2ADYA

Structural basis of dna recognition by p53 tetramers (complex iv)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
197
structure length
197
Chain Sequence
SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis/dna
molecule keywords 5'-D(*CP*GP*GP*AP*CP*AP*TP*GP*TP*CP*CP*G)-3'
publication title Structural Basis of DNA Recognition by p53 Tetramers
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2adyA00
2BIOA 4IBQA 2BIPA 3Q05A 1IO4C 3D08A 3VD1A 1H9DA 3Q01A 4LO9A 3WTTA 4GUQA 2WGXA 4QO1B 3D07A 4MZIA 2P52A 3WTUA 4MZRA 3WTVA 3VD2A 3D09A 3Q06A 2J20A 5G4MA 4IJTA 5LAPA 1GZHC 2X0UA 3QYNA 5A7BA 2MEJB 4KVPA 4LOFA 1E50A 2IOIA 5ECGA 5AOKA 1LJMA 2FEJA 1YCSA 1TUPA 2H1LM 5AOMA 2J1YA 3ZMEA 2AC0A 2J1ZA 1EANA 5AOIA 2J6WA 4GUOA 3VD0A 3KZ8A 4IBVA 4IBZA 2GEQA 3D0AA 4LOEA 1EAOA 5KBDA 1CO1A 4AGOA 3IGKA 1HJBC 2J1XA 4G82A 3WTSA 5AOLA 2AHIA 2XWRA 5G4OA 2X0WA 5BUAA 1TSRA 3D05A 2ATAA 2BIMA 4AGQA 4HJEA 5ABAA 3WTWA 3KMDA 1GZHA 4L18A 3IGLA 4AGMA 3US1A 1CMOA 2VUKA 2OCJA 3WU1A 2PCXA 3QYMA 1T4WA 2ADYA 3EXLA 2IOOA 3WTXA 4IBSA 4L0ZA 3EXJA 4IBTA 2BIQA 3D06A 4IBUA 2IOMA 2BINA 3US0A 2XWCA 4L0YA 4XR8C 1EAQA 2J1WA 4A63A 1HU8A 5AB9A 2YBGA 5LGYA 2RMNA 5AOJA 1KZYA 4AGLA 3WTYA 1HJCA 1UOLA 4G83A 5G4NA 4AGNA 4IBYA 3TS8A 2X0VA 2J21A 4AGPA 4IBWA
chains in the Genus database with same CATH superfamily
5D71H 3UTPE 3QHTC 4A7QA 4RZCB 3QNYB 1U42A 3SYQA 4DN4L 1VFAB 2JIXA 5LHDA 3IE9A 3P0YL 3BUTA 4Y9BA 2YXMA 1X4XA 2NY0C 3MO1A 3HI5H 4TSBH 5I23A 3NESA 4KI5F 4PJGB 5SWSD 4F8LA 4G6KH 4YQXL 1WJ3A 5DSCB 4MNGE 3BO8A 4A1RA 3ULVC 3DUUB 1AGEA 5LGHH 4G7YH 5A6LA 1UA3A 1JUFB 2VN5A 1MFCL 2QTVA 4IGBC 3T8XA 2R0ZL 3UTTB 3RZCC 3ZTJH 4R84A 4LPUA 3DVGA 4NUJB 5DURB 1NIDA 3ARGB 3SEPA 4IRZL 3QJHB 4OCLC 2YO3A 3VSUA 3T65A 2F58H 3THML 4ZFFA 4HEMA 1ETZA 2Z1KA 2UUDH 1J7VR 3RVVD 4YMPA 4GLRI 1BSIA 4Q0XL 2YAFA 2VN7A 5D6DA 5A2BA 3EGSA 2WSDA 4OV5A 3O6FC 1BVZA 3QXVA 4OJFH 1M6UA 1MIML 1PNCA 4JY4A 1E28A 3FT2B 1AC6A 2YXWA 4D7BA 1QI5A 4NEHB 2EYSA 3MBXL 1V3MA 4UOJA 5FIEA 3ME0A 2EE6A 4WV1C 1YC7A 4V1DD 2L7QA 1DVZA 1KSRA 1T1WB 1KV7A 2EDQA 5BPPA 4JFUA 2OULB 5FHBH 3AS1A 2XV0A 4XCFL 4MDRA 3QCUL 4YBLB 2D0GA 4XNMA 1ZLSL 4FEIA 2LLNA 1J8RA 2X6VA 4LFHD 5HDLA 3T08A 4ZW3A 2BW5A 5HYJD 4K7PH 4AEHL 4WWKA 3SDYL 2OMWB 3K71A 2ZAHA 1YNLH 5DUBA 2VLME 3UZVB 3OMIB 4NC2B 4XMVA 3O2VL 1YYCA 4R2GB 1YPZB 4M3KB 5JXAH 4JFQB 4MSWA 4GRWH 5MEQB 3ATAA 1WS8A 2VIRB 1TZHB 2YSSA 2XZQH 3O6KH 1S3KL 1PY0A 5D2NE 1DQIA 4QHUB 5EBWA 2AANA 4FFVD 1EHKB 4ZFGH 4FULA 1JHLL 5IQNA 3QUXB 1EJOL 1ZSHA 3TYGH 3GYRA 4LL4A 3VWKD 3LRSB 4E41D 3CUPA 3GJFH 4N26A 4GBXB 4WUKH 4IMLA 2PPEA 1AD9A 3D12B 1XGUA 3H42L 1RK1B 5FKAA 4HS3B 4UB0L 5HJ3A 4ODTL 3H3PL 3RTQB 4CC1A 4NFDA 1URLA 3U7YL 2NXYD 3FU3A 3R4DA 5FS5A 2PPCA 1DHKA 2H6PA 2EDWA 2K6ZA 3M8OH 1O6VA 4JCMA 1SXSA 5F96L 3U1SL 2AQ2A 3ZRFC 4YSDA 4N8UA 4ZFOB 1KJVB 1HI6A 3UTQA 3F84A 5LGKA 4P4KC 4U05A 4WTZA 3KS0H 3Q8BA 4MA1C 5CBEB 2DYPA 4QKXB 3TV3L 2WMPB 3FFOA 4O4YH 5FOBA 5IFHH 1IGTA 1GTNA 3OZKA 5DR5H 4Z0BL 5KS9B 4NKMB 3WENA 1PG7X 1BFOA 4R7NA 3VXRE 2LU7A 3QQ9D 4WNQB 4Z7QE 5ECJE 5F7HA 5FFGA 3OV6A 3KPNA 1KPRA 3AROA 3IXAB 2ICWB 4I88A 1PEZA 3KR3L 1D5ZA 3T3ME 4NP4L 4AKPA 2V8LA 3DMMA 3NFPB 1EFXB 5KYUA 3N04A 3QE5A 5CLTA 3QNZB 4JFDA 2CO4A 5KSBB 1AS7A 3SOBH 3AT8A 4N0CD 4R83A 2DI7A 2IH8A 3GBLA 4LLYB 4MJIE 2QQNH 2VLJB 3CZKA 1SNRA 2H6UA 5E8EB 4M7JL 4XX1G 4ES8A 1GYWA 2E6QA 4FMKA 4P8QA 5CLZA 1GPOL 3FFCB 4NM8H 3VGEA 1YEFL 3L8QA 4AEEA 2L04A 2C8NA 1B9KA 4LZKA 3LZPA 5J1SC 1T1XB 3NK4A 4Y19B 3GK8L 4B60A 3A67H 2J6EL 3BAEH 1I8IA 4WI7A 4XBGA 5EZOL 3F64A 4ZAKD 3WU1A 1A9BA 4OSUL 3APFA 3G6AB 4D8PA 1A6TB 1B9ZA 1LL1A 1FO0A 4QHLB 3HAEA 2WKLA 4LARL 5ES4B 2BCKB 4YHOL 3VWJC 3DX7A 2OP4L 3W9EB 1MCFA 2JKJA 2OV0A 3GXDA 4AYFA 3BRFA 3E80A 1G7JB 4UM9B 2YPLE 4XPAL 2XQBH 3ULUF 5IVXA 4ZI8A 5GS2D 3VRLE 3Q5OA 3C12A 5FAAA 2WQSA 5E9DB 2BSRA 4WFHE 3QDHA 5BMFH 2DLFL 4XPGH 3EYVA 2FX7H 3H9SE 4HK3J 5DC4B 1RKRA 3CXDH 1UFUA 3EHBD 4BZ1H 4E9LA 3SDAC 4N2IA 2BVPB 2G75B 3HUJB 1DBJL 5C0DA 2VQUA 1VF5C 5DYOA 4UQ2A 1DQVA 5GJSH 2NQ3A 3K2KA 1IEBA 3BUYA 1I7UA 3K3QA 4M61A 3VMOA 2PYEA 4X98A 5AKTA 1U41A 1JNJA 3NJVA 1U8IA 2HX7A 4J2XA 1Q0YL 3RNQB 1AHWB 2YN5A 3FUEA 4XVTL 1NDMA 4X83A 4PR5B 5F7NC 1ZWIA 3V7AG 1PKQE 1H0DA 4AJVA 4FFWD 2F53A 1NDGB 3DARA 4YDVB 1QRNB 2JB5L 3TIDB 1UB5A 3EYQC 4ZMZA 1H5BC 1FL5B 2XWTA 3O8XA 4P2RE 4ABUA 3BOVA 3MRBB 3HS8A 3KNBB 1N6QL 1FJ1A 1QFWI 4BYHA 5B3SB 4Y9FA 2BPBA 2A9BA 3TA3D 3DO7A 2DEXX 4N2MA 1T0MA 4JFXB 4X6DB 2F1EA 4R97C 4YL9A 3C6EA 5D1QA 4C4KO 3NJMA 4Q0XH 1QD0A 4MMZA 4XNUH 5D72H 3TO4C 1CF1A 1DQKA 5KW9L 4OIIH 1HHJA 2FWOB 3I6LE 3IDGB 3M6DA 3Q6GH 4GNKB 5HHNA 5IKCB 2CA4A 1JPGA 3BISA 2IGFL 2BSDA 4JM2B 4FQ1H 4G8IB 3G5VA 1HKLL 1KF9B 2R69A 1EQWA 4YDNA 1MCNA 4WO0A 2OCFD 1BYPA 3HG1D 4L5FE 2Y7LA 3BQUC 3TJHC 3RI5K 1G4MA 2CK0L 4K8RC 2C9AA 3NIGE 4WU7A 3MC0A 4KV5E 2J56A 3DETD 1BAGA 1HYSD 1N68A 3MYZA 3D05A 1UURA 2E4TA 3PFQA 4HUNB 3STZB 4Y5VA 4CVXA 1TQWA 4OZ4B 2WN2A 4HD9A 4NO3B 5IJKC 4HX1A 2EZ0C 1NGPH 3BZ4A 2NYYC 1EVUA 3L3HB 4CAGA 2KH2B 4F20A 1T4KB 4FFYH 3GMQB 3L95B 4LLMB 3RL1B 