 3DLQR 4MBRA 1MY5A 4YZFE 4MDRA 3IRZA 5D7LD 3UYRH 3ZMNA 1ED3B 2G9KA 5EO1A 3TA4D 5B8CB 5L0QC 1JN6A 3GSXB 3BPCB 2EE3A 3ZDWA 1A3ZA 4L4TB 5C0GA 3MREA 1CL7I 5L2KA 5T1JA 2I9LB 4G1EB 1TFPA 4R4FL 4HWBH 1JDAA 4MB4A 4LP4A 3BD4A 4FERA 4ZTOL 3FSAA 1FZJB 3B3BA 4K8RH 3VFRB 4M7ZB 5HDQL 5BV7B 1NM9A 1FFOB 1XF1A 3HOGA 3WE6A 3GZOA 4CKVX 4PJ8A 1RK7A 2EECA 4MQSB 4L3ED 5JZ7D 5D7LB 2GI7A 3MNVB 4ADIA 2YA0A 1QA9A 3MV8D 4RGMB 4APQA 1OM3L 1T5KA 2HX7A 3BAKA 3W2DH 4CJ0A 4R5TA 3H7BB 4KDTC 1XIWD 4BFRA 5D7JD 1AR1D 2I60H 4J3OF 5DRZB 3TFBA 1J86A 4X80L 5IM7B 1NIEA 4L4JA 1FFQA 1I7RA 4HXBH 2ESVE 1CE1L 3AG2B 4L3EB 4NBZB 2CUHA 4PWFA 1D6VL 4LB8A 3MV8B 1LEKB 2LTQB 3QG6A 3QJRB 5DU7A 2G75B 4G9FA 1ZHKA 4ELDA 5IB1A 4ECNA 1BGXL 4L8BA 3QNYB 4QDGA 2H2PD 2XDHA 1XIWB 5D7JB 1T3FB 1AR1B 1JV2A 2F53D 1KTKE 2UXTA 1UCBH 4U1IA 3A5VA 4QGTA 4AXWB 2Q86A 4Q58C 3II2A 5FV2A 2IH3B 5LQBL 5CR8A 2DQUH 3WIIL 1H3VA 5AKVA 2V3FA 3UJJL 2L7EA 4KV5F 3LN4B 2CJUH 2Z93A 3HE7C 4GKNB 4ZD3L 5DZOA 3RU8H 3UO1L 5FM5O 4UQDA 5FYKD 1K72A 3I6KB 2ZWYA 3LS5L 4HIIA 1GKOA 5JQHC 2F53B 2F7PA 4TRPL 3CMOH 3WNOA 1YUHA 2IWEA 2LFEA 3CFQA 1PW3A 3D3VA 3ECVA 3I75A 4LQFL 5AW9B 2NUTA 1BF5A 2PCXA 2XACC 3EJZC 3C60A 4KJYB 2V7HA 1WITA 5C0BE 1PY9A 4IJTA 2I24N 3UZQA 4PRIE 2KC0A 4DKFL 4CU6A 4IW4C 1OAJA 1NINA 3IS0X 4YDKH 1MVFA 2ZWZA 8FABA 2VLRA 5KW9L 4JY6B 4YHIA 3HW7A 5LGHL 2XQBH 2AJ3A 4LSSL 1E8WA 1AY1H 5J8OA 1IBZA 4APXA 3PP4H 5CJBA 4Y5VB 5HXMA 1KJVB 5EU3B 5C3LD 2BSTB 2M83A 3CDZA 4P46C 3FFCB 3MGOA 1N2RB 2CLRB 1UM6H 3C8HA 4NM8H 1TOXA 1KGWA 4QHKJ 4JHAH 1R4XA 5L0QB 1K85A 4TNVF 4F7EB 4PJBF 5BQ7A 3ZKQD 4OZHE 1JWMB 2DTML 1O6TA 4G8FB 2WLNA 1CU4H 1IIKA 4S1DC 3BXNA 4F8QA 1YN7B 3KM2A 3KWTA 5EZIH 3CZNA 5C8JA 4F58H 5B22A 5GZOC 3AU0A 3VFTB 4X8JB 4TNWK 3IJ7A 1BVNT 2D7NA 2E7BA 2X5PA 5MENA 4U3CA 3T3ME 4LCYA 2A38A 4ABUA 4YLCA 2DH2A 1U6AL 4NN6C 5I19L 3SYCA 4N2CA 5D4JA 1GZQA 3VI4E 1YYLH 3UH8A 3FB5B 2ATAA 3G08A 4JRYE 2FBJH 4NKOA 1LO3H 5D71H 1R9FA 5DFAA 5BQDA 5KVGH 1WBZA 5KSBA 4LRIC 2WBJC 1ID2A 4PN6A 5EZLA 5MERB 4OF7A 5MEOB 2XQYK 3CQQA 3GHEH 5ANMA 4KK8C 3RPIB 2V2TB 4DH2A 2QTEA 2P8MA 4ODTL 4UTAH 5JXEA 3HE7D 3TBSA 3RWJA 1DUYA 2R27A 3T1FB 1P7HL 1KDJA 5F9OL 3KBFA 5AQ0A 3P3TA 2CBMA 5BS0A 4LAJH 1JZ3A 4LASH 2E9JA 1TTFA 3SY0B 1EJOH 2XTLA 3DUSB 4X9GA 3VAEA 1TTUA 4HPHA 1BYNA 2WOBA 4BSVB 3QEQE 1K4CA 1CGYA 2NQDA 2YAMA 4GO6B 1RJYB 4N9GA 3UC0L 1J9RA 5FHAH 2Y5TB 1PZBA 3DWTA 3FTSA 3HE7B 5IR1B 3H3BC 2VDOL 3FK3A 4F27A 2F5AH 3GD1C 3U4AA 1DVTA 1DQDL 4JFXB 4ANVA 3LZPA 1NAKL 3GIZL 4Y8DC 4E5XG 1IMHC 5GRUH 2BX5A 1UVQB 1E5UI 3CDYA 5BVPL 3FUMA 4JQVA 4YHOL 3FQXB 3FF8A 1YDPA 2Q3AA 2K6WA 4RVBA 1FGVH 5LAPA 3B8YA 2PYEA 4MAUH 2H45A 4K9EH 4P46D 3QI9A 4U33A 4JPKH 1ML0A 2Z35A 3FUFA 2X53A 4GSDL 1X5IA 1J1XL 1HKFA 1FNSH 2OV0A 4UT9L 4Q8BA 2HRLA 2L7UA 4H8WL 1PSKH 5CSZA 4A2EA 1CZ8L 4M61A 5H2BA 4CVXA 1XF2A 1WIPA 1ID5I 2DWTA 3QH3A 1HWGB 2PETA 1A4KB 1S7SB 2LU5A 3MXWH 3O2VH 3HG1A 3T04D 3F64A 4OUOA 1W9XA 4LSTH 1U21A 4S1DD 2FJUB 2RBLA 4GRLC 4EDWL 2V9QA 3HG3A 4JE0A 4X4YA 4WUUD 1AQHA 1OB1B 2EDHA 5DO8A 1G7PB 2BOLA 3QUHA 2D7PA 1I1CA 4P46B 2Q8AL 2O26U 5AD0A 5GZOD 4K94C 3QT2A 2F9BT 1FYTA 3TA3A 3U7AA 4ELME 5JIQA 4UT9A 5JXAL 1ET8A 4KXDA 3BGMB 3D0AA 4AVHA 1IVTA 2Y0SA 2P80A 4X6EB 5EN2A 1A6VL 1DSFH 1HNFA 3DV4A 2BJML 2LOEA 4WUUB 2EC9U 1PZ3A 1MQKH 2XWTB 1TPXC 3BZ5A 4K5LA 2ZUVA 2DLFH 2WBJD 1BXAA 3Q48A 5AVXB 4CVZB 2VN5A 3HRZA 3EJJX 4GSRA 5DHYB 5KN5A 1N19A 2VLKA 3KEDA 3VW3H 2B1OA 1RULH 4KK8D 2Z1PA 1OP9A 1J1PL 1Q90A 5IGXH 4FA7B 2EICA 4NN6B 3WUZA 4CL7A 2XTSA 1IC0A 4RETB 2CHDA 4X6FB 2GIXA 2NW2B 5DJZA 2IFFH 1XF5A 1MFDH 1NKOA 2HG5B 2VDNL 4PJFB 4YE4H 3RNQB 4HUUA 4LCIH 1MNNA 2WBJB 2YC1B 1BLNB 5KEZA 2VDPL 3FAWA 4MZRA 2AQPA 3MBEC 4ZO8A 4OLVH 3RTQA 1NCIA 2E6QA 4JJ5A 4GFTB 5FIEA 3WE1A 5FUZL 1DO6A 4OM1L 1N0XL 2EYSA 4UNVA 1JXJA 3IJHA 4OTXL 3WTYA 2P44B 4RSYA 1NCDH 3TCTA 1MJUL 5E5UB 4U0RC 4DN4L 2DQMA 4UB0L 1JHKH 4JFED 3MV01 1U8PA 5CEYA 3D39A 1S9YB 5DQJA 1JNHA 1Y7VA 2KERA 4JN2A 4L8DB 5B38B 3BZ4B 1U91A 3NCFB 1FVDA 3L4TA 3M7FB 2FECL 3U36B 4G1MB 4B9ZA 4OZIB 5DO2C 3W9DA 3CBKB 3ARRA 5KSVB 4UWQB 1DN0B 1HOCB 4PCYA 4MNHA 3S35L 4BH7A 4O02B 2IBZY 2R0ZL 3HFML 3QFJD 1T7XA 1SOKA 12E8H 2H41A 5E2TL 5FUOH 5HDBE 4KVCH 3WJJA 3BO8B 4JFEB 2VQTA 3HLKA 1B90A 1QRNA 4NUMA 3MJ7A 2SODB 5HHPA 1NL0L 4OLUL 5T3ZE 4I87A 4NB7A 4BK8A 2R2BB 4GRLD 2J73A 4M5TA 4MZIA 2XG5A 2ZXDA 3V0GA 1HEHC 3QFJB 5TE4H 3OZ9L 1C16A 1CIDA 1QLFA 3OWEA 3QEUA 4J3UA 4OQTL 3DYMA 5J5EA 2COVD 5TF0A 1FLTX 1PAZA 4NEHB 1DJHA 5KAQF 