2ADYA

Structural basis of dna recognition by p53 tetramers (complex iv)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
197
structure length
197
Chain Sequence
SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of DNA Recognition by p53 Tetramers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/dna
molecule keywords 5'-D(*CP*GP*GP*AP*CP*AP*TP*GP*TP*CP*CP*G)-3'
total genus 53
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2adyA00
4L0ZA 4LO9A 3EXLA 3Q05A 4LOFA 3WTSA 3EXJA 1LJMA 3WTWA 4AGLA 4AGOA 2ATAA 1EAQA 1CO1A 3D06A 2X0UA 5A7BA 2PCXA 2P52A 2IOMA 1KZYA 2AHIA 1H9DA 3WTYA 2RMNA 2J21A 4AGQA 5AOIA 3QYNA 4IBWA 4L18A 2OCJA 3ZMEA 4KVPA 2H1LM 3VD2A 2AC0A 3US1A 2VUKA 2X0VA 2YBGA 3WTVA 3IGKA 3D07A 1EANA 5G4MA 2IOOA 5G4OA 3D05A 5ECGA 1GZHC 5AB9A 3VD1A 1CMOA 1E50A 1HJBC 5KBDA 1TSRA 2BIMA 5LGYA 3QYMA 2J1WA 3WTTA 4IBYA 3US0A 4GUOA 2XWCA 1HJCA 4A63A 2FEJA 5ABAA 2J1YA 2BIQA 5G4NA 4AGNA 3Q01A 2IOIA 4IBTA 3KMDA 1YCSA 5AOMA 5LAPA 3Q06A 3WTUA 4QO1B 4MZRA 2BINA 3KZ8A 4L0YA 2GEQA 2J20A 2X0WA 3D09A 1TUPA 1HU8A 5AOJA 5BUAA 2MEJB 2J6WA 3VD0A 1EAOA 5AOKA 4GUQA 1GZHA 1UOLA 3D08A 4IBQA 1IO4C 4HJEA 5AOLA 2XWRA 1T4WA 2J1ZA 4IJTA 3WU1A 3TS8A 4IBVA 4MZIA 4LOEA 2WGXA 4IBUA 2ADYA 3WTXA 4AGMA 2J1XA 3D0AA 2BIPA 4AGPA 4G83A 3IGLA 4XR8C 4G82A 4IBSA 2BIOA 4IBZA
chains in the Genus database with same CATH superfamily
4PRHB 4PJ6A 1D5ZB 2VTFA 3MUGA 3WEMA 1VKXB 2EVIA 3GO1L 4YDVB 4KKPA 1T03H 1UA3A 1FGVH 5D7EA 4KKNA 4NO3B 4FLSA 4KKRA 3A47A 1RJZA 2BOBB 2GVYA 4DPBX 2ID5A 1ZVSA 1I7ZA 2BH0A 4YIQA 4D7BA 4KY1H 4HD5A 1JGEB 1OGAE 1OW0C 2CUHA 5GS2D 5JW4R 4DP8X 2HJFA 2GJJA 2AJYL 2B59A 3OR7B 3HZVA 3WD5L 2AEIT 4PJCF 3V10A 1ONQA 4N0UA 3UYPA 3FMGL 3G6AB 4FNSA 3VFSB 3QJFA 3LD8C 4GSXA 4CSPA 1CTMA 3X1NA 4KMLB 1J8SA 1IAOB 2FDBP 1MRFL 2YMTA 3V8OA 4RFEA 3V55A 1AHMA 4X6CE 4FABL 4EZLA 4RSYA 3VXRB 4PJDE 3KH4A 4HUMB 3DO7A 1IGMH 4OCLC 5TE6L 1FO0L 1I8MB 4K8RH 4V1DA 5JXEA 5GZOC 4GO6B 1PFOA 5CXPA 3APCA 3H7BB 2Z9TA 3LZPA 3QI9C 3ZKNC 4PRNB 1U8MB 4U1SA 1JNLH 4R4ND 3VWJA 5C0AA 4AXWA 1KCVL 3KPSB 3EFDL 3JV0A 2DKUA 2J3SA 5EUKA 5LB1A 4LKXB 5IQ7H 1MCNA 2NCEA 3SGJC 3HNVH 4G2AA 2QSCH 2RALA 2Z3FA 1GYUA 4FCAA 5BZWA 3X11B 4Y19E 1GGYA 4M5YL 4QO1B 4RGMC 3JT0A 3GI9L 4UT7L 1WWBX 1N4XH 1SDDB 3OHMB 4WHTB 2DLHA 1C5DB 1YSOA 2WBJB 2WXRA 4JM4L 4PTUB 1Z9SB 1OB0A 1N0XL 2BSED 1RUKL 2VXVL 3NIFB 4OLXH 4YEEA 3AT9A 2GB2A 5AOJA 1AQHA 1DVZA 2FSEB 5TD4A 32C2B 1WRFA 1N0LA 2IADA 3MYJA 4M1CD 2D9QB 3PWJB 5HHXH 4K73A 4WW1A 4N2OA 2BCMA 4JRXB 4TLUA 5DRNA 4UQ2B 4JPSA 4BEIA 2EDQA 5DTFB 4ZMNA 5BZDA 2XTJE 4IHBA 3WSQL 1F58H 1JNNL 3APDA 2OYMA 3PHAA 5C6TH 5E94B 3VTAA 4QT5A 5KAQF 1P4IH 3PWJA 1MHHA 1YZZA 3Q8EA 2HLFC 2QQNH 1DQJA 1JGDA 3KPNA 4N3UA 5I6NA 3NQIA 4BE6A 1LEGB 1CDGA 3FQWA 3N85H 3ECBB 3M86A 4IBZA 4JFDB 3LEVH 1KEGH 3VI4F 1RJYA 4H13C 3B5GA 4LPVA 3TO4C 1L9TA 1NC2D 1O7SA 2F7RA 3NFNA 3FU7A 2AZUA 3G5YA 3O41B 5GRUL 5KYUB 1LEKA 4HGKC 3K71A 4PCTA 3ZX1A 2V5MA 1IGYB 5FKPB 3FO1B 4WFEE 3ZK0A 5LVEA 3WOVA 2Q20A 2F19H 1H9DA 2DQEH 3U4EB 1MFDL 3MDJA 5EA0H 4XNQB 4NWUL 3X12A 3RWEA 1D7CA 4LSQH 2R51A 1IAIM 2E7BA 4NZUL 4P4KD 2JCCF 1V3MA 2C3VA 4P9ML 2XXMB 3ZE1B 3MRRB 2DWDB 3SBWC 5J6GB 2IPUG 4MJ6A 2P28B 2P42B 2Z64C 2V0AA 4L9DA 3U6RB 3VXRA 1FNHA 4LBEB 4TQEH 1LVEA 4RGNB 5IW1B 5TE6H 1VEOA 4J6IA 5G4OA 2Y3NA 1OAXL 4KJYA 2H6PA 4JFXB 4PY7A 5F7YC 3AZUA 3G6AA 1XF3A 5BZDB 3WNNA 4RWHA 1JV5B 1R19A 4NM8H 2MQ3A 4K8RC 2RGSA 5IHWA 5L6YH 3L95B 1D5IL 3QI9B 2GAZB 4ONOA 4PJ5D 4BIKA 4GRMB 3G5ZB 5DD0L 1GGCH 4A7TA 4Q4IA 4OI7A 3C09C 3I6KB 3IJYA 4U3HA 5T5NF 5HHNA 2IEPA 5ANME 2WQRA 3OBAA 1AS6A 2DIAA 4XC1L 1HZHH 1MWOA 5SV3A 2Q3AA 2WN3A 3B6SB 5F3BA 3MJGX 4HIIA 2FZ3A 1KF9B 1EQWA 5LDSA 4QO1A 5CAYB 4ONHB 3QIUB 5B1BB 5IOKA 1NOFA 2F54B 3CZFB 2H45A 2FX8L 3H53A 1N3NA 2Q3ZA 3MV7B 4KKLD 4ZJ9A 4LHUG 4LCCC 5D7JA 1IGCL 2V5RA 1YNTF 2JQMA 4U1SB 2PCFB 4GXUN 5T33L 4LCYB 4FMFA 4EF3A 3RRQA 5I2IA 1CGWA 2Z0UA 4XC3L 3TNNB 3EOTL 3D4ZA 2V5YA 3LRGA 3NCYP 2J5LB 3EDJA 4GIOA 4YDNA 4BXSV 4EZMA 1FRGH 1QLEL 1AQKH 3ZTNL 4E9SA 3ULUH 2C3HA 3APNA 2FECI 4YR6A 3BJ91 3KDPB 5C6WH 3E1ZA 5D72H 3BWSA 4XOCA 2QQLL 4OJAA 1E5UI 2RIKA 3DX1A 4OAWA 1GRWA 5D8JL 1T80A 4LCCB 3R1GL 5I30L 2HTLD 2BZ7A 2MOQA 1UD5A 2WN2A 3R19A 4OLUL 5HDOA 1NFIA 4DUWA 5I1CL 3EF4A 1JYWA 5F93C 2DKMA 3SDXF 1DCLA 5JOFB 1G7QA 3CFDB 3MA7A 4BFRA 1K5WA 2WOYA 1DBML 4XR8C 2OULB 3B9EA 3FSVA 4ODTH 5DQJA 3UC2A 1FYTD 4F2ME 1A6VL 4X4XA 1BZ7B 1ODUA 4KROC 3UTQB 5CZVH 5GGRB 4Z6AT 1KSRA 1N3NB 4RRPA 3DGGA 1JE6A 2AV7B 3L3JB 5EWIL 3B1TA 2ZYSA 3IDJA 5C07B 1LO3L 2ZAHA 2ZWYA 5A7BA 4DEPB 4MQXD 2EXWC 2AK1H 4RX4A 3HIZA 1XXDC 4HXAH 1B2WH 4OD1H 3VGGA 1GY1A 1AOHA 4AQ8A 4WW2B 2AQSA 1AD0A 4HJSA 4W6XB 1T6BX 1SJXA 1FFOB 5E23A 3QH3A 4TLSA 5F8QC 1IT9L 2VIRA 2ZNWA 1ORSB 3MNZA 1E40A 3GBNH 4L3EB 4OZGE 2EIJB 1INQB 3RYMA 3ZDZB 4ICWA 1GH7A 3GLEA 3IDGA 4OLVL 4K15A 2BHFA 4XMKH 4FD0A 1YY9D 4MNHB 2FBJL 3HG5A 4NX0A 2ZZUT 2H6PB 1CTOA 1KLUB 1SVCP 1LO5A 1QX1A 3TNMB 3DRQA 1MHPH 3SQOH 1DHKA 2YGQA 4JG1H 2QJDA 4O02B 3ZYJA 1I8AA 3QRGL 4Y4HC 4BFJA 4MD0A 4D94A 1TEGA 1YPZE 1A3ZA 4PV8A 3MRRA 2CU9A 