2ZF9A 2BP0B 4X8CA 3W5MA 3OAYH 1MCIA 3OJ2C 1JHKH 1A6UH 2CKNA 3UFIA 3ZE0F 3KVPA 2EE2A 2DQJL 2YXFA 2OMUA 1ONQA 4MCYB 3GUTB 4AYDC 1JIBA 2AEQL 2OS7A 3DDGA 2EYTB 1F0LA 2O5YL 3AREA 1I1AB 1QO3B 2X4QB 2W65B 4KKCC 3H3PH 4KKRA 2XICA 1EHLL 5HGDB 1JNLL 1S7WB 1CQYA 3FUNA 4UTCA 5T1KB 1K9TA 3DJTA 3RPKA 2F2HA 4WFEE 4M56A 2CCWA 4FRWA 2UZXA 3ABGA 5B7EA 2J21A 2NX5B 1QUPA 3CG8A 3LNEA 3WEOA 4C56D 4M6AA 2BP5M 4BDVB 1CICC 2X4TB 5DJ0A 4FTVB 5T8IA 3DBXB 3I75A 4XE0A 2CPUA 3HPLB 1MW2A 1QA9A 5I1EH 4K5NA 4BHUA 2WNGA 5MHSD 1DVFA 5INDA 2HVKB 4XN4A 1PLCA 1J10A 2CO2A 4JZJA 4LVOB 1ECYA 5GGRA 3VUAA 5DVOA 4E42A 4HOWA 4OGQC 3PLYA 2FIKB 2CHXA 4OZIE 1R3IL 2EDKA 1K72A 4PRBA 3H4FA 3BN9D 4JFFE 3QW9A 5BZWB 2X6BA 5I8OH 3CU1A 2QEJA 3TX4A 1A1NB 3KPOB 2GBVA 1JGDA 1QQDB 2XXMB 3S96B 1UWFA 3RY6C 3IU4H 5IHUH 1X9UA 4XBMA 3TC9A 4ZMXA 3VD7A 1HQ4B 5EO9B 3MA7B 1JWUA 4DKAA 2AK4E 4ZMAT 3ELAT 1OK8A 1OQOA 4DZBB 3H9HB 4XXWC 3ZMEA 4MCMA 2ESVD 2VJ0A 1CFTA 4N0RA 1SMAA 4ATTA 1YMMD 4AUJA 1KTDB 1N26A 2NR6D 5T33L 1AGFA 5L2KE 1LP9F 1JYNA 1WQVT 3AXLB 1A0QH 4Y16D 2JCCE 1YEFH 2HFEB 2W60A 5HHMB 1ZHNB 3B9KC 4L5FL 5D1XC 1NL0H 1VA9A 5B1JA 4YX2H 3WY2A 2JKWA 1KB3A 4HUVB 2J6EH 3ASWA 3ZE1E 4DVBA 2X0WA 2V3FA 1FNEA 5CJ5A 3RVXC 3ASOB 3G7TA 3QO1A 4LCCA 5CGYD 3T71A 5BZDA 3H56A 1BW8A 2H3NA 4AK1A 2GBUA 5L6YL 4P4RB 3MV11 2W0FB 1L6ZA 1VEOA 2LGNA 5CO1A 3SYPA 1HOCA 4TNVK 1DLFL 3WIHL 1JXFA 3DO3A 3QUHA 4HLEA 5HYIA 3H53A 1JFQL 2IQAB 3QQ4A 3LJ3A 4A2HA 4S1SL 2I5YH 5C6WH 3QJRB 5FA4A 2DLFH 3MLYH 3WFDH 1E65A 4UOW1 1NC2B 5DJAB 3UP1A 5FK9B 1F58L 5BVPH 2HN7A 3KPSD 4Z18A 2EYRA 1N5YL 4GAGH 3D39D 3A4FA 3BIAX 3ZW3A 5JHAA 4IYKA 4PBDA 3C8KB 3QUMA 3CSFA 4NKOB 2OZ4A 4NKIL 1E5ZA 5J12C 4P59L 3FTWA 1DLHB 2CM5A 3AY4A 4I1PA 3CC5A 1QVOB 5JORB 2AV7B 3MACL 3FCBA 4UQDA 3RL2B 3WLWC 2PMZA 1A4AA 4G8GA 4P3DA 4EZJA 2N1KA 3W0WB 4WENB 5C0AD 2DH2A 4MASA 3UJIL 4Z23A 1MF2H 3SY0A 1XZ0A 3MZGB 2EKJA 2QLVB 3BT0A 3R8BB 4H25B 3VXMD 3SDCB 1XIWD 2IPUG 4EI6B 2V5TA 5E6ID 3V4VL 3ATBA 1XF4A 2RCSH 4PV8A 5LDUA 4UINL 3KXFE 2AI0H 2BHZA 1HOEA 4ZQKA 5C97A 1TU2B 3HNTL 5CJOL 2P4AB 3GHEH 4PP1D 2VDMH 3F04A 1N5AB 5FW6A 2W94A 1KCLA 1X9LA 3EH4B 4S1RL 1JWMA 4KJWC 3RA7L 5C0GB 4L3ED 3EAKA 3LIZA 4GG6B 3ZBMA 4PJ7E 2AF2A 3G6JA 1ZOXA 4CNIA 1M3JA 5BJTB 5LXVA 4U1LB 1AYRA 4RGOL 3ARBD 4NZUL 5LBSH 3N06B 4WUUE 3QNXA 2YK1L 2IPUK 3MLTA 3FTYA 2ED6A 4XO9A 2E8YA 3D50A 1H3UA 4L9LC 4L8DA 1SFDA 2VN3A 3C6SA 1KUMA 4F8OA 2XBDA 1JPST 5IOKA 1MHPH 1UYWL 3SGDH 1Z0MA 1XTMA 4KJYB 2VLRD 3IDIB 2EXYD 4E9TA 3WO4B 3AMLA 1A14H 1RUML 4TUOA 3MCKB 5DLMH 2CGYA 5JA9A 2NY5L 1OTSC 7CGTA 3ISYA 3KEDA 4NSKA 5AW2B 1K4CA 4QNPE 4GAYB 5AOLA 1Q0XH 1MI5A 1ZLUH 4XRCB 2Q8AL 5L7XL 2OA9A 2CZNA 3WTWA 4Y2OB 1YDPA 3L3GB 5L2JB 2W5PA 2FHBA 4KVNH 4L4TE 5FDYA 5EU5A 1I9EA 3T3MB 1FQ9C 4O2EA 3TXAA 2VMDA 4FABH 2FTAA 4GSQA 4JMXA 3FCUB 2GC4C 3P3SA 3OMNB 2ERJC 1F11A 2O5YH 3RILA 2Y36L 1TG8A 4NZFA 4YBQC 3E8UH 1BZ7A 3Q2VA 2WXGA 1S7SB 4MJIB 3F6LA 3GMRA 1JNLH 1AHKA 2VUYA 3SDDC 4IMKA 3EOBB 2Z91B 3MRLB 3OBAA 4XMZA 4IKLA 2ZUUA 1PFCA 3S8WA 1UCTA 5K1JA 1S7TB 4PGCA 3DJ9A 4PTUA 2R2HB 4F9PC 3BVNA 4KHTH 4AGLA 2HSIA 5DK3A 1L9TA 3CFKB 4RQQB 4MQ7B 3MX0B 4PJBA 4BV1A 4YDLB 1HHIB 1FNHA 2K4AA 2GCYA 3QDMD 1YNTF 4KY2A 1KN2H 4OM0H 2XQ0A 5JA8B 1EO8L 1S5HA 2BY1A 5BUPA 4FADA 4PGBA 4YWGH 3T2LA 4A2FA 4MD4B 3IM1A 2L4OA 3QCVH 3V6BR 4BSVA 4QOKE 4NHUA 3C60D 1KCRH 3Q05A 3GRGA 3ZQWA 2DQHH 2A74C 5HPMB 4NGHL 4M00A 3BZFB 3IMSA 4WI5A 5IR1B 2MPVA 1CU4L 4YXLL 1T83A 1FNFA 2EDEA 4U3XA 1QFHA 1DL7H 1VFBA 3A5VA 4I1RA 5E99H 2OR9L 2LU3A 3F7YB 4LASH 4G6MH 2EVGA 1RERA 3LHPH 5C3LD 5IHZB 3LKRA 4IRSD 1BD2D 2WUBH 4C47A 2HRPH 1P7QA 3I6SA 4KI5D 3ZGHA 1TEFA 4BFGA 1PKQB 1ORQA 3GSOB 3UAJA 3X14B 4DCQB 4HKXA 2HKHH 1BG1A 2JQMA 4R90H 5T3XH 4GKZA 3V9EA 2QTEA 1E6JL 2HLFC 4QXTB 2LAGB 5DWPA 1KB9K 1L3NA 4BSWB 2V3EA 5FO7A 1OGAB 3LRHA 1F2QA 5F7YC 3RX8A 4PJ9B 1WWBX 5JNYB 1A4JB 1YJDL 1NTDA 1H6TA 3ABLB 4N2LA 3IGAA 1QHOA 2Y24A 4K8RH 2E47A 4PCTA 1WIOA 4H88H 2J8UF 1A47A 4UAOB 4XVUC 3IJYB 2CLZB 4RFNB 4UIMA 3BAIA 4BZYA 4NQXA 4DZ8A 2G4EA 4UT7H 5KYWB 1D7BA 1EDQA 3Q8FA 1HC1A 3IS1X 3AWFA 3KYMB 5IOPA 3KYKH 4PAZA 3SGEI 1P5UC 2FWLB 3C09C 4JO3H 5CUSH 1P4IL 3MRIA 4MVBD 1JZ3A 2DL2A 4LXFA 3WNIA 4Y4FB 4EBQH 1E4KA 1YY8B 3HC3H 5GZND 4FXGC 3LRKA 3MCLH 1D5BB 2OPCA 4BK8A 3FT4B 2H9GB 5GRUL 1GZQB 3LMJL 3NIGB 5BS0A 4W68A 4OH2A 1NCBH 5DD1L 3KE0A 3SJVA 4D9QE 3GSRB 3K6SA 3CAFA 1BQHB 4NXSA 5D96B 3U2SA 3TFKD 4KKBD 5HYQA 3FN9A 5HP5A 3SQRA 3C5ZB 2Z65C 5DC9B 2WLHA 3TASA 4U3CA 4UINH 3NZSA 5CHNA 4KK6D 4Y2DC 1RULH 2APBA 2H47C 3SPHA 1JZ8A 1MFAL 1RZJC 3WI9A 5D7IA 4L48A 3FSWA 2EO9A 3O9WD 3ZIMA 3IJSA 2GITA 5EU6E 2XTJD 4ADIA 2MCAA 3N85H 3VTTA 4JR9H 3KM2A 4N1EA 4OLVL 1LDPH 2K6YA 1IO4C 4PWIA 4M8UA 3B37A 3EO9L 3UZEC 2OAAA 1L9QA 5D7JB 5GGUA 1M1XB 4W9HC 2GUOB 2IPKA 2ZXBA 5JZ7C 4A6YL 4WW2B 4AUYA 2NOYA 4HBCL 3D07A 3O3AB 1A02N 3NPSC 2WINB 3WD5H 3V4VB 1N3NB 5ILTL 4LSPL 1XH1A 1EXGA 2I9LA 2ZX5A 4PG2A 1AKJB 3J27A 3RWEB 4FP8H 2W1NA 2X3BA 3JQOB 1NKRA 2VQ1A 3FQYA 1FZOA 3QVAA 1Y7VA 4MLSA 1NGXA 2ENPA 2QDWA 2OMYA 1A4KA 1CGXA 4OGXL 5D7SL 4Z5RB 1AGDB 3BEWB 2ZCKH 