2ADYA

Structural basis of dna recognition by p53 tetramers (complex iv)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
197
structure length
197
Chain Sequence
SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of DNA Recognition by p53 Tetramers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/dna
molecule keywords 5'-D(*CP*GP*GP*AP*CP*AP*TP*GP*TP*CP*CP*G)-3'
total genus 53
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2adyA00
4LO9A 3WU1A 1EANA 4GUQA 2J1YA 3VD1A 5BUAA 2J21A 5LGYA 1HJBC 4IBSA 3Q06A 1E50A 2ADYA 4IBYA 3WTTA 1CO1A 3VD0A 4MZIA 1EAOA 2BIQA 3WTXA 2MEJB 2X0UA 4G83A 4L0YA 1TSRA 2AHIA 5ECGA 3KMDA 2AC0A 3WTWA 3US1A 1T4WA 4XR8C 5A7BA 3EXLA 3IGLA 4IBWA 2WGXA 3WTUA 2BINA 5AOMA 2FEJA 2GEQA 3D07A 5AB9A 1H9DA 5AOJA 3WTSA 4AGOA 5KBDA 3WTYA 2OCJA 2J1WA 1HU8A 1GZHA 4AGNA 2IOMA 2YBGA 4LOEA 2BIPA 3D0AA 5ABAA 2P52A 5LAPA 4L18A 4IBTA 3D05A 4IBVA 4A63A 3EXJA 3Q01A 3D09A 5AOLA 3Q05A 1LJMA 4IBQA 3D06A 4AGPA 4AGQA 4MZRA 3KZ8A 4AGLA 4AGMA 4IBZA 1CMOA 2PCXA 1GZHC 2VUKA 4IJTA 1IO4C 3ZMEA 5AOIA 2BIOA 3VD2A 1EAQA 3QYMA 5G4MA 4LOFA 2H1LM 5G4OA 3IGKA 3US0A 2X0WA 1KZYA 5G4NA 1TUPA 2J1XA 2ATAA 5AOKA 1HJCA 2RMNA 4G82A 1UOLA 1YCSA 2J1ZA 2J6WA 4HJEA 3WTVA 3D08A 4KVPA 2IOOA 3QYNA 3TS8A 4GUOA 4L0ZA 2XWCA 2IOIA 2J20A 2XWRA 2X0VA 4IBUA 2BIMA 4QO1B
chains in the Genus database with same CATH superfamily
2B8OT 2E47A 1YEEH 3HG1D 1PZCA 4LO9A 2YA1A 3WU1A 1EWHA 1T2QH 2OMWB 1FL3B 4RAVA 4PRHD 3L5IA 1HX0A 4FQPA 4OLVL 2AJ3B 2ZCLH 3KHOA 5TF0A 5L0QC 1A6VL 1FFOA 3VA6A 3K6SA 2BVQB 3BAJA 3BHBB 3QCTL 3LDBB 5EIIG 4A2EA 3IDIB 2OTWA 2W81C 4DP4X 1BQUA 2F18A 1JNJA 1M6OB 1SEQH 5C8JA 2UY6B 4EAEA 3AG4B 4N90D 4XCCL 2VXVL 4ELMB 5C3IA 4XP1H 3FTGA 2GTWA 2F19L 3DTXB 5I8OL 3OB0K 4JUTA 2DWSA 4J4PD 2BZCA 4TKWA 4OZIF 3VW3H 3PAVA 1WAEA 4P4RB 2VABB 1GGUA 3KR3H 3H2PA 7PAZA 4GQQA 4U1IA 5DJCB 5F1IB 2IG2L 2APFA 2YR3A 2B1OA 3L7EA 4M7LL 4TLKA 4KKBC 3CDGA 4WUKL 5E1GA 2P5ED 1XH2A 3C08H 4LPVA 4UOZA 5CCGE 4FMKA 1IQWH 1X6LA 1OSPL 5BJTB 4J3SA 3FAXA 2BWIA 3E9UA 3GBMH 3TO4A 3V8OA 2BK8A 2FIKA 4BDVA 1LEIA 1JHKH 1YJDC 3CH1A 2L0DA 2JJTA 1EDYA 4KKNA 4PJXA 2I24N 1QWUA 2BOLA 2Z65C 4S1SH 2XN9A 4CU6A 1LJMA 3QQ3B 3WG7B 5F1SA 3TX4A 3UTPE 5JXAH 3IFLL 4GIAA 2W9DL 3EJYC 1G0DA 5C92A 2MCPH 3O6KL 2HT4D 2E8ZA 5DGRA 5DUMH 3VQ2C 4QXGH 2F9BT 4GG8B 5HJ3B 5T5FL 3QEUB 1O9VA 2F5BL 3M17B 4LE8A 4MQ7A 4HDIA 5DJXB 4PRPA 1T1YA 4OLXL 4QXTB 3PWUB 5B38G 5F0LB 5H37A 3R1GH 1QUNA 2CM5A 5C07A 4G5ZH 1XGRB 1NDMB 4Y4KB 4TVPD 1L9OA 2NZIA 5IK3A 4MB3A 2R15A 3GUTA 2VZOA 1E8YA 3CPLA 3IJ7A 3E8VA 3BH9A 4K07A 4TL4A 5FYKE 4GXVH 2E9IA 2C34A 2Y69B 2R1WA 2CBTA 4IGBA 4Y1AB 3MGOA 4MCZA 1BQSA 1N19A 4HUMB 4TNVK 4AKPA 4ECNA 2ZKXA 1UB6B 3T2QA 1AIFA 4G8GD 1D2PA 5FDWB 1NMCC 2P3YA 4MAYC 2ISDA 4NM4H 5E1AA 4AVHA 4B96A 4ZTEA 3WEMA 3OLDA 5HGHA 3WEOA 4JB9H 3VRIB 3W1ZA 2X0VA 4Y89A 3W82A 4Q9CA 5BVPH 4OGZA 5FX3A 1O6TA 3M86A 2FYYB 3IKKA 3W38A 1NBCA 1TQBC 3KH4A 2DWDA 1NFDE 2ZCHL 1KTLB 3O9WB 3RWFA 1INQB 3Q06A 1EDQA 3LSOA 3O0LA 3FT9A 5IROD 1VEPA 4BV1A 3DROB 3GMLA 4MZIA 1M05A 2LR4A 5EO1A 2J6EL 1MFUA 5DMJB 5DJZA 1AO7A 2WOYA 2VIRB 4OLUL 3EOTH 4OLWL 1AH1A 2L7QA 3HPJA 3BP6B 4OD1L 4W1TA 1GTNA 2MIZA 4J3UA 3P30H 3CZEA 2CA4A 1V54B 3H0TA 1QFWH 2V2TB 1Z7JA 2GUOB 1RHFA 4E41B 4K7PX 4AEHL 2GSMB 3BJ91 2OL3A 5AG9A 1EO8H 5KBKA 3MJGX 3V6BR 3NBNA 1M9WA 1MCCA 3BZ5A 5G5DA 5KBDA 3S8WA 4J6IA 3IAPA 4PJEB 3GHPA 1WQVT 2OP4L 4KKLD 3ZRCC 1I8MB 1XXDC 1I3UA 2YD2A 3ARSA 2Z31C 3VFNB 5FO9B 5CD3B 5E8PA 1P2CB 5F1NB 5EUKA 2DTSA 1PKOA 2X41A 1A4JA 4GAAA 1A7NL 5GISH 4JO3L 5KSBF 8FABA 1CFVL 4EUPA 5I5JA 1QLFB 4UB0L 4EDWL 2D4DA 3IU4L 4UM9A 4ZODA 1JHTB 2HRLA 2QSCH 2X10A 3O2WH 4W93A 5B1KA 3X13A 3CN2A 4LSUH 2DI9A 3IDMA 2VXSH 4OR1A 4AIOA 2FATL 5TE7H 3N5AA 4AC4A 3BVXA 3BUIA 4OUOA 5TE4L 5HHME 5IB5A 2AK4B 3NPSB 4HWBL 4PGJA 2A6JB 2H26B 4QCIA 3VI3A 1MREH 3R8BB 1GW6A 3KXFA 4AL8H 5I82A 4F7TA 3KG5A 4AIEA 4KTDL 4YC2B 3ECUA 3UBXG 4X5RA 4MAYA 3VRIA 4IBLT 1A14H 1KV3A 2J88H 3LQAC 4JHWH 3QP3A 2B4CL 2EDOA 5E4EC 3AROA 3TYGH 4YHNA 1HZHH 4DPCX 1BBDH 4ZJ9A 4OB5L 5AZ2L 4Q97A 3ALPA 1GGYA 4LQFL 3BH9B 3VMNA 4R5VA 2EJ1A 4H40A 5C09A 1W72H 4QNPE 3B9EA 3OZ9L 2GJ6D 1OTSD 3EGXA 4J6RL 1NSNH 1QUNB 1OLLA 2QDVA 5CGYD 2WLJA 4P46C 2F5AL 5LO7A 3AMLA 3MRGB 1MW0A 2CDEB 3SBWC 3OKYA 4FQJL 3VFWB 5FFOA 4PJCA 5BS0A 4FTDA 1ZSHA 4DQAA 1RXLA 3V2AR 2VLKD 4N8VA 5FYJL 5HGDB 3BH8A 4U6VL 3IJYA 1TLKA 4K4KA 1JNLH 4P4KA 5C0JB 2WXFA 1CE6A 1MCLA 4KHTH 3NG5A 2CBMA 2JJTC 1BFVH 4NQEA 5BV7B 1WJ3A 4WEUD 5DZNA 3VJ6B 1FYTB 2EECA 3MRFA 1UWFA 2O5YH 3EH3B 2X7LB 3D9AH 4BCZA 3V5KA 3SCMA 3MNZB 5FGRA 1DSYA 2CR0A 3WXVL 3X3FL 4PRNB 3DBSA 3Q2LA 3UYRH 2YXFA 2RACA 3H55A 5IQ9B 5KN5A 1PZUB 5EA0L 1F4WH 1Z2KA 2DQJH 2Y5TB 5JHDB 4CU8A 1LE5B 5I1HL 3EO1B 2R83A 3PQYA 4P2RE 2XFXA 1JDCA 3U83A 4R84A 5BOZG 2BSEA 3BPNC 1YN7A 1JD7A 2BVPA 2FWUA 4U1JB 5L88H 2BZ7A 3CU7A 2OTUB 4L4JA 3IFPB 3AS1A 3MCLL 4HS8L 3VFMA 1G1YA 4NN6C 4OKVB 3MLSL 1Q94B 2CK0H 3HAEH 3U7AA 2V3DA 2VAAB 1T83C 2JB5L 3WKYA 5E8DH 9CGTA 4M62L 4MNGE 2HX9A 4J8RB 2WUBH 4G8GB 3RX8A 5HPMB 1FV1A 4XB7A 4QLWA 1RUMH 1B2YA 1T04A 