2ADYA

Structural basis of dna recognition by p53 tetramers (complex iv)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
197
structure length
197
Chain Sequence
SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*GP*AP*CP*AP*TP*GP*TP*CP*CP*G)-3'
publication title Structural Basis of DNA Recognition by p53 Tetramers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/dna
total genus 53
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2adyA00
1T4WA 3VD1A 2J21A 2AC0A 5AOIA 4MZRA 4G83A 2BIMA 4HJEA 3VD2A 4L18A 1TUPA 1UOLA 2VUKA 5G4NA 5ABAA 5A7BA 3D08A 1H9DA 4IBVA 1HU8A 2FEJA 1EAQA 2XWCA 3QYMA 5AOJA 2BINA 5G4MA 2J6WA 4LO9A 3IGKA 3EXLA 4A63A 4AGLA 1YCSA 5AOLA 3US1A 5AOMA 4IBYA 1LJMA 3D06A 2XWRA 5AB9A 3Q05A 5BUAA 4LOEA 4AGMA 5LAPA 1IO4C 4AGOA 4AGPA 4KVPA 3WU1A 2ADYA 4GUOA 2MEJB 5LGYA 1CMOA 1HJBC 2RMNA 3KZ8A 3Q01A 2J1XA 3D09A 3WTYA 1TSRA 4AGQA 3WTWA 3US0A 3IGLA 2WGXA 3WTXA 5KBDA 2IOIA 1GZHC 2X0VA 3Q06A 4AGNA 2J20A 2OCJA 4LOFA 2AHIA 2X0UA 1GZHA 2J1ZA 4L0ZA 1EAOA 4IBTA 4GUQA 4QO1B 2J1WA 1EANA 3WTVA 2GEQA 3VD0A 3D05A 1HJCA 5AOKA 5ECGA 1CO1A 4G82A 4IBUA 2J1YA 2X0WA 4IBSA 3QYNA 2ATAA 1KZYA 3D07A 3KMDA 2IOOA 3WTSA 3WTTA 2BIOA 3TS8A 2BIPA 3D0AA 4XR8C 2IOMA 2PCXA 4IBQA 4IBWA 4IJTA 4L0YA 3EXJA 5G4OA 4MZIA 2H1LM 1E50A 3WTUA 2BIQA 4IBZA 3ZMEA 2YBGA 2P52A
chains in the Genus database with same CATH superfamily
1R24A 1TO5A 2PP9A 4FNRA 4UIKH 1EHAA 4LHUG 1AVAA 2K45A 2ZOKA 1OANA 5L9DL 2DQEH 4NP4L 1DDHA 1IBFA 1SYVB 4NZ8A 3FT4A 4B7LA 3FT3B 4F8LA 4EO5A 1VFOA 3NCMA 4DKAA 1OAYH 4APXA 2EXTA 1I7RA 4F3FB 4Q4IA 2CDFB 1UACH 4XCYB 3VXRB 3VD7A 2WO3B 2J6WA 1RPKA 2B7DT 2YAHA 2YPLB 3EO1B 3EJUA 1OZTG 4ZPVB 4JFXA 2DWEA 4ZTOH 3L8QA 3MBEA 1ND0B 4UWQB 5IGXH 5BRQA 2A0LC 2J5LB 3TCXA 1IAKB 2EH8L 4YR6A 4Z7NB 2B59A 3O3BB 4TSAL 4CJ1A 4GUPB 4OZ4A 1YUHA 3KGRA 4FNLH 1MCBA 2IG2L 3QS3A 5GJSH 3UTQA 4NCDA 3GKWL 1WFOA 4RNRA 1S78D 3G5VA 1IT9L 2EQDA 3D34A 3D39A 1G9EA 1TZAA 1B9ZA 3TOPA 2R1YA 2O1AA 5F9WC 1JZ7A 1UXWB 4R7LA 4X99B 4KKBC 4LKXB 3TT1L 2IFFL 4BFBD 1KTDB 4XP9H 4HLEA 1GW6A 3WUWA 1T1XA 3MLUL 4IOIA 3FOLB 3IFNH 4N0FA 5T1DH 4ENEC 4PRID 1TTUA 2VTFA 4ZOBA 1YNKL 3QPKA 4BJLA 3AT8A 3FB7B 5AAMA 3BFQG 3ZHDA 1G7QB 4ZUUA 3GPSA 2WZPD 1E0OB 3K8MA 3VI4A 1CR9H 1EX0A 5B1JC 1A0QL 5ECJE 3BVTA 1UD3A 4M56A 4L4TA 5F71A 2GBAA 1ONQA 2QDWA 3U9WA 2NNAB 3S5LB 3W38A 2ZWKA 2HT3D 3DJZA 3OAUH 3PFQA 1CK0L 1S7UB 3CVHB 3C5SB 3GSQA 3MRRB 3Q48A 2LV4A 1QO3A 2IDSA 2R0KL 4R26L 4D0CB 5J9PA 4L3EA 3DX3A 1Z9OA 1KG0A 4GSDL 1UD8A 1S7VA 1A6AA 3LRSA 4OW6A 5EZLB 3TVMC 1RULL 5D72L 1OQXA 3N43F 3MXWL 1KTCA 5BS0E 1CGYA 3S9DB 2WYIA 4JE0A 5ICZB 1TZ8A 1VFAB 5AYTA 1XF2B 1E3XA 1H5BA 1KLGA 2H1LM 3D3VA 3EF7A 2VLJE 1JPFA 1V05A 3SGKC 1MCHA 2R0LL 2AXJA 2PTVA 1EJFA 2PLTA 4G8IA 4CDGC 2WNWA 4DFHA 4F8PA 1E4WH 1B4JH 1HI6B 2CNZA 2PXYC 3JTBA 4XPTL 5EZJA 5B7FA 3WYRA 3TEZA 5CILL 3IDJB 2CK2A 3C5ZD 4IIQA 1NEUA 4EI5D 2FR4B 3STZA 3GHPA 1A8JH 4RA0C 2R29H 4RMWA 5A6IA 4AOFA 1O6VA 4FXGA 4YAQB 3ZGIA 1NLBH 4OZFG 2DIAA 2N3JA 2OCCB 1VJSA 2BNUB 2WBJD 1HIMH 3P77A 4OCMC 5FA4B 3TBSA 1VZHA 1JGDA 1PQZB 1UM4L 4N2BA 4DZ8B 2CGRL 5GSRA 4K4KA 3KHQA 3O3EB 4JM0A 2CJSA 4TOYH 2BNRA 5BOZG 3RLSA 3T0EB 3G6DH 2P5EE 3D06A 4Z7NF 3QO0B 3C8DA 4MWFB 1G7MB 5E4EC 2WLIA 4PJIA 3LEXA 5IG7B 3TBBA 5BV7B 1FSKB 5ESAA 5MEOB 2GUOA 5T1LA 3TGXA 4ZMOA 1KWGA 1WIPA 3ESPA 1T7VA 3UIZA 1G0DA 4TULL 4OZIB 5FR3A 4ILDA 3E6FB 4ZMNA 2IBZY 5I24A 2BSTA 1PIGA 4YX2L 4MXWL 3CLWA 4KOCA 1WISA 5F7AA 4OCWL 5I66A 1L4IA 2WP3T 1G7PB 4XPGL 5E9DA 1MFVA 5AB2A 4Z23A 1INEL 1RZQA 3C60B 3SDYH 1PJ9A 4HQQH 1UGNA 4OM0L 5MERB 3BCFA 3MA7A 4BSVA 1HEZA 4XB7A 1LM8V 4NXKA 5D2LA 1DL7H 4ZSOA 3G04A 5L2KD 4U1JA 2K4AA 5I1JH 9PCYA 2XN9B 2P45B 3ZBMA 4QD2E 2B16A 3QJFB 2GY7B 3K2MC 1YEGH 2EZ0D 1J1XL 4H88H 5D1ZB 3ME0B 3BPCA 2ATKA 5J1AA 4N0UB 2RGSA 2MPAH 2YA2A 3EFOB 2WXIA 3F8UB 2X12A 3TCTA 2XNAB 4LIQE 2BOCB 5GSVB 3KE0A 1HAWA 1P4IH 1TYEB 1A22B 4AIEA 1WWBX 3ZZLA 1JFHA 3RWGA 3KJ6H 2VCOA 5DR5H 3CN4A 5EWIL 2QMKA 3SDXE 3NQKA 1J05B 4EJ1C 3VJ6B 2G5BA 4M1GL 3V7AG 1KSRA 4I4WB 4FRWA 1AGDA 2OCFD 1PGRB 4MNQD 1W2KT 4N87A 5JO5A 3NRPA 2WXHA 4GQ9H 4MS8C 1BOYA 2J44A 5AKRA 4HJJH 3VFSB 4K3HA 4KJPD 4DERA 1ZLWK 1NFDB 3U0WH 1WAAE 4NKOB 1T7ZA 4PWEA 3OXSA 4XXDA 3SPVB 1MFAH 2DQCL 3RWFA 3HOGA 1DSWA 1AP2A 1IC0A 5IY5B 1C08A 2K3HA 1I9IH 4NS0A 3ZK0A 5ID1B 1IMHC 3EH2A 3QORA 3G7TA 2AQ2A 2JKLA 1HNFA 1PZBA 2Z8SA 3QE5A 3QUYA 1F4XH 1MFUA 3LS5L 5I0XA 1BQHA 4JN2A 1JPSH 1TQSA 3P4MA 4GQRA 5DHVH 7PCYA 2MOVA 3HA0A 4K3JH 1NAKH 5F7EL 2XWCA 3I3BA 3ARGB 3IXAA 4PJEB 1OTUC 4Y4HB 2YA0A 1HEJC 1RKRA 3WKQA 3GSRB 2OP4H 3SKNA 3KDMB 5E6RB 4ZW7A 2H2PC 4UDUA 5B8CA 4DCQA 3KH3A 1RJYA 3L16A 1LJMA 3LNEA 4KKAD 5BRZD 2HRLA 4UV4L 3QZWB 2XETA 4U1GB 4JY6A 5IV2A 4UM8A 1SM3L 5JORB 1ITCA 3EO0B 3T6ZA 1Q90A 2C1PA 4UBDD 1E42A 4O00A 4OZIF 2P80D 3Q6GH 4X4YA 2L0DA 5HPMB 1AGBB 2XY1A 5MI0B 1W72B 5D7SL 1OAZL 2HTKD 4ZMVA 2NY1B 3NA4A 2Y3AA 4PJXA 1S9WA 4KQ4H 5I73B 2VDMB 4XCFH 4FLQA 5KSVA 3SE6A 3KG5A 4TSCH 5F7DA 3V4LA 4HJGA 3BDBA 1LE9A 3FU9A 5E8EA 1RP9A 4AQOA 3FZUC 3MRNB 2DYPA 4DP6X 3LH8A 1BYPA 2X4RB 1U8OA 4OSUL 