2ADYA

Structural basis of dna recognition by p53 tetramers (complex iv)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
197
structure length
197
Chain Sequence
SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*GP*AP*CP*AP*TP*GP*TP*CP*CP*G)-3'
publication title Structural Basis of DNA Recognition by p53 Tetramers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/dna
total genus 53
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2adyA00
2MEJB 5AB9A 1CO1A 2H1LM 2J1XA 2XWCA 2BIOA 2IOMA 3QYMA 4AGMA 2GEQA 3WTUA 4G82A 2IOOA 3IGLA 5ABAA 4GUQA 4AGPA 5AOJA 5LGYA 4LOEA 2J1YA 2PCXA 3WTSA 3WTWA 3WTTA 4L18A 4LOFA 4HJEA 3EXLA 2X0UA 2ADYA 4IBUA 3QYNA 1H9DA 4AGOA 3D05A 5AOIA 3Q06A 5AOLA 2BIPA 1HU8A 4IJTA 1KZYA 2IOIA 4IBTA 3D09A 3D07A 2RMNA 2AHIA 1T4WA 2BIMA 4IBYA 2BIQA 4QO1B 4AGQA 4IBQA 3KZ8A 2J21A 3Q05A 4IBZA 1IO4C 5G4OA 4MZRA 5BUAA 5G4NA 2P52A 4L0ZA 5LAPA 3US0A 3WU1A 2AC0A 3Q01A 2VUKA 3D0AA 1CMOA 2J1WA 3D06A 3WTXA 1TSRA 2XWRA 5KBDA 5G4MA 1UOLA 3WTYA 4IBSA 2OCJA 2WGXA 4L0YA 1YCSA 2J1ZA 1EAOA 2J20A 2FEJA 4MZIA 5AOMA 4AGLA 4AGNA 3VD2A 1TUPA 1EANA 4KVPA 3ZMEA 4A63A 3VD0A 3D08A 1E50A 3IGKA 2YBGA 1LJMA 3US1A 2X0WA 1GZHC 3TS8A 5ECGA 1GZHA 4XR8C 5A7BA 4IBWA 2X0VA 1HJBC 5AOKA 4GUOA 2ATAA 1EAQA 3WTVA 3VD1A 2J6WA 1HJCA 2BINA 4IBVA 3EXJA 3KMDA 4G83A 4LO9A
chains in the Genus database with same CATH superfamily
3MLTA 2GBUA 1UCTA 2AXGB 2PCPA 4Z0BL 3SDYL 1FHNA 1JVKA 2X42A 5IF0B 3WE1A 2TAAA 3C5ZA 5E1IA 3C12A 3FSAA 3O2DA 4FZ8H 4G7VH 1UZ8A 2BDNL 1XMWA 4EZMA 5I8CB 2XTJC 3HA0A 1PFCA 2E9GA 3CK0L 5EORH 4WNQB 1HXMA 1HNYA 3ARPA 5LGYA 5ICXB 2XETA 5IK3B 2NY1B 1JZEA 3C60D 3BZDA 4FXGC 4QO1A 5ILTH 4KMLB 1JNNL 3HHRB 2F6AA 3REWB 3VXME 1JSYA 2DMKA 1CFSA 2BM3A 1DVZA 3CXDH 4PJIE 4X8CA 5AZEH 3V9CA 3VCLB 2LW3A 1U8IB 4U33A 4Y16B 3D2UA 2XWZA 1TTBA 2AJZA 4LKCB 4XT1C 1Y6KR 4WWNA 3VB8A 1WAAF 3DWTA 3TT1L 1TFPA 2EAEA 3AVEA 5I16B 4FX5A 4F58L 3SDCD 3CWGA 1W72B 4D8OA 5I1GH 5L0QB 5IVXE 2Y1VA 4UB0H 5F0LB 5I6LA 1RZFH 3GMQA 3NSCA 1IC0A 1TETH 4OGYH 1X6LA 1XGTA 1TJIH 2HRGA 4P23A 4LPUA 3S34L 3HS0C 2VQUA 1LLAA 3MGTB 2Z4QA 2J4WL 3S36H 3WEMA 4TF4A 3ZE2E 4R5VA 2VUOA 1EIBA 1E6JL 2ITDB 3BKJL 5CLZA 1GOFA 4PJDA 2QR0A 4NKOB 2WCGA 4FMVA 4PR5B 3S0PA 4CVZA 1OB1A 4HA1A 1DBKL 4IKNA 3D2TA 4MDJB 4PVBA 5JQHC 4HUVB 3BFWA 4AEHL 3TO4D 1CG9B 2A83A 4H5SB 4JAMB 2CKBA 4NZFA 3RVXC 4H44C 2CJTA 5H37G 1J0ZA 1P5UA 2PPEA 5E4EC 3LQAL 4G6JL 5J11B 2FSEB 2IQ9H 1DP0A 3BMWA 2VDPB 4J3UA 4TVUA 3SBWC 1RZJL 1GZHC 2IQAB 1MAML 3AXLA 3HN3A 4HJJH 3CDZA 1KEGH 4YHYB 3X13B 3V0WL 2ZYHA 2C1PA 4LSRH 5TDPB 2CGZA 2DS4A 2P8PA 1X5HA 1DUZA 3TWCH 2LVCA 1JWSB 1PBYA 3UZVB 5F3BA 4DW2L 3SOTA 5E2UL 3ZDXE 1WWCA 4OZIF 5KVFE 2LR4A 4A2LA 4LLDA 1JI2A 1O6VA 4HBCL 4NRXB 2K7PA 5HHOA 3L95B 4RX4D 5I8OH 4JQIH 3T8XA 1R3HA 5LNDA 3HW7A 4KDWA 1WFNA 4F1ZA 4FFVC 3COOA 5EO1B 2HPOA 1Q9KB 1Z3GL 4BWTA 4PTUA 1IKOP 5JPNB 5HI4C 5JXAL 2HJLB 3AMKA 5GZND 2IXQA 1M57B 2W0FB 3TT3L 4EIGB 1P1VA 2VLJA 3JZYA 3LXAA 3BQVA 4JQXA 1R3KB 5JQIB 4EPSA 4ZMNA 4W9EC 1WGVA 2UX7A 2X2IA 3C6LA 5KSAB 4EI6B 4R9HA 1DJGA 2OMBA 3QAQA 4HQQH 4CU8A 3D8MA 2PWFA 1TZGL 4FE9A 1PNCA 1KCSH 1QRND 2LE9A 4IW4C 3KE0A 3JYCA 4JY5L 3FB8B 2R0LH 3LN9A 4PGCA 5GS2H 2VXQH 2A6IA 3L4CA 5DDHA 2KDYA 3LVEA 4P2OA 4XN4A 2Q6WB 2EEFA 3ASWA 3O41B 2H32B 1AKPA 1A2YB 1DQLH 2EH8L 5ANHA 3VXPB 3CHPA 1OE3A 1JPSL 2DZEA 4OJAA 4X4KA 3DJ9A 3D69A 3EFOB 4LP8A 4Z6AT 5J9PB 2IF7A 2X4UB 4I4WA 4U6VH 3ATFA 3ARWA 4KDVA 3VMOA 3QIUB 1E5UI 2QKIC 1ORQB 5SWZE 1G5AA 3O8XD 2E5EA 2D7TL 5FYJL 3TVMB 3EO9H 4IRZH 4OD3L 3WNKA 5DJDB 3BN9D 3EOBA 1EXUB 1SPDA 3DO7B 4M8VA 2WK2A 3GUFA 1HCYA 3QDAA 1G7MA 2IPKB 3T0ED 4IRZA 2J1WA 1JDAA 3IPFA 2D7QA 2XZCL 4LQFH 2VL5A 2R29A 4NQUA 1PNDA 4EDWL 5DJZB 5FUCC 2DL9A 1NGPH 2YSSA 5C6TH 1UOLA 3D39A 4OV6F 3P0VH 5I18L 2VDNL 1CTNA 5AVSB 2IIJA 4CC1A 2Q3XA 4KJWD 1BAFL 2E8YA 2P5WA 1HQRA 2Y5QA 3SDXE 4JN2A 5BS0B 2IV9A 3BH4A 3IPEA 3JV4A 2IFFH 5B38A 2JB5H 2LU5A 2D7MA 2IALB 2YZ1A 4PWKA 3L6FB 2A6DA 1ZSDB 4JO1L 4NJ9H 1NIDA 4XRCA 3TJEL 1YMMB 5IBLC 4C56E 3EYVB 3NAAH 4ZOBA 3VA2C 4WKZA 1CUOA 1D6EA 5J8OA 1E4KA 4G80A 3GC3A 3VFTA 4N0YL 4UU9B 1JPFA 4LPCA 1ZK5A 1KTKE 1G9HA 4I85A 4A7VA 3IRPX 4FG0A 2XZAH 5IEHA 4XVTL 4RGOL 3GTVA 4UOW0 2WQ8A 4W9KC 5DJ6B 4A37A 3WIHL 4GQRA 2NQDA 4AEEA 3KNBA 4HLZG 5JDJA 1N19A 5JOFA 1FDLH 1MDTA 5CM1A 5DEFB 1M7UA 4ZO7A 1RK1B 5DMGD 3LZRA 5IOPA 2AK4D 3JWOL 3FOLB 2DOCA 2P5EE 4MA3A 5E1AA 2X40A 5I0DA 1INDL 5DC4B 1RUML 4AYEC 4EOWH 4E0RB 3DK2A 2I07A 4R4NC 5FO8B 1S7QA 3U0WL 1QFOA 3VGDA 2G9KA 3RLSA 1GC1L 2PXYB 3QFJE 3R18A 4X6EA 3HBGA 2R9HC 4M7KH 3WTWA 5KVEH 2VZ1A 2K45A 4ZPVA 2DM3A 4PUBH 2NY7L 3VFVA 4S0SD 4NZRL 1KIRA 2FIRT 3MODL 3BT2L 1S9XB 2OMWB 1HOCB 1S9YA 2WVSA 2E76C 4DN3L 3HRZA 4F8NA 1A6ZB 3EDEA 3MROB 1FL3A 4WU5B 3HS9A 1WO2A 3C75A 2BIPA 4K3DL 1EGJA 1M7XA 4C83B 5AW5B 1VFAB 4QRPD 4KNTA 2V2XB 2Z35A 4PW3A 1Q0XH 3CZSA 2X4OB 5DD3L 1VIWA 3GXTA 1FL6A 1AO7A 3OSKA 4AGQA 3MJWA 2NX5E 4GRWH 1P4LB 3LD8C 2HG5A 4ISVA 4AQOA 2D73A 1FNEB 4LOUD 3S96B 5EUOB 2KUTA 4QLRA 2BVOB 1ADQH 5AVXB 1LQSR 3D6GA 1OGPA 4L3EB 3KWWB 2YA1A 2DAVA 3SGDH 1ITBB 