1N5AB

Crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
molecule tags Immune system
source organism Mus musculus
publication title A Structural Basis for LCMV Immune Evasion. Subversion of H-2D(b) and H-2K(b) Presentation of gp33 Revealed by Comparative Crystal Structure Analyses.
pubmed doi rcsb
total genus 15
structure length 98
sequence length 98
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n5aB00
4XBPB 5J13C 5I2IA 1T0NA 4EQ2A 3U2SB 5EC2B 3SKJL 3TT3H 1NLDH 1P7KB 4YR6B 5DEZA 1VADB 3HAEA 2Q86A 2DTML 3JTSA 1JHKL 3BH8A 5D93B 5DUBB 5EIIA 1NCWL 5DK2B 4GRWF 1Q9LB 4E42B 3WHE1 2F8XC 3QDGE 2QQKL 1UKQA 2FGWL 2FR4B 3HFMH 5FECB 1I9JL 5E6YA 4MQ7A 1FLRH 4OLZH 5HHPA 4X7TA 1LO3L 4Q7DA 1U41A 3V4UH 2EYRB 3N1QC 4EUPH 4OD3L 5F3BA 3ES6B 1EGJA 1NCAH 2IPUK 3C60D 4JDTH 1BGXL 2VDLL 4FQXD 3SO3C 4AZ8A 5FGBA 5DVNA 4JG0H 1XR9A 5D2NC 3QEGH 1U95A 1HINL 4LHUD 5KVDH 3QIWB 2CDEA 5DRXB 1FVCA 5A3IC 4MCYA 1HHIA 3LZFL 3QO0A 1MHPH 4OLYH 3NFNB 5ENWB 5HHNB 2DLIA 3IRPX 4I0PA 3MJ9A 4PJEA 1LO5A 4OD3H 1RIVL 3BESR 4OGAC 4QY8A 2QSCL 3RKDC 4BQ6A 2CRIA 5DJ6A 4B41A 4UV4L 1KUMA 1AJ7H 1CWVA 5DZOA 1JGDB 4NQXB 3PGDA 1NCWH 4KJPD 3OZ9L 3C08H 5ETUA 3UROR 4E0RA 2VXVL 1UQSA 4M7ZB 2PTTA 4NQED 2X4UA 4JGMA 1IM9A 2E6JA 5EORH 3BRDA 4N1EA 3BYYA 3OJDA 2CGRH 3KXFA 4O2FA 3GHBL 4R90L 5LKNA 3D1MC 1ROWA 2W0KA 1OAUH 3D25A 1HK6A 5H2BB 4JM2F 1G84A 2ZG1A 5JLZA 4JFHD 1FL3B 5T3ZH 3DUUB 5IBUG 2B1HH 4Y4HB 1N8ZA 4J6RL 3HUJE 4QTHA 4OCLC 5KAQG 1ZS8A 3MLTA 4JFPA 1G9NC 1KJVB 3JV5A 3SGDH 1ZA6A 2Q8BL 2V9RA 4CN1A 3LCYA 1HHIB 3WN5B 1VKXB 5A40E 4JFOB 5GJSL 1G7LA 1AKJA 1ZSDB 4AMKL 1X5LA 4N9GB 2AJUH 3VFNB 4PJIE 5BVJA 3TFKD 1YY9D 3L3DA 2BOCB 5TGBB 1HDMA 4GAYA 4XB8A 1GPOL 1T2XA 2UWEA 3RUGA 5D7JA 4KMLB 4NBZB 4X6BA 5E6ID 1T89A 2EZ0C 2YC1A 4KUCF 5E5UB 4C56B 4M1DH 2A77H 1OCWH 3LOWA 5CJOL 4YXHL 4WHCA 4EI6A 4KWUA 1KCSH 3T1FA 1P7KA 3TBWB 5MI0C 3FQWB 3TO4A 3T09A 3D0LB 3ARDA 4JN1L 1WCQA 1M4KA 2D0GA 1V3LA 1ZS8B 3ARED 3RWFB 1GCFA 1U58A 1VDGA 4LFHD 2NXZB 1FQ9C 3O6KL 1E6JH 3O3AA 1FZJB 2EICA 3WIFB 4MNQB 5E5RB 1AKJB 4KI1A 2YPLB 1QA9A 3GMMB 3NA9L 5TDOA 3K81A 1FL3A 1T04B 1XGTA 5F6HJ 3ULUE 5F7EL 3PHOB 5J6GA 4HBCH 1AXTL 4XGZB 3ZDXE 4HGWA 2PTUA 1BD2B 4M7KH 2PTTB 4QRQA 1DQLL 2EDHA 1KN2H 4L8BA 1RZFH 3RQ3A 3TN0B 4ZUWB 2AGJL 4L29A 1HSAA 3UYPA 4LCCA 1EGJL 1T1WA 3PGDB 3O3EA 1C08A 4GFTB 1GGCL 1RZ8A 5I17B 1B2WH 2DBLH 4ODBD 3TA3D 4AEIH 3LV3B 1D5BB 5H94A 1QBLH 3KWWA 3WDHA 4PLJD 4Q6YA 4GXUN 2DQDH 5IVXF 2XZCH 1YZZA 2Z8RA 4WVRA 3GSWA 3NCJL 5C0AA 4EI5C 3QH3B 3F65A 4K7PL 3HI1B 4I0PC 3FOLB 5ID0B 2FX9H 1EXUB 1FL5B 3DVIA 4S1DD 4O58H 1CG9A 3HE6D 4OM0L 2XA3A 3UC0H 2JE8A 3U7WH 3VXTB 2EE9A 2XRAL 5C1MB 1XGYH 4I18A 5IHLB 1PAMA 4ZPTB 5KG9B 2EECA 2P5EA 5HI3C 4LCIL 1F6LL 3AB0B 3CXDH 5FKAB 3W5NA 1TLKA 4M93C 3DGGA 1HIMH 1KG0A 5KAQF 2BY2A 1BZ7A 3OPZL 3NFNA 4GMSH 1K4CA 3OAUL 1HOCA 4WY7L 4PJ9D 1LK3L 2B7DT 5AG9A 5DUPL 4HT1L 1BD2E 3MRDB 3TT1H 4OLEA 2J8UB 3E3QC 4JFFB 5EU4A 1WWCA 5E7FA 4IOIA 1TZGH 4XPFL 5D7JD 1U6AL 4Z0XA 2BFVL 1EO8H 5CEXB 4JVWA 1IARB 2WWKO 2FR4A 5IVXB 2HJFB 5B39G 4BSWA 4GXVL 2GSGA 4HKXA 3ZE0F 4MVBD 3ULVL 3S98A 2W65A 4N9GA 4QHKI 4Y19B 4ZOCA 1EXUA 1FL5A 1FNGB 1WCBA 1K2DA 1J9CT 3MLUL 1KCRH 2J2ZA 5TE4H 3QYCA 4F2MA 2IFFL 5EU7C 5E70A 4NM4L 3VRIB 4R26H 3DHJA 43C9B 4ESKA 1NLBL 3I50L 1F11A 1T7VA 3WNNA 2XG5A 1B9ZA 4M5YH 5D9SB 1MFDL 4WV1B 5E1HB 4G6FB 3IFLL 4Y5VB 3AS2A 1Y6MR 3RX8A 2QSQA 1MJ8H 3AS0A 2EDLA 3MV7B 3QJFB 4NRXB 3WDIA 4GOSA 4YXKL 5ID0A 5ILTH 1IM9D 4JKKA 2KPNA 1YJDC 3UJTL 2HT2D 1A14L 3LKRB 1FFRA 2O93L 1RUKL 1AO7A 1X6NA 4LLWB 4ZUTA 3F7YA 1DQDH 4PTTB 1I8LC 3HKFA 1P5UA 5E2VH 3VFGH 3LRSA 4BH7A 4S1SH 3X3GH 1YEGL 3V6OE 1SVCP 4M5ZL 1MQKH 5DR5H 3O3EB 1KENH 2VXQH 5IKCB 1N26A 1QEWB 1QA9B 2NZ9C 3O4LB 3R0NA 1FNGA 4Y7MA 1A6ZB 1SEBB 43CAB 4Z7UF 3EGSA 4QOKE 1FVDB 2NY4C 1EV2E 5F7WC 1L0QA 4QXTB 1NMCB 2CDGA 2VR5A 2MNUA 2AVGA 4P99A 1X5XA 5IVXA 4HWBA 1HCFX 2L0DA 3UTTA 4NQDD 3H7LA 1HHJB 3TV3L 5HTSA 4NO0B 3WIFA 3CPLB 1QQDB 2ICCA 4HQQH 1NCDL 2Y06H 1IGMH 5D5ME 3Q3GB 5HVGB 3SDAD 4HH9A 2DKUA 2W0FA 2HJKA 2NY5L 2AI0L 1DQJB 3GZKA 4NRZA 4XNXL 4GRMA 3VFPA 3WMSA 2WAHA 1T5XB 4HUWB 4LAJH 3NCBB 5D7LD 2ZUQB 1U93B 1WK0A 2XKNA 2HJFA 1N59B 4C56D 5FA3B 4M6NH 4NYLA 5D5MA 3IDMA 1YN7A 3K3QA 1F90L 3V0WH 4XCFH 1RZGB 3DMMA 3T0BA 2ICWJ 4KKLD 1TCMA 2BC4B 4Y4KD 4C83A 1GGIL 3HZKB 3SJVB 5E8NA 3HI5H 4HULB 5CSGA 1P6FA 2JJVA 2ARJA 5JPNA 1FVDA 5CKAA 2Y5TB 3A67H 1H3TA 2CDGB 3OKEB 1SJEA 4PB9H 4TSAH 4TTDC 1F5WA 4UOJA 2XWBA 4Q9CA 2IAMB 2MKWA 5DJ2B 3WD5L 1KLGB 2NW2A 4Y16C 3V7AG 3BHBB 3ULVD 4LVNB 4PJBA 5SV4A 3X3FL 5DRWB 4PGCA 3RWEA 5DQJA 1KTDB 4U1LB 3CVIH 4Z5RA 1S5IH 5MP6H 3Q3GA 4K3EL 3UJJH 1CK0H 4OCXH 3BIAX 1K9TA 1IGCH 4JE4B 5CS7A 4OAWA 1J18A 3HE6B 4R7NA 4X5XA 1NBVL 1VEOA 3O4OC 3QUZB 2DKMA 4GW1B 3DLQR 5C2UB 2R2EB 4PLKD 4ODXB 3NABL 5SX4H 3S3SA 3T77B 3ULVE 5FYKL 1FGNL 4CUCA 1BJ8A 1MCBA 2XZQL 2RQ8A 4F33A 4I0KA 5DRNA 3G08A 2G60H 4ZMAT 4ZNEE 1UCBL 4OIIH 4WNQA 2HFFB 2E9WA 3NTCL 4HBQA 3RBSA 4OGXL 1MREL 3GSOA 2GJZA 1YEJH 4UTAL 1EEZA 4PJ7E 1WC7A 4YHIA 3QDHA 2EC9T 2E7BA 2IQAB 1T66C 5DHYB 