1AO7B 2O6CA 3M8OL 3O11B 1GMIA 2R23A 5DQ9B 1TO5A 1FFOB 3QRBA 3WFZA 2GCYB 4MB1A 4HKJA 4FI6A 1A7QL 4UDUB 5J12C 1KY6A 4PJEA 4EIGB 2WVVB 4MRCA 2EC9U 2KQNA 4XODA 4LSQH 5I8EA 1F4WL 3FNKA 4JPVL 5DZ9A 5L9DL 1BFOA 2WLIA 4CN4A 2XIIA 3ARGC 1KTLA 2XWJB 1D6VH 3QUMA 2OQJB 3BO8B 4B50A 2J5LB 2G4GA 1OT4A 4ONFL 1YY8A 1ZGLA 3SB3A 1SXBA 3RWCB 3BWAB 4LL9A 4LNRB 3BXNB 1PW3A 4XN5A 1A6VH 3TZVA 2I69A 3V0IA 4Q52A 4OFVA 2X1PA 3NCFB 1PSKL 1S9WB 3NIDF 1AXTH 1NC4B 1A8ZA 1CF8L 2YA0A 1U8PA 3GZPA 3QDJB 4JN2B 1P4UA 4PIBA 3VFWA 4HU8A 3OAYK 1KT2B 2BP5M 5FYLH 2D8KA 5T1MA 4F37F 1SXZA 3RL2B 3SDAB 3GSNH 2C1PA 4G1EA 2QT6A 1PZBA 4K9EL 3NZHL 4JZJC 3VWJD 3ULUL 1ZA6B 3CDZB 3VDAA 3U4AA 4R4BB 5C0AE 4W4OA 1AG0A 4HJTA 2J2ZB 3AGWA 4DVRH 3ABMB 2G3MA 3N43B 1QBBA 4UI2A 1OCCB 5I74C 4UQ3A 4UUJA 1FVDA 1Y0LB 4OFIA 5BO0D 2XQBH 4W6XB 4ZMNA 3QAQA 3EFOB 4JY5H 4OW6A 3L4TA 1C5BH 3UJJH 3D39B 2H1PH 2J71A 4Y4FD 4ZMLA 2FQFA 3MNWB 2GEQA 3S7GA 4LVNC 5I1KH 1RZIA 3WFDL 1CT8B 3MTRA 4P57B 5IK3B 4RMUA 4FABL 2VH5H 3OKNB 4G80A 2HFEA 3MRRB 4LEEA 2BNRD 3QPXL 5DRNA 5TE4H 4HUVB 3ARDB 4XWOC 2ADJB 3FUFA 1MPAL 5ERWA 2LFEA 3CVBA 4OBRA 2VZ3A 1F42A 4MQXD 4B9JA 1NMCB 4RDBA 5T1LA 1N0LB 5KVGH 3RGVC 1XF4B 4FFYH 3ARFB 2ZUXA 3JZYA 5IHUL 2EVIA 4RAHA 2PWDA 2NTFB 3KDPB 1X3DA 1F86A 2XPGB 1MCHA 3UAJA 5C0CD 5HDOA 2BSCA 2OW7A 1F3DJ 5GRVL 3BO8A 4L5FL 1WFUA 3V9EA 4GG6F 2AGJL 3ZZLA 1PGRB 3C5ZD 3MRDB 3QJFA 1S3KH 5FKAB 5KVFH 4BJLA 1ECYA 1E9PA 2A9CA 3C12A 2J5WA 3DVIA 4OB5H 4D8OA 1U3HA 4OZHA 1DL7L 2ZUUA 1OCOB 3FCTA 5HVHC 1MCNA 3BWSA 1DN2A 4QHUA 5B7EA 3DJSA 1L7TL 4M5SA 4R8WH 3O3AA 4HS6A 4P5TB 4IRZL 5KSUA 2JQMA 3V6OE 1NBYB 1U2CA 2BSTA 4WI6A 4O58H 1BAFH 2F54A 3AUWB 4HCIA 4E41A 2E6QA 1M05B 3S48A 1MDTA 3STZA 4JFSA 4KVCL 4MJ5A 3SPVB 2WZ6A 1A4CA 4PGZA 3LSOB 3S37X 4Z7OF 2MJWA 1INQA 4NOBA 2HKAA 5C7XH 2WBXA 4LCVA 2E7LA 1HIMH 5IVZB 4DK6A 2FD6L 4MNQE 5F72S 1AMXA 3L8QA 2JFCA 1XQ4A 4V33A 4Y4FC 1I3GH 1X9RA 2XETA 3QJUB 3NJVA 4HQQL 4JMXA 3NIFE 1KN2L 3BISA 1AR1D 2BW5A 1XGPB 1WA2X 3A3YB 4ZMVA 2X0UA 1CI3M 1JTOA 3RNQB 4JZJA 4B9YA 4XNAA 3QR0A 1E4WH 4GBXC 2FYYA 1A7OL 4I89A 3S3DB 4NQEB 4OD2A 3HZMB 1A7RL 2CK2A 1HOCA 4JM2D 3S35H 4CBZA 5I76A 3DX9A 4G71B 3QDGA 4ODTL 4O9HH 4GSXA 4LARH 1W91A 2AEIT 2MNJB 5GS0C 3D07A 3OHMB 3QNYB 1OANA 3IEAA 1SEBB 3QUKB 4FI8A 1IM9A 4NRZB 1LO4L 3DVNB 5CP7B 1GH7A 1YJDH 4UV4H 1ZGLP 1YEGL 1DQML 3AREB 1C7TA 5FV2A 4D0CB 4ZMTA 2WXQA 4BHUA 3ZL4L 5KSAA 4JHUA 3GQFA 4F80A 4PJ9B 2PR4L 3JVGA 3VUAA 3W37A 3RHWF 2CWRA 2WQUA 3PWUA 3HZYA 5AKRA 4Z7UE 5CR1A 3L7FB 2MNUA 1MNUL 4N26A 3RJQB 3ZVVA 2CRIA 1TYJA 3D4CA 3MLWH 1IBGH 4WSJA 4YDKL 3GBNH 2CJ3A 4NI3A 3CC5B 3D3VD 3CDCA 3QEQE 4Y16C 2EP6A 4MX7A 4P59H 5ADOL 1OPGH 4ZTPL 1TEGA 4AYFA 2PCFB 4AIZB 1SNRA 1NC2A 3F7YA 4FHJA 4N1CA 5F7HA 5D7IB 1FORH 3S5YA 4NWTH 1T1ZB 1IQWL 1YEHH 4QGTA 1JXGA 2IPKB 1J5OL 2YSTA 1U8CA 1G9HA 3IMUA 3H1ZA 4KQ4L 3CMOL 3DXAE 2ID5A 2R8SL 2JKIS 2FT6A 2XNAB 2BVOA 2NY6D 5HDLA 5JHDE 4QRFA 1FH5L 1MJUH 5EEWA 4OY9A 2X05A 2GSGB 3GSOB 3GBML 4MNQA 5CJOL 4CW1A 1GOGA 3O2DL 5T8IA 5GRUL 3U6RA 5HY9B 1I7ZB 3DVGA 3I9PA 2IEPA 2VLRE 1GKOA 3KLAA 5SWSA 4E9VA 3ESPA 1BZ9A 4OQTA 4ZPTB 1A6TB 4MNHA 2WLNA 3D8MA 4PRHE 3U36B 5MEOA 3HE7A 1H0DA 5F88B 2GT9A 2X4NA 5KSVA 1WP6A 4ENZA 2P49B 2ZOUA 3SO3C 2R2HB 4JFHD 1CB4A 5E95B 1KF9B 3CN1A 4R96B 1NCGA 3W9EA 1OP5H 3L1OL 1B2WL 3IK2A 4PWGA 4MASA 3SE8H 5JIKA 2VDPB 3GJFH 4AWJC 4P4KC 4JDZB 4XGZA 1HL8A 4PS7A 4YLBA 5IB1B 1KG0B 1U3NA 1QRNE 1OGAB 2GTZB 1D7DA 4G3YL 3HAEB 2YD4A 5FYLD 5B4MD 1CXLA 1R3HB 2DLFH 2L04A 3GYRA 3C6EA 4PUBH 4QOKD 2D7TH 2EIBA 1EDHA 3HRZC 5IOKA 2JKJA 4JCMA 4K3HA 1F1AA 3ESOA 4WV1A 4Y8DC 4HAGA 5F71A 2CRZA 3LZQA 4PBXA 4M8UA 4HIJB 5K39A 4F15B 5BQ7B 3V6FB 3PV6B 3HG2A 4WENB 4DVBB 1AXSA 3VTMA 3GHEH 1XGYL 1KJ2A 3OKOB 4PY8I 1NIAA 3DDFA 2ZCKL 1EO5A 4AMWA 4N85A 1SJEA 3PGDA 1F11B 2BVYA 3C2AH 3OR6A 1CUOA 3FO9A 4JPWH 4YHKH 3QNYA 5DRWB 2CO7B 4XC3H 4K5NA 4PQXA 3QUYC 1YECL 1WICA 2J72A 4OIFA 1GYUA 1D9KB 4HBCH 3ZYIA 4DEPB 4PJAE 3BUTA 2VB5A 5JQIB 1T20B 3HMXH 2E27H 1E4XH 3ZMRA 1KYFA 3OAUH 1L0YA 2AXGB 4PW9A 4QRPA 2UY7A 1FH2A 2F7OA 3M1OA 1QEWA 4ODUA 4F20A 1S4IA 1ZT1B 4IJTA 4UV7H 3ZRSA 3GSVB 2FUTA 2YO3A 1QBML 4HSAC 4JFDD 3TJPA 1KWKA 4JDVA 1CXFA 2R56H 4GT7A 4R6UA 1BREA 4HW6A 2FJSA 2JI3A 4MMYB 5IW6A 4HXAH 3LRLA 5C0RH 4OD2B 1MLBA 2EXYD 3US0A 1CL7H 3S0PA 1GAFH 4KVNH 5AVVB 2GHZA 3OHXA 2EADA 1R17A 1YAIA 1BD2B 1X4YA 2QHRL 3O4LA 4KHXH 4G43B 2W94A 3RGVB 5D1XE 3MJ9A 2YGNA 1E27B 2G9KA 1VFMA 1M7UA 3QYNA 2XWBA 2ZWNA 4PV8B 4D7PA 1B0IA 3ENEA 2A38A 3TVMD 4B9GA 3RNQA 3GSUA 1ANUA 4K71C 2RJMA 3FQTB 3RQ3A 2VLJD 4FLSA 5JLZA 4HLZH 4KKLC 2D31A 2PXYD 5DHDA 5T1DH 3FT2B 4M8RA 4MJ5B 3SPVA 3FYIB 4L3ED 5D72H 5DLMH 2EICA 2WKOF 2D3LA 4KPHH 4ZUWB 3CK0H 5IHHA 1BW8A 1DCEA 3SDXE 1OLZA 2CJUH 2X4UA 4MYWB 2LU7A 2KUTA 1OKEA 4G8GA 5D1QC 1NCDL 4ZQKB 3ARBC 4ZUTA 5LKNA 4PV1C 4Y4HD 3VYNA 1NFIA 1A1OA 3EJCA 1AZCA 4X7EC 5DQDL 3GRWL 4RZCB 4NKDA 5T5NG 1EEYA 4AEIL 3QUGA 1L9RA 1T7YA 1GJIA 2GHWB 1XF4A 5E70A 2EDBA 1U8NB 2FGWH 2XNAA 4G59C 4X9BA 1T4WA 3NH7L 3FUIA 1L7IL 2EACA 3DI3B 5LBSH 4ZTOL 4PWFA 1RJLB 3QHZH 3N9GL 3OBAA 4OZ4B 3C5JB 