2W81C 4MAUL 5AB1A 1DZ0A 3SE9H 4E68A 3V0WH 4ZPTB 2VL5B 4TUKH 1AHKA 4PCSA 3CSPA 1WBYA 2C9AA 1V27A 3X12B 1U8LA 4GQ9L 4XP1L 5CBEA 4FI6A 1EFQA 4WWKC 4PSRA 3VJ6A 4KI5D 5MERA 2IF7A 2R0WL 1GZQA 2YRLA 4Q52A 3UYOD 2IWKA 1T3FA 2EDTA 4HPYL 2A2QT 2XIDA 1Z9NA 2CDEA 4IKJA 4Q6YA 2JFCA 2OYLA 4E9TA 4EMZA 4WHDA 4AL8H 1BMGA 4ODTL 4WY7L 4QXUL 5JIIA 1E3ZA 4XZUA 1ZLDA 2VLJB 2LFGA 3C6SB 4FHBD 1TQCB 5A2AA 4RSVA 1NKOA 3RFZC 2GJ6D 4KOBA 4AKOA 4G8IA 5I9QB 2K8MA 5HYIA 3NJNA 3S4SB 1A3QA 1DQKA 1LO4L 2W92A 3SY0A 3MV01 3OLIA 1WWWX 3R7RA 3U9WA 2IGTA 2KPWA 5E4EB 4JM2B 1G9MC 1KMGA 2YAMA 1MWAB 4P59L 5LGKA 1AE6H 5E6ZA 2W65B 3IPFA 5CEZH 2FIKA 4N25A 1QFWI 2F74B 4WW1B 3BVTA 5HHVL 4MD4A 3N44B 1HDMA 4I1RA 4L4VA 1FVCB 4AYFA 3SJVB 2DLFL 2L4OA 3LKPA 4OR1A 3CQPA 1AXSA 4KROB 3KLQA 2ZCZA 3WCYA 3DX8A 2WXFA 3NT0A 4GP5B 4NKDA 3WY4A 3LH2H 2CUIA 4IU2A 4G7YL 1H15A 3UCQA 3RVUC 3QHZH 3OB0K 5IHZB 4OCNC 4WEUD 3TV8A 4TPRH 5CUSH 3QPQD 2R56H 3PREA 4BKLA 1NBVH 3ZHFA 3F5WA 2R1XB 3DOIA 3ILDA 4KXAA 5I1EH 3WTYA 1PMYA 1TQTA 2YRBA 3U4AA 4MJJA 3EYVB 5DK0A 1AJ7L 4GBXD 4XMKL 5IWLA 1MSPA 3HZMB 1F6LL 3K2IA 4KVPA 5I28A 4YHOH 3ULUF 2X6VA 3ROOB 4QRBA 4V1DB 2JELH 4YZFE 3VI4A 2VLRD 3D5OF 4HGWA 1M4KA 2YSTA 2UXFA 5DYOB 2WCPA 4DW2H 2FJUB 3H0TB 1U3HD 4I8DA 1OHQA 3CXDL 2WLIB 3HE6B 2GY7B 1BPLB 4LSUH 3S7GA 1PYWB 3CXHJ 3FQNB 3QUHA 1A7BA 1HH9A 2NNFA 2ARWA 4WFFD 4F58L 1J7VR 4QRFA 1IEBA 1ZT7B 2CRMA 1ZAGA 5IF0A 4OZFH 4X9HA 4P3CH 2WZAA 2PP8A 4UUJA 1FP5A 3ESPA 1T3FB 2Z31D 2FGWH 3LEYH 3CQFA 3QQ9D 2E76C 2E27H 3QFJE 4PVMA 3WIHA 1NCBL 3RNQA 3OJMB 3SO5A 1QACA 1ZANH 1YEHL 3I50L 5IP4A 4AY0A 4J4PD 2WVTA 4P2OB 4WUUD 4N8VG 4GFXA 1B0RB 4RETB 3EFFB 2NNRA 5E2WL 4PLJD 2ZCHL 4QOKA 3QP3A 5IK3B 4GW5B 3U6XS 4R26L 1OPGL 3U7WL 3KWVA 2LLGA 4YLBA 3ULSA 4DOHB 1TQCC 5I1JH 3FSZA 3FU3A 3VD7A 3RWHB 4Z7WF 1LP9A 3I6LD 1JVLA 2VR7A 4QRPE 3MJ9L 1TTBA 1WZKA 1I9IH 3VXPA 2O93L 5E4EC 1NDGB 2J55A 2JTYA 4MZIA 5B39B 1XB3A 5K9QG 2VW4A 2W0PA 5IBTH 4WV1B 4EI6A 5K9OA 2BSDA 3CVCA 3HJEA 4JG1L 1NLDL 4JKKA 4GAJH 4XBGB 3TBTB 1YO4A 2V2WB 3RBSA 1Q9KA 3B4NA 4R7LA 5IVXF 5DEGA 5C09D 5FCSH 4KRPB 4AGPA 1OB1B 5HYJE 2ZE0A 1TVDA 4NUGH 4S2SA 3PWPE 1H8SA 2V2TA 2EKSB 3GO1H 1XVSA 4WNQB 1G7LB 2GKIA 4NO2A 4S11A 3VXRD 3EYUL 1UA6H 4PRPB 3RU8H 4B60A 5DJ6B 5TQ0H 4ZMWA 1YN6B 3NPSB 4H7VA 4JQXA 3D2TA 1D9KA 4H26A 2V8LA 4X4XB 4W9EC 5DQJB 5SWSE 5F9WB 1JCVA 1I8KA 2QTVA 3ZE1F 2IPKB 3G3LA 1K2DB 2X3AA 4IBWA 1MXDA 3MLSH 1NEZB 3QA3A 4HUNB 4RAUB 4ABWA 1P6WA 2HT4D 2CD0A 3QUMH 4FP8H 4ODBD 4P5TA 1KBPA 1YUKB 2G3ZA 4H44C 5A43C 4IJ3B 1A6AA 3EJJX 3RX7A 3UOAB 2YEVB 4PJAB 2CO7B 2N3JA 3BUQA 3OV6A 3CC5A 3PF2A 4LRIC 3B3IA 4H25A 1OHZA 5BXFB 5I30H 2E47A 4XVOA 4U1NB 5D2NC 5IJKA 2DKSA 5DD3L 3AGWA 3FXIC 1XIWD 4G5AA 3PWPB 3HUJB 4XOBA 2G9KA 4TVPL 5F2FA 3QDHA 1PCSA 3TEUA 4JVUA 4UOW0 2CUMA 4MA1C 3CSGA 4YL4A 1U93A 5D7JC 3ALXA 1BD2A 1WFNA 3DKHA 4U3SA 1OD7A 1TVBA 2AJXL 3BT2H 3IS1X 4NKOA 3NCBB 4X2UA 2GSGA 2JKRM 2EDHA 5BQ7A 3OKEB 3G5XA 5ITFA 5IFHH 1N6QL 3JSSA 5ABDE 2DQTL 4ZUTA 4CMHC 4HH9B 3T0BA 3ZKQD 4CU8A 4MMZA 4DKDC 1P5VB 2XKUA 2WUBH 3MUZ1 4K23H 3QFGA 3VFTB 3A23A 4APQD 6TAAA 3RWGA 1F3RB 4XH2B 2HVKB 1BMZA 1QUNA 2OS7A 2QGDA 2V3EA 3O9WC 3V79C 4FADA 3T3PF 1N8ZB 1RULH 1XCQA 2PWDA 1IT9H 5GJTH 1U58A 1RPUA 1VF5C 5FPIA 1UOLA 4XPHL 4TSAL 5DQ9A 1WGOA 1E6OH 2D7TL 4I4WB 5I16B 3TJEH 4K7PX 2D2OA 4D9QD 3MO1B 5F7FA 3BVDB 1IB5A 3HMXL 1BM3L 4TM9A 4P4KB 1FH2A 5GS0D 2BHUA 4KTYA 4I0CC 2KLRA 3ZZ1A 5DF0A 1A14H 2ADYA 1A3LL 5FYLD 4RGND 3MV11 1PZCA 1BEYL 1SYVA 2RD0A 4GAFB 4TOYL 2VMFA 3SDCD 1JNJA 1E9QA 2D0HA 4XP4L 1E4JA 2QLVB 3RVTC 4FP8L 4X5QA 5A2FA 5KSBE 2HG5B 4CJ1A 1YC7A 1YMHA 5K9QI 4XMVA 4AGLA 3G5VA 2IJ0C 2BMKA 3Q1EA 4EDWL 2ED6A 5IJVB 4G8GA 4B3VA 5D7SH 2YMXL 4J27A 4LMQE 2YQGA 4NC1C 4YLQT 4F2FA 3DYOA 4Y8AA 3SGEH 2LU3A 2CHNA 3QWQB 4TSCH 1BAFH 2OX5B 2IBBA 4JFDA 5H94B 1DR9A 4KGLA 5C70A 1TU2B 4L4JA 3WFZA 4EO5A 1FYTE 2BFVH 4APXA 1GJWA 1T1ZB 4YSDA 2PYFA 3QQ9C 3ZQXA 1QHOA 3VRLF 1NANI 1DQJB 5B8CA 1UCTA 2Y7SA 1F5WA 3P77A 4XRCB 5KN5A 2CG9X 2PP9A 5DTFA 1UACL 1H3GA 2WWOA 2VWEC 2NY0C 4OVUA 2XWEA 3WLBB 1E4WH 1Y7VA 4N2KA 4RA0C 5DJYB 4FA6A 5HDBF 2YSSA 5HVHC 4PQXA 3S96B 4FYQA 1IARB 3P0YH 5EBWB 2BS71 1E90A 2JSFA 3KL0A 5CLZA 2HKHH 1BF5A 3WE1A 5KVEH 1MREH 2XC8A 1TKWB 3TYGH 2OZ4H 1QHPA 3ZOAA 4IMLB 2YIHA 1S7WB 5FGCE 1KGCE 5IY5B 2ZCKH 5ICYB 4LLYB 3P4LA 2VZVA 5T5FH 3OHXA 1P9MC 4OCWH 4Z0BH 2CAKA 5FM5O 3BQUB 3SDDB 5I76B 2EVGA 5DJXA 1C5CL 4ZFFA 3IRCA 5AVTB 5BJTB 4NPYB 5MI0B 4V2CB 2NW3A 3NH7L 5C0AB 2AJ3A 4QHKJ 1TETL 2AAAA 1DN0A 5J3HD 1FYTB 2DQIL 1AGCB 1TQBB 1U8MA 4KTDL 2PO6A 3MACH 4LHQB 4MWFB 1QD0A 5GRZA 1XEDA 1HHKB 4FQLH 2FO4B 1T1YB 4YLCA 5IIEA 4PJ9D 1TO4A 4N1CA 3NJVA 1UURA 2WWMC 3QORD 3QPQC 5TDOA 1TYEB 1AZCA 1HQRA 2ZX9A 4L1LA 1EJOL 4I9WE 3T0EA 1B3IA 4X5WA 4BFKA 2NMSA 5F7DA 2CCVA 1BFVH 1CQYA 5BRZA 3NK3A 4OD2A 2AABH 3DX4A 2X05A 4JN1H 1NGWB 1EH9A 1NCDL 4ZUUA 2EO1A 5A3IC 1W91A 3DOSB 4L2YA 3V0IA 1Q1JH 2JV6A 3DGCR 4ZOAA 3LSOA 1WS7A 2FATH 4XN7A 1RLBA 5HYQB 1ETB1 4XP9L 4AEHL 3MBED 4OBRA 2LW3A 4AVIA 3ULUC 1V7NL 2CSPA 3KG5A 5E00B 3HZYB 1RJZB 1LMIA 2CKBL 5BVJB 1UXSA 1MRCH 