4WWKA 5JDJA 2G5BA 1GC1H 3RL1A 4NWTL 5ID1B 3LB6C 4NQVB 3O81A 4QRPB 5CSZA 1HXYA 1SMAA 2FJGB 5JUEL 4MDJA 4P5TD 1I1FB 2R39A 5C9JA 5FV1L 3E2HC 3MV8A 4F7CB 4JGJA 3PWPB 5E9DA 2H6PB 3ULVC 2NY6C 5F88B 4U1NA 3V79C 3Q1SL 2Y6SD 2W9LA 3EO9L 3GI8L 5BQ7B 4GH7B 3TNNA 5D1ZD 3IFNL 1AHWB 1X5IA 5IESL 5KN5B 3NCYP 2BMKB 3RWJB 4F7PB 2JJWA 4JEGB 5L0QB 3O4OB 3TZVA 3C6LC 1ITCA 3EJZC 2AK4E 3GMLA 2X4RB 4MJ6B 4LLYB 4TNWK 3GGWB 3I3EA 1K3IA 1G7PA 1UACL 2RFXB 1NGQH 1FL6A 2BSED 3FT2B 3KJ6L 4PRPB 4D3CH 3MXVL 2Z92B 1JJUA 1RZJC 3D69B 1MHHA 3EYUL 1BVKB 4LDLB 3MRMA 5CJQL 2HRPH 4G80B 3TBSA 2J8UE 1HNGA 3FQXB 4NKOA 1YDPA 3HNVL 4R3SB 1IAOA 5T1DH 3FQUA 3H3KA 2D7QA 5C9JB 3C60B 2V9QA 3NPSC 4G8GD 1E0OB 5JIPA 3SJVE 3TCLB 1OTUC 2ITDA 3MFGB 4R97C 1J05A 5AUMB 4RA0C 3QUYB 3DMMC 4PS4L 3U0TA 3Q0HA 4AEFA 4M48H 1KJ2L 1T0MA 4JREC 3QUXC 4KUCD 4GAJL 1FC2D 3FO9B 5ALBH 5DSCA 5IP4A 5DMJB 5CMAB 4YK4B 4AQOA 4GUPA 5DO2D 4FQIL 1DCLA 2R15A 4XNUL 4QRRA 1OW0C 4XVUD 3PWJB 3MQIA 5IJKC 5FKPB 3BHBA 3X12A 1YUHB 4J12A 3O3AB 5CSBA 4U6YA 3RWIB 5FYLH 1S9YA 3OX8B 2K1MA 5LCVH 5KSBA 5HI5D 3LKNB 1EFXB 2P8LB 4OGYH 3NFPA 2AEIT 3QULA 1E6OH 3FT4A 2DWEA 3QHTC 3MV9D 3BWAB 3LD8B 1WJ3A 2W60B 5C08A 1RV6X 2WK2A 1R0AL 1JPTL 1OGTB 4QHLA 4Z7VF 3ZYJA 1ZHKB 4QYOB 5FM5M 2PR4H 2R2HA 1C1EH 1MNUL 2EH8L 1XGUA 4I5BA 4YHNA 4JPWH 3U48A 3AY4A 3L3OB 1S7UB 4U1LA 4Z5RB 2J3SA 4FZ8H 1DBKH 4G9FD 4S0SD 3ILPB 4LRIC 2XT1B 1H3WM 1G7PB 2VXSH 4WENB 1T1YA 5I18H 3TESA 1F42A 4CN4A 3GMRB 1IAKA 1LO0L 1BF2A 2VOTA 3CFKB 2Q86B 3ABZA 2GK0B 4J4PA 5IT2H 3QEUB 3QCUL 1F4HA 5L8KB 1CIDA 2EXWC 3ZKMD 3B9KC 3I6LE 4G8IA 2FATH 2NY7L 2ZNXA 5JPNB 3MJ9L 3HC4H 4M62H 2WINB 2PO6C 1ZA3B 1BIHA 3HA0A 43CAA 2DS4A 1HN1A 2CKNA 3DYPA 1UM4H 4U1MA 4KK5C 4UAOC 1CFTA 4K3DL 4NNYB 1BQLH 1H5BA 1U91A 4OLWH 4KI5D 2H6PA 5CEZE 4HEPG 3CMOL 3WNMA 1WGOA 3DV4A 2VWEE 2W92A 4FFZH 4MD5B 4I4WA 2HTKD 3HHRB 5T5NG 1QLFB 3UTOA 4HJJL 5FOJA 3RI5K 4OCWL 2QQLH 2O61B 1G7JB 3HE6A 5DC4B 4B0MM 5DJ0B 2VITA 4D8PB 4LLAA 1E4KC 3BXNB 4WFGE 3DUHA 1M1SA 1FV1A 4EN3B 1BQLL 5D8JL 5EZIL 1L7IH 2F58H 2X4UB 5F9WB 4E41D 3KHOA 4L8SA 3L1OH 4F9PA 3QCVH 4OD1L 5KW9L 4YLQT 2OS7A 2Q87A 4N0UB 2AABL 2B0SL 5IIEB 4UINH 1MCPH 3BKCL 2VDML 4QF1A 1N4XL 1YECH 4WI9A 3RNKB 4LU5L 2XTJC 5IB2B 2FJHB 3CFDB 3DWTA 3MSPA 3SQBA 4PTUA 1H3PL 4OJFH 3BPCA 4PJGF 3IFOB 1MFAL 3GSNA 4W81A 5F3HA 5C09A 1EZVX 2H26B 4UQ2B 2XQBH 1AQDB 1ZT7A 4UUJB 1EAJA 4NUGH 1QLFA 3MPCA 5A43C 4CVZA 5GRWA 3T0EB 2WLZA 3WBDA 1BF8A 3I3BA 4WI7A 5DHVB 2A74A 1S9VA 4Z78B 3TVMD 1QSEA 2YUXA 4HDIB 3OJVC 2W0FB 1F3JB 4HKJA 1Q0XL 4KROD 3BWUC 3MYJA 5CIPH 3MOQA 4PJ8C 4APQB 4XH2A 2DQUL 5HBBA 1H5BB 2XWBB 3HC0B 4PD4J 2VZ3A 3IDGB 1S3KH 2A6IA 3MRIB 1MCOH 1QBMH 1ZV5A 2O5XL 4P2CG 1A7OH 5FYLL 5I8EB 1KIPA 2WANA 5J1SC 1S7TB 3VCLA 3BP6A 2W91A 3SGDI 2NY1B 5D7IE 4GBXB 1E27B 4OV6F 2RGSA 1K6QH 3D85D 1RVFH 4G6MH 5I1AA 4JZNB 3MLVH 4P23A 1J0HA 3RTQC 2YSSA 1MI5B 4P5MB 5C7XL 3WXWL 4L8CA 3PIQA 4X4YB 1YEHH 4NZTH 4OLXL 3E0GA 1QLRB 1V7NH 4RGNE 4Y4FB 5E4EC 2R1XA 3T2QA 2R4SL 3QXWA 4UIKL 2GCYB 3VFVA 1G9NL 3LAFA 3HNVH 5LGKA 4BQCA 3RTQB 5FA4A 1CFNB 4ONGL 4WU7B 1G6RA 3P0VH 5DS8B 1ZHKA 4WO4C 4AL8H 5LAXB 1QSEB 4AJ0A 4P4RA 2QQNH 3RU8L 3EIFA 1U8OB 2JJTC 4TULL 2F74B 4NWUH 3NZ8A 4MAYA 5IV2A 1NGQL 4CDGC 2HMID 3BGAA 1MHEB 1OD7A 4Z7QE 4PJDB 4G8EA 1OTSC 5DJZA 1CLYL 3AU1B 1LEKA 3DRTA 4LSVL 2BNRD 3QIBA 4X9BA 1QLEL 3DROA 4ZFOA 4LKCA 5E6IC 5SV3A 3VXUE 5J6HA 3NAAL 3DX8B 2V2WA 5F9OH 4JHWH 4E5XB 1R5VB 1RI8A 3RZCD 2RJMA 4QRPE 2XN9A 3ZKND 2E7MA 3ECBB 5M95B 3GI8H 3P9LB 2WWKT 3MLRH 3CLFH 3PQYA 1DZBA 3T4YB 4PGCB 3RWEB 2DLEA 3C6SB 4ZDHA 3S88L 3QHFH 2I60H 4H0HB 3P4MB 4LQ1A 2FO1A 3VWJC 2X41A 1AH1A 1EX0A 1YEKH 5B38G 5I8CB 1UM6L 4L3ED 1T03L 5L9DH 4R3SA 2IBBA 4RGMB 1WBZA 3TCXA 2V17L 2X7LB 2OL3B 2F53B 4CMHC 4KXZH 5C0RH 4IRJC 1AR1C 3C5SB 1OAXL 3V8CA 1MCCA 4X6DE 3RUGE 2UZIL 4NJ9H 1I7RB 1GOHA 2CK0H 1NKOA 3SE8H 4DUVA 5B39B 5IMMA 2I9LA 4K7FA 4OIIL 4Z7VE 5JO5B 1SY6H 4XPTH 4YHOL 2ESVE 4GAFB 4PJIB 3U9UA 4NN7C 4DUXA 1ITBB 4NNPH 3RWDB 1E27A 5D6DA 4PBWD 1KPRA 2DM7A 1G6RL 1OAZL 2HT3C 3LKSB 3WJLC 2OMBA 5TF1L 1JWSB 2L7JA 4TSBH 3BKML 4TUJA 3IXTB 1IQDA 1A7BA 1Y6NR 2R0LH 4AY0A 1XF4B 3GSRA 3MLWL 5HSFA 3TVMC 2GAZB 3NN8A 4XB7A 1CDCA 3LQMA 4ETQA 3CVHH 1KJ2A 1RK1B 2DQJH 3CDGA 3WLWD 2GEEA 5CFHA 4YHYB 3BO8B 1LEIA 1WIOA 3CJJA 5E2TH 1H3VA 1TNMA 4LSSH 1L0YA 3MA7B 3GJFA 4U1IB 1IZJA 1QKZH 2JB5H 4LQFH 3LDBC 5TGBA 1ZT7B 3QIWC 5CWSA 1RHFA 2P49B 3QJHB 3FN0H 1I1RA 3C5JA 2VJXA 2FBJH 3M8OH 4Y1AE 5BXFB 3JZ7A 3OXRB 1VFAA 3QEHB 5FYLE 4K94L 3DVNA 3KPNA 5J1TC 2OL3L 5DRZB 1IT9H 3Q5OA 1ZA6B 5HVHB 5IM7A 5BO1L 2RHEA 5T1KA 4RAUB 3HI5L 1ED3A 1GGIH 4LHUB 2EYTA 5C3LD 5I1JH 3GRWA 1F4XL 1MPAH 3V0WL 4DOHB 5GHWH 4TUOB 2DYPB 1CBVH 4PJXE 1I75A 5E94A 2F74A 4Z7UB 5F1IB 1BEYH 3WLBB 3EDEA 3X17A 2W0LA 1CFTB 5DVLA 1X5FA 4LBEA 1QLRA 3X13A 3O4LE 2ZNWA 2PCPB 3FO2A 1DBJH 4NO3A 2R1XB 4P49A 1KCUH 4HS6A 4WJ5B 1DLHA 3TV3H 1EHXA 4IRSA 1JYNA 3MRRA 4S1DC 5I6XB 2MCG1 3NFSL 1CGYA 4W6WB 5GHWL 3QBTB 2AEPH 1CQYA 3VI3F 4WWID 4L3CA 2Q8AH 1F4XH 1MPAL 2XQYG 5I1JL 2VKXA 3B9KD 3GIVB 4FQJL 2XN9D 4Y4HD 1JCKA 5FYJE 