4N6RA 4MDIA 2WLKA 2OMXA 5AVWB 2AANA 1PVHA 5EC1B 4GRLB 4U3XA 3IU4H 3D50A 5DEZA 3CFIC 1A14H 1P5VA 4MNGA 4QRRD 3SQBB 4BD4A 1BFVH 3VFUA 5KVDH 3SDDA 5DD3H 4RFEB 3G6JF 4C55A 1HILB 3UTSA 3Q7JA 3RY6C 4RIRB 1UZ6F 4OQTA 1T4KB 4RGNE 1IC4L 5HHQB 5JA8B 2I32A 3WCYA 4PB9H 5JNYA 4K07A 1IBGH 2EE9A 4R7NB 3VU2A 3CK0L 4I2XA 3RJOA 1T1WA 4Y8AA 4ZUSA 2YAFA 2VM3A 3OR7A 1AXSA 5HHXL 1AD0B 2DQCL 3NSYA 5C08E 2EILB 5JORB 1TTGA 4OSUL 3RWFB 4JKMA 5I6MA 4QRRB 1TPXB 1PTZA 1WA0X 1KCLA 1X4XA 3PHOB 3PHQB 4OJYA 1KUMA 1M1XB 2CA3A 3Q8FA 4H0LC 4M43L 3OJ2C 4QYOA 4P5KB 4IU3A 3ZBMA 1DBAH 2Q7YA 2VDMH 1F1DA 3MBED 2QGCA 3L1GA 3U4BL 1FNGB 4Y16C 3BAEH 2EEFA 3LMJL 2FO8A 3LD8C 4W9DC 5A2IH 4RESB 2Y6TE 5EF3A 1Q9LA 1B9KA 1GYAA 1XH3B 4E9WA 1LO0H 4TUJB 4Y9BA 2WIIA 4HFWA 4TF4A 4XNAA 2XBTA 3L9RA 1AG0A 1U8KA 5IROC 2ESVA 1BF8A 2PTUA 1J7VR 1FZOB 1JE6A 3EHBC 4NZRH 5D5MF 3LRMA 3MBEB 5F6HJ 3T6VA 3ZMEA 5C9JA 5I16A 4EZKA 3CHQA 1WFIA 1OF2B 1BBDH 4OU3A 1MWAB 5DO2D 2R23A 5DQDH 4ETQA 3EO0B 1E4WL 3BFWA 1LDPL 1OAUH 2XPZA 4U0RB 4QTFA 5F7BA 3BMWA 2XBDA 3HB3C 4DOHE 3TT1L 2NY4C 3JWNC 2MWCA 1Q9WA 2NDFA 5ADOL 1S7UB 2PXYC 3B5HA 3H54A 2HRPL 1KPUA 3GGWB 1UFUA 3R4DA 4HWUA 2XWJB 3NP4A 3KPRA 4FHBD 5T1MA 1FIEA 1GHFH 2CXGA 2MHAA 4HAFA 1TQTA 4TVPH 2JK5B 3P0VH 4XN8A 2H0JA 3ET9F 4PAZA 2ITDB 4QRFA 2R59A 3C6SB 1NPUA 1JHTB 1QSFE 3EZJB 2YPKB 3BISA 2PWHA 2EYRA 5IQ7L 1JZ2A 3GI9H 3CFDB 2W9DL 2MTAA 5H4YA 1NCOA 4E41D 4FG6C 4XP4H 3WMSA 2XQYA 4F2FA 3L3HA 2GSIB 2N1KA 4RRPG 4RDQG 3QUYC 1L0XA 1JGDB 2QQKL 4K3JL 4MJ4A 1X9LA 5C0BA 1TCRB 3VXTB 1ONQB 4HEPG 4CAGA 3VSQA 3NIDB 4R97C 2GEQA 4GPVA 1G4RA 1VEMA 4XN7A 4JB9L 1IFHL 3WDHA 2OQJA 1WBYA 5JIMA 4FMVA 1A3LL 5GS0L 1G7MB 3VJ6A 2UUDH 2NT1A 1GZPB 3RY5A 3L4XA 3IDMA 1KPVB 4E41B 3EYUL 3LNEA 1G9EA 4AV4A 4LSDA 3BZEA 5D6DC 4K3DH 3ARDD 4MVBC 5I76A 2HKFH 1I85A 3QYNA 2AC0A 4G7VL 2OI9C 5LNEA 3C12A 4L5FH 2FD6L 4C8XA 4PGJA 4WKXA 5J6GB 2J8OA 1BZ9B 3CIQA 2CK2A 5FCUL 5HVGB 5D7HA 4F33A 1LWRA 2JJTA 1G7HA 2YGNA 5I2IA 4H5SB 2P9RA 1ORQB 2YD4A 4NP9A 4UMSA 4WFHD 2XWDA 4Y16D 5JO5A 2IOMA 2CHWA 4KPHH 3P11H 1ZV9A 2R4SH 4ZYKA 1WA1X 1DYZA 3ARDB 2W9EL 3AWGA 1S3RA 4L9DA 4NX0A 2DQDH 4M03A 5DLLA 1PPIA 2F74A 4Q9QH 1D9KC 2VR5A 3PPSA 5AAMA 1L5GB 3V5DA 4HUXB 5JMRA 3OZLA 1WAEA 2R4RH 1EEYA 1PNDA 2GJ6D 3UTTD 4CBZA 5IROD 5C7XL 3QQXA 3QUZC 4ZSOE 3EHBD 4LSVL 3VD9A 3SDAA 2V7NA 4RSVA 4Y16B 2CJ3A 1OARH 2VDLL 2O30A 4LMQI 1ZLWH 3VI4A 5I18H 1ASPA 3LKOB 1W15A 1ESOA 2G60H 4FE9A 3ASWA 3BHBA 1A3RL 3LD8B 1GZHC 2I27N 4XWOC 3OPUA 2HJFB 4MHHI 4PV1C 3VGDA 2AJUH 1QQDA 3IU3B 4QXGL 4E9TA 1I1FB 2NY4D 2MNJB 4G8GD 3LZFH 3UTTB 2GJ6B 5F0JB 1ZRUA 2PXYD 3GO1L 4PJXF 3EHBB 3CFCL 1G5AA 5KSAA 4X8GA 4P59H 4DPCX 2ZKMX 2QBWA 1QSEE 4YMPA 2OZ4L 1IKOP 2CR0A 4ODWB 1UWXH 4DVRH 4EXPX 1DCEA 1IGTA 4XP5H 1M53A 4Y4KC 4M8QB 5DZVA 3SDXB 1UXWA 4DO5A 1X5LA 1JYWA 4A7TA 3CFTA 1EDQA 4JFYA 4OCWL 4AYID 4QKTA 4YSOA 4LCWA 4NOFA 4Z0XB 4MJJA 2NY4B 3FRUB 1N8OE 2PXYB 2EIZB 5CIPA 4FG6D 3QEQA 3F7PC 2NY0D 1OE1A 2DD8L 3LXCA 2B3RA 1A7PL 3QUYD 4N3TA 4U1GC 1MRFH 3GK8L 3QJXA 4YHML 1BJ1H 1RZ7L 3CZLA 4OJDH 4RMUA 2OZ4A 4P05A 1I7TA 2JCCF 1AC0A 3E6HB 4KZEH 1UWFA 3N9GL 3DVGA 2Y7SA 1RLBA 4GXVL 1HI6A 5ALBH 3DHMA 4L9LC 5D2NA 5F89A 5B3JE 1HL4A 1IFRA 4IKLA 1N3NB 3CH8A 1AIZA 4HJ0C 3IJYA 3NT0A 3ZIMA 2R0KH 4OF5A 5B39G 3OR6B 2J44A 4LLQA 4MVBD 3QUYB 1QFUH 3UJIH 3V4PB 3MRRA 3AT9A 5DJYA 1QSVA 3KWWA 4L05A 3ULVC 4R97B 1F6AA 3DX4A 3ZKSD 3FN0L 4WEBL 5DD5H 3LNDA 3D09A 5IMLA 1WUNT 3TGXA 3NEEA 1ZTXE 4YSUA 1CUOA 2OBGA 3JWOC 3IN0A 1P1ZA 2BNQA 1QKZH 2XVKA 3D2TA 3DMMA 5J57B 1D7FA 4UT7H 3WIHL 3DRTA 3W37A 4OBRA 1UWGL 3H2QA 4H26A 4Q4EA 1KIRB 2H3KA 2OI9B 1D9KD 4HIJA 4OGZA 3ZK0A 3FQ2A 1KCVL 4UT6L 5I9QC 1CGWA 2BSEA 5D4HA 4AYEC 4MFHA 1UZ8A 1C5CL 2RH0A 4G5ZL 4U1KB 2V4LA 1T89A 2A9CA 2W5PA 3QUZD 4H20L 4ELMA 5KBLA 2JE8A 3KPSD 4OGXH 2ZPKH 1JDDA 2P7TB 3EFDH 5TD4A 2BS71 1E9OB 4HC1H 1I3RA 4E9RA 1XGRA 1VA9A 1HFUA 1A6WH 3WIHA 3MCLH 2HFEA 3ZO9A 4IBLT 2QPEB 4XWOD 4XN2A 4MWFA 4UDTA 2FYVA 3H3PL 1D9KB 2FEJA 1YEFH 1MPAH 4WI4A 3WD5L 4UT6A 2WVVB 5IHBA 3ZTJH 4Y2OA 1QRKA 4FXGA 5HVHC 2OYLA 2XVBA 1T2QL 3QUZB 4KKNA 4C56D 3FQRB 4HZAA 3DJSA 3FT3B 2J43A 4FNPA 2WXIA 5CU9A 1FH5H 3Q9QA 3BGFC 2FSEA 3GJEB 2D9CA 4LKCA 4Y4KD 5SX5K 1RURH 4OFYD 4NNYA 2V2XB 2J5WA 5HYSA 4PGEB 2XVLA 3P9MB 1SBBA 4X42A 1E6JL 43C9A 1AIFB 3OHXA 3OGCB 4C56B 5BZDB 1SXBA 2JJWA 3CVHH 1OP3H 5JOPD 1W72B 2UY6A 3KHQA 5D7SH 2WK2A 5PAZA 4ZMPA 2J4WH 4G5AA 4KVPA 4LCUA 4Y4KB 2EIJB 3ZE2B 2NY5C 3BSGA 2E8ZA 1BOGB 4GI6A 1F90L 4PGCA 4EUPB 