1TOXA 4NQTA 2UZYA 2X0UA 1ZEAH 1Q1JL 2R2BB 3BHBB 3KLLA 3QDJD 1A9BB 4KKBD 4K5OA 1ED3A 4W9IC 4HJJH 4Z7OB 4A2DA 3SO3C 3IGAB 4FG0A 3UAAA 5DJDA 2DB8A 2DOCA 4OBSA 1JERA 1PAZA 2VE6B 4HBQA 4F2EA 2AXFA 1CXLA 2UZIL 3HLKA 4FFYH 4LASL 1MELA 5BCAA 5I75B 4J28A 1O6SA 4BSJA 3VD2A 1JHTB 2PCPB 1H5BB 1X9QA 2HFEB 4MD5B 4PU2A 5F7MC 2YBGA 1DBAH 3NQKA 3MUY1 4J8RA 1XGZA 2V9QA 3W5NA 5T1DL 5JUEL 2MCPL 1FG2A 1M7IA 4ZTEA 3KDMB 2EC9T 4PJ8D 1AXIB 3OMAB 4I5BB 1UHVA 4P2AA 2MFNA 4GG6A 4XO9A 3RL2B 5IEHA 1A4JB 1BECA 4AQEA 1C5CH 2F53A 1AY1L 5EBMA 3I02B 3WFHB 5B1AB 1MZYA 1TIUA 4YGVA 2Y6TE 3AG4B 2VN6A 3UBXG 1U8IB 2E9JA 1HWHB 1NCIA 2R83A 3SDDC 2UY7B 4Y7OC 3V5DA 2IWFA 1A6VH 2YMXH 4ZFZB 3HLAA 4LAJH 1L7IL 2BSCA 4Z7VF 3ME0B 4DVBA 4Z76B 3M46A 1QQDA 4M7JH 4N22A 4TTGA 1FHGA 2XFXA 1NJ9A 2I9TA 4JFYA 5B1JC 2WIMA 2XDHA 4PJBE 3MRQA 2NT0A 2GBTA 1KYDA 2DTSA 3V9EA 1UENA 3KPLB 2YUWA 4ORZC 3H9HB 2K4WA 43CAB 4F7TA 1OOAA 2I07A 2Q9OA 3UG5A 1CE6B 3ASOB 3L7EB 3MJ7B 3MXWH 3WHE1 1MJ8H 1SEQH 5KVFH 2H41A 1FO0A 2WVSA 2XQYA 1CFBA 4CU7A 1JTPA 4N5EC 2HRPH 3MZGB 2BVPB 2XG4B 5T1KA 3FCTA 1UXWB 3CHPA 4N8CL 5D9SB 2XZCL 1FZKA 4JG0H 1HILB 3KEDA 3TIEA 3U36B 4UNUA 1EDQA 3QHFL 5TE7L 4JBSA 1V10A 4I7ZC 4MJID 1EJ8A 4WEBH 5JHBA 1OL0A 1JK9B 4HIEA 4K94H 4ZMZA 1DVQA 4PWHA 4Y19D 3FU8A 4KO7A 1U3HB 5CN2A 3HE6D 2VGLM 2FO8A 4H0LC 2ZUXA 3VRIA 4OUUA 3WL9A 4ZNCD 1R3JB 3IDXH 5DO2D 5KSAC 2F6AA 4LAQL 3O4LB 3O81A 4ISVB 5HSFA 3AT8A 4XPAH 4BRJA 3OKOB 3UMTA 2XWTB 5DVNA 2DQFA 4LOUC 4YDIH 1THCA 5IG7A 1BVOA 2Y24A 4I2XA 3Q5OA 3HPJA 4Z7NF 4JRFA 3DDFA 1CUOA 7FABH 1KV7A 1KLGB 2W9LA 5GJTL 3ILQD 1LWJA 1O7DE 5CZVL 1D5MB 2A9DA 2X6CA 3VSQA 3LXBA 1ZIAA 1U3JA 1U8JA 2BSRB 4H8UA 1BDYA 4M5SA 5BS0D 1ETJA 1K6QL 2Q2LA 3VFNA 1M05B 2DQUH 1D6VH 2JLPA 4BZ2L 3KWWA 3ZL4L 3BW9B 4LARL 3HCVB 5HY9B 1WA0X 4ZO7A 1WBZA 1FL5A 4YHKH 1HINL 2ZKXA 2A6DA 3N91A 3IGUA 4UINL 5IJDC 2OTUB 4NQSA 1A14L 4Y19A 4UILL 3DMMD 4BQBA 4ZOBA 4EKXA 3LZFL 3LZRA 5D70H 2AJYH 2ED7A 1I31A 4RFOH 1LWHA 2IDFA 2Y5TA 4PGCA 4Q9QH 2RA1A 4LARH 5KVEE 1Q4NX 1VACA 2OV0A 2XI9A 1I9RH 5MHSE 4AJVA 1I8IA 1BAFL 4RMUA 3QUML 1F97A 4EUPG 2B3IA 3HG1A 2Y0SA 1O0VA 1O5PA 5AVSB 1G87A 3I9GH 4PRPD 2XVKA 4MCMA 3MODH 1VFMA 2OSYA 1JFQL 3RWDB 5I1CH 1HIML 4H1LB 4MYPA 1DVFC 1PZBA 4I0PA 5EU7E 1F8TL 3B7RL 4HXBH 3MREB 2JF1A 3U6XA 3EAKA 2ZOTA 5F9JB 2WGNB 2KYIA 3HC3H 3A6CH 2VT0A 3C60B 2YBRA 4GPVA 3X17A 2Y1YA 4XT1C 3K91A 5GGTA 3VD3A 2ZP0T 4KH2A 3GWJA 3HTLX 4PS4H 2NY5H 3RGVA 1MFUA 4WJ5B 3FB7B 4Y16B 2XNAB 5C86A 3GQFA 3SE4A 1DJWA 2JJUA 3MGOB 5GIRB 3UTTD 2A6IB 4MJ5A 6CGTA 3DUSB 3Q05A 5KVGL 4PBXA 4HV8B 4IGBA 1B90A 1ETZB 4X7DC 3ZE0F 2R27A 4GSDL 4LLQB 5DQDL 2AFNA 5JQ6H 2XN1A 5DRWB 1T89A 1ULVA 4N8VA 3N9GH 3EDDA 1HKFA 5F1IA 4XP5H 1NLBL 3VD5A 2OMTA 2EIEA 3IRPX 3MLSL 3V4UL 3L3IA 2WUCH 1J5IA 1DBJH 2WKOF 1QSFD 1AGEA 4GW1B 4PJ8A 4F3FB 4KKAC 1XT5A 4PB9H 1TJIL 1QFWH 2QBWA 4WEEA 5E8OB 3MRIB 4LIQH 5J12B 4G8FA 5C0BB 3QQ4A 4JREB 3KWTA 3SZ6A 4TUJA 4FDWA 3G9AB 2QSCL 4BDVA 1AHWA 3O2DH 4GMTH 3UDWC 4HK0A 2HX7A 5DZLA 4M3JA 3W57A 1AQMA 2GFBA 4PG9A 3VVVA 3FT2B 3PWVA 3H2PA 2OCFD 3BESR 3ARUA 1MCPH 4IU3B 2WWMD 3QORC 2VR8A 3X3FL 1A1NA 3S3BB 4M02A 3CFQA 3OC8A 1WZAA 3K0WA 2N59A 3K8MA 1VADA 4O4YL 2BSBA 4U6XB 5HDLA 5TH2B 4P23B 2LV4A 4FLOA 2QPFA 5JW3L 4PREB 4GMSH 1PZUB 5DWPA 3M1BA 1IQWH 4LLQA 4ZMAT 3T1FA 2AMUA 4PJXB 5E5RB 3N5AA 2F15A 2JJTA 1TTCA 5BRZD 2NNAB 2BC4B 5SX5H 4ELMF 2NY5L 4WJ5A 5J4MA 4O4YH 4IKLA 5AAPA 1EUUA 4NNXB 3EADA 5D7IE 4XVJH 5FO7B 1FFQA 3U9PH 3VSUA 4AKQA 1M2VA 1FNGB 3LRHA 2HVJB 4YHZH 1INDL 3K1KC 1RZKC 3K3QA 4ZO6A 4R84A 5JIMA 1R3IL 1ZA3A 1O9VA 3C60C 3IYLW 2A77L 1KJ2B 4JFPA 4R5XA 1CG9A 3TYGL 3IU4L 1MKFA 4PJFF 4POYA 5D1XD 1AHWC 3NCYS 2BP5M 2XN0A 2VLMD 2YWYA 5EOQL 3I2CH 3P11H 1CIDA 1S9KC 3QZMA 2BXYA 2R56L 4NZFA 1WITA 5DDHA 5SX4H 3CLEL 1G9NH 1B88A 4RMTA 3S3SA 4NHUB 3IE4A 2X41A 3FULA 5AKTA 4LSSL 4R90H 1XSOA 5A16A 1R3LB 4JM4H 1UXLA 5T1JA 5F7KC 2JK5B 2WD0A 4BQ8A 2J8UF 5HPOA 4PJ7F 1USZA 4M93B 3QPKA 5KUKA 1DTUA 4P9HH 4M1DL 3WXWH 1SFDA 4JZJC 3BVXA 5EIIG 4NN6C 3X1FA 3P2BA 4MCNA 2CWRA 4D9LH 4NKMB 3ET9F 3KPPA 3C5ZB 3UZVB 3GI8H 3WELA 1NCUA 4OFYA 5LCVA 3GHPA 5SWQA 4FZEH 3HS8A 1LM8V 1RZIB 3BQUD 2CZNA 1SMAA 2VZUA 2N7SA 3NIDF 5GRJH 4KUCD 4LF3B 3UGEA 2W9EL 1UJ3A 1BZQK 2FX7L 4JO2L 4JRXE 4X4KA 1S5IL 1UATA 2BW4A 3GXFA 4LL1A 3MNWA 4NQDB 4WVRA 1G9ML 1WD9A 2E7CA 2VC2B 1KXVC 3C5ZC 5FOBA 5GGVY 3SOBH 4A2EA 2VDKB 5AUMB 4XN5A 1E67A 3GSNH 1GGBH 3NPSC 3V4VA 3BSHA 4JGNA 3VGDA 1J05B 4YO0B 1VGEH 5CEZD 4UZGA 2L04A 5HYSG 1F3JB 5DLLA 2WUCL 5K1NA 4TQ8A 2D4FA 1DBBL 3VXME 3VMNA 1AIFB 4P46A 1VEPA 1MFBH 1MJJB 2C8NA 4M48H 3V0VB 1KIRA 4JUTA 3GMRA 5E70A 3IFNH 3TN0B 2BRQA 4KK5C 4PP2B 1SLWA 4D3CH 3V5HA 5ISZE 4TVUA 3T8VA 5KYYA 1I9RL 1U4FA 2GT9A 2VJXA 3SPGA 1B0WA 2O6FA 4BE5A 5E0QA 3DHJA 5TPWL 4YN3A 4MQ7A 3QNZB 4HDIA 1PQZB 4I3RL 5C0IA 4NENA 4OZFB 1A7PL 4G7YH 4ZD3L 4LLVB 4FXKC 2CA4A 1OGPA 3GF8A 2PYEA 4UTBL 2B4CH 4HJ0C 4LDEB 3IMWA 3BDXA 5FEBA 2R8SL 1AHWB 2GJRA 5KOMC 3GSVA 3MXWL 4H1LG 4Y4FD 4ERSL 1FO0B 4QI3A 2JI2A 5KBLA 5KJ7E 3SE3C 5E9DD 2ZX8A 3MRIA 2JKXA 3L7EA 3WKML 1NFKA 4WFED 2G2NA 4ZFOA 