4KQ3H 3HPJB 4P46D 3ILQC 1OGAD 5IW6B 2VERN 4K94H 2YZ8A 5IBTL 4OUUA 3HRZA 2DB8A 1U8NB 1MCDA 4MA7H 5E6IA 3MNVA 3FN0L 2YD9A 4OLUH 1KPRB 2HTLC 5FOBA 4ZO7A 1S7SB 1I7ZB 4BQBA 1OT2A 1U8JA 4PG9B 4PJFB 3H2WA 3QXDB 4NZRL 2QLVB 2E9BA 2Y07L 2H2SC 5ECJE 4ZDHB 3JV4A 2W9DL 4JG1L 2YXMA 2ZCKH 1MJ8L 3DXAE 1LK2A 5E56A 2DQJL 2IBZX 3LKOA 1FG9C 2J1KA 4LSRL 5ITFA 1W0VB 1S7VB 3QSKB 5DFTA 5LJYH 4YHYC 2ADFH 3H42L 4LLQA 4MA3B 3KJ4B 1ETZA 4ZFGL 5L0QC 2WMPA 4PJ5E 5FK9B 3WFBL 1FIGL 1EJOL 4R26L 4JCLA 1NGXB 4G9FE 3MNZA 3BKMH 3UTQB 2ICWA 3JVGC 5DFVC 3KDMB 4PGEB 4CW1B 3EOBA 3FRPG 1OF2B 3NACH 2D4FA 4O2EA 3WKNA 4MHHG 2QHRL 4PJFE 2F8OA 4M7LT 4KHXL 3AM8C 1CLOH 3CLEL 1YNLH 4O02H 4XCNA 4Z18A 4EVNB 5D7IF 2C3WA 5TQ0L 1GZQB 2J4WH 4NQDB 4NJ9L 3VXPA 3JUYA 3K4AA 1OAXH 4XX1G 3I2CH 4HFUL 5HHOD 2A9ML 3P73B 4JO1L 1EO8L 3V0AC 3AMKA 3TPKA 2LFGA 4PLOB 2GJ6D 3LN4A 4U1HA 5IJVA 2BHYA 3B9KA 2DQTH 3IB4A 5JQ6L 3SN6N 4UT9L 1IBGH 4WY7H 2LE9A 4UB0H 1VACB 3TZVD 1T21B 1S7VA 2CQVA 1HIML 2CPCA 3EYQC 3S88H 4M7JL 2KKQA 2YMXH 2CUMA 2A6JB 4S11A 5JOPD 2VN4A 2HH0L 4PYGA 4P3DA 1XGYL 3TA3B 4Q58C 4XNMB 2EC9U 3U9PH 5DJXA 4YXLL 3HCVB 3BQUA 4X4YA 2YA1A 3BGMA 1C16B 3IJSA 1GGTA 5JXEC 5F9OL 1QO3A 2DICA 4XRCB 4EJ1C 4Y0GA 4Z6AT 5D7LB 1S7WB 2YD3A 2X9WA 2JKXA 5DT1L 3HZVB 1JPSH 2ZKHH 2VMFA 1D5ZB 2MQCA 4L4VA 3KPRB 2BOBB 2PCPA 3FO2B 5I74C 4OIBA 5AYQA 1B2WL 1GGCH 2GKIA 4NO3B 2AQ1A 1CI5A 1Z6JT 3FFCA 4I3SL 3VXMD 2QQNL 1CICD 5TE6L 3V4PH 1TVBA 3W39B 3P0VL 4AL8L 2AGJH 4LCWB 1YEFH 4PJCE 2IADB 3VXRE 4HIXL 3T0AA 2WBKA 4M7KL 1BFOB 1BJ1J 4NGHL 5IF0B 5E94B 1QFWL 2Y72A 3G5VA 3DV6A 2C3XA 4HBCL 4TVPL 5C07E 2ZP0T 1EBAA 4FXGA 4UU9B 1YN6A 1R5WB 4OLXH 4JRYD 1FH5L 4FA8A 5ACZB 3SDXA 2HVKA 5ICYB 1NGYB 5C7XH 4PJ9C 3Q6GH 2X70B 4IRZH 3RWIA 3K8KA 4AK1A 3G5YB 4LP5A 2KQNA 4BFBD 5CBEB 1MFNA 2X4OA 3SKUD 3OX8A 4HUUA 5HYSA 4U31A 1AFVH 1YNKL 3REVA 3LS5H 3FQNA 5D1QC 4N8VG 3RKDD 4X8JB 3JV6A 4TNVK 2EDDA 5I76A 4MZ3A 1J10A 1XF2A 2ZSVB 2VLKD 1IM9B 1J0ZA 1HHHB 1KTLB 3MRFA 3D3VE 3SDXF 5FCSH 4ELMA 5HHXL 5GGRY 3OJMB 1NGZA 5ICZA 3UJIH 5C0DB 1NAMH 5FDWA 3CC5A 5FA4B 3ZE0E 3LIZH 4ETQB 1W0YT 2OTUB 2DIAA 3WIIH 4MA8L 3FQUB 1U3JA 4DEPC 3MRBA 3IYLW 2Y4SA 4HWNA 3MA7A 1MY5A 3WHXB 1H3PH 3FO0L 4OJFL 4NQXA 5DA4A 3G9AB 5JOEA 4KUZL 4LU5H 3VFRA 4F37F 2F5BH 5L2JB 3G5YA 1A1OB 4RCAA 4CVWA 1U8MA 4YDKL 1IGIH 1YPZB 1RJLA 5GGTL 5FB8B 1G7QA 2Y36H 4O2CB 4HK3N 4H1LA 1JUFB 3H0TB 2UY7A 1NDMA 2B0SH 4U33A 3FMGH 2I27N 1SJEB 5I1KL 2R29H 4U3HA 3V4VH 1B0GB 4M8VA 5KSUB 4ORGA 5T3ZL 3CU1A 5A2IH 1RULL 2YUVA 4PJCB 3MRKA 3EYSL 4ZOAA 4N8VB 1RU9H 4Z7OF 2D3VA 3GNMH 2N1KA 2CGRL 5C08B 3EBAA 1N6QH 3MR9B 1J5OL 3U1SL 4RZCA 1NL0L 4Q0XH 4OQTH 1QRNB 2F19L 1QSFD 2WUBH 4YDLC 1MAKA 3VXRA 4NOFA 5DD0L 1K8DA 4MA1C 4H20H 4I18B 2UWEB 2HJLB 1TVHA 1M7DA 3KYMA 3V6FB 5IMOB 4YDLB 3MRFB 4XRCA 2V5YA 2QSCH 3OAYK 4M00A 3RFZC 1M05A 3SGKA 4CVXA 2LVEA 3J7HA 4L4TE 2FSEA 3BE1L 4PRHB 3B9EA 5INDB 2E7CA 2EDNA 4JFQA 5IMKA 5EUOB 3STLB 4D0CA 2OP4L 5GIRA 1T22A 1NFKA 1HINH 2C3VA 5CAYB 1B4RA 2NY7H 3HMWL 1D5XA 3EDFA 3RIFF 5ESVB 1KJMA 2C1PB 3IFPB 4TNVF 5AWNH 4X5LA 5IT2L 5F72S 1VGEH 1WFNA 2ZJSH 4JRXD 5HDOA 2FGWH 4JKMA 4TVPD 1HSAB 4I1NB 2B5IC 5LQBH 5L8JB 1NGPL 3DMMD 2QV2A 3RVUD 2H8PB 4BKLA 1XF2B 3ZDZF 1DBKL 5BW7C 1IC7H 2OX5A 3RA7H 2VLLB 2DL9A 4PB0H 2BY0A 2YWZA 5JA9A 4JO4L 1MNUH 1FN4B 1HQ4A 2PR4L 4P59L 3RVTC 2AXFB 3O9WB 3W82A 4DEPB 2AKRA 2YA0A 1DSFH 3W9EA 2EIEA 4IDLA 1BQHB 1YQVH 1E4XH 4L9LC 3TCLA 5C07A 1E6OL 3PWVB 1MCJA 1BX2A 3QIUD 1NCBL 4F37K 4HX1B 4UIMB 4ZUUA 5GIRB 3P30L 1P7QA 3ROLB 4C55A 1OAQL 3F12B 1U8PB 4UOW1 1PKOA 1NDMB 3HN3A 4MJ2A 1MIEL 3GSVA 3QDJA 4IIQC 4AQ1B 3MCKB 1DUZB 4P5TB 1KB5A 4GO6B 1LGVA 4KGJA 5D7SH 3V6FA 1J8HE 1UWGL 4DN3L 1ZHLB 4WUUB 3ARFB 4WU5B 1F4WL 4HIIB 4DGYH 3TN0C 3Q2CA 1LVEA 1CLZH 1FNFA 4OZGF 5FYJL 3QDMB 3E6FB 3MREB 2EIDA 4GRLD 4OCRL 4RZCB 4YZFF 4E41A 4WW1A 5DURD 4Z7NF 4F58L 2N7AA 3O8XA 4XC1H 4UUJA 3V52L 5SWSD 4KAQL 4OCSH 1FRGH 3GJFH 4BH8A 1J0JA 1I4FB 4JQVA 2BVPA 5T3XH 3OAYH 3O3UN 3RWGB 3K4ZA 2FX7H 5CILL 4D9LH 3BPNB 5J6HB 3GIVA 1X4XA 2NW3A 2ZUWA 3V5KB 1VFBA 4GLRI 5DFVD 4NNXB 4PD4K 4JQXC 1A22B 2X9XA 5FCUL 5CINL 4Z7WE 5TH2A 3E6HB 3TP4A 3PDGA 3GIZH 4MQXD 4HSQA 5GQBA 3V5HA 3U6RB 5GRXG 4YBQC 5I17A 1GAFL 4N9OB 3KPSE 3MROB 1NKRA 1A7QH 3IXAA 2WQ8A 5FGSA 3BIBX 4FQ2H 1AHWC 2FH6A 3TBTB 2BCKA 4NZUH 1OP5K 3ARFC 3BPOC 4PJXB 4A2LA 5EOCL 2NY6B 3UYRL 3EKCA 3EJZD 4P5TC 3GSQA 2Y25A 5AUMA 2AJ3B 4DW2L 3VRJA 2WW8A 4M9PA 4NRXA 4IIQB 1KB5L 1MCQA 4MWFA 5M94B 1ETZB 4LCCB 3TWCH 3T04D 4Q9RL 4H88H 5F7DA 4RNRA 1BQSA 1MLCA 1D5ZA 1I7UB 2GTWB 1V3JA 3LKSA 4M7LH 4XC3L 1DE4B 1MREH 1OQOA 2WP3T 3MRCA 3NA4A 4U6VH 1AD9A 5D1QA 4FQLH 4GW4B 3U6RA 3V5HB 4PLNC 4OTXH 5ERWA 2FSEB 4WUKL 3ZE1E 4K9EL 4YNYA 2CLVB 3O3DB 3TNMA 3QUXA 1A64A 3WS3B 2MKLC 5FYKH 3KPSB 4ZQKB 2ARJB 5B39A 1ES0A 2B4CH 3PXHA 2GSGB 4HKXB 3W9DA 1WFUA 1XCTB 2W9EL 2ZUYA 2R4RL 4JQIH 4FXKA 3QEUA 1KYOK 4OV5B 1HHJA 5D5MB 4I5BB 5ABDE 1CGSL 1IGCL 4OI9A 3OG6B 1XF4A 4UIMA 3CC5B 3MREA 1YMHB 5I1EH 3G6JF 1CLCA 3VI3E 3L7FA 4KKCC 5I1GH 3H9YA 1JL8A 1XIWB 1P2CB 3IS0X 2JCCB 4GAGL 2YN3A 1FFPB 5C8JB 