4TVPD 3L5JA 2FATH 2X6CA 4G8AC 2HKHL 4EAEA 1IEBA 5T3ZL 4ICXA 4CRPA 4HJ0D 5INDA 2VR7A 4PJAF 2BSCA 1TYEB 3QORA 4KV5E 4ABQA 4ESKA 2H6UA 5HGAA 5D9SA 4ONGH 2VITB 4U1GB 3IFOB 5E9DE 4L1HA 1A1OB 3B2UC 4JHZA 3E6FA 1X9RA 3ULVD 1RUAH 4FQHA 3FB8A 2RMNA 4PV8A 1KLFA 1P9MC 3PXJA 4N2IA 5JIPA 5DFVC 1MJJA 2DB8A 1DJIA 4FQJH 2OJ1A 3PJSB 1FHGA 4HT1H 4ZMXA 3H9SD 2H0PA 3BKJH 4HWZB 2C9AA 4OKVB 4HKJA 3GSNB 2VN7A 3DGCR 4L9LB 3WN5C 1Z9PA 4XNYH 4M6NL 1U8MB 4OFQA 1PL3A 1R3JB 5JIHA 3MMEA 1WICA 3VFSB 2Y07L 3WU1A 4L0PB 3DJRA 3A21A 5EO9B 2CK0H 3GJFB 3QJFB 5C0DA 4L8CA 3QJZA 1SFHA 5D2LF 1AZBA 1BXXA 1NGPH 4IIQC 1YQVH 4FCAA 1JBJA 5D7EA 3TBVA 1GY1A 1MW0A 2A9MH 3BD3A 3T08A 2ATKB 1VFUA 2QR0B 3NJMA 3Q8EA 3N06B 5JDSA 2OR9L 3H9SB 3WNNA 3ZZ1A 4CSSA 3KPOA 4PJIB 1OCWH 1A0QH 4JFPB 5D1ZI 1DEEA 2PW2A 4QLWA 4BUGA 4J8RB 1JNJA 4PJEF 4I4WB 4QRSB 5HGDA 3MVSA 5KVEL 2IQ9H 3GSVB 1U8LA 4V1DE 3CCHB 3NAAL 1XGTB 5AZEH 3IM1A 3VXSD 2CD0A 5I9QB 1RUML 3WXWH 5AW8B 4BKTC 2XN9E 1FVEA 5TGBB 4DGVL 25C8H 2FHFA 4PJBE 3VMOA 4WV1A 3QCVH 4J3SA 3IJSA 2EXWD 1DQJB 4Z95H 1CE6B 2R56H 2XRAH 4G42B 3CSPA 2RALA 3GSUB 1QBAA 1BECA 1HKLL 4IKIA 1I9EA 5EB9A 4DP7X 2R39A 3V4UH 3LKQA 4JY4A 4Q97A 5EBWA 1ZS8B 1T0NA 3VXSB 4P5SA 2BSBA 1CVRA 4WF7A 1M7DA 4Z7VB 2BIHA 5HVHB 2WYZA 2X4OB 1LJMA 3N41B 3R06B 4HP5A 4JAMB 1BQKA 1WZ1H 4JJOA 5E2VH 1FG2B 2AEPH 3N85H 4Y4FC 3TWCH 2R69L 4NQVA 3P9WB 3DUUA 4JY5H 4LSUL 2GJPA 3BDYL 5DK3A 2DYPA 5I1GH 4F1SA 4E36A 4NHCH 3LNHA 1OSPH 3NSCA 3HC0A 3UBXG 4BM7A 1U36A 1YYML 2XZZA 4Y5YC 3WLWC 4XNQA 3D4ZA 3RFRA 4MYWB 4HUKB 4PJ7E 3RHWK 1P6FA 5J9PB 3KCWA 4TM9A 3SYPA 5LBSH 3BPNC 2R69A 3B2UD 1IGYB 2VOTA 3B43A 4A7QA 5C9KA 2AAAA 4K7PY 2ZUSA 4BFJA 5I1KL 2K6ZA 2JXMA 1RZJH 4L0ZA 3FU7A 4M6MH 4FZEH 1D5IL 2CJTA 3E9UA 5ID0A 1KCUL 2BP8A 3C6LA 4QHPA 3KPLB 3CZSA 5GJSH 1LK2A 3PL6A 4TLSA 4ES9A 3UZEC 2X4SB 1MCPL 4F9PC 3BT0A 3SE3A 4RMRA 3Q5OA 1XB3A 3P4OA 1J5IA 4JPWL 4PS7A 4HISA 5IQ9A 3J27A 1B4LA 1EAOA 5E5MA 5IKCB 4NZUH 3MRMB 4OF0A 3BZFA 5DJCB 1SDDA 5DZNA 1YEDB 3WN5B 3TJEL 5C0EA 3V5HB 2ZOLB 4FFZL 2DRUA 3EJUA 3QYCA 5FYJD 3BVVA 3UROR 2YK1H 3SJVD 3CFEB 3BSZH 3FQUA 3BUTA 4KBPA 4IIQB 4Y1SA 5CD3A 2G30A 3VXUE 3VFOA 1R3KB 3L4ZA 4R0LA 1B4RA 3F3HA 4MJ2A 1HT6A 1EJ8A 4POZC 3V0WH 4CBPA 4ODXB 1Z5HA 4IS6B 5EU5B 2VR4A 3HNTL 2X41A 4D94A 4KUZL 1SLXA 4FFZA 1G0XA 4LHQB 1M2VA 3SJVB 1CXEA 3AG1B 4D9QD 3VYPA 3ZDXB 1VPOH 1CJYA 4LGSB 1MI5A 3QO1A 5LAXB 4YFDB 5CD5C 4QGYA 3RAJL 4LDOB 3BWAA 2FO4A 1EBAA 4U1HA 1AE6L 3E38A 3QCUH 5CILH 3QXWA 3DIFB 3VXRE 5DLMH 5IHHA 1ZA6B 4XP9H 5DJ8B 4HPOL 1A6TB 1FSKC 4H8QA 5DEFA 2BY1A 4M1DL 2KDGA 4LOFA 4PH8A 3ULUL 1IE5A 5DRNA 3FSWA 3WLWD 3ZO0A 1Q9OA 4ZSOA 3UG3A 5HYJE 2AXJA 2K78A 3EO1A 3K6DA 4FLQA 3TH4T 4RQQB 3DJ9A 1NM4A 4Y4FB 3RZCD 1S7VB 3H4FA 1TVDA 4CSTA 3O3EA 2H3NB 4FFVC 1BQRA 2Y06L 1GCYA 4GBXC 5C0AD 4D3CL 1R3IH 2BP0A 3AM8C 5ABAA 3DRQB 4BFEA 4CDGC 1JF6A 3ECBA 5ICZA 3K5RA 2A9AA 4Y5YB 4PTTB 2AQQA 3K91A 3IDNA 4H40A 3O81A 2NNAA 4KXZH 5F93C 2RR3A 2VB5A 3KYKL 1U8CA 2X6VA 4NRYA 1T7VA 2SEBA 5EIIA 3BPNB 1MFBL 4X83A 5AYUH 1C1EH 5B21A 5IEHB 5B1AB 3G9AB 4OD3L 2BXZA 2VKWA 1IC5L 1K9TA 4FI6A 4N4YB 3UJTH 5LHDA 5ISZE 5C0AB 1EFXA 4O9HL 1OOAA 3RX8A 1KJ3H 1ZY9A 1NCBH 1INDH 5GGRY 4BGDA 4JREC 2ZOWA 3VXMD 1ZV2A 2K0RA 1A7OL 4RBPK 4WI8A 2YD7A 3VSTA 4WI2A 2HG0A 5B4MC 2JIXA 5CEZL 3ILEA 2NSXA 7FABH 4PLNC 1K5NB 2NLJB 4L48A 1ZTXL 4POZD 2IXQB 2NXYC 4YN3A 5BMFH 2JJSA 4OV6F 3LRLA 3FO9B 2Y23A 1VFBA 4PFEA 4QOKA 3IFLH 2B59B 2L3BA 1KPRA 4YSAA 4TYUA 3CU1A 3VXMB 3W5NA 4OCYL 1RK0B 4AQEB 5F7FA 1OD7A 5EUKA 4XCYA 4JQXC 3U1QA 3OQRA 1FAKT 1FFNB 1E8XA 2JB5L 3R7QA 1JNLH 2GY7B 1UXMA 3FTXA 3G3LA 3OKLA 4KXBA 3RILA 2RAMA 3I9AA 2E74C 5CD5D 3VG0L 4XP1L 1AQKL 1I8KB 1SJMA 3TN0C 1CB4A 3L3DA 3LXAA 3P30L 3O9WC 5ITBL 2OMNA 1IM9A 2ZXCA 1F2QA 1I3GH 2ZUWA 3CPLB 3MV11 4P4RB 2VUKA 2G2RB 3DGDA 3G6JE 4CC1A 1QHPA 1UZ6E 1JWSB 5CWSB 4RISH 2QEJA 2NX5E 2JLLA 4CC4A 5JHBA 2NY1C 3FONB 5D1XC 1FCGA 1GYWA 5DURD 4Z5RA 1Q4NX 3NJKA 3L3GA 3L9YA 2WY3B 3OWRA 3QEHA 3K6SB 1XCTA 2DQFA 3AY4C 1XSIA 3RZWA 5B7MA 2AQNA 4HZLB 4Z7QF 4IU2A 1LEIA 1FSKB 6FABL 2F7QA 3GNMH 2A4CA 4FFVD 4GBXD 1T0OA 1S5HB 2AEWA 4X0KB 2H8PB 2HP4A 3WKMH 1O7DE 3RJQB 5EEXA 4R90L 2MJWA 1QBMH 2CIIA 4HIEB 4HWNA 3UP6A 4WKZB 3QUKB 3EYOA 4GRWB 5HYIA 2Z7YA 5DURB 1MIMH 4E5XB 4G72B 1XVSA 3AROA 1EEZA 3PS6A 3U9WA 1MWOA 2QMKA 35C8L 3MLXL 1NDGB 3E0GA 2XIBA 1DVFC 3DX7A 5D5ME 4GBXB 1BMGA 1T7WA 2BVUA 2G3MA 2AITA 3QIWA 5H37G 1B2YA 1G6RL 3RIAF 5I1DB 3TONA 3KM1A 2FZ3A 2E8YA 3CLFL 4X9IA 3QDJD 4YPJA 