2Z93B 1N59A 3MJ7A 4JPVH 1NOFA 4UMGA 4Y4HA 5IR1B 1ADQA 4HETA 4YSDA 1JNJA 4BZYA 5DT1H 4HS3A 1LMKA 1IGTA 3I2CL 2FJFA 5F7LB 1UWXK 3OAZK 4GAFB 5ALBH 4ERSL 1XGPA 2ADJB 1WWWX 4PJAB 2EC9T 3PPEA 2NRDA 4N2GA 4QHMB 1MG2C 1HKFA 5DHVA 3QZMA 1L9TA 2F19H 4K71C 4BA8A 3W39A 1MJUH 4MCNA 3DPBB 1KTDA 5T5NF 3CVBA 1I75A 1BGXL 3PGCB 3HI6H 5D7IB 1AZBA 1C5BL 1SNRA 2XFXB 2BSRA 4XZUB 2CDEB 3BP7B 1CB4A 1KTLB 2VNCA 4B0MM 3ZHLA 1C7SA 4YUEH 1YMHA 2EYTB 4DK3A 1LE9B 2J2ZB 1AZVA 3GLAA 1T6VN 2APFA 4J4PD 5AYQA 1EO8L 2D2OA 2QHLA 4FQLH 1T7YA 4AMKL 5EIIA 5FGCB 1J5HA 1B0RA 3HG1D 4LEOB 4PM1A 5IB1A 4K3JH 5C6WH 2J1XA 3LXBA 2K78A 4JRXB 2W9LA 3AT8A 3QJQB 2VW4A 2AAVA 4MHHI 3IJ9A 1KXQA 1C8PA 1E4XH 3B6SA 2BNQB 1RPKA 2FGWH 2GBVA 4GBXA 5DK2B 4M7ZB 3MJ9A 4UQEA 5C2UB 5DUPL 4R4FH 4H1LG 2WLHA 2VJ0A 1BJ1J 3VXNA 4CN1A 3U2SB 3ZTNH 3M17A 3MA7A 1PKQA 1A7RL 1N0LA 2KHAA 4DCQA 3TBYB 3JVGC 1LEKA 1KT2A 1RKRA 4WIQA 4X6CE 3HBPA 1GHFH 2W95A 2WOBA 4MB4A 4O2EA 4OF8A 3T0VA 5EU5A 1WICA 1Q0YH 1S8DB 2F5BL 4UBDC 2O5XL 3LJ3A 1EMTH 4OJDH 3IMBA 1G1CA 4U6HB 3UJJL 1H9DA 3LEXA 4CAGA 1GYAA 1HU8A 4M6ML 4NRYA 3V0FA 3QI9C 3OPZH 4HAGA 3GSOB 3T1FA 4BWUA 5FYJD 4ODBD 1KJVB 1QX1A 1U36A 4XB7A 5ID0A 5A16A 4Q9RH 4UV7L 2QBWA 3C09C 4POYA 4X6FB 4KY1H 4DPAX 2AANA 2CUMA 3A4DA 3MMEA 1AXTL 4TTDD 5AVYB 3P9MA 3ESMA 4H25B 2X4NA 5DVMA 1AIFA 1B0GB 3QE5A 1UCBL 1S78C 4NC1C 3GHEL 2JQMA 3BVNA 4U49A 3D9AH 1SYSA 1FG2B 2E4TA 2ZONA 4L8DA 3GMLA 1L6XA 1P7KB 4NCC1 3F7KA 1HKLL 4UZGA 1JGVL 1XWVA 1HIML 3W9EB 2G3MA 4FQQB 4LSPH 2A0LC 4MXVF 4OD1L 1TDQA 1YYLH 2UX6A 2O5ZL 2A4EA 2ID5A 4DTGH 2KS0A 3VWKC 3GK8L 2Q87A 5C09A 3DX6A 3IGKA 2KC0A 1UOKA 2FL5B 4YHZL 4M93C 3KYNA 3HNSL 1N0XL 1DLHA 2V7NB 3B9DA 3QPQD 4AK2A 5C07B 5JTWA 2BZCA 3CFTA 5D7LB 3QHTC 5DD5L 1RP8A 3F01A 3QGVA 4FYTA 5FCUL 5C0AE 1FZKA 3G9VA 4HSCX 4QHNA 2ZKYA 4TL5A 3ECUA 3TLRA 3MHZA 1T03H 5IMKA 4GW4B 3ZRFC 4BE5A 1JHLH 4PJCF 3E1ZA 4BGLA 1A4AA 1EHKB 3FF8A 3H54A 1RZKC 1G4MA 3FZUC 2DLFH 2XFGB 4LFHG 2BVYA 2N56A 4WO4D 2NYZA 3BWSA 4R8WL 3K6IA 3UGEA 4POUB 4UQ2A 2X3BA 5K9JH 2V9RA 4JM4L 2C9PA 4G8GB 4PMFA 1NCJA 2ZCKL 3PL6A 1NGQH 2QADB 4F9LC 1IEAA 2IOOA 3LZFH 2OTPA 4FLQA 1B3IA 1JTOA 5AVRB 4IBLT 2HTKD 5CN2A 3MLTB 2W07A 3FUHA 2PABA 2VIRA 5EF2A 4HPOH 5C08E 4N2BA 3RIKA 3SQOH 1QFPA 2AV7A 4EF3A 4AEIH 1LDSA 4Q6IA 4MNQA 4W4OC 3BH9A 4HOZA 1V55B 3NIGF 2RD0A 4MVBD 1WSST 3N50A 3ZVVA 5EC1A 2I24N 1JTTA 3RKDC 1UZ8B 4S2SA 2ICWJ 2V17L 5EV7A 4DH2A 3TIDB 3ORJA 5IIEA 1IGFH 1PLCA 4XCYA 5MEQB 3ATEA 1EJ6A 2YXVA 4NNPL 4RFNC 4QRBA 2BOLA 2F74B 1CBJA 5CBAB 2O93L 2B7DT 4OQTH 2FJGA 4QO1B 2XUWA 8CGTA 4MZRA 1AC6A 3VXTA 2AEOA 2P80D 3L2LA 4NERA 2F54A 3QDHA 1FH5H 2D03L 5H8DA 1YEKL 3DNKA 5HDWA 2V37A 4ZFZA 3BQUC 3G6JE 1RUPL 4I9WE 3UIYA 4UYPA 1D5IL 3N40F 3ZX1A 2HLFD 2BK8A 4U1JA 1W6LA 4L5FH 5JW4N 5J3HC 4NQEA 2XTSA 1KGXA 3GMQB 1M2OA 3K8MA 4JUTA 4RZKA 3W2DL 3ZYOA 3ES6A 5J89A 1E9OA 1XGTB 2FQDA 3QCTL 4P23B 3N43B 3S7GA 2EXYC 2Z4QB 1EANA 1OE1A 4NKIH 2EIJB 4LSQH 5D7KE 1MFAL 4MFHA 4N0CD 1QFUH 2QR0B 4NJAL 2Q86A 4PJDB 4UQ9A 1WV7T 3UBXA 3VXUA 3S8FB 4HXBH 5DHYA 1OB1B 1XH1A 4H0LC 4U6XA 1NDGA 2JXMA 4G8AC 4EJ1C 5LXVA 1KZQA 5KW9L 4JHAH 2A83B 1NANH 3L16A 4TNFA 4EZJA 3KPRB 4QRQA 3DX8B 3VFVB 1FLRL 2VITB 5D7JD 3NCJL 1BQLH 4GPVA 2BNRA 3L5IA 3VD5A 3BJLA 3MPCA 1PZCA 1NDMA 5E5RB 3RHWK 3LS5L 2ICWA 1OCOB 2AABL 3A0OA 3C87A 4X4ME 3CDGA 3N06B 3CDZB 3RILA 1K6QH 2YGPA 2YPLD 2VERN 4G71B 2C1PB 4QHPA 2VDRL 1EVUA 2P8PB 1SLXA 4LLUA 2VR5A 4QMEA 1TFHA 4BFJA 5F3BB 2O61A 4JM2D 5L8LB 5TQ2L 5AL8A 5C3IA 1FQ9C 3U1SL 4LLDB 2DEYX 4HXAL 4XXWC 5HHOB 1G6RH 4ZUSA 5LVEA 3T8XB 1R3HB 1FNFA 3HUJA 5CZRA 1F4YL 2XWBA 3ETBF 4JDEA 3R0MA 4PTUB 4NCC2 5E1GA 1UYWH 3KBHE 3RUGA 4WI0B 3V6OC 4JVWA 3U7WL 3CFDA 1Z2KA 2VLJB 3AWGA 4L4JA 1YVLA 4XNYL 1GVIA 3C6LB 1MJ8H 1G1OA 4JFWA 3QCUL 3T2OA 4ANKA 5HPMB 2BJMH 3GZPA 1EXHA 4U1IA 4Y19B 4ABWA 3AG2B 1RIHL 2YEZA 3L3IA 2O1AA 3EHBD 1T0NA 3GFUA 5G4OA 4PGCB 3I9PA 5D1QC 2A6IB 2YBRA 3QZPA 3H42H 3SKOA 4P2OB 1CXKA 5ACZB 4ZD3L 5CWSA 2ZCLL 4KXZH 4Y4KA 4Y9EA 3DURA 3D69B 5A1AA 5AZ2H 2IC2A 4JB9H 1IAII 4U2ZA 3MBWA 4I4WB 3FMGH 4JANB 5IT2H 5C0EA 3BISA 1U8OA 3WTYA 5KZCB 4ICWA 4M00A 2CQVA 1BWMA 3U0PB 3TF4A 5J1SC 1O6TA 2W88A 1R3JA 1QEWB 2W59A 4DNLA 2Q8AL 4YDVA 3EOBB 1IAOA 4ADIA 1A9VA 4OB5H 2MNUA 1ESOA 5F7EL 4FFZH 5ESAA 2YPVA 1G7MB 3O3DA 3ULUE 5ADPH 3GXPA 2C9UA 3ZZ1A 1DJXA 2YSSB 4FFZA 4M5SA 4OCXL 5E2WH 1IGIH 2MQ0A 3NJXA 2X0VA 4WEBL 1BD2A 3RZWA 4OJYA 5CLTA 5JW3L 5E9NA 1BEXA 1HQRB 2OL3A 2P5WB 4MMYB 2EDMA 3QR0A 5I76A 5T33H 3STZA 2PW2A 3JV4B 4ZS6D 5B38B 2HRHA 3OZ9L 1AY1L 1CGUA 2JI3A 4ORZC 2A6DB 4EN2A 4HULB 1QHQA 2YD9A 1IIKA 4UTAA 4ONHA 2CUAA 2ZXQA 1R3IH 4WKZB 5C0ND 3UTTD 3R0NA 4Y2DD 3HPLB 3KM1A 5B1KA 3PYCA 1RJYA 2I27N 2Y7NA 4UT9A 3RBGA 2ZXBA 4F80A 4U6TA 5M94B 5IEHB 4YC2C 3O11A 3WELA 3N44F 4BUQA 1KCVH 5EZJA 4KZDL 3Q44A 2G2PA 4PB0H 5SX5H 4KX7A 4MLIA 5AB2A 4RFEA 5G5DA 2DN7A 3TA3C 4KNSA 2UVEA 5JOFB 2BHZA 3HMWL 2IAMC 4RETB 5BQ7B 2VDOL 2C3XA 2NY5H 4I8DA 2QT6A 2EKJA 4FQ1H 2YKLL 5LXGH 3T4AC 3L7EA 2YQGA 5BS0E 4IRJD 5IOPB 2N1KA 1BFOA 4RDQG 4MA3B 4OZFH 5E1AB 1MIEH 1E8ZA 4I0PD 1MCIA 4R2GB 5DJYA 