3SBPA 2YSSB 3KL3A 4QRAA 2O5ZH 5EUOF 1GXEA 1DSYA 4JHUA 1S9XB 4R7DB 5AL8A 3LMJH 1O7SA 3NJVA 1JGLH 4J3VA 4CKQA 4HXAL 4ADJA 5DEGA 5CGYD 1BJ1H 1EEUA 4PI0A 1BOGB 2V5SA 1UJ3A 3H9SE 3B9KC 3Q8CA 4ODWA 4XN2A 1JIBA 1HQRB 2CCLA 4NO3A 1UJTA 2EIZA 1GC1H 5E8NA 3U7YH 2QQLL 3KPOB 4POZD 2Q87A 1CVSC 2XKSA 3CXDL 3P69A 5KBMA 1ACZA 5I28A 4AQ8A 4AMKH 3C8HA 5L8JB 1QW8A 3W11C 3IBOA 5E00B 1U2HA 2ESVA 1CFTB 2A6DA 1SXSA 1C5CL 3FQXB 3MJWA 3VFVB 3HZVB 2CXKA 2WK2A 3L4XA 4KQ3H 4M93B 2DY2A 5DTFA 2LLNA 3PUUA 4OBSA 1SXZA 1A7QL 2FZ3B 1AIZA 4FQ2L 5EG6C 4O5LH 4YEFA 3V55A 2K4WA 1WK0A 2YSTA 3SKMA 5I6OA 1EO7A 4PJ9C 1OT1A 2EVFA 3DYPA 1NCCL 4FNUA 4PRDB 4A2MA 5J11B 3RHWK 4GP5B 5KSUB 3L5XL 3V0FA 4PSRA 2AJVL 2JQZA 4G6KL 5AEAA 3CVBA 2AXFB 1MFBL 4RIRB 4HP5A 2YXFA 5C3TA 4NFCA 2WIMA 4WO4B 3C5JB 4LP4A 3WJMB 3ULUH 4FABL 2YD1A 3BPNB 3GJEA 3HKZA 1T3FA 3FULA 1I8IB 5FS5A 2E7HA 1K2DA 2EIDA 1OSEA 2W91A 5H37H 5INCA 3UZQB 4NQCD 3MJ8B 4IRSB 2R56H 1KXHA 2A9BA 3L1EA 2CJTA 3QSKB 1BG1A 3FT1A 3JV4A 3UGUA 3M8OL 2F68X 4Z78B 3QDJD 4G43B 1W8OA 3BSZA 3HB3B 3EG9A 5MHSD 5DT1L 3A6CL 3QEQA 4R97B 1ZHLA 3ISYA 3LH9A 4Z5RB 5BCAA 3DXAD 5H4YA 3S35H 1DP0A 2VZUA 4AJYV 2BCMA 5GRJH 3QG7L 3QUZD 2NY0B 5IWLA 1LP9E 3MV9D 3GLAA 2OZ4H 4N2OA 2H9GA 5KVDE 4P4KB 4FZ8L 4X0KB 4TVSa 3NCCB 4TNGA 4G1EA 2WD0A 1W0YT 5KVFL 1KEGL 5CN3A 1QFOA 1QVOB 2WWNA 4UILH 3F7LA 1RZGA 5BVJA 3HG4A 4FOMA 5K59E 5JMOC 4A04A 2A6JA 3EGXA 3WJLA 2EEFA 1EXHA 4A7TA 2YXMA 3GMNA 3LNFA 4PHXA 4CU7A 4X6CA 1HQ4A 2BWIA 3AQZA 4Q6KA 4CU6A 1VDGA 1MHHB 3FDWA 4K8RL 3GMMB 4XBPA 2K7PA 1OCWH 2YKKA 4E9WA 4BK8A 5FDYA 5IKCB 4QXGL 1T6VN 4ZAKC 5CIPH 3KPSA 4OIIL 1UD5A 4WU5A 5I1EL 4ZW8A 1PYWA 2BC4B 3WEMA 2AJSH 1JMZA 2Y7QA 4P06A 1A3LL 4KH2A 4OQTH 5FGBA 2R2BA 4H20H 3CFMA 1RUML 3GIZH 3GD1C 3D6GA 1JZDC 4NBZB 3RVVD 5IIEB 4F5CA 2EIJB 4V1DE 3LZNA 2DZEA 3UBHA 3GWJA 3DSNA 1I31A 2DMCA 1Q72L 1A4KB 5J12C 1AI1H 3FHQA 2ZX5A 2VLME 3NPSB 3PABB 5JQ6L 3RFZB 1U91A 5IW6B 5GGSB 2C1OB 3HPLB 2X4PA 2UWEA 5LAXB 1FH5H 3A4EA 5J06A 4PRPD 3NK3A 3FQNA 2H0FA 1BEYH 1OPGL 5F7NC 3B6SB 4ZT1A 3NIGE 1VFBB 1P0SE 1XO8A 2ITEA 3ULAB 5JDSB 1KXQA 2CHDA 4N0CD 3HR5A 2XXGA 4MNGA 4GI8A 1UUNA 3FAWA 1NOAA 3WNMA 2VC2B 4XNYH 2FNWA 1LO3H 3MRBB 3NIFE 2WXLA 3DUUB 1FFNA 3Q5TA 1RLWA 4EKXA 1G1YA 3PJNA 1ZK5A 5E6ID 3OR6B 1L7TH 2QR0B 1CGVA 3FRUA 1VACB 3OPZL 3UABA 3L5WB 2EUZA 3EGDB 1Q4NX 2HJKA 4HOWA 3AXLB 2NCEA 4YC2C 5HGBB 2ODIA 4L9LC 2JVUA 1K4CB 3T8VA 5GS3A 5IEHA 4NN7C 4FJZA 1FG2B 4PB0L 3UXFA 2A9ML 3C12A 3PHSA 5AOMA 4Z3EA 5EZPA 4P46D 1JNNL 1KYAA 2OQJB 5CSGA 3BUBA 3PE9A 2P8LB 3EH3B 2X9ZA 4Q2ZA 1S9KC 2Y6TE 5JIPA 3WEBA 4XN1A 1CYGA 3FRPB 3V6OC 2D7MA 4OQTA 4ES8A 1U8QA 3CFEB 4DEWA 1GA2A 2Z4QB 3BZFA 1ZY9A 2EKSB 3L5HA 4OGAC 3B83A 4UTCA 3O0RL 5KAQF 5GGVY 5D1QD 2NZ1A 3V10A 2SEBA 1MZYA 3NBNA 3P11H 4DETA 1LYQA 2ITDB 3KPLB 4FJ6A 3V6ZA 5C07A 4X8XA 3RIAF 1VADB 4J4PA 1TEFA 1ETA1 2XG4B 4J3WA 4NNXB 4GG8A 3DMMD 4E41E 4KK5C 4NQED 4KTGA 1DUZB 1AS6A 1RUQL 2BIIA 2BZ7A 2WLHA 3JV6A 2XV3A 3OC5A 2VXUL 4YGVB 2P8MB 2FTAA 4NGHH 2KC0A 4XNXH 5ECGA 4YIQB 5C8JB 3SHSA 1B90A 3L9BA 2J1YA 5FDWB 1H3PL 3P73A 2CWRA 4ORGB 2X4UB 4U31A 1TG8A 3FYIB 1YPZB 5IQ9B 4JFDD 4GP8B 1L9QA 3LAFA 4GPVA 2W9DL 5JZ7C 3LXUX 3QEHB 4U3CA 3WO3B 4IS6A 5J6GA 2JIXA 3DBXA 5KYYA 1A5FH 5AOZA 3E1F1 1NBYA 4IJTA 1UEYA 3GUFA 5IHLB 3I6LD 2VXSL 2YD8A 5E2UL 3ZKND 1L9NA 1LDPH 2LVEA 2X3CA 2VDPL 1LEKB 1CI3M 3KPNA 1R24B 4J6RH 3F05A 2BVQA 4BSJA 4C58B 4ZTEA 2ZOKB 3VGGA 3QJQB 1WQVT 3FU3A 4HUWA 2FATH 2NY3D 2YR3A 4OZHF 1DDHB 5DEJA 5DUMH 1D6VH 3I6KA 3FT4B 5T3XE 5DC4B 4EI6A 3VFTA 1K5WA 2BSEA 1WD8A 3LB6C 4LSTL 1HWHB 3LHPL 3OKNA 4APXB 3APCA 4X5QA 2DS4A 3LIZA 1I7RB 4MVBC 3H2WA 2LOEA 3GBNL 4BZ1H 4ZO9A 3UBXG 2DLFL 1J9RA 4JFXB 2DWEB 4ELDA 3Q1SH 3MBEB 3WFCL 4ZFFA 5C08A 4PYHA 4F15B 1BQLL 3MBWA 4LVHC 4AEHL 2XG5A 4YR6B 2JCCA 2B59B 4E9SA 4WO0A 4IBYA 4OCXL 7CGTA 4OZ4B 4LSPH 1YUHB 3QZLA 1MNUH 1DJSA 2UZYA 3UCQA 3UTQB 2R2HA 2W65A 3T6WA 4RNRB 3G5VB 1KCLA 1TTAA 3D39B 3ZL2A 1HJBC 4H40A 2R1YB 4Y88A 3UAJD 5JXEA 1IILE 1S3RA 2YS4A 2AJUH 2BP8A 3FYEB 3OF6A 3QWOA 3ZDYE 5JHMA 5L0QC 4IGBD 4H0HB 5BZWA 2CK0H 1VKXA 3WY4A 3UERA 3WUWB 1T1XB 5IFHL 2V3FA 4IOIB 1JZ4A 1ID5I 1NCIA 4N0FB 4PVNA 4L3CA 2G9HA 4HCFA 1TQBC 1CD1A 4U6XA 3HE7A 4I0PC 4L8SA 5D7JA 1XX9C 4J3OG 4ZUUB 2AAVA 4LU5H 3VI4B 4WWKA 4GNKB 3A6BH 3IVKA 3MACH 1B88A 4YPJA 3GXMA 1OIOA 4L4TB 2CBPA 4FFYH 1ONQB 1NMCB 4XX1E 2FB4H 2O6CA 2OV0A 1AZUA 2C3WA 1ZTXE 3V0HA 4QRRA 5L8KB 5E70A 4XMVA 1E6OL 3GSQB 3HNSH 1Y07A 2CMRH 5DZJA 4M7ZC 2EDTA 1QO3B 2XLLA 2CR0A 3H9ZA 4PW4A 3B9DA 4H8QA 4L3EB 5J9PB 2WLNA 1KG0B 1S7VB 4RWHA 1SDYA 1A6AB 3LRSB 3MNWA 3P4OA 4M00A 5AVSB 4Q74A 4I1NB 4J6IA 4OH2A 5C0BE 2XBTA 3QIUC 5GZNC 5GISH 4P2RE 1XH0A 4G5ZH 3O45A 4AK1A 1H5BB 1J88A 1KLGB 3LN4A 2AAAA 1NGWA 3F01A 4JO1H 3TU6A 5CLTA 3D3VB 3I85A 3L6FA 2FD6H 1JPFB 3MNVA 5FW6A 3FU8A 4Q6IA 4IBZA 4Y7MA 5EORH 4I3GA 3RTQD 2AEQH 2E74C 2ZICA 4G8IB 5FW8A 3U0PA 4K55A 5IROD 3JV0A 3KR3H 4LSQL 5A43C 5EZJB 1A3QA 2ZWSA 2HXAA 4IIQB 4BYHA 3STZB 1NOFA 4H1LA 3QARA 3J7HA 1UD4A 4AG4H 3MO1A 1QRND 2FO8A 4QPEA 4HSCX 5DGQA 2XICA 1RHHB 4FXGB 3N1PC 4ALAH 4DQOH 