2NX5E 3PL6A 3QUXD 1FHGA 3VWJD 4KZEL 3ARQA 5ANME 2HFGL 4PB9L 5DVMA 1NC2A 1HH6B 2IF7A 4WDIB 3A67L 4DK6A 5GRUH 2EE6A 1KBGH 3QEQD 3HC3H 4MA1B 1KJVA 3UDWA 3T3ME 4TVSa 3GM8A 1L7TH 5HI4C 5TH2B 5JW4Q 5FAAA 5JOFA 4YFEA 4P2OA 4L8DA 4LHUG 1F90H 4QXUL 5I15L 4LKXA 2Q3ZA 5CZVL 1L9MA 2M8XA 5D1ZC 2PF6A 2HMIC 2NY5H 3ZL4H 2X1QA 4JO3L 3GEWB 4NQCE 4UILL 3WO3B 4TTGA 1D9KB 4NQUA 3MUZ1 1HKLH 3I6GB 5F8RC 3CZFA 1MAMH 2YD6A 2ID5A 4MQXC 3T4AA 2X4RA 3VFWA 1U8LA 4AM0A 5ETUB 4E0RB 3PV7A 3CVHB 4MDIB 4PY7A 4Z77B 1XGRA 4FFYL 4LCWD 1FG2B 1BOYA 1IE5A 5GGQH 1NC4A 2Y1VA 1TJIH 3FRUB 4HWUA 3CSBA 5EO0B 5BV7B 1NANH 1AHWA 5C0BD 3MUGA 1VFBB 3TBVA 2IH3B 5EBWA 3HUJA 2CO7B 1CYGA 2OXHA 3LQZA 3NBNA 2P43B 1ZGLP 3SBWA 1MIML 5B38A 4XH2B 1PG7L 2MWCA 4KI5C 1FFOB 4QT5A 1S5HA 1X5AA 1XF5A 1A14H 4WUUD 1CFBA 4PV8B 3OKKB 5BQ7A 4RDQF 1S78D 4ZPTA 4LCYB 5HGAB 4X9FA 4I3RH 3MR9A 3QDGA 5GS2H 5IQ7L 2FZ3B 3QCTL 4EIGB 3VWJA 5HHQB 1NCUA 1WC7B 4I9WE 5D1QB 2IQAA 1BWWA 4UTBL 2PYEE 2C7UB 3FQTB 4MDIA 4PY7B 4PREA 5I8OL 5I1LB 4Y5XA 1HEZB 2R1YB 1D6EA 3D2UD 3I50H 4Y5VC 4D9RE 4PJ9B 5FYJU 5FO8A 4ONFH 3VG0L 3SOBH 1UCTA 3UXFA 4OZHE 3P2TA 4PR5B 1BX2B 3SE4C 1QRND 3C8KB 4V1DB 4NO2A 4HUVA 2FECI 2VO5A 4CL7A 5CD3A 4CKVX 1PVHA 3MFFB 4PJHF 4HZLB 3IDYB 2B1AL 3NZHL 3ULVH 4XTRC 4XBGA 4KXZI 1SEQL 2ADIA 3K4DA 1X5JA 5AZEL 1R3JB 4JKWA 1QEWA 4YDJA 2BCKB 1G7IB 3RVUC 5KSVA 2AJZB 3O11B 3MMEB 5FHAL 1HE7A 4OF7A 4YIQA 3NH7L 4X6EA 1YPZE 4IS6A 1SYVA 4PJBB 4LOUD 4FTVA 5CEZL 3GMPA 2YPLA 3TT1L 1MHCB 3QA3B 4TTDD 4ZUVB 3UO1H 1MVUA 3VFSA 4GKNB 4OAWB 1CDBA 3OR6B 1TQBC 4NHUB 4XP1L 1R3KB 2P5WD 1EEUA 1URLA 2QEJA 4LPYA 1M71A 4ZD3L 1AD0B 2YBRB 1EZVY 3S4SB 2YWYA 1IVLA 1DANU 3D0LA 4XMKL 3DGCR 1LQSR 5F88A 2XXCB 3E6HA 1NC2B 2NLJA 1UZ8B 5C6PB 5DWUL 1FNSL 1I8KA 2PKDA 3KLHC 4OQ1A 1EJ6A 2D0FA 1KLFA 1IJ9A 1U92B 1ZHNB 3RTQD 3C5SA 3O2DL 1ERNA 1Z5LB 4YPGB 3ULUC 4C4KT 3LS4L 4HH9B 2FLBT 2DBLL 5I9QC 3MRNA 3ILPA 1DQJA 4NRZB 4Z76A 2D03H 4GAYB 4Y2DA 4X80L 3E1F1 1D6VL 2FRGP 3R1GH 2BVQB 4M3KB 1NC2D 5ALCL 2OK0L 5I1IH 3SCMC 5AZEH 3ZE2E 4LFHG 3IETA 2R8SH 3IKCA 1LE9A 3NZHH 2IH1A 4R6UA 1ZVSB 3ZKXB 2EXWD 3ZKMC 5J12C 1GGYA 1YEIL 1RK0B 2O5ZH 1CD1B 4NHCL 5J4MA 4TUKH 2DMCA 3L3DB 1C12A 4BZYA 3BP5B 1YEEL 4KHTL 1AQKH 5TE7H 4MNHA 1NCCL 4G6FD 2CXGA 2FYYA 2GFBB 2HKHL 3P4NB 5IB4B 1B6UA 2IAMD 5SWSB 5I8OH 3I75B 2NXZC 1O5DT 1ZLUH 4QXTA 4BZ2L 2ICEA 3S8WA 1UENA 3MLTB 1J12A 3S96A 2CJUH 3QZWA 2VXTL 2VITB 1BQUA 3M1BB 2FLRT 1A6AA 1MRFL 1XFPA 4APQC 5EZJA 4HIJA 3QFDB 3C6LA 4Y88A 3GFUA 1CD9B 1OGAE 5D9SA 3SDCD 3JWOC 1MIMH 3G6JE 2X40A 4Y5VA 4YDVA 2ZCHH 3QISA 4F7TB 1MEXL 4HWZB 1GOFA 2R0KL 2F54B 1QFWI 1IGYA 5TDOB 5DDHA 4PIRF 4XMLH 4RFEA 5GGVL 4EOWL 2P7TA 4NKQB 1CICC 3ES6A 2CR3A 1TJIL 1E4KA 3WKMH 1QFHA 2VTFA 5GGQL 3FB6A 1ONQB 3AC0A 4G6AD 3P4NA 3S37H 2XTJB 3PWNB 3OL2A 4FFYH 4OBSA 4NIKB 1K5NA 4BSWB 1OTUD 3QO0B 5BS0B 1Q9LA 4E42A 4JZJC 3BH9A 4X83A 1QPPA 1FFNB 4S0TD 5DMIL 1OTTD 2W59A 5IUSA 1K2DB 5FUCC 2R9HC 4EZMA 5D1ZB 2H32B 5IBLC 5H35A 3VDBA 3IKKA 4HKJB 4TOYH 1MHHB 4HC1H 2W65B 2FDBP 3PWPA 4KK8C 4O9HH 3HG1B 3WLWC 2GYSA 1A6TA 2V2XA 2K7PA 1Z5LA 4YPGA 1Y0LA 4RDQG 3GMLB 4MJ6A 5HHQA 1FJ1A 1AGFB 1BVLB 4QXUH 5I15H 2VXVH 2YPVH 1JMXA 3OZ9H 5HVHC 2NTSP 4FQQA 4W6XB 4ZYKA 1EMTH 1Q9KA 3MNVB 1DBBH 4OBRA 4JO2L 1KCLA 4AIOA 3T2OA 3BEVB 1ND0B 2X09A 5HY9B 1T1XB 3OXSA 1VERA 3O8XD 1ORSB 1WAAA 2XPGB 4ZPVA 4FFWD 5GGSY 1KEML 4DTGH 4PP2A 1K8IA 4KVCH 4F15B 2MCPL 4U49A 1CTNA 4ZTPL 1KCVH 1NCAL 4JDTL 5F9AC 5FUCE 1FPTH 2VZSA 3LKRA 2UVFA 3KYKH 1LDPH 4ZXBA 1T20A 1CGVA 3QT2A 1N8ZB 5EUOF 4MNQE 2X6MA 1CT8A 1KACB 4KKLC 4XVSL 3VXSA 1NBYB 4YAQA 3WYRA 1CGSH 1A6AB 3QDJD 3TH2T 4IS6B 3ZKQD 1T3FB 2APTA 2HFEB 3RVXC 1AXSB 3OKMA 3D2UB 2NR6D 3D0VB 4R9HA 5KANG 3TT3L 2W9EH 1Q72H 2DBJA 4LPCA 2ZOLA 4JPVL 2B4CL 5C07D 4M6MH 4CNIB 3WL9A 2FCBA 2VAJA 4NN7B 3D39E 4HIJB 3PL6B 4YBQD 2VL4A 3R4DA 1CFSA 1FBIL 3ZYIA 4ZS7H 2YOCA 4Z7NE 3V5DA 1M05B 3MODH 2WIIA 2NX5B 1X6LA 1I3VA 1RK0A 3EOYG 1G1CA 1E4XI 1KELH 3QPQC 3PF2A 5A2FA 1TJGL 4WEBH 4PJAE 5DEGB 2C3VB 2P1YA 5E6ZA 3WE6A 2IEPA 5CGYD 5FO8B 4HG4K 1X3DA 4Q9RH 3V6ZB 2VQTA 2I07B 1TJHH 4MNHB 4X7SH 3FQWA 3TO4B 4Z8FL 4NN5C 5FGBC 3RVVC 3VWJB 3VW3H 4WW1B 5FO7B 3LEXA 2IGFL 2VXUH 3IDMB 4ZFFB 5FDYA 3HG1E 4ZTOH 4WI6A 5MEPA 5I19H 1BBJB 5HHOB 4U2YA 5DQDH 1BWMA 2ENSA 1K4DA 4OT1H 4POZD 1BFOA 1MI5E 5IMMB 3OKOB 4XPAH 4G9FA 4L4TB 1UB6B 5EBLA 4DKFL 5DD3H 3WS6A 3VA2C 3FB7A 1OGTA 3MBXH 4QHLB 3C60C 3NPSB 1DBAL 4PJAF 4ZFOL 1ZEAH 5D96B 4AYFA 1JNNH 3RY6A 3VI4E 4F57L 3BPNC 3MRIA 3Q48A 5F44A 2ZSWA 3DVGA 1S7WA 4UDTB 4WO4B 1YUHA 4H8WL 5HYQA 5D7KE 1RQ5A 1YPZA 2YK1H 3FB6B 2YD5A 5HDQL 4NO5B 5T3XL 4PRAB 5C09D 3ARRA 5T1LD 5E4EB 2CMRH 3MGAA 4WNQB 4L9DA 5DJ0A 1T7ZA 3H3PL 1MRCL 1DP0A 1N2RB 2CR6A 2D9CA 2E6QA 2EKJA 3DX8A 4JZJA 4OCRH 4UQ2A 4X9GA 3T08A 1A0QH 3VGBA 3VDCA 1N64L 2UZYB 2DD8L 1IM3A 2XWTB 5DLMH 2VDPL 2WWMD 1W2KT 3CH1B 1IKNA 5JR1L 1LEIB 5E1AB 4P48A 1NUNB 2VNCA 1X5GA 5BZDA 5MEOB 2DKSA 3ALXA 1DANT 1A8JH 4RAUA 2EDTA 4LPXA 4M61A 4PJ8B 4P4KA 1KELL 3AXLB 1CGUA 2MPAL 3AROA 4XNZB 3ZHKA 4HZLA 2NY1D 4FMFA 1PBYA 4ZFOB 3F58L 3QEHA 2LV4A 