4TUJB 1PZ5B 3ILPB 2ITFA 1FZOB 4U05A 4ZAKD 1W15A 4X6CA 1CLYH 3FFCA 3KLAB 5SWSB 4KZEH 1E5ZA 2HT4C 4JY6A 4S1DD 3WKNA 5D1QD 4HIEB 4AE0A 2D2OA 5GGTH 2G9HB 4QRSB 4HJ1A 2OV0A 1ASPA 1CDUA 1NL0H 1JFQL 3V0WL 3VD5A 3GSXA 5AUMB 4KKQA 5HHQB 1ZHLB 1M3IA 5EBMA 3LQAL 3HPLA 1G5AA 5CBEB 1PCSA 1J0IA 5D2NC 5A2CA 2C9PA 4IRJD 4Q7DA 3EYVA 4AYSA 1R5IA 4NPYA 4NCC2 32C2B 2B1HH 3QJOA 3WKPA 1V7MH 5HDBE 3JV5A 5F3HB 3VVWA 4MJ2A 1CTNA 4OT1H 2R0KH 5DTFB 3ARDA 2QSVA 1YVLA 4F9PA 4XP9L 4YHZL 2AW2A 3V0AC 3DVNA 3CWGA 3SGEH 1Q9OB 4PJ9C 1BAWA 4Z9KB 1B6DA 5I1JL 4OGXL 1MFEL 3P0YH 2HPTA 1FVDB 3WFCH 2PETA 3VXUB 1I3RB 4N4YB 5LBSL 3TYFB 3CLEH 2M83A 1HNYA 4FRWA 4KK9D 1L3NA 4XO3A 3K1DA 1UEMA 3LNFA 3RDTA 4ODXB 4K7FB 4YO0A 1SLUA 2NX5B 4LEBA 5IVXB 5JA8B 3GRWH 3B37A 5D9SA 2O5XL 1FVEB 4IU2B 4L8SC 5FS5A 2F2HA 3BZEB 2QTEA 3HG4A 4KFMA 4D9RD 2LVEA 2QQNL 1CGVA 3UG3A 1OP3H 4XOEA 4QEGA 1LP9E 4FQLH 4XP5H 3EGDB 1S7TB 5IHZA 3U6XA 2ED8A 3H7BB 3WS6A 5IGXH 3NRQA 4HGMA 4KKBD 1NC4A 5T1LD 4P23B 1KMGA 4IEFA 3K7UA 2NY3D 1NBZB 2VWEC 2ADYA 4I4WA 4XPBL 4PRDA 1OOWA 2X89A 2EDDA 1N10A 4NQDB 3C8HA 4HLZG 3NCJL 4QHLA 2F54B 5IUSA 4DCQB 4AQ8A 4JPVH 5L9DH 2V8LA 1OT1A 3MUUA 1MFAH 4NQSA 3WYRA 4NN7C 5ITFB 3JYCA 2D7TL 4MMXA 5F3BB 1M6UA 1PEZA 5L2KB 2ZCZA 1TTBA 3VFRB 1N64H 4PLJD 2AJUL 5IIEA 3M8OH 2Y72A 3KCWA 4PWKA 4L29A 3VXMB 4E9TA 5LN8A 2WQVA 4ONGL 1B4JH 1PBYA 3BP5B 3HS0B 1KLFB 4ANUA 1QATA 2BX5A 3HI5L 2O5XH 3U30B 3PWJB 3GLDA 2HTLC 3HE6B 1LO0L 2WW8A 1XF2A 2XYCA 4QRBA 4DFIA 1Z9NA 4J2XA 4Y5XB 1Q38A 2NTFA 4FQHB 1KN4H 2ICEC 4LHQB 3UBGA 1NKOA 1HQRB 1KJ3L 4MXWH 2FL5B 4UT9H 1DQVA 4X6FB 3RZCD 3BP6A 2A77H 3CFCL 3PJLA 4ZOBA 3IJHA 3EYOA 2VDQB 3U9UA 3UC0L 1QMUA 3IGFA 3LRSA 5D5MA 5HY9A 3VCLA 1BOYA 2WANA 1CMOA 3LRHA 4NUQA 2PCXA 3WFHA 3LKOB 1OCZB 4LSRL 1TCRB 1E5AA 1NCCL 5D1ZC 2J3SA 2OMVA 3L3IA 2WM0A 2R8SH 4K3EH 1BFVL 2JTDA 2H6UA 4BFNA 4PD4J 1QFUL 5I5IA 1L0PA 3EG9A 5FUOH 1GCFA 1T0NB 1LD9B 1NIFA 3F7LA 4WO4D 1T7WA 4HS8H 1NDTA 2CKNA 1ZS8B 1MVUB 4UM8A 5FC9A 4YXLH 4Z3FA 1ZLEA 2ZXQA 1GJUA 1I9IL 2DWTA 3FRUB 3ET9F 4YSOA 2CHXA 2YS4A 1LO0H 4LLMB 3ZZQA 2VWEE 4IDLA 2Z8RA 5DMIH 3NP4A 3QRGH 4JPSA 5EA0H 1T80A 2DYPB 4JG0L 2PW2A 1WO2A 1B2WH 2WOBA 3LIUA 4ZTOH 1OGAE 5I17B 1ZVSA 4KKPA 2FGWL 4NO5A 1ZDSA 4DP1X 3RX9A 1V3LA 2J4WH 2VLLB 4DZBB 5KEZA 1XWVA 2H2SC 5I1IH 1IAOA 3VGHA 5D4JA 1NLBL 1PX3A 4PJFB 1NPJA 3RG1C 4JO1H 3H42H 2B15A 4ZFOB 4B9KC 1DEEB 2WWOA 4C83B 4QI3A 1D3CA 4QTIL 3NJGA 3PXHA 3VD0A 3LV3A 4UOW1 3NAAL 5E4AA 1MF2L 3J7HA 5FM4A 1EGJL 4CMMB 3IPEA 3BMWA 3ZIMA 2OMBA 1W2KT 4HFWA 5EFIB 3TBSA 5J11B 1ZLUH 2P5WD 5KS9F 4R3SB 3ZL2A 3MNVB 3LAFA 3KLLA 4JQIH 4I1PA 2GK0B 2IH1A 2RBLA 2Z6FA 4UT9A 3VGEA 5HHQA 2HPOA 5FWQA 1R3IL 2V5RA 5IOPB 3T8MA 4HUUA 4WWNA 4HC1H 4H0IA 3BJLA 3W0WB 3TTSA 4F7EB 4LP5A 3NACL 2HX7A 1LK3H 1A1NA 1WG3A 4U1NB 1ORSB 4XMUA 3ARVA 1FF5A 1KGUA 1QQDB 4QT5B 1DN0A 3BZ4B 1P2CA 5D7KD 1IE5A 4GBXD 5KVEL 1N59A 4N2EA 1YUKB 2WVTA 2NNFA 1RIVH 3QQDA 1DQIA 1DQKA 4XPGL 5LG1A 2P45B 4AKOA 1BF2A 1XF5B 4JO2L 4C56A 3IU3B 5DSCB 3RIAF 2VR9A 4L48A 1MIMH 1EHLH 3QW9A 4MHHG 4X6FA 3PAZA 2YPKB 4ZNEA 4BSVA 5JDJA 3LH2H 2FNWA 4ELDA 4PS3A 2AJYH 4G9FA 2Y1YA 3MSPA 4FNTA 4WW1B 2BOCA 2VXTL 3B5HA 3FTVA 2H2SD 4L1SA 4GY4A 4BFIA 4WI9A 4Z7IA 2GVYA 3EDJA 1JDAA 4HKXA 3MGTB 3PP3H 4CU7A 1QP1A 2IXQA 2A1WH 4PRIB 4UANA 5F7NC 5J3HC 1NQBA 1WAAF 2H1LM 5HDQL 5IFAH 1FL5B 1N2RA 3P2DA 3BP4B 4GT0A 2MTAA 2NDGA 4V2BA 5F9AC 5SX5K 1YECH 3QIWB 3QIUD 1SVZA 5C0IA 2G2PA 5CR8A 5E9DA 2QKIA 1MCOL 1K8IB 1OE1A 2X53A 3HS0A 5AAPA 2BXYA 2QHLA 4HIHA 4FLOA 4ZSOE 4PRPE 3SO3B 4PV8A 2CNZA 1A7OH 1WHPA 2DQHL 5CN1A 4JFYB 4KPHL 3D18B 4MAUL 4UQBA 1HYRC 1DE4B 5D71H 4H5SA 4QTHB 3X12B 5BMFH 1USQA 4QAWA 3V5DB 5JW4Q 1UWGH 1RIUL 4Y2OB 5IVXA 5D2NE 4GP8B 2DWDB 2HYMA 2EVHA 4FA6A 5K9KA 3OC5A 1AHWA 3CFTA 1ILUA 1M42A 3WHE1 2R1WB 1XTMA 3TL5A 3PUUA 2OZNA 2DIBA 4HG4J 1XBDA 3CFQA 4N8UA 3U1QA 1EZSA 5T3XL 3TASA 2J43A 1J1XH 1BLNA 1O7VA 4OSUH 4GRWB 3ME0B 4GKNB 4H8VA 5I19L 4JKMA 5FDWA 1QWNA 4QHMA 4KI5D 3OB8A 1CLVA 3F7PC 5IWLC 2NYYD 4JQXC 5FYKH 1C1EL 3UL4A 4I3RH 4QAMB 3QIBA 3U46B 3NFSH 4YN3A 5HVGB 3B9VA 4R2GC 3A4FA 4A04A 4JHZA 3RKDC 3KMDA 4K7FA 3UTTD 1R3LA 1JERA 2HLAB 3L5XL 1DQQA 3VD7A 3NN8A 1YEJH 1ZHLA 3MOAH 3O6FD 4JE0A 4QTFA 4YXKH 3S3CB 1RIHL 1S3KL 5F6IB 1B0RA 5AB9A 4YE4H 1YMHA 4P5RA 1FAIH 32C2A 2ATKB 2DW5A 4NQTA 2BHUA 3AADB 4X7SL 4FD0A 2PW2B 2QPDB 1QZNA 4ADJA 1PD1A 4WV1B 2IANA 4LF3A 2YMTA 1UJTA 4J3TA 1X5LA 3JWNC 4O02H 5KBNC 3GSRB 2VMCA 2A6JA 4TQHA 2E5EA 1BF5A 4JRXA 1CXHA 1IIIA 2AXJA 4JFED 1R5IB 4NPYB 2J73A 2NXZB 3IRZA 5DEJA 3IJHB 1NBVH 3WY2A 2CMRL 4JQVA 4MAYB 3GHBL 4MMZA 4YPGA 1VHPA 2R4RL 4YLCA 4CGTA 4KY1L 2YFNA 2XQ0A 5CEXB 1UUSA 4XH2A 5KTEL 4CVXA 4ZSOA 1SOKA 2H26A 4V1DB 3OPZL 2E9JA 4JQIA 1NFIB 2DIEA 2ZAHA 4KMLB 4RRPA 2Y22A 4ZUTB 3HMXL 3PWJA 1JPEA 3VXUD 1A4JB 4H7VA 5JHLL 1GR7A 2E6PA 3RB7A 3VXME 1D5BA 2F19H 3O3BB 5DLLA 5GXBB 3IFLH 4NN5C 1H15A 4PB9L 2E9WA 5CUSL 4HGWB 3OM3B 2YHGA 1KEML 1M9SA 2XI9A 4CMHB 2QLVB 1FNHA 4WWKC 2COQA 4FFTA 5EIQA 3AVEA 1I9IH 4XPHH 1U9KA 2D0HA 3WIIL 4G6MH 1NCAL 4QXWA 1ADQA 1LO2L 2EXTA 3ZY7A 4BSWA 4D2NA 4EZLA 