3P77B 4GQQA 2WCSA 3MV7E 3TBSB 3BN9D 1JGDB 5I19L 4RMTA 5GRXG 5GSRB 3H3PH 4AJWA 3IGKA 5BO1H 4JL1A 2BNRB 2JKTM 1VEMA 3UO1L 1UXSA 3BKCL 4WHYG 2RAMA 3W57A 1ZOXA 1S7XA 2H7WA 2WLIB 4PJIB 1N3NA 3LXCA 1RK7A 5ESAB 4RQQA 2GUOB 5T1LB 3V0EA 3WIIL 1JD9A 2RA1A 3FO0L 4TS6A 2XFGB 1U3ZA 1HYSC 2BSTB 4JGNA 3VXRE 1ZHNA 2KMWA 1J8HD 1OGPA 4Y16D 5ADPH 4LP8A 4V33A 4PRIA 1WFJA 2Y9RT 3VACA 1IFRA 3IF1A 5E9DB 1OP4A 3QZPA 3MX0A 4HZLA 2XV6B 3TWCH 3K5SA 1KIQA 2ZIDA 4LIQL 4PEEA 1ES0A 3MA7B 4KV5F 1HEZB 4BSVB 2ZXDA 4ZI8A 5JHDE 5D2LB 2YK1H 4ZSOB 3G04B 1SJEA 4U1JB 4XO9A 7FABH 4HLJA 4LSVH 4H8WL 4XNZB 4MDJA 4KX8A 3V4PH 2YXVA 5DO2D 2E86A 1TQCC 3K2KA 1N10A 3LVTA 4I89A 1SHXA 1K5NA 2NUTA 3BPCB 2ATKB 5J1AB 2DQTL 3U30C 1O9VA 3MV8A 4WWPA 1OVZA 1U8MA 2GVYA 1NKRA 3EJQA 4M5YL 2CRMA 3WMPA 4J3TA 1QBLL 2NY6C 2X0WA 2Y36H 3IDYB 4QKTA 2J55A 1BVZA 4U05A 3VMNA 1EV2E 3UYRL 3CHRA 3RWGB 3SDDC 1BBJA 1SYSA 2VYRE 3EJSA 1MRFL 2G5BB 4QTHA 1YZZA 3S3SA 5AAWC 2WB1A 1AGDB 3T4YA 2G5RA 2V4LA 2CO7B 3OGOE 5JO5B 2HPTA 3QWQB 2HFFA 3S3DB 5JMRA 1HXYA 2WXRA 2YPVL 3CFCL 4GKSA 4NQDD 5E5LA 5I74C 5C97A 1DN2A 2XBDA 1AYOA 3OXSB 2DKMA 4XXDB 3RWFB 1AP2B 1QBAA 5I1HH 4WY7L 3C5ZA 1C08B 3WN5C 4UV7H 5LUMA 3L1OH 3AS3A 1T4WA 1N18A 3QORB 4QMEA 4GMTL 4YDIH 5B7MA 1QI5A 2MHAA 4MXVE 1D5MA 1I3GL 3GSNH 4OLZL 3U7WL 4A2DA 3QUYB 2VH5L 4TQEL 1BQHB 1T5KA 4JN2B 1NIFA 2WBJA 5G4NA 2I85A 1IIKA 3P4MB 1J11A 1P5VA 4TV3A 1IFHL 1QTSA 5C86A 4JDTH 2OTUA 1N59A 4L23A 3IXAB 4TTDC 4GMSL 2F53D 3M45A 4KXZI 4XB8A 3AZUA 3F6IA 2F8OA 3J8F7 1GPOL 3CFNA 5TK4A 5BMFL 1AGEA 2VE6A 3SKNB 5E94A 3N42B 1QP1A 2ZWLT 3ESOA 2Y24A 3CZKA 3GS4A 2NX5E 5FEBA 1C1EH 1WTGT 4Q4EA 2PWEA 4UDUB 3U6XS 5B8CB 4DCQB 2J6EL 1RJYB 3CZNA 1S46A 2VN4A 4IRJD 5F0LB 4JY6B 1S7RA 5IV2B 4UM8B 1ZWIA 1I1AC 4WV1C 5AUMA 4FTVD 1QLRA 4DP4X 1KCKA 2JB6B 4GBXA 2C1PB 4L9DA 4TNWK 3SCMC 1WIUA 3O6MH 3U0TA 1GGCL 4PJXB 5AWNL 5GIRA 4NQUA 1S9WB 4FNTA 2YEVB 5KVGE 2GT9A 4C4KO 3QRGH 4XHJD 5CP3H 5KSVB 2ZKXA 4WFFD 5F7DB 4HJGB 5IEKA 1IBGL 2G60L 2VXQL 4JQIA 5D7LD 5E8EB 1RUPL 2VLKE 3TC9A 1LE9B 2DYPB 4YFLF 1HXKA 4YQXH 1IC4H 1U8OB 2QSVA 5HI3C 3VG9C 4IHOA 1Q1JH 4GO9A 1MRCH 2NY5H 4YLQT 5DEGB 2X70A 2R8SL 4B9ZA 3EUDA 3GJFH 1A6WL 1UJ3B 2A74A 4WI4A 4ODWB 1ZGLM 5E8NB 4FCAA 4NO3B 1FFPA 1FG9C 2EIZB 1NDTA 5DQDL 1CO1A 3EDDA 3DVNA 43C9A 3L3JA 4GAGL 1A6UL 1OCRB 5C6TH 3H9HA 1WT5C 2ESVB 1MHEA 2A6DB 3MRIA 3IMSA 3O2DA 5EBWA 4W9EC 4HF5L 5DGRA 5DTFB 3B5HA 3OKOA 5CS7A 3ZQXA 1G7HA 3K6NA 1Y1DA 3PV6A 3Q5YA 4HC1L 3S36L 5KYNA 3VCLA 3SKMB 2C4FT 3TA4D 5DK0A 4FN0A 1H3UA 1EUTA 5I0YA 1LO2L 1VSCA 3V0WH 1TO4A 2ZG2A 1A3RL 5C0AE 3D87B 3B2UD 5DHEA 3QHZL 4ZX4A 1XXDC 1OK0A 1FDLL 2I25N 2V2WA 2NXYC 1Q9KA 4YDKH 1HHKA 2GTWB 4UNVA 3E7JA 1BMWA 2CUIA 1JMXA 3L95A 3QXDA 4PJCE 1SLUA 3GJEB 3O2VH 1T3FB 1V7NH 5CBEA 5KS9F 4LAJH 2BWQA 1UA7A 1K2DB 3US9A 5KVDL 2FE0A 1ZPLA 5BO0D 5INCB 1YO4A 3GI9H 4O51A 5ITBL 3DRQA 4KFZC 3EJYC 3PG2A 3HR6A 5BRZA 2Q7YA 3JV4B 4DQAA 2V9UA 1JZEA 4IOSD 2OR9H 3EG9B 2BY2A 2PCFA 1OY3B 1MJUL 3QEQB 5DHYA 1NCBH 1ZHLB 4AGLA 1JXKA 4UNTA 3GXIA 3D30A 1YYLH 3THMH 1NMAL 3RHWF 4M7LH 1REIA 3GJFA 4OJEH 1EERB 2H9GB 4OD3L 4FFZL 4WCYH 3L3KA 1KYOK 3BT2L 4G1EB 1TNNA 4ZQKA 1O0VA 2ZXWB 4FNPA 1RZGB 5BVJB 3MXVH 2Z93A 1MCLA 1UYWH 1XB6A 2VQ1A 2A6JB 3EGXB 3CXFA 3GMNB 1KV7A 2B14A 4X6CB 1HQ4B 2QPSA 3L3OC 4GAYA 4OTXH 1MUJA 2OCJA 4FMVA 4DAGL 4LPCA 1LTXA 4TSBH 1I3UA 4L29A 4XBPB 1PPIA 2ZKHL 4OD1L 1OGSA 4CNIA 1A14L 3KPSB 4WLCA 5IESL 4MLIA 4WU5B 3U48A 1PYWB 3VXPA 3VSTA 2Y7QB 3QXVA 4NOBA 2Z8VC 1UURA 2ERJB 5CEZD 2R2BB 4I8DA 5AOKA 3CE1A 3WAJA 2AS5M 5SV4A 4JRXE 2DWSA 5TE7H 3VWJD 2MOGA 2TSBA 3QYNA 1X9QA 4Y4FD 4ZMTA 1QSFD 3CMOH 3DSNB 4V2BA 3P0GB 5DJCA 3WO4C 2CHXA 3QAZC 3ARTA 3DWTA 3SOBL 3OHMB 4ZMQA 2EUWA 3KH4A 2E7LC 1U91B 5IF0A 4JM2C 2X4PB 1BJ8A 1DLFH 1E8ZA 2UWEB 4UT9A 5EEWA 2Z31A 3T1FA 2NSQA 3FQNB 1X5YA 3GJFK 5IB1A 2MH4A 1DBJH 2GYSA 3HR5B 1UWGL 4MNGB 4RISL 4DGUA 2DKUA 4R7NA 2DTMH 5ACMA 3ZE2F 2G30A 5CSZA 3ZDXB 4RMVA 4WI9A 1CGSH 1UM6H 2DLTA 3RX7A 3FW6A 1LILA 1FFNB 3VD2A 2DAVA 1GC1C 5CJXC 3Q43A 3M86A 1AHKA 5HGGS 1D5XA 3FRUB 4KMTL 4JM2F 3QC6X 1I7ZA 2HJKB 1YNLL 2V0AA 1JAEA 1IGMH 3UDWA 3FMGH 2FL5A 3QUZA 4KRPB 5IEHB 3EYQD 3TJEH 4FKKA 1DCLA 3UG5A 2JNZA 1YEJH 4J3UA 1KMGA 1RI8A 3QHFL 2W0KA 5SX4I 2WO4A 4Q2ZB 1E4KC 2Y7OA 3QIWD 4UCFA 1AIFA 2MJWA 5SX5K 1KBGL 3ARBD 1U8QB 1YQVH 1AHWA 2IAMC 4PJ7F 3TH4T 3QI9A 4GIPD 3OLIA 5D8JH 5ESQA 3L17A 3BZFB 3W1ZA 1ZTMA 3BAEH 3UIYA 5JW4M 1X5ZA 1E30A 4MB1A 1EJ8A 2W8CA 4Z3FA 1W0VA 2SEBB 3TO4C 3ZKSD 5E6SB 2FSEA 4P23D 4X6CF 5DUJA 2WXOA 2YIHA 4EAEA 5CINL 1YUKB 2EAEA 4HPOH 5KSAC 3V6ZB 1RURH 2OA9A 5C07B 3IT8D 1DFBL 4EPSA 1F4AA 2A83A 2N7AA 1AZCA 4GG8B 3VA2C 3QIBC 2F5BL 3ATAA 1ZANH 4YHKL 1OF0A 1OAUH 2IGLA 4ETYA 3JV6B 3R0NA 2WBKA 2OMYA 1ADQA 5GGRY 4K5MA 3BAWA 4U7SA 4KI5D 1OGTA 4EDWL 2Q5BA 2ZUQC 4D9QD 1JV2A 2CUMA 1P9MC 2CHZA 4F7CA 2XSKA 3UPAA 3ULUF 3AW5A 1MREH 2QTEA 3BWUC 1SHWA 1ZDQA 4XAWL 5F7HA 3F62A 4F1SA 2WAHA 2YUZA 4OF8A 5T3XL 4KRMB 5J6GB 4IS6B 2JIXB 3S8GB 3DBXB 5KYYB 4BINA 3UEQA 1JWMA 1NBYB 5BNXD 3DARA 3C08L 2UWEF 4FDWA 1NLDL 4KAQH 4B0MB 4PS3A 2LQRA 4UQDA 1MDAA 