1RZGA 3O9WC 4MGXA 4HWEL 1RZJL 4X99B 1BECA 4TN9A 4ODHL 4KK6D 1WSST 5EA0H 4P23B 2DMBA 3NOIA 5BS0D 3TH4T 3AAZA 2CLRB 1B4JH 4CMMB 3QEQE 3VXUB 5HDLA 2R2BA 2R23A 2VAAB 3INUH 4QXGH 3SDDD 1HXMB 5EZLA 2X5PA 3VJ6B 5E9DE 1I1FA 5DEFB 1R5IB 4KROB 5JW4N 5KVEL 3HE6C 3IXTA 2DJSA 3MRDA 4JRYE 4LIQH 1MCEA 2PTVA 5KSUA 4GXUM 3HB3C 2BP3A 4XVJL 3IVKA 2ED7A 4WCYH 4BSVA 1I1CA 1A1OA 3K1DA 1E28B 3KXFD 3EOAA 1DL7H 3GBMH 1WVZA 3W9EB 4N0RA 1A6ZA 4O2CA 3AXLA 4ELKA 1G9EA 4JRYA 3C8HA 5FO7A 2P7TB 4R4FL 1NMBH 2D7TL 3HR6A 2IAMC 3BE1H 4QRSB 3RGVA 4GRLC 4P2OD 2J8OA 2UV3A 3OQ3B 3QFJB 4BFIB 5GZND 1IEAB 4AENA 3HC0A 5I1CH 5DHVH 3KPRD 4XP9H 5MEOA 2JCCF 3KXFB 3MLXH 2HLFC 1NAMB 2FIRT 5F9JB 5GSRB 4PP1D 3RNKA 3ESUF 2X2YA 5GRZA 1JNHA 3DYOA 5D1XD 1BFSA 5EU6A 3B8SA 5C6TL 1ED3B 2JCCE 3C60A 1UADC 5HPMA 1RU9L 2AJVL 3BWAA 3ARXA 3MV9A 4CJ1A 2OJZL 4L5FH 1P7QD 1R3IL 4G7VH 4KK6C 4XXDB 3C6SA 5DMIH 3AVEA 2WBJA 4JDZA 1J1OL 4M6OL 3ARVA 5I1KH 4EI5D 3HNTH 3BSZH 4I0PD 1G0DA 1P7HL 2PXYB 3RWHB 4QGTA 5SWZA 4QTIH 1RJZB 1WFOA 3VXSE 3I84A 2GJ6A 4GRWB 3V0VB 2OLDA 3BP7B 2J88H 2ICWB 2A0LD 1KIQB 4KUZH 3RKPA 5B8CB 1LO5B 4O51B 4MXVF 4PGJA 4OCMC 5A1AA 3GI9H 5GGVH 1BIIA 4EOWH 3JVGA 1EUUA 5E03A 5CGMA 1YYML 5LWYL 3WSQH 3EUUA 3IU3A 2IPTL 3MUY1 1GVIA 1MOEA 4LGPB 4L3EE 1JP5A 1RURL 3NIFF 4NRYB 1XR8A 3SE9L 3DI3B 4MA8H 3P77B 4F7EB 3ZHLA 4JKPH 4RFOL 2R56H 1FAKT 3MJGX 3K1KC 4MX7A 4G7YH 2AJSL 1K4DB 3GKWH 4WHYG 1QBAA 4WHDA 4IRJD 2A6KB 1OM3L 1A3LH 5FGCB 4M1CC 1D9KC 4G5ZH 4POZC 3RY4A 4OZIF 3EJYD 2VXTH 2CJUL 1QVOB 4Z9KB 5K9QG 2QSTA 3O9WD 4WU5A 5EIQA 3NIGF 1K85A 2EDQA 3EOAB 4Y19D 1YNKH 1RUQL 2ESVA 2MFNA 1D7FA 3F62A 3KLDA 4LLUB 4P3DB 3FQRB 4ODVL 1JPFB 5TE7L 2C9AA 4IRZL 3Q6GL 3HCVA 2WIIB 3DMMB 3QUYC 3NIDF 4HK0B 4GRLB 3BOVA 3TO2A 1HKFA 2BSSB 1UWEH 2DTSA 3BP4B 3PP3H 3GM0A 5AZ2L 3QQ4B 2DN7A 1AD9B 1KEGL 3U82B 3MC0A 1P69B 2PXYD 4D0DB 4FTVB 4HIXH 1TMCB 4DGVH 1HHHA 1KTLA 1FO0B 1N7MH 4NKIL 3ETBF 5SWZB 4WTZA 3KGRA 1OAYL 2D7NA 5I74B 3WIHH 4OKDA 4PJHB 4X80H 2B8OT 4HCRH 1JNLH 4PTUB 4XX1E 3VRJB 1G7JA 1S9XA 2GIYA 4JANB 4PRDB 5CZXD 3T2NH 4Z7WA 1JHTA 3WJLA 2QJDA 3DETD 4FFVD 1MWAH 3RX5A 5DWUH 5F7FA 3N1MC 1U8IB 3KS0H 4PJEB 5DT1H 1PW3A 4A6YL 3V5KA 3MRHA 5E08L 4XCEB 4R7DB 4ZSOE 1K8IB 4JM2B 4R2GD 5FK9A 4LHUA 4LP4A 3AB0C 4N0UA 5IROC 4NCC2 3BZEB 4DVBB 3S4SG 2JJSA 5EUKA 4HUUB 1VPOH 3OKLB 4PV9B 2VR4A 4X7TB 4M7JH 3FQNB 3I6KB 3CFCH 4K3HA 1FYTD 4X4MA 1JGUH 3MV8E 4XCYB 5JNYB 3UTPD 3MV9B 1I9RL 5C0IA 2M1KA 2VZUA 5KTEL 1T3FA 2GUOA 5IK3B 3PP4L 2I9TB 5MENB 2GT9A 1P4LA 2BERA 3D18A 1IAIM 3PWPD 4MJ5B 4PRPD 3NPZB 4PJFA 2DQHL 3HZYA 3HRZB 3KPPA 3B2VL 3NH7H 3VD5A 3GSNL 4E9LA 2CLVA 1OGAB 4UT7H 5FHAH 2ATPB 3DYMA 2DQIH 1TENA 3W0WB 2J4WL 1T0NB 3BPOB 3EFDH 3S6CA 4G6KH 3FB8B 1OAKL 1SY6A 2V7HA 5DMGC 2FD6L 5HI3D 3F8UB 4HUMB 3U4EB 2ORBH 5C0CB 1IGJA 3IU4L 2NY5C 3WV0A 4DUWA 4ELKB 3WFZA 1UXWB 4N8CL 4YGVA 1KTRL 4ZFZA 3QQ9C 3FN3A 3VD3A 3VG0H 5L2JA 1R3LA 2DRUA 2PW2B 5KOVC 3MLZH 5IFAL 2HKFH 1JZ6A 3O9WA 2HTLD 4MJIE 4OZIA 2P5ED 4PY8I 3U36A 1MLBA 2A6KA 3ME0A 5D6CB 1P4IL 5JNYA 5GGRB 3N85H 2BX5A 1OP9A 5MEPB 1MUJA 4K7PX 2DLFL 5IQ7H 4P4KD 1P9MC 5D96C 1C5CL 1U42A 4NSKB 1ZVHA 5ISZB 3RI5F 2YRZA 2XN9B 4NC2B 1BFVH 1H0DB 3CDCA 4BKLB 3QRFM 4U1HB 4LLMA 2CIIA 1AGEA 4LPWA 3RIAF 3CSPA 2AV7B 4HGKC 4PPTA 1YDPB 2HWZL 4HUKB 1U8IA 3I9GL 1UJTA 3SKOB 3AY4C 1WZ1L 5ISZD 3O41B 1AC6A 2XICA 3HR5B 3P9MB 1YJDL 1F4AA 4WHTB 5BOPA 3S36H 1AR1D 2E7LC 1RHHB 4FQJH 1R24A 4LSPL 1LK2B 4JJHA 3JXAA 5DD1H 5I6XC 1GZQA 2F5AL 4KQ4H 3VFUB 1NANI 4WFED 2EE2A 3NFSH 4OKVA 3PGCA 2YD4A 3LEVL 5D72L 4U1SA 5HXMA 4LOUC 2A83B 2R69L 2Q76A 5HYJD 4PJ5B 3NZ8B 4KK9D 3L3KB 5BRZB 1Y6KR 2PW1A 5INDA 2UUDH 4FXGB 5C0CD 1BMGA 1RZ7L 4H8WC 4QT5B 3EJJX 4N0CC 5IG7A 5IW3A 3QIUA 3E3QE 4K23L 5GGSB 1O7SA 1H0DA 4PRBB 2Z4QB 4YX2L 3QNXA 4LCWA 2NXZD 1T04A 2NY4B 5TPWL 4PJAA 3KPRA 5EH1A 3RZWA 4PG2A 4HIHB 3H7BA 2G75B 3N50A 1KJ3H 4LEOB 4M7ZC 2OR7A 3EYVB 1CFQA 5BRZE 3VFNA 5ESQB 1KBGL 2PN5A 5JMOC 4FP8L 5FYKU 4ZFZB 3CUPA 1LILA 1GYAA 3QHZL 4P9HH 4HPYL 4W4OC 3R8BB 5K9OA 1AC0A 4KFZC 4HUXB 1FE8L 4Q97A 5IHZB 1GHFL 1SQ2N 1ZT4A 1J1XL 5HGGS 4F15C 2EDYA 5E24E 1EHAA 4LQFL 3HZYB 3KPPB 4JFXA 5IGXL 5JPMA 2EIZA 1BIIB 3QEQA 4LNRB 2KUTA 3WFHB 3MBEB 1CICA 5EO1B 3MZTA 4Z7UE 4XAWL 3UMTA 2EYSB 1GRWA 1N6VA 3UTZA 1F2QA 4QF1B 3WCYA 4I18C 3VFUA 3QXAA 2LAGB 4JQIL 3HS0A 3O45A 1BLNB 2YPLD 3K2UH 5L8LB 4Z7UA 1ZT1B 1XIWD 1ODAA 3CFDA 1A7RH 4LLVA 1KOAA 2P5WE 4GRWH 4WFHE 4N90E 3NCMA 5LGHL 1L4IA 3LEYH 4F9LC 1ZMYA 2BNRB 2JIXD 1HHKB 3SHSA 3BQUD 4TRPH 4J3WA 1HYRC 2R0ZL 4OF3A 2OTWA 2FB4H 4G3YL 2PYFA 2UZIH 3SBWC 4M7LL 1VESA 3L9RA 3NCCB 1E4WL 4RGMC 4U6TA 5E2UH 3ZE2F 4JRWA 4OI8A 4P2RA 3UTQA 4MS8C 2BRRH 2CLZB 3GBNH 1XGPB 5L9DL 3D87B 5F7YC 5CBEA 1A9EB 3B9VA 3FL7A 1M7IA 1FO0H 1U3ZA 3THMH 3OG4B 1X5KA 4M93B 3K46A 4JHAH 3N06B 2GCYA 3VFVB 3DOSA 4WTXA 2P45B 1IQDB 5GSVB 3T1WA 5FUOL 1JWUB 3BUYA 2Q6WB 1VADA 1BREA 2W1NA 4X98A 5F7HA 4X4ZA 3VDAA 4X6FB 5CJBA 3HMXL 1I7ZA 15C8L 3ARFA 4I0PB 4MNQA 4OUUB 2AK4A 1O7VA 2BSSA 1Y18A 4LAQL 3KYNB 5E6IB 1DN0A 3QUKB 4O5LH 4OD2A 5F96H 4U1JA 1T7WA 3GGWA 3FT3A 4KK9C 1G7LB 