2EE3A 3CFCL 3VGFA 3MBXH 2I07B 3NN8A 1QFWM 1S7QB 1YMME 2AXHA 2ZICA 4OZFA 2DD8L 4UZSA 4X6EB 1G9EA 4QJ4B 1XR8A 4JHBA 4PY8I 2F68X 3OF6D 4HG4K 1AJ7H 4Q6KA 4ZPVB 4XB3A 1HL9A 3WEBA 3WD5L 4R5XA 5FW7A 1FYTD 1KIRB 4NT6A 2F53D 4LCIL 3T0XA 1VF5C 1YEWA 1AANA 3ML8A 3GXUB 3V4UH 3EOTH 1D6VL 5LAPA 3ZKXC 5KYUA 1FL3B 2X6AA 1SF5A 4OZGF 4WNSA 4K4KA 4GI6A 3R4RA 5IROA 5SWSA 4DGYL 3GZOA 4HPHA 3QG6A 5AW2B 4DP9X 2VC2L 3EJYC 2NR6A 2Z35B 3VWJD 3ZT6A 3UC0H 5A6IA 3K2UH 5HYSG 5I28A 5B1BB 4NUGL 4P07A 1AO7B 1V3MA 4F8LA 4KQ4L 2XA3A 4L0YA 4AOFA 2FH8A 1FRGH 1GSKA 2AITA 3ABZA 3VTAA 4ISVB 4MJIA 4MWFA 1U92B 1FO0H 3L5XH 1BZEA 3ZL1A 3OMZA 4GRWB 1VB9A 2WZPA 1XFPA 2F7IA 5AAWC 2MJWA 5AFAA 3QDMA 1FO0A 3SE4A 4K8RL 1LO4L 1RZGA 2PWHA 4L4TA 3SN6N 1N59B 4PJ8D 4Y4HB 4MCYA 1DVYA 4RWYL 4XBPA 1GY2A 4U1MA 4HS3B 3CU1A 2FJFB 3X1NA 3CE1A 1JIBA 4BK5C 1CVSC 5I1KL 4RGMC 1XIWA 5TPWL 4XPBH 4Y4FB 4AYSA 1KWKA 2XBZA 4HDIA 5JUEH 3DUSA 3S37L 5JHDA 3LZPA 2CA4A 2MNWA 1ZKAA 4PBXA 4IOFD 3T6VA 2WLZA 3RVTD 3V4PH 2P48B 5ECJE 2Y7OA 5DHVB 1E9PA 2ESVD 3W39B 4RRPM 1KPVA 1KTDB 3TZVC 1A1NA 3HOGA 3LMJL 5JDSA 2MKLC 2V0AA 3EJRA 1MDAA 4G6AD 3QJVB 3AW5A 1OCWL 5FW6A 4HWBL 4UV4H 5IB5B 1JFQH 3AU1B 4KKBC 4TQHA 4EN3D 5I6OA 1VGKA 3BD3A 1WITA 3FFCA 5GS0C 1YEFH 2R8SL 3UDWA 5EUOE 1E4HA 4B9KC 3RWIA 1P7QA 5E2VH 2X70B 2Y06H 4L3EE 3QHFL 4AGPA 3V5HB 3WKQA 5HHVL 2DTMH 4KK6D 2JELH 5IB1B 1U4FA 3CIQA 4N85A 2CGRH 2N7BA 2PETA 1TMCB 2DIJA 5C0BA 5IJKA 2WLKA 4OFQA 3SKUD 1MCCA 2WUBH 3DROA 3B6SB 4GBXB 5ES4B 5J6HA 4PJAE 1DQQA 1NZRA 4FS0A 5IVNA 3EH3B 3P77A 4P59L 1KZYA 2AEQL 4P5TC 4S1QH 5GRWA 1OSZB 1U91B 1N0LB 1VENA 3L4YA 3MOAL 3P0GB 4FFWD 1LEKB 5D7IE 1KT2B 1UB5A 4HUWA 1MEXH 1JGEA 2EDNA 4O2EB 5EU5B 1QFWH 1B4LA 3ZRSA 4HP5A 1ETZB 4MNHB 2DQCL 4MMXC 1P6AB 3LEXB 2UWEF 1J11A 1X5LA 1G7QB 3Q48A 4NRYB 5FGCE 3OAYH 1T2JA 3MR9A 3KLHC 4XMZA 5CP7A 3H7BB 3T1FB 1I7UB 2DWEB 4UWQB 1I7ZA 4O2FA 4JRXE 5ID0B 3HCVA 3S9DB 3K2IA 5HGBA 5A16B 3U2JA 3EFDH 5FFLA 1NCWL 4XP1L 2AJVH 2DQTL 2X1QA 3MMEB 4AYID 2BNQE 1JVLA 4F7CA 3P9MB 1L9SA 2X4NB 1AIFB 3AQZA 5AW6B 2YSTA 3V4VH 1JGDA 1TTRA 4ODSH 1JJUA 2NZIA 4P46C 3SOBH 2GUYA 4JPWH 7CGTA 4J6RH 1I31A 5ANMB 1SYSB 1TTFA 4L8DB 1IVLA 1DDTA 4ONFL 3BRFA 2OMVA 3K7UA 4QDGA 3GHPA 4JREC 4FLSA 5EOTA 1HZHL 3FUDA 4LK4A 1WA0X 3EYFA 1PY0A 2HA1A 5DS2A 5HBBA 3B7RL 3J7HA 4XP5H 1PVHA 4RBPH 3UO1L 5E6UB 3U79A 5CCJA 1ORSA 1OAXL 1WA2X 5C09B 4F7MA 1CTOA 2D0GA 5IQ9A 3SDCA 2X3AA 4GKSA 3SO3C 5F6IB 2Z8WC 4Y5VA 3L9RA 2JK5A 1KXVC 3KYNB 1DLHB 4FADA 1IAIL 3PUUA 3WHXA 4XHQA 2XBDA 1ET5A 3FHAA 3L3OA 1DZBA 1FZKB 2VR7A 1XTMA 4M61B 4G7YL 4QHNB 1KGUA 1MRFL 2Y24A 1MHHA 3M46A 1AYOA 1ASPA 4ZT1A 3V8OA 3GBNL 4BZ1L 5IMKB 3KL3A 4FQCH 4Z77A 1QI4A 1W8NA 4LQ1A 1ERNA 4YE4L 1ZIBA 3ILPB 4JRWA 1TVBA 2V3EA 2FIKA 2EIEA 2HWZH 4RRPG 4FG4A 1KB5H 2FGZA 2HKHL 3TO4A 4AMXA 2HH0H 3GSVA 4B0MB 1JD7A 4LOFA 1AD0A 1MELA 1OAQL 4RZCA 1N8ZA 1IEAB 5DLML 2J8OA 1MFCL 5T5FH 2WM0A 4AKOA 4P3DA 1OCZB 1KJ2H 5GRYA 1WAPA 4FNSA 5ENWB 1QSED 3T0BA 2XQYG 4XPAL 1H15A 3IFLH 2EDDA 2W07B 2OYLA 3S4SG 4JY6A 1GTNA 2GI7A 2XPGA 5F1SA 2AV7B 4QOKA 5FYJU 3NJHA 1RZ7H 5C07E 4QF1B 2OZ4L 4Q6IB 1A21A 3BH9B 3RGVC 5D7LE 2JLLA 3FPYA 1I82A 3WNNA 3DSNA 1AS8A 1R33A 5F7WC 1H8SA 4BZ2L 5KYYA 1I3GL 3FN0H 4RX4A 3ATBA 4PV8A 1OM3L 3S5LA 5AW1B 4XNMA 1IFHL 4FKKA 1SJXA 4OFVA 3IDYB 1C1EL 2GFBA 3KPSE 3GB7A 2FJGB 3IS0X 5GZNA 4QUOA 4IRSB 5J0BA 1PD6A 5CIPA 4Z1PA 4G8GE 4EBQL 3VXTB 2OSLA 3ERXA 1GPOL 4GEIA 2KT6A 4ZXBC 1JZ5A 4EI5D 2F54B 1A0QL 4ANUA 5I73B 3MV8D 3PF2A 3RL1A 4YXLL 1QNIA 1T83C 1SMOA 4WTQA 4ZFZB 1OIOA 5EZIL 5HHQA 1R17A 3O6FD 2WWOA 3MCKA 2V7HA 4U1JB 1QRNA 3K72A 2X6BA 3LH8A 3MNDA 5L2KA 2EE6A 5AAPA 1KPUB 3C5JA 3M1BA 4MMZC 4IM8A 1TZHA 1CF1A 4NQEB 2VMJA 1F90H 2LU7A 3P3SA 4D9QE 1YLBB 2XNAA 4DEPB 4GAAA 4RVBA 1BPVA 1DJWA 4OSUL 4JG9A 1GXEA 1OZTG 4JLRA 3SBRA 1FNSH 2NZ1A 1K3IA 1WWAX 4WI5A 1DZ0A 3SE8H 2ENYA 3V7AE 4PJ6A 1J12A 3LSOB 3UBXB 5F72S 3Q8BA 5CJ8A 1GJIA 3O8XA 4U6XB 3VGGA 1UXMA 2JXMB 1URZA 1ZWIA 3L13A 1EBPA 1E8WA 3DMMC 2WC7A 3U25A 4EXPX 2WUCH 4YHOL 5HHPA 5A43C 3ARFD 1S3RA 5MHSD 3S88H 3SDDC 2HPTA 4X98A 3K6SA 1T1WA 2BNRB 4BWWA 1FGVL 1NDMB 1AGCA 2BPBA 1BZQK 1BDYA 4DN4L 4HJIA 3ZIMA 4K94C 1T5XA 2FDBP 1Z66A 1OD9A 4LLUB 1HT6A 3IF1A 3D34A 3MRBA 5JHLA 2B1HH 3QFGA 4TSCH 3MREA 4DEWA 4NZTL 5D1XC 5EZOL 3VYPA 2WCPA 2YGQA 1MCLA 4PJDE 4UMSA 2WTPA 3EYQD 4PGDB 5D71H 3U9PL 4CVXA 3HUJB 2FQGA 1MZZA 2XWBB 4JDEB 1G6RB 2H6PA 3HNTL 3QEQA 1DYZA 1Y18A 3SDAD 2QV2A 2GQHA 3ZKSD 1DQDH 4X4ZA 2VKWA 2UUDH 4B41A 4YDLC 3WHE0 3KPRE 2WKOA 1JAEA 3BAIA 2YHGA 4ZAKA 3VB9A 1JZGA 3DX3A 1L3WA 1J0JA 3FHQA 1UD5A 2D2CC 35C8L 3E9UA 3ZTEA 1HH9A 4P2AA 4MA1C 1JWMA 3PU7A 3FHEA 5CSBA 1I85A 4EVNA 3QDJD 4U1IB 4PS4H 4OTXH 3TJHC 2VYRE 4QHKJ 4APQC 4CKQA 2YEZB 3E0GA 2AK4A 2GHWB 4NHUA 2E47A 3F04A 2YWZA 1XZ0A 3CFKA 5HHNB 4AGLA 2JCWA 2YBRB 3NSYA 4K94H 3QB7C 3SKOB 4MJ6A 5HHOE 5CWSB 1BLIA 3DURB 3HAEA 4TS6A 2EDLA 3MBWB 5E03A 4PRIA 1NBYB 3N1QC 5H4ZA 3WFEL 2OMYA 3IWVA 3UCQA 4UIMA 4KXAA 2DIAA 1R3JB 5F9OL 2VLJE 1ET7A 4YDVB 3E8UH 1IAOB 4PJBA 2YIHA 3I6LD 2YAPA 3KDPB 2WIIB 4QRPA 5GISL 4BGDA 5ESAB 3WJJA 4N2OA 