2RCSL 3CWGA 3KPNB 3KWXA 1M1SA 5F7KC 4MHHI 1UD2A 1CTNA 2FVNA 2H32H 3ABKB 1IC7H 3KXFD 4O2FA 4F9LA 2APTA 2BVQB 3S3CB 5E6IA 4HUWB 3ZDXF 2LVCA 3AG3B 3BWUF 3I6KB 5D4HA 5C2BH 1U8IA 4EI6B 3VFTB 4ZFZA 2JJTA 3EHBB 3FPXA 4IU3A 4MAZA 4AYBA 3E8UL 3BP4A 4KX7A 3FONA 3OKNB 4JL2A 4QHMA 4EN3C 4WWNA 4KHXL 2P5WE 1MN4A 4R5XA 4FCHA 1UCBL 4P46A 1O7DC 3HIZA 3BGMA 1OAQL 4ZFFB 5C08B 2NNRA 5JA8B 4YLCA 3MBWB 1R3KA 2WXKA 2XG5B 5DMGC 1L0PA 2JCCB 4G42A 1NAMH 3O6LH 3MLWL 1FL3A 1G9MH 2UZYB 5L4FA 1COBA 1YEIH 2R2HB 2W65B 1ZHBA 1N26A 4H0GA 4PY8I 3ZRFC 4J12A 3S88L 2BP8B 3QWOB 4XVSH 2X38A 5CD5C 4Y7OC 5ANME 3DRTA 4BWWA 5EULV 5JUEL 4XPHH 1ZTXL 5BZWB 2KHAA 3GS7A 4YWGL 4G9FE 4LLAA 1GYVA 1HNGA 2J25A 3DMMA 4K3DH 2DM3A 4L3CB 2G9HB 2HVBA 4FQ1L 1CD1B 4U6XB 1FPTH 3EBAA 3HE7B 3P0VH 2I7SA 4L8SB 5D7JB 3VXTA 1OV8A 4D2NA 4WWKB 3WY3A 3UTTD 3ET9F 4AIZB 4XOBA 3LEYH 3GSVA 4IU2A 3IVKB 3V4VH 3QDMA 5CM1A 4FFVC 3VGAB 4KXDA 3GNMH 3D85D 3FSOA 4W4NA 1NKGA 4JFDA 1KPUA 1CT8A 1NPUA 5FK9A 4GH7B 4QRRB 5LKNA 2WANA 1ZT1A 1H3TA 1H6EA 3FSAA 2CIKA 5L7XH 1AMYA 2AI0L 2I60H 4HT1L 2F15A 2VRKA 4M5SA 3RL1A 3RWJA 5DZLA 1UM5L 2Q3XA 5K69A 5IM7A 1VCAA 2B8OT 4XNDA 4AQAA 2XZCL 3MNWB 4J3OD 3P4OB 3AT9A 4WKXA 5FUZL 5I15H 4KK9D 4ISVA 4HK3N 3CK0L 3PJLA 1YG9A 4X7SL 1CF8H 1NCDL 2YMXL 2XJLA 3O45B 4XN4A 3MODL 3LN4B 4NIYE 1PSKL 3LJ3A 1NGWB 1G84A 4NN6B 1XD1A 3QPXL 1CD0A 3L6FB 3MNVB 4Q6IB 3OG4B 2RR3A 1QG3A 1ZEAH 1WD9A 1WYJA 2PYEE 3SYOA 2XU9A 1E65A 2F58L 3U0PB 3ZPDA 4F7PA 1IGCH 5IP4A 2PWFA 4TUJA 3SE8H 1IUZA 3GMOA 2AANA 1OSPH 3LRGA 4H1LB 1FWXA 1R5VA 5I1KH 3O9WA 2CUHA 4YBHA 3MO1B 1IVLA 2B1AH 3ZO0A 3VXSE 1YEEH 4HKBA 2LABA 4LHUA 3CX5K 4OZGA 3UJTH 4X9BA 3ESMA 4KKQA 5GGTH 3S3BB 1IC1A 4H2AA 2W0LA 2WBWB 2V9QA 2V17L 5CEXA 2IDFA 4LE8A 1UXSB 2YC1A 2XZZA 2JCCF 2FO4A 4GSUA 3WKMH 3NZSA 1S7XB 1OAXH 2BNQD 3UAJA 2WXMA 1N3NB 4HWEH 4RQQB 4BK4A 1W6LA 4XAKE 5KYUA 2HVJA 1SN5A 2Y6SD 4A7QA 5TPWL 2DWDA 4IGBA 2FYVA 4KBPA 4IKJA 5D4JA 4Z3TA 4FERA 3NIDF 1BZ8A 3QCUL 4BCXA 5IHHA 2NDGA 4PRIB 3S5LG 3HFML 2X44D 3IF1B 3ETSA 1T0MA 3MX0B 1YC8A 4XMZA 4HZLB 5F7BA 1EDYA 4BFEA 5JQIB 1KIQB 3DJ9A 1ES0B 2X1QA 3WNJA 4F8TA 1JZ2A 2ZUSA 5EOCH 5K9JH 4A7UA 4GO6B 4CGUB 1SJEB 3PCYA 3RPBA 3T0WA 1QLEH 3NACL 4APQC 1IAIH 2X89D 4MDJB 1VLXA 1OTSC 2Z1KA 4XVTH 1QAWA 1K5NB 2NUTB 4FFTA 3UP1A 1UFGA 3MV8B 1V7MH 4XPAL 1U8MB 1D5BA 5TF1H 1HJCA 1ADWA 2ED6A 4PR5A 1BPVA 4O02L 4ZFOL 4JO3H 4R5VA 1WFTA 2DBLL 1YMMD 4GS7B 4KKCD 3UAFA 2NY7L 5FUOL 5MP6H 1BBJB 3BDXA 1SYSB 2XZAH 1A47A 2VDKL 2IOOA 3KYNA 3WTSA 4QTHB 1AHMA 2B3IA 1NCAL 1JXGA 1Y6NR 4XO4A 1SFHA 3T4YB 2HFFB 3RTQA 3UFIA 1HXYB 3H42H 1DTUA 4OJAA 4GKSB 2KDGA 1XT5A 4OFVA 3RVWC 3ZTEA 2IFGA 4KTEL 3LKRA 2G2NA 3JTTA 3LNIA 1S78C 3C5ZB 1HKLH 2OKMA 3DHJA 2APWA 2OSLA 4XWGL 2QPEB 3SDCC 4UTAL 4NM4H 4Y2DA 3CH1A 1IU1A 3MOAH 5CGBA 1QRNA 4LAQL 1MOEA 2YXWA 5KVEE 1OWRM 3FTUA 2MHAB 2YMTA 1D5MB 2VDNL 2E8YA 4HFUH 4X4KA 2YWZA 2FEEL 3AY4C 1MY5A 3ZKQD 2WBJB 1AO7E 4JG9A 2R1XA 1P5VB 1MCFA 2OTUB 1N59B 1PFCA 4OFPA 4DGYL 2QQKL 4NZRL 4TUUA 4RGND 4CBZA 4Y5XA 1IGIH 3DO4A 3P9MA 1WWCA 5KVGL 2IIJA 1AGEB 2NNXA 2VE6B 3BFWA 4I87A 2ZOWA 5E94B 4Z8FH 4LRNL 3K0WA 4TUOA 4A68A 4OCRH 4TNVK 5IJKA 4IDJL 4HALA 1I53A 3MVSA 3Q2LA 1XGRA 4P04A 4AIOA 2X40A 1TOXA 3X3FH 1S7RB 2HT3C 1J8HA 1LO0L 1HCZA 1ZWIB 4HZAA 2VN5A 4Y16A 2K7QA 1QLRB 5AUMB 5CZXD 2VXTH 4GBXB 4JBSA 5EF0A 2XWRA 2IH9A 3C6EA 1X9RA 4Y19E 4ACPA 4KITB 5EFIA 3U0TB 1NCGA 4G72B 2FX7L 4KNQA 5GIRB 3G5WA 4QEGA 3GLZA 4X9GA 1HL4A 2GT9B 4HK3J 1AG6A 1DSFL 4NQTA 3MJ7A 3HAEH 1T04A 2A9NH 2CJUL 4WNSA 5IEKB 2DPKA 3FK3A 2EE2A 3B5TA 4Z7OB 4K5OA 1AY1H 3PQYD 4MQXC 5T1JA 4KXAA 2ENYA 1SZNA 1MWAL 4YE0A 2DQEL 3DUSA 4ALAC 1LQSR 1FGVH 4K07A 2EILB 5D6DA 4ZX3A 2BO0A 4LEOA 2EXWC 5AW2B 5EF2A 2WW8A 4UMGA 1T6BX 2X70B 5CJ8A 5BV7C 4KJWD 1F86A 1FSKC 3MLPA 4QXTA 4L0ZA 1OAYL 4MKTA 4E5XG 1CFBA 1KJMA 1QUNA 2A74B 4ELMF 3QDAA 1A6VH 4OGYL 3FTSA 3OVUB 4PJDA 4UB0L 1FFPB 1FRGH 1OCCB 5EEYA 3CXHJ 3SB3A 2AV1A 3WTVA 2ZCKH 4TNWF 1VEOA 3DVNB 43C9B 1G1CA 3L3JB 4IJ3C 3RVUC 2L7QA 4PJHA 2CU9A 3H9HB 3SIKA 2E6PA 1MHEB 3BP5A 3UTPE 3MRIB 4LGSB 3VGBA 5EBWB 2GY5A 3CVCA 3LDBC 4AUYA 2CG9X 4OLYH 5EHFA 3OKOB 5LXGL 2YPLE 2Z7YA 1G7HB 2BRRL 2WM0A 4GRWE 1SBBA 3PV6B 3VCLB 4EIZC 4BZ2A 3WLWD 4XWOD 4LLYA 5DK0B 3H2QA 1TENA 3SE4A 5F7UA 3SE9H 3F6LA 1F4YH 3PF2A 5AL0A 3QNZA 4JKPL 2VQ4A 2WQSA 3EYUL 4Z7NE 4HUUA 3OX8A 5HHXH 2VDRB 1FFQA 3Q5OA 3LKPA 1G5AA 4XP9L 2AK1H 2V2WB 1AFVH 4BE6A 1Q9KB 1BDYA 1HHKB 3ZMEA 3IU4H 1W9XA 1TQUA 1CLCA 2Y23A 1S5IH 3LIUA 1NSNL 3QXDB 4GXVL 2CRIA 4TLKA 4GY4A 3W2DL 4O51B 4AL8L 3NABH 2DWYA 4KDVA 1B0RA 3DRQB 3WFDL 3L45A 5BRZB 2Y2WA 3BJ91 2Q7YB 1KBWA 4JR9H 2E0PA 5EC2A 2GI7A 4FTVA 2B39A 1BFOA 1J0IA 5IVOA 2PCFB 5DHYB 4NPKA 1JRHH 5EU7C 5JIHA 1IEBA 4BA0A 2ZXQA 3TF7C 3GJFB 1ZGLP 4TVUA 4EKJA 5D4QA 1H6UA 5GGQH 4GLRH 1FYTD 3L3KB 5I26A 3UTSE 1D9KC 4UTBA 2OK0H 5H35A 3ZSTA 3SQOH 4HEME 4ZQKB 1Y6MR 4G7VL 4WFGD 2ADYA 3V0GA 2HH0L 1QFHA 2Z93B 3TJHC 2W60A 4F58H 4C47A 1JTOA 2VQ1B 4N2HA 1ZVHA 4Z7OF 2W95A 3SGDI 1AR1B 3FTGA 5GGUA 3V5DA 4GAYB 1V3KA 1NANH 4ZDHA 5I1IL 2YD7A 4WJ5A 5ITFA 2WCPA 1BVOA 1MUJB 1E4WL 