1B3JA 1BPVA 3BFOA 1ACYH 1U8NA 5AUMA 3NCJH 4JEGB 1CG9A 5TFSH 4UTCA 5B1KA 3S3SA 2GTQA 3SDYL 5EBLA 2ZX6A 3CDGA 4QPEA 5I66A 4A7GA 4I5BA 4OM0H 3S5YA 2NXYD 3MV7D 4C83B 4J2QA 3U6XA 5I15L 4XR8C 2XBZA 2VNCA 4JREB 5DMGC 1G6RA 1KBVA 2H1PL 4YQXH 1VLXA 3PYCA 1W6WA 5DI8A 2VABA 3RL1A 1G9MH 5IT2L 3QDJB 3WELA 4U1SB 1OGPA 1FF5A 2KLRA 1WP6A 3DUHA 3Q8AA 4JMNA 5E9DA 1LK3L 1MCNA 3QCTL 4F7PB 1DJWA 5LB1A 1IJ9A 3QO0B 1MCWW 1QUNA 2FJGA 1QNZL 1J8SA 2X40A 2XX1A 2VDQH 3FSZA 4XC1H 4YSPA 3T0BA 5BVJA 1TJGL 2NXYB 3MV7B 4GJTB 4NC2B 3TN0D 4AQ8A 4BQCA 1RZIA 2AJSH 2WLLB 3MGAA 2BS9A 2WXPA 3O9WD 4IMKC 4KX8A 5FYLL 1ZLWK 1C5BL 3CN4A 3X11A 5KYYA 5FEBA 4AGQA 4XN4A 1IARB 5E5RB 2DIBA 2YAQA 3OJVC 1O7SA 2J57A 2ENJA 2AXWA 4CSZA 4P2RD 4P2OC 5DJXA 2XWCA 5T5NG 3SZ6A 3AWEA 3NN8A 2VIRA 5C6WH 5GHWH 1RZFL 2NY1D 1IFGA 1LO2L 4GMSL 3PAVA 5D1XD 2VZ1A 3TN0B 3AAZB 1D6EA 8CGTA 1OEZW 1WCQA 4GG8A 1DLFH 3RUGB 3O9WB 1RHHB 3X1BA 5AW3B 4OZIF 4OV5A 2FX7H 1DQQB 5C07E 3WFBH 3VFMA 5ACZA 2HRGA 2YUZA 4OZFG 3GUTB 1X7QB 3OXSA 3OKKB 5DTFA 3ZQWA 1OSEA 1TITA 4HIHB 1YECH 1TU2B 5AB2A 3PRZA 2EDLA 5IHZA 4P2RB 5I8OL 2X87A 3BVXA 1DHKA 4LNRB 1NJ9A 2NY1B 3FF7A 2WMPA 5D1XB 1HQ4B 2FIRT 3HBQA 4KTYA 1G7QA 3HLAA 3V6OA 4GP5B 4UOZA 2DBLH 5DSCB 2EJ1A 2ZSWB 4XPTH 3MYJB 1JGLH 4RMVA 1T5XB 5E1QA 3D12B 1DVFD 5CNHA 4F2MB 2DIAA 4PGDA 3ARGA 2HWZH 1VAHA 3QQDB 4XPBL 4LCCA 3AACA 1QFWM 3AY2A 4R9HA 1RZKC 3PWLB 1T0MB 3NIGF 4PGBA 4LIQH 5F7DB 1O9WA 2A7BA 1RZGA 1ND0A 4M1GL 4JFQA 4QRAA 1ZLUH 3MLVH 4GQPH 1EEUA 4P4KC 1E40A 3FQTA 4JUTA 5EULV 4W6XB 5HYFA 1H15A 1MCFA 2OXHB 3MSPA 1FA4A 4KQ4H 1CVSC 1OQXA 1DVFB 3F04A 4R96B 1U0QA 5AZ2H 4ADJA 4KI5D 1BM3L 1K4DA 2IAND 4JO2L 5GSRB 1TZAA 4PRBA 4YR6A 2BZDA 5C70A 1XZ0B 2BDNH 1E43A 4NENA 1Z5LA 4PJ7A 5DMGD 3GXFA 3X14B 2XXCB 4FQ2L 1NGQL 4JRLA 4NIKB 1H0DA 3HN3A 2O61A 3SGKA 2OMZB 3ZKXC 1KC5L 3T71A 4XCEA 3EG9A 4XVOA 1QW9A 3ZE0B 3NZ8A 2G3NA 4AYFA 4ZNEE 3VE0B 3BH9B 5EBMB 2IANB 4DP4X 2YSTA 3NACH 4F1ZA 3CZEA 1EHXA 2WQXA 2VUOA 3Q6GL 2JCCE 1OAYL 4TOYH 3E8UL 4UILL 2Q3ZA 3O3AA 2GPZA 4P2OD 4DZ8A 4NAMA 1TJMA 1MW1A 1XT5A 3BUQA 4JX0A 4Q74A 5H94A 1RUKL 1RXLA 2BMKA 3QZWG 3RURA 3H56A 2UWEE 3DVNA 1LNUA 2E7CA 2ROYA 1BM7A 4DFIA 2J55A 5A6LA 1YC8A 1EO8L 1X6LA 3SZKC 1F1AA 4KY1L 1ZWIB 3QXDA 4P2OB 4GG6F 3VXUA 4ZUUA 1AR2A 3Q2WA 5C6TH 4Q2ZB 4XNMB 1CTNA 1QZ1A 2D3LA 5BXFA 5TDNB 4QRTA 4DP9X 1PS3A 4WSKA 4HETA 2HJKB 5HPOA 2XFGB 2MCPH 4A6YL 5ESQA 4YLBA 4D8PB 2P8LA 1NEZA 3HZMB 1JI1A 4BWWA 1BWMA 2YBGA 2JTDA 1JF1A 1QBLH 1QFWL 1YEHL 4Y9GA 4D9RD 1EZLA 4MAYA 3WTWA 1CR9H 2YA2A 4XC3H 1MCBA 2HX9A 4MA7H 4LCVA 3LYRA 1RMFH 2VGLM 3WUWG 3VXQA 5E94B 2QQLH 2A77H 5I6OA 1A9BB 3QHFH 3VXRA 4P4KD 2GBTA 4YNYA 2MQ0A 4A6YA 3HMWL 5CKAA 4QKXB 1YNTF 3BAYA 3VD2A 2CLVB 2XLLA 3DX9A 1LDSA 2ZUTA 1RIUL 3QIBC 1ZEAL 1HHGA 1U92A 4OIIH 5HYJA 3WY1A 1ZVSA 4UV7H 1QLRB 4F20A 3QJVB 3D4CA 1QI3A 3A24A 2J88L 2KL6A 2DLGA 1X3DA 3IXAB 4K23H 4WU7B 4Z7AA 2EH8L 4J6RL 4P4KB 5GGVY 1ZVYA 3ZZQA 2D0GA 4N0FA 3HBPA 3UPRB 4JM4H 3ZT7A 2APFA 1AXTH 1DLHA 3MLZL 5FS5A 1E2ZA 4WW1A 2WN2A 4I3SL 4YLQT 4Q52A 4UOW0 3DSFL 3JXAA 2KBGA 4XN5A 5GGUA 3ZJAA 2YPLD 1ZT4B 4LLWB 2OP4H 4DCQA 3IJEB 1LO4L 5EFIA 2JKLA 3A4EA 2NXZC 4NWTH 3STBA 1XD1A 2Z64C 3T2NH 4HIIB 3HBGA 3WEXB 3EJYC 3ZKXB 3SOBH 3AABA 1EIBA 4YXLL 2ALWA 5ISZA 3I75B 1P1VA 2A6KB 5MP6L 4EQ3A 4PJAE 4O2CA 3MNDA 4FJ6A 4MNQE 3V0JA 4X5QA 2R2EB 3POCA 4WWPA 2FEEL 4ERSH 4FQXA 2F0CA 2JV6A 3NFPA 1IUZA 4LARH 4EKJA 5HGBA 2VMEA 2YPLB 2ZCLH 3TF7C 2DM4A 3FPYA 2VZSA 5CINH 4IKNA 3L08A 1KXQE 4ENZA 5I1LA 4G80A 2RB8A 1H3PH 4M5YL 4P49A 5F7NC 3TIEA 3M88A 2OSLB 2QHRH 5ESAA 2ZP8A 4OIFA 1Q8MA 3HPLB 5IOPA 5FF6B 2AJ3B 5F1NB 4NUJA 5HHVL 4PM1A 2P5PA 4A2MA 5FCSH 1OW0C 4PR5B 2GTZA 1J8HA 4NO3A 5IVZA 2DM3A 2FR4A 3X12A 2Q76B 1UOKA 2DQGL 3U0TB 4JFZL 4Q6KA 3N1QC 3IGAB 4RX4D 1CI5A 3KG5A 3LHAA 3NPZB 2FGWL 2VE6A 3Q8CA 1S9XB 3K0YA 3PUUA 3TH3T 3NA9L 4ONOA 2G4GA 1HAUA 4KMTH 3I02B 2BRRL 3DX8B 4MB1A 2UYLA 4B60A 1S7WA 3JT2A 4NRXA 1OAZH 4R4BB 5D1ZA 3B8SA 4IQHA 3RWHA 3P77B 4B6ZA 5BZZA 3STLB 1P4LB 3MXVL 3VXOA 2M8XA 1JXFA 1TNMA 3G6JA 1KFAH 4OCRL 3BKCH 1HK6A 4M6OL 3V79C 2OXGA 4B9KC 4URTB 3QIBD 4S1RL 5K9OA 4M3KB 2IH9A 3S4SG 3U2SA 4Y9FA 1BHGA 3WBDA 3ML8A 3CE1A 2FLMA 3A6BL 4DSYA 3GDCA 4YFEA 1X7SA 3HA0A 5JDJA 3UEZA 5D1QC 5E6RB 4BQ9A 3H6JA 1FUNA 3B5GA 4JO4H 4U1LB 4QXTB 1RJLA 2MNWA 3WG7B 3FBKA 3PWJB 4N2BA 2WCGA 2ENQA 4DN3L 1UH2A 5AW5B 5A16B 3QIBB 3BPLC 2HFGL 2A6JA 4JLRA 3MRIA 2XKNA 1I8IB 3UYPB 3UIYA 3LKPA 3N1FC 4Y1AE 5MEQA 1MELA 1U58B 1W0WB 2XTJD 