1N5AB

Crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Basis for LCMV Immune Evasion. Subversion of H-2D(b) and H-2K(b) Presentation of gp33 Revealed by Comparative Crystal Structure Analyses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 15
structure length 98
sequence length 98
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n5aB00
3PGDB 2CJUH 3HMWH 5EOTB 3VFVA 2Y06H 4NHUB 5AD0B 3ROOA 1DZBA 1R5WB 4JRYB 4WO4C 3U9UA 5C6TL 4E41B 4M6MH 4MHHI 3U7AA 2R0WH 1HSBA 2Z9TA 4LSVL 1EH9A 3H0TA 2ZSVA 3GBNH 2A6IA 5T5NG 1FH5L 3H3KA 3V6FA 5LKNA 4RIRA 4J4PD 1XF4B 4U1IA 5IB2A 1CBVH 3HE6D 4GUPB 1K2DA 4YXHL 5IMMB 2F53A 5TJWK 5JA8B 3CVIH 4U6VL 4PJBF 5IB5B 4EXKA 5DTFB 5EC1B 4C56E 5CHNB 5GS1C 4Q58C 3QDJA 4N90D 4PGCB 3DX6B 4PJCF 1OLZA 2OR9L 4NQDE 2AJSH 5HGBA 1IGFL 4PJDA 4NM4L 4X6DE 5GXBB 1LO4H 5L9DL 4HDIA 1EAJA 2D31A 5BXFA 2LV4A 4A6YH 4GKOA 3UYPA 3WKML 5F8QC 1GGIL 1ADQL 1KACB 2EIDA 1AFVL 3PQYD 1SYSA 1WF5A 4I18A 5L7XH 1XIWB 3FTGA 1HYSC 4B5EA 1JGDB 5SWZE 5TE7H 3MRGB 4WWKC 2AP2