3L81A 4ZO8A 1MVUB 5J1TC 1MCPL 3S5LB 1U8PB 2V0AA 2VDNL 4XCEA 3LKSA 5AVXB 3UTSA 3MV7B 4JPVH 3F7VA 5D5MB 2AC0A 3QPXL 4OZIB 2IXQB 3FB5A 4OQTL 3U0TA 2Z0UA 3BP6B 3BSZA 4PJAA 1QEXA 4AK2A 4KX7A 1N0LA 4PRHD 2WYZA 2VDKH 5E2WL 1NGWA 1T80A 1WBZB 1ZE3C 5I19L 4UDTB 3FHEA 3EFOB 2ISDA 1T3FA 5E94A 3VRJA 5GS1C 2FECI 3FULA 2J1XA 2WC7A 1G7LB 1R75A 4WI9A 4N6QA 3GEFA 1NPUA 4QR7A 4P57A 1E27A 5A7EA 1BXAA 3FQRA 2ZYSA 4PRIB 4Y89A 1BFVH 4IHOA 5L2KB 1IGJB 2O26U 4NNYB 5DFVD 1D7FA 2EEFA 4AQ1B 5HHXL 1FAKT 4FKKA 4EI5D 3LEVL 4XWGH 2VAAA 5DRZA 3MQIA 2R7EA 2NLJA 5C09D 3FU7B 5E2UH 3WTXA 2CAKA 2UWEA 4F80A 2P8MA 4PJEF 5D2LE 4TQPA 4H8WC 2DS4A 3ZE1B 4PW4A 1ACYH 2ZJSH 2XTLA 5CSZA 3UC0H 3LN5A 1EUTA 4QUOA 1TNMA 2BINA 5IFJB 4DO5A 2ZCHL 1S9YB 3V4PA 3APMA 4ODSL 4MXQD 2YLKA 3LPOA 2F6AA 5JDJA 5F1NB 2HLAB 1LWRA 3WFEH 1EBPA 3WTYA 1WE5A 2PPAA 1HH9B 4FD0A 2DQCL 5CEZD 3HKFA 4ZPTA 5K1NA 2BZCA 1HJCA 4YK4B 3OZ9L 3EH3B 2EO1A 2L3BA 1FHGA 2Z6FA 5G4NA 1I9RH 1CU4H 1J1PH 4L05A 1NKGA 3D8MA 2DD8H 2PXYC 2MQ0A 4Y8AA 2Y23A 4MD0B 4MMXB 4WJ5B 5FYJU 1EEYA 3VMNA 1CFQA 1KB5L 4GMTH 5IREA 4PMEA 5I1HL 2XXCB 3CFMA 2WGXA 4GY4A 3KCPB 3UXFA 3RVTC 4HIXH 4QXGL 1F3DH 1QW8A 3B9DA 5B1BB 4QXUL 3T3PF 3ZTCC 4F7TA 3D0VB 2IGLA 2A6JB 1CL7H 2JK5B 5F21B 2V5RA 3KXFB 5K9OB 5AW0B 4L1BA 4Z77A 3FYEB 3W3BA 3T9WA 5I1LB 1A1OB 4ZUWB 3UPRB 4L2LA 3C5JA 5C7XL 2O93L 2WCGA 1FZJA 3TPKA 2FEJA 4N6RA 3BX7C 3U4AA 2VXUL 2VRKA 1OT1A 1ZD6A 3PL6A 2OMTB 4Z7OF 3FB8A 3GBNL 5K39B 3TV8A 4PJ7B 1M7DB 3WNMA 5I30H 4FNRA 5IESH 3Q0HA 1RIUL 3W37A 1HESA 1CO1A 4GPVA 2HX8A 2ALWA 2DWEB 3KEHA 3ARGC 2ZWLT 3FO1B 4KKLC 3HN5A 1KIUA 1DFBL 2VYRE 1YQ2A 2FYVA 2V9QA 5CCGE 4H5SB 2RAMA 4NC1C 4AWJC 2VSDA 3JTSA 5JHLH 4MXVE 3ESOA 1G6RL 4XVSL 3C2AL 4DVRH 4JHAH 1SYVA 5AG9A 4WRLA 2JJUA 3GXPA 5I24A 3BPCA 5ISZD 3BUPA 1DVQA 5K69A 3IE4A 2XC8A 2WBJB 2FX8L 4BE6A 1FSKB 3EG9B 3AXHA 1OCCB 3ISWA 4F33B 2BIQA 2G2RA 2LHAA 4F7PB 2DWTA 4PTTB 4XHJD 5IM7B 1P6AB 4FI8A 4OCRL 3VYPA 4A63A 4Z78B 1TFHA 2GY7B 5AYTA 4YBLC 4UOZA 4NHCL 1KIRA 3H7LA 3SKMA 1D9KB 2YPVL 2LLLA 1XGTA 1RIHL 5DEGB 1KENL 5DC0A 3PJLA 1OAQL 1IT9L 4L1TA 9CGTA 4IOIA 2BK8A 1FN4B 4GKSA 5J57B 1AZZC 3B3BA 2HJLA 2PW1A 3K4ZA 1QUNB 4HXBL 1J5OL 4NQDA 1WA2X 3BZ5A 1D7DA 2CXGA 1TFPA 3HFML 4R2GC 5FYJH 3MGOA 1FL3B 1S7UB 4ZW5A 4NNXA 3B83A 2ITDA 4M7LL 3BWAB 1CXFA 3Q01A 4G1MA 3V6OE 1R46A 4XGZA 5CEXA 4I9WD 3FTGA 3HKZA 1CR9L 2WXOA 4IJ3C 3M46A 1C1EL 1S9VA 3QUXC 5I1CH 1KXVC 2P52A 1RK0A 1RVFL 5EIQA 1I1RA 2CLRA 1SGKA 4KAQH 3PWPB 1XGRA 4GBXC 1W0VA 3U7AA 3UJTL 4U1KB 2Q20A 5M95B 4YBHA 1NBVL 5SWZD 4BXSV 4EIBA 4X42A 3RTQC 1YC8A 1GS8A 3GKWL 3DX4A 4A6YB 2OTWB 5IBTL 3GM8A 3DXAD 3NACL 4YHLL 3Q5YA 2MCPL 5E8NB 4ORGA 5C0EA 5C2BL 4YJZL 5C3TA 1IM9B 4BFFA 2C3WA 4IGBA 5DZLA 1YNKH 4NT6A 2FSEA 5KSUB 5GIRA 1U8KB 5BO1H 5JUEL 4OY9A 3NUKA 4GB9A 5HI4C 4KY1L 3II1A 2BY3A 4TSCL 3A6BL 1JRHH 1U8NA 3KLDA 4NXKA 5IUCA 5BZXA 4EDWH 5GS0L 4OZFB 2B59A 1QKZH 3D2UB 3E9UA 3QXWA 1LWHA 2VDNB 3C5SB 2N0KA 1RUKH 3U7WL 3WHE1 3EBGA 5KANG 4HQQL 3P4MB 3O6FA 1QPKA 2XKUA 1DR9A 2XWXA 4AVJA 2M26A 3TH2T 2VAJA 3PDOB 1BQHG 2C7FA 3MMEB 4LQFL 2Z8WC 2X05A 2ZCHH 4H1LA 4O5LH 2VMEA 3UZQB 2DB8A 4WV1A 3PAYA 1CVRA 2WVUA 2BOBA 4G9DA 1JXDA 2ATKA 1S7QA 2UY6B 4HK0B 4IKKA 1R3KB 1SBSL 1B4TA 1D5MA 2BRRL 2J4WL 1HAWA 4MNQB 3DRTA 2JKXA 3EFFA 2BNUB 1RJYA 3PRZA 5EBGA 3GS0A 3U9PH 1ESOA 2B4CH 3U83A 3J8F7 1URIA 3OR6A 2EJ1A 3SKOA 1PU0A 4YDJB 1IFRA 1KN4H 1MHCA 4GS7B 3IAPA 1WEJH 1UOLA 3B34A 3MJ8A 4KTDL 4E36A 2JFCA 1QSED 4HMDA 4H4NA 3VH8A 5IVXF 5TDNB 4JVPA 5TE6L 3VX0A 3OJVC 3S37X 1U58B 2WIIB 3ZKQD 2OI9B 5M7QA 1QFPA 4G8FA 5IMLB 5JMRA 1N59B 1U91A 4E9RA 1MJ8L 2J12B 2DQUL 2GJ6D 2VXQL 3AQDA 3SO3B 1AG6A 1BZEA 4AG4L 3QQ3A 5C08B 5T1MA 1OP4A 2V7NA 4MAYD 3T77A 1A65A 1P0SE 2BJMH 3M1BB 5D1ZA 5IBUB 5TTRA 3S5LG 2VXTH 1NANI 3BUQA 3OMAB 2NY3D 1IQWH 5IEHA 3VD5A 4DH2A 3B5HA 1AHWC 2I07B 3FH5A 5EO1B 1KB5B 1I31A 2VSKB 4JMNA 3DK2A 3UJJH 2BIIA 5I8KL 5I1DB 3HBQA 2DQIL 1OF2A 4Q9QL 1QFWM 3KLAA 1RIUH 1HZHH 1M71A 5KZCB 3ARRA 4P4KA 4AT6B 1OZUA 5IWLC 4WK0B 4O58H 4NQVA 4ZZFA 5FFLA 1AQ8A 3ZR5A 3FMGL 4P2OB 3CBJB 2K45A 1U8HB 2Y3AA 1ZE3H 4G70B 2DKMA 2NY7H 4QT5A 5LBSA 5KN5B 1GYVA 2AQRA 4FG6C 1BQ5A 4C54A 3AGVA 1E6OL 5C0BD 1R17A 3QG6A 1Y18A 4S2SB 5G2NA 4C56E 4J6RL 3TVMD 3HLAB 1HSBA 3AAZB 1DANT 3I9GL 1X44A 5SWQB 3FO0H 2FX8H 4ZG1A 4C83B 5E08H 5MHSE 4CKVX 4B7LA 3G9VA 1TQSA 4R0LA 5EH1A 5IQ9B 4OFQA 1LO2L 5KSAD 4LLDA 3OKEA 2XV6B 4LLQA 1KJ2L 4M6ML 4UV4H 5EZLA 2EDLA 3IETB 5TQ2L 4BUHA 1KXQE 1N8OE 1UC6A 2YBRB 4Y1TA 5CJ8A 3UGXA 4BFOA 4OJAA 2CO1A 4B41A 2H0PA 3A22A 4CBZA 2PW2B 3P54A 4BFIA 2BMKA 4O9HL 1MHHA 4L0YA 1G6RB 2DQDH 3JTTA 4F15B 1RZKC 1DN2A 2ZUVA 4IS6B 3QDGB 5ABDE 4X5XA 5AOJA 5F7DB 2ESVE 3VWJA 1MCHA 2G0LA 3BZEB 1BVLB 1S78C 2B5IB 3Q48A 1AO7B 1NWOA 1KTCA 3BWZA 3E0GA 4YHMH 5D2LB 1XL4A 4YHIA 3MXWL 3RURA 1CK0L 5EUKB 3UBXB 5CD5C 3IBOA 2ZWKA 2HP4A 3H3BC 2HRGA 3SDAA 1RVFH 1VFUA 4PH8A 3DNKA 4FXKB 1UWEL 1IAIL 3WY3A 4ELME 3MBEB 2Z3FA 2Q3XA 2ROXA 1NCAL 5BV7L 1I1AC 2R0WL 2WWMD 5B3NA 3FKUS 2EH8H 4LEXH 4B5EA 6PCYA 3TN0D 2EE3A 1J8HA 4PJFF 4OR1A 1DQLL 4ODUB 4RMVA 2JELH 5JPMB 4YHLH 