3HKFA 5J6HA 4NM8H 2HXAA 1IGTB 2XG5B 2DM2A 2OMUA 3UGUA 3VRLE 3P1VA 4BEIA 5D96B 2YD6A 3GZOA 1N67A 5ALCL 3HBZA 1NBZA 2I7OA 4N5UA 2VDKL 5JUEH 1QA9A 1OTSC 4P23A 4OFYD 3R8QA 4KROD 1S7XB 5F0PB 5MI0B 2XN9D 1ACYL 1UATA 4DH2A 1LE5A 1T0OA 3GSUB 5DVKA 4P5KA 5TGBA 1SMOA 5SX5H 2EXWC 2WXOA 1C9SA 3H0TB 4WFEE 2UXTA 3R06A 4NWUH 2C4XA 2D31B 4RMVA 2K9FB 2CBPA 3KNBB 1HHIB 1S7WA 2CCLA 4KQ4H 1BZQK 4LLAA 4LLWB 4LLYA 3RVVD 1JWUB 3VG9B 4R97C 3QR2A 2D2CC 1JWSB 1H5BC 5E00B 2X44D 3PP3K 4X9YA 3RJOA 5LQBL 3K6NA 4NNYA 2C9SA 5F7BA 2QTVA 2FR4B 4H13C 3FUNA 2NSQA 3EHBD 3ABKB 4N9GA 4PVNA 5I2IA 5GS2H 1IB5A 2KT6A 4R4FL 3TBYA 4DKDC 1EHXA 4GIOA 1TYRA 3QRLA 2OYKA 1F1GA 3FW6A 4XX1E 5FUCE 5GGVY 3L4YA 2MPVA 5HYSB 2Q8BL 3QPKA 3LEXA 1GOHA 3DPBA 1ED3A 2FJHB 4LSSH 2BFGA 3A4DA 4QXTA 3IE9A 4FX5A 3VFVA 1B3IA 4P2QD 2UZPA 3NSFA 4JFFB 1IAOB 5KZCD 4OJEH 4DGVL 1JZIA 5AZUA 2LAGB 5EDXA 2MQ0A 5KVMC 4XMLL 4WHTA 5E6ZA 3IPFA 2RA1A 5ABDE 3ARBD 4XNMA 2HKHL 2X2UA 3VSQA 2QR0A 4C59B 1FGNL 3FN9A 5GZNA 2VC2B 4ZPVB 1WRFA 4J4PC 4P9ML 4TUKH 3MRHB 1EPFA 3X17A 2X89D 2ALAA 1NOLA 3UROR 1MVUA 5M7QA 1OHQA 2UZYA 3PHQA 3EZJB 3V52H 4UTBH 1MOEA 2VT0A 2IGFL 3AT9A 4FNSA 3HR6A 3PGCB 3BLPX 1AO7D 3BPCA 2FBRA 5EBWA 1SHMA 5GRVK 4P5MA 1TF4A 3ZDZB 3U0PA 4YUEH 2CO6B 4ZUSB 5TQ0L 4ERSL 3ISWA 4D9LH 5BRZD 2X6MA 4F58H 4RGNB 2B20A 3BPOB 4L9LB 1JD9A 4WJ5A 5CIPB 3FPYA 2WTRB 2JQZA 3RWGB 1JNNL 2NY4B 2Y25A 2DPKA 2VXSL 4F57L 1DUYA 1Y07A 1FG2B 2PPAA 4BK4A 1AP2B 4ZS6C 1MWOA 5C7XL 2NY1C 2R27A 3GLAA 5ID1B 5KANI 1CD9B 3TFKC 3HN5A 3MV7B 4WWOA 5HGBB 2IBZY 1HFUA 5TH2A 1A3ZA 5GHWL 1OAUH 2AAAA 2WNGA 2FL5A 4DZ8B 4IU3A 2VL4A 4MNHB 4OFKA 5EULV 3VACA 3QDJD 3EHBC 4GSQA 2ZWLT 4O58L 1QD0A 1L0QA 1TG8A 1IMHC 3L7EB 5D1ZI 3AU1B 1BEYH 4TOYL 3V0HA 4ZFGL 5DRZB 3L3HA 4HC1A 3N6YA 4TPRH 1AS8A 3MLVL 1BZEA 2WIIA 1A66A 1BOGB 1CDJA 4HGKC 5E6YA 1N5YH 4PJ8A 3QUYD 3GSOA 4I8DA 1OTTC 5FAAA 5TK4A 3D69A 3ULVF 2DBLH 1Z5LA 5DFTA 4LQFH 4GW1A 4LPUA 4YPGB 2F7PA 2WXIA 4K55A 4JZOA 3KBHE 1I53A 5D2LA 4ZBJA 4WK0B 1IRAY 3PP4L 1BXAA 2LLLA 4MJ6B 4NN6B 3L9EA 2YAFA 4O02B 4X8XA 5I6PA 7FABL 3U6RB 4FQ1H 4IMKC 3LIZL 2GSGA 4K5LA 2HN7B 4L8DB 1KIRB 1UZ6F 12E8H 2NXZD 4F3FA 3K6SB 1XSOA 4UT6A 3VH8G 4QRPD 1LWJA 1GAFL 4KVNL 4JR9H 4WU7A 2JI2A 3B3IA 3HNTH 1RP8A 5B1AB 3WTYA 1WWCA 3KYNA 4PJBB 3GZQA 1NAML 3Q5OA 4A55A 2YGPA 1UZ8A 3QIWC 4N24A 4W9EC 1X7SA 2AXFB 3GXDA 1MRFL 3TO2B 1F4XL 2OJZH 5B39A 4FFWC 1EUUA 1F8TH 3AG2B 3DLQR 5D4IA 5LAXA 4M3JA 4X99B 3K5RA 3AJ7A 4MFHA 4PJIE 1OP5K 5FW6A 4WO0A 3HB3D 2WKLA 3MNDA 3LKQA 5F7EL 1SJMA 2OR9L 4NM4L 3KDMB 1I9RL 2KERA 2BLFA 3U7WL 4F8LA 3MGOB 4MCZB 5C97A 1K8DA 4DUVA 2WK2A 4EBQL 2DQTL 3QPQD 1IILE 3IETA 1SF5A 1AXSB 2I32A 4AH2A 1GPOL 1UXLA 1K2DA 3FQWA 3QFJA 4PRIE 5JW4N 2D3NA 3SGJC 3SDAC 5DZPA 4KNUA 1UB5B 3EO0B 2HUEA 3IFOA 3DSFH 1BQHB 1RMFH 3GI8L 3RWJB 4KZCA 5JW3H 2E6JA 1ETA1 3P11H 4XBPB 3QJZA 1R3HA 1AHMA 3RFRA 1A9VA 1U33A 2AQTA 3CFMA 4MAZA 1JVOA 2VDKB 1ADWA 3VXRD 5JHMA 2UWEA 3LTVA 4QKTA 2R1YA 2AEWA 2WZ5A 5C0ND 1GYVA 4FQCH 3WNLA 3VVVA 2BIMA 3FQ4A 3KWWB 1VFOA 2XVLA 2A4CA 2QQLL 3KYKH 4NFBA 5SV3A 3KBEA 1TR7A 4E9WA 4OU3A 2ZYIA 4PCTA 4PJHF 5FM5M 4LVNB 5F8RC 2XTJE 2COVD 3QEGH 2Y6SC 2XFGB 4NSKB 1E50A 3QWRA 5I1AB 1R47A 5T3ZE 4DVRL 4QRAA 3LH8A 3PAYA 1JMZA 1QEXA 5IESH 4HFUH 4HKXB 1MW1A 1HAUA 2XTJD 4JR9L 3LRMA 1J18A 1IKNA 2PW1A 3BIBX 4KRNA 4JGJA 1AP2A 3Q2WA 4WFHD 4NO0B 3Q3GA 3BESR 4YHZH 4LCWB 2C9UA 3V4VB 4FQXA 3MRKA 1FO0A 2YD9A 3QJFB 3O6FB 2ZWKA 1NCCH 1W0VA 1F45A 1KXHA 3IU3A 2N7SA 1ND0B 2XZCH 3RBGA 4X5WA 3TA4D 4OZHB 4UQCA 3IDJB 3JYBA 3N41B 4U49A 4KKCC 3O6LL 2QKIC 2KI6A 3ABLB 2J6EA 3SDXA 4XI5D 2VLKA 3T6VA 2M26A 4ZW3A 5EU7C 3I3EA 4DP8X 1ITBB 1NZRA 1T1WA 2K0RA 2NNAA 2V7NA 4JRXB 35C8H 2CO1A 5IMMA 1B88A 3V0DA 2OM5A 4F9LC 4QHPA 4L4VA 3MLWL 1T22B 4IBQA 3WN5A 1TTCA 4BSJA 3RNKB 1A65A 2VDNB 3O3UN 2PO6A 5FYJU 4MZRA 5E8NA 4PJHA 1P5UC 4ABVA 4R7NA 5JHLH 2AJUH 3I9IA 3F7VB 3RY5A 4EQ2A 4HZLB 4N9OB 1M1SA 4PMFA 2X4RB 4AEIH 1BD2D 25C8L 3C5XA 3O45B 4TNGA 4XHJC 1YY9C 2EEDA 2BCKA 3MLYL 4POZC 4G8EB 4HCRH 4G6KL 1F4YL 1QASA 3OJMB 3UTSB 2HFFA 1XDTT 3BUDA 4HPOL 4FXKA 5D8JH 1JZ6A 2YD3A 3AQXA 4PU2A 3TBVA 4WFGE 5CMAB 5C09B 1SDAB 2XZCL 3ESVF 3WIHL 2MCMA 4AK2A 2J6WA 3VRLF 2ED7A 3D39E 2QGEA 4ESKA 2QR0B 1JYNA 5J1TC 2FR4A 1MJ8L 1DBJL 2P24A 4M6ML 2VDPH 2ED6A 1OAXH 4CJ0A 1YN6A 5J57B 1A9BA 3FQRA 5FYJE 1OGSA 5E8OA 5E1HB 4YZFE 1EERB 1KCRL 2V2XB 3WXVH 3X3FH 1G6VK 4ZYKB 4AEHH 2QSTA 5DRWA 3CQPA 5KVFE 2X70B 4LSTL 4ZX6A 2IO5A 1J9TA 3EIFA 2DQEH 1F90L 2CHWA 3NPSC 4FXGC 3S37L 3MBWA 4KJQD 2PW1B 3B5GA 1ZVYA 1CYXA 2JK5A 2XKNB 2WTPA 2ZOLB 1RZ8B 1ONQB 1IBDA 5D7LE 2WXNA 2WVVA 4CBPA 3BN9D 5D7HA 3GIVA 2XG5A 3F3HA 4NNYB 2SODB 3T6ZA 4ATTA 3BIAX 2XG4A 12E8L 2ERJC 5T1JA 1P7KB 4YDMA 2K6YA 3KS0J 1MWAB 3T1WA 1TSRA 4U1SA 1LL1A 4AYBA 3JWOH 1F56A 5DEGB 5DK0A 4W68A 4EVNA 3ZKQD 5BV7L 3GBLA 3WE1A 5DFVC 2NXZC 2MWCA 3MTXA 1RZPA 1MW2A 3QULB 2DMGA 1CVRA 1KDJA 3UPRB 4UT7L 3MXVH 1COBA 1FBIL 2OCJA 5I15H 4G8FA 3U7YH 4AUYA 2XTSA 3VMPA 1X6NA 4KY2A 4TXVB 5H2BA 3JWNH 3D12B 4FDWA 4L2LA 5L4FA 3H2QA 2BP3A 3O11A 1DDTA 1RZJC 2OR9H 4MMXB 3MRCB 3UOAB 5DYFA 