4XX5A 1FFTB 2J71A 4O9HL 2W9DH 2QPUA 5H4YA 4JG0L 5B39A 2Q1EA 1SOKA 5BMFL 4Y19E 4N87A 2PYFA 4DP4X 3QNXB 4XPGH 2HN7A 1UG9A 4NYLB 3HLAA 1BD2B 3T2NL 2AQPA 4HOWA 3C5ZC 2F5AH 4LVHB 2OL3B 4IJ3C 3W37A 2K70A 43CAA 3STZB 4KKPA 3GSWA 2OX5A 2Y1YA 2HX7A 1E6OL 5I0VA 2PMZA 4G9FB 3HBQA 4ONHB 2PW1B 2XG4B 1HH6A 4ODTL 4MAYC 5E6YA 5GGSA 4A38A 4QRTA 3EUUA 4AIZA 3H2WA 3WNJA 3LYRA 5CSZA 4BHUA 1FFOB 1NIFA 4LHUA 1A02N 1LDPL 2F1EA 3EYSL 3F6LA 4JFED 1BVZA 2X2UA 4I77H 1W8EA 2J6EH 3QORC 3WCYA 5E6ID 2OTWA 4HS6A 3DVNA 1G7PB 4XAWL 4R0LA 5EZJB 1G84A 4LSVH 1MF2L 5IW6A 2HYMA 4M4PA 4RFEB 4JDVA 4O02H 2UZXA 3ZTJG 4AT6B 4PCTA 4LP5A 3ESNA 3Q5YA 1MSPA 1Z5LA 1GKEA 4LCWA 2P5WE 2MTPA 2H0JA 2XU9A 3L7EB 4JFFB 4FQXA 3IMSA 1BFOB 4L0ZA 2DBLL 2NNXA 3KLDA 1BX2B 3NN8B 3NACL 4YQXL 3HG1A 4OZFB 2D9CA 1CQYA 1MWAH 1SY6L 2VXVL 2BVEA 3UPRA 1P2CA 1JMXA 1XR8B 1Z9MA 5DR5H 1X5MA 3JWDC 3OD3A 2BP0A 5E08L 2DRUA 2NLJB 3CMOL 5E5UB 2YD3A 5EC2A 5LQBH 4FXKA 3LH9A 2IBZX 1L9PA 4Q2ZA 4KHTH 3M07A 4TNEA 2A9NH 4LLVA 5IQNA 5HD8D 3VXMD 1P5UC 4F7KA 5FLVA 1UT1A 2WZ5A 5KYUB 1I9RH 4N9OB 2FQEA 5CF3A 1P9MA 3TXAA 4OFKA 5C97A 1CTMA 2QZ5A 3S8WA 3UJIH 3QG6B 5KEZA 3NIDF 1BFVL 3FUFA 5IKCA 2FH6A 2LU3A 3B9KB 3O9WD 1QI5A 3MLRH 3T2LA 3X14A 3QUXD 1I8KA 1LHZA 4X7FC 1OWRM 1UM5H 4YSUA 3O6MH 4K7FA 3B43A 2AJ3A 1OPOA 3QUMH 2EH7H 4MWFB 4NZ8A 4J23A 3CVHH 1CLYH 1SUHA 3B2UC 3LKPA 7TAAA 3N40P 3BPNC 2W9EH 3OAUH 3QUMA 3HI1A 3QDMB 1FO0B 7PCYA 2WLYA 1EPFA 4L4TB 5HPOA 4WTZA 2ZXEB 4MCYB 4PVNA 4XP9H 1KCUL 2DTSA 1YJDH 2XWCA 4U1MB 3U36B 2J8UF 2E9WA 1NCBL 4EXKA 1XIWB 3MACH 3JWDH 5KVEE 3D4ZA 1MUJA 4HDIB 3H4HA 4XPTH 3DUSB 1EH9A 3RA7L 2QSQA 1Y07A 5F93C 5JHDB 3BUTA 3OLDA 1FV1B 4NEHB 1E9PB 3ZPDA 1KPVB 5B1JA 3L3HA 2F18A 4X42A 4PG2C 1AO7E 1CICA 3VFWA 1JYWA 1HFUA 3DV4A 4KK5D 1NSNH 1RZKL 1HSBB 4MD0A 1VGKB 2ZOUA 1CFNB 2ICEA 2BXZA 3QHZL 3T09A 3VFPA 1OT1A 2QSCH 3FFCB 5HVHC 3DRTB 5KS9F 4J3BA 4GRWE 3SE9L 4LRIC 3TBVA 3RWHA 1C5CL 1DSFL 2X4TA 4HOMA 5JOPD 1P7QB 3GKWL 1XCTB 3N3EA 4A39A 1MFBL 1FGNH 1T89A 3IBEA 4NAMA 2OI9B 4IBTA 1CDCA 3SQRA 5TF1L 4G1MA 4FMFA 2EVIA 3MV7A 4XC1H 1KULA 1YEHL 1WFUA 2GSGA 3DROB 1YN7A 4UM8B 3X3FH 2UZYA 3IPBA 4BKLA 5J6HB 2AMGA 4JFXA 3P3UA 3V6BR 1ZVYA 2EEBA 5DFTA 2LABA 4ENEC 2HMID 2RTTA 1CDBA 3P77B 1OD7A 3MRJB 1NKRA 1A7BA 3IKKA 2WXOA 4FNRA 4WO4A 5D8JH 2DJUA 4HGWA 4ELMF 4PGBA 3APMA 2CLRA 2COVD 4JHWL 1UB5B 4HUWB 5I2IB 1CYXA 5G55A 3MX0A 5F9WC 3OKKA 4Z7NF 4M8QA 4XO5A 4A7UA 2X88A 4OCRH 3WJLA 4P2QB 4EZLA 1DLFL 2VRQA 3GPEA 1J1OH 2JKNA 1OTSD 1KBGH 4HIJA 4LKXA 1ECZA 3TTSA 5C92A 4CJ1A 1A7QH 1ES0A 3NJJA 3ZL4L 3HCVB 5HGBB 1KFGA 2YEVB 3WNMA 2P8MA 1UASA 1KSRA 4W1TA 3TBBA 1I7TB 4YHKL 4F7CB 5SWZD 5GJSL 2WWNA 1NC2B 3FAXA 1X9QA 1JGDB 2GG1A 4XVUD 1R19A 2GIXA 3QIWC 3TV8A 5DRXB 4A2HA 3U9UB 1OARH 3FQRA 2AGJL 4ONGL 1D9KC 1KYOJ 4FCAA 1J5OL 2R0KL 5GRZA 3V4VB 5LWYH 1BVNP 2DQHH 1FZMB 2DQGL 2F7QA 2ZXAA 2D0HA 4D3CL 5BJTB 4PJXF 1FFPA 2FBJH 3W9DA 2P80A 5EOTB 2YD2A 1PGRB 4CC4A 3EYFB 3MOBH 5D4QA 4XPFL 2BCMA 1EX0A 2E9IA 2GBAA 1NCUA 4E2OA 3WGVB 5DMKB 5DZ9A 2HT2D 2PTTB 2GABA 1X4ZA 1NAKL 4UT7H 4UAOB 5K1JA 5GGRY 3BKML 2EEXA 3ZIYA 5IQ9B 4GJTB 3T3MF 4WK4B 2QQLL 3L9RB 4Y5VB 3DTUB 4JDTH 3EJUA 2JQZA 3WHXB 3AGVA 4C56D 3MLZL 3H3KA 5D4JA 1IKFH 3DPDA 2P4AB 4DO4A 2ED7A 3ZHFA 1OTUD 4FYQA 2B4CC 4X6DF 3CVIH 3ARBC 1QHPA 5K69A 1N70A 5CEZH 4PCSA 2WY3B 1MHHB 1A3RL 4QHLA 1UATA 4AGOA 1FUNA 3DX0A 5ANME 5PAZA 1UENA 3CSPA 2ZKXA 1QWNA 1JZIA 4OGQC 2IOIA 2FIKB 3MRIA 2W65A 3NCYP 2YAMA 5FB8A 2R4SH 2CBQA 4E9LA 3ABGA 1S6NA 3HG2A 5B7MA 3I02B 3PAVA 4PIRF 4P4KD 5FLUA 4JGNA 3GSVB 4JFHE 2WV3A 3PXJA 2EVJA 2J5LC 4MJ2A 1LXMA 4RZCB 1N8ZB 4MJHA 5D7JA 1ZPUA 5E8OA 2R2CA 4F91B 1BVLB 2VMDA 3EJZD 3JWNH 3LEVL 4P3DB 5C09E 4H4NA 2NY3B 4XNDA 1H15B 3UTPE 3E8VA 4JY6B 5BZWA 3BAEH 2XPZA 1E65A 4QOKB 1KJ2B 4OLYH 1OP9A 2QL1A 4YSEA 1PAZA 4AKPA 4JM2A 4AG4L 3AS1A 3DSNB 5KYYB 2PUQT 4HFUL 1NCAH 2NUTA 4DKFH 2X4SB 1GYCA 4WLCA 2CUHA 5E99L 3S5LB 1JHKH 2B4CH 2B8OT 4N5ED 4XNMB 4RA0C 5E6RB 2X9ZA 4KKAD 1IX2A 4A7SA 4J8RA 2GFBB 2WJ7A 3GM8A 5LNGA 4J3OF 3GB7B 2OSWA 4JRFA 3FF7A 1R0AH 1I1AC 3HFML 4KZCA 4BFNA 1NCOA 5CIPB 1C16B 5F1NA 2OSLB 4APXA 5IB2A 1A1MA 1QRKA 3A3YB 4GUOA 2NX5D 3NABL 3HC0B 2XKSA 4ZK8A 1IC7H 2FAUA 2XTLA 1GAFH 3NZ8A 3RL1B 4AZUA 3KYMA 1AR1C 5HHQB 4LASL 2IBGA 4ZMQA 2AXJA 2E7CA 3BFQG 5J12C 1XEDA 3MCKB 3ZDZB 3BPOC 4L37A 1JF1A 5L2KB 3ILQC 3K72B 3SPIA 4OU3A 1OSEA 3C5JB 3CIAA 2DV6A 3CU7A 3M1BB 1F4XL 1TZHB 1LQBC 2E7MA 1IB5A 3WO4B 2XNAB 3OKOB 3P3RA 3ZQ9A 1QG3A 4OCYH 5HY9B 4Q9QH 1AKJD 3A4FA 3W0WB 4JLRB 1KTBA 5CAYB 2Y9RT 1JZFA 4TUJB 4F8QA 3MRRA 1UB6A 4WY7L 3V0DA 5DJAB 2WLLA 4PRNB 4WHYG 4AQAB 1G7IA 4FOMA 4OZIA 1A6TB 3O6LH 1MCFA 2AVGA 3ATAA 5E7FA 2FRGP 2ZOOA 3D85B 3ULSA 3ELQA 4N0FA 3IVKA 2F54E 4U2YA 5HHPB 4N0UA 3N1MC 4H40A 1PCSA 4R90L 4YHML 3ZKMC 5AKVA 3A24A 3IDNA 5D6CA 4AYFA 4TUKH 1AGCB 4K5OA 2BS8A 2ZAHA 4I18A 4FP8H 5CSGA 1U8PA 4NQEE 2RAMA 2CU9A 3CN0A 1XF4A 3K6FA 3BUPA 3OAYK 3AT9A 4KI5E 4L5FE 2K4WA 1UWGH 1T5WB 3B9EA 5PCYA 5C0IA 1TPXC 3MRBB 3QNYA 5FM8A 5G4NA 5H2BB 3K5SA 3II1A 1W72L 1ZIAA 5MP6H 4Y1AB 1U2HA 4OVUA 2NY6C 4FFYL 4AW4A 2CM6A 