4RMQA 3MRMA 1CWVA 5IFAL 2D4FA 3GUFA 5JXED 5HHPA 3MLRL 4CMHB 5FM4A 2YC1A 2XT1B 2ODIA 1A3LL 4NYLB 2W81C 1WBYA 5L4FA 3OF6A 3AU1A 2J88L 4M03A 3I50H 2BS9A 3D39E 4KPHH 1UM4H 3VQ2C 1H5BA 4ZFQA 3QUYD 2GG1A 3ZZ1A 2VR6A 5C07D 3MNVA 5HI5C 4I48B 2DQGL 2VLKA 1BYNA 3N40P 3T4AB 2V2TA 4LVOC 1PD6A 1RJZB 4JRYA 1UA6H 2EABA 3AB0B 5F6IC 5C0AE 2V7HB 3G04A 2LW3A 1MWAL 3LYRA 4JN2A 3TO4A 3IJEA 2VDQL 3HS0B 4XN8A 4HQQH 2IH3A 3WNJA 1M6OA 4NNPL 1A66A 4ZPVA 4BQCA 3VXME 4JJHA 1LEIB 3KLHC 3RWGA 5I1KL 1XEDA 5AVVB 2OL3L 5MP6H 2R2EB 1KXTB 1FAIH 2NZ9C 2Y1AA 3NABH 5FC9A 5MENA 5IP4A 1M2OA 5H37G 5EUOB 3II2A 4DN3L 3CCHB 1TZIB 2CM6A 3WY1A 1XL6A 2YUVA 4J12A 3BQUA 4RVBA 4PGDB 5EC2A 3I3BA 3DOIA 2YWYA 5KG9A 1RHFA 4XXDB 5J9PA 1GZHA 1IE5A 3ECQA 4XPFH 1CMOA 4G9FE 3DGGB 3WL9B 3TBYB 4KRPD 3O4LA 1TLKA 1YY9D 2WVTA 1SEBA 2X6AA 1CFBA 5IJKA 4LHQB 2D7NA 4ZT1A 4JPWL 3B4NA 1I3GL 2V9UA 1M05A 4QRTB 3QFDA 3BP4B 4LIQE 3KM1A 5TE6H 3WJJA 3QORD 1CIDA 2EEBA 2QLYA 2WQVA 3RB7A 1DO5A 2EO7A 5GQBA 4UQIM 5FF6A 2EC9T 4GLRH 3MROA 1FZMB 2B9BA 1T04A 2Z9TA 1IJ9A 3BAYA 1PJ9A 1DQDL 5DWUH 4W9JC 4D0DB 2PWDA 2NY1D 2R51A 1W0WB 4V2CB 4NERA 5B8CB 4Z3FA 1PZ3A 3VRIB 1PD0A 3HBPA 1NGQL 7PAZA 1JPTL 2A9DA 5I1AA 1QR4A 4QI3A 1CDYA 3GIVB 3EOAB 4KQ3H 5JOFA 4AVIA 1NCWL 1TJHL 3B6SA 5K9KA 3K5SA 1YN6B 1MG2C 4G6JH 1USQA 4G6AD 1CICA 3F7RA 2LTQB 2QDVA 3N41B 3HHSA 4YDIL 2Y69B 5C6TH 1H3WM 3FHAA 5ALCL 3RUGA 2KLTA 3UTZA 2CJTA 3EYUL 4N0UE 2ZWZA 4XP1H 2EP6A 4XB8A 3ARDB 1OGSA 1WFUA 3L13A 4XO4A 4DUVA 1RP9A 2GHWB 1UXSA 3GEWB 1T5WB 1N2RB 4P5TD 5ETUB 5JHBA 4AIZB 1THCA 1BEXA 1JGIA 1T7WA 3N40F 1A6ZB 4OZFG 4UZSA 3GNML 1DCLA 2MMXA 4JB9H 3U46B 2CO6A 1ZGLP 3I9GH 5F97E 5DD6B 3RY6A 1OLLA 5F3FA 3VX1A 4FA6A 3QDME 4MWFA 2YAOA 4ZNEA 1FFPA 3LH2L 2WXQA 1D3CA 5GGTL 2EDTA 2PN5A 2ADFL 2FO4B 1P4BH 4YHZL 2R4RH 1WAPA 1U3HB 3MUGA 4OLYL 3P4NB 4JUSA 4OQ1A 4NWTL 3ARYA 1BM7A 1USZA 1ZVHA 3US9A 3A6CH 4NWUL 1OCWH 3S36H 3B9KA 1QTSA 3QHFL 3B5GA 3VW3H 2C26A 3T8XB 1CGSH 1CLCA 1BF5A 4LNRB 2BW4A 3BKJL 1E5AA 2IPTL 4PJ8D 4XI5D 4YGVA 1VAHA 2QHLA 4TNWF 1I8MA 4P5KB 3SDXA 2FDBP 1M7IB 3T65B 1E7VA 2GB2A 3VFGH 4KI5E 4ZFFB 2V6HA 3JXAA 2XRAL 1ETZB 4XT1C 2DMHA 2VE6A 3L5JA 1HXYB 4X6BA 2W07A 2KDGA 1ZEAL 3D25B 4FQCH 3EJRA 4LIQL 3WJLC 3FFDA 4RRPA 2WLIB 2IAMB 3PGCA 5AW6B 3GINA 3MRKA 2EYSB 2FZ3A 3MNZA 4XMLL 2R23A 4FL4B 4Z6AT 5EF1A 3R06A 3VSTA 3B1UA 5I1GH 2YEQA 2ZCLL 1ACXA 4UF7C 1JYXA 1NCHA 1UOKA 1IEAA 3QH3B 1II4E 4Z7VF 1QSFD 3SE8H 5IBUG 1E9PB 5GZNC 3BGMB 3BKYL 4NS0A 3KGRA 3TA4D 3VJ6B 4QTIL 3TBWA 1VIWA 4FFZL 4WWKB 2DN7A 4NRXB 3O3BB 4U7KA 1DDHA 3CDZA 4P5SA 2R29A 4YDLC 2FUTA 2JB6A 4U1HA 1YEJH 1KBVA 4OF0A 4KGJA 3F00A 3TFKC 2C3VA 2QGBA 4L37A 2YSSB 3D1MC 4N85A 4XCCL 1KBWA 1SXCA 1CPUA 1QHQA 4FQLL 2VDQH 3ZDXF 5TDPA 2FD6H 2FHCA 2JIXD 5D70H 1RUPL 2Z92A 5KBLA 5ID0B 3IRCA 1CYGA 1EWHA 4M5TA 3S88H 4HGMA 4YSOA 1BREA 1MCSA 5B38B 4FQIL 4E9SA 4Z3GA 2I60H 5EU3A 3KH3A 2J6WA 2DI8A 3GLEA 2IWFA 5JIHA 5KYXB 2XYBA 5HJ3B 3VGAB 4A39A 5TDOA 1RZIA 4PJ5A 2A6KB 4WCYL 2OW7A 1KCUL 4L9LA 4WQOA 1KBGL 5J11B 1PD1A 1T66C 3UDWC 3S5ZA 2NDGA 2XTJE 1ED3A 2YKLH 3FB6A 2ZXDA 3M17A 5CINL 3GRWL 3QDJE 2PUQT 2P49B 2W8CA 4HIPA 1AVAA 3FBKA 4L4VB 3WUWB 1IBDA 1TXKA 4QTHB 4C57C 1HL8A 2A3TA 1U8CA 2OSXA 4HJTA 2OFQA 3QARA 2DYPB 1RZ7L 4LCUA 4TNGA 4PJIA 3VGHA 2A83B 1QFWH 2WLLA 3VXPA 3RX7A 1PDKB 3T2NL 5TF1H 2OL3B 3CXFA 4UNIA 4UAOC 2VITA 1E8XA 4R7NB 4U6TA 4PCSA 3TZVA 4I2XB 1YMHB 4WSJA 5DMKA 3MV9E 2DQFB 3QQNA 1MZYA 2E27L 1BQLL 4O51A 3UMTA 1K8DB 1KGUA 5D8JL 3T0WA 2VXVL 5HHQA 1VPOL 3D5OF 1DQDH 1D5ZB 1PY4A 2DYSB 3I02A 4I5BB 1CLZL 4TTDC 4XWOD 1RZKH 2YUZA 3UO8B 1VEPA 3UBXG 1A8JH 4Y4FC 2EEDA 4JFDB 1SXZA 2WLKA 4Q6IA 5E8DL 5JHDB 1KYUA 4CDGC 4GSXA 2FJFA 1NBZA 3HE7D 1SQMA 1E5UI 3SDDA 3UG3A 3CTTA 4MNHA 3R1GL 3ZQ9A 1GW6A 1J8SA 1QR1B 5EV7A 4IOFD 4RGNB 3U2IA 1WYJA 1YYLH 2WAHA 3C6LB 4LE8A 4GG8B 4PRHE 3N3EA 4PS8A 1L5GB 1MH5A 3LZRA 4HDIB 1MWOA 4F9PA 3QFJA 5EF3A 5D96C 1QAWA 2NUPB 2C1OB 4LEEA 5KSVA 1E43A 2OJEA 2VCOA 2FR4A 4PG9A 4GXVL 1G9ML 3K1KC 1NCOA 2DKUA 3C5ZC 2Q86B 7PCYA 3MRCA 15C8H 3LX9A 4UQCA 2V33A 3FONB 1JERA 1A9BB 4TOYH 1ACCA 1FNGB 4H2CA 1Z66A 1FO0B 4GRWF 1SYSA 2X4UA 3L3DA 1RAMA 5I6NA 2IQ9H 5D7LD 3DX7B 2QQKL 1JGLH 5ID1B 1CZ8L 3PWUB 3UROR 2AJUH 1U93B 4JQIH 3QK0A 4FQ2H 1MLCA 1QBML 5JO5A 2P80D 4M6NH 4OI9A 4XPTL 4Y0GA 5B21A 4Y4HB 1NGYB 3TPUA 4NFCA 3VFTB 3IDJA 4JPKH 1CFNB 1KIQA 1OXYA 3L3JA 4FLSA 2W0KA 4FEMA 2BVUA 4ZUVA 3O11B 2V4LA 1YSOA 2Q7NA 3LPGA 3IJHA 3UGEA 3ZSTA 1I8KB 4ELMB 5FR3A 4GSUA 1JPFA 3BSHA 3KJ4B 4FX5A 4PP2A 2EINB 3WO3B 5L0QB 1MFDL 2VZSA 2AJXL 1I7UB 3BUYB 1V7NH 3D3VA 1IIKA 4X98B 4U1GB 3ULUE 2H8PB 2N59A 5IQLA 5FYKE 4ETQA 3GDBA 1U36A 2J1ZA 5EN2B 5CEZE 1XT5A 1WT5C 4N1CA 1NDMB 3HC0A 2JKSA 1FFOB 3JV4B 3RVWC 3WLBB 1ZWIB 2F68X 1H0DB 1I7TA 1WH0A 4LMQE 3HNSH 4H8PA 3D0LB 4NENA 2V2WB 1JAEA 3PNRB 2XWTB 3TNMB 1U4FA 3NN8A 2FBJL 1AMXA 3MRGA 4PIBA 1J9QA 1EXUB 1FJ1B 2P7TB 2XV2A 4PJAF 1OT2A 3CMOH 3KDPB 2CUIA 3G6DL 4UMSA 1MREH 2ZSVB 4FE9A 4Y9CA 3OLGA 3TCLA 1F6FB 3BP7A 4UAHA 3DMMD 1BVKA 4LDLB 3EBIA 1PYWB 1HHJB 1BX2A 1P1ZA 1T5XB 2LAAA 3K6OA 3LY6A 3V6ZB 4E0RB 