2Z31A 5FYKU 1FVCB 2NXZD 4ODVL 1OAXL 3EJYD 4WGWB 1D5XA 4H0HB 1NICA 4P23A 4XTRC 1DL7L 4K7FB 1M3JA 2CLZA 3L17A 2AEOA 3FO0H 1TTCA 4X5PA 4YHNB 4XNUH 3W0WD 2OJEA 4OAWA 3SKOA 4PSPA 2DI9A 5IFHH 5LVEA 2AQ3A 4CNIA 1V8HA 2BVOA 2ADFL 3CZFB 1WZKA 1RD6A 2P5EE 4FQ1L 1OCCB 3S36H 3S3PA 2NXZB 1DBJH 3F7YA 1GOHA 1NBQA 1AOZA 3D25B 3ES6B 4J3OG 1F6LL 1NGXB 3CFKA 3PABB 3IMBA 2R1YA 2DF3A 4NJ9L 2UVFA 5ETUB 2O4EA 3W0WB 4YGVA 3RNKA 1F3DJ 2YMOA 2ZAIA 2AV7B 2EE2A 4XP6H 2O6EA 2HN7A 1NFDA 1UB5A 3C6EA 1JFQH 4FFYL 1BYPA 3QULB 3C9NA 1P4BL 5KUMA 3SBWC 2JSFA 1G9NH 1Q94A 1BJ8A 5H2BB 5TE7L 4L3EE 4N8VA 5F71A 1F58H 1SMDA 3MDJA 4ZUTA 3Q1SL 5EZJB 4BBWA 1NFAA 3NJLA 4LPWA 5C0IB 1A6ZA 1AJ7L 4WEUD 1FRGH 2R83A 1M71A 1NLDL 1QOKA 5FOBA 2FNWA 5SWSD 3FMGH 4PJDB 4YIQA 3EFOA 3D08A 4FFYA 4OZGA 1FYTB 3RP1A 4WI0A 1VZHA 4JKPH 3GTVA 1V7NH 4MXQC 1H3XA 1KB5B 5C0CA 1KWGA 4R3SA 4N22A 3COOA 5SV3A 4ZW3A 2AQSA 4NJAH 4ZPVB 2TSBA 1T2XA 1QD0A 5F7EH 5D1QD 5SWSB 3SE9H 5F9DC 5CLWA 3PQYE 1E9QB 1Y0LB 1T1XB 2F53E 2X4RB 3I50L 4OLYL 4ZMZA 4AW4A 5IVXB 3B2PA 4HPYL 1R47A 4BSJA 4N2KA 2DWEB 4PTUA 2ED6A 5GGTH 3APCA 1R3LB 4LSPH 2AKRB 4MMXC 2X2IA 5IB3A 4TUOA 3FFOA 3QFGA 2FT7A 5D1QB 5FYKE 3IPFA 2E7HA 4XTRD 3IJ9A 2H9GA 3EJTA 4HS3A 5SV4A 3KS0J 3IGKA 1U2YA 2Y7MA 1MREH 2QVIA 1E9PA 2C9PA 2D4FA 3ESUF 1KIUB 5FKPA 5GRZA 3T4AA 1CFSB 1BEYH 3BPLB 2H26A 3LQAH 4ODSH 1GIGL 1IAIH 2WV3A 1BWWA 2X28A 4X7CC 2F2HA 4G83A 3DSNA 5ANHA 5E2WL 4EBQH 1BZ7B 3AQXA 4HAGA 1T21A 3UYOD 3FTGB 2Y7QA 1T4WA 4EEEA 3MR9B 3VB9A 4LVEA 3MRBB 1NEPA 1DBBH 1OTUC 4IGBC 4IRZL 3GRWL 2NY7L 4UIKL 4DHLA 3TEWA 2JELL 4K15A 1QASA 1IAOA 3DGGA 5L7XH 1RU9L 1UWEH 2MFNA 1YNKL 4DWHA 1XAUA 4Y2NA 4WFED 1YJDH 4YEEA 2Q87A 3IDIA 4AZ8B 2A9NL 1F2XK 5ABZA 1SXCA 2Q5BA 4N90E 3HUJF 3V2AR 4YDVB 1WBXB 1TYRA 3IDUA 3L7FB 3LIZL 2AS5M 2FEDC 4A68A 2BRQA 2EH7L 3EZ8A 3MC0A 5AVSB 1FZMB 4X4ZA 3OMNB 4IRZA 3GRWA 3VFPB 3MLYL 3WGUB 3IFPB 4ZNEA 1BVZA 3NCWA 3OC8A 4UI2A 4G8EB 3LKSA 4LGRB 4ORGB 2BVPA 3NSJA 2Z8SA 4AQOA 1J05A 3GRBA 3TBTB 4JHWL 2JCCA 4IOSD 4HS8H 2XA8L 5KYNA 2DYRB 1TUPA 3JTBA 2F8XC 3LIZA 3OB0H 4KH2A 3PF2A 4UANA 4MXQD 3TTYA 2YBRA 5IBUG 2I25N 3G6DL 3CPUA 1JTOA 4KRLB 3GZQA 5JPMC 1RUQH 1XF3B 2QVFB 1I85C 2UWEA 4D7BA 3V95A 2WBKA 3MACL 4E42B 3D0VB 1CXKA 1ASQA 3S8FB 4G6ML 3CSTA 3QNXB 1S9WB 3EDKA 1R0AL 2BHUA 4MXVF 1G1YA 3JVGC 5HDWA 3P0YH 4ZFZA 4A38A 1QUPA 5EOQH 1DVQA 4NNPL 5GRJH 1F4XH 2VR3A 2ITCA 4Z3IA 5ERWB 4HOMA 1JXKA 1LD9A 5EDSA 3DOSA 5H37H 1HE7A 5D7IF 1QI4A 1TVHB 1H8SA 1KJ2B 3B3IB 4NKDB 3WS6A 2AEQL 5B1JA 3PNWB 5E00B 1TF4A 1U8QB 4XX1G 1NGYA 3SDAC 2CDEB 3O6LH 2V17L 3BESR 3RBSA 5B3NA 4X4ME 4NPKA 6PCYA 1DDHA 4Z77A 1W8OA 3GMMB 4Z7QE 2BIIA 4MMXB 1IC7H 1CC3A 2L04A 3II3A 4N25A 4Z0BH 1E30A 2HA1A 1MCDA 2C7UB 2DJUA 4IGBD 4N20A 4GI8A 4PJGF 1F02I 4QF1A 4TULH 4AIZB 2OLDA 1F3JB 5CM1A 1U30A 5FO2A 4AEIL 1AGFB 5FKAA 1HH6A 4B50A 5JQ6L 1L0PA 4ELKA 4FABH 2IVFC 2LU3A 3JZ7A 5JIDA 1ORSB 2FEDD 4PLKC 4HJTA 1FO0B 5BRZD 1QP1A 3H9HA 2XCMC 1N59A 1TTRA 1ZANH 3CFUA 4IGBB 4IEFB 3A6CL 4CILA 3NABL 4DKEH 1A4CA 1KB9K 4LKXB 4WWKA 3S88H 1S6NA 1NAMH 4PRID 4RAUA 4WUUE 5DS8B 5LBVA 4ZRGA 3GBLA 4BDVB 1RIHH 1AZUA 4JM2C 5IF0B 2WXQA 3K6OA 4KGLA 2EVJA 1T22A 2CGZA 4AQAA 2R15A 4NKIH 4NQCE 4OZFH 3D85A 5BRZB 2CUAA 1DJYA 3QWOA 2ADGA 2VXVL 4MNQA 2DQTH 4D0DA 2C1OA 3Q9PA 1U2HA 4XN1A 2AK4E 1E6OL 1EAPB 1AP2A 2I26N 1OZUA 3KGSA 4H25B 3L95B 3TCLB 4NZTH 4WCYH 3RB7A 1BAWA 4PRIB 5IW6A 2QKIA 4LHUA 2CXKA 1NA8A 5JHLL 4LOEA 3GDBA 3CXHK 3MRKA 4DP5X 1BIIA 4ZW6A 3VFVA 2YSSB 3V9CA 5E1AA 2F7OA 2Y72A 3RX9A 3F65A 4NQXA 5TF1H 3HZKA 3OG4B 5JPMB 3TVMC 1NUFA 4WW2C 2B4CC 1U8JB 2KQMA 1A7NH 4CMMB 4YH6A 3F85A 3TV3H 3D9AH 3ZHFA 1CD1B 2CRYA 3OKNA 1KOAA 4A63A 4KUCD 2E6JA 3O11A 5I2IB 5JHLA 3ATAA 1J9TA 5DUML 1T80A 3Q5YA 4ZPTB 3HAEB 1UD3A 3QWRD 3CHPA 4OZHB 1GGBL 1GC1L 3PDDA 8PAZA 4BQBA 4OZIE 3S8WA 4JRYD 5I1HL 1KB9J 3B34A 3C5ZA 3D33A 1OB0A 3JZYA 4P07A 3F5WA 5E8NA 4YE0A 3CG8A 5E23A 3WEBA 4YS4A 5F9JA 5CHNA 4NQDE 2VLMD 1DUZA 4N85A 2VN4A 3D69B 3T3MB 1SXNA 5HDOA 3PWPD 2YA1A 3ZUCA 1GJUA 3SDAB 4Q9RH 1FZKB 4L29A 1RUPL 1LMIA 4JRYB 1IAII 4NHUB 1N5AA 2YAPA 4HKBB 2X05A 5FK9A 5CJQH 2ZOKA 3OLEA 4I3GA 1NC2D 4MA1C 5JUEH 1EMTH 1J48A 4XBGA 1ZGLP 1WTLA 4PLKD 3D05A 2WQAA 1TKWB 5AW0B 3OJDB 4TSCH 2Y1VA 4ZDHB 3I84A 1U8OA 1OOWA 3CXHJ 3JUZA 3GTNA 2ZP0T 5DMJB 3DBSA 1WGVA 2E9GA 3PWPB 3NIGE 2DLTA 2ZZUT 4POUB 4NZFA 1NFIA 1ZHBA 4EVNB 1SJEA 3QHZL 2FQGA 1KACB 4HH9B 3OKEA 4Y1AA 5BV7L 1E2VA 1ZCRA 4WUKH 4JM2D 4OJCA 3HVNA 5I23A 1ED3A 1S78D 5CKGA 5JR1L 