1QFWH 3VXME 4F2EA 4L29B 3CSYA 3LRLA 2DQGH 2FLMA 1AXSA 2ZUXA 3GXNA 3O4OC 1SVCP 1X5KA 2B4CH 3VXPB 3EOAA 2KQNA 2IF7A 4WRLA 1D7FA 5L88H 5CKGA 2J1WA 4MCMA 5HDBB 5CU9A 2ZUWA 3VFNA 1B4TA 5A3IC 3N0PB 2GJ6D 2PW1A 1FFRA 2JXMA 3VD0A 2BDNL 1KCRL 1UWEL 3MI6A 1PLGH 4MA8L 4J2QA 3MLYH 4G3YH 4AVKA 1XTMA 4E36A 4PGBA 5DJCB 4QXUH 1RZ7H 1TJIL 4FQPA 3ZTJH 1MW3A 4LPTA 1JWUA 4B9FA 3TM6A 3TS8A 1YRKA 5IF0B 3O41A 2ICEA 1VB9A 1BVKA 4GW1A 2EC9T 4KKAC 3VH8A 4M7JH 5DA4A 4L5FH 1U3JA 2H2SD 3VFGL 4IRZA 3W82A 5CEZH 3PAZA 2Z31B 3T1FB 3IXTA 5DC9B 1PD0A 3DTXA 3VX1A 2VSDA 4UBDC 3H9YA 2L04A 5IB1B 1GRWA 1CXEA 3LH2H 1QSEA 4R7NB 4J28A 5AZ2L 1XEDA 2HJLA 5CSZB 1F3JA 3BQVA 1XWVA 4YXHH 3C75A 4O9HH 4ZMXA 1LVEA 3S48A 5DSCA 3AB0C 2HKFL 3T2NH 1C16A 5HI5D 4L18A 3U4AA 1DQKA 3GRWA 3KLQA 4YHIA 3GMLA 1D5XB 1D7BA 3NAAH 4H88L 1FC2D 3V5KB 1I7ZB 1DQDL 4LLWA 5I75C 2FL5B 3QUZB 4RRPA 5CGYC 3SKJL 1DCEA 1DO5A 2AVFA 1PZ5A 2XN9E 1TPXB 4G7SB 4S1QH 3OJVC 4W81A 3Q8FA 1FAIH 1P7QA 3T1WA 2G9KA 3BN3B 1VZIA 1AIFB 4R2GD 3UC2A 4D3CL 1BM3H 1I4FA 3MA9H 4M8QA 4N0UE 1KJ2A 1AHWB 2VNCA 3QI9B 4Q7DA 1M9SA 2J8UF 5ESQB 1WJ3A 3BQUD 4W6WB 2OMXA 1ICTA 2OXHA 3D25A 4KK6C 4W9JC 5L9DH 2HT2D 4RETB 1JG9A 4G8AC 3Q01A 1V5JA 4OT1L 1W0VB 2WZ6A 1X5JA 5ACLA 2X1OA 2FQFA 2FSEB 4MS6A 4X6DF 5F96L 3JZYA 5CD3A 3SEPA 4JY5L 3S4SA 2A83B 3SD2A 2KBGA 5AVYB 2APSA 4GXUN 2GHZA 1NFDE 2PPDA 1YEKH 5FYKU 3T0DA 2C9AA 1Q0XL 5TH2A 4HUKB 2OMYB 2EH8H 2QHRL 1QSFA 1OGTB 4TSAH 3RGVD 5HDBF 3TYFA 3SJVA 4NHCL 1JV2B 3KEHA 3I3DA 4R8WL 2IG2H 3JVGA 4JS7A 2N59A 4F7CB 5AW6B 3GKWH 1DJWA 3JWOL 4ATTA 1D5RA 4XP6L 2FAUA 3C2SA 2VR5A 5JXAL 1JYXA 1YY9C 1SJHA 3KD4A 5I1LA 1E5BA 5BS0D 2AEWA 4OIAA 2VM3A 4PJEE 4MQ7A 4PJGA 3TT1H 3CG8A 2IFFH 4X7CC 1X6NA 1JWMB 1M42A 3TF4A 2DLEA 1F4WH 3MLUH 1UH2A 2QV2A 2QMJA 2RJMA 3KS0J 1P4LA 4KO9A 1KGUA 3QEGL 1YNKH 1DZ0A 3KM2A 2DLGA 4M8UA 4O2FB 4TSCL 1A0QH 4PRHA 5D2NA 3MYJA 5E6IB 4PUBL 4YVNA 1BW8A 1UZ8A 1HE7A 4JFFA 3MUHL 1U8IB 4ZFZB 4IU3B 2Q7NA 3B34A 1OL0A 4LLQA 3BP4B 4DEPC 3PFUA 3CSPA 3IEAA 1GMEA 3FONB 3RZCD 1EHLL 1CK0H 1A9VA 3HBPA 1A9EA 3B9AA 1JZ6A 3NPSC 3WN6A 2R0KH 1CFVL 3E9UA 1JJUA 4R26H 4EMZA 4EUPH 2QPFA 4P46B 5I6XB 2FQGA 2OLDA 2W94A 4OVVA 3BGMB 1RV6X 2Z35A 3MOBL 4GSDH 4W9CC 3V95A 4YXLL 3VFRA 4PJBF 1GC1L 1X7QA 4YMPA 1R3KB 4BK5C 2CKNA 1RULH 4X4MA 1JF6A 5D72H 2VR4A 4O2EA 3ARBA 3MXWH 4G42B 4QKXB 1FL3B 2BVEA 1B2YA 5DVOA 5GRUH 8CGTA 2PPEA 2DRUA 4LPVA 4UANA 1H8LA 4RAVA 4XO5A 3RVVC 4L1BA 1ZHBB 4PGZA 5GRVL 4OFDA 2R0LH 3T4AC 1KENL 1KBPA 3T09A 3DRTB 4XPTH 1OK8A 3U25A 4F1ZA 3WXVL 4R7VA 5CILH 4K71B 2HFGL 3DMMB 1TSRA 3C9NA 1UVQA 3WIHA 3EDEA 4PH8A 4PPTA 5FM4A 1SXNA 3VXTB 1WLHA 2KH2B 5I8OL 2A0LD 5DWUL 3GSVB 4IU2B 2K6YA 3IYLW 3QDMB 4N0CC 3NCYS 4XMLL 1UM4H 1K4DB 4RBPH 2CGRH 3F5WA 5C0FA 4JFDB 1KPUB 1CT8B 5FK9B 3X2QB 4M48L 1ZT1B 2JJVA 2CIKB 2HZHA 1LD9A 2AQRA 1ORQA 3RL1B 3RWJB 4KKBD 2A6KA 2CBMA 4TULH 4ZW6A 5IM7B 3UP6A 1WEJH 1T2JA 3IKKA 4YX2H 4MXWH 4ZMYA 4AQAB 5J1SC 1J7VR 3S35L 4A2LA 4OCWH 3T04D 4ENED 3KLLA 2DV6A 6FABL 4KQ0A 4XPGH 3VFOA 4ISVB 1UFUA 3V7MA 3AREC 1INEH 4GG6A 4BUGA 5C71A 4OM0H 4K3EH 5GGSY 2NY3B 3N2JA 2MFNA 5LDSA 4RGOL 3PXJA 3VI3A 4NQVA 1JDAA 2Y1YA 1FGNH 3B3BA 4WTZG 4C55A 1JYWA 2Z91A 3VQLA 1EZLA 4JE4B 1J1XH 2PYFA 4FFWD 2F6AA 3HHMA 4F7PB 5IZ7A 1TZOA 2MQ3A 4TUJB 3FHAA 3GMOB 1ZVSA 1DQLL 1SGKA 1MPAL 5D1QC 2MWCA 1R5VB 2XHNA 3NRFA 3I9GL 4DWHA 5I30L 3VW3L 3O9WB 2AABL 1PX3A 1CXHA 3EH5B 1TUPA 4HKBB 3TVMD 2IMNA 5FO7A 4LHUB 4OZGB 1Q9OA 4F27A 5A7BA 5LBSL 4Y5VC 5EWIH 4FHKA 1IKOP 3GTTA 3SPHA 3O4LA 5DMKA 3TJPA 1ZLUK 1U33A 3GIZL 5CEXB 1T89C 2YC1B 1TZGL 4GFTB 5D7IE 2FO4B 4JM4L 3ISRA 2AJ3A 2AJXL 2QVIA 3OC8A 5KYUB 2HVJB 3UBXA 1WWAX 2Z1PA 2DWDB 4IGBB 4HHWA 2JB5L 2DQCH 2VDQL 5IOPA 1EVTC 3SKUD 1V3MA 2R9HD 4N5ED 4Z7WA 4CMHB 1YC7A 2QL1A 4XZUA 1JVKA 4JFOA 1N4XL 1T0MB 5K1VA 3KAAA 2R23A 3UTTA 3LS5H 4L3FA 3Q3GA 1SLVA 3BRGC 2E59A 3CBRA 2PW2A 3DBSA 3D85A 3NCEB 3ZTNL 3NCJL 4L37A 4QNPF 1G6RA 1J0YA 1DJZA 3TTSA 1FL5A 5HPOA 4QGTA 1E5ZA 2IOIA 4NZDA 3NCXA 4XXCA 3HG1E 4N1HB 4U2ZA 3H9SD 2ZNXA 1Z32X 1HHIA 1N0XL 2GSMB 3CJJA 2YQ2A 4JGMA 2HKHL 3ZT7A 4UV4H 1G9MC 5IHUL 2ICWI 4AEIL 1D5BB 4M1DL 3ARQA 3MCKA 1SM3H 4PR5B 4U1NA 1FI8C 3RUGF 1YNTF 1T21A 3T2PA 1ETB1 1AD9A 3GDBA 4LPYA 5KVEL 5A2KH 3OZLA 3BP7A 5KEZA 2N01B 3V0JA 1VPOL 1UZGA 1FNFA 3HFFA 4K3GA 5AAMC 1MCEA 3RTQB 3CZUB 2MCPL 1VA9A 3BZDA 1K9TA 3F04A 3LKRB 1G5GA 4OSUH 3JTTB 5KBLA 1EFXA 3IU3A 5DJZA 2MCG1 4AH2A 3KPMA 1BZOA 1FP5A 3KLDA 2OSLB 4HXAH 4Y2DB 3CH1B 4ZX5A 4J8RA 3LZFL 1QRNB 1PY9A 2E7BA 1J5OL 1JV5A 2ZCHL 3V52L 2JJSC 5LBVA 6TAAA 2R1XB 4P2AA 2OTWB 2QQLH 3R8QA 1E2VA 1XCTA 4MBRA 5D93C 1YYCA 4F8QA 3CXDH 5I9QC 1CDBA 4KDTC 4Y5XB 1GOGA 4M3KB 3H3BC 4I77L 3U9UA 3P9MB 2BNQA 3E80A 4J3BA 1C5CH 3HLAA 4MS8D 4TUOB 1DJHA 1BX2A 4BFJA 3LPGA 3MLRL 5DZPA 1A7QH 4FQ2H 4P5MA 1XGRB 5FYJE 3CU1A 4BQBA 1J8HB 2R0WL 3CN2A 3QWRA 3O8XA 4Y16B 4Y89A 3RYMA 3D0LA 2YN5A 1VIWA 4H8PA 1NCCH 1YJDL 1TLMA 2HMIC 3K72A 3HUJE 3L5XH 2WVUA 5A16A 4ONOA 2ARJQ 3DOHA 2OBGA 2ZTBA 1SOKA 5GJTL 1YPZE 1LDPL 2VKXA 3MJ7B 1IO4C 4M6OL 1T04B 4WFEE 3L9RA 2R0ZL 1OTUD 1B4RA 2X89A 3UMTA 1DVSA 