2HT3D 3EYFA 5ELIA 5KZCB 4LASL 3MYJB 1MJUH 3JWOH 1RAMA 1JI1A 4ZUUB 2XKSA 1MF2L 2J8UA 2ESVB 4LSVH 1F02I 4MCZA 2A6JA 4QRUB 5JTWA 1T0PB 4P9MH 4S1RH 4QHNB 2COQA 1UVQB 4HS6B 4WJ5A 5CILH 3QI9D 1FGVH 1XH3A 4NN6B 3RU8H 3BGMB 1HH9B 2KZ1B 4IM8A 2NYYD 1AY1L 1DE4A 1F13A 1PQZB 4Y4FC 1G9NH 3LEXB 5IJKA 4HS3A 4HIEA 3TBYA 3SQOH 1INEL 1QR1B 5GXBB 1UA6L 4F58H 2Z31A 4KKCD 1QTYT 1Q1JH 5T3XD 1YEHL 1Z0MA 3F7VA 1TTUA 1S7QB 3MROA 4G42A 3SCMB 3WXWH 2OTUA 5FYJH 5IVXE 5HVFB 4HKBB 1DBMH 4DGYL 4JFEB 4F7TA 3SKOA 1P4BL 1BD2D 4DN3H 1CL7H 4LDOB 5B3JE 2B4CC 5BCAA 7CGTA 2P5EB 1ZXQA 2DYPD 3JWOL 4WHYH 1JFQL 5I9QB 4WV1A 3UYOD 1Q8MA 3JTTA 2X44D 1CDGA 1IC5H 4LVEA 2AXFA 4O5LL 5ANMB 4UZGA 1JN6A 3KVQA 4X6CA 1GZPA 2NY0D 3PDDA 3WNLA 4XGZA 3O6MH 3QUMH 3TFKC 1UJ3C 4YDVB 3G5ZA 1E4XL 2C1OB 1YQVL 4L1HA 2OZ4L 3MA9H 3P0GB 3QG6B 2MMXA 3WFCH 1JZ4A 2PYEA 4PTTA 4I8DA 4F8TA 2XWJB 3WXVH 3TA3C 1BAFH 5AEAA 1KF9B 5HYJB 1T1WB 2G9HA 3O6LH 4JO4H 3FAWA 2XN9E 5DD5H 3JSSA 2D7PA 4LKXB 1U8NA 2ITDB 2QTEA 2V2XB 4OZHF 5L2KD 1JZ3A 5E00B 1TTGA 3TC9A 3MFFA 4WI3A 4QRUA 1EEYA 4YGVB 4X4XA 3DIFB 2AXJA 4AIZA 4S1QL 1NGPH 4TUJB 2BRRL 2Y7QB 3W9DB 2VDRH 3AUVA 1LMKA 3P40A 1KTDA 4KMTL 3H8NA 4BSJA 4QRRD 3UTSD 1X7QA 2VDMH 4JQXA 2FB4L 3K7UA 1LNUB 1MCPL 3RPIA 1R5IA 4XXCA 3F5WA 3IAGC 1A1NA 1TPXB 4PJBF 2AABH 2VLKB 4TRPL 3ZZ1A 4YUEL 5GS0D 2C7UA 3HE7A 1G9ML 1AI1L 3L3GB 4X6BB 3QCVL 1U58B 1FG2A 5LGHH 1G7HA 3QNYB 2A6DA 3IDYC 3IVKB 5FYKD 2WBWB 4NP4L 4S2SB 2I9LB 2P24A 1LO2H 1EIBA 3TJHD 4KJYA 2V7NA 5C0EA 4IOIB 1P7QB 5IHUL 2QQLL 5HDBF 4DGIH 1SYSB 4EI6B 1AGBA 3MRPA 2F19H 2APFA 3DX7A 5LG1A 3L3KA 1KGCD 4Q0XL 4K71C 4POYA 3PNWB 4ZXBD 5MENE 2J6EH 2VLJB 3EDDA 2R23B 3CH8A 1F6AB 1UC6A 5DQ9B 4ELMB 4NUJA 4OLWL 1CE1H 5GS1B 3BKJL 5LXGH 3RDTD 3ARGC 3LKPA 5ADPH 3FTGA 1HQ4B 1YYLL 1RULH 1TVDA 5T5FH 2PYEB 3SO3B 3PGCB 4YFLF 4MNGB 4QOKA 2R29L 5BJTB 4JLRB 3T65B 3DX6A 4U3XA 4HS8L 4JPIA 2P8PA 4XP6H 4H0IA 3MJ9H 4JFOA 2FATL 3MCLL 5BVPH 3D48R 3GSWB 3GK8H 2HRLA 1IGIL 3D5OF 5C0AD 2ATKB 3WNOA 3TBYB 1OP3K 1P84K 3FO0H 1OPGH 3VH8A 3TYGH 1MH5A 1FYTA 2V6HA 4YHZH 3QUZA 1YMHA 4MS8D 2DDQH 5L6YH 1UKSA 4NSKA 3DV4B 4NQTA 4JPWL 4ZAKA 1WZLA 1WWAX 4HKBA 4XPBL 3T3MF 4AG4H 5D2LF 1C1EL 1JWMA 3IDXH 4K23H 2X4TB 4LLWA 4ZUTB 3BX7C 3LD8C 3QIWA 4FXKB 3O11A 1FNAA 1NAML 2BOBA 1KC5H 4KPHL 4X8JA 3CUPB 2EYSA 1FYHB 3QDAA 4XVTH 4XBGB 2P24B 2ZUXA 2OI9C 5HHXH 4NDMA 4PJ7A 1KFAL 2EO1A 3T8XA 2DQCH 3A6BL 2YUZA 4Z95H 2J12B 4H25B 4MMXC 2BOCA 5HHNA 4N90D 2BVTA 3VGGA 4EIZC 2ILLA 2JCCA 5C8JA 3QIBD 1KIUA 1CD1A 3BD3A 2KBGA 5ISZE 4KZDL 4NQCB 5I1HH 4FQIH 5T3ZD 1ACYL 4JREB 1XGUB 3U30C 3U2SA 3I9GH 1P53A 3PWVA 5F7DB 4XHJC 4L4TA 5EBLB 4F7CA 1CFVL 3KNBA 2H2PD 4I48A 1EHNA 3A0OA 4JY4B 3HLAB 4G8GE 3K2MC 2VH5L 5MHSD 5E00A 2VLRD 1W0WA 4OV5A 3N9GH 5F7MC 3DBXB 4I77H 4PGDB 4TVPH 5T1MA 4P2RB 4S2SA 3MGTA 4MAUL 1BBJA 1IAKB 1C5CH 3ZE1F 5IJVB 5CJQH 4GSDL 5GS2D 5J7CC 1PLGL 3LDBB 25C8H 3DSFL 2GSIB 2VLKE 4KJQD 4I3SH 1ADQL 3F5WB 1YMME 1U8QB 2VIRA 4NJAH 2GTZA 1SHMA 4FQCL 1DQQB 5B21A 4OB5H 4UV7L 1G7IA 3T4AB 1R5VA 2IH3A 4J3UA 2P8PB 1BOGB 4V1DD 1MELA 4OF5A 3TVMB 4QHMB 4RNRB 5KS9A 3QIUC 4TPRH 3LKNA 4Q2ZA 1D9KD 4YXLH 3MNZB 3VMNA 3EJYC 3U9PL 1LD9A 5JXEA 2GQHA 4IMKA 2FHCA 1CGXA 4IOFC 3E2HB 4IRJA 3UTTD 1TQCC 5JPMB 3U4BL 3KYMB 5IMOA 3B2VH 3K74B 4N8PA 5IFHL 2W07A 4M03A 4YDJB 4D0DA 4NQDA 1AO7B 2DM3A 3CCHB 3O2DA 4CMHB 3QXAB 5KSAD 2FYYB 2GFBA 1S7RA 3MMEA 3HRPA 5IW1B 2AJYL 1GGBH 2VE6A 2H2PC 4YWGL 5F1NB 3OMZA 4K7PY 1OSPL 4J3TA 3OAZK 1D5XB 1JNHB 1L6XA 3QJFA 3CFCL 4IDJL 3RWFA 2RCSH 3CIQA 4O00A 2IAMA 1A7NH 4GT7A 5F7UA 3RGVC 1NEZB 4OGXH 3M17B 3T0EE 1YNLL 2RFXA 4O02L 4OCYH 3CLEH 1U8KB 3KPLA 4H1LH 4ALAL 43C9A 5EU6E 4X9IA 4JRYB 5EZLB 3QUKA 4ODTL 2XZQH 2Y23A 1FGNH 4Z0XB 3LHPH 4Y5YB 1IGTA 3L95A 4KC3B 1FZMB 3CX2A 5IR1A 1RJCA 3QZWG 4HUWA 5B3NA 1MCRA 1JPGB 1I85C 1KXVC 1E4JA 4M43L 3T2NL 4FTVD 4KKAC 4KK8D 3GSUA 4NZJA 4DN4L 3MO1B 2NLJB 1ZLVH 3ULSA 2X4PB 3O6FB 3DSFH 4JFDB 4JG1H 1OAYH 2HLFD 4I48B 5D2LE 3BZ4B 4MVBC 4NQEB 1N5YH 3X3FH 3WN5A 1Z3GH 5E5MB 4POUB 1XCTA 1ULVA 3BN3B 4PLKC 2GW5A 3BW9B 2NXYC 2YEZA 2VH5H 1WIPA 3H9SD 1PYWA 1MCWM 4LRIA 1AQDA 4TSAL 1BZ7B 5DD6B 1KN4H 1RJYA 5DHYA 3FT4B 4X6DF 5J0BA 1ADQH 1W72A 5JIIA 2KDGA 4QHMA 1A3QA 5H94B 1ACYH 1KTKE 4KQ3L 2WP3O 2PYED 4KMQA 4XWOC 4KZDH 8FABB 3R0MA 2N4IA 1BBDH 3RIFK 4M8QA 3H9HA 3ARDC 5D7LE 2ZUQC 1I1AA 2YN5A 2X70A 3ALWA 4XCFL 2NY1C 2VSDA 1CS6A 4I77L 4LRNH 2O61A 3N9GL 1MWAA 4Z95L 3C2SA 5D1XA 2CKBL 35C8H 1A1MA 5JW5B 3BXNA 1KFAH 4OF0A 2NY2B 4G5ZL 4WUUE 5C70A 1T89C 5HHMD 5TFSL 3VXOB 1A3LL 1A21A 1DBJL 1H5BC 1WIUA 2GHWB 1WBYA 5AAWA 4NO2B 4HUVB 3H9SA 5I1HL 2R56L 5C0EB 1SVZA 3LH2H 4HQQL 5T5NF 3ARPA 8CGTA 4L8DB 2EDKA 2OSLA 4CN6A 2Z93B 4X7CC 2BNRE 5HGDA 1VB9A 3A6BH 3LQAC 5SWSA 1WCBB 4DVRH 1JRHL 1FCCA 3FHQA 5JIHA 5BXFA 4Y1AB 2OXGA 2NCMA 3KG5A 1PEZA 5EWIL 3UPRB 5BO1H 4JHBA 3SKNA 2B5IB 3QI9A 1X7QB 3GK8L 1F3JA 2VXQL 1KENL 1P2CA 2UWEE 3BSZL 4P3WA 2VC2L 1ZVSA 3SDCC 3QO1A 1F58L 4MD0A 5A16B 2EIZB 3VFGL 4LSDA 5JDSA 2WQRA 3JWDH 1FCGA 2D7MA 4RX4D 1R3IH 4G7VL 5F3BB 3DBXA 4NRYA 2OJZH 4L5FL 4GKZA 4YHNB 1LEGA 