1A6UL 2IDSA 5L9DH 5B8CA 3EYQC 3GSXA 1MZZA 3BPCA 1I9JL 3EYSL 4L4TA 4QXUH 4DP8X 3RFZB 2VL5B 4LU5L 4OD2B 2I9LA 4G1EA 2CGRL 4K3EH 3KW7A 4NM4H 4WHTB 3KPNB 4NPJA 1FZJA 3VFRA 1T1ZB 3GF8A 4NSKB 1INEH 5L88H 4YWGL 1FFOA 1O9ZA 5JW4M 5SWQB 4JM2B 5BZWB 3WDJA 4M4PA 5D7LA 3MNVA 4XVUC 3QWQB 5FOJA 5IV2B 3QSKB 3TVMD 1H8LA 1N0LB 1HZHH 1EZVY 4JFSA 4UOQA 4LLQB 3FU9A 3H7BA 4DEPC 3QPXH 4OUUA 2DW5A 3O3DB 3X1GA 5DRZA 4H0GA 3KYNB 2CHNA 4Q7DA 5ADPH 1PX8A 5IM7A 2Z7ZA 1B0RB 5KVGE 5CBAB 4L3EA 3HC4L 1FDLH 3S2CA 2DIEA 4TSAH 4AEHH 3Q2NA 1IGCH 1QLEH 3CQPA 2R2HB 3MCG1 1WC7B 1JVLA 1YRKA 3MV8A 1LEKA 2DQIH 2G75A 3TVMB 4WW2B 2FB4H 1CICD 3F8UB 3QNYA 1MNUH 3QUGA 1JZGA 4PYGA 1HE8A 3LH9A 1JGVH 1XIWA 1JNNH 5D7JA 1T3FA 3ISRA 2C4FT 5GGSB 1C9SA 1GGCH 4FEMA 4X6CF 4WV1C 5MEPB 4RGNC 2YKLL 2H32H 3CN2A 4NRZB 1NIDA 2IH3A 2NY6C 4HCRH 2NRDA 5IWLC 1ZA3A 2O1AA 3LN4A 4MA8L 5EO0B 4V11A 3AU1B 4DT2A 1SMOA 3PGDB 4GKNA 1SN2A 2ORBH 1QABA 4J3XA 3ILPB 4B5EA 3I6KA 1S7XB 3NCYP 2F53A 2EKSB 4QI3A 1AKPA 1B0GB 2IOOA 4JDVB 4PQXA 1FLRL 3IVKB 3VYNA 4AYGA 4KJYA 4OGAC 4C59B 4LKCB 4G7YL 3NIDE 5JQIB 4WWOA 4XI5C 4MXWL 2R8SL 4MA1B 4NNYB 2XFXB 5HYSB 2XETA 4MJ6B 4OLWH 1KY6A 2ZAHA 3EJRA 4JY6A 3B2MA 3EYQD 1XSOA 5D70L 1JPSH 5C0JB 2EUVA 3ZTDC 2CO7B 1SEQL 5I1JL 2OJZH 1VJSA 1Y6KR 4AGOA 4ES8A 2X3CA 2XWZA 3KMDA 4HEMA 4Y5VA 3SQOH 1WAAF 5BW7A 1KJVA 2BM3A 5EU3A 1BW8A 2BSTA 5ALCL 1N2RA 2AXHA 1U42A 2CLRA 4PGCB 3C8KB 4FN0A 1HQRB 3OKOB 2A6IB 4ZMYA 4JKNA 1FE8H 3VWKC 4XVUD 1Z66A 1MCHA 3WLBB 3ARYA 1MLBB 2XIIA 1VCBC 1DE4B 4G8FA 1WHPA 3NESA 3CLWA 4A04A 2ZUUA 5DMYA 1UASA 1YN7A 1DQVA 1NCCL 3ECQA 5E6UB 5DJ2B 5F72S 3K2UL 5KS9B 3FB8B 1J11A 1JXGA 1Q0XL 1MF2H 3VFTA 1I1AC 4X8JA 2EXTA 4HBCH 4PHXA 4FD0A 5I1AB 3SSGA 2P4AB 4XOEA 3N0PB 5KJ4A 4WFHE 2VXTL 2EVHA 3FB5A 1MFEL 5GISL 4M5ZL 4OFKA 3FUNA 4RH4A 4DEPB 4L8CB 4KDTA 5KBKA 1ACZA 1NCAL 2EDJA 4JPVL 4ONFL 3WFZA 1JWUB 3MZTA 1OGSA 2E76C 2ITFA 3PP3H 4HHGA 3JV6A 5MEOA 5MERA 4KY2A 1WFOA 2WTOA 1GTFA 5CUSH 2YN5A 3RPIA 2NY6D 3MRJB 2Z7WA 4XCFL 1AHKA 1ZHNB 1OALA 5C08D 4HOWA 5GS2H 4R8WH 2D9QB 3SDXE 3MROB 3T1FA 3WJMB 3CMGA 1HL8A 4K7PH 1EUTA 3SY0A 4WV1B 3NRFA 3DUSA 1A7QH 2QADC 3QXAB 4G8GE 4LEXL 4RGNB 1TZGH 3NFSH 3X1FA 4BFOA 3FOLB 2BIQA 2PW1B 4BSVA 4KI5F 1TT6A 4A2GA 2AERT 1O6SB 2DAVA 2DIJA 2NY6B 1RJYA 2KQNA 1SEBB 4OGAD 4D9LH 2XNAB 2Y5TA 1PZDA 3HC3L 5C08B 4ALAC 2W60B 4X7SL 4HX1B 3HE7A 3HFFA 4XI5D 5IR1A 3EBAA 1T0NB 5GZNC 7TAAA 4E9QA 4NPYB 2X3AA 4EOWL 4JFXA 1N9PA 3GRGA 5JOFB 1UVQA 3HMXH 1JUFB 3JWDH 5EU4B 3BVNB 1G4MA 3FQXA 4X4MA 3HZVB 4H2CA 4NXKA 5J89A 1J12A 3WY3A 5F88B 1RLWA 4J7RA 3U46B 5EORH 1WFNA 4P3DB 1H6TA 3HC0B 3VWKD 3FUJA 4DW2L 2K70A 1AFVL 2R29H 5I30L 4XBEH 1QMUA 4MBOA 1A4KA 1S7SA 2GYSA 4FLOA 2EC8A 5DZAA 4KHXL 3U0WH 3U1SL 3PPEA 4LEBA 3H4HA 3BCFA 3CSGA 2XZAH 1SMAA 3LPFA 1OB1A 4YVNA 2XX0A 3ZT5A 4UQBA 1G7PA 1KTLB 1B2WL 2F8OA 4LEEA 5F7KC 4MRBA 4P46A 1JTTA 3EDEA 3TESA 5KSUB 1I1AD 1CLZL 1QSFD 2HRHA 1ILSA 2RCSH 1TJHL 3BGMA 3VWKB 2VRQA 4ZAKC 4I1NB 1XGQB 4ZXBC 4BK4A 4KO5A 3BJLA 3K4AA 3O2WH 1S46A 4X6EA 3MA7B 1NMCC 4WUUA 3ZX1A 2GJRA 2R1WB 4ZOBA 1TJIL 2R0WH 2CKBB 2XQYG 3CWGA 4CVZA 1SLUA 5GZOA 1F4WL 4XPAH 5DHYA 1I1AB 3BZDA 4WLCA 1QSFB 2VW4A 3AJ7A 3H53A 1S3KH 1UXSB 2BVTA 3KPSE 4JZNB 2BHYA 1JPST 1NCJA 1OP4A 2ZUQC 1TLMA 4XMUA 4X6FA 2X4QB 4LPYA 2NW2A 3QZLA 5HI5C 4RWYH 4MSWB 4QXWA 2HG5A 2ZONA 4V33A 3RNQA 1NFKA 4LRIA 3QC6X 2WBJA 2YC1A 1QO3B 3NTCH 1BLNA 4LLAA 3WUWB 2QADD 3CVCA 1EGJL 2AZAA 4HD5A 1Z3GH 4RDQF 1XV8A 4C56E 4JVUA 4NQUA 3KJ6H 5E2UH 2XWEA 2YD8A 3L3IB 3D51A 5FFOA 5F1SA 2HLFC 4J28A 4BFIB 3AS3A 4O02L 2H2SC 1BP3B 1ROCA 1UXLA 4N8CH 3SKUD 4L2YA 4QEGA 3V6ZB 1CBJA 5GZND 2QLYA 3WIFB 2A73B 2CJUL 1IKFH 1U3YA 4ZUWB 4AOFA 1FORL 1S9YA 4HJJH 2YR3A 3QEGH 4L8DA 5B38A 3BZ4A 2QADB 4JFWA 2FX9H 4F7MB 1EGJA 2WSPA 1A22B 2Y25A 4YFLI 4AG4L 3U36A 4G1MA 2AAVA 4LPCA 3QNFA 4OZIA 5JOPE 4Z23A 4XOAA 2E3VA 3CQFA 4NUPA 5KSVA 1DN0A 1E7UA 1HOCA 1VGEH 3MLUH 4KROC 4O02A 4C57C 2CO6B 3AFLA 3KVPA 1CLOL 1I9RL 1TEGA 3UC2A 2IPUG 3BO8A 4ZUVB 4JFEA 4TVPE 1OAKH 4FQCL 1MEXL 4YO0B 5CAYB 2KZKA 2FH8A 1SOSA 4NI3A 1MZYA 1QSED 4QT5B 2R2BA 1WH0A 4J3OC 4GIAA 5KJRL 3OKYA 4H88L 3BD5A 2JB6B 5IEKB 4NN7C 5F9WC 4K94L 4OGYL 3QFJA 5DR5H 5AVQB 3VI3F 3RDTC 3ZPDA 2PMZA 4ZTEA 2HXAA 1UM6L 2EDMA 2W80C 3H9SE 3L4WA 4ZAKD 4PJIE 3D52A 4TUKH 4ZXBD 3GFUA 5DUPH 2J1WA 1H8NA 4LF3B 1NDMB 3O4LE 3TO2B 5EC1A 1QSEB 1ANUA 4GRLA 2QVMA 4N5EC 4M7LL 5AEAA 3SCMC 3SQBA 2KHAA 2EUXA 3VFWB 4RFEA 1HILA 5J7CC 4RIRA 1VEOA 1ZLEA 4L5FE 3FKUS 1T4KA 