5I0ZA 3JTBA 2X2IA 4NQSB 2NY4C 1JVKA 4EE2A 4K2UH 2VQUA 1W0WB 1YPZA 3HC0A 4RWYL 5ICZB 5D6DC 1RURL 3FONB 3UMTA 3GSRA 3HUJB 4XMLH 2ZT9C 3T1FB 4A7UA 2NOYA 4YHYB 2O61B 4IOFC 1CQYA 2R1XA 2Z8WC 2LV4A 2ZPKL 3BH8B 5DJ6B 1RU9L 2Q7NA 5FKPB 5TPWH 4YSTA 3MLXL 1NUDA 4F7PB 4CVXB 2O5ZH 3UTTA 4JPIA 4AL8C 4AJ0A 1TQWA 4KTEH 5ICYA 3P2BA 5JOFB 4FG4A 4KJPC 4P0DA 4QUOA 5D6DA 1WAAA 3QT2A 3RDTB 3U4BL 4N28A 4EI5D 1FYTE 4JLRB 1DEDA 1QR1A 4I9WD 1EMTL 3A6CL 3MV9B 2CBQA 4GAJL 3CPLB 3L9RB 2XWTB 4JFXA 2IGTA 5GRJL 4AQ8C 2KDYA 2IQ9H 4N8VB 4YFDB 3MLVH 2VITB 1S2EA 2P42B 1WLHA 3C5ZA 3FQYA 4F8QA 3SDAA 2A9BA 2NXYB 4I3GA 5FCUL 1GGCL 3TBWA 3WNMA 2CRMA 2FHFA 3MBXL 4HIPA 4XHJD 3L3JB 5GHWH 1UWYA 3N3EA 2BIQA 3KPRD 3F6IA 3UAAA 3P73A 2VL5B 3Q9QA 4YNYA 5HHOD 5A16B 1V55B 3MU3A 4JKLA 3O3DB 5E2TH 4Q9QH 4YL4A 2N4IA 4IKJA 2AQRA 3ZE1E 3B9AA 1TZGH 4U1HB 1OALA 4XCNB 3L3IB 1YUHA 5EF0A 1F3RB 2A0LD 1YEEL 2OJ1A 3EJSA 1LWRA 4YGVB 5TJWK 1UT9A 4XNYL 4UBDD 4U7MA 2KZWA 3NZSA 4RNRA 3DJTA 2VN3A 3L4WA 1EBAA 1JHTA 2N0KA 4UQEA 5I19H 3ULAB 4ODWB 1JFHA 4XI5C 3G08B 4WU5A 2F53B 1NM9A 1KACB 3E6HB 5F21B 3TH2T 2ZX5A 1ACYH 3PABA 4HKBA 2YIHA 4ZDHB 3HR5A 3WFEL 5C0DB 1QPKA 2AJVH 2BP8A 1FP5A 1CICD 3AFLA 3SJVD 3D6GA 2BWDA 5JO5A 4NP9A 2CKBB 3BPCB 3AB0B 2MPAL 4G9FB 1RZQA 3FTZA 4M93C 5E6IA 3DX4A 1NLDL 4H1LA 4UDTA 1SQ2N 3RU8L 2QVIA 4Y8AA 2BVPB 2J8UA 3DHUA 4NZJA 5CLYA 4WUUD 1GW0A 4GAGH 2OLDA 3MNMA 4QXGL 3QDHA 5D7KE 5EEVA 1M71A 2IWFA 2ZF8A 2FJGA 2OPCA 4NNXB 3QE5A 2BVEA 4WO4B 1UASA 4PJFF 1IM3D 3D33A 3LX9A 1MFBL 3WENA 5FKAA 4XNDA 5CN3A 2AJXH 1I8MA 3TJEL 2C3XA 2HG0A 2XA3A 3IAGC 5KSAD 5I1EL 4NZTH 1E4XI 4P48A 4WLCA 4Y7MA 5HPMA 5ESVB 1A0QH 1P7KA 1WUZA 2HVBA 5J13B 2NDFA 1I3GL 3PWPA 2B59A 1PNDA 2OMXB 2X4OB 1ZSDB 2J1ZA 1CQKA 3F01A 4S1DC 4WW1A 4Y5VB 3SDDA 2GPZA 1NTDA 1WH0A 1TJGL 1EJ8A 2AK4D 3L2MA 1EJ6A 3CHRA 4A39A 1EXHA 4XCEB 3EFFB 1XGUA 4BQ9A 3ULSB 1BZ7B 4P4KB 3QIBD 2CMRH 2R9HD 1DDHA 3QUXB 3EJQA 4N0FA 4KKRA 3ULUF 3KBPA 2WGNB 1AGEA 4A7SA 3ARBA 3ML8A 1ZLSL 3CN3A 3MROB 5H35A 1SXCA 3B1TA 3BEWB 2YD8A 3AWFA 3GMRA 3DX2A 2WNXA 2AK1L 2ZXBA 3H9HA 3FN3A 1I1YA 2WINB 3UYOD 5IVNA 1G7LA 2BIIA 2XWXA 3LPFA 4XRCA 1EIBA 2OI9B 2G2NA 2ILLA 2WIMA 2IMNA 4GJTB 3MO1A 4HUUB 4QF1B 4DO4A 5KVEH 2GFBA 1VACA 2A6DB 3BIKA 1QFWM 2UUDK 4N2IA 3FCSB 1HWHB 2LLNA 3U0WH 3W5MA 3H8NA 3B43A 2AHIA 2EINB 4E5XB 5T3XE 1BIIB 2XZZA 3F12A 4LGRB 4MXQD 4RZKA 2YQGA 3FDWA 4JHAH 3K4ZA 1JZHA 1IKNC 1JZFA 2GBVA 3PIQB 2Y06L 4MA3B 4KXAA 4PJIB 3QDMA 4C83A 4Z23A 2FO1A 3EXLA 2I85A 3GBNL 4N2BA 4YSUA 1OAUL 3O4LD 4FYTA 3ZE1F 2N3JA 3FQ2A 3VQMA 1SJVA 4IIQA 4R4BA 3S88H 2Z4QA 4PS4L 2AQPA 1I8AA 2NYZA 4WZ9A 4OLYL 4WHYH 1BVLA 5DZLA 4LOUC 4AZ8B 4WU5B 2A1WL 3LB6C 1UYWH 4NC1C 3GDBA 3NA4A 4PRAA 2B77A 5BO1L 3HBGA 4P5TD 5ESAA 5AALA 4XTRD 2DIAA 5J5EA 3HHRB 4GRLA 4M5YL 1RULL 2WLZA 4L23A 4L3CA 1K4DB 1VAHA 2V5MA 5IF0A 5I1DB 1CWVA 3DV4A 5C0CE 4H1LB 4YZWA 1F6FB 1H5BA 4M1CD 4LNRA 3NJMA 3HC3L 4X98B 5IQMA 1IO4C 2VZSA 4DK3A 3BH4A 3G5ZB 3NFPB 1XGQB 1G9NH 2VQ1A 3P77A 1P4LA 5C09D 2C5DC 4PCKA 2A2QT 5F88A 5DI8A 1QI5A 2ITCB 4P23C 4UT6L 1ZANL 4OCLC 4UDUA 2LOEA 1J12A 1RZ7L 3CXFA 4L29B 3VXMA 1WF5A 2F6AA 2W0LA 4BFKA 3QAZC 2NXYD 2ATKA 1FIGL 1D2OA 5H94A 4BINA 4OF0A 4FQQA 5I6MA 1R3JB 3ML9A 2ERJB 2XKUA 4FLQA 5DZVA 1R5WA 4RLDA 4N86A 4I3SH 2K7QA 2PCYA 2XWCA 4A6YL 3PJSB 4ZD3L 4ANWA 2F7RA 2UUDH 1P0SE 2UY6A 3SOBH 3V7MA 4F7CA 3KPLA 1PYWB 2D7NA 2IPKA 2JKTM 2P5WE 1EFXB 1HE8A 4XVSL 3SDCD 1CZ8L 3ARED 4AT6B 5DEFB 2DZEA 1QACA 3TT1L 1I75A 1BZOA 4RIRA 2OK0L 1D6EA 4Z7NF 2UVEA 4KZDH 3IXAB 3C60B 4LSTH 1PNCA 2HRGA 4IRSD 1UD8A 3MUGA 1JF1B 1BVNT 4U1GB 1BQKA 4PLNC 1V27A 3ARDD 4FTVE 3QJHA 3U82B 4JLRA 43CAA 1LDSA 1ZTMA 3FONA 5IW1B 1GHFL 1PLGH 1MCDA 2HVKB 4LBAA 1MCEA 4I9WE 2L7JA 5GGUA 1IC0A 1IGMH 3QQ9C 4M03A 4WNJA 4DESA 4GQ9L 3VG0L 2IPUG 2Y3NA 4FL4C 3US9A 1CDBA 5HYJA 3P4NA 4PJ8D 1N6QH 5DD5L 3LRKA 2UX7A 4XX5A 1K8IA 2EEAA 5DUPH 4PJAF 1WISA 2AITA 3OR7B 3II2A 1EO7A 1HOCB 3D0AA 2R1XB 2H6PB 4BH7A 4PCYA 3KL5A 4IBTA 3CFNA 3RWDB 4ZMZA 3OKLA 5BZDB 2UZXB 1BXXA 5ALBH 4FS0A 4YX2H 2VO8A 1BLIA 2OCFD 2CGZA 4GRLC 4WSGA 4DW2H 3MOBL 1VKXA 3HI6L 1DANU 5EBLB 4MXWL 3D9AL 3VH8B 4HK0A 5HDRA 2ADGA 5BQ7A 4JMNA 4TUOB 4CNIA 1ERNA 3C6LB 3HG1B 5E9AA 1EZVY 3BLBA 4YDIH 5JYLA 2EAEA 1ZHNB 1HNGA 2DQCL 3MV9E 2R0LL 4U3XA 4TUJA 4IIQC 3HNSH 3SHSA 5AKTA 2J55A 5IFHL 5DHYB 3HAEA 4NKIH 2F53A 4DP2X 3EJZD 1UOLA 1MCIA 2PTTA 4I48A 3EBAA 1AJ7H 4LU5L 2DKUA 4GW1B 4EI5B 2Z9TA 4L8CB 3D08A 3LIZH 2EKSA 5FR3A 3T2PA 5I75C 1RHHA 3B8YA 1KCKA 3LKPA 4RZCA 3B5TA 4H8WC 5M95B 3UTQA 1HILB 5I18H 5I8OH 3NCYP 5HGGS 4AV0A 1YUHB 5I6LA 4B95C 1NWPA 3FJTA 3GIVB 4G9FE 4CVUA 1AI1L 5D7IE 3INOA 5E8PB 5F1NA 1FNSH 4NN7B 4K9EC 1JV5A 4QY8B 3O3DA 4R3SA 2CCVA 4OZ4A 4FFVD 2F5BH 3QCUL 3ABGA 1NA8A 2ZAGA 3DVGB 5ENWA 1DVQA 1ID5I 3KBFA 2Z4TA 4PIRF 3JV0A 4HAKA 3LZOA 5KYXA 2VRQA 4PP1C 1V7NH 2YPLE 5D7LD 5EU6B 5FYKL 4M7JL 3QRGL 5KWYC 1EEYB 1PFCA 5TD4A 1I8KA 3FTGB 1MQKL 1RK7A 4MDJB 3UACA 3SYCA 3BGFB 3F84A 4KUCF 4JFDB 5GJSH 2FWSA 4ZG1A 1EJOL 2E56A 4PJ9D 3L5WB 3SDDC 3SKOA 3BP7B 4K71B 1XH3A 4WVRA 5HHXH 4HJSA 1ZIAA 1N0XL 5EBWB 1E3ZA 