4CVXB 4FXTA 2H6OA 4Y2DA 4OLEA 5L8KB 2XX1A 3QEQB 4MYPA 4P2RB 2YOAA 3KG5A 5L9DL 3T2QA 4ZUTB 4EUPH 3ZE0B 1UQSA 3LZOA 2VLMD 4IOIB 2DL2A 2R1WA 3RURA 5CO1A 1TJHH 2P26A 2CHXA 2WBKA 4JRYA 1M42A 4ZAKB 3GSQB 3LS4H 4OFIA 5TFSL 2BNRE 3H9YA 5FM4A 1MFEH 4R7VA 4EUPG 1HHJA 3QUYA 2QDWA 2ZPKL 5CCGE 1HH9B 3M6DA 1FPTL 3UTSB 3X2QB 1JWMB 4RBPK 1T4KA 4H88H 4TSBH 4D0CA 4ODHL 1S5IH 2XLLA 3IDIA 3NFPA 3FXIC 3BD5A 4PGEA 4P3CL 4IRJA 2VDPL 3II2A 4NHUB 4F1SA 4ZI8A 1WG3A 4N2FA 1CGYA 3CFKB 4DGIH 2D31A 4I0PA 1TTUA 2ITFA 1NCGA 5IQLA 3RAJH 5J06A 1A66A 1YNKH 3ZHDA 1HZLA 3ZR5A 2C4XA 4D0DA 3OF6A 3HAEB 4HZLB 4JZOA 5HSFA 4GG6F 4WW2F 4G3YL 2FHCA 4NNXB 4PRIB 1QP1A 5K93A 1FYTA 5CGBA 3GXMA 3RIFF 3MFGB 3TBWA 4BQBA 1GGIH 2OMYB 4UIMB 5DVPA 3SJVE 3PL6C 5HXMA 2P1YA 3QRGL 2H3KA 4M1CC 4UQCA 3GJEA 3CN1A 1OHQA 4PJBB 2WWMD 2GTQA 4QRPB 3QQNA 2XQYK 5ABAA 3HI5H 4Y2OA 1LD9A 2Y0SA 3CN4A 5B39B 3QPXH 5JPMA 4LRNL 3GIVA 5DJXA 1GZQA 5I1HH 2W80C 2PYFB 3WUWA 2HG0A 2YMOA 4PJFF 3BP5B 1IUZA 4LSUL 2HN7B 3L3DB 3HLAB 4L1SA 3NK4A 5FX3A 3ZT7A 4NM4H 4FJZA 4DGVL 4NP4L 43CAB 5AVUB 3TNMA 3GSWB 2IH9A 2OX5B 5C0AD 3TM6A 5F1KC 3V0EA 4S1DC 1YY9D 2EXWD 5EIVA 3UACA 4PJ8A 1OGAA 5FM5O 4R26H 5GS0L 4APQB 3WLBA 2B0SH 2ENQA 5DWPA 1HH6B 1YEGH 5AW4B 3VD3A 5ITBL 3AUWB 4ZFOA 2Z31D 2QQKL 3WY1A 1NFDF 5CSZB 4LHUB 3UZEC 1CT8A 1BVOA 3MC0A 5T3ZH 1MCPH 1JXFA 4P5SA 1HILA 3MTXA 4J3WA 4X7SL 2OTWB 4HS6B 2NOYA 3DVNB 3IJYA 2Y6SD 1QBML 3I50L 2ESVA 4R0LB 2A74A 2HT4D 3D1MC 4RMVA 4LOVA 2PCFA 2XRAL 1IGJA 4WI8A 1CMOA 1RVFH 1UADC 1INEL 4X80H 1XDTT 1M2VA 3IFNL 5D1ZA 2AJXL 1BD2E 1Z5LB 1R46A 4HU2A 4LCWB 4O02B 1RJCA 4FQXB 4E5XG 5D5MA 4XCCH 1ZA6A 5GXBB 1FFNA 1RZ8A 4QXUH 3FYIB 5GS1C 1H3UA 2EDKA 2XWXA 2NT1A 1U8HA 4N2AA 4G9FE 1TZIA 3MRCA 1AMYA 3QJHA 3UPRB 2B1AL 4MDRA 3MN8A 1PTZA 5DVNA 1SRDA 2V2WA 2E6QA 5EC2B 1MWAB 1BOGA 1WZMA 4Q2ZB 4IK6A 4N8VG 5ICUA 1YNTA 2OLDA 1NTDA 4LLVB 4TKWA 4MTMA 2QVTA 4FC3E 3GI9H 4QKXB 4E9QA 3ARSA 3SKMA 3HZVA 4HJ1A 3VRIA 1I3VA 5IKCB 2X1OA 4BFFA 4I9WD 2MEJB 2QELA 4KVNL 5FK9A 3X14B 5GJTH 3AJ7A 4JN1H 1I8KB 4LVNC 2K6ZA 2VLRA 1BQHA 4YSTA 4JFFE 3O4OC 3APFA 4HIEA 3O3EA 5EHFA 4DGWC 1PX3A 3B1UA 5DHMC 3LKPB 2VL4A 1F4AA 2MWCA 3QUMB 1W6WA 1Y1UA 5D7KD 3P11L 1XSIA 3CV5A 4QWWD 3H9HB 2ZWYA 1NC4D 1NLBL 5IFAL 1WVZA 5T1KA 1OE2A 2VDLH 5IHWA 3VFMA 1IAKA 2NY1D 2A4CA 4O58L 4Y88A 4KAQL 1V7NL 1ZANL 2Y1AA 4WO0A 4OIFA 5DJ8A 5IUSA 1MUJB 4YDKL 4CN6A 5JW4M 3ZUNC 3BSZL 2NDFA 4QRUA 2QHRH 4G5ZL 4Y16D 2UUDK 1GZPA 1ROCA 5T8IA 3FU7B 3PGFL 2OCFD 1SQMA 2C8NA 1CICB 4TM9A 4X4YB 3GEWB 4XMLL 3CH8A 4MD0B 1R3LA 4Z78A 1OXYA 1CVRA 3VFPB 2DQFA 1SM3H 2ICEB 4B9ZA 1FNAA 2YD1A 4XO8A 5FYKH 1F5WA 1KIUB 2X4TB 4FQPA 2ZUVA 3C6EA 3QDME 5I1LA 5A2IH 4Y4KC 4L4TE 3GHBH 2VZ3A 3AG4B 1R5IA 1UVQB 3OMNB 2AVFA 4YWGH 2E7HA 2VLLB 4ZS7H 4POZD 4S0HA 4NFBA 3MV7B 4OUUA 2GSGB 3BZEB 2R69L 1VSCA 1YN7B 3TGXA 1DQML 2UZYB 4BKLB 4RCAA 3GI8H 4JFXB 1MCBA 5DHXB 2PO6C 3RTLA 1GYVA 2IGLA 4UNTA 3FUMA 5HVFB 3GMMA 4WO4B 5HGGS 3OKNA 4PJ9B 3FW6A 4PGBB 4P5MA 1A7OH 2CLRB 4J28A 2ZCZA 1YA5A 4TSAH 3ZMRA 4U1GC 3FFCE 4N8CL 2DWSA 3RVWD 1U3ZA 3MX0B 1E90A 3AITA 3OKKB 2CIKA 4M8QB 3TN0B 1ETB1 1MREH 2OULB 3D3VD 1DFXA 1QSEA 2Z7ZA 2ZX6A 4JL1A 4H26B 4EKJA 1G1YA 5FO7A 1EWHA 2J6WA 2NUPA 1R47A 4HIJB 4LKXB 2HFEA 3GNMH 4LO9A 1OF0A 4NNYA 4PH8A 4XCFL 1CURA 4PJ5D 2N01B 4CMHC 4BFIA 5AB9A 1U8KB 2P8MB 1WWBX 2JJTA 1EZVX 1VPOH 1XGYH 2FX8H 2LTQB 1TKWA 2R2EA 5CU9A 5DJ2A 3ISYA 4MXQC 2HVKB 3VXRA 2AQQA 3UYRH 4U1KB 5TK2A 3NIFB 3FQRB 4A7GA 5CLXA 3M1OA 2FBRA 4HH9A 3ULUD 5KSAD 4U3CA 2OTUA 3HG5A 4RISL 5TQ0L 4YHLL 4ANWA 1DVFA 1FFPB 3KJ4B 1QPXA 1I8IA 3QAZB 4L1LA 3DX7B 2WYTA 4H2AA 4OLXL 3W9DB 4W68A 2ADGA 1OPGL 4Y5XC 4DP7X 4IYKA 2XSKA 3LIZL 4L18A 2WO4A 4KDTA 5KSVA 4KK9C 4P2QE 3F7QA 4OUOA 5ESVA 2V9QA 3DGCR 4DPCX 3P4OA 3BESR 3WFBH 2L4OA 1NOAA 2L7UA 4GSUA 1BMZA 3VQLA 1HL8A 1TEYA 3BZ5A 2V5YA 1QO3A 1CR9L 3O2WL 4K5NA 2CBMA 3QIUD 2J5WA 3D18B 2X28A 5EOCL 4MBRA 4IBZA 1U3HA 3TVMD 4LLWA 4QHLB 2Z8VC 2A9ML 1KCKA 2BVPB 1RLWA 1U8QA 2WBJA 1TQCC 4PCYA 4X7DC 3C5SA 4PJIF 2NXZB 4DUVA 3WU1A 2W65B 5HVWA 1TOXA 1XAUA 4RIRA 4IU2A 5I71C 3F05A 5T1LA 2EC8A 5KBDA 3KWUA 1WE5A 2JQAA 1KXTA 1Q9WA 2E9JA 3ARFA 4L4VA 5F7DA 3E3QC 4IBSA 5JO5B 4DKDC 4HT1H 1UM6L 4H2CA 2MHAA 3CZFA 5F3HA 5IESL 3B2DC 5BS0D 1ZHLA 2OM5A 5DD0L 3TJPA 2GUOA 3BWAA 4HS8L 1S46A 3QIBB 2YO3A 4NPYA 4UTBH 5IMOB 3VD0A 3WS6A 1OQOA 1T6WA 1V54B 3ZE2F 4B5ZA 4L8SB 3P2BA 1YMMD 1Y7VA 1RK0B 2VXUL 4HC1A 1B9KA 1LEGA 1UT9A 5ECGA 2AQ3A 4JM2B 1I4FA 3UTQB 1PX8A 1OAUL 3F85A 4TMPA 5FHBL 1AE6L 5JMOC 1IT9H 2VDQH 3WLWD 3MRHB 3L2MA 3TNNA 3T3PF 4Z8FL 2VERA 4XBMA 3VTTA 1OCCB 4PRHA 3TTYA 3UAJD 5I9QC 3SDAA 2OMZA 1HI6A 3ARBB 1CD9B 5FV1L 2APBA 4MDIA 4FNUA 1VGEH 4NGHH 4APXB 5IB2B 1A1MB 3MJ8A 5FGBC 3BEWB 2PR4L 2XN0A 1KGCE 1JXDA 4ODWA 3UDWC 1MCHA 2ALAA 2DYRB 3G5YA 1E43A 3KYMB 3NFSL 2VZSA 5I6KA 1FORL 2ATKA 1CLOL 4O51B 5HDRA 2RJMA 2ZOLA 1U6AL 3WIIH 4L37B 4QOKE 4ATTA 2XDHA 1PZUB 1KN4H 4IHBA 2PXYD 4HALA 5D55A 2ORBH 2VCOA 3PGDA 4JKPH 4LF3A 3QZWA 5JW5B 2ALWA 3OHXA 3HC3L 4UQBA 5IJKC 3DOSA 1QZNA 2NT0A 2OXHA 4K3GA 3K71B 4PSRA 3AB0C 1ZLSH 4B5EA 4MQ7A 3N85L 