1Y1DA 5FFGA 1OTSC 5HHQA 4ZAKB 3FB7B 5FA4B 4R7NA 5FYJU 4ZXBB 2X70B 3CBRA 1K6QL 3A4AA 3B9EA 4GMTH 1BD2D 5EHFA 1CDJA 1CO1A 2EDEA 1AD0A 2YQGA 3HUJE 1NMCB 1Z9LA 5GIRB 5JORA 4X5WA 2XA3A 1ZSHA 4XXCC 3VXSE 3PAYA 1N7ML 3PHOA 4QRRA 2DY2A 3PHQA 1M1XA 5CCHE 1IO4C 3NFNB 3RIFK 2IMNA 4P5KA 5CN2A 4Z7VE 3HTLX 2ICCA 1Z9NA 4R4FH 1FNGA 1MWAL 1Y6NR 1KPRB 4ZTOH 4HUVB 5HDQH 2HLFD 2ZUQB 1BD2B 3N04A 2H2SD 3P02A 5J1AB 3RIKA 1PD1A 1XH3A 5F8QC 3ABZA 3UOAB 2C3VB 2YEZB 1EDHA 4TUJA 3W5MA 1BZEA 2YXMA 1KJMB 5AD0B 3HNSL 1OM3H 1RP9A 2Q7NA 2IFGA 1FZOA 3MBEA 2WXRA 2EKJA 2BH0A 1OF2A 5BUPA 1MWAA 1Z0NA 4X80H 1K8DB 2J1ZA 3EO0A 3CFMA 4KROD 4WZ9A 4B7LA 4ZS7L 1CE1H 5LNGA 3JV4B 4B41A 2AVGA 4EI0A 4O5LL 4PU2A 1D6VH 2VJ8A 4JRXD 5IW1A 4G3YL 1S7UA 4UINL 1BGXH 2WQRA 2FE0A 5F7WC 3GGWA 1WAPA 2EDNA 2XWJA 3KL0A 4J3OD 2DWXA 3T5WA 1JZ7A 2A6DB 1OKEA 3P4NB 2JK5A 3KHOA 4NQQA 3C2AH 4KROB 2VR8A 4WHDA 1UOWA 1BVLB 1VEPA 3RDTD 1P84K 2ITDA 3ARVA 1RY7B 3C6SA 1JHTA 2YPKA 5LQBH 2W0LA 3WIIH 4F8NA 4JRXB 4M7JL 1I4FB 3ZL2A 3CFDA 3UJJH 4ZFQA 3OBAA 1GAFL 4XVSL 1FQ9C 1U8HB 1KXVC 2GSIA 3W56A 2ICWB 4ZD3H 3UO1H 1JGDA 2RJMA 3REVB 5D7KD 4N5ED 3LS5H 3BKML 3SCMD 4HA1A 1TCRA 4NN7B 5LCVL 1ONQA 2FTAA 3VXTA 3O4OC 5F9WB 4D7PA 1PCXA 4TRPH 2DLIA 4EIBA 5IJBC 2WXFA 4PJDF 4EQ2A 4PJGE 4KKLC 4LQFH 3UBHA 3RDTB 2WW8A 3W9EB 4AIXA 4W6WB 2DQ6A 2F15A 1OTSD 1G7MA 3X3GL 1GZPA 2CHZA 3OAUL 5FHBL 1KPVA 4E41A 3GQFA 1BJMA 1RP8A 4DKFH 3U6RB 1EJ6A 4PP2B 1NBZB 3SCMB 5G55A 3ZDXE 2WO3B 3QJQB 4MGXA 3MUJA 5LCVA 4LHJB 5KW9H 5J6GA 3T4YB 1BZ9A 3I6GB 2F54D 1F1GA 4PRHD 1PG7L 3RY6A 3ZR6A 1BSIA 5LGHH 4H5SA 4LSSH 1VADA 1GA2A 4O58L 4XPGL 1ORQA 2VQUA 3OQ3B 2GJJA 3UGEA 1BZ8A 3LRSB 1NMAL 1I1YB 4YSTA 2X42A 1FNFA 3ARDA 2QDWA 3JYBA 4D9QE 1FJ1A 1L5GA 4JO1L 4HUXA 1KN4L 4G43B 1YAZA 4XO9A 1ZTMA 2F54B 2DTMH 2DQHL 3BJ91 4C4UA 3HS9A 4Z3FA 2IDQA 4GI9A 4NI6A 2VMDA 3LV3B 4Y16A 2ODIA 3S9DB 3LKOA 2VXSL 5I0XA 4V1DD 2E27L 3GMRB 1SLVA 2CDFB 1AMYA 4JGNA 2YPVL 2HJFA 3NVQA 4R7XA 3C5JA 3V9FA 1M1SA 2XN9D 4EXKA 5KG9B 3IU3A 1SYSB 1CFNB 1U6AH 5FA3B 1I1FA 5D6CB 3UTTA 3CNKA 2GJ6A 1OPOA 3K74B 5IROA 2GC7C 4Z7OF 1J1OL 3KGTA 1E3XA 1D6EB 1FNLA 2BINA 3T3PF 1A4JB 4HD9A 2EADA 4OV5B 2BVEA 4NDMB 3PV6A 5AG8A 3HG4A 1XCXA 4FI8A 3N40F 3NDYE 4ODWA 4V1DB 3D5OF 3ROOA 1JYVA 4M8QA 3SDXA 2NDGA 2YPVA 3NDZE 2DL2A 2O6DA 2XN9B 4ODHL 5F0MB 1BXUA 3MUGB 4PJBB 2CO4A 4Z0XA 3QQ4B 4UTBL 1YNLL 3FRUA 4G8GA 4KNUA 4ODTH 2PXYA 2EIZA 1UGKA 1QACA 3ROLB 3V4PL 4GP8B 2GT9B 2IQAB 5F9OH 3IGFA 3TL5A 5GGRB 1RH8A 3E6HA 5L4FA 3IMTA 3WFCL 5L6YL 2WLMA 1B6UA 5HDLA 3WNMA 3K0WA 4J6IA 4JM0A 1N3NA 4UTBA 3SO5A 3UC0H 2W88A 2L0DA 2OM5A 1KGJA 1HXKA 2YHGA 3OR6A 3V4PA 2VDOH 1T1YB 3QUYA 1OP5H 1H19A 2QZQA 1E2WA 1DQDH 1RQ5A 3QQ3B 1OTTC 1NAKH 2FSDA 3GIZH 3O4OB 3OAWA 2JJVA 4N2NA 1CFTB 2BOBB 5CZXC 5BVPH 4YHOH 3I3BA 4DGYL 5AB9A 4GT0A 1YSOA 1R34A 5KOVC 5L2KD 4CADA 3VMPA 3RGVC 2JKNA 3C5SB 5I5RA 5B3SB 4GSDH 5D6DA 1J1XH 3GPSA 4TQ8A 4UT9H 1QWNA 4H8WH 2X6AA 1KIRA 5IBUB 5JHDE 1CZ8H 4YSEA 4JL2A 3UCQA 1KGUA 3H55A 4UV4L 2OS7A 3IBEA 2DKUA 1P7KB 3LX9A 4EDWH 4J3BA 1NUDA 2P7TA 3EDFA 4W9FC 4TV3A 4KKPA 1E9OA 4L0YA 3FOMB 4TL4A 4LESA 5FW6A 2Q8AH 3K6NA 2D4DA 3HR6A 4YGAB 5JXAH 1D9KA 5DD0L 1W0VB 5E4AA 1WDAA 2WVVA 1HC1A 1KYUA 3BDBA 1X5FA 1MW3A 1J8RA 3QUZA 3FQRA 4OCSL 5HVFB 4AK2A 1YEGL 1A6VH 1W72L 4GIPD 4GRWE 4KTDL 2BJMH 5DJ6B 5EF2A 3FSOA 2OMWB 3DPBB 4FXKC 4M3JA 2ZF8A 3GJEA 4URKA 1GZHA 1KSRA 4AJ0A 3IXTB 3QXDB 3WHE0 1J1PH 4PGEA 3PAUA 3P9MA 1WCBB 1AIFA 3OGCA 4C56A 2J12B 5BZDA 2G0LA 2MNUA 2B2XL 2OA9A 1W72A 4AYSA 5HD8C 2VDNH 1H9DA 1OF0A 1ZLSL 4XE5B 4Y4KA 4HBQA 2VDPH 1BOGA 4JN1L 4OFYA 1AHWC 3P0VL 1NCUA 2IWFA 4EUPA 1JF1B 1HXYB 1SY6L 3GSNL 4B53A 4PW4A 5FUZH 4OM1H 1IGJB 1N0XH 3AS1A 3M1OA 4QWWC 2WP3O 4OTXH 3G5XB 1MJUH 1PEWA 3MBXL 1WWCA 4AEEA 2VITA 4DN4H 4UB0H 1FIGH 4XP4L 1IBBA 3IFOA 5G4NA 1A1OA 1OTTD 2AJVL 3DX2A 3OAYK 4I18C 3ULVL 1X5JA 1NTDA 4U7KA 2GUOB 5CZXD 2P42B 3PJSA 4PD4K 4U1MB 5T1LB 4F91B 1LL1A 4H8VA 4BE6A 4OD1L 1S7TB 3SKJL 4HWZA 3JWOL 3MV7E 1SY6A 3GSNA 3APMA 4L9LA 4OKVA 2O6PA 4ZMAT 1MG2C 2JKSA 1U8MA 3RGVD 4AV5A 3VFSA 1BOYA 1R3JA 1X5KA 2KS0A 5DD1L 2R0ZH 5E2TH 3GXUB 3HFMH 3S35H 3GJFA 3QJFA 2FWOB 2G2NA 4PRAB 4HOZA 3H6AA 4X50A 3AXLB 4KOCA 4PS4L 5CLZA 1RVFL 4RAHA 1JTPA 3MU3A 1NL0H 4OLUH 4K0OA 2ATKA 2QR0A 3H9SA 3QIUC 2UY7B 3PGCB 3Q44A 4PJIA 4ANUA 3NK3A 2FIKB 2OZNA 4JFPA 2X9WA 3RUGE 1WAAE 4J8RA 3UACA 3RGVB 3V4VB 5EBGA 2YOCA 3CD4A 4I4WA 1DJXA 4QRSA 4O00A 4M48L 1XGPB 3OZ9H 5G4OA 5IMKB 3GSVA 2ED9A 3CCHA 4OQTH 