3OKOA 4HMCA 3P77A 3HZKA 4F7EA 3O6FA 2I07A 4APQA 2V7NB 5F9WC 3MUGB 1PG7W 4XI5C 2BJMH 4YO0B 2J6EL 1KXTB 2RB8A 2IMMA 3PABB 4EN3C 5DEGA 4QCIB 3QWRA 2G5BB 4KRPB 4FQXA 3NCYS 1I8KB 1QSFE 2H1PH 3RWDA 5HHOA 1SJVA 4YNYB 4XP9L 4BZ1L 5T5FL 1I9IL 4RRPG 2ATKA 1RFDL 1K5NB 3PP3K 4ERSH 1YYLH 5IW1A 1HSBB 1RZIB 4Y1AA 2P48B 2IFFH 5F6IB 3SDAB 2D7TH 1LWRA 3LY6A 1CE1L 1KCRL 5D1QD 3FO9A 5DSCB 1OAZH 4UAOB 2V2WB 1NJ9A 4L9LA 1C5BH 4Z0BH 1G9MH 2V5RA 3QAZC 4QOKB 5BJTA 5TF0A 1N5AB 1SY6L 3UPCA 1AD0A 4P2RD 1INDL 2R1WB 3ZKNC 2Z93A 4GXVH 3L5JA 3C5ZD 1R3HA 2BNQD 2QKIB 5SWZD 4GW1A 2F15A 3WFEL 3B9KB 5LAXA 1G6VK 4RGOL 5EULV 3ZTJH 4GKOA 4NKOB 5KVEH 1XF3A 1SMOA 2NXYD 2XWTA 2BFVH 4LNVA 4AEHL 2EEBA 1TETL 1MH5B 2XQYK 4PGBB 5D1XB 1ACZA 4ZUSB 2EO9A 5DGQA 4LVHC 4BH7B 5D6CA 1QUNA 4JY5L 3MJ8A 3L3IB 1EAPB 2NQCA 3WFDH 3OPZH 1DVFC 3ULSB 2BSTA 5EA0L 3L5IA 3QFJA 4BFIA 5SX5K 2WINA 4ODHH 3CXDL 5F71A 5KSAA 4U3CA 3QDME 4H5SA 4UT6L 1TCRA 5DJAA 1IAOB 1P1ZB 3WFCL 4JPIB 1GSMA 4HIIA 2VDRL 3PQYE 3QUML 3SY0A 4N5UA 1CXFA 1NAKL 4D94A 1BM3L 3C09C 3VGAC 2XTJD 4X4ME 1NBZB 5C0BE 3L3HA 3PV6A 2IANA 4LLYA 1KIRA 5DD5L 1QLEH 5DJYB 2XZCL 1G7MA 1JFQH 3EO1A 3FOMA 2DQDL 3DTXB 3IJYB 4Y5XB 2R2BB 1WT5C 1WZMA 5I8CA 1A6PA 4AEIL 3QDMD 2H32A 5JR1H 1P4BH 2ZOKB 3LQZB 1JTTA 2EDWA 3MO1A 3IJHA 4GRMB 4JFYA 4TULH 4YK4C 4URTB 1BVZA 3ZTNL 1S8DA 5GGUB 1QFUL 2GT9B 3H3PH 4WWKC 5JMRA 1FFOA 4MXWL 2VB5A 4C59B 1BVLA 4NFCA 1INEH 3FKUS 3ZDYE 4IMKC 3VE0B 3N1FC 4ENED 4PJFF 1F3RB 5GGSA 2R2HB 5DRNB 5FKPA 3CFIC 2V7HB 4W6YB 1RVFL 1TNNA 1CF8L 3BQUB 4NQVA 1M6OA 4WIQA 3MRGA 4WI5A 3HZMB 2EEAA 1NEZA 1TZIB 3NFPB 5KVFH 3SQOL 3T0WA 5E0QA 3T77A 2XFXA 3WL9B 1KSRA 4CADB 5SWQB 2P5WA 1QFUH 1NFIA 1A1MB 5JW5A 2VE6B 3ZTNH 5EFIB 1AIFA 3MV9E 2JB6B 15C8H 5CWSB 5DZLA 5SX4I 4UI2A 4S1RL 2IWGA 3HR5A 4M1DL 1YMMD 4C4KO 4OT1L 4YBHA 4FQXC 3D0VA 3H9SB 1VCAA 3KPOA 3S34H 4P9HC 4ODXA 5I19L 4ZTOL 1OB1A 5LGJA 4NNYA 2XQBL 5F96L 4PRIE 4BJLA 3TEUA 3NGBC 3VW3L 1RY7B 3GMOB 1BM3H 4OGAD 1JF5A 2BMKA 3M1BA 1Q94B 3RWJA 4F7PA 1XGQA 3BZFB 3C5ZC 2G5RA 4QCIA 3HMXH 1YECL 3TVMA 1N4XH 5DRWA 4Q6IB 2A0LC 3W81A 1I8IA 1IGFL 4OZFA 4HHAA 5CGYC 4Y4HC 4XNYH 4JAMA 5CBAB 2XG4A 3MODL 2VN7A 5H37H 4JR9L 1UB6A 3ALPA 1VFUA 5F89B 5GS3A 5IEHA 4PBXA 3LEYL 1FO0L 2Y5EA 3L1OL 4MHHI 2FJFB 1U3HC 3VG9B 2APWA 2FJGA 4AEHH 4M6ML 1L7IL 2H32H 5E2UL 4MNGE 3TO2B 3FOMB 3UTTE 4JM2D 2D31B 3VFTA 4YO0A 4NKMB 5KANI 4WTWA 3V95A 4JM4H 4Y2DB 1CDHA 2YBRA 4XAWH 1CD8A 1UEYA 2NY0C 4FFZL 2MSPA 1JZ5A 5IVNA 7FABL 3VGHA 2VLMD 1UZ8A 1GHFH 3K2UL 3T0EA 1FE8H 3EYVA 3KR3H 4Z77A 5ID1A 4LVNC 5BZDB 4X99A 3KLSA 5KSAB 3AREA 1DLFL 4M62L 2NX5D 4I0CC 3QI9C 4WEMB 5DJAB 4XWOD 4JAMB 1WUNT 4IJ3C 5CBAA 4N1CA 3SDDC 1BGXH 2VDLH 3OF6A 4LKCB 3HE7C 5F7KC 4HWZA 3GB7A 1HWHB 3V4UL 3K8MA 5DXWA 4GUPB 4PJDF 1EA9C 4GBXD 5HD8C 1V5JA 1W8OA 3TIEA 2QQKH 1FV1B 1LO0H 2VZTA 4K3JL 1IC4H 3EHBC 5JHDB 5J57B 3LKQA 2YPVL 1CDJA 2OSLB 5IV2B 5D6DC 1I1AB 2XFXB 5IFJA 2FEEL 1YN6B 2OM5A 1QSEE 3U0TB 5E2WH 3VD9A 4HPYH 4WU7A 1F58H 3DO3A 4B7LA 5GSRA 4PJ7F 4HUNB 4W4OA 4TOYL 3SKJH 1AE6H 1AGBB 3G6JA 3MRPB 4FFWC 3VH8B 4QNPE 5JW4M 1KPUA 5TDPB 2PYFB 4HK0A 3O3BA 4V1DE 1OARH 5L7XL 1FL6B 3FT2A 2E8ZA 4L1DA 3ZSSA 4EVNA 3BN9D 1JRHH 1I85A 3Q6FB 3WO4B 5I1LA 4DVRL 1LP9E 1FFQA 2P5WB 3FB7B 1H15A 5GGTA 5SX5H 4ODUA 5IB5A 1IL1B 2AK1H 4YX2H 3WKML 3OKKA 1U8JB 3D9AL 3GMRA 3LRGA 4JKLA 1QSZA 1J88A 3CSYA 3LH2L 1NMCC 2Z91A 3VD7A 5ACZA 4RMTA 1W0WB 3IDIB 4GAJH 4JY6B 1A2YA 1G1YA 3FHAA 1ND0A 1W8NA 4JFZH 1D5MB 4MB5A 1OW0A 3SKMA 5TFSH 3EYOB 3LKOB 3B9DA 3EO0B 5E8NB 4U1GC 1F3DJ 4JPKL 4FQQB 5A16A 3VJ6A 2CKBH 1GH7A 2MQ0A 1FAIL 4QRSA 1GXEA 5DD1L 1VEPA 1HDMB 1ZLUK 4EN3D 9CGTA 4PYHA 1A47A 3PWUB 3FJTA 2VABA 4ZOEA 1A6TB 3C5ZA 5CP7A 4XWGL 4RMWA 5JZ7D 5IQ9A 1AO7D 1IQWL 2FJHA 3CFBA 5D2LB 3S5LB 2D7OA 4FMKA 1AP2A 1FFNA 2CUIA 4R96A 4RBPH 3DPBA 2DWDB 2HKFL 3UTTB 4CDHA 1J0IA 3S4SA 1BFVL 1T1ZA 3KPTA 5D7JC 1DR9A 4DJMA 2X10A 1JZ2A 4PJEE 4YGAB 5HHVL 3TO4D 2BSRB 4D0BA 2NY4D 3QA3A 4HDIA 2R2EA 4RBPK 2H3NA 4ZUVA 2DMKA 2IALA 1WF5A 3SJVD 2EE3A 2A38A 1DLHB 3N85L 4MAYB 4G6KL 4RAHA 4LSUH 4CVZB 2WV3A 2VISA 5I1IL 4OFVA 4M43H 1F2XK 3ARYA 4H1LG 2OK0H 4JVUA 5JORA 3P4LA 2BNQE 3MLZL 2DQHH 3SGJA 2PNDA 3DVNB 3LHPL 5JUEH 4IRJB 1KNOA 4K94C 2XPGA 4ZPVB 3T3PE 3O2DH 1B3JA 2AJZA 4PRAA 4NBXB 3O6FD 4LK4A 4NWTH 2Y9RT 2VLRE 5KTEH 3HE7D 5ICZB 1CGWA 2FIKA 2FD6H 2XNAA 4ODWA 5DVKA 3P0YH 2DOCA 3B83A 1OAKH 1JGUL 4RAVA 1U8QA 2C1PA 3IFPA 4U0RB 3TPUB 1FDLH 4DK3A 2WM0A 2HTKC 1BHGA 1JGLH 4IDJH 2OTPA 4B7IA 2PO6A 1UCBH 2LAAA 1T4KB 3WHE0 4YWGH 2KZWA 2AJYH 4EDWH 1YA5A 2HG5B 4GG8B 4TSCH 2X4NB 2HT2C 4M4RA 5H37G 4P4RB 4BQ9A 1N0XH 4EN3A 1QSFB 1G0XA 5GJTH 3NABH 2H9GB 4EI5B 4DZ8A 3VWKD 4UU9A 3KAAA 1MQ8A 3U4BH 3C8DA 2AW2A 1IGTB 1JNLL 1HQRA 2DQEL 2GUOB 3HI6L 5IK3A 4L8CB 3IGAB 3WIHL 5EB9A 3UJJL 4TPRL 2Z8VC 1LO4H 3O4LD 4R0LB 5FB8A 4ODUB 5IB5B 3CVIL 3IU3B 5F1IA 4Z76B 1RMFL 5IB2A 2BVEA 3VCLB 1OQXA 3VXUA 2IG2H 2EXYD 4UV7H 4OB5L 5CCKH 4G9DA 4RISL 3OKDB 4Y4HA 1NQBA 3UTSB 3U46A 2G75A 4NDMB 3T8XB 3MRRB 5E1AA 2ADGB 3JUZA 4XBEL 3T0VA 1JWUA 3BUYB 2Q6WA 1EERB 1N7ML 1RUQH 4HLJA 