3CN0A 4HUCA 2H3XC 3DV6A 4TQHA 3TP4A 2GJZA 4LASL 1C5DA 2H2PD 3DUSB 3S96A 5CF3A 5HYJA 3QCTL 3CNKA 1QUPA 1URZA 1BPLB 5IMKA 3R7QA 4TNVF 5FM5O 2TSAA 4ICXA 1ZV9A 4QXTB 5FYKH 1A2YA 4NP9A 2KPWA 5IROC 4WI6A 5DT1H 3A6CH 1KJMB 1QUNB 3HC4L 1YMMA 4XO8A 4PJDB 3RURA 1BBDL 2AV1B 2COVD 1WBYA 2HLFD 3QG7H 1T83C 1MCKA 1SN2A 4N68A 4V1DD 4BUHA 2R69L 1EXUA 3A5VA 4JZJC 4PJHB 2N4IA 3RDTA 4FQXD 1TJGL 5GHWH 1CF1A 4MTMA 4FZ8H 2VLMD 3BP5B 4GIOA 5HYIA 1X5HA 1FNSL 3T0VA 2KLSA 1JZ3A 1KEGH 4LSPL 1L0QA 2VRAA 1SDDA 1N64H 5LBGA 1BQHG 5HBBA 1KCSH 3ZL1A 2UZXA 3NSDA 4LL4A 1TR7A 1IM3D 4KGJA 1KB9J 4LLYB 5CZKA 4WW1A 3GYRA 3EGSA 2WXGA 4HJIA 3SY6A 4U1KA 3QNZB 3TZVC 1CXKA 4HUUB 4K8RH 1F1GA 3OX8B 2C8NA 1TLKA 4F9PA 3LKPB 2VL5A 4AYSA 3G5XA 5K9QG 4NQSA 4QXGH 2NQDA 1MCSA 2BFGA 1RMFH 4JO8A 4OIIH 5T5NF 2IXQA 1N70A 5I1EH 3D39E 4JHZA 4N25A 4WFHE 2VW7A 1A3LH 1MI5D 2OI9C 4LU5L 4KXBA 1YMHB 3W11D 1T22A 1P7HL 1RUMH 3H0TA 3FXIC 4U7KA 1BD2A 1B0RB 2NY2B 2R2CA 5DJ6A 3WLWC 2O5NA 3J07A 3UOAB 5EC2B 3LKOA 2DI8A 2E4TA 3L3HA 1Q72H 4FTVB 2A9AA 1BFOB 1DVFA 4GJTB 2ZAIA 2I5YL 3MRLA 3VI4E 5J3HD 5JQ6H 3MCG1 4UOQA 2NY4B 5ALBL 4ANWA 2IWKA 2Y1AA 2QVMA 5C0RH 5ISZA 1IEBB 4LO9A 4L4TE 2VOTA 1AJ7L 3WL9A 5C0DA 4IBLT 1OPGH 1QWUA 1IKNA 2UVFA 2RFXA 4HWZA 3BUPA 5H35B 3JTSA 3IWUA 4ZXBD 4GKOA 3CAFA 4HKXA 2W60B 4L3EE 5SWSA 3LZPA 2K6WA 2DJSA 1T1ZA 5TDOA 4BV1A 3FTGB 5GGUB 3V5DB 1PG7L 2VDLB 2BFVL 4ZDHB 5ITFB 1RIHL 4KJYA 4WJ5B 5E2TL 5AYUL 3KJ4B 3RA7L 4L1SA 4E41D 4PLNC 1CN4A 3CSYB 5E99L 3OPZH 5C9KA 1M3IA 1XB8A 3ZZ1A 1AXSB 2HWZH 1EK3A 3OG6B 4OUOA 3D3VE 2DQFA 1PNCA 2H5UA 4MD5A 3S0PA 3EOAB 2DQDL 4ZODA 3SZ6A 2XPGA 4PB0H 2A9MH 2Z0BA 3IMVA 4PJDF 2QFRA 3QXWA 4K5PA 1JNNH 2DF3A 4W6XB 3VFNB 2PW1B 5F3HA 2JXMB 3TTYA 1DQIA 3T9WA 5BV7L 4JPIA 1D3CA 3IMBA 2ZT9C 4LCIL 4IM8A 4PGBB 4EBQL 2AEOA 3DIDA 4LBEA 3ZE0B 5DRWA 1CPUA 3ZO9A 1B6UA 5EO0B 2B1OA 1JWUB 2MTPA 3L13A 4DUVA 1MFEL 2TAAA 3O0RH 1WGOA 2AK4D 2ICEB 3O41B 1BVKB 4GW1B 5IK3A 3VH8B 4IRJC 4N2EA 1CL7I 2WVTA 3NFSL 3D0AA 2W92A 4ZAKD 3IXTB 5ADOH 2BNRE 4QXWA 5ADPL 3DTXB 5DD5L 2QVKA 4FEIA 2YRPA 4IOFC 3G5YA 4PJIE 5C0JA 1QSEB 5BW7A 5T3XD 2NZ9D 2RQ8A 2HJLB 2ZP0T 4HETA 4HG4J 1F3JB 1RUQH 5LWYL 4XNQA 3EW3B 2OJEA 4KRLB 2VXUH 3W0WE 2KLRA 1V3JA 4XHJC 1IGFL 2GQHA 5DSCB 1QHPA 2E8ZA 3U4KA 6PAZA 2DD8L 1C16B 3ABZA 1H3PH 1F6LL 2BVYA 4LZKA 4P57A 4YHIB 1JE6A 5E9DE 3GMLB 2ZQKA 1BGXL 3GK8L 5AVRB 5IQLA 1SVBA 5KW9L 2GG1A 3H3KA 4HA1A 4LLWB 3WD5L 5D2LE 4C4KT 2E9BA 4IBVA 1N5AA 4EXPX 2W9DH 1GJUA 2JQAA 1T7YA 4LCCA 1PZ5B 4AEFA 5K9KA 1SHMA 3FOMA 4Z7UF 2QHLA 1GOHA 1ZHKA 2QQQA 1P7QB 5EC1A 2VXSH 5E2UH 2IGTA 4YFDB 2VDPH 3M1OA 3BKML 2AZUA 4M8QB 1I4FB 2AXWA 1KJ2B 3HE6D 1ACYL 3M46A 4F7TA 5T5FA 1MG2C 1B0IA 3L3GA 2RD0A 1Z9PA 3UMNA 4BGDA 3WDJA 4H25A 5BQDA 2OMXB 4HKJA 3AJ7A 2OXHB 3D25B 3ZE1B 4XCEA 3PGCA 1SHSA 2V2TA 4NN5B 5JHBA 1BWWA 4R4BA 1TJXA 1YN6A 4P2QA 4PJAA 1G0YR 4LSTH 3MRDA 3TBVA 2Q10A 2WKLA 3LHPH 1GSMA 1QYGL 1RUKL 5CD3B 3RGBA 1DQML 4YDIL 3S4SB 3KPRE 3GBNH 3H55A 1KBVA 2OMZA 1WITA 2B1HL 2DLFH 2ZWZA 3B2UC 3GSNL 5H37G 4DOHB 4XPFL 3CPLA 3LKQA 3WFCH 5HDQL 5JLZA 1PY0A 5IWLC 4R3SA 1MCIA 5TH2B 3K6OA 4XX5A 1DJIA 1GZHA 1QSFB 2PO6C 3NMEA 4OCXH 4M29A 3SJVB 3TYFB 4ZBJA 4AENB 4OY9A 5A40E 3RB5A 4PB9L 3WFEL 1BIIA 1B9KA 1WG3A 3X3GL 4UT6L 2DI7A 2D73A 1SJHB 5C0BD 3ZE0F 5I1LB 3QW9A 4F2MA 1JZFA 4YHZL 4RZKA 3GZQA 3MRKA 1IAMA 4MQ7B 3FQRA 4PJGB 1W72L 4Y1AA 4P2RD 3V5HA 4AQ1C 3ULVE 3HZMA 3OHXC 5IFHH 2VAJA 2JSFA 4UINH 4ESKA 2I69A 4QRQA 2FJUB 4M1CD 1CLVA 1P4LB 4ONHA 2KYIA 1QRKA 2FH6A 2LLLA 2ZF9A 3GHBL 4EF3A 4Q89A 2COQA 1EBAA 5D2NB 3MYJB 5TFSL 3TV3L 1UZ8B 5G4OA 4JFFB 2ALAA 4U6VH 4YQXL 4U1HA 2BIQA 4LLQB 1W80A 4PJXE 5C0IA 3LCYA 1GS6X 4WZ9A 1MLBA 2JTDA 3IM1A 1E6OH 2J21A 4YPGA 1A9EB 3MV7D 3WNIA 4HJEA 4NCC1 4LMQI 4BDVA 3Q44A 2OR7A 1Q8MA 4R4FL 5AW4B 5I1AA 2D7OA 4Y9BA 3ZYZA 2Z35B 4NWUL 5HVHC 5EZIH 3VFRB 3D08A 2AVGA 4PWIA 5F7LB 4AQZA 4Z7QF 4JFVA 4MA1C 4O2EB 4QOKA 5GXBB 3ARBB 3EJTA 4JREC 3RIFK 5E4AA 3NGBB 5FPIA 5I0ZA 1KGCE 3VQ2C 3BQUA 3BLKA 4RAVB 4HD9A 3VXRD 3VQ1C 5E2VL 3VWJC 4MMYA 3HPJA 4ODSL 4Y4FC 1CFNA 4NKDA 2LAAA 1G9NL 3S7GA 5CO1A 3WV0A 3FU5A 1E9PA 3SPCA 3LB6D 1ML0A 3PS6A 2WZ0A 2DMBA 3TA3C 4OGQC 4LSQH 4CN4A 5I8EA 5JHDD 3GM0A 2A77L 3IAQA 1THCA 1UVQB 3C9NB 2WUBL 4U3HA 5AW3B 1WC7A 4ANUA 1T0NA 1RP8A 2UXVA 4PS4L 4EXKA 4LVEA 4R0LC 4YN3A 3LQMA 3UBXI 4WI0A 4MJID 4F33A 2ROYA 4X5XA 5I19H 5LN8A 5K39A 3O2VL 3F5WB 4U1LA 5DVNA 3ZN6A 5C0FB 4X0NA 4C56A 1LLAA 3IJSA 4BHUA 3BKCH 1RZ8A 3QUMA 3U1SL 3WENA 1KXVA 1LD9B 2PP8A 1ORQB 3WIIH 3BPLB 2O5YH 2A6KB 1BZQK 2R7EA 1YDPA 2OR9L 4JG0L 5C6WH 3W5NA 1R17A 2DLIA 3R19A 4LCWE 3FUEA 3II1A 4QRPA 1MVYA 4U3XA 2AKRA 4PJGF 5BUGA 4I0PD 3VFOB 1MDTA 2XWJA 2AF2A 4GG6B 4HWBH 4WCYL 4OBRA 3OAZH 4LIQH 3SZKC 5CLYA 2CGYA 4WEMB 2CALA 4ZOEA 3QEQE 2ZSVA 3QIWC 4NC1E 3VI3B 4NQVB 5J4MA 2B20A 4OJDH 3QR1A 1NEZG 3K5RA 4H8WH 5C09D 3J2PA 2Z91B 3RZCA 4J7RA 2A4EA 3C6LC 3WUZA 2PYFB 1WRFA 3EXJA 4ZNEE 1ZVSB 5GZOD 5ALCL 5FYLH 4BA8A 3VTMA 1SBSL 4M5YH 4P23C 4FQHA 1ET8A 2HB0A 1EHNA 2AXHA 1ED3A 4WU7A 8FABA 5FO7B 1Q9OB 1P4BL 1GY2A 2NX5D 3UYRH 3QIUD 2EDQA 2WYTA 5C7XH 