4AIOA 3O2DL 2WLLB 4XPHL 4B50A 1G7IB 3QJUB 4OZIB 4B6ZA 1K2DB 4YS4A 3ULSB 4N0FB 2FX9H 4K2UL 3EH2A 4GMSH 4ZMXA 3RWJA 1WT5A 3TL5A 4CA4A 4G72B 4JS7A 3FBKA 4H0IA 1EDYA 3SCMA 4ALAL 4OCNC 4FKHA 4DJMA 3IDNB 2CBTA 3KVPA 2IADA 2YRZA 5D6CB 3DTDA 2YGOA 1G87A 3SGDI 4AYFB 3FU9A 3V0VB 2JKIS 4XOEA 3STLA 3ZDZE 5L2KE 2D7NA 3RDTA 3CLFL 4L3ED 3MFFA 2VXTH 3B8YA 1U8PB 3JXAA 1GGCL 1F18A 2OMTA 1EXGA 4HUKB 1QLRB 1XF4B 4YXHH 3G7TA 4FEMA 5C0IB 5I0ZA 3T65B 4F37K 2UZPA 2F8IA 3W0WE 2H2SD 1J5CA 4L3CB 5IBUB 3PWPB 2AI0L 2CUIA 4NSKB 2WTRA 1AGDA 2XJLA 3M8OH 4FYSA 4H8UA 2ZXCA 3C60C 1A9EA 2XV2A 3QA3B 4OIBA 5F70A 1KIPA 4Q4EA 5LCVH 5JHAA 3PV7A 1RSFA 4JFEA 4U1HB 3WFDL 2VSDA 2H0PA 1UQSB 2VE6B 2YLKA 3C2AH 2CMRL 3PCYA 5E6IA 5LCVA 3N41F 5AWNH 4JRYB 3K3QA 1WZKA 1UZ6E 3O2VL 1FIGL 2E27L 5IBTH 1MCRA 5KANG 4HAKA 2WSDA 2YFNA 3WKNA 4WGWB 3VFRA 3QUYB 4ZFGH 2NY0B 2X44D 4RMRA 3SDCC 2CKBL 2CNYA 3DK0A 2P3YA 3G6DH 3CSYA 1HZKA 1ZTXL 5IW1A 4XP6H 1GS8A 1HVXA 4PP1D 2NSXA 2K3TA 4D0CB 1VJSA 3IDIB 3KBFA 3NFPB 4YFLF 3WE6A 4MSWA 4JRXD 1BLNA 3X11B 5JW4R 4IMLA 2G75A 4NBYB 1ZJBA 1KXHA 1NMBL 2D31B 3ZBMA 1QD0A 3P30H 4KHXH 4QY8A 2E74C 2BNQD 2IQ9L 4Y1AE 3AY4A 4NN5C 5B4MD 2J55A 3VFOA 1BIIA 2QFPA 3QRFM 2YXFA 3GMOB 2XZZA 4MJJA 1NCDH 5CCKL 2UZIH 1J8RA 4TULL 4YIQA 3QEQE 5CUSL 4P2RE 4YR6A 2JH2A 5DD1H 2PP9A 4UT6A 1S7WA 1FYTB 3TO4C 3ZE0E 4HUMB 3TWCL 1YHPA 3DXAA 4AQ1C 3PIQA 3KAAA 1DVQA 2VKXA 2XN1A 2Z1KA 2BWDA 1QOKA 3AU0A 4Z7QB 4QPEA 2D3VA 3GJEB 4X7CC 3O0RL 4Y7OC 3DO4A 3SGJA 3D0LA 1LD9B 3O9WA 3RU8L 1KDIA 2ZKWA 3MBEB 3UTSE 5DO2D 3TO2B 1GZQB 1BM3H 2MNJB 2VDMH 4NN7C 4QIRA 5CP3H 3WUWB 1N7MH 4YXKL 3P3TA 5IVXA 1IJ9A 4Z76B 4LVOC 4PLOB 3O6KH 4TQPA 5CP3A 4XXCC 3AQDA 3IGFA 3TNMB 4EQ3A 2X41A 4MQSB 3AMLA 3KLAA 4DSYA 3B56A 1L7IH 5JYLA 1UXSB 1CF8H 4MXWH 4UI2A 5CJBA 5KYNA 1E4WL 1OGAB 3OG4B 3UGUA 2BXYA 4OCLC 1TIUA 1H8OA 1PZDA 1BQSA 1SBBA 4PRIE 1U8MB 2PWDA 4ZFOB 3GSNH 5A2BA 5GZNC 1MHCA 5I23A 4JE0A 4WV1C 5BW7C 1CT8B 2NCEA 3IMWA 3BE1L 4OT1H 1OL0A 4UANA 3RP1A 3T4YA 5DRNA 5L4JA 3VD9A 1N6VA 2O6FA 3BLPX 4PJBE 3GSNA 4L2YA 1RLBA 3U7YH 2J1ZA 3IJYB 4QRPE 4HD5A 4XNBA 4N9GB 4KKNA 4RFOH 3KBPA 1WF5A 4GQ9H 4IIQC 3I6GB 4N2KA 2PCFB 1IBGH 3RY4A 2R56H 2A2QT 3NCMA 1PFOA 2YBGA 3MVSA 3UOAB 4HUCA 1A9BA 5TE6H 4HIHB 1M2VB 2YK1H 4R97B 5D1ZB 4F9PC 4OZGA 3VGAB 1THAA 3L4TA 4NKMB 2NNRA 4IRZL 1WIPA 3GRWL 5C07D 2R29L 4M48L 4KOBA 5D7LD 2BRRL 4S1RH 4ONOA 1ZA6B 1RZ8B 3CH1A 4AQ8C 2XKUA 2A9BA 1A6WH 5F9JA 4JG1L 1U8HB 4D7BA 1MLBA 4HUUA 4JCLA 1TZIB 2W92A 5I74C 2BY3A 3QJHB 1UWEH 3HC4L 5I8EA 4PJHF 2HJFA 1D7CA 4FQ2H 4WUKL 3HMXA 3U4BL 5EFIA 3EBHA 3O8XC 1XAKA 3KPSD 1BOGB 4L3FA 3ZYJA 3DHJA 3LRMA 1M1XA 3FCTA 3BN9C 4G8GD 2FR4B 5SX4H 2QADD 2XZQH 5CJOH 3HR5A 4JGMA 1J1XL 2O72A 3APCA 3KLSA 1BEYH 3QZBA 3T0EC 3EH1A 1BQRA 5A3ID 3SKMB 3HZVB 3VRIB 1TZ8A 1K8IB 4XHJD 3ECVA 4HWEL 4W9GC 4I3SL 5FK9B 2OK0L 4GSDL 4A66A 3C8DA 4KJWC 4LCWE 2VLRB 1BQHB 4KGLA 1AS6A 5FKPA 1ZGLA 1CYWA 4JE4B 1NPJA 4IMKA 3MXWL 4HIEB 3O3EB 4TVPH 1YEDB 3GBML 3KR3L 4D9QD 1A7NL 1H19A 2EEAA 5EWIL 2ROYA 2FHFA 1BG1A 5L88L 2I9LA 2YMXH 3L9BA 2A4ZA 2XVBA 1DBJH 1EAPA 1LK3L 1IU1A 4XOAA 3BJ91 1S7SA 4BQ9A 1C12A 1A6UH 1QA9A 1RULL 5T1KB 4HLEA 4MCMA 4YPGA 1T4WA 3PAUA 4XWOD 1IAKB 3VFMB 4FTVD 4JO5A 5FC9A 1DDHA 1DBMH 1GR7A 4OAWA 4TOYL 3KGRA 2J21A 1MJ7L 3PV6A 2CO7A 2VDLB 3QXAB 2VR4A 3L5JA 1VZIA 1XV8A 3WENA 5IGXL 4GIPD 1NGXA 4QRUB 4CMMA 1T04A 4QAWA 3E2HC 1CDGA 1ADWA 2IV8A 4Q0XH 2C26A 1EDQA 3DOHA 3NSJA 1CL7H 4X0KA 2VM9A 3WY2A 5DMGC 3MLWH 1EGJL 4Z78B 3A22A 1FP5A 3UBXI 4MNGA 5AB1A 4L1TA 1MIMH 4JDZA 4KVCL 2W0LA 4LSTH 4NLAA 5DZOA 3UL4A 1KDJA 3SPJA 4YSOA 2XV3A 4P23D 1TUPA 1G9ML 2HX9A 3I3EA 4NO3B 5I1LB 1X4YA 1EHLH 1A14L 2XXGA 5E8EA 3S2AA 3SGEI 2CDFA 2A38A 4C56A 1H8LA 1INQA 1N64L 1R5IB 4B7LA 2J57A 4L0PB 1BYOA 3SBPA 1GMIA 2E6PA 1OAYH 1LL1A 4WI6A 5I5RA 4X8JB 2ICWI 2DQJL 3BPLB 1HWWA 4HV8A 2R59A 5KVDH 1ZV9A 1WZ1L 1MAKA 1W91A 1HINL 1W8OA 5A7EA 3KPRD 3LPPA 3GMMB 2B9BA 1SEQL 4F27A 1YG9A 4Z0BH 3SDYH 2WQRA 3AM8A 3D25B 5DHDA 3EXJA 1U3YA 2Y7MA 4HEPA 1WYJA 1ZT7B 4KRPC 4B9CA 1ODUA 3DHUA 3WSQH 1A64A 5LGKA 4XODA 4D2NA 5DFWH 4ETYA 5CBEB 2V8MA 2CIKB 4CGUB 4TXVB 2WAQA 3CK0H 4MB1A 5I6XB 2DQUL 4KKRA 5FO7B 2GITA 4O2CB 2NUPB 5CILL 5HHOD 1EEUA 4G1EA 3I3DA 4NNYB 6TAAA 1HQ4A 4BFIB 1CDYA 1JNNH 3LQAC 1JNHB 3MV7E 4RGNB 1KYFA 3RZCC 2BIHA 2HTLD 2R2EB 1TKWB 1OANA 5DJ2B 4RNRA 4PJEE 3VXRB 2VH5L 3ZOAA 2DLTA 3TEYA 2VLJD 1ZA3A 3TT1H 3JVFC 2OJZL 5F7YC 3KJ6L 1JXJA 1YSOA 4H8HA 4F58H 1QLFA 3C6LD 3MJ9L 4HH9B 2OTUB 4P5RA 3T9WA 1DVFB 3BGFC 2C3VA 3CFBA 4LCCA 1I8IB 3QVAA 5DWUL 2X4QB 2X7LA 5TTRA 4KMTL 2ADGB 4Y19D 3S34H 2N4IA 1M4KA 2J4WH 3GYRA 4YBHA 4J4PC 5ID1A 3AS3A 4UUJA 4M7JL 4XNZC 2RB8A 5ESVB 1E6JH 3BKJH 4P2OD 1PU0A 1SXAA 2VQ4A 1EBAA 1YECL 3P4OB 3RJDA 3KHOA 1UXWB 2LV4A 1DBAL 2ZXWB 1DBKH 4KX9A 5GRVK 2Z92A 4JFOA 1CPUA 3E6HA 4AEHH 5D2NA 3VI3A 3WN5A 3FB7A 1AKJA 5L7XL 5J56B 4N2HA 1D5BA 4ZBJA 1U3HB 2EUVA 1RERA 3LQAH 4G6JH 4LLWB 3T0WA 1EJOL 2WBJB 3NIFE 3NIGB 3NOIA 1IBYA 3C5SB 1RZJH 4L48A 4GKZA 1ETJA 1MAMH 3KLLA 1BOYA 4WU7A 3TP4A 4RIRB 3KBEA 3V0WH 1PMYA 5T1LB 2IMNA 4L4VB 1Q9WB 5F7DB 