1H8NA 3JXAA 4M7ZC 2BINA 4JY4A 4QYOB 1U8JB 4KY1H 4AG4H 4JAMA 2QL1A 5LBVA 3EOAB 1YSOA 3BAXA 4QRQA 5DA0B 2HRHA 1J05A 1I1YB 4XP9H 4XO4A 1W8NA 1J88A 2BMKA 3DX1A 3WMQA 3V6ZB 2YBGA 4H0GA 5ITBH 1PL3A 4XPFL 5DO2D 2VM4A 1T6VN 3QXDA 5B7MA 1FIGH 5E6RB 4PJ6A 1DZBA 2YBRA 1U2HA 5E51A 2YAPA 1RZ7H 1I1AB 2AJSL 3ULSA 3B2DC 2DWEB 4URKA 2QQNH 3LKRA 4GSRA 1J5OH 1MEXH 2ZWYA 3UADA 5IHWA 2X38A 4WWKA 1ZVHA 4KK5C 1TCMA 5CSZA 1G9NL 4NC0B 2VKWA 4TRPL 2VDQL 3QDGB 1TNNA 4TVPL 5E9NA 5FM5O 1ZV2A 1NMBL 1FI8C 3APDA 1F1DA 3U2JA 2AJYL 1FSKC 5D1QE 4MWFB 4N20A 3LH2L 4BFGA 5KJRH 2GW5A 4OQTL 2C7UA 4XMPL 2F0CA 1MDAA 5FEBA 1JWSA 3M1BB 4ODSL 4HS3A 5LXVA 1MUJA 1EXUB 1UACH 5GZOA 3FO1A 5AEAA 1I8IA 3TS8A 1CD1B 2CKBL 2B39A 3FKUS 4JDZA 4E9LA 4JJHA 3DUUA 1M3JA 4KI5F 5IEKB 4L37A 4YDJB 4R4ND 1XVSA 3IJ9A 1MFDL 1PQZA 3GXUB 5BV7C 5KG9A 3PU7A 5F70A 3PABB 4HKBB 4LCUB 5ACZA 4M48H 4X4KA 5BUAA 5D1XC 1FZKB 5D7IF 4XHQA 1NUFA 1OCRB 2DQHH 3MRNA 2P46B 1C5DA 3GTVA 3WIHH 4TUOA 3ZUCA 3RRQA 1EK3A 4WI4A 4GKLA 3IMSA 3UGXA 5C0CA 2ORBL 4N0CD 4G2AA 1RZJL 4OI9A 3HKZA 5ELIA 4HWNA 1Q94A 4G83A 1BJ1H 1YYCA 1AYOA 3UBXA 2AKRA 2W60A 1E2ZA 1PZ3A 1SJHB 2X5PA 3TZVC 1SXNA 4FTVA 3PF2A 1V3JA 1YN7B 4U1JA 1BX2B 3QYCA 1NAMH 1DQJB 3GKWL 4DP7X 2PTVA 2D03L 2WBKA 4NJ9H 4X6DB 2LGNA 4OGXH 1LILA 5DC9B 3IFOB 3VWKD 3WIFB 4K3JL 2J1KA 3D3VE 4RFOL 4OJFH 4MKTA 5J1AA 1MW3A 3OKEA 1HEZB 1UQSB 5TK2A 4LHUG 1FNFA 1OT2A 4OGAC 5DS2A 4NKOB 5CCKL 1L0XA 2ICWA 3FMGH 4FFZA 1Z9SB 5LAPA 4HZAA 2YFOA 5FO2A 3MV8D 1X5MA 4MNQB 1V05A 4NQDE 3GI9H 4KGLA 2KKQA 3FU9A 1V3MA 2YJQA 4PN6A 5GGRB 5DTFA 4RFEA 5F6HI 4ZXBD 4OJCA 2DWEA 1IGCH 3CHQA 2C9RA 5J13C 1GZQB 1P7QD 4U0QB 2C7FA 2VZVA 2R4SL 4X6DE 3MJ9L 3NYKA 4CAGA 1BHGA 4Z3GA 4W9HC 3PG2A 3T3PF 1AGDA 2NY3B 3VXOB 3HC4L 4HC1L 3TVMB 4KKCD 3DKHA 2JCCB 1S7RB 4BFEA 1KJVB 1RK1A 1OQOA 3GMNB 5CINL 4D3CH 1D9KD 3I6LE 4BK5C 3CUPA 4OJDH 2I07B 5IFHH 4O2FB 2GAZB 2V6HA 1QSEE 3VXRB 4DNLA 4XMVA 5T3XD 2AEQL 1LNUA 5AZEH 3VFPB 4W9DC 2DDQL 2J2ZA 4QXVA 3QEGL 2P8PA 1FZOA 4HJEA 3JV6A 1I7TA 4U1GC 1NJ9B 3ZDZF 3K2UL 2WLLA 5DJ8A 2GUYA 4PJ5D 5E5MB 4PBVC 3U4EB 4MVBC 4PP1D 4PB9H 1IBGL 1XF3B 3RTQD 3BVVA 3CSGA 4YDKH 3SQRA 1DVFB 4K5OA 2FWOA 3VGDA 4MJ4A 4LBEB 2W65A 4ONGH 1MZYA 1EVTC 3CVIL 2IALB 4LLVB 2ZZUT 1PDKB 1QRND 5IEHB 5CJ8A 2H6OA 5JQHC 1R24A 1FZKA 1QSFE 3JWDL 1E9OA 2J8UE 5CS7A 5IKCB 4M6NL 1HESA 1T2XA 3QXAA 4RGNE 2R4RH 1SJHA 2WSPA 3F58L 4A6YA 4WUUA 5AD0B 5KVEE 4OH2A 1BEXA 2Q9OA 4GQ9H 1JPTH 1MCKA 3TO4D 1PY4A 5HTSA 1IGML 4ICXA 4WQOA 4Y9CA 5SX4I 4F37K 3TEUA 3VFOA 1VKXB 5FK9A 4EOWL 1HSAB 2ZJSH 4L37B 2QPEB 4GYBA 1WEJH 4AE1A 3QZOA 5K1NA 2A6KB 2C3VA 5EHFA 2R4SH 2X1XR 4IS6A 1OE2A 5CUSH 3NSCA 3WEBA 3NA9H 5GRJH 5J06A 3KHQA 2A83B 5AOJA 4CVZA 5D70L 4H44C 4DT2A 2NR6C 4LVOB 4HUXA 4OV5A 3ILQD 3FQUA 2I9TA 5HDQH 3D2UD 3R19A 2HH0H 1UVQB 1II4E 1S7QA 3T0BA 1KJ3H 3S97C 4Z7WF 4L9LC 4FNLL 1P84K 1HHKA 3MRQB 2OTUA 3MKGA 3QFJB 4Z7VE 4LGPB 3P0YL 4QWWC 4WUKH 4F9LA 4AYMC 4U1MB 1C1EH 1L4IA 5J4MA 3MJ6A 2YBRB 4HF5H 3EO1A 1UEYA 1YDPB 2Y23A 2NW2B 2XZAH 3C6LD 4NZUH 4HD5A 3ZE0B 4YHKL 1KXTA 3QWOB 2QVTA 1TU2B 3MCKB 4CILA 5B3SB 4U4BA 1CLCA 2R69A 1YJDL 1WEJL 1HH9A 3APMA 2YA2A 1JF1A 4Z78A 4I88A 5KUKA 4A1RA 1RFDL 2VERN 1RJCA 3V5KB 1U3JA 4JAMB 5B39B 1MFCL 2I07A 2NY0C 3UTSA 3T77B 2Z0BA 5L7XL 4FERA 1ZS2A 5D96C 2HT2D 4P5KB 5TGBB 1I1AC 1U8MB 4M6OH 1PD0A 1NGYA 1UD3A 3EUDA 1MFNA 5T1LB 1BFSA 1T0MB 1R1CA 2APTA 1U30A 3PHSA 2KZKA 2YK1H 3FB7A 3L1FA 1ZLWH 1FVCB 2P5EA 4P59L 1ZLUK 2HX8A 2XBZA 4XNQA 1C7SA 2Y2WA 4KFZC 3QNZB 1KCVL 3VE0A 3TU6A 2NY7L 4RAUB 1UM5L 3IDXH 3QUZB 4S0TD 3BD5A 1IM3A 3SPJA 3V4VH 5EU3A 4KJYB 1RP9A 2PP7A 4LKCA 4RVBA 5LBGA 3FS9A 5SWSE 3UGEA 2GBTA 4M7ZB 5J89A 3EOAA 4M1GH 4XP6H 3DBXA 1DVSA 1NGZA 1UFGA 2XV3A 3ELQA 4NS0A 3QJTB 4GXFA 3MAWA 4GEIA 2WQSA 2VUOA 1M57B 3OF6D 3EFOA 3T3MB 2NYYC 3LQZB 1FYTD 3ROOB 3VWKB 4Z18A 2CDGB 2WBJD 3DRTA 1OQXA 3KD4A 3E3QE 4FP8L 2FBOJ 5AVWB 1Q9LB 3CC1A 2NLJB 4IMLB 3KWVA 4YR6A 1MIEH 1LD9A 4OZGA 5FDYA 4YDLC 4PMEA 4H88L 4MMZB 5T1DL 2F15A 2VJ8A 2ZONA 3GNMH 3Q8BA 5E2WH 4GW4B 3FB8A 4DP0X 4Y19B 4IGBC 4GKZA 2B5IC 2J25A 1S46A 4JDTL 4JM0A 2NRDA 3G3LA 3WFHB 2AJSH 4LMQI 5K69A 3L6FB 2EEFA 2IANB 4LF3B 4PP2B 4ZAKC 5F7WC 2ZD0A 2CLVA 4YAQA 2FD6H 5HHMB 1AS7A 1L9TA 3SYQA 2PABA 3BEVA 4XX1G 1AR1C 4YZFF 2NUPB 5D7IA 4PRHA 3MC0A 5DURB 4L8SA 4FP8H 3DJZA 4DEUA 3HZKB 1CTMA 3FTYA 2UXVA 5B21A 1J8HB 3QARA 1CC3A 1XF2B 1TQCB 4BH7B 5D7LA 4M3HA 5HGAB 2DQMA 5DHEA 5EEZA 1RY7B 1H8SA 2AQQA 1CN4A 3AITA 2JKWA 1Q1PA 4JFEE 4ENEC 5KYNA 5LQBH 4W9KC 1DVFD 2JCCF 4MWFA 3LZFH 4XO9A 2NNRA 4PJ9A 2A5UA 1D5RA 4BWWA 4YVNA 4EDWH 4RFNC 4NT6A 3ARDC 5JDSB 4JO3H 1U8IB 3UX9B 3MV9A 3PDOB 4RAUA 4AQEA 3NIGB 2OSLA 3A6BH 4NRXB 5EU7E 1KC5L 2BXZA 3LPPA 3AABA 4LT7A 2EIDA 4KVPA 2N7AA 2FX8H 3VFUA 3X2QB 3HEIB 4GG6A 3CFKA 2V37A 5CEZL 2HWZL 5IMLA 4XZUB 1F13A 1QHPA 5IHBA 1NEZA 4JM2B 4F7KA 1P1ZB 2YLKA 3QXDB 1NCBH 2WCPA 4Z7UA 3MRGA 5F7UA 1JGLH 3ZYZA 2WKOA 3GSNL 1BP3B 5D7JD 2XTJC 2OFQA 1XR9B 2XXGA 4PLKD 4WI0B 1C8PA 4OTXL 2OSWA 1N68A 2IDUA 1U42A 3CZFA 4PD4K 3MA7A 5AW8B 3WL9A 5AW2B 1LK2A 4GMTL 4S2SA 5AB2A 1QFPA 3RWHB 4J8QA 