1J0KA 3O4LB 5DMKB 4PJFE 4YZWA 5E7FA 1MRFH 1UGKA 5F6IB 1GYUA 2V7HA 3R4RA 3BIAX 2XY2A 1CBVL 4PMEA 2AJ3B 4NKMA 3KPSE 5KG9A 3CFCH 4FG6C 3G6JF 3UBXB 1TYRA 2NRDA 2CKBA 3KHOA 3I9AA 5E5UB 4P9ML 5IOPB 4WY7H 1NCNA 3IRCA 3T6VA 3OKLA 4Z7WB 5IUCA 3US1A 4XZUB 1Q0EA 2UY6A 2YA1A 4ZPTA 3MKKA 4JFOB 4GMTH 4RAUA 2WY3B 4F5CE 2X4TA 2VLKD 3GXPA 5E03A 4ODUA 3PXHA 1S4IA 1I3GH 3FH7A 1N7MH 2R23B 4OLZH 3U7WH 3UTTB 2VC2L 2GK0A 3FUHA 4TQEH 2IGFL 3Q3GB 2DIEA 3W9DA 4MLSA 1IFHH 2PW2B 2J1XA 3D85B 3VTAA 3G3LA 4L37B 1ZGLA 1G6RB 1CDYA 1HEHC 1PEZA 1FL5B 2XIBA 4GMSH 4TLUA 4YHYC 1CGSL 4KI5F 1GPOH 5BMFH 4H8UA 3GEFA 4HW6A 1HHIB 2WQWA 4NEHB 2J6EH 4OLEA 4LGPB 1KXQE 4HCGA 5AW8B 3SDXA 3RPKA 4MNGE 1HYSD 3MUJA 1Y18A 5T1MA 5HVGB 1QBBA 1IEAA 4Z18A 3MCKB 4JO2L 4U1NB 2DWTA 4ZRGA 1T21B 2CZNA 3CQPA 3TJEL 3KEDA 1JXFA 4QIRA 2WB7A 1AD9B 3D05A 4H13C 2JI2A 2DEXX 1GGCH 2IJ0C 4IK7A 5B1JA 5AWNH 3BP7B 1HH6A 2CPUA 2DEYX 5ICYA 4ORZC 1RVFL 1JDDA 1N0LA 3WAKA 3QYCA 1W8NA 1IBGH 2G60H 2VXQH 1EGJA 3R1GL 1RUPH 3N44B 2F08A 4ZS7L 2A38A 1Y6KR 4YBLB 4XO3A 1G87A 2XVKA 2Q76A 1EFXB 3IU3B 5DJZB 4AH2B 3ECVA 1O7VA 1M3JA 2WYHA 3KPMB 2WIIA 4Y9CA 2YPVA 4J8RB 4KROD 2G0KA 1UH4A 4R83A 4RGMB 4KGLA 1F8TL 4X5PA 2R8SH 1U92A 2NY6D 3CN3A 5FYJL 1AAJA 4E9VA 1A6WH 4G80A 4U4BA 3TVMA 1P69B 4Q8BA 1JV5B 3WEOA 5DQDH 1AANA 3SDDD 1GYAA 4FKEA 4CVWA 1XCTB 3FN3A 4AK2A 3BE1H 1BZ9A 4GAGH 1OAUL 3PL6D 3L5JA 3OBAA 2FIRT 3K3QA 1BQ5A 3U9UB 3SGKA 2BNQB 4WK0B 1IAKA 4G6FD 3HLAB 3OAZK 1X44A 3GO1L 3TEUA 1OGAE 3RRQA 5C07E 1BX2B 4N5UA 1BEXA 2PXYA 4M5TA 2DQUL 4P5MB 4HC1H 4WAFA 3S36H 4PP2A 2WLJA 4DESA 3FO9A 4RX4D 1X7SA 4FXTA 1SY6A 1N12A 2W9LA 3ARUA 3O8XB 5LGHL 3D0LB 3F6JA 4GXFA 1LO2H 4KZCA 1A3RH 1UXWA 3K72B 1NMBL 2LTQB 1H0DA 3QHZH 1JPEA 4AEEA 5A16B 2R39A 1FDLH 2QKIC 2V5YA 1BYOA 5GS0C 1TFPA 5MENA 4R6UA 3C8KA 1KCBA 4B41A 1T2XA 1IZJA 3L9RB 4TTDD 4KK9C 1LGVA 3DV6B 1DANT 3H9SA 4GT0A 2JFCA 2GJZB 5KVDH 3SOTA 1C5DB 3D4ZA 5ITBH 3FT2A 3S96B 5HYJB 1XGPA 5DRXA 4QUOA 3WKNA 5IMKB 2WGXA 3ELQA 3S5LA 1F0LA 3AFLA 5EOTB 5EOQL 2E9IA 1HHGA 3LRMA 2ARWA 1A2YB 2C4FU 3UYOD 1R6VA 1WGVA 1LL1A 1MJUH 3OJDA 1YMMB 4YDLC 3SCMD 2HT4C 4JRXD 4OB5L 1A7BA 1RU9L 3EJZC 3RB7A 1EHXA 1ZD6A 1WBYB 5TQ0L 4J3OF 1NMAH 1EXUB 4BUQA 3IRZA 3LKSA 1WS8A 3GS0A 3RDTB 2D9CA 4OD3H 4FFZH 1BAWA 1UD6A 1F97A 2F2HA 3VSUA 3BT2H 1F1AA 3TH2T 3CFQA 4QF1A 2GC7C 1SDDB 3I2CL 2UZXB 1BECA 3LS4L 1NFIA 2VLLA 4WW1B 2QKSA 3EGSB 3P3RA 4MD4A 3DX7A 4KTDH 5KUMA 4HC1A 4DAGH 4JPVL 5LG6A 1EWHA 1O75A 2VL5B 1WTLA 3G5XB 4NQSB 4K2UL 3CSTA 3IDJA 2ZKHH 2P1YA 1A4AA 3L7EA 4OD1H 5IESH 2IXQB 3T2OA 5KJ7E 5CMAA 4NHUA 3TBYA 1T22B 3AGWA 3H0TB 1SJMA 1BD2B 3UCRA 3H4HA 1J1PL 5J5EA 3FSVA 3N3EA 4XMKL 1LP9A 5B38A 3QXTA 3ECQA 2QGEA 4X50A 3LKOB 3ZRCC 3L3HB 1A1OA 1OB1A 4OLUL 2XQYG 2KKQA 3H7BA 4X6EA 3L48A 4LVNC 4YSTA 5AW0B 4YHOL 3MRLB 2QADC 3SOBH 1QATA 3ALXA 3B8SA 1KN2L 5EO1A 3CZFA 5ISZB 2ATPA 2NXYD 3V9FA 3WL9B 5C0DB 5L4MA 2GW5A 3P02A 4LF3A 1XSOA 2RFXB 5I15L 5FF6A 4Z3IA 1G7PA 3JTSB 4GO8A 1UWGH 2EE0A 1X4XA 4N2DA 1NIBA 4HKXB 3BVNB 4N86A 5FGSA 1DZBA 4FFZA 3Q05A 5SWSB 1A8ZA 4A7VA 4AGMA 3ZMRA 1T1ZB 5TDOB 1NUFA 5EUOA 3SGEI 2B5IB 2GI0A 4KJYB 4ZYKA 4KOBA 1B0GA 1ET5A 4WK2B 4AJVA 5FGCB 1B2WL 4I3SL 1TITA 3L4UA 2FX9L 2ZUYA 2X4QA 5F1NA 2G3MA 4AGQA 4KMTH 4NRYA 1IGCL 2P28B 3NDZE 3PLYA 4OM1L 1UATA 1YNLH 1OSPL 1ZV2A 3P3UA 2NXZB 4OVUA 5HGDA 5K33A 3T71A 2DQFB 2H3KA 3L08A 4HMCA 4MD5B 1QR4A 1TCRA 3EZJB 2AJYL 5DHMC 2XPGB 3CZGA 5EEZA 1EAPA 1YEEL 3QHFH 4I5BA 1PKOA 1LK2A 4F37K 2VO5A 4G7QB 3D52A 2RH0A 1BXVA 1D7CA 5F3HB 1HFUA 2BSCA 1KGYE 5GGTL 2IH1A 1G4RA 1KBGH 1S7SA 4JPIB 4B9JA 3OWRA 2Y7SA 3T8XA 3WGUB 5F89A 4LBEB 1EVUA 3BW9B 5DRWB 4DP0X 4E5XA 1OAXL 4M8VA 2C9SA 5J6HA 4PIBA 2YMOA 3OWEA 1V10A 5IK3B 2F19L 3B9KA 5CINH 2BIOA 1MCRA 3VXOA 1XGUA 3G5YB 3FTZA 1MI5A 3WY2A 1J0JA 5C0JB 1QMUA 2ZXBA 2F5BH 3RVXC 4YHKH 1CLZH 3I6SA 4TQ8A 4XNQB 2OJEB 1J87A 4K9JA 4MMZC 4H2CA 1QLEL 2P5WD 4EDWH 1CVRA 3W39A 4P57B 4PJ9A 1QSVA 1TDQA 3S37X 1WUZA 4TLTA 1WFUA 3FB6A 3MREA 4XAWH 2QGCA 3EBIA 1AH1A 4X6BA 1N5AB 5T3XH 1MFDL 1JHKH 4KJWC 4LCCB 4HLZG 5K9KB 3S6CA 3ZHLA 4JO3L 3BUTA 1ZHKB 1CBJA 3C08H 5EC1B 4CILA 1NLDH 3C09C 4N3UA 3NEXA 3BGFC 3JV5A 3T3PB 2RCSH 3VYNA 1A4BA 3F12A 3MV8E 4K8RC 1J9CT 1ZA6A 2VMDA 1QOKA 3HN3A 4F7TB 2NW2A 1FZMA 3VA6A 3VNYA 1AZZC 4H25B 4MMXC 5FFOA 4A55A 4HKJB 3PV7A 3D9AL 1H15A 2J57A 3DIFA 4G9FD 1T0PB 3H42L 4XCEB 2E27L 8PAZA 3PGCB 3QQ3A 2V9RA 4E41A 2V2TB 2DI9A 1II4E 4R4BB 1WSST 1YN6B 4PJAB 2Z6FA 4P2QB 4PLKC 3TBVB 3MRDB 4XN8A 3KL0A 5FKPA 5GS1C 4KHXH 5HVWA 4AQEA 1AR2A 3D09A 2OMZB 1HNYA 3L4YA 4NENA 2HX9A 3A4AA 1UCBH 2VDOB 1OHZA 3CFBA 3CPLB 2H4EA 3LKQB 1OAQH 2WSDA 2M2DA 5JLZB 2A9CA 1ITBB 3ULVL 3QCVH 4R3SB 3KPOA 5ELIA 1ZLVK 2Z0UA 3ETTA 2GSGA 5C6PB 1JF1A 1GYWA 2IAMD 2EUVA 3BSGA 3SBWA 4G8GE 1ZJBA 1BIIB 1FORL 1S8DA 2JQMA 1C5BL 2AK4A 4GSXA 3T5WA 3TO4D 2OL3H 4F2MB 2C9QA 1J0ZA 2PMZA 3MRKB 4N6QA 3FQRB 4Y1AB 4HCRA 5KSAD 1ZTXH 3V5HB 5JUEH 5D96B 3N6YA 3HZMB 4YWGH 2YQ3A 3AQYA 1THAA 2X6AA 5I0DA 1JCVA 4L4VE 4QRQB 2F18A 3QIBD 4BHUI 4YHLL 1A02N 2OMUA 4FQ1H 4N8CH 2PYED 4ONHB 3OB0H 4YZFF 1QABA 1M71A 2VMEA 3FUFA 