2LR4A 1PLBA 1FLRL 3O0RH 1JZEA 1IC4L 1RPKA 2XY2A 5DD3H 4QO1A 1IMHC 4OJYA 5IJVB 3CK0L 2IALB 3HI1B 3G5VB 4FXGA 1O7DE 1WRFA 5AAWC 5F7LB 2R0LL 4M5SA 4F8TA 1TVBB 2NNCA 1U8JA 5A16B 2XTSA 4OIFA 5GGSA 1UZ8A 4JS7A 4K5PA 4G9FB 4QWWD 4AQ1C 3U79A 1KJ3H 3MXVH 3WSQL 1RPQA 1ZHBA 5CBAA 3HZKA 4B6ZA 3AM8C 1DFXA 3IDNA 5DEFB 5EO0B 5AYUL 2X2YA 1IZKA 2EIZB 3S3PA 4EZKA 1HCFX 4J1UB 3PWJA 2FL5A 4DO6A 1SEQH 1XFPA 1T5KA 4HX1B 1RURH 3FSZA 1HHHA 1IGCH 4Y2DA 2OYLA 3NEXA 3IKCA 4OCYL 5FUCE 4JCLA 1NCNA 4HIJA 4XCCH 5GXBB 3MRFB 1G9HA 5HYEA 3FU6A 1SOSA 4B9PA 1BAFL 1JHTA 1TJGL 3LEYH 1LO3H 4YK4C 1ANUA 1SHXA 2PP7A 4UCFA 3SBPA 1DZ0A 2OQJA 2PYED 1LEKB 1ONQB 1FH2A 1U2YA 1XAKA 3NSXA 4BHUI 5I17B 1TCMA 4LP8A 3UZEA 2J20A 1KG0A 4QHMB 5DJZA 3RX9A 1MRCH 3AREB 4OKVA 1B0GB 5DVLA 5E2VH 1Q1JL 4FJZA 3QULA 5EIIB 4MMXC 3A4EA 3FRUA 3L2LA 2F53D 5DJYB 4YFLF 4M1DH 2NNAB 2GK0A 3ZE0E 5GJTH 2VKWA 3O8XD 3E3QE 3I6GA 3NSJA 3GSUA 5JW4R 5IGXL 1I75A 3P30L 4EKXA 3ULUL 5GRWA 1XF2A 1MFEL 5HHOD 5FYKL 2XG5B 4M93B 4KFMA 4LRIC 3EJJX 4XP4H 5CEZL 2P24B 2XKSA 5DQJA 3RFZC 2H2PD 3MNDA 3EO0A 3I75B 1IM3D 4WHYH 5D1QD 4ZTPL 2CDEA 4N0UB 2AEOA 2OXGA 4RFOH 3VGDA 1JGUH 4HJ0D 3CIAA 1F41A 2XLLA 3L1FA 3L4TA 2P8PB 5TH2B 4X2UA 4Z3HA 1JZ6A 5GGQL 2K3HA 3SGJC 4NZRH 1DVUA 1HXMA 2AFNA 3WMSA 3U48A 1AXIB 3BD5A 1E9QB 1LWJA 1ZT7A 4PRBB 2YOAA 5A6MA 1MW1A 4ISVB 2WXLA 2JJWA 3CSYA 3VFOA 3D4GA 3GWJA 4I9WE 4JO2H 4BFRA 4P3WA 1VPOH 5GS1A 1NZRA 5AQ0A 2XYCA 2H3XC 1JGDB 2AQNA 4LGRB 4A7GA 2K0RA 1DO6A 4ZSOA 1JWUB 4GKNB 2DICA 5BRZA 3X1BA 4PJHF 1OAXH 4M1GL 5HGHA 1L7TH 3MCG1 1BZQK 2QHRH 1ZT4A 2IH1B 1P4LB 1CFTB 4OT1H 3D06A 4KKPA 3ZTNL 5ADOH 3C8HA 5FWQA 4IU2B 5E8OB 1LO5A 2Q87A 3ESPA 1SN0A 4J3SA 2W60B 3VI3A 4Y9EA 2BC4A 3R0MA 2RALA 1GS7A 4Z7UA 1GAFH 1KYFA 1B6DA 5CAYB 4U6XB 3VO0A 5GGVY 4NRYA 1UASA 2HPTA 2PLTA 3BPOB 2QVTA 4ZTOL 1BWMA 4OZGE 2H26B 1N64H 2CDFB 3RTLA 4OD3L 1BWWA 3QISA 1FSKC 2X4SA 2OMBA 1SY6L 1LP9E 4PJDA 4ZMNA 2WY3B 1FRGH 3WEXA 3NSFA 3QQ4B 4JAMA 4OGAD 2OTPA 4DGVL 3V0HA 4EQ2A 5IV2B 2P5WE 1UB6B 1TJIL 3D08A 3TJEH 4X9IA 4GYBA 3IJ9A 1D9KC 1S7XB 2H5UA 2VZVA 1PJWA 3VI4F 3JV0A 2PXYA 3QI9D 4L8BA 3F5WA 3DPBA 2FECL 3I9AA 3QUMB 3WXWL 4JFWA 3CSTA 3G08A 3STLB 4MMYA 1HDMA 1CS6A 1CFSA 2XA8L 3IDXL 3LQMA 4GQZA 3HPJB 5CZXD 3NIFF 3QQDB 3EGDB 4ZMOA 4U0RB 5C70A 4JDVA 1LQSR 5LXGH 3QYNA 3LZFL 5A7BA 2F19H 4N8VB 1HH6A 1TNNA 4N86A 5K59F 1IIIA 1XZ0B 4MA7H 3SY0B 4YSCA 5B22A 2E74C 3DJRA 1P2CA 1DVFD 5IBLC 2W9DL 5FDWA 4IU3B 5FPIA 1A7PH 3QUZD 4U7SA 1UT2A 4UOW0 4PV8B 4RZCA 3P02A 3QNYA 4TULL 1MFUA 5SX5K 3L9RB 3QEUA 1VFAA 4H2AA 3WUWG 1N9PA 1QSEE 4XO8A 4CSSA 2Y7OA 2X6UA 3TM6A 1HJBC 4PS4H 1XD0A 1MVFA 5GRJL 2AJ3B 3NCMA 4GRMB 1WBXB 2RIKA 4PRPE 5DSCA 5KVEE 1MAML 3DUUA 5HDBB 5HDQL 4DQOL 4PCKA 1JUFA 4WKZB 2JH2A 3G6JB 3EFDL 4CNIB 2O30A 4NUJA 1KGIA 3ARGA 4ANXA 4TTGA 3QJHA 3RZWA 5DF0A 4KZCA 2P5EB 3JYCA 5DJ8B 1N4XL 2DLGA 5AG8A 4L8DB 4DEWA 2OMNA 3X17A 3QDJB 1A7RH 2CMRH 3LS5H 1AQHA 3WGUB 3JWNE 4RBPK 4JK0D 4XH2B 1OM9A 1AACA 1ET8A 1SJXA 4RMUA 3NA4A 3F2LA 3MRJB 4XR8C 4LK4A 5KAQF 3FT2A 3OKNB 1KELL 1NFIA 4MLIA 5L88L 3ABMB 1Y0LB 4F37K 4ZW8A 3UADA 4MQXD 3CHOA 1T1WA 1KDJA 4Z7NF 3ZKNC 3WOVA 1KFGA 3QRGH 3MV9B 3BDBA 4ZUUB 1V8HA 4EUPA 5IQMA 5C0BE 2A73A 2PCPB 4IEFB 2BIOA 4JFHE 5GSRB 4QMEA 2C9PA 3X3FL 3AS3A 3IF1B 4Q2ZB 1F11B 4LPVA 3SGEH 5I6LA 4G8GD 1NSNH 1UGKA 1HAUA 1BQRA 5IQ7L 2OMWA 2OR8A 5ITFB 4HXAL 2R4SL 4GS7C 3UZVA 5CN3A 2EACA 1DQTA 3QEHB 1YPZA 5TD4A 4O02L 3K80A 4PGZA 4OIBA 4TNEA 5I15L 2CRIA 4RWYH 5MEQA 2VIRA 1TZHA 4AVHA 1GZPB 4QHUA 2O61B 1OL0A 3BLBA 5EORL 4D3CL 4Q4EA 2OI9C 2ZICA 2H1PL 3NCJH 1P69B 4XAKE 3W9DB 5DJ6B 4OB5L 4FS0A 1KXVA 3P3TA 3EDKA 4PJBB 1IGIL 3HS9A 4CDHA 1E50A 1YYML 5B1AB 2DH3A 2WXMA 3SO3C 4GBXA 2KLRA 4YSQA 1I1CA 4YNYB 4UT6L 1RK1A 2WLJA 1KZQA 4HS3A 1F4YH 2H0FA 4HHWA 4BSVB 4HCRL 3RTQA 5T5NG 5FYLE 3FQNB 4YC2B 3BN3B 4TUKH 5B7FA 1T7XA 2BFVL 5AKVA 1YQVH 3FQXB 1KIPB 3MRHA 3BFOA 1D5IH 3PUUA 4HFUL 1K4DB 2IDCA 5GHWH 3RBGA 1M42A 25C8H 4E5XB 3S34H 5FW7A 1Z0NA 3KYAA 1X5JA 1AZNA 4ZFOA 1KJVA 3TEZA 4P23D 1TQVA 3LKRB 1F4WH 3ZTEA 1UVQA 5KVEL 3MA9H 4OCXL 1JDDA 1RJLB 2WMPA 4OFYA 3ZYOA 3AWEA 4P2OC 5KS9A 2WP3T 4NKMA 1IEHA 1ORQB 2NT1A 3HRZB 3I84A 1AD0B 4FG4A 4B0MB 5F9JB 4WNQA 2PCXA 4LSUH 3PREA 1UOWA 4XN2A 4NOBA 4PJCB 2HXAA 1F5WA 4QRRD 5F9DC 4GKZB 4ZYKB 3E38A 3IXAA 1CGUA 2ICWA 3EGXB 1MI5D 4HH8A 5D4QA 5FO7B 5BOZG 5C07E 4BKLB 1GGBL 1Z9NA 3NFPA 1EFXA 1M7UA 2ED9A 4Q9RH 4RAHA 1T22B 3QXUA 3QNZA 1K5WA 5KSBA 5AALA 1I9IH 2DTML 1RH8A 3BAKA 4M02A 5H2BB 3FUFA 4OM1L 5AVRB 4NQXB 1XBRA 2VLJA 3KGTA 4HS8L 2F18A 4MCNA 4GXUM 5E8EA 1JGVL 1MN4A 2W38A 2XN1A 5E9AA 3V55A 4NQCE 3FFCA 2ZXCA 3L4CA 4AI7A 3CZLA 4LRNL 4PS3A 3MRIB 4PBXA 1T1XA 3KPRA 3BDYH 5L4IA 4Y19A 2O5XH 4S1QL 4FLRA 2O6PA 3QEGL 2J8UE 1OAYL 2QVKA 4WEBL 3G6AA 5ITBL 1A6TA 4QHLA 3BAWA 1UQSB 1EK3A 2BCKA 3BH4A 4UTBL 3W9EA 1TZAA 5B1CA 5EIIG 2FO1A 1BIHA 4FAAB 1G7JA 2B5IC 2PWHA 4UM9A 4NJ9H 1JK9B 4XMTA 3QJQB 2YSTA 5E9DA 4KZDH 5HYQB 2W9DH 1PG7H 1TO4A 4MZRA 4I13B 4AL8L 1FGVL 5E5LA 3L2MA 1TT6A 2VDLL 2X3AA 4OLXH 32C2A 3RFRA 4H0IA 4JHUA 1WAAA 2BVPA 2G75A 3HUJA 4G3YL 4FXKC 