1XGTA 1HIML 1IC1A 3TNMB 1UB6B 3WY4A 1WZMA 1UOLA 2J6WA 5MEND 1KTDB 5TGBA 3B4NA 3KLKA 1E5BA 2F7IA 1DQJA 5D1XE 2DN7A 2E59A 3QJUB 4XB8A 4MD4B 1CE6A 1GGUA 2X4NB 4G42A 4LXFA 4F5CE 3GSUA 1D2OA 4GQRA 1N4XL 2B16A 1CXIA 1QYGL 3QDME 1TR7A 4IBTA 2R9HD 1SJVA 3V55A 4EIZC 1NCHA 5BO1L 1ZS8A 3VXSA 2NQCA 4F2ME 4Z7WF 1IC4H 5E1GA 4NP4L 1QAWA 3LAFA 3DX6B 1C5DB 2R51A 4Z7VA 3CK0H 4KFMA 1E4XL 4OT1L 2X4OA 3R06A 3HE6C 4JAMA 5F3HB 2APXA 2DQCH 3BQUC 5HHXH 1FG2A 5HD8D 2HFFA 4OSUH 5JIIA 2WYTA 2QQNL 5C09D 3VD3A 2G5RA 3F6IA 4FXKB 5AKSA 3LNFA 4M43H 1IE4A 2NY5L 1PU0A 4YSQA 2ZX9A 2X6BA 2NX5D 1OE2A 2B0SL 5DVMA 3U4BH 1IL1A 4QWWD 5MI0C 3LMJH 2MPVA 3QPKA 4NQSB 5DD6B 2BSDA 1OCZB 2Y6SC 2XC8A 5I75C 5J9PA 2H4EA 5C09B 1IGYA 3V0IA 4L3FA 3T65B 5F3FA 3SGJC 4LRNL 1J9QA 1MSPA 4LSRL 3ZE0E 1BVKB 1AHWB 4NNXB 3HI5L 4CU7A 3KZ8A 2NX5B 5FGRA 1LM8V 4P99A 3K80A 1A9VA 2IAMC 4KI5E 2EXYC 2V0AA 1YPZB 1XGUB 2X38A 3G04B 3KPLA 4W6YB 3SPGA 3BRFA 1E4WH 1LDPH 4NQEE 3MUHL 2X4SA 1P0SE 2WXJA 3VTTA 2AK1L 4I18B 2ZXEB 3TT1H 4UYQA 3CDFA 3NA4A 5ADOH 1P9MA 2D3NA 3L5WB 2K8MA 1XTLA 3BDXA 4JFFD 5IKCA 3MRMA 2HRPH 4XZUB 3QIUD 5DJCA 5BO0D 2A6JB 2B3IA 2OPCA 1QNIA 1YEDA 2Y1ZA 4P9HC 3WN5A 1XGYL 1KENL 3KBHE 1A65A 3UO8B 3V5HA 2ZOLA 3LH8A 5FYJL 3IDXL 2EZ0C 4QR7A 5A2BA 4QRUB 4JW3A 5LLIC 3CFEA 1SLWA 1TETL 3VMNA 3ZUNC 2WWOA 4IIQA 2JLPA 4NS0A 1R3KA 2W9DH 5D5MB 3BWUF 4PMEA 1LE5B 4JFFB 4KFZC 3VX1A 4ZX5A 4FXLA 3N6YA 3QIUB 4F37F 5GGQL 4K3JH 2OMTB 2QQKH 2ADJB 1K3IA 3BVWA 3DECA 4IBYA 4ODXA 4XVJL 5EU5A 4L4VE 1J9SA 3PGFL 2BSRB 1OXYA 3INOA 3SJVA 5T33L 4JB9H 1IFHH 3U9PL 1AXIB 1TXKA 4NCDA 4HHWA 4LQ1A 1A3LH 1BYOA 5GS0H 2EACA 5IFAL 3BEWB 5LAXA 1B9ZA 3S5ZA 2A1WL 4B9FA 3TYGL 2EIDA 3EYUH 2AEIT 4IRJC 4RWHA 3HE6D 5TQ0L 3BQUD 3NG5A 2YJLA 4UU9B 4G7VH 3N3EA 1BAFL 2FD6H 4NFBA 1V54B 3AREC 4DO4A 1AS8A 1ZA6A 1PJWA 5DJ8A 1PX4A 3P54A 3GI8L 1A1NB 1KV7A 1A6TA 4HC1A 5FCUH 4ZFOB 5IJDC 3OLGA 2VAAB 2E47A 4QHLB 3IWUA 4GYBA 4D9RE 4FTVD 2WCPA 2C9SA 2O6CA 2A4EA 2G2PA 3TBCA 1AI1L 3HE6B 5IBTL 2W9EH 2QGBA 4RQQA 3BQUB 3G5VB 1EHAA 2Y6SD 4IBUA 1HYSC 4YBQC 1TLKA 4M1CC 4TQHA 4Y4FA 5C07D 1L6ZA 1S7VA 1NBCA 1T7YA 3OMAB 4XMLL 3IRPX 5C7XH 2H3NA 1LTXA 4LSVH 2FK9A 3CU7A 1ZDQA 4UQ9A 4NCC2 2DS4A 2IAMD 1JK8B 2VDLH 3DRQA 3EUDA 5MI0B 2EXYD 4FTVB 4Y5YA 4PTTA 4E68A 1A3RH 2UX7A 1W91A 4X6DF 3GUFA 4JCLA 4OR1A 5T5NF 5I75B 5KANI 4E0RB 2WWNA 4LPXA 5C07B 4QXGH 3RZCA 5IEHA 4JFOB 3DJTA 2AV1B 2MQ3A 3NK4A 1RI8A 5CIPH 3BRDA 3GO1H 4R2GC 4XXWC 3CFCH 1WSST 4M8VA 5C0AA 3QISA 2IAMB 5AOKA 2FECI 3GB7A 4U2YA 2OZ4H 3MRHA 2WVUA 2PP8A 4FNRA 2XSKA 2EZ0D 2KLSA 4JO5A 4JRFA 2YPLE 3UZEA 2IG2L 3F7RA 1OK0A 4F9PA 3QUXC 2RQEA 4OCWH 3IK2A 4ZMWA 4BZ2L 4PY8J 4DAGL 2NY2C 2AQ2A 1UUSA 4QHKI 3D1MC 4N2HA 2GABA 1K5NA 2NLJA 2IXQA 4KU1A 2DD8H 4FXTA 5F1OB 1A7PH 5AFAA 3FO9A 1U3HC 4HK3N 2ZCKL 2O6FA 3F01A 3GK8H 4P5MB 4YHMH 4AT6B 2B59A 1YC7A 1RZ7H 4MHHG 1KTRL 3P2BA 3VXMA 2EDFA 4NQTA 1RK0A 2X4TB 5F21B 1MVUB 4JKWA 4AQEA 3NZHL 3N9GH 3NCMA 3VI3E 2VDKB 5EUOF 4GXVH 4ZI8A 4FYSA 3DK0A 2NZIA 4BZ2A 2A2QT 4J39A 4Y0GA 1HCFX 3FUIA 4LDEB 2XXMB 3HJ0A 4PJXB 4U6VL 2YWZA 5CGMA 2WLYA 2YFNA 4IRJD 1CGSL 1DVUA 5IHUL 1I8KA 4OJEH 3SB3A 1CBVL 1BX2B 2VM4A 3UADA 1J5DA 3ARED 2AJYL 4KKZA 3CPLA 3FN0H 4OFDA 4P06A 1AYOA 4P4RA 2G2RA 4WEBH 1PLGL 5J6HB 3H42L 4WFGD 1UTDA 2VO8A 1JWSA 3V52L 1MCEA 5CWSA 3GLZA 4P57B 1KEML 3EF7A 3UG4A 2OL3B 3S3BB 1N18A 3QJTB 3WIHH 3NCXA 1C8QA 3FONA 4IRJB 3ARSA 1UWGH 1HYSD 2PP7A 1ECYA 1TENA 3WFEL 4H1LB 1SHSA 3S48A 2DEXX 1M6OB 3EOYG 4FCHA 4M1CD 4BINA 2X0WA 4UT6H 1KCVH 3MO1B 4LE8A 4DGWC 3K6SA 1IQWL 3AREB 4A39A 4HZLA 3KBPA 4PJCF 3TWCL 1C5CH 1T6WA 4G5ZH 5J4MA 3EXLA 3M86A 3IKKA 4H20H 1GXEA 1PLAA 1HVXA 1YMME 2WCSA 2YD9A 3WFDL 3C8DA 1S5HA 2J8UF 1O9VA 2FH6A 2H8PA 2WWKO 5KVFE 4HCGA 4QAWA 5DZPA 1AZZC 1UM5L 2X6MA 4W9GC 2E6PA 4HIEA 4WKZA 3QUKA 3B7UX 2XWBB 2ZKHL 4DEUA 4E9LA 4E5XA 3H3PH 4I85A 4JPSA 3WD5H 1THCA 1VFAB 4OBSA 3II1A 1UACL 5T3XH 4LIQE 1E67A 1TSRA 1T2QH 1NDGA 1TG8A 2ENSA 3MYZA 3LZQA 2HLEB 3PXHA 3QUMB 4PP1C 4R2GD 4ZOCA 4GBXA 3RVVC 4P5RA 3ZHLA 2Y5EA 1NEZG 3AM8A 4PS3A 3GMQB 5AKRA 1DFXA 3FU6A 3SN6N 4ONHB 5I1DA 5I6PA 3FQWB 5TK2A 4U3HA 1AMXA 1QTPA 3L8QA 4XAKE 2XTJE 3QUXD 2BLFA 1QI5A 3UTPD 3WAJA 3BIBX 4YPGB 1E6JH 2FL5B 3VXNB 4R2GB 5T1KD 3STZB 1L9SA 4C83A 1P4IL 4MZ3A 4U1JB 3IMSA 1U3HD 1G6VK 3W0WE 4ZMVA 5K9KB 3S98A 4FHKA 1NKGA 2ZJSL 4P9ML 3UAJC 3QDJA 1NSNL 2PTTB 4U1SA 1WUZA 1F90H 3M1CA 4F3FB 4YJZL 2R1XB 3QUXB 3G7TA 4UDUB 4H7VA 3LKNB 3R18A 4F7PA 1IZKA 1OY3B 2HKHH 2YD2A 5T3ZH 3M46A