3BZ5A 1UEMA 4DVRH 1DLHA 1CU4L 3T2QA 4ZFGL 1CYWA 1Z5LA 4U1HB 2X6CA 4PM1A 5C0IB 3VXSD 1MLBB 1MXGA 2X9XA 3P3YA 3CHPA 4YPGB 4K23L 4RWYL 3OQ3B 2AI0H 4HT1H 1ZVNA 1H6FA 1GCFA 4BDVB 3AQXA 1UM5H 2OXGA 2W0FA 5LG1A 5I1AB 3OV6A 3BRDA 2XZCH 3UL4A 2AQQA 2YZ8A 4QTFA 4R2GB 5FUZH 2H8PA 1JL8A 4QOKB 2F54A 4LEXL 5DJXA 4NUPA 1K72A 3WHXA 5C2UB 3AU0A 3CK0H 4QT5A 5DS1A 4X7SH 5J8OA 4IKIA 2YMXH 2BW5A 4B60A 3BQUB 4PV1C 5DC2A 3MODH 3QZMA 1YN7A 1PSKH 4JUTA 3OGCA 4L0PB 1IAIM 3T3PF 5BXFA 3QPXH 4MMYB 3HPJB 5AB0A 3IS1X 1CFNB 2Y7MA 4NKDB 3EXLA 3UAEA 5FYKE 4KVNL 1E9PB 4QHNA 3RPIA 2F58H 3OJMB 3A4DA 1HS6A 5I8EB 4EN3D 4L9LA 3SE9L 5AG9A 3IE4A 4JJHA 1N6QH 4DPBX 4BRVA 3AXIA 2EIMB 5M95B 1WC7B 1J0HA 2H2SC 1T0NB 3DVFA 3QFJA 5PCYA 4W9DC 2IANA 4PLJC 1E4XI 4Z77A 3BISA 3VWKC 3V6OA 4WI0B 5DMGD 2CM5A 5EMYA 1S5IL 3JT2A 4F33B 2YPKA 4X5XB 3IDIA 5K39B 3OM3B 5F7WC 2OMVA 4U1LB 3WFBL 3UC0L 3RDJA 1ROCA 4C56B 4RCAA 4AZ8A 3H7LA 1H8NA 1RZ8B 3BSZL 3AMKA 4MA7L 5L4JA 2AHIA 5IJBC 1FNLA 2D9QB 4YHNA 4RFNC 2IMMA 4M43L 1FF5A 3QQXA 4FL4B 5E2JA 5HI5C 3CLFL 4AM0Q 5CD5D 5TPWH 2ADGA 1BZ7A 2R7EB 1YDPB 3GTNA 1PL3A 3N04A 3AABA 4MAYA 3ATEA 2MIZA 3ECBA 3CIQA 1M7IA 4XMPH 4QRPB 3VXQA 3QCUH 4XP5L 4FD0A 4NWTL 2AKRB 1VRSA 5F7YC 1DBAL 3HFMH 4TNEA 5BRZE 3WS6C 5IVNA 2XWJB 2A1WL 1FO0L 3FFOA 1LMKA 5F0PB 2QTVA 2XCMC 3A4FA 2ZSVB 1O9ZA 3GRGA 4JPSA 4B9YA 2C3VA 1KB5A 1ZS2A 3MZGB 2Y25A 3NACH 2WBXA 4OZHA 4F58L 2G2RA 4RMQA 4ZUWA 1D6EA 5AVQB 4UM9D 3RZCB 3IDUA 1F3DJ 2JKSA 4DGIL 3QFGA 3MV7A 2JWYA 5DRNA 2WLLA 5IW1A 1PJWA 1JZGA 2QBWA 4P8QA 4XPAH 4BCZA 1I1CA 1W6WA 3GLEA 4FQHB 4I18C 4LVOB 1XGZA 5A6MA 1JVOA 4DP2X 4KNSA 3RIAK 1ED3B 3AU1A 4WU7B 8FABB 4O02H 4JO4L 5B1BB 1LEGA 2DBLH 1J9SA 1L7IL 3PDDA 2ZJSL 3B7RL 2NY7H 5FUOH 5IB5A 2C7FA 4RDQF 5HDOA 3VXRA 2DDQL 2V7HB 4FHJA 1TTRA 1NCAH 4X8JA 3LHAA 3TO2A 1U95A 3ZKXC 2FEJA 5L6YH 1ZLSL 3RGVC 4NKMB 3E6HA 3ARDC 4PQXA 5KG9B 4Y19D 5JR1L 2CKBB 4KTEH 4Y5YC 5JPNC 3ZOAA 5HDBE 2BOLA 3OKLB 1Z2KA 4XWGH 2KLTA 4UTAH 2I9TA 2UY6B 2Y5TA 4ZPTB 1PZ2A 3BAXA 4RAUB 4LAQH 2X4TB 3MUY1 2WCGA 2F8XC 2BZCA 2I26N 4ODUB 2VDNH 3DOIA 5E2WH 1Z3GL 3QQ4A 2GK0B 5LO7A 1YEHL 4MJIA 3W9DB 5EA0H 4N22A 3WDIA 3F7YA 1ZGLB 1UQSA 1RLBA 3BPOC 3IETA 2QQKH 1GKEA 4NZRH 4W9HC 4DGYH 4YH6A 4HOXA 4YXHL 4DW2L 4O9HL 3AACA 3O6KL 5KVGH 1GYCA 5AVVB 2NR6C 3NG5A 1EEZA 5B3NA 1A7RL 5F9WB 2IPUG 4LRNH 5FUCC 2HRPL 1ORSA 2CDGA 4IDJH 4AV0A 3SDXB 4WHCA 4W9GC 3S2CA 1Y18B 5T1MB 1YQ2A 1IEAB 3PXLA 3TNMA 1LO0H 2VABA 4L8BA 5LCVL 4CADA 1PVHA 3UTPD 4HOZA 4BZYA 5JIMA 1PG7W 3GSOA 2F74A 4JFQA 2YPLD 3IPBA 4G6ML 1SLWA 2GEQA 1CFQA 1HH6B 4HUXA 1I9JL 5ICYB 5AZEL 3K2UL 4O02A 5JIIA 1DSFH 1DQTA 2DMKA 2CJUH 4YNYA 4OGZA 1N0LB 5F1SA 2BHYA 4JANA 5C09A 1C8PA 4APQD 1AZRA 4G8FA 4ZMPA 1OTSD 1OLZA 3EYOA 2VZVA 3OMIB 2OAAA 2Q76B 3FS9A 1MWAH 1OP3H 1JP5A 3BKYL 3UAAA 4KK8C 3MJ9A 4K7PX 2WIIB 2ZWNA 3DVGA 3STLA 3E0GA 1WO2A 1U92B 1HC1A 3BDYL 4NJ9H 4E9TA 4G80B 3TVMB 4LFHD 1JGVL 2K9UA 3A0OA 4GKNA 4OGYH 2NX5A 4UB0H 1QI4A 3QIUA 5GZNA 2F8IA 5IHZA 3VB9A 4FJYA 1BZ9B 4J5VA 2P3YA 1VESA 1YEKL 2EEAA 4WTZA 2ZONA 5FAAA 3ZU8A 2CPCA 1QPPA 3O6FC 4G83A 1CGUA 4FYSA 3NA9H 5LXGH 4LSDA 3RVWD 3MFFA 2PXYB 2BRRH 4NZUL 3TURA 4PP2B 3KYMA 1KBKA 2VAAA 3FO9B 1E28A 1QFWM 2QELA 3GI8L 4RRPM 3SDCD 3UTSD 2XVLA 3WKPA 4JFEA 5HHVL 2JKIS 4JKPH 5JHAA 3EYUH 1H0DB 3D48R 4H8WC 2R51A 2L3BA 1MF2L 35C8L 1E27A 4NSKA 1F4WL 3B2XA 4P48A 4TPRH 5CJBA 5HYQA 5MENB 3C87A 3C8KB 2XKUA 1CD8A 3FL7A 4DUWA 3NJIA 5C0CA 1NSNH 1KYFA 5FIEA 4GXVH 3IAPA 3VXMD 3V4UL 5I1GL 4MQTB 5E4EB 3H9SB 4WEBL 3MCYA 4YSRA 2MEJB 1NICA 1KNOA 3W2DH 4AL8H 3NJXA 3FT2B 4TL5A 5DMYA 4FA7B 3WFDH 1IBHA 1XGPB 4LRIC 5DRXB 3LIZL 4ZO8A 4OJFL 3RVTC 1KC5L 4ZMZA 4Q9CA 1HHGB 4I9WE 2O30A 4NPYA 4FFWC 1MCQA 3BZ4A 3OJDB 3SDXF 3EYVA 4CN1A 4BM7A 4LSRL 3DX1A 3LKSB 1R1CA 4G6AD 1U21A 5TTRA 1A64A 3BD3A 1WAAF 4PJ8C 4UQ2A 4MQXD 4QF1B 5D1ZI 5T5NG 5GRUL 4G7VH 4ONFL 3KPPA 3QJUB 2C3XA 1NQBA 4RESB 2HH0H 2Z7WA 3S98A 4OV6F 1OD9A 4N9GA 1JFQL 1NFIB 4HS8L 1MW1A 2VLLB 1UT9A 2EXWD 5KBKA 1TMCB 3S5ZA 5I1IH 2FWUA 4MD4B 3DX7B 4OQ1A 3TFBA 2Z92A 4MGXA 4HULB 3QZBA 1BFSA 1JYVA 2E7CA 3IFOA 2R9HC 4N5EC 2PETA 5FUCE 2A9DA 3DO3A 3L7EB 3SDDA 4ZFQA 4CDHA 1I1FA 2JELL 4K7FA 4W6YB 1MJJA 3RVUD 5AAWA 2OULB 1PF3A 4NHUB 5CMAB 3TBYB 1RHHA 2YLKA 2WLKA 4JHVA 1UT2A 1TU2A 2BDNH 2KT6A 1KCRH 3N40P 1UWEH 3QG6A 4HH9A 3UZEC 4MA8H 3WE1A 1LP9B 5B38B 4RX4A 1VAHA 2XN9D 5I6NA 1A1OB 1OB1B 1TJIH 2JKJA 4OUUA 3CVIL 5JW4Q 3H7BB 3IJEA 4X6EB 1HH9A 4XGZA 3ZRSA 3F00A 3JWNE 3HCVA 4JDZA 5TQ2L 4FZEL 4AYFA 5HI4C 3QDME 1J9QA 1KWKA 3TN0C 1IGJA 3T3ME 5EO1B 3CZFB 4E68A 1WEJL 1N68A 3VFGH 3X12A 4HHGA 2R4SL 4FQJL 2ATPB 1XZ0A 4X7TA 5J1TC 3DSFL 1TNMA 2WWOA 3NK4A 4UIMA 2E46A 4LF3B 3GZPA 3ZHNA 3ML8A 5FF6B 1EDQA 4OCLC 4D94A 4PY8J 3QQ9D 1RJCA 2KZWA 1NC2A 3EJRA 5AZ2H 4X2UA 1OTTC 4K3EL 2DICA 3NCBB 4M6NL 4RSYA 1R3JA 4EZMA 3BYYA 3CU7A 5EUOB 2HKFH 3HBQA 1FGNL 3K6DA 4ZYKB 1B0GB 3DX8A 1I1AA 4ANKA 2N1KA 4YK4C 3V8OA 5GS0L 2X4QB 5F1NB 2G4EA 4NRYB 3BWSA 4D0BA 4N20A 2NOYA 5GRZA 3SCMA 1DQDH 5D55A 5HGDB 5JPMC 3JZ7A 2C9XA 2EC9U 2KZ1B 3SKJH 3ILDA 1TCRB 2NUPA 3RKDC 3DX4A 2WXFA 1EAPB