4TULH 5D7EA 5IMOB 2BDNL 1UEMA 4UNUA 4F8NA 3MBEC 1O9VA 3OXRB 3RGVB 5CN2A 2HJKA 3HE6B 1XR8B 4K5LA 4NQUA 2QKIB 4OLZH 3MLZH 3RNQA 2R56L 3CLEL 3NVQA 1NCCL 5IVZB 4QJ4B 5JPMC 4PY7B 4PR5A 2JVUA 3QCTH 1U8OB 2CJUL 4CMHC 2I27N 1K2DB 1P7QD 1NDGA 1NOFA 5FYLL 2QADB 1EGJH 2BSBA 4ZOBA 4HWBL 3RVUD 1FL5A 3UAJD 5IWLA 3MRBA 1WS7A 3DX6B 4MZ2A 4N87A 2XQYG 3FL7A 4CU7A 4X7TA 3T4AC 2GY5A 1GHFL 4J4PA 1CXIA 2I9LB 1FFTB 3IAQA 4JFXA 2HYMA 4WIQA 4HPYH 4CSZA 3NFSH 4AENB 3HI6H 4HVBA 1L6XA 3HS0C 2FWOA 4L18A 3IDGA 1P7KA 5EEXA 2CKBL 4FQXB 4J3XA 4CSTA 2OK0H 2V17H 3JV6B 3WGVB 5IKCA 4LSDA 1KELH 3W2DL 3D30A 3TFBA 1H3XA 2P3YA 4JM2A 4QRPD 4G8IA 3M07A 3QB7C 1I4FA 4S0HA 3BRGC 3GSWB 3U0TB 1DBAL 2NZIA 2WUCH 1QYGH 1N0LB 1TCRB 2HRHA 4LLUB 4U49A 5GGSY 3FO9B 2QSTA 4JZNB 3ILQD 4IRZA 3K8LA 4X5PA 3EDFA 3IAGC 5GS0C 2BVOA 2YMXL 5E94B 3MR9B 3DGDA 2WLYA 2ZWNA 2UV3A 3RPIB 1GXEA 3UPAA 5BS0D 3OPUA 3APCA 4HSCX 4ZXBB 3SJVD 3STZA 4OZ4A 4BRVA 3L5IA 4U4IA 5JIPA 2Y2WA 3MOBL 3VXUE 3WIFB 5DC2A 1TR7A 3Q3GB 2R0KL 4BZ2L 4IHOB 2DJSA 4JBSA 5FB8A 1RIVL 5HD8C 5DJDB 1DSYA 1T4KA 3GMQA 4YHKH 5DURD 4XI5C 2JTYA 3L95A 4LLMA 5L4MA 3RL1A 2X1PA 2BP0A 3LS4H 4AXWB 3OMZA 2H1PH 3ETBF 3WTTA 5CP7B 5LG6A 1TZOA 2HRLA 2HUEA 1QOKA 4OZGB 2ENYA 4N8VG 1NFDB 3DOSA 4MCYA 4S0TD 3GUTA 1TOXA 4P07A 4N25A 4I87A 2EYTA 4UQEA 1AZCA 3C9NA 4MX7B 4R3SA 3V4PB 3FTUA 3TBTA 1LP9B 4WEUD 3Q06A 1QO3A 2X4QA 5B8CC 2V2XB 3OKLB 1TEGA 2W65A 1AIZA 5I8CA 1T1YB 4OGYL 5HGDA 3VU1A 2P5WB 4UIKL 1S7WA 3FN0L 1KYAA 5T1KA 2KPNA 1F13A 3FUHA 4PJEE 1DJGA 5LNEA 2CDGB 1W8NA 2XDHA 4HLZG 4O02B 4Z7WB 4NX0A 4HJ1A 3K2IA 3ALXA 5C0RH 1GCFA 3CSPA 3PXLA 1EMTH 2X4TA 3SKJL 2LTQC 4U1SB 3DBXA 1LILA 1CLOL 4RDQF 2AK1L 1DSWA 3HPLA 4OZHF 4P3CH 3B8SA 5DHVB 4KJQC 1SUJA 3V4UH 1KYOJ 2B15A 4PJXF 2I25N 2HVKA 4NC0B 3VDAA 4LESA 3BPLB 3O3UN 3ARDC 4G80B 5I82A 1KBBA 1RMFH 2FIKA 3V6OC 1QSFE 2B0SH 2FRGP 3EJYD 4NDMA 5CIPA 1PX3A 3UTSD 4F7TB 3QG7L 2ATAA 2X1XR 2WTPA 4ONGL 2W91A 5SX4I 3WYRA 1LXMA 2ADJB 2E59A 1OAUH 4EEEA 4F8QA 3KPOA 3S96A 5LJYH 4APQD 3RIKA 3EJTA 2DQ6A 3DIFA 1HQ4A 5EO9A 3IJ8A 3MA7A 3VFMB 4OZFH 1FYHB 2G2PA 3DIDA 2KZKA 4DZBA 3H9HA 2EDXA 1FGNL 3BT2H 1AC0A 3T3PE 2A38A 1TVDA 4X99B 4PRPB 2BNQE 2FWSA 4MNGA 3TWCH 2CO7B 1KTDA 4IBTA 2EECA 4M7ZB 4FKHA 5T5FL 3CC1A 1KGCD 4FKEA 1E5BA 3VSQA 1A3RL 3AXLA 4WFFE 1JGEB 2HFEA 4Z3IA 1CFVH 1J8KA 5JW3H 4J3OG 4DIXA 1ZHNA 3HZYA 2XZCH 4KVCH 3NJFA 5K9JH 1T6BX 1VZGA 3SDXF 1OM3L 2YXVA 3QEGH 4UILL 5I16A 4R6UA 3FQUB 3GC3A 1NAMB 2YA1A 2QSVA 3TF4A 3VXSE 4Z7OE 3MLWL 4XPHH 1XSJA 1Q94B 2FJGB 3B2MA 2J5WA 4XZ4A 3N9GH 2DAVA 4JFZH 4XVJL 5D6DC 1UH4A 5DD0H 3GZQA 2OX5A 4HPOH 5GISL 1JNNL 2N0MA 1RP8A 3OKYA 1T0PB 2JJTC 5DJAA 5FK9A 1JTTA 2FH6A 2EXTA 2IAMC 4PBVC 3B2XA 4NLAA 5INCB 1ZTXE 3G3LA 5T3ZE 4PLKD 3C8KA 4TNWK 4TPRH 3VMPA 1FVDA 4UOQA 3WEAA 1DLHA 4NPKA 2OTUB 4IOSA 4PWKA 1BJ8A 1MRDL 1QVOA 3MDJA 4FL4C 3S35X 3ULSB 5A1AA 3CVHL 4MJ6B 3RL2A 3N0PB 1KEGH 3I3DA 5EBMB 1GIGH 2NQDA 4LSVL 4G5ZH 3W0WA 3HN8A 1OARH 1NMAL 1KIRB 3VG9C 3SKMB 4K94L 4F2ME 4WNJA 2I9TA 3L4ZA 1C5BL 2BLFA 4H25A 4HWBH 4WWKC 1WWCA 3K91A 2HJLB 2PW1B 3SDCA 1NAKH 1YHPA 4EI6A 5J6GB 4JJ5B 2E9WA 1GJWA 4E5XG 4G6FD 3SZKC 1QLFB 1FH5H 4PB0H 5TE4H 3VD0A 1TU2A 3CFJB 2ZP0T 4HOMA 2WZ6A 2ITDB 3ML8A 3T09A 2GUYA 4Z3JA 4KMTL 1N5AA 2E7MA 2JTDA 3WNNA 1MNUL 1R6VA 3NH7L 5C0FA 3QS3A 1DN0B 2FT8A 4TL5A 5C0GA 1CD0A 1GKEA 1H8NA 4F24A 4GG6A 3WDJA 2X12A 3PDDA 1INDH 2ADGB 5LCVL 5BJTA 3PL6D 1GR7A 4U1LA 4PEEA 5D7LE 2ZKHH 2R2CA 3T5WA 3VGAC 2GSMB 2W9EL 3T0VA 1QBBA 4ZUSA 1AG0A 1SLVA 1R5VB 1YNTB 2WQAA 3U1QA 3X3GH 5C0NC 5F0LB 5J11C 1K3IA 3DSNB 2WWKO 1EZVY 2O4EA 5CSBA 2XPGB 3RGHA 1IC5L 1PSKH 5C86A 5FCUH 2F1AA 4KJYA 1XCXA 2Q8BL 4UT9H 3QZOA 3IDIA 4ZS6D 1A9EB 5CNHA 2B77A 5HDRA 2E7HA 2VC2L 3MCKA 2CKBB 1CTNA 4X5LA 2AVGA 4LCWB 2RMNA 2B59B 3Q1EA 4GAYA 3L1EA 4NBYB 4OAWB 4DAGH 1A5FH 4KH2A 1XR9B 4G83A 2ZUQB 1UKQA 4Y2OA 4P9HH 1FBIL 3L3GA 5T1LB 3WJLA 5L2JA 1AR1B 2PP8A 4TLSA 3W57A 5ESQB 2FLRT 1LO0H 2NMSA 3FQ4A 5EU7C 1BP3B 1SJMA 3GFUA 4H1LB 4JGJA 4YHPB 3DMMC 4P2QB 4BUQA 2WOYA 2BOBB 3D48R 1S7SA 4MJIA 2NY4B 2UUDK 4U1MB 4OGYH 1JPSH 3DHUA 5T3ZL 1ZTXL 4MAUL 2JKIS 4PVNA 2UY7B 2Z91A 3EOBA 3MRLA 4K7FB 4I3SL 1XCWA 4NQCB 3KJ6H 3DRTB 4RGNC 1WDAA 3CFEB 3RWFB 3WHE0 3F3HA 4NQDD 5B1KA 2R2HA 5FOJA 3OR6B 4J8RB 2YFOA 1IAMA 1UACH 3UG5A 2QGEA 5DZNA 4M3JA 4XE5B 2J8UB 4K3EL 3SKJH 3B2PA 4RQQA 3N6YA 1I9JL 1MHCB 4MQ7A 4MS8D 5D1ZI 4NZTL 1HHIA 5DJCB 4APXB 4K71B 3GJEB 4KXAA 1FPTH 5JR1H 1NC4A 2L8AA 1RSFA 3VH8B 2VOTA 4HKJB 4MD4A 1X9QA 1GMIA 5CCKL 5IROC 4JEGB 5HPMA 5BZZA 1CGYA 2JXMB 4Y4HC 1MJUL 4YO0B 2NY0D 5IR1A 1EEQA 1R4XA 4I3RH 3GSNL 4JE4B 1FVCB 1THAA 3MUUA 4XBPB 3MUZ1 5F1IB 3TCXA 4WNSA 1JVLA 3F7YA 1ZXKA 5IVXE 5F0MB 3UCRA 3KJ4C 5IHZA 3N1MC 5L0QC 3ULVD 1G7PB 3EBAA 5DHYA 2ZKMX 2PPFA 4U1GC 4IGBD 3U6XS 4DW2L 1J0KA 1IGMH 2FHFA 3UDWA 1PKQA 5FO9B 3OWEA 3X14A 1BVNT 4DCQA 1OTTC 4EN3B 3IGLA 1JD9A 4PRNA 2PYEE 2MNWA 4JRXE 4P2RA 5CLXA 4XPBH 1QWNA 3LXBA 5IMMB 4HH9B 4QXTA 1M71B 3IGUA 5AL0A 4F1SA 1DVYA 4BSWA 1IKFL 4W93A 1GC1C 4E9WA 1OGAA 4PJ9A 1GA2A 5JNYA 1A4JA 4DKFL 3O6FD 2F53E 2HMIC 1PFOA 3IJYA 