1JF1B 4J3OH 3IWUA 1EEZB 1JHLL 4PGDA 4WUKL 2PW2B 4I85A 4NOFA 1BD2D 1AO7B 1JZDC 1U8QA 2VXTH 3AC0A 1N59B 2FL5A 3LXAA 1G1KA 2DQUL 3GFUA 4H0IA 4O2EA 3WTSA 1I3RA 5LQBL 3B7TA 2F58H 4GSQA 2QPSA 4M8VA 4N28A 4KRMB 1LNUB 5E4AA 3U1SL 4JO4H 1KGJA 5TDPA 1XIWA 3Q6FA 5HBBA 1CDYA 1HL5A 3MUJA 1HT6A 2A9ML 2P26A 1G7MB 1AQKL 4R83A 5E6SB 1Q9WA 1DUZB 3V6FB 4F9LA 3ULUL 3V5DB 4YDMA 2LGNA 4MJ5B 1XL4A 2A6IA 4U33A 1RZ7H 5FGBA 3T0WA 1QBMH 2VDOB 5D71H 2EDNA 5T33H 1Z5LA 1FAKT 2MJWA 1IMHC 4U2YA 3VFOB 4XBMA 4GO9A 1O6VA 3RTQC 4NQCB 2P3YA 5INCA 1I7RB 4TUKL 2JE8A 4LQFL 4NRZB 3V9FA 4NBZB 3D05A 1R0AH 4AYMC 1DLHA 4D0BA 3UTSD 3ZDYE 4NPKA 3DJRA 4K3HA 4LSRH 2ZKMX 4PJBF 2ZJSL 4QRQB 4WO4C 3S48A 5GS1B 3L5HA 4ELMA 2V3FA 1PZDA 2F7OA 2FJFA 2VDQH 3JTBA 1MCIA 2Y6SC 3LRLA 1BQLH 1QBBA 3Q3GB 2YD1A 3RURA 3GXNA 3VFUA 3F6IA 3LQAC 4PGJA 1VGKB 2WINA 1X7QB 2HKAA 1M9SA 1G7MA 1MFDH 5DD0H 4G3YL 5GISL 1GJIA 2DWSA 1U21A 3TEWA 3STLB 4L5FH 3GSXB 2ZPKL 1T7ZA 4L0PB 3HN8A 4BXVA 3EUDA 1URZA 2AVFA 4BINA 2UZYB 1I3RB 1D5BA 4LOUD 1DFBL 2AK1L 1MLCB 3PWNA 3G5WA 3SY6A 4N0CC 2A4CA 5CEZL 2EINB 2WZ5A 3CSYB 3MX0A 1G9MH 4GT7A 1EEZA 2IDSA 3QNYB 3O3EB 4G5ZH 1I1YB 1TCMA 2ITCB 3QDMA 4LU5L 5EH1A 2B1HH 1HXYA 4GS7C 5HYQA 4JCWA 1QA9B 3NZUA 5CSZB 1TTFA 3NSFA 4LSDA 5DD6A 2N7AA 3KWWB 3Q13A 4I1NB 3UAJA 4ZW7A 4HU8A 4Z5RB 2J1ZA 4N8UA 1KOAA 4NRYA 1MCWW 4HMEA 5C08B 3DV6A 3ZDXE 3ARDB 1U8JB 5CEXB 5JHDB 4C56A 1ECYA 3BQUC 1TETH 4OZGA 4BA8A 3B9AA 4FFWD 5IR1A 1U8HA 3KHQA 2WQVA 3BWUC 3L8QA 4MNGE 5EZIL 3LDBC 4XNMB 4PTTA 5L8LB 5C3IA 3KJ6L 4ZMPA 1HSAB 5GRUH 2G3MA 4S1QL 2Z31A 3GHBH 2PO6B 4PP2A 2QZ5A 3B7YA 4UT9L 5I74C 1NCDH 4V2BA 3CZEA 2AJ3B 4FNUA 5JYLA 3AJ7A 1RPKA 2WNGA 4C59B 4NPYA 5JW4Q 1K5NA 1OP3H 1Z0NA 1T22A 4UZSA 3OHXB 3IVKB 3HC0B 5IMLA 1HSAA 4BH7A 4XO8A 2ZXQA 3NTCL 4KDTA 3HB3C 4L4VE 1JMZA 1JZGA 2XVGA 1E4WL 1KY6A 3UTPD 4OTXH 5DJ0B 5CZKA 1ZEAL 2XJLA 3EHBD 2EDBA 2Z31C 3LEXA 1LD9A 5B7FA 1RUKH 2VXVH 3FQXA 1WHPA 5IVXA 3ARDA 1EZLA 1MIEL 1NFDA 3U9UB 5FGSA 4GBXA 2CH8A 1U36A 2BVPA 2KQMA 1WT5A 2JVUA 3D85D 2XRAL 3FU0A 3O2WL 3QEHB 4M3HA 5CJQL 3WLBA 2EECA 5FO8B 5EORH 25C8H 3JVGA 4IBYA 1BZEA 1RZIA 5A2JH 2AZAA 3A4FA 1EAJA 1HN1A 3H9HA 1YEEL 3MX0B 4FFYL 4LASH 2RHEA 4WSJA 1XF1A 1I7UB 3EG9A 3BLPX 5EOQH 1U8CB 4ELKB 1IGML 1TTGA 1U2HA 3P0YL 3FQUA 3D87B 1WF5A 5H4YA 4AE1A 5C0RL 3B83A 5D1XC 4NNYA 5F7BA 4K7FB 4KJQD 3W9DB 4QHMA 4P9HL 4L4VD 4YGAB 2DQMA 1FUNA 3DX6B 3QT2A 4G8GB 4DVBB 5PCYA 4R9HA 2R23B 3SBWA 1GS7A 5KBMA 3DYMA 1WFTA 4YBQC 2X4OA 4Q56A 2YPLD 4KC3B 1W72A 2GEQA 4DW2L 2APXA 5GJSH 5JIDA 3B2UD 2AQ3A 2VLJE 5B38A 2YUZA 3B7UX 3DRTB 3HE7A 4DOHE 1BP3B 4L8CB 3GI9H 3FZUD 3PJLA 4KO9A 1ZSDA 4W9KC 1ZV5A 1AGDB 1MNNA 1JTTA 1A7PH 4XGZA 2CHZA 3A6CL 4D0BB 4ZD3H 3TYFB 2F5AH 4ZT1A 4WO4A 1GKOA 3F58L 3L13A 3PUCA 4MLIA 4I4WA 3D1MC 1HNGA 1FJ1A 4J8RB 1G9EA 3MLZH 3TBBA 1S2EA 2PCPA 2BC4A 4NEHB 4HJ1A 1EJFA 5TDNB 2Y4SA 1CFQA 2GK2A 4QXWA 4AT6A 1HSBB 1UADC 4NCC1 2VE6A 1XH0A 4C47A 4PVNA 4C4KO 2FR4A 3CFKA 4PREA 4QAWA 3STBA 1CXHA 1WTLA 1IL1A 4FHKA 3KPOA 2VERA 1F6AB 1IM3B 1R6VA 4Z7WE 5EOCJ 4ALAC 1CYWA 2X4NB 2OJEB 4MCZB 4HXAL 2WZPA 2X1QA 2VB5A 5I8OL 1HL8A 4I18C 3TFBA 4EUPA 2PW2A 3W37A 1CE1H 3BGMA 1FAIH 1N10A 3GUFA 5CLWA 3FT2A 1MFNA 3HRZB 1FLTX 3PWVB 3CUPB 4YOKA 3CFIC 4PJEE 3PG2A 4IRJD 4HK0B 4K8RL 4OCRH 1XBRA 4ZUUB 2GBUA 4XPFL 3M1CA 3D48R 5GRWA 3O2DL 4GMTL 2V7HA 2C4FT 2PYEB 1TSRA 4JQVA 4ONGL 2ZG3A 1N7ML 4RX4D 4K3DL 3ECUA 3EJYD 3Q5TA 4MBRA 4XTRC 4ZX4A 3L7FB 2EIMB 3NK4A 4O51A 4XNYL 3CK0L 2XQ0A 3MHZA 4PD4K 5EFIA 1A5FH 1T1YA 1RP9A 3S5ZA 3SE3A 2BLFA 2XIIA 2XZZA 3NG5A 1K2DA 1CFSB 2IANE 1XGUA 2J1KA 1NWPA 2P49B 4D8OA 1MQKH 2Q7NA 4K3DH 4YZFF 1IC4L 1BVKA 5ETUA 1GKEA 2XPYA 3MLWH 4AQOA 2X38A 5TQ0L 3RVWC 2IH3B 4GXUM 5I8EB 4NGHL 1DUYA 4O9HH 3E0GA 3GRBA 3HBGA 4CGTA 1F4AA 1MJ7H 1EFXB 1OTTD 2NX5D 4ODHL 4LVNB 3L81A 4NXKA 1T6WA 4NO5A 5EDXA 4P46C 3D09A 3Q6GL 4WI0A 3V6OC 3WSQH 2V2TB 5CMAB 3UAFA 2KL6A 1YEKL 2OL3H 2NSMA 5DEGB 4F24A 4B9PA 5CO1A 5DZAA 2YD5A 3RVXC 3M7FB 1MLBA 1PL3A 4QHKI 3OR6B 4F20A 2UWEB 1CF1A 3CMGA 2FLMA 3SZKC 1VGEL 2HFTA 4DAGL 2FCBA 5D96B 2R69A 1B2WL 4OD1L 5HHVH 1XGTB 1F4WL 3LV3B 2Y2YA 3MLVH 4GRWB 2WYIA 3AG2B 2BVOB 4X8JA 1HIMH 4QTIH 4D7PA 2HT3D 2A83A 4NS0A 3QUKB 3TO4D 1CI5A 1LO2L 4XMLL 4Z3HA 4GP4B 3L5IA 1BGXH 4WTWA 4X8XA 5EEUA 2P7TB 1A25A 4WGWB 3AG3B 4GNKB 4NQDD 3MRMB 4HHAA 5FYJU 5HJBA 2YKKA 3SD2A 1PTZA 4P2RB 1KN2H 4DFHA 3ARBC 3PY9A 4JRWA 1CPUA 2OLDA 2FHCA 2CXKA 4FX5A 4BKTC 3CJJA 5IQ9B 3GTNA 4UQ3A 5INDA 5I6MA 5KSBA 1T83C 3X1GA 2OM5A 3MKKA 1X5LA 2OTUA 5GRYA 1YJDL 2QVFB 3AG1B 3D39D 4JW3A 2WKGA 3GXPA 3IKCB 4HIXH 2MKWA 1IAKA 4MNQE 5DDHB 3UBXB 4ZXBA 1Q0YL 2E9GA 3D3VD 5D7LA 3Q1SH 1SN5A 4FI8A 2BDNH 5FO2A 2OMUB 3ATEA 4B0MM 4V33A 1BLNB 2X0VA 3P73B 3OKKB 3SDXA 4A68A 3L4YA 4XWGH 1BPVA 1IFHH 1PYWA 5IUSA 4TNVK 3HG0A 1I9EA 1MNUL 2D73A 2IDUA 3H0TA 3PV7A 5D6CA 3JV6B 1YAZA 3S3CB 1T0NB 2X70B 3FTUA 5I16A 4NYLB 5EB9A 4A7UA 4S0HA 2IQ9H 2YFNA 3UJTL 3QPXH 2CO4A 1QUNB 4OLVH 1EUTA 2DYRB 4K8RD 5IG7B 4YH6A 5DC0A 5TK2A 2CLZA 1QI5A 1R3IH 3FUIA 4ZW5A 3EYVA 5DK0B 1ZT4A 1NKGA 4UT9H 2XV3A 2P8PA 4OZGF 4TULL 3U1QA 