2F53D 3PHQB 2VUOA 1EHLH 1VKXA 4MAUH 3VXOA 5K93A 2X7LA 4GBXC 1WAAE 1UYWH 4AT6B 1KEGH 1UG9A 3ZYZA 1UFUA 5AZ2H 4WGVB 5I71B 3ISWA 2X05A 1NFIB 3PXJA 4N5ED 1IAII 4FG6D 1MFEL 5HGBA 1AIFB 3S3JA 3WDJA 3WE6B 2AQ3A 1JWMB 3B6SB 4P46C 5JLZB 3QP3A 4DVBA 4QY8B 5FM5O 2F53E 3LN4B 1IGML 2RR3A 1EFXA 2P8LA 1LHZA 5JQHC 5K9QI 1PKQE 4JFED 1NGXA 3FTGB 1T1ZB 1AR2A 1U95B 3T0EC 3WSQL 2WZPD 3NN8B 5LWYH 3MOBL 5E8DL 2CDEB 4E5XA 4NCDA 3BEVA 4ODSL 2EYRA 3GRWH 4DWHA 3QWRD 4ZXBC 3O41A 4ZNEA 1KC5L 2A1WL 3Q5TA 2VQ1B 5IEKB 3GKWL 2AJSH 3VGDA 4UDUB 3WN5C 1AGFA 1TZHB 1QRNA 1FVCB 4AG4L 1T1YB 3HNTL 1P5VA 3B5TA 4S1SL 3X3GL 3RUGB 3OHXA 3ZLQC 3BO8A 3S36X 2ZUSA 4ZXBB 1YYMH 1EBPA 2UYLA 4FQ1L 3GI9L 2EDRA 3MRLB 3TYGL 1S9WA 1YNTB 4UILH 4JFDE 4ISVB 1QSFA 4HW6A 1FYTE 4CMMA 5GRJH 1G9MC 1DUZA 4P5TA 3QO1B 3T1FB 4QTIL 3IJSB 1OLZA 2FBOJ 4N0UE 1MLBB 4H26B 1OP5H 5D7KD 3CFBB 4XP6L 3TF7C 4Y19E 4A6YA 5AYUH 1U8MB 3VXNA 2DL2A 3CGTA 4OKVB 3RVWD 1NLBH 1UXWA 1MY7A 1P4LB 3K80A 4QRTA 5GRUL 4NM4H 4TYUA 2AJVH 2DI9A 5DO2C 3GJEA 5INCA 3G5XA 5ITBH 3DETC 3MLUH 4FFVC 4GW5B 2HFGH 4KKAD 3FFDB 1GL4B 4E41E 2Q7NA 4M1GH 3GBML 4JDZB 2PO6B 1A6WH 3GHEH 4GG6E 4DGIL 5I1GL 3MZGB 5EOTA 3QNZA 4XVJH 5DTFA 4HFWB 2O5YL 4RIRB 5I1CL 3V5DB 5HGBB 2LQRA 5IIEA 4NP4H 1OOAA 1HILB 1JTPA 2X9YA 3BISA 4R4FH 2X89D 4O2EB 2VLJD 5D93C 1RIHL 1XGTB 1DL7L 3O8XC 5DI8B 2JTDA 1B4JL 4XHJD 3WLBA 3OAUH 2B20A 4D9QD 4P2YA 5B3JF 5GPRA 3UP1A 1PGRB 3BN9C 3VXPB 2LU4A 5C0JA 3F7VB 3REVB 2Z35B 4U4BA 1MRDL 4R4BA 5GZOC 5JOFB 2HT4D 3Q5YA 5HJ3A 4U6VL 4YBLB 3BW9A 2VLJA 2CIIB 4EUPG 2OQJA 4LGSB 2BNRA 1T66D 3FRPA 1NJ9B 5FYJD 5ICYA 4OLVH 5TJWK 4NPYB 1XCQB 2HN7A 3SCMA 3BFOA 1ORQB 1S7SA 4U6HB 4V2BA 5CZXC 1RUPL 5KZCD 1BAFL 2BVQA 3QUYD 1OWWA 2EC8A 5LBSH 5K9OB 4K55A 2JK5A 1RZJH 3FQXA 4D8PA 2KQMA 3FQRA 3JV4B 2VDQH 4OF8A 4V2CB 4CVXB 1IEBA 5J6GB 2VDPH 1UXSA 5DLML 3O6ML 4JFDA 4RFNC 2P5EE 2MPAH 1JMZA 4GLRH 3B5GA 4R2GC 3QUXB 1WAAF 3QFJE 5E8OA 3FFDA 5CSZB 5EU3B 2CIKA 1DQLH 2QHLA 4UOW0 5D7LA 1NC4B 3RPIB 1K3ZA 3IJHB 4JFYB 4P4KC 3P3YA 1AXTH 5C0IB 4HXBL 3VFRB 4KJQC 1NUDA 4R97B 2GJJA 2VQ1A 2AXHA 2NY3C 2V2TA 5GS0C 1IZKA 5IMLB 2L4OA 1GAFH 1U2HA 3C6LD 1QSVA 3MRKB 3KLHD 5DJCB 1ES0B 4H8WH 1E6JL 3GIZL 4QOKD 3FO1A 5IVZA 1EFQA 4YHPA 4JZOA 5GZNC 3PHSA 2KH2B 2HN7B 1EEYB 5J1AA 3A6CL 3U0PB 4HIHA 3DO7A 3GSQB 5D7JB 1WZKA 3C6LB 1AY1H 4EBQL 3VD4A 4Z7WB 1TXKA 2A74B 4O2FB 3T0XA 4OCSL 1IEBB 5BMFL 5CJOH 2IMNA 3A6CH 1OCWL 4RRPA 1UM5H 1Q9WA 4P2QE 4PV9A 3ARGD 3CZFB 4X7EC 3EOTH 5HYSB 3I6KA 1MJUL 2BVUA 1C5DA 1XCQA 1CLZL 1H3UA 4NQEE 4WDIA 1OWRM 1KJMB 3L5WB 3D3VD 3MLSL 2IAND 1DBAH 1OF2A 5D7SL 4OZFH 3RY6C 1XEDA 3MOAH 3DUSB 4D2NA 3BP4A 1SEBA 1L0XA 1T22B 4PJ8D 1RJYB 4DKFH 4HPOL 4RWYL 3QG7L 4JFEA 2FIKB 1WFTA 1XR9B 4YEFA 3DX7B 5A2LH 2FNBA 2MTPA 3BEWA 3N0PB 4P2QD 1ZANH 1IKFL 4QRRB 4EKXA 3LRSB 1CN4A 3HS0B 3O45B 4LEXL 4FABH 1A4KB 3L3JA 4PJHA 1UEMA 1LP9B 3FFCB 2ZUTA 3DRQB 2VXUL 1TFHA 2VDQL 2VL5B 5L2KA 3MJ7A 2DIJA 4JRXB 4KVNH 3VFMB 3A6OA 1Z9SA 4P59H 5HPOA 4RMRA 1XF5B 3GBNL 5I30L 1ZWIA 1UVQA 1ZHLA 3HZVA 4L3AA 4JQVC 4QO1A 3VXRB 3B3IA 3MBED 4R90H 4B5EA 3HLAA 4OLVL 2H9GA 5EOTB 1TJGH 3ZO0A 1PD6A 5EU4B 1IGJB 2JK5B 4ZO8A 4RA3A 1I8MB 4AEEA 5M7QA 3QUZC 1JK8B 4YHML 3C08L 5DJXB 1PFCA 4XVSH 1MRDH 1AJ7L 5EO0A 4OZGE 3RWCA 4KGLA 3EZJB 5IMLA 1VGEL 1QOKA 4UBDD 3U0WL 1VFMA 5AWNL 5CIPA 4EQ3A 4QRTB 1NFDF 4JPVH 5ACLA 4LARH 3VXTA 3RDTB 2Z4QA 2JF1A 1AGCB 3F7PC 4OZGB 1H3GA 1RIHH 4Q74A 3QDGB 2XIDA 1MCLA 5SWSE 4DTGL 4J4PD 2YPLE 4WEUD 2I9TA 4U6XA 3QEGL 4Y16B 5E2JA 3BI9X 1A1NB 4J23A 5HYJA 1BZ9B 2CDFA 1EUTA 1KLUB 3ARZA 1LO3H 3M07A 4HX1A 2AS5M 1FLRL 4OLZL 2VLLA 1DBBL 1CE6A 3SDDB 1LDPL 1QR4A 5IOPB 2EDEA 2CSPA 1M71B 5IGXH 3TA3A 1XF3B 1U3YA 5DJYA 1LD9B 1NSNL 4F8QA 1HILA 5KVMC 5C09E 3OHXB 4M1GL 2BNQA 3DJ9A 1WITA 3MV01 1T83A 3P9MA 4WHTA 4LF3B 1NLDL 4GQ9H 2ZPKL 5JHDA 4HC1L 2G9HB 3GNML 5I75B 1T2JA 4UNTA 4FP8H 2C1OA 3C8KA 2YS4A 3VH8G 1H15B 4JO2H 3ARBB 1EMTL 1BZQK 1CG9B 1KJ3L 5AYUL 4X6EB 1YMMA 1J0KA 1Q0YL 4I2XA 4MLIA 4LCUA 3FMGL 4PJXF 5C2BL 3VRIA 1WEJL 2ZSVA 3GUTB 5HI4D 3ARUA 4KRNA 1EDQA 2XACC 4NT6B 1R3JA 5JW4R 2DLHA 5TPWH 4EEEA 2LTQB 3DARA 3S37L 4ZUSA 1JF1A 4JLRA 3T65A 1FZKB 2AK4D 2NMSA 4IOFD 5FV2A 1T2QL 3CU7A 2GSIA 1U3HB 2F5BL 5HYIA 5ICXA 4N0YL 5I16B 1M6OB 1QFPA 2GK2A 4FQ1H 1MAJA 3GO1L 3LN5A 5K59F 5J89A 4H26A 5DQ9A 1PSKL 3HMXA 1UH4A 2ADJB 2ZCHL 4XMPL 4Q6IC 5JHLH 1HCVA 4XZUA 2MHAA 3LEVH 5D72H 3LIZL 1BPVA 3GJFK 5E9DB 1TVHB 4BH8B 3PWPE 2A1WH 1A2YB 3CX5J 1LE5A 3UJIL 5I66A 2C26A 1RJLB 4QRPA 5E8DH 4Z7OE 3D39B 3MOBH 3NVQA 5JIKA 2R0KH 4BZ2H 2CRZA 1KPVB 1MEXH 2ZOKA 4YDIL 4WUUA 2PETA 2HWZH 4YC2B 2R0WH 4QLRA 4PJ7B 1SJHA 5EN2A 3Q6FA 1F6FB 3RWCB 4W68A 1S7RB 4XBPA 4WV1C 3HTLX 1QHOA 1Q94A 4KDTA 3BDXA 3TM6A 4XVUC 1MRFH 3G08B 4KHTH 1YEEH 3CPLA 1U8KA 4OF6A 1ZAGA 3MRBB 4WW2A 1IKNC 5JHDD 1IILE 5C0BA 1FH5H 3KYNA 3CSGA 3WNPA 5MEND 5C86A 2DLFH 3EFFA 4GS7C 1MHCA 2ITCA 1S78C 1UYWL 3G04B 3CXHK 2DWEB 4NGHH 3REWB 3OBAA 3CVHA 2YPKA 4IRSB 3UEZA 3L9RB 5D4QA 4GKSA 4XBEH 5CLWA 5IFAH 1PX3A 3QQ3A 4U1SB 5DJDA 1PZ5B 3LMJL 3QWOB 2E27L 2D03L 3RIAK 4JGUA 1XGPA 2DM4A 2VSCA