2CLZA 1B2WL 5I5IA 2ZSWB 1OSEA 5KYWA 4XN1A 1ZV9A 5HHOE 5F71A 3KYMA 1B3JA 4RETB 4GSDH 5F9WB 1JMZA 1JBJA 3EF7A 1ZJAA 2MNJB 2F5BH 1U21A 4GUPB 2Q76A 4JKPH 1CN4A 1E4JA 2FO8A 1TZGL 3D9AL 4ZMTA 1G1KA 1YY8A 3AQXA 4GP8B 1D5BA 4XMKL 3RHWF 1J05B 3HC4H 5AZ2L 3IK2A 2FAUA 2H9GA 1GZQA 2MQCA 3LZNA 3PS6A 4LLDB 2YRPA 2FNBA 3O2DH 1Z9MA 3GSRA 1BQHA 5I0VA 2WXHA 2ZYRA 1CD8A 4HAFA 1G9NL 1G7MB 3AGWA 4PRAB 3WIHA 3PP4H 2JMRA 2CBMA 2RTTA 2DM2A 3KG5A 3VXUB 2GTZB 2HT2C 3OJMB 1TTGA 4HHAA 1GGUA 2A6DB 2F74A 2J44A 5MERB 5EG6C 2TRYA 3CFBB 3VNYA 3NCCB 1MY7A 4EOWH 1GMEA 3ES6B 2Y25A 4A2GA 1KLUB 3IMRA 2L7UA 1NUGA 1ODAA 4K9EC 1PG7W 3NTCL 3L1GA 5DHEA 3LH9A 1UCBL 5D1ZD 5D4IA 2JCWA 1KNOB 3ABKB 1YO4A 1A22B 3WEBA 2Q0ZX 3DROB 4PV1C 1X5XA 2EUVA 4NUMA 2WKGA 3L3IB 3H2QA 5D7JA 4KKNA 5CP3A 1M1XA 2GUOA 3AREC 2XV3A 2GT9B 5DFAA 1B88A 4ALAL 4WW2A 3V0AC 1RUQL 3B9AA 4PJEB 5BVJB 3TOPA 1OAKL 2WINA 1NBYB 3V4VA 1N3NA 4B9IA 3HZMB 1WT5A 3DX9B 3P3RA 4P4KD 5ADPH 2FJHB 3RWEA 1QEWB 1Z3GH 2ICWJ 1YEKL 4JO8A 2YC1B 1UT9A 2EE9A 3IFOB 3LDBB 1IC5H 2X1OA 1LHZA 1B4JL 3FU9A 4X5WA 4Z5RA 1AGDA 1H8OA 2Q1EA 3PHOB 4M93C 5CZXC 3EDDA 2VSMB 1XBDA 1KCWA 4GO9A 3ZZLA 2AP2A 2IWKA 1KEML 2A2QT 2IBBA 5EA0H 1U8PA 4PJFE 3QYMA 1GJUA 1XH3B 2QPEB 4M4RA 4R26H 3MV7A 2V2TB 4CMMB 5TE7L 1DVFC 4TVPD 5D5MA 3GIZL 4OZIA 2IXQA 4HZAA 2ICEB 2UVEA 4F7KA 1BA9A 4NLHA 1P5VB 3RI5F 2DMKA 1X3DA 3PNWB 4HUXB 4RA0C 1KGXA 2IH3B 4UDTA 4A7GF 2XOTA 5F3HB 1CBVL 1ETB1 2N7SA 5AOZA 2IDTA 2YWZA 4ELKB 4EJ1C 1RZPA 1G7LA 3JVFC 3IGFA 3IMTA 4HJSA 2CGZA 5AAWA 4YN3A 2WYHA 4FHBD 3T3PB 3QXAB 2K4WA 1X6LA 5D4HA 1RJCA 2BNQB 2FQDA 4QHNB 4JHZA 4ODWB 1IGJA 5L2KA 4Y7OC 4NNYA 1RZFL 2JCCA 4DTGL 5KG9B 4AQ1A 5BQ7B 1ID5I 4WJKB 4JO4L 1PGRB 4GFTB 3L5XH 5H4YA 4NKDB 4GIAA 2VDPL 3VWJD 1H3VA 1SEBB 1WGOA 3T0BA 5IJDC 2I7OA 2FGWL 1YVLA 1MCLA 1V54B 3BPOC 3VXSB 1DZBA 4BWTA 3HW7A 1WIPA 4PJDF 5IFJA 1S9YA 2ZNWA 3QFDB 5IVOA 4JG0L 1R3HB 5I1IL 3D85B 4X8GA 2VRQA 5F1NA 4HG4J 3SDAD 1XSOA 1HH9A 5FW8A 1ZVNA 1KLFB 4HBQA 4QCIB 2FBOJ 2UXFA 4ZNCD 1A4BA 3O3EA 4NPJA 1A3ZA 1WF5A 1PCSA 5I18H 2ORBL 2YFNA 2CJ3A 1W72B 1J8HD 4MA8H 1J0JA 4HWZB 1YECL 1CVSC 4YFDB 3NIDF 2OMVB 4MD0A 2NW3B 4MMXA 3P1VA 3ET9F 4AYEC 5SX5H 5DT1L 5I1AB 3N91A 4K3DH 3EYQD 3P9LA 5IB1B 3DVNB 4A7SA 5LN8A 4L3AA 4UBDC 5EZPA 3S36X 3F58L 4U0RC 3KCPA 2XKNB 2VLKD 4P48A 4LRIA 3SHSA 2VDRH 4JRYD 2A6JA 3AZUA 2JK5A 4HP5A 1CXHA 5CEYA 4L9DA 4X7SH 3KXFA 5DQDL 5CJQL 2FEEI 2GAZB 3TO4D 3T2PA 4F58L 5K9QI 2J43A 4RH4A 4Z8FH 1TTBA 1U95B 3GSNB 5I1LA 1A1OA 1H3PH 5JIIA 1JZ2A 3UPRA 1LO4L 2WNKA 4NAJA 4PJGF 5MEPB 5T3XD 5AAPA 1Z9OA 3U4BH 2BX5A 2ITEA 3TF7C 1O6TA 1AMYA 2YA2A 3ARZA 3NAAH 2OMTA 5MEND 2DWSA 2LOEA 4RAUA 3Q1SH 4RBPH 5K39A 2CO6B 4PJ7A 1LGVA 2WBKA 3L4XA 3BQUD 4JM4L 3TJHD 2D7PA 4K8RD 2C7UA 1QFUL 1Q1PA 1DBML 3QZPA 4GEIA 4WUUA 5LGYA 4BCYA 1EERB 1DJSA 2DWEA 3LTVA 1BOGA 2QFPA 3FO1A 4M6OH 3O4LD 5TFSL 2Y1VA 4H1LG 2D4DA 5JW4M 1BYOA 3E2HB 5I5RA 3HMXL 3JWOC 4TNVF 2C4FT 3KL3A 2F9BT 2BS71 3TS8A 1A21A 1JD7A 1JFHA 1ASOA 2EZ0D 2AW2A 3ORJA 4X4ZA 2HZHA 2NYYD 4UV7H 3GSQB 1XDTT 3HHRB 5H37A 5ANME 4D9LL 1TZ8A 1L0QA 4LSQL 1KCSH 2WBJA 1I8MB 1PZ2A 2UZIH 2WVSA 2ZKWA 4JO1H 1A7NL 4Y2NA 2NCMA 3P0VL 2B2XH 4X80H 4ZZKA 4P99A 1LK2A 2ZAIA 4F33A 4LCVA 1S2EA 3EBHA 3VACA 1E4XI 1PQZB 1WIUA 2HX9A 3ZL1A 4PTTA 5IM7A 1QPPA 4XAWH 4L4TA 4Z78A 5E5MB 4J3OC 3VH8G 4CRPA 1SLUA 3Q7JA 1T1ZB 2O6EA 4QRRE 1NQBA 5J4MA 3UMNA 1D9KA 4KKCD 4JKWA 1MI5E 2C5DC 4LCIL 1JE6A 5DEGA 1H15B 4F3FB 3MTRA 1T03H 3MRKB 3C08L 1YPZF 5ICXA 1U2CA 1TJMA 1FO0H 1QUNA 3P3YA 5AB1A 5E00B 3DVFA 1WPCA 3WKPA 1CICD 4FZEL 3F85A 4NJAL 3RWJB 2BSEA 2G30A 1FL3A 1FL6B 1IEAB 1MCKA 1S7UA 5CFAA 3OAZK 4JL2A 4DEUA 3BWAA 5F93C 2NTFB 4M7KH 4LDOB 2XZAL 1FIGL 2NXZB 2DQTL 1Z5LB 2ZXQA 2KC0A 1HIMH 1FG2B 2X1WL 1MFBH 3ZMNA 4P05A 1TMQA 4U1HB 1BGXH 4W9GC 3PWPA 4NQTA 4KDTC 5DRXB 2J1KA 4GRLB 2C3VB 4NQSA 4U1KA 4Z7VE 2GJJA 4MBOA 3BH9B 3GMOA 1Z9LA 3EYFB 1X5FA 3NA9L 1Q72H 4OCNC 4YC2C 4A6YA 1JS4A 2OTWA 3V52H 1V55B 5G5DB 2P45B 4HJIA 5E8NA 2EDDA 3ILEA 3B2VL 1T83C 1IM9A 1GC1H 4AQEA 2QELA 4W70A 2LFGA 2F54E 4MA3B 5KSUA 1U8KA 5E4OA 2YEZB 3FQ1A 5EU3B 5EBLB 1TQBB 2O5ZH 3ULUC 1T7ZA 4ZDHB 5DJXB 5KS9F 1OY3B 3MLUL 5D1XD 3B9KD 3OKOB 3TWYA 3ZDXE 5I6XB 5KBKA 2Y1ZA 4OZFA 4PY8I 3ZL4L 3D2UA 4HC1H 2V9TA 4P46A 1A6AB 3GPEA 3C5SA 5F7EH 2D8KA 3TBVB 1HINL 4BUGA 4FNLL 4ZFZB 3HRZC 3TEYA 1UG9A 4JRXB 3RVXD 3M17B 1HXKA 3ARFA 3LIZL 3P4MA 4LQ1A 4U3SB 1D6VL 1MLBB 2MSPA 4HUWB 3PDOA 2NSMA 3ETSA 2VDOB 4JHWL 2A4CA 2R69H 3MMEA 2OXHA 35C8L 5IK3B 1C12B 2IFFH 2VZ1A 4PJIB 3UZQA 5I1IH 2WLLB 2D3VA 5AVQB 1JDCA 2B39A 3LQAC 4HK0A 2UY6A 3PWVB 4PB9H 1R3KA 3TZVB 3QWOB 1IGFL 3NEEA 3HMWH 4A66A 4AM0B 4Q97A 5DMKB 7FABL 3I2CH 1RHHB 1X4YA 2AXGB 2BNUA 5KVFH 4WDIA 5SV3A 3SE9L 2G3ZA 3VQLA 1DBKL 3WLWD 3PGDB 5I6KA 4YDJA 1GGIH 5C71A 2JWYA 4QRPE 5LAPA 4Q6IB 2VDPB 2HT3C 2I85A 4NI3A 4NOFA 4FOMA 1KBKA 1BF2A 3BGAA 4K9EH 4MNHB 3P0GB 1HCVA 5ICZA 1GY2A 3PE9A 1AAJA 3WKNA 1G1OA 4DP6X 1U58A 2WIIA 1DANU 2H1LM 3P3UA 1MH5B 4YXKH 3BE1H 3ZZSA 1OSPL 4EXKA 3PGFH 5J06A 4OCWH 1AIFB 2OJEB 3HUJF 3VFPB 5IEKB 5IMLA 1WFOA 3LNHA 1K5NB 3IB4A 