2QADD 4LLAA 1B4TA 2ICWI 3F7QA 5LAPA 5ADOL 2YD9A 3L3KA 4OUUB 2P24B 1G1YA 4O2CA 4CVZA 3QDGB 3DX9B 5JOPE 2BINA 2VQ4A 1OE2A 4OZIA 2X12A 1AO7D 1BD2B 4U3SB 4X5XB 3ZGHA 4JREC 4AK2A 3MRLA 4LNVA 5HYEA 1QBLH 4MQTB 5JYMA 1HILA 3U36A 4F9PC 2NXYC 1AFVL 3T0XA 5JW3H 2E4FA 3EDFA 1FZKB 4S1DD 2I85A 1YEGL 2L7QA 3LKPB 1OARL 2GFBB 2GIYA 2Y7QB 3T8XA 4DN3H 2ZP8A 5A2IH 3KGRA 4F9PA 3CPUA 2COQA 4M7JL 4PRIB 3UYRL 4FFVC 3OQRA 5IBTL 3F3HA 2CR6A 4GI6A 4B9IA 2GEEA 2JCWA 1NSNH 1KIQA 4IBUA 3MJ7A 4M6ML 2B2XH 3D4YA 1UD2A 1WUZA 2Z93B 4B95C 2QKIB 3U0TA 1PAMA 3G6JF 2R29L 2P5EE 3CXDH 5DFAA 1VCBC 5IVXE 4X5RA 3VXMB 3KPSE 3BAEL 5ANMB 1KYUA 2W38A 2JQZA 3ABLB 2IPKA 2V2XA 2I9TB 3UTPE 2JCCA 1MCSA 1WWCA 2H2SD 1G7JA 1QEWA 4J3OF 3Q8FA 4RMVA 4ODSH 4XC3H 2C7FA 2VQTA 1MF2H 4IRSA 4HFWA 1Z3GL 1GY2A 3PP4L 3CFJB 1DQML 2UX7A 4ZFQA 4GINA 1M7XA 1CC3A 2EKJA 2FX9L 4PSPA 3WMPA 3FL7A 4NUJA 3ZL4H 5KZCD 4YGVB 1JWSB 1WS8A 3B2VL 4UIMB 1GAFL 4GQQA 1RI8A 4AQEB 4F91B 1AY1H 3KLSA 1OK0A 1U8OB 4AMKH 3SQOL 1Q9KB 3C08L 4IRZA 1RZJL 5DSCA 4PRIE 3UGUA 4FA7B 1A7QL 5ALBL 1TVHA 1BX2B 2CBOA 3T4AB 5LNGA 1H8NA 4WCYH 2YPVA 4PBVC 1W8NA 5CUSL 4KKLC 4UV7L 2YUXA 1D7BA 1OIOA 1OSZB 3MGTB 4H1LA 4YBQD 4YUEL 3SGKA 1JYNA 3VFWB 4MD5A 4UT7H 4WI7A 4QDGA 3K8KA 4NZTH 3FCUB 1MFCH 2WYZA 3AFLA 1J9RA 3K2KA 4WWID 3M1OA 4BGLA 3KPRA 2QQKL 1SJHB 1WC7B 4LLUA 3V7AG 2J1YA 5GPRA 4GKNB 2IAMB 4X0KA 2OK0L 2V6HA 1A9BA 3E9UA 1WFJA 2X4RA 3ARXA 2YAHA 3QFJA 3TCTA 3V5KA 3O0RH 2BY0A 1IM9A 3QJHA 5ILTH 2DWXA 3DARA 1AMXA 1IGJA 4GI9A 3HZYA 1BOGA 3BO8A 3RNQB 3LNDA 5EZOL 3S8WA 1S7VA 1X7SA 2JKIS 3QR0A 2NXYB 3MNMA 1JV2B 2A6JB 2B1HL 5LG6A 1GR7A 4QJ3B 4UUJB 1K4DB 4Z23A 5L8KB 1S8DB 3WIFA 5J1TC 1EXHA 1ZT7A 2XX0A 1IFHL 4N2AA 1JJUA 3C8KA 1NDTA 1TTAA 1KBKA 1GZHA 2XPZA 1G9NL 3VI4E 1T7VA 1RIVH 3N3EA 3VWKC 3H9SE 4MDRA 1E3XA 5BPPA 1DVUA 4MQSB 3GM0A 3HE7C 3QZWB 1S9XA 2YXMA 4C8XA 1EJOH 3ZMRA 3RHWK 1YC8A 1RFDH 3ZHDA 2BNRA 2NZ9C 1DSFL 8FABA 4I2XB 3ISRA 2P5WA 2PCFA 4GRLC 1OAKL 4BUHA 1IGIL 1LDPL 1QOKA 4ABUA 4URKA 2Z4QB 2XTLA 1MCEA 4K3JL 4NC0B 4AGOA 2AP2A 1HEHC 2DF3A 4MJIE 4X7SH 3DMMC 5A6IA 1C16A 1NOAA 5CJ8A 5CJOH 1Z9PA 3QIUA 5D2LF 3SDDA 3VXNA 5DMJB 2Y2TA 4FMVA 4J2XA 1TXKA 3RHWF 5I73B 5KSAA 1IRAY 5GSVB 2M2DA 2O6DA 5T1MB 5F3BB 5L6YL 2EEDA 3BAIA 4IU2B 1UTDA 3HI5H 4DGIL 2YK1H 1T20B 1GGCL 5I26A 4AUYA 2XIBA 3MXVL 3PLYA 3ARGA 4Z95H 4JMNA 3N1QC 4AH2A 4ATTA 4FFZH 4BWUA 5DEFA 3EH4B 1DEEB 3SGDH 1CLOH 1MHEA 4ZODA 1PBYA 4JN2A 3HZ3A 4Y9EA 3TA3C 1XH2A 3EGDA 2TRYA 4JO4L 3VACA 1P7KB 3ZE0B 4P49A 2AEPH 3NJXA 1BF8A 5C0GB 5IQOA 2MH4A 5CR8A 4YC2C 3GNML 3S4SA 4N8CH 4B5EA 3PE9A 5IW1A 4WFGE 4NSKA 1MRFH 2DM7A 3D33A 4MSWA 4M3KB 1E28A 3IF1B 3TA4D 2G2RB 3VGHA 3VGAC 2IGLA 3HPLA 3OJ2C 1WA1X 4LIQL 5AL0A 4JFYB 2D4DA 3MLVL 4RDBA 3UBHA 4FG4A 2XTJD 1OAQH 2EZ0D 1QQDB 4AIXA 4QOKE 1OCWH 5HI4D 1PNCA 2Z8VC 2CO3A 4Y2OB 1WA2X 1IGYA 1YMHB 3NZHL 1AYRA 4A2MA 2UY7A 3OSVA 4S1RH 4LDOB 2VLJD 2YA2A 3CZSA 3H9YA 2HT3C 5F9DC 2Q1EA 4KXCA 5HI3D 3B9KB 4LLDB 3ZRFC 2F53B 3CLEH 5DVKA 3WFHA 5IMMB 1HS6A 5HJGA 4LEOA 4M6NH 2WTOA 2ICWA 3S98A 3DVIA 2E7DA 1GPOL 4AQAA 4Y1AD 3NSDA 5C0GA 5C0DA 5BVPL 5DJZB 3LKSB 1BQHA 4MXQC 3ZE2B 1PG7L 2O5ZH 4RGOL 5JR1H 1LE9A 4HSAC 5DRNB 2Y1VA 1H5BA 5IB4A 1G0YR 1ORSA 1O6SB 3MNZB 3TLRA 3U9PL 4OB5H 5B3JF 3PWUB 4IRJB 4TRPL 5L2KD 1KB3A 1T04B 4DAGH 2EE9A 3SDXE 5BUGA 2QSQA 5KSBF 1FFOA 3WN6A 4AH2B 3GS0A 4MMZB 3PJSB 1J1PL 4NQEA 1RURH 4XXDA 4UBDC 3A24A 4RNRB 2K9FB 4NQXB 1RULL 7CGTA 1SDDA 1SGKA 2I5YL 5A6MA 2R2BA 2JJVA 2ZX6A 3BHBA 3IMSA 3O4OB 1I7TA 5GGVL 1QPPA 3BD5A 2WXKA 4UV4H 4KNSA 1MW1A 2QLYA 4GG8A 4DGUA 1GSMA 3ZU8A 1F4XL 1C16B 3CG8A 4M7LT 5C07A 4BSWA 1R1CA 1T5KA 1YMMA 1TZOA 3CE1A 2J21A 4QXTA 4CC0A 4PJFB 3KPSA 4MMZC 4N1HB 2C5DC 3D0LA 2P5WB 1SY6A 1OPOA 5IW3A 5LG1A 1RV6X 1G7QB 1NCTA 2QADC 3D51A 1H3WM 2LAGB 1KN4L 5ENWA 3JWNC 5D4HA 4PLKD 4M1DH 3WXWL 1OW0A 3A5VA 3M17B 1EFXD 4A6YA 4Y5XA 4PJAA 2WHVA 3BVNB 1ZHKB 3TC9A 1NBCA 3FPXA 3PGFL 4GH7B 1HQRB 4R2GB 2GJPA 1MVYA 5FUCC 1KPRA 3QJFB 1YEIH 3L16A 4XCNB 1O9ZA 1L6ZA 1TZGL 2EDWA 1YY8B 4KAQH 2X09A 2NCMA 4HS8L 4R8WL 3IDYB 4KVCL 4Q2ZB 4FLRA 1QTYT 4AVHA 1FHNA 4YK4B 1AQ8A 1CWVA 3GI8L 2RTTA 1EZUA 4Q9RH 1MAJA 3MV7A 4QXTB 1I1AD 4Z95L 5T3XE 5J11C 5JA8B 1B3JA 5SWSD 1BOGB 4K71B 4YDJA 4PJIF 3QJUB 3MGAA 3O2WH 2Z92B 5EPMA 1G1OA 3WIHH 1I85C 3R0MA 1KYOJ 1ODAA 1S7WA 4HIIB 1YEJH 1A3RH 3FQRB 4YK4C 1BVNP 3CFMA 1RUQH 2CCLA 2ATKB 2D3JA 1U92B 4NQEB 3TBTA 5BV7B 3VRJB 5C0EB 2V3DA 4Y9GA 2WP3O 4M8UA 3VGFA 4YBLC 5GQBA 1Y6NR 2YSSB 3D25B 4M7LH 1NQBA 3L95A 4IBQA 3HHMA 4OKVB 1QP1A 3L4WA 3N41F 5DJYA 4FERA 3VFWA 5AG8A 3WU1A 1PD6A 1JV5A 3D39B 3TONA 1OSZA 4ZX6A 1UWEL 4AITA 4PY7B 5DU7A 5AZEL 3T4AA 1K8IB 3F7VA 2CO6B 5AEAA 3S4SG 4JFHE 3VFVA 1ZT1A 4GYBA 2X7LB 1HXKA 5DUPL 1U2CA 2W60A 2VDLB 3GDBA 3X14A 2C7UA 4HZ1A 1U8OA 2EDXA 2F5AL 2FWSA 4IKNA 5K39B 4R5VA 5MEND 1KB5L 3GGWA 3O4OC 2IXQB 1JWSA 4CC4C 2X2JA 4N5UA 3HBZA 4TVPD 3ZMNA 5J5EA 1GTNA 3FO1A 2VITA 4ZTOL 4WI9A 3BCFA 4HEPG 3MFFA 3CK0H 4ZSOE 1LEKB 3T8MA 4AM0A 4HOMA 3K71B 1WD8A 2AABL 3B5TA 3CDZB 3QUGA 4G6MH 3VDAA 4OLZL 3W2DL 1H19A 1UC6A 2ZYHA 1UA7A 2QADB 4GQPH 