2Y6SD 4HP5A 5IMKB 2O61A 4IHOA 1EAOA 1SXSA 4HH9B 4BQ6A 3D39D 4TNWF 5KW9H 5JW4M 2HTLD 3K6FA 1CFTA 4I1NB 3GUTB 3ISYA 4XPAL 1MCQA 5IUCA 4PTUA 2YOCA 2A73B 4TV3A 5KSAC 1ZT4A 4XR8C 3I6LD 2WY3B 2F53D 3RVUD 2FECI 3UO1L 1EH9A 2EXWD 5D70H 1WCBB 4UILH 2VXUH 3NCEB 1U4FA 4O2EB 2PWEA 4L3AA 4NBXB 4PGCB 3N2JA 43C9B 4Z7OE 4F33B 1QSFA 5INCA 3OXRA 5ICUA 4KNSA 2FYVA 3KPQA 4KK6D 1H3PH 2CO3A 3TN0D 4NENA 4HISA 4Z5RA 1P7BA 2BIPA 2X09A 2XRAL 4S1QH 5EOCH 2GQHA 4J4PA 4FFYL 5IHUH 3TGXA 1FUNA 1E7UA 1DP0A 5LNEA 3JWNG 2X1WL 4JG9A 4ZO9A 2XG4B 3N04A 1FGVL 5E4OA 2AMUA 3CX5J 5I6NA 3EFDH 4XNXL 3WY1A 2G60L 3BEVB 4PI2A 3ZQ9A 3ATDA 3EADA 3HR5B 3OHXC 4TQEH 5C0DA 4YNYB 4TLUA 3WIAA 2JMRA 3NP3A 1CK0H 1T5WB 1YEKH 1FRGL 1S78D 4G3YH 5IT2H 1KPVA 4NAJA 5LDSA 1CIUA 4Q6IC 1DJHA 4Q4IA 3REVA 3EYQC 2ZKHL 4MS8C 4P2RD 4LBEA 1T89C 4M7JH 3F05A 4IMLA 3K71B 1B90A 4KO9A 4XNZC 4S1SL 5T3XH 4JW3A 3U25A 3WKQA 1MRFH 5EB9A 4YXLL 4KRMB 5IOPA 2I27N 3GMPB 2JLPA 3FT4B 3TCLA 4JNXA 3OGCA 3PQYD 4NLAA 2H0PA 3ULUH 2VC2H 3DOSB 4LKXA 1CGSL 3T65A 2K9UA 1VPOL 2GAZA 3M88A 1A2YB 2OMWA 4XCFL 1MJ7H 2WZPD 2AMGA 3CFJB 4LKCB 2A7BA 4NHCL 4UQIM 4XAWH 4MTMA 1WBYB 3MLTA 1S9YA 2IAAC 2YAHA 4BZ1L 1Z32X 1NGZB 2PO6D 1T3FA 2KHAA 2QQQA 2RAMA 4LDOB 5GRXG 4P99A 4D7BA 3AY2A 1MG2C 4JRWA 2WP3O 4NKIL 1DQLH 1IFHL 3RKDD 5AYTA 3JT0A 3PGFL 3NTCH 5MEQA 1JGVL 3VFUB 1OZUA 5F89A 1DFXA 4JGUA 3QQ4B 1AIFB 5EO1B 3ZSSA 3HMWH 2EH7H 5IMKA 2PCPB 5IB3B 3HJ0A 1ICTA 2QVMA 3QSKB 4U6HB 4YDVA 1Q0XH 1HHIA 1S7WB 4LLWA 1IAMA 5C08A 3BKJH 3UP6A 4BIKA 5DVOA 3RWCA 1AE6H 2R59A 4W81A 5I1JH 3SE6A 1QTYT 3STLB 4KTYA 1WFOA 2JJVA 4HXAL 5DUBB 3ZT6A 2Y1ZA 4L1DA 4OCWH 4AT6A 4FJYA 1B4RA 4XPGH 1HH9B 4MMZC 3VNYA 1MFAL 1ZXQA 2IQAA 3L3DA 5E9DD 5ID0A 2A74B 3K1KC 3KPOB 2QMJA 1G6RB 2CLZB 3ULUE 2OSLB 2ORBH 2R0ZL 4PRHB 1SJEB 1XZWA 4RWHA 1OK8A 2ZG2A 4L3FA 3DX6B 2DRUA 4JFOA 1V3KA 4MCYB 3ZDYE 3AXLA 5EWIH 3ZLQC 2DJUA 4B0MM 3KW7A 1P69B 2HT2C 3T8XA 4XNBA 4QRPE 1J9SA 1YNTF 3OLEA 1UVQA 5BZZA 4PRPB 4MA7H 2EDTA 3VFMB 2CKBA 2VSDA 5C9KA 3U1SL 2BP8B 3ILDA 2VDRH 3O8XD 2WLHA 4LRIA 3I6GB 1OAZL 5FK9B 4P46B 2DM3A 3UYRL 1RZ8A 3BGAA 2NY2B 3AY4C 4FG6C 3FTWA 3QHZL 5KAQF 1WS7A 1RL1A 3QNXA 3QCVH 3DIDA 3TV3H 4OD3L 4EN3D 1R34A 3CIAA 4N90E 4J1UA 5HHXL 4OD1H 1D9KC 1SM3H 4YR6B 1BVZA 5JNYB 3SODB 3T6WA 4JG1L 3DTXA 5L2KA 3HZVB 4MJIB 2CXGA 2EEBA 5IWLA 4DKEH 5JMRA 4QO1B 4ODXA 1AQKL 5AD0A 3O3EB 5E94B 4O4YL 2OMNA 4ZPTA 1Y6NR 3QUXD 4WNQB 5K1JA 4TRPH 1MH5A 3GT6A 1BQHG 1MIEL 1KCSH 4AZ8A 3O8XC 3QEQB 4BZ2H 1ETB1 3BAEL 3W39A 3MX0B 1W16A 4ZAKB 4E9XA 3DJ9A 1GMEA 2OL3L 2OYPA 4MJJA 4MYPA 5DMGD 3R7QA 3SGEI 4PGBB 1IE4A 3SPHA 3FH5A 5SWQB 2VRKA 3KXFE 4NZRL 1XIWD 4NWUL 1FNEA 2IPTH 3TOPA 1KB5A 2NSXA 1MI5B 1D5MA 3N41F 4Z77A 3OGOE 3Q8AA 3FCSA 3JUYA 4HUWA 4Z76A 2O93L 2X9YA 3HNVL 1NGYB 2ZCKH 3P3TA 2YWZA 4NQEE 5FECA 2GFBB 3OG4B 4QF1A 1MREL 3FRUA 1FVCA 2P5EB 3FB6B 1DBAH 3AG3B 3EOBB 1IU1A 1VSCA 4XAKD 3RGHA 5DD0L 4B9ZA 2EIZB 3RWIB 3CVHH 3GMRB 2GABA 1T6BX 1A25A 1KIRA 2HH0L 3LVTA 1PD6A 1TT6A 1YMMD 4UNVA 2WQWA 3S9DB 5A6LA 4IRZA 2XV6B 2F7IA 3CFDA 4Y5VC 5CJQL 4P04A 5I1LB 1RZFL 5GS0L 4QRRD 5ACLA 4F1SA 4I0KA 4PJHB 4OCRL 2R2CA 1NAKH 3CFKB 3JSSA 5F96L 2O6PA 2HFTA 1X9QA 5BQDA 3C9NA 4LIQH 3UDWC 3T0AA 3DVFA 3H3PH 4GSDH 4XXCC 4AC2A 5TTRA 3P69A 3ZL4H 4ZUVB 3VI3F 1HL9A 1TVDA 2PYFA 4Q4EA 3SBWA 3VWJC 3X3GL 4BE6A 1RK0B 4AQZA 1KYUA 5JDSA 2YUVA 3UG4A 5JOPE 4Q9RH 2XTJB 3JT2A 3FUJA 1XGZA 3O6LH 4QPEA 4CKQA 4X4XA 3EAKA 2MPAH 5FO9A 3RJDA 2IADA 3VFNA 4DZ8A 2H32B 5EDSA 1G9EA 3F58H 1XFPA 1TVBB 2YLHA 3BLKA 4G7SB 1G0XA 2V33A 4G82A 4AOFA 2FO4A 4FNLH 5HD8C 5JPMB 1ND0A 4F92B 3VI4F 3FCBA 2YQ3A 2IJ0C 5IQ7L 4WI3A 2PXYB 1RHHB 1AXIB 2GYSA 2PWFA 1LM8V 1PAMA 1KBGH 3CMOH 1HHGB 5DYOB 3U9PH 4AIXA 4A7VA 1VCBC 2BNQD 4DPRA 5CEZD 1FDLH 1IKOP 4HOWA 2D7OA 3KCPB 4Q56A 4DPAX 5CJQH 2RFXB 2YN3A 3ECQA 2ESVE 4A2GA 5I1GL 1HIML 4OLVH 2NZ1A 3F65A 4OZFG 5BCAA 5AZEL 2WXHA 4KNQA 5CM1A 3HW7A 1RUPH 4HK0B 1C5CL 5AVUB 1QQDA 3VGFA 4LEXH 4HS3B 2K78A 2ZOKA 4PJBF 3V0VA 2O5ZL 5EO9A 1QABA 5CF3A 1JUFB 4Z7VA 4IRSB 2C7UB 5LGHH 2NT1A 4M61A 1X7QB 1A7QH 4GXUM 4GMTH 3HA0A 4IRZH 2MOQA 4H26A 3MFFA 3MRDA 3N43F 5FO8A 3B2UD 1E5CA 3PP4H 1OARL 5CMAA 2JK5B 2XKNA 3QQ9D 4UYPA 4YO0B 1NAKL 5AVRB 3WNJA 1HEHC 4E41E 1EVUA 3AS0A 2AXHA 3IDUA 2HFGH 1KENH 5MHSE 5D1XD 1R3KA 3TNMA 4EDXB 3SIKA 4W9JC 1VFUA 2MOVA 1JPGA 3A24A 2PYEA 1RI8A 4Y5YB 5MP6H 4G5AA 3P0GB 4M1DL 3L3KA 5FO7A 3MJ7A 2IBBA 3BOVA 2G3NA 5CSZB 5HP5A 3FF8A 4PVLA 5EO0B 3EXJA 4JY4B 4QYOA 4QRPB 4JN1L 3KVDD 2LU5A 4HBQA 2Q3XA 4AJVA 1EGJA 1JZJA 5AFAA 2A4ZA 4DKEL 2G5BA 4PJ7E 1G1CA 2V7NB 4FXKB 1MCRA 1T1WB 3VSTA 3NEXA 2AAVA 5BO1H 4XGZB 4L4VB 4PFEA 1JGDA 2LE9A 3QCVL 3TV3L 3S8FB 1FJ1A 1BGXL 3RUGA 1IJ9A 3TFKD 4PJBA 3ZYOA 4WFFE 1YMME 5A2LH 4FABH 1BQLH 4YFEA 4U0RC 5IVXE 4JANB 2YXMA 4NKOA 4HIEA 3DOSA 4LKXB 2OL3H 2DH3A 4TSCH 1PAZA 2JKXA 4BKSC 5C07E 3QR1A 2PPEA 2VCOA 5I16A 2VJ0A 5IB2A 3QXUA 4BZ2L 3S96A 4MMXC 1MCFA 2A6IB 4JCWA 3LXCA 3ARWA 5HYQA 3S5LA 2F5AH 1T83A 1WCQA 3I85A 1ZJAA 1F90H 4PV9A 4HLJA 4X7SH 3RVXD 4HLEA 1AQHA 2ED9A 4MD4B 3HTLX 3HZVA 4JG5A 5CBAA 3E7JA 4UTAL 4RGOH 4B9IA 2BS8A 