5B3JF 1N59A 3MRCB 3SJVE 2YD4A 4FC3E 2N1TE 3VYNA 4YUEL 5FUCC 1SYSB 4KJWD 3INUH 4UTAL 3CZUB 3RGVC 3M1BA 4FF9A 3CHRA 2AJYH 4LSSH 2XN9D 3HE6C 1WTLA 3QQXA 5JO5B 1BPLB 2J25A 2B1AH 1C8QA 2I07A 5EO1A 1KB5A 5AW7B 4RMSA 1KIQB 3L3JB 5J6SA 1V05A 3RG1C 5I1DA 2MPAL 4PJ5D 4JM4H 2ZG3A 1UZGA 2EILB 4GRWE 3K4AA 5IHHA 2QADC 4OI7A 2WAQA 4PP2B 3NDYE 1QNZL 3V0WL 4AT6A 4MB1A 2A1WH 3MZTA 1HEHC 1KT2B 4X6DF 1EZLA 3WAJA 4ETQB 1AE6H 1KCVH 4LDEB 3U6RB 3VQ1C 3QIBB 2JKRM 4PG2C 1FDLL 4J8QA 4FG2A 3GM0A 4P9MH 5LAXB 2E6JA 4XO3A 1CURA 4N2FA 1I7TB 1OTSD 1XB8A 4S2SA 4BKSC 2YGQA 3S37H 4NENB 1JI2A 5LUMA 1X5AA 4FQXC 4PJFB 4KDWA 5D71L 3D4YA 4ANKA 2PO6B 1UXWB 1OWRM 4ZX4A 3ARUA 4LHUA 1A7NH 8PAZA 3P11H 1CLYH 2IFGA 2WK2A 1VRSA 4BQ9A 2PKDA 3MLSH 5IQ9A 3RWHB 3TCLB 5F1SA 5KUKA 2KERA 1V3KA 2N7AA 3BP7B 3HI5L 4TSBL 2BZ7A 3CZSA 4DQAA 4POZC 5E23A 2MJWA 3IMUA 4YBQD 2LLGA 4EI0A 3UTSE 3IETA 1F3JB 3T2QA 3HB3B 4G6KL 1YEIH 2IANE 2YBRA 4YPGB 4MRBA 3SDDD 2PW2A 5LGHL 3MODL 4G7YL 1U6AH 4ICXA 3M7OA 4PJAE 4QO1B 5D9SB 2JLPA 3REVB 2KS0A 1G6RA 3GI9H 3KWTA 3MJWA 4JDZB 4Y1AE 3QFJD 4KNUA 1IBGH 3QDGA 4R7LA 1IZJA 5DS8B 5F7DA 3DURB 1JDAA 3ZL2A 2F58L 3FF8A 4W9IC 5GGSB 3BZEA 1UZ8B 2AQ3A 1BVLA 3L2NA 4AMWA 1AO7A 4MJHA 1FI8C 1KGCE 4HSAC 5D2LA 1NIEA 3V2AR 3ZKMC 5CBAB 3BMVA 1FIGH 5EUKA 4YDKH 3UBXA 4LU5H 3IDNB 4OJFL 2UXVA 3QUMH 3S48A 2OZ4H 4K23H 3BKCH 4PSRA 2FL5B 4AKOA 2PF6A 1IAOA 4FXKA 4ZD3H 2YPVA 4G8AC 4D2NA 2FT6A 3IKCB 3MBWB 4HIJB 3T2OA 3W11C 1W8EA 3EJQA 3CZEA 4XTRC 5FHBL 4WO4B 4ODUA 1TQUA 4M1CC 4PLKC 4KROB 3TH4T 3CFCH 4NQEE 5GRVL 3D3VD 3LPFA 4AITA 4NYLA 2X4OB 1CDGA 1RZ8B 4ZW6A 3RDTB 4UNVA 2TAAA 5DGRA 1P84K 1KFAH 1ZLDA 4K7PL 5JW5B 1BEYH 1M9SA 4MDIA 3T0EE 4OKVB 1YNLL 1F8TH 2ZXEB 3QULB 1XCTA 4I48A 3TT3H 4ODHH 5JXAL 5KJ7E 1FNLA 1IC7H 2LVEA 4GQQA 2HLFD 5J13B 3QC5X 5HGAB 3BPLC 1RJZA 4BIKA 3QS2A 2XZQL 1MCOH 1FORH 3I6GB 3O6KL 1IKOP 4KUZH 1U3JA 2V7HA 2QVFB 5LN4A 5K9QG 1OIOA 2RQ8A 3BCFA 3VXTB 1UD6A 4HIQA 4ZFGL 3CFUA 5JYLA 1B90A 1GGCH 5DQJB 4XVUD 1YEGH 1ZANH 3TYGL 1LEIA 2G9KA 4Q4IA 1X5MA 4A7UA 2R2EA 1J9SA 4WUKL 3WS6C 3ZU8A 3K6DA 2NCEA 1I3VA 5DDHB 4XMUA 1E42A 5EUOA 2R15A 2P42B 3JWOH 2D0HA 1HXMB 3TTSA 2ZF8A 1TZIA 3VDCA 1PZ5B 2H41A 4PGDA 1Z5HA 2DM7A 2EIJB 4F7MB 1EAPB 2XBZA 4X4XB 4XXDA 2NY2B 3GSVA 3VFOB 4LDCA 4M7ZC 1S9KC 1YG9A 3S3DB 3M8OL 4NN7C 3WL9A 3DGGA 5FO8B 3EJUA 4V2BA 5AWNH 4KI1A 5DTFB 2QZQA 2CR0A 4LO9A 5BO0D 2A9CA 5HGHB 2F5AH 2X4RB 4QRTA 4O4YL 3BP4A 5IFHL 4IIZA 2XJLA 5DR5L 4J3OH 4NM4H 5DMGC 1R0AH 4GKOA 3VTAA 2YQ2A 4XNQB 4ZS6C 1LE9B 4JKLA 4Y2DD 1FZMA 3OGCB 5ANMB 5FGCE 5J1AB 5J7CC 4PJHE 1Z6JT 2MH4A 4FNQA 4X9YA 3NCFB 2WZ0A 1WZMA 4D0DA 5ECGA 3MNWB 4MHHG 3EO1B 1D5RA 1W0WA 2ZX7A 2BSCA 1A1MB 5B8CA 3SPVB 3VRIA 4P49A 2BP8B 4RSYA 4HEPG 3VXNB 4CVUA 4JLRB 3GIVA 1LMKA 3EOAA 2QQNL 3BESR 4HWEH 5JZ7D 1IKNC 2CBQA 4BFJA 2AJVH 1NEZB 1YN6A 1XGPB 2BFGA 3HNVH 2BSSB 4NM8L 3RU8H 4D0CA 2PWEA 1JOIA 4CSPA 3FH8A 3F5WB 3CVIH 2ZX8A 3LV3B 5I74B 2PNDA 2L7EA 2GKIA 3A67L 3BAEL 5AKSA 2VLLB 4PJ6A 4CC0A 1SJEB 3CHQA 2P1YA 1ICTA 3IMWA 4HJJH 4AL8C 1VERA 2UXGA 1DP0A 3X1NA 2F7IA 3ARDA 4PV9B 2VXQA 2F61A 1S5IH 4ONOA 4JRLA 3MV8D 3V6OA 1T5WA 1N2RA 2VH5H 5ETUA 3SPCA 3IXTB 4MS8C 2YAMA 2XQBL 4J3BA 3SGKA 3ZHNA 1A6ZA 4IK7A 4LLWB 3VI4E 1NIFA 5DEJA 4GG6F 3WNOA 3L1OH 5BMFL 2LQRA 3O45B 4XPGL 4M8RA 2X89D 2FX7L 3FT3A 3GI8H 3N1GC 4TQHA 4ZAKA 3U46A 3CXDL 3V4LA 3ZDYB 4BZ1L 5DD6A 2CUMA 4ZOEA 1LNUB 1YEDB 3NIFE 4UUJB 4Z7VB 4B9FA 1N18A 3QEUB 1MFVA 3I3EA 5GJSL 4WI0B 1CDCA 5DJ2B 3FUIA 1NUFA 2FO4A 4G71B 1BJ1H 1QW9A 1VKXB 1OEZW 1SM3H 1U3HA 2XIBA 4F7CB 1TPXB 3P4NA 4Z95H 1M57B 3NDZE 2H6OA 1YN7B 5IUSA 1A64A 5BRZD 1WFNA 2JKTM 2F54B 1XX9C 1WV7T 4XCNB 3MODH 1BZ9A 5C0CE 2EE0A 4LNRA 3GF8A 2M8XA 4GQPH 2BIPA 5M94B 1GGTA 5AW4B 3LQAH 2XIIA 3IFNH 3U6XA 4P5KA 5AENA 3GD1C 1M7IA 1COBA 3KL0A 3KGSA 2E4FA 1HXYA 2NNFA 2OJZH 4XNUL 3D25A 2ZUQC 5D72L 2QSQA 1ZGLB 4OIIL 1INEH 1MFNA 1AR1C 2JJTA 2Y5QA 3Q6GL 1G1YA 3ROOA 1SHSA 2WLIA 2IAMA 4YZFF 1NFIB 1MSPA 2BO0A 1R5IB 5JTWA 4Y4KB 2W88A 4E9QA 5LWYH 3TA3A 4FQ1L 1G0XA 2E0PA 5F0JB 5CD3B 3VXQB 2VZTA 2NY4C 3AG1B 3QJFB 4L1SA 3VFWA 4EUPB 2PXYD 3QHZH 4BFBD 5KBPA 2WCSA 1HNFA 3JWDC 1S9WA 1N0XH 2A73B 1YAIA 3QH3A 4PU2A 4IQHA 3CNKA 1E9PA 1G7IB 4GUOA 3EYSH 3BGMA 4MBRA 1YEHH 1NWPA 3VJ6A 2K7QA 4QRPB 3S4SB 4BK5A 4ZODA 4NRXA 3RVTD 3FHQA 3O3BA 1MIEH 1MJ7L 4Z7NE 1W0YT 5KBDA 3UABA 4AGOA 4K71C 4X6CF 4H44C 1NGPL 3QZBA 4C59B 4RNRA 2NY6C 1WLHA 4ZS7H 1QPXA 4KNQA 4YVNA 1E30A 4FFYL 1K3ZA 2Y4SA 3H0TB 3LN9A 5E8PB 1QWHA 3ZX1A 4TRPH 2PTVA 8FABB 5KVDH 4ZMPA 1JHKL 1A6UL 1Y1DA 2IV8A 2ZOLB 5ID0A 5J56B 3E6HB 3ZKSD 5B39B 1VENA 5B38A 2Z8SA 4NUGH 4H40A 4XOEA 3HIZA 5KYXA 5D1ZC 1JZ4A 1BFSA 5FUZH 2A6KA 3UTTD 3N55A 1T21B 3MRHB 1Q38A 1OV8A 2ICWI 2CIIB 2QV4A 3OG6B 2VMFA 3ARGD 4KKLD 4KZ0A 2Y7MA 4LGSB 1RV6X 1T2XA 4EN3C 2XVLA 2YAQA 1HVXA 1I8UA 4L4VA 2WM0A 3WUWA 1KC5H 4XZUB 5EWIH 2LE9A 4HK3N 4QTHA 1IAKA 1UVQB 5E2JA 2X0VA 4HKBB 5I1EL 3PQYE 4N3UA 3BSZH 3LPPA 2A83A 4OCSH 3JSSA 4DPAX 1PDKA 1RI8A 1SUHA 2OL3A 4YE0A 4D9RE 1V5JA 1WG3A 3EOTH 2AABL 2GIXA 4FN0A 1F3RB 4C56A 3ZRSA 1F4XH 1XGYH 4OTXH 4I2XA 4QIRA