4TNWF 3MRNB 3ECBA 4D9QE 2WB1A 3IFPB 1NLBH 3KYKL 4R3SA 4UTAH 2VABA 4MSWB 2NY0D 4E9RA 2WCGA 3QDGD 2LTQB 5ESVA 4XP4H 1EBPA 2XACC 5F1SA 3NSYA 3HBPA 1F00I 1YQ2A 3W0WB 2WOBA 1E4HA 4XCEA 3CN3A 1GW0A 3JWOH 5F1KC 2ETWA 2E6QA 4I9XA 4UCFA 2CGZA 3GBMH 4ECNA 35C8H 3RB7A 2DL9A 4NERA 3IDYC 3HZMA 1J1PH 2L3BA 4P3DA 1NZRA 3TH3T 3FCGA 1N8OE 4NM4L 4PRID 2HT2D 1CZ8L 2AEQH 2CJTA 3LHAA 3DHMA 4HJ0D 3AS2A 1FVDA 2WBJA 4FCHA 2RFXA 4K3JH 3V8CA 4X5XA 2AI0H 3OKEA 4JPVL 3KJ4C 2GJZB 2GJZA 4YSUA 3MV7E 4X6BA 4CILA 5IHZA 1BQLL 4XI5D 3D50A 3FCBA 1U93B 2B4CC 3KH3A 4ZX5A 4U05A 1H8LA 1UEMA 2D7MA 4LSRL 3VYPA 1ZLWK 1MY5A 3FTWA 3RILA 1EO7A 4OZHA 1TF4A 1IJNA 1KPUA 5J3HC 4PRNA 3D2UD 3PNWB 3QG7H 4TF4A 4U0RC 3B3IB 5IUCA 1VJSA 4DZ8A 4G9FA 2VH5H 4JPWH 4KDWA 2YD2A 2DM4A 3MKGA 5TTRA 2DJMA 5LNDA 5IBLD 4Q14A 4O02L 3DI3B 1TZAA 3CMOH 4OGYL 4Y2DC 3MRNA 1E4XL 4YHLH 4F8QA 3OR7A 3MLTA 3P4NA 2ZICA 5FA3B 3T4YB 2A9NH 4DK5A 4Y4KD 5K9KB 4NCC2 3QNXB 4FTVD 1GSKA 1KEML 4HUXB 4PUBH 5C07E 1UT2A 4LVNC 3TA3D 1E5BA 3V0FA 4DETA 3LEYL 1JPGA 3DIFB 4M62H 4N0RA 1GZQB 3U2JA 5D1XE 2VITB 1JGVH 3NRQA 1EAQA 3INOA 3ULVL 1A6WL 1JG9A 1I7ZB 5DJ6A 3LKRA 1R0AL 1JI2A 4QYOA 4YHLL 1RSYA 3H6JA 3RBGA 3PABB 4GW4A 1JDDA 2ZWNA 3FO0H 1OKEA 3OKMA 2DM3A 1J9SA 4N2FA 1FE8H 1IFGA 3HFFA 4P2YA 5DMGD 5EO9B 3HKFA 3UPAA 2C7UB 1XMWA 3RGBA 1OGTA 3AY4C 3IDXL 2V2WA 5TPWH 2RH0A 2HVBA 3QUKA 3SD5A 4A1RA 4UF7C 4HUKB 5KS9E 3GIVA 4JKLA 4MBOA 3S8FB 4C56E 2E4TA 3MGTA 4Z3TA 3W82A 4L3EA 4MYWB 2NY2C 3E8UL 2W9EH 3NCEB 3O9WA 3QZNA 3BVUA 1JPFA 3PIQB 1H6EA 1YYCA 5C0EA 5JXAL 2EDYA 5DSCB 4HX1B 4HJJL 5FGCB 3ULSB 5DFWH 1A9VA 4NGHH 2UZXB 1MNUH 4Z7VA 4M9PA 5D1QD 3FUEA 5IK3A 1J0KA 3NCCB 4IK6A 2QL1A 1NEPA 2XA8L 2E7HA 3P2TA 3PABA 3NJHA 4C83B 1S7SA 1NCAL 1PPIA 1YCSA 1QRNA 3FT9A 5D71L 5IROA 2WQWA 5AAMC 3DI2B 4XVSH 2AV7A 2FNWA 3DDGA 1T83A 3CFJA 4G8AC 4IK7A 4NC1E 4UAOC 3VXSE 3DBXA 3WJMA 3LXCA 5DHYB 1S7XB 5DZJA 3QNXA 3LQMA 1A9EA 5EU3A 5DC4B 5HPMB 5FA3A 2R69H 3BUTA 3T4YA 3MPCA 3C9NB 4HAKA 1TT6A 3V6ZB 4W68A 5CGBA 4FNLL 3DO4A 3ZW3A 2ADIA 3I75B 4M6AA 1USQA 2QZQA 4PGBB 5I1GL 1G6VK 1HK6A 1YYMH 4JRYE 3N6YA 2Z93A 3IJSB 1KFGA 3CCHB 1AZUA 2WBKA 3IDMB 4GKLA 4YHNB 3WXVH 3BC9A 1SEBA 1AFVH 5E2VH 2R7EA 4M4PA 3H56A 4UTBH 3UACA 4KZCA 4UQ9A 2M1KA 3P4OB 4GSRA 1CXFA 2E9IA 5JLZB 2P46B 3QE5A 1O6TA 2OJZL 3AWGA 4KNUA 4FJ6A 5GGUB 1QBLL 3N1GC 4NZTL 2YXWA 3NA9H 1NL0L 1I9JL 1D5IH 2I60H 4KXBA 4WI3A 1UWYA 2R1XA 4G3YH 4PGEB 4XHQA 3CZFA 1KB5H 1O75A 1ZVHA 3HOGA 4YUEH 2I25N 3BXNB 5E6ID 2ATAA 5AW4B 4EQ3A 4PY8I 4PS3A 1EERB 4G71B 4CVZB 2PWHA 4FQIH 4R5TA 3BDYH 2ZKHH 3O0RL 4IMKA 2UUDK 4B5ZA 3IMBA 4LCUA 5JXAH 5KBNC 5E8DH 4W9CC 1A4CA 5AZ2H 2CRZA 3F58H 4FZEL 1SXNA 4MNGA 1RJCA 5CD5C 2HKHL 1T04A 2WXHA 3FU5A 5E5UB 2BY3A 2NUTA 1F2XK 4QXGH 2EYTB 1T5WB 2QKIC 4R7XA 4JPIA 2CIKA 1MQKL 2UXTA 2Y69B 3ZO9A 1F6FB 3KYNA 1CK0L 3LQZB 1TFPA 3D07A 4NRXA 1NGZA 1XF3B 3K72A 1MI5E 2H1XA 3PP3K 1JXJA 4UZUA 3FTXA 2C9PA 5C0DB 4WNJA 1IKNC 4N9OB 3QYMA 1A6UH 2J1WA 2XWDA 1NCNA 4PB9L 3TWYA 3T0DA 5DS1A 2YPVH 3WIAA 2Y5QA 4TSBH 4HK3J 4KK6D 4LOVA 5FA4B 4PJHA 5SWZA 3T2NH 1JZFA 4X4YB 2VO8A 3K4DA 1UUNA 1MFAL 3PYCA 3U4EA 4R96A 1MQ8A 1S7UB 3UJJL 5E6YA 2NY4C 4KGJA 1YLBB 5FDWA 1PCXA 4KNTA 4FABH 2Y22A 1KULA 4HHWA 4Y2DD 4YXKH 2ICES 4YZWA 1RQ5A 4NNYB 4PJGE 3RI5K 2G75A 4PRDA 5IEKB 4I48A 4QTIL 4RRPM 3L3OB 3VH8A 3I84A 1SM3H 5EIQA 3AVEA 1A21A 1F3DJ 3HPLB 4J8QA 4AV5A 4AWJC 5GS2H 3DC0A 3VMPA 1TUPA 2P7TA 4G11A 2MQ0A 1DVFD 5IESL 2FATL 3QJRB 4PLKC 1ND0A 1AZNA 4N3TA 3TGXA 1OY3B 4G1EA 4GKZA 3E6HA 2PWFA 3QUXA 4YHOL 4MNHA 3L4ZA 1Z9OA 2X28A 4IQHA 2J71A 3VUAA 1W72H 4AG4L 4EVNA 4GAJL 2FEEI 4YPJA 1DEEA 4FF9A 2QVIA 1MDTA 3UIYA 4YHZL 1T0MA 2FSEA 4ETYA 4Y4HA 1GCYA 1UWEH 5C0FB 3AREA 4N90D 1JUFA 5DYFA 2A77H 3LVTA 1N19A 4OCXH 5B1JA 9CGTA 2AXWA 3OKDB 3OAYK 5DJ0A 4A67A 2Y9RT 2I5YH 4B9GA 4KX7A 2YAPA 1Q9LB 4KTDH 2FE0A 3Q8CA 4BH7B 1MCBA 3IFLL 4QGTA 4WWOA 1FF5A 4K5MA 2XG5B 2WBJC 1CZ8H 1IBYA 5EG6C 4YQXH 4JB9L 4WW2F 3GSNL 4F8TA 4PJEF 1OTSC 1QFWL 1I8LC 1HNYA 1YNLL 4LCWB 3W11D 2BVEA 1XGPB 1RU9L 3OG6B 4KKAD 3LZLA 2W88A 1IBFA 4M8RA 3T08A 2A9CA 2MOGA 1I1AB 2F5BL 4MX7B 4L18A 1ZA6B 3SPIA 3UROR 1J86A 1QRND 1ITBB 5CIPB 1EGJH 1U0QA 1J8HB 2GI7A 2O6EA 4J6RH 4DEUA 1TCRA 3IJEB 1E6JL 2E46A 3EOYG 2CRYA 2DL2A 4RZCB 4B7LA 1AZRA 3TWCH 4FFZA 1BQHG 3T2NL 4TV3A 1DQDL 3EW3B 3NPZB 3QAQA 4K7PY 4DKEH 4Z77B 2YMOA 4ACPA 1XAKA 3DMMB 3ZTCC 2BNQD 3VO0A 1E43A 3MRKB 5GZND 2E0PA 4FXKA 1HHHA 4LHUB 4TRPH 2X9ZA 4HPOH 4A38A 4N2HA 2VLKD 4Y8DC 3QNYA 4HIXL 1S7VB 2X4QA 3HJ0A 2VN7A 3JWNH 1MLCA 1IGJB 2RJMA 3PWNB 3RIKA 1J9TA 1FZMB 1XR8B 2CO1A 3GKZA 3V5KB 1BJ1J 4KXDA 2X4NA 3WTUA 3G04B 2FZ3B 1IM3A 5ICXA 5B22A 4ELDA 1HXMB 3RPIA 3RPKA 1LMKA 3ROLA 5ITBH 1I3VA 4C4UA 1M9WA 3BP4A 1IC5H 3FB5A 5K9JL 1RHHA 5JORA 2EDKA 2HA1A 3CXHK 4ZUSB 5AB0A 3CIQA 1LO2H 4XMLH 3C60D 3CFEB 4QY8B 4JFFD 1JD7A 1S7QB 1PW3A 4R7DB 2VMCA 1FJ1B 2LU7A 4EIZC 2AQ2A 3TA3A 3DOHA 1M7DB 3VAEA 1WAPA 4DCQA 1RLWA 4JHWH 4LSVH 4Y4KA 4F15B 2GIMA 1KJMA 3KBHE 1EAPA 4YMPA 1MFVA 1DJSA 2ICWJ 1RK7A 1IEAA 4XGZB 3DJ9A 5DO8A 4MNQA 1CD9B 4J3SA 1NTDA 2EJ1A 2H2PC 3QCVL 1A5FL 