3TPKA 4DW2H 4AK1A 4PRDA 3ALWA 5E2UH 3MV01 5IB4A 2MHAB 3OL2A 5DCCA 1OT2A 3G6AB 3CZFB 1CE6B 4JFQA 5AVQB 1R6VA 4HBCH 1K4CA 3K74B 1XGRA 5D96C 3F7YA 1ZHLB 1IBDA 1AXIB 4QEGA 2GUOB 3IKCB 3MRMA 1Z3GH 5GZOA 3BDBA 1XF5B 2IPTL 3WNOA 3AS0A 2F08A 4I13B 5JXAH 1LEGB 1NFAA 1S7VA 3TT3H 2WQXA 1I4FB 4FG6C 4TTDC 5EU7E 3DX2A 4JEGB 3R1GL 1FNGA 3ECWA 3H55A 5MENA 4PPTA 3AG3B 1OGTB 3F65A 3G5VB 3CX5K 1ANUA 4XO4A 5CEZE 4E9WA 1JRHI 3CSTA 2GK2A 4PRHB 5B1JC 5DQJA 1TZGH 1YY8B 2OMZB 2AJUL 1JPTL 2UV3A 3VI4F 4JY5H 2A6JA 1HE7A 4MDIB 5GRJL 2DQIL 5BVJA 3MNZA 4FERA 5GGSY 1UACL 4BCXA 4ODWB 1YC8A 3T6WA 3G5YB 1IMHC 4OF3A 4FI8A 3Q2VA 1UA6L 3NCYS 4URKA 1JPSH 2ATKB 2NW2B 1JZHA 3D05A 4NQXA 4R2GD 3JWNE 5FECA 1JTPA 1LP9F 3QPQC 3AREA 3UADA 4L8BA 2KERA 2YAHA 2B59B 1NL0L 2D7TH 4Y5YA 3PGDB 1XSKA 3T71A 3ARDA 1EEQA 3QZWB 4LF3B 5FYJH 3U48A 3OHXB 4OD3H 2YXWA 1EZVY 4HCRA 4BH7A 2OXHB 3BVXA 3DI2B 5I0YA 1Y1DA 5EEVA 2PP8A 4P9HC 1G9NL 2FE0A 5GRVL 4IGBC 2XZCH 2ZUTA 3CFEA 3O45B 4EDWH 4MQ7B 4DAGL 1T20B 3JWOC 5I18H 2VDNH 5IVOA 4Q14A 2RFXB 4X5RA 4JFZL 5ISZB 3VXQA 1BAFH 3IRCA 3M1CA 1AO7D 1J88A 1XB6A 2XX0A 4LBEA 4M3JA 1AP2A 1NMCC 4CDHA 1F3JA 1BHGA 1MCKA 1FNHA 3SCMB 2HFGL 3ZDYB 3TJEH 4JO1H 2HTKC 2H2PD 4E9SA 2NNAA 1OQXA 2IADB 5HDBF 4ZFFB 4TL4A 3I9IA 4X8GA 4ZSOA 1K85A 3WMQA 4OLWL 3STLB 3RDTB 1MNUL 5EU6D 5C7XL 1HXYA 4DO6A 3MFFB 1MQKL 1ZOXA 2WYZA 2FT7A 3CFJA 3H6JA 4OF5A 1JN6A 1J9CT 1NDTA 2PKDA 4MVBC 3SKJL 3R4DA 1ZV2A 4KJYB 4Y4HD 5B8CC 2X9XA 2RALA 3RWGA 3QUGA 2XWDA 1BXAA 2LAGB 4RGOH 4XVTH 1IGML 3WMSA 2MRYA 4ZO8A 3P2DA 1A4JA 3FTYA 4Y4FD 3VACA 3WIHH 3PPSA 1MWOA 5KJRL 3ARTA 2WTRB 1K4DA 2H8PB 5GIRA 1F2XK 3WEOA 1U3JA 3WIFA 3N91A 4OZIE 1KIPB 5HI3D 2GJ6D 1KGIA 2EDOA 1MW1A 1O6SA 4X50A 1EVTC 1FCGA 3C8KA 3S37X 3AGWA 3JWOH 2A1WL 2DW5A 3QH3B 3FDWA 3WAKA 4BUGA 1P4UA 5D4HA 1YPZF 1INDH 3QYMA 1RUMH 4G43A 3P40A 2UY7A 3U0WH 3WAJA 2HLFC 2EDFA 3VFRB 1V8HA 3V79C 2OFQA 3ASOB 1GC1H 1JZJA 2R4RL 3G3LA 4L9LC 4HHAA 2B3IA 2OP4L 2CRYA 5IW1B 4NQQA 2NY7H 1KFAL 1I1RA 1SYVB 3K1KC 4NZRH 4Y7MA 5KANI 3WE6B 3MODH 1LNUA 3BT2H 5DRZB 3V6FB 1S5HB 4DN3H 2G75B 4Q9BA 3VD4A 3MRKB 1X9UA 3QBTB 4QY8B 3PWPE 3HPJA 3RPBA 4K3DH 4WSKA 3VFOB 5BV7L 1ROWA 4KTDL 2XVGA 4PS3A 5HGHB 2DI7A 4HUXA 4N0CC 4JHZA 4YIQB 4YR6B 2CPUA 5DD3H 1VDGA 2BZ7A 1H6UA 2HT3D 1S7WB 4NO5A 3DXAB 3PIQB 3PLYA 3A6CH 3L4UA 4JRYE 1U8JB 1RXLA 5D7JC 1TJMA 3ARYA 4LDOB 1T80A 3G6JA 1BBDL 9CGTA 2BIIA 3SE3A 3FTGA 4GLRI 5LBGA 4I9XA 1RCYA 4MASA 3I2CH 1SOSA 3GRBA 5IVXB 3NCFB 1VZGA 1H5BA 4ERSH 2VDMB 8PAZA 4GMTL 4YFDB 3DA0A 3KLAB 2G5BB 4WNQA 3LY6A 4DQOL 5A2JH 3GSXA 1NC4A 5T3XE 1BGXH 5ICXA 4YO0B 5IK3A 1C5BH 1FYTE 2ZP8A 1MHCB 3JBG7 3RY5A 1G0DA 4Z7QE 3DDGA 5DRNB 2ZTBA 1ZK9A 3A47A 3GSNB 1UJ3A 5AW3B 4JFHD 3VCLA 3N0AA 1EO8H 1U8IA 2YD4A 4AMKH 3T04D 5AW7B 1MCOL 3FC8A 4J2XA 5IJDC 1HHHA 4YH6A 1RK7A 5C09D 3M45A 1SJEA 2IDUA 3UTPD 1A9BB 3N1GC 5ALCL 4KKZA 3MUHL 3GM0A 3EHBC 2ARJQ 1L4IA 2YPVL 4OZGB 3VH8G 4CNIA 1IM3A 2IDTA 1XL6A 1M56B 2CO2A 3ZO0A 3BFOA 5DUPH 4IU3B 2NSQA 3CH1B 3H3PL 3MGTA 4H13C 5L4IA 1D5RA 4GKOA 3W82A 1CXLA 5I1IL 5F9JB 1OGAE 2CM5A 1F3RB 1A7RH 3OZKA 2VN7A 2OL3L 1IGCL 1SQ2N 4PR5A 5I8EB 4YSCA 2HJFB 1JHTA 1K72A 1UD8A 1EK3A 2XXFA 3QCVL 4X7TB 4X8XA 5EFIB 4AJVA 4MDJA 4PLJD 1NEZG 1CG9A 2F5BH 2O5XH 1M1XB 3FCTB 4H5SA 4JAMA 4UTAL 3NBNA 4BH8A 4KRLB 2E7LA 1NCCL 4Y1TA 3KYKL 1S7XA 5C71A 1I1YA 2AJYL 3EFFA 4M6MH 3HR5B 3PHAA 1PIGA 2JSFA 4EZKA 5T3ZE 3QQ4A 4UT9L 2AQ2A 3VRJA 4RAVA 4YL4A 4KQ3L 3ULVE 4WV1B 1F3DH 2IQAA 4UV7H 4I18C 2RQ8A 4FEIA 2X2YA 1AXTH 2G4GA 4CU7A 2B5IB 4MD4A 5FKPB 5IP4A 1ZGLB 1JWSA 3D3VA 5F7UA 1WZAA 2DPKA 3UZVA 4ZS6C 1BM7A 1UCBH 3PRZA 2F8VA 3U6RA 3VWKD 2JKSA 3GHEH 2I9LB 3L48A 5I66A 1EAPB 1UWXH 4PJ5A 5C0NC 1HKLH 1JRHL 1JGVH 1Q9KA 4IDJL 1HIMH 3H9SB 4Y2DC 1PX4A 1C12B 4R6UA 5JPNA 1QA9B 5F88B 4G7RB 4XAKD 4IIZA 4LE8A 3LB6D 3F58L 2HJLA 1NUFA 4M8RA 4OAWB 2W0FA 1JPST 4IRSD 1BF2A 4YDIL 1MCWW 4OD1H 3FU8A 3PV6B 2O5ZH 4J39A 1Q1JL 3CAFA 3B2MA 3DX1A 2F54D 3NT0A 3GK8H 5I74B 3NRQA 1NGXB 3FZUD 5FYLE 5I6MA 4KITB 3LRSA 3VXSA 1T04B 3QNZA 1IGYA 4YHZH 5KSAA 4EI6A 2KH2B 5KVGL 3HNSH 1F41A 1N0XH 4LBAA 2DB8A 1N6QL 4YDMA 4X0KB 4LGRB 5GSRA 2VLRE 4H20L 5DD5H 5FCUH 2YGVA 1Q72L 2EIDA 4IRJC 4NQED 4MNGB 3HB3B 5C6PB 3DVGA 1EEZB 4KI5D 4A6YA 1MXGA 5AOKA 3EGSA 3VYOA 2BRQA 2FUTA 3ZU8A 3FRPB 4BFOA 4KV5F 4MRCA 3QQ3A 3VD1A 5E8EB 2NZ9C 2EADA 1TYJA 5J9PA 5A2CA 2NY4B 4ODUA 5FS5A 2A77L 4GAYA 4R8WH 5GGQH 5IWLA 2UWEB 1FRGL 1BWWA 4JM4H 1N4XL 2ZCKH 3FT2A 3IU4L 4KZEL 2FX7L 3VFNA 4HV8B 3RX8A 2COQA 1EXUA 2OR9L 5E9DA 1YEEL 1WCBB 4A2FA 3DO7A 1WDAA 2Y07L 3ZRCC 4QRSA 2X1PA 1LO3L 2BNRD 3VWJC 5F6HJ 4FABL 3FL7A 5DJZA 5IMLB 5LBSL 5JPMC 3OLIA 2YD8A 4N2CA 3L1FA 4LDEB 5CJXC 1KB3A 1ZXQA 1OLLA 1JUFA 3DSFL 3GXDA 5I30L 2QQQA 2V17H 4QYOA 4AL8C 4PQXA 1E2VA 2FNBA 2IALA 4NNPH 3L6FA 5EBMA 2GITB 5FYKE 2W91A 3TV3L 4AX3A 1YMMA 3AACA 1YEIL 4PJ8C 3EYVA 5J3HD 2JKLA 4WI7A 1M6OA 3RKPA 1NCHA 3D09A 4UU9A 1WFOA 4ZDHA 4HJUA 5DUBA 3EJSA 2RA1A 1RURL 1HHKA 1JPGA 2D03H 1YEKH 4R96A 4RNRB 3SJVD 4IOFC 1RUPH 3RVTC 2Y06L 3HS8A 2ZP0T 1D5IH 1ZA3B 2R27A 1XXDC 1BSIA 3UAJA 2A74C 3H2PA 1MN4A 1YNLL 