5AQ0A 5DJYB 1WVZA 5IJKA 3NJFA 3PPEA 4WDIA 4ISVA 4Y5XA 3B1UA 3CBJB 2ZTBA 1YRKA 4TOYH 5HHNB 5ADOH 1U3HD 4UINH 4F2ME 4N68A 3L5HA 3G5XB 2QGBA 2KQMA 5AW7B 4ABQA 4D8PA 6PAZA 4EXPX 2KMWA 2J6EH 4A68A 4WY7L 4J3VA 3GO1L 5C0AA 5IEKA 2QV4A 1I9JH 1SYSA 4PW3A 2D0GA 2EUWA 3SCMC 4L9DA 3LMJH 1DJWA 1JG9A 5KJ4A 4DKAA 5DF0A 4G7YH 3ARUA 1JAEA 1XH1A 4NERA 5LG6A 1AZZC 3VFOB 5F3BA 2RTTA 1L7TH 3HE6D 2BHFA 4MS8D 3RE0A 2CUMA 2CU9A 3BUQA 3N42F 4FZEL 4XNUL 3A4AA 3T0EB 4A7GF 1F6LL 2PTTB 2IQAB 3GMMB 3BVDB 2IADB 3CDFA 3U79A 4F9PC 5IB4B 4P46A 4I0PB 3B7YA 3IE4A 5E2VH 3FH8A 2PYFB 1MFBH 4N25A 3DK2A 4J28A 3DUUB 1GGBL 3K2KA 4EI6B 2NY2C 4BUQA 3KPOA 5D7EA 1DFBH 3L3DB 3P9LB 5ID0B 5C0FA 1YEIH 2OR8A 4N6RB 4DJMA 3IRCA 1HKLL 1TQTA 5KJRL 5D2NA 3ZDYF 1PG7W 3DX6A 2FWOB 1AE6L 1IQDB 4KBPA 1BQLL 5A2BA 4E0RB 4N2MA 1IARB 3G04A 4G6KH 1MELA 1Q0XL 3MR9B 3ATEA 3BVNB 3TTYA 5CAYB 5I71C 4AQAB 1L3WA 3HZYB 3RY6C 4ATWA 4U6YB 1KTJA 1TVHB 2H0JA 1D7BA 3OWRA 4Z7UF 1P4IL 1OAKL 3SKJH 4S1RH 3BD3A 3AQDA 4FQIL 3TONA 1A6UH 4B9PA 3MKKA 4LB8A 4KXCA 5A2AA 1OXYA 4YFLF 5CZRA 4ES9A 4G8EA 1G7MB 2X12A 1BPLB 4XOBA 4YFLI 3TLRA 3UZVA 3HUJF 3BPNB 3LYRA 1PSKH 2BMKB 4JRYA 2FO8A 3W57A 1QFWI 3V5DA 1YEKL 4O5LH 4APXA 4UWQB 1RVFL 2P43B 4M4RB 4XCEA 1BIHA 4NNPL 1WDAA 3D3VA 5ABZA 2W07B 1JV2A 2W9LA 2DH2A 3AMKA 3BUBA 4QDGA 1MHHB 4OF3A 3RNKA 3L08A 5BPPA 4S0HA 5EC2B 2YEVB 2XWRA 4LP8A 1JVLA 5D1QA 4I77H 3OKMA 1OARH 3WFBL 2Z31A 1DUZB 2ROXA 3MPCA 1CLZL 3KPNB 3W39B 3UC2A 1JWMB 2A4EA 5DMKA 3NJNA 3MRPB 4M6MH 5FCUH 5HVHB 4IBSA 4P3DB 4NKMB 1CICB 2ADFH 4PPTA 3NSDA 2IXQB 3BX7C 3SJVB 5SV4A 3TNMB 4F8PA 2H3NA 4QHNB 1AC0A 1NLDH 3E38A 5CEYA 4QHKI 2K70A 2R2BB 4YMPA 4HKZB 1IAIM 3W2DH 1UG9A 1E65A 4QR7A 1JBJA 4U3SB 4XPHL 4ZTPH 5TDOB 3AT8A 2Y4SA 1WZLA 2ARJQ 4MA1C 2G60H 2VW4A 4ALAC 1D5ZA 3S4SG 2VW7A 3S3BB 3QPXH 4MD5B 3WAJA 3V0GA 3E6HA 3VI4A 4O5LL 1MHPH 4Y4FB 5IF0B 1WFIA 3NFPA 5CZKA 4X6BA 4H20H 1DUYB 2FX9H 4OCRH 4NPJA 2H1PL 2DL9A 4BCYA 5CZVL 2F68X 4L9LA 1YYML 5T5FA 2ZPKH 2QZQA 3AXLB 3O2VL 4S1RL 3P02A 5DU7A 1GY1A 1XGQA 3G6JE 1K4DA 4V1DA 2P8LB 1Z9PA 4HXBL 4WTWA 3DMMB 3U2IA 3ZW3A 4HPHA 2EYRB 1UM4L 2NT0A 2W0FA 3BPLC 3IU4H 3UPCA 3VI3E 4KROC 4LLUA 3MUZ1 1E43A 4MA3A 1XB3A 1DSWA 1J5DA 2YPLA 4KRPC 1AFVL 2CHNA 4XN7A 3IJEB 3X3GH 3ZO9A 2FEDC 2YEQA 5KSBE 2OMTA 5DS8A 4MJIE 4NZFA 3LZNA 1D5XA 1LYQA 4ZPVA 4W6WB 5HJDA 3Q1SH 4OT1L 4Y4HA 5JIHA 2I5YL 3KR3L 1E4WL 1AVAA 4D0BA 1F3JA 1TJMA 3VDCA 4QHMB 4GS7C 4C55A 2H32A 3CHOA 3P54A 4Z3EA 5B4MC 5LGJB 1VJSA 4WEMB 2VITA 3C5ZB 2Y24A 4YIQA 3L48A 4ZMXA 4BM7A 3E1ZA 1W6WA 1RZFH 1MVYA 5GS0H 1ZA3A 1MHPL 3HRZA 4H8PA 2I9LB 4LHUD 4XBEL 3UG5A 3H3BC 5EC2A 1WIOA 3I50L 1FPTH 4F1ZA 3FQXA 1JFQH 1U92B 4HH9A 5CJXC 1JXJA 4AM0Q 1P9MA 3OKLB 3IPBA 1WFJA 3I2CH 3H6AA 3QJHB 3K72B 3GLEA 1IT9H 3FOMA 4KTDH 3R0NA 3H9HB 3KLKA 3VSUA 4X5PA 3CFBB 1FWXA 2EUXA 1Q72L 3NQKA 4AL8L 5J9PB 2XCMC 2BHYA 1N6UA 4Z7UB 3TO4C 4WHDA 1ZSDA 2GJZB 4Y5VA 5DK2A 4FQJH 3BE1L 3SDDB 4PVBA 4QNPF 3B9KD 4NT6B 3OKOA 3KGTA 3NIDB 3CLWA 2CIIA 5BW7C 1SY6H 3UERA 1LQBC 3D2TA 1AGEB 2CG9X 4N0FB 3BVNA 3QFDA 5ANMA 3ZTNL 3C87A 5BOPA 5I0VA 3LZFL 4Y1TA 2YD0A 3POHA 4Z7QE 5EIVA 1GPOH 4D9QE 1DTUA 2Z7ZA 5AVSB 3E6FB 3FO0L 4OM0H 3R06B 1J1PL 3WDHA 2IPUK 2M2DA 2XN1A 3FFCE 4XXDB 3MXWL 1NGXB 5F7YC 5BZWA 3AQZA 3AAZA 3FQUB 1AGFA 2I9TB 1URIA 3FPXA 3BMVA 4LDEB 3NDZE 1LMKA 1QSEB 1PG7X 5GGSB 4KMQA 3ZDXE 4KXZH 2YRZA 3HZKA 4Y16A 3IMTA 4YHOH 3DECA 2FJGB 4NJAL 4LSVH 2FAUA 3UBHA 4PJ7F 4MGXA 3ARZA 4HV8A 4BZ1A 2P48B 1LP9A 1HTYA 1VFAA 3OKKB 2UZIH 3QIUA 1T2JA 3BQUD 4Y19A 3IYLW 4YGVA 3Q48A 4DAGH 5TQ0H 1J0ZA 3D1MC 2DQIL 4OCSL 2KBGA 3CHPA 5E4IA 3WS3A 3OAYH 4AGLA 4ALAL 4F15C 4PP2A 1Y6MR 3QH3A 4HHAB 5HYSG 1CFBA 3GFUA 3H9YA 3J2PA 4OM0L 4EI5A 2K4WA 4FA8A 1TYEB 2G5UA 4ZDHA 4EEEA 1RIVL 4WJ5B 5CIPA 6CGTA 1T5WA 2BRRH 3AS3A 4NQXB 5G4MA 4KKAC 2CIKA 7FABH 1DVXA 4ODWA 2BFVH 1WZMA 5F9JB 1UZ6E 3C08L 3EDFA 4P4RA 1E9QA 4JO4H 2H2PD 1DQLL 4LRIC 5AOKA 2EXSA 3WNKA 4HKZA 2C9VA 3DBXB 5A16A 4WFHE 1G7PB 2AK1H 1PF3A 4GBXA 4X0NA 2QPUA 5D1XA 3V4PA 1IM3B 1FQ9C 2CZNA 4ZZFA 5ISZD 5JPNB 2JNZA 4TSCL 3RP1A 1PLCA 1DQQB 1HE7A 3BHBA 3FRPB 1X5YA 3BKJL 4J3OC 3UTOA 4G70B 3OKDA 3P4MB 5L2JB 3PL6C 2CIIB 4AG4L 2FT7A 4JANA 4MDIB 1O6SB 1WBZB 3MXWH 2IDQA 1BLNB 4IOSD 1Q8MA 4JHAL 2PUQT 3LQZA 5EU4B 1XH0A 2WP3T 3Q5TA 1YZZA 4A7GA 2JVUA 4ZXBA 4PGEB 4XP6L 3U0WL 1F58L 3T77A 1ED3B 4OM1L 4QCIB 4RGNC 3FQNB 4HJIA 3VI3B 1FE8H 4PTUB 4ZZKA 4BZYA 1G7LB 4CC1A 1IC5H 3C8KA 5I6KA 4G8GE 4KJYA 5FCSH 3CMGA 4FF9A 2FNBA 3SGKA 3QUZA 2E8YA 4HEPG 2F58L 1JE6A 1T22A 4OCXL 5AG8A 4X6EA 2QVKA 1GGTA 3HPLB 4NFDA 1MRDH 3TFBA 4UM9B 2APSA 4I5BA 5B1JC 1BAGA 4ZMYA 4X4ME 3QUXA 4KX8A 2W80C 4F8NA 1YC7A 1OSPH 3GXMA 3HMXA 5GGQH 1XZ0B 1TTAA 4RISH 1T0MA 3EH5B 5IBLC 2XUWA 4B9FA 2DLIA 3B56A 1SHXA 1CR9H 4IOIA 2ZG3A 3SQBB 1H6TA 3ARBB 3NIGF 4LRNH 2AI0H 2MQCA 3PHAA 2NW2A 3NDYE 4RRPG 1XIWC 3HBPA 3O2VH 2BNQA 5DCCA 4MQTB 3PHOA 1NICA 5DZAA 4UU9B 4MA8L 2XZAL 4A63A 5HHMD 5F7DA 1N3NA 2R7EB 4FHKA 4LCYB 5ADPL 4KJQC 1NGWB 1YPZF 2BY3A 3IWVA 3NA9L 2V2TA 4LEXL 1JMXA 3VXTA 3VX0A 1UA6H 1QLRA 4TQIA 1NWOA 4HFUL 4R7XA 2DL2A 3KPSA