4X7TB 5CWSB 1CGYA 4CA4A 4LLDA 3B9KA 4JO5A 2JXMA 1Z5LB 1BXXA 2K70A 2H8PA 4HXBL 4XNQA 1UH3A 2OMWA 4G9FD 4ODHH 3GMPB 4WI8A 2DQCL 4XMUA 4M29A 2L8AA 4TQEL 4HUUB 2R23A 2E7MA 2ALAA 1YRKA 1DSFH 4KKCC 1CD8A 1L6XA 1UM4H 3FU7B 3G5YB 4QHMB 3TVMC 3JT2A 1E9OB 5M7QA 2JCCB 3ZKMD 2ZF8A 4JDZB 5CP7A 12E8H 4O2EB 4ZFGL 1I7UA 1LO0L 1QSZA 4HIPA 2YPKA 4HPOL 2BSSB 1ZHBB 1JGDB 4P2QD 4ZS6C 3H6AA 3W38A 2AC0A 3LNHA 4L1DA 3FTVA 5CS7A 3U83A 4ZAKA 5DD1H 4TLTA 2AK4E 3QEUB 5LWYH 5I0XA 4DO6A 4PJXF 2OFQA 2XRAH 3ETBF 2H32A 3QIBB 2VAAA 1U3NA 3B9VA 3NVQA 4A6YL 3SSGA 3SEPA 4JRYA 3OGCA 3TBSA 1QG3A 2VN4A 5F0LB 4ZQTA 3JZ7A 3U9UA 1MHCB 32C2A 3T8XB 4WGKA 4OCXL 1E4KC 1MPAL 2WKOA 4G7SB 4LEBA 1CL7I 1SPDA 3R4DA 1OSPH 1E42A 3ILPB 5J6SA 2NR6C 3VXSA 1QSEB 2J7LA 3WBDA 2HMID 3I6GB 4N9GA 3FCSB 1RAMA 1NGYB 4U7MA 1R3HB 3L3KB 1RIVL 4CN4A 4EUPH 5JIKA 2FEDD 3L2MA 4HEPA 3B2XA 5F9AC 5J89A 1FWXA 1OTUC 4QWWD 3BKJH 2P45B 3BN9C 3EYUH 4KTGA 1VIWA 3U25A 1Q72H 2AJVH 5HD8C 2MIZA 1EVUA 4F37F 2DEWX 3WKNA 4TS6A 7PAZA 4ENEC 3H7BA 2J4WH 3AXLB 2H0EA 2O5ZL 3TOPA 3RDTD 1WYJA 4ALAH 3V0DA 4XNMA 3GHEH 4HJGB 5GRVK 1KIUB 5E8NB 2XY2A 2EP6A 1Q9OA 4UMSA 4UTAL 4EIUA 5JHDA 1BWWA 4P3CL 1JHLH 5CGYC 2IO5A 3O6KL 3RJDA 3MNWB 4ZRGA 4OLZH 3W2DH 4Z5RA 2B9BA 2YPVL 1G6RB 1HESA 4CGUB 25C8L 4LF3A 5D55A 3IKCA 3DX7A 1Z5HA 1ZMYA 3TZVD 4DT2A 2ITCA 1I1YA 3QDMB 4MJHA 3NESA 3IXTA 4R26H 3U7WH 3ARTA 3EBHA 3SKMB 3WNKA 1JRHL 3LZFH 5FCUL 4I3RH 4NKMA 4EN3B 2DQHH 4RISH 5JNYA 5ADOH 1KYFA 4HJIA 2APTA 5F0MB 3GLDA 1BVLA 1IBGL 4L8BA 1A47A 1R5VA 1SBSL 3E2HC 3R8QA 5D1QB 1VKXA 1T21B 1I1FB 2JK5A 2VRAA 2BX5A 5J06A 2X2HA 4Z7OF 3ULVC 2DWEB 1RK0A 2C9QA 1ZJBA 4YHIA 3QXDA 5MEQA 4UV4L 4A7VA 3MJ8A 2H32H 3B37A 4QRSB 3FQTA 3ZMEA 3C6EA 3L3GA 3Q8BA 1D2PA 2VXUH 2ZSVA 5JZ7C 1NBVL 1TITA 3VFRA 4D2NA 4E41B 1RCYA 2IQAA 3T0EE 1PX3A 1IGTB 2NZIA 4BJLA 3S36L 2UWEA 5I18H 1JPTH 3KLHC 3UBGA 3EJPA 4XWGL 3FONA 1VDGA 2XWZA 3RIAK 3EJRA 3DUHA 1OAJA 4OZFG 4R7NB 3F7PC 3U2SA 3D30A 4NUQA 2Q7AA 5FO7A 2OZ4L 2AQRA 1DBKH 2RQEA 4OTXL 2YEZB 4QYAA 3VDCA 4W9ZA 1JPSH 1S9VA 2DQJL 3TBCA 3BEWA 3WGVB 5DMIL 2SEBB 3MRGA 5AW5B 4JL1A 4PJXA 1XB6A 1UM4L 3AT0A 1SVZA 3TTSA 2PXYB 5F3HA 4DEWA 5KVEL 1LO4H 3KEHA 4N6RA 5CM1A 2Y1ZA 3Q6FB 4KRPC 1JZIA 4A6YH 1LNUA 5CD5D 2OXHA 3GBNL 3H3KA 2F18A 3EJQA 5IROC 2ZWLT 5CFAA 3K5SA 1NIEA 1R9FA 3JWDL 5DJCA 5AYUH 4R6UA 4FQXD 4N0CD 4CSZA 4GEIA 5KVFL 5FCUH 3UTSE 1TJIH 1U8KA 4EI5C 4KO6A 2ZG2A 2PXYC 3GJFH 1TTRA 4LSPL 3AREC 2DTMH 5E9DB 3QS3A 1ZWIA 4EZJA 1UXMA 5J9PA 4PAZA 1SFHA 2BJML 1FFNB 1IILE 1LEIA 1JZ7A 3QQ4B 2C1OA 4Z3IA 4JN1L 4PCYA 3GMNB 4NIKB 1D2OA 2J1XA 3TCLA 1XH3B 3RTQD 4GIPD 1N70A 2WPGA 4KVNH 1SXZA 4DGVL 3AUVA 2PCYA 2KQNA 2KZ1B 4AEIH 1NFDF 4XPTL 1GGIH 3E1F1 2UYLA 2CHXA 5KANG 3UPRB 1UQSA 3UBXI 4HPYH 2OK0H 3AQDA 4LVEA 1XF5B 4EJ1C 3V6BR 3BWAA 4N86A 4ZBJA 4DZBB 4YPGB 1JHKL 2WZ6A 1ZVYA 4HS3A 1XZ0B 2VDNL 3FFCB 1S78D 1LK3L 2IOMA 4E9QA 2PKDA 1Y18B 5FHBL 5D1ZD 1MW0A 1OT2A 1NC2B 4IOSD 2GSMB 4IGBB 5C0JB 3ML9A 3E6FB 1AR1D 3EIFA 4E5XA 1J0IA 3FYIB 2XNAA 4ZFGH 4HIJB 3Q6GH 3U1SH 1FYHB 3GBML 1OAZL 2A6KA 4NI6A 2WLLA 2X70A 2VJ0A 2P8LB 2FEDC 2ORBH 1NIBA 4YAQB 5T5NG 4FI7A 3T9WA 4AMKL 1YNTB 4CMHB 5B3SB 1KWKA 3ULVH 1AGDA 3V0AC 3RFZB 1BLNA 4M5TA 1IGFL 4OJFL 4U1KB 3B5HA 3GINA 3O0LA 3T04D 4NDMA 5BO0D 5AAMA 5I6KA 2XV6B 3QDME 1RUMH 1FV1A 3P54A 4WJKB 3D69A 2GUOB 4CN6A 3KW7A 5DR5H 4DQOH 4KH9A 4BZ1L 4A2FA 1I82A 2XETA 5LO7A 4XP6H 4HS6B 4S1SL 2AJUL 2LU4A 1H3TA 4LSPH 4PJ5B 4MXQD 4D0CB 3LKNA 2ITDB 4JPQA 4LKCB 1G43A 5JO5B 4AEHH 4PCKA 1J1OH 4F93B 3NN8A 4WENB 1OK8A 4P2RA 4HKJB 3ARSA 2YD3A 1H6TA 3MV9D 3R4RA 1KTDB 3B2MA 3B2UC 5D7IF 2OZ4A 4B9FA 1URIA 4JQIL 2DQCH 3I9PA 4OF8A 1TEYA 3FHAA 2HFFB 1SNRA 1DDTA 1P1ZA 4K9EC 5D5MF 1KT2B 1BOYA 3EUUA 4H8QA 5GGTL 5CN3A 1OLLA 3QIUD 3W3BA 3FUMA 2F54D 5C08D 1IQDB 2GUOA 2BVOA 2Z7UA 4X8JB 5CZXC 4UM9A 1CLOL 5E1GA 4A37A 1TZ8A 4OGYH 2VSMB 3MZTA 3GSUB 2DH2A 2A1WL 3VFNB 4PWFA 1MLBB 3E3QC 3SCMA 4NJ9H 1INDH 2VZ3A 4WK0B 1X5IA 3CBRA 3WDIA 4Q6KA 4JLRA 4WK4B 1NFDE 2HVJA 1J8HD 2EDDA 5AZUA 1S9YA 4DP2X 1R4XA 2BIPA 1X4YA 4IOFD 3H8NA 4NNXA 1K3ZA 4HIJA 5KYNA 5FHAL 1RP8A 5C8JA 1DVXA 3CWGA 5C7ZA 1E6OL 1UVQB 4JEGB 5E2WH 1IQWL 2IMMA 2DQFB 1YJDC 4PRAB 4YDZA 3BKYH 1LTXA 4KXZH 1PGRB 3S37H 3PXJA 1RZKL 1UB5A 1OAKH 1XGRB 3SPCA 2J57A 3SQRA 3N50A 4JFUA 4ZX3A 2VERN 2QR0B 2BWDA 3IFNL 3REVB 2AEOA 4DP4X 1GJUA 3UJTH 3DNKA 4LHUD 1XGUB 4WHYG 4RMRA 1XF5A 4NWUH 1QHQA 2VLKB 4FNPA 4BWTA 5HYSB 2Q76A 3VXTA 1DP0A 1GHFL 2WO4A 2Y7NA 3HG4A 1C7TA 1JK9A 2CNYA 4HIEB 4PJGB 1IC1A 5FYLH 5IQLA 4IU3A 4L4TA 2XLLA 3PPEA 1AQDA 4KJQC 2R2HA 1XH3A 5IMOB 2VR3A 5IB2B 3MBXH 4ZPVA 3GMNA 1J9CT 2OCCB 5C08A 3SYPA 4FQ2L 3FCTB 4JFOA 3AU0A 5LJYH 2P80D 3ZE0E 4YSCA 3RVUD 1AXTL 2BFVL 2FX7H 4JO2H 2O1AA 1J18A 4YDLC 4JFFB 4QTHB 3VW3H 4UQAA 2HTKD 3U46A 4CW1A 4ADGA 3BGMB 5C6TL 1ZE3H 2AK4D 3O3EA 1S7TA 2IALA 4JFWA 1FL6B 4KRNA 4L48A 4PWEA 4AIZB 5D7KE 5DJCB 5BUPA 2FQFA 3IGFA 2O61A 2BIQA 3KPLA 2XN9E 1FI8C 1E65A 4LSTH 3S3JA 3MMEB 2Q0ZX 1W72L 4AG4H 3ARBA 4I3SH 1TJMA 1U91A 3GTTA 4JHVA 1QTPA 5DRWA 3O45B 1ZLSL 5AKSA 4GLRI 3OAZH 4Z76A 1KFAL 2FR4B 4JZNB 5HI5D 