2FHBA 2TRHA 3K0YA 3Q2NA 4GXUM 3VX0A 4G6AC 2KZWA 2DM2A 4LCCB 3CFBB 1ILSA 1MVYA 2C3VB 2VOTA 3K8LA 5B7FA 4EN3C 2X7LB 3W2DH 5E5MA 2I85A 3GXNA 3PP3H 3LIUA 2WW8A 3QCTH 3CBRA 2X9YA 4N3TA 2EC9U 1FE8L 4UUJB 2XV0A 4JO2L 3JUZA 2CJSA 3SSGA 3IMRA 5I1JL 2D8KA 1MFAH 5FO8A 1Z7JA 4MXVE 4NJAH 3MLXL 4KK6C 4Q89A 4Z0XB 2UXVA 2PXYA 4K5MA 1OB0A 1KBKA 4GYBA 3DC0A 5J7CC 2Z92B 4JFOB 1UHVA 3E6HB 5KW9H 4RGNE 3SGKC 5D2NB 1GIGL 4KUZL 3VI3B 3WN5B 4M7LT 1SLVA 5E4AA 3G08B 1AIZA 1S9XA 4AVJA 2OMWA 1D5BB 3VXRE 1FLRH 1MCNA 3GJFH 3NCJH 5M7QA 4R7XA 2KLRA 2F1AA 1NINA 3II3A 1XB3A 4RA3A 3LPOA 4L8CA 4WU5A 1K5WA 5CJQL 4GP8B 3LS5H 4K7PL 2AABH 1VFAA 3PUCA 2CWRA 1WIUA 4FFWC 4AUUA 25C8L 3INUL 2Z1PA 5H35A 2VDRH 3ME0B 5DEZA 4FXLA 4OGXL 2XBTA 5AL0A 4PRDB 1CDHA 5TQ2H 5IB4B 3GS7A 1BD2D 2VDKB 3U1SH 3CCHA 4JFQB 4HXAH 1GKOA 1K4CB 4BHUI 5EUOA 3F7YB 3D50A 2BVOA 2ZCHL 3G04B 4UINL 4L3EA 3X12B 1F4YH 3CVDA 4OGAD 3LN4A 4QHKI 2QQNL 2ZKHL 4X9IA 4HIIB 4G9FD 4R7NA 1S7VB 2WXJA 4XVOA 1XXFC 4XP5L 3U7WH 1OAKL 2FLRT 2YUWA 4U6YB 5MENB 4XNYH 2C9RA 2CDGB 2Y3AA 5HTSA 4MA8L 3NIGE 3Q2WA 4KI1A 3QCUH 5HYJA 2BVQB 4XN5A 3IS1X 3N9GL 5TE4L 1XT5A 4BFGA 3HKFA 4I3RL 3WJMA 3PGCA 1RIHH 2A6JB 3WBDA 5D7IA 4L4VE 2WXIA 4XZUA 1O7DC 3ELAT 4JO4L 3BP7A 3OQ3B 4NFDA 3ZE1F 5BVJB 3MNZB 4AWJC 3BZFA 5J13B 1LE9A 2J2ZA 1Z5YD 1JS4A 4ILDA 4ZD3H 4JFFD 2ZCLH 1QLEL 2VWEE 4TRPL 1AS7A 1I8LA 3N43F 4MHHG 4NQXB 1G7HA 1QVOA 3UMTA 3TCLA 1L9NA 3AREB 5EH1A 4L8BB 2EACA 4ZO6A 1OW0A 2R0ZL 4XNQA 4Y5YB 1MG3C 3ARDB 4NC0B 1HYSC 3NMEA 4JZJC 2B9AA 1V10A 3CMGA 5D96B 2Q8AH 3J27A 5DK2A 2XQBL 3WKML 4GT7A 1I1FA 4JUSA 5F7EH 5JIPA 3SBQA 2A99A 2CE6A 4PRHE 3CFEB 4KTEL 4GS7C 1MY7A 2L04A 5ESQB 1QATA 4OCXH 2R7EB 3P54A 4LAQL 3TBYA 1N67A 3H6AA 1LJMA 3B9KD 1O5DT 4WEBH 3VSQA 5BUPA 3FU6A 1T0MB 4KXCA 3VXQB 3L9EA 5JW3H 5DMJB 3RYMA 4M62L 4LBEB 3TWYA 4Y2NA 4U6HA 2OW6A 1AY1H 3OZ9H 1F3JB 5E0QA 2QSVA 2Z65C 4OZHA 1Q90A 2G0KA 1FSKB 3DOIA 3N2JA 3AFLA 1DR9A 2I9TA 2K8MA 4GAJL 2Q7AA 4ZSOB 3BP6A 2WZPD 2HJKA 1NOLA 3FKUS 3GSOA 4YSRA 3SODB 4AIXA 3IWUA 3QDMD 5DK0A 4KQ0A 1GCYA 2GYSA 2VR6A 1E9QB 3CFJB 3FCBA 4L4TD 1YEJL 2I60L 2ZP9A 3H4FA 4X6FA 3RPIB 1G0YR 5E94B 4XN1A 4FGMA 1CDIA 3A67L 3S3BB 5IW3A 3AABA 3BVVA 4HWZA 4HZ1A 5KUKA 2YN3A 1A4JB 1XIWD 1B0GA 1WRFA 4NRZA 1OSPL 4NM8L 4DFHA 4KZDH 1K4DB 4M6OL 3X3GL 3Q2LA 5F7FA 3CSBA 4X5XB 3B3BA 3HNVL 3K8KA 4R7DA 3WIFB 3HMWH 2EECA 3RY6A 1BYPA 2VDOH 1KGYE 2GCYA 5IG7B 1O6SB 5ISZE 2V5MA 4TN9A 4FTDA 2YKLH 1B6DA 2ZSWA 4EI5C 3C8KB 3P3YA 2BOBA 2D7PA 1HAUA 2EO7A 4YAQA 1BREA 2XIIA 4IGBB 3BEVB 5LO7A 4WW2A 1ZT1B 2C9SA 4GG6A 3ZDYE 3CFCH 3K2MC 3LKQA 4G43B 3O6FC 4UILL 2WWKO 5DUML 4F37F 2DD8H 2F1BA 3LNEA 1P7QD 5AW8B 1PEZA 3V4LA 3L17A 2FL5A 5EUKB 2YWYA 4YBLC 4HHAB 1CDJA 2O5YL 3WD5H 3R19A 1TNNA 1SVCP 4PJGF 3RL2A 5C07A 2G2NA 4Z7VF 1F4HA 4LCIH 5D7LA 1R1CA 3QEGL 1JCKA 1AZCA 3CLEL 1D6VH 4P0DA 4CJ0A 3HPJB 4GW4A 5B22A 4DGYH 1DCEA 3EGXB 4J12A 4PJFA 3QULA 1OHZA 2VC2H 3PREA 2DMGA 1XEUA 5JHLL 4NUGH 3KPSA 4ACTA 4KQ4H 4LPTA 3EW3B 5B1CA 3ARFC 1P84K 2DMHA 1GGBL 1S9KC 4OQ1A 4F8OA 5ADOL 1PLAA 3LKSB 3QO0A 3VM7A 1NFDA 1E28A 1LO4H 4K8RH 4P2QD 3D52A 4RWYH 3FTGB 2BSEA 1J8HB 4D8PA 5I1KH 5TPWH 1MRDL 4A7QA 5MI0C 1IAIM 1H5BB 1I1CA 1SHXA 4DQAA 3S37H 4IBWA 5BXFB 1GL4B 4FF9A 2KZBA 1NC2D 4WWKA 3TIDA 1H6FA 5BVPL 3EYQC 5MEQA 3GSXB 1Z1WA 3LMJH 5JIDA 1L9MA 3PQYA 2F74A 1NC4B 4IKIA 1WC7A 5CBAA 2B16A 1E7VA 1OCWH 3SDAC 1NIEA 4HWBH 4CADA 4FTVA 3KMDA 1KLGA 3DXAE 1TCMA 2BMKA 4E9YA 5ITFA 1H3WM 3VRLE 2R8SH 2W38A 1UJ3B 3TFBA 3B8SA 3TBCA 4KROB 2K8QA 3QHFH 1K8DB 3V9FA 3HE6A 3JTBA 1WCQA 2RH0A 1HHHB 5DJCB 5HHVH 5GQBA 2ZG3A 1ZEAL 2FCBA 2WXMA 4PWIA 3HE7B 1SJEB 4XX1E 5EN2B 3GLZA 1ILUA 1OTTD 1Y6MR 4CNIB 4M6NL 1IM3B 2OW7A 5F21B 2JI2A 3S35L 2RIKA 1RUAL 1A1OB 2YC1A 3KWXA 2Q2EB 3Q2CA 1SDDB 4P59H 2AEQH 3BDYL 3D33A 3CQPA 4LEXL 3S48A 1G1KA 1BFTA 3MOAH 1E2WA 5H37H 4YN3A 1FVEA 1JHTB 1KBVA 4DT2A 2E0PA 1NEZB 2LT9A 2EZ0D 3AG1B 3IDGB 1NAML 2QMKA 2BIQA 5H37A 2NW3B 3RWCB 4BH8B 3BOVA 5EF3A 1DVTA 2DQCH 3KPRA 4PAZA 4Z7WF 3PAYA 1S7XB 3DX8A 1WP6A 2VITA 3QNFA 2UY6B 1I1YB 2JI1A 3EFFB 3NGBC 4HUNB 5FKAB 1KGCD 3QQ4B 2J8UB 1Q0EA 3VRJB 4RAVB 2NY3D 1RJZB 4AVIA 2WLIA 2WANA 4LLYA 4OZGE 1NCWH 1FN4B 2DQTH 3AXHA 1QEXA 3L8QA 3MLVL 4QOKD 4XP1H 8FABA 2XY2A 2YJQA 3P69A 4MD4B 1U8LA 5G4MA 3SQBA 3D3VB 4DPBX 5LLIC 4B9IA 4M6AA 5JOPE 4GW5B 3VSTA 1EUTA 3U6RB 2VSCA 1UKQA 1RV6X 3QP3A 4PCKA 2F7RA 4HJ0D 1XF2B 5I66B 4KVPA 4ONFH 3GKZA 1UA3A 4PJ5B 5KVMC 5KS9B 3NPSB 2K7QA 2OQJA 3CHSA 1HZHH 3DJTA 4JQIA 4LGPB 4ZUWA 2AV1A 2X0WA 3BUBA 3P1VA 4WI0A 5ICZA 1HCZA 5E6IC 3UO1H 1UURA 1TQWA 4E41A 1OAXH 3M88A 4JKWA 1RUKL 3HC2A 3LRSB 1ZXKA 1CBVL 4WNJA 3VXSB 1WBZA 3QNZB 3OJ2C 4O4YH 1IGYB 1XF1A 4WUUB 3RTQB 1NBQA 4LIQL 5HPMA 5L2KD 1DEEA 4Y19A 5GSRB 3K6NA 3AT0A 4PGJA 2XIDA 2W60B 5EMYA 4G7YH 4RAUA 1MRFH 4FHJA 4LLAA 3G5XB 4BZ1H 3GBNH 3DVGB 4A6YB 3SBWA 4ELMB 3EGSB 5ACZA 5DMYA 2EIZA 3KD4A 4NQCB 4YE4H 4TVPE 5GGVL 4PD4K 3W0WD 3QQ3B 5I19L 1DSWA 2Y2YA 1FLTX 2VXQA 3QYCA 2PYEA 5BZXA 3H9SE 4ODUB 3HEIB 4GAYB 4JANA 2HKHH 4Z7NB 1CFVL 4Y8DC 2C9QA 3FO0L 2B77A 2BS9A 3FT2B 1OAQH 3U0PA 3VFNB 5DLMH