3OXRA 1KELH 1NA8A 3Q2WA 4RMBA 3MQIA 1M7UA 3RWIA 2SEBA 3K6SB 1VGKA 1X7QA 3FN3A 3KL5A 5HHOD 5BO1L 1TR7A 2A3TA 1H9VA 1NMBL 3O3UN 2X6UA 5AG9A 3FUNA 1FC1A 1DBJL 2H3KA 1BJMA 4IRSD 1BV8A 3MSPA 1W0VA 1A4JA 3DIVA 5HVHB 2AV1A 3C87A 5C7XH 3DIDA 4PBDA 3WLWD 4NQQA 4AE0A 3F7YA 1W6LA 3FT0A 2K6YA 2NW2A 5F44A 1NOLA 1ZSDB 3GMMA 5L2JA 1TZGH 3P9MA 3BKYL 4I0KA 4KI5C 1HTYA 3RWDA 1GL4B 5HHQA 3Q43A 1N12A 2P5EB 3FQTB 1QW8A 3GZOA 1QFUH 4JM2D 4MJ4A 4S0SD 5TF1L 1ACZA 4WTQA 1NBYA 3EYQC 3R18A 3OXRB 5EEVA 1CLVA 2B5IB 4KUZL 1ID5I 3WTWA 3IGAA 1T21A 3SJVD 4F8PA 3S3DB 1TQBC 4KROD 2GTZB 5HD8D 2OR7A 2NDGA 4P0DA 4Q6IB 4JK0D 1CK0H 1KPVA 3CSBA 3HG2A 3EG9B 1ZPUA 4EN3A 2B2XL 3NGBC 5E00A 3FBKA 4MA3B 1L6PA 2IWEA 1RSFA 4YSQA 1FIEA 2MNJB 1ZS2A 3DTUB 3NIGF 1MCOH 2B5IC 2MPAL 2E74C 3VW3L 1G6RA 1CD0A 1FG9C 3QEHA 1UD8A 2XN2A 4J7RA 4ZG1A 1NIFA 4GBXB 3TIDB 2GCYB 4BCXA 1KXHA 3R0NA 1NFDB 3QEQA 3UPCA 4F5CE 3IN2A 3OKYA 4PS7A 2CA3A 5D7IA 2DBLL 2J43A 3WGUB 4DWHA 1CYXA 1YNLH 3QNZA 2XOTA 3LEXB 4HDIB 1HHIA 5E8NA 5AW3B 2D7NA 1YEDB 3L9YA 4BH8A 3US0A 5CZXD 4WQOA 3QWOB 1UGKA 2FK9A 2HJLB 4QRPA 1CJYA 2CJUL 2D7OA 1FE8L 2MCPH 3EF7A 4WLCA 5T1DH 5JUEH 5IMLB 2O5YH 1GHFH 1NINA 2WNKA 3CVIH 4DUXA 3PL6B 3C08H 4LB8A 4NO0B 2Y5EA 1K5NB 4GBXC 1QR1A 1F4YH 1E4KA 2BRRH 1T0PB 5FOJA 1WE5A 3SO3B 4XN2A 3WXVL 2HT4C 5DGQA 2UXGA 2B77A 3D3VA 5BJTA 3N1MC 1P6FA 1KCRL 3FF8A 1XSKA 1S3RA 2NR6A 1XBDA 1VZIA 4W9GC 5F6IB 1AIFA 2BSTA 4OQTA 1F45A 4U6HA 5F0JB 4JPKL 3FCSA 1IGIH 1LDPH 1XF2A 5E5MB 5L4FA 3KPMA 4PTTB 3VXSB 5IFHL 3FKUS 5I1IL 1VFUA 3SBPA 5FUOH 3ILPA 4BH8B 3MJ6A 3UP1A 3L1GA 4FFVD 4FXGA 4WNSA 3L4XA 5B8CC 5JZ7D 4C56B 3ASNB 5D7IB 5CEXA 1H3PL 2VISB 1KBVA 4L3EE 3CZGA 4FLQA 2WXLA 2WXOA 5FW7A 4M9OA 3OGCB 2OZNA 3CBKB 4JRYB 4TVPE 1BQRA 5CSZA 1YNKL 5G2NA 2H0FA 3VGEA 4RMSA 1SLVA 1ZIBA 2VISA 2JKJA 3WO3B 1G9NC 1KJ2H 3CFTA 3KPQA 3MV8A 2OMVA 2Z6FA 2ZCLH 4NFDA 4AJWA 5B8CB 4QCIA 1MFEL 3OGOE 3RTLA 4IBSA 1JF5A 1U3YA 2WC7A 4F80A 3EXLA 2B08A 1TU2A 4Z9KB 4IOIB 4UNVA 1E5CA 4HKJA 1BJ1H 1EEQA 1OARH 2KDGA 2BSTB 4CVUA 1KTBA 4KRPD 4LU5H 5KSUA 3ZIMA 3QDGE 1MFBL 3MNVA 3D3VB 2ITDA 5EUOA 3S0PA 5L0QC 3A22A 4FNRA 5A16B 2K0RA 4GQ9H 3G5VB 4TSBL 4UOJA 3MR9B 1DE4A 3CDGB 3O4LE 4LRNH 2J2ZA 4FQXC 5BV7L 1MG2C 2R0WH 3MLPA 3VQLA 1QBAA 2OMWB 2P5EA 3KR3L 3NIDE 1I8LA 2PP7A 4MHHI 3N41B 1ROWA 3IB4A 1G84A 1UWXH 1E27A 2VQUA 4CSTA 2YOCA 4MNQB 4OGZA 1CICB 2MKLC 4J3BA 3DK0A 3F7YB 4WKZA 1PJWA 3S36X 2Y7MA 3RDTA 3OC5A 2AXHA 2WLNA 4X7SL 2A73A 1QAWA 2WXNA 3K7UA 3LQAH 4I5BA 5EWIH 3LIZL 4MDIB 2P8LA 4WWKB 3GM8A 4FQXB 5GRJL 1IIKA 1MJ7L 4HBCH 2HRGA 4WUUE 1DLFL 3ES6B 4FE9A 3ULVE 4LESA 3RWGB 4KU1A 3K6SA 5G5DA 5JMRA 3TF7C 1QABA 3JXAA 4OCSH 1P5VA 5FIEA 3MC0A 4E9XA 3ZXAC 2FD6L 3FFCA 4ZUTB 1BXVA 1EDHA 1X5GA 5AW6B 3O45A 4NM8L 2A7BA 3KYMA 1E30A 5EIIB 1BVNT 4Q6IA 3BWAB 5F6IC 1ZLUK 1I3GL 4YBHA 5F96L 5GGRY 4WFFE 2D9CA 1H3PH 4OLEA 1RUPL 3FO0L 4HCGA 3QIBC 1NMAH 5T5FA 2ZCHH 3TL5A 5IGXL 1NDMB 2CCWA 3CLFL 3G08B 5AYUL 3NIDB 1Q0XL 2DYSB 1MCOL 2MPAH 2YC1A 3AAZB 3UC0H 3V95A 3QHFH 4PG9B 1IV8A 3MRKA 5DJ8B 1NCWH 2VDMB 4MAYA 5E2UL 2K7QA 3FFCD 5C2UB 2C9RA 1FFNA 2DN7A 1AAJA 1VESA 3L2LA 4OD2B 3VXMD 2YLHA 4ALAL 1J5CA 3ARFB 5EBLB 5E8OA 2NZ9D 2J8UB 2CXGA 5K1VA 4RZCA 5GRVL 1SF3A 4OZFA 1TZHA 3W81A 1ZK9A 1YEGH 1NUNB 2TAAA 5AW2B 5GZOA 4PRBA 2IGFL 3GK8H 2FO4A 2GT9B 1HHKA 5FW6A 1IU1A 1HE8A 1D9KC 4Z7QE 3HBQA 2DZEA 1QLFA 1HKLH 1XGPA 4ADIA 1A6TB 3TBYA 2ZD0A 4M6MH 2NW3B 2DJUA 2JJSA 4JQIA 4N6RB 4UTCA 1F1AA 5ECJE 4B7IA 3SDCB 5B3NA 2NY6D 2OJ1A 2GSIB 4BK5A 3IJHA 4HFUH 2DYPD 2XG5A 1IE5A 3QZLA 4GG6F 3DUSA 5T1LA 4HBCL 3V7AE 5D1QE 1GZPB 4QUOA 4WW2C 4X0NA 1YECL 5CU9A 2R1WB 1DO5A 4GAAA 1JPSL 4ZSOB 3PU7A 2MNUA 2O61B 3QPXL 4S2SB 1S9YB 1W8OA 3IRZA 4QRRD 1ZTXH 1FL6A 3QQ3A 5FOBB 2Y3AA 3K6OA 3CDFA 3MV9B 3SCMB 5EBWA 5CF3A 1R5IA 4LHJB 1WDAA 3JWOL 3NA9L 4EVNB 3EOAA 3QJXA 2CLVB 2FRGP 2WNXA 4IS6A 4LRIA 1ZS8B 4JFOB 2WBXA 4IOFC 2OMXA 2VXUL 3E6HB 1BZ8A 5SWQB 3E2HB 1SMOA 2PPDA 3D85A 3C5ZA 3RZCD 3X13B 1FA4A 1E6JH 1YJDH 2IOIA 5HGHB 1GOHA 2JJWA 4QOKB 2VLKA 3L3OA 4AV4A 1H6FA 4FKKA 2LU5A 3L48A 4LXFA 3KLAA 3MROB 1FFPB 3NCFB 4KVCH 4QRRA 3FSWA 1CGSL 2BMKB 2QSVA 1R3LA 1XGRA 5IJVA 3SKMA 2A38A 1BWMA 2YGOA 3IXTB 3IU3B 4HWZA 3I6LE 4NWTH 1HI6A 4M61A 4ZI8A 5IFAL 2K9UA 4HWEH 3EYFB 4KO5A 3C12A 4G9DB 5E03A 5EOCH 1T7WA 4JGJA 5AVWB 4E0RA 3BAEH 4WTZA 1KCKA 2ZXCA 3V52H 1NIAA 2Y7OA 4OIIH 4W1TA 5AVUB 4JLRB 4U1JB 4AIOA 1QSFE 2UVFA 3AQYA 3ARFC 2WW8A 1OTSD 5FFOA 2BP8A 1NAMH 3E9TA 4DP6X 1J12A 1D5MA 5TK4A 3WAKA 5AENA 3I3BA 3ZDXB 1IC5L 3MLZL 5K9JH 1VFOA 3QORB 4DPCX 1JGLH 1GMEA 1UWGH 2C4FU 1U58B 3ROOA 1TYJA 1U8PB 3PCYA 3RL1B 4BZYA 1PY0A 2EYTA 3QC5X 4JY5L 5ICUA 4IRZL 3UX9B 3IAPA 5B1KA 3VFTA 1GXEA 2GG1A 3WFBL 5EC2B 1SLUA 3BH4A 2ICEB 1Y18A 4BUQA 1DVSA 3NSJA 2JKWA 4O2FA 5CEYB 1W9XA 2NTFB 2PNDA 3GZKA 4PV9A 4AYDC 2QKSA 3OPZL 2GSGB 1G7HB 3NN8B 5BVPH 3BXNA 3AQXA 4K3EH 3EYOB 2APFA 5I1DB 3BT0A 2FQGA 3CVHB 3V4VL 3FRPB 4FQHA 2Z0BA 3FUDA 3ZE1E 4NKDB 2G5RA 3JUYA 1JF6A 1TPXC 2XTSA 1MCPL 2YA0A 5HI4C 2B1OA 4QLRA 5GGTH 3ZT7A 2WVVB 4P04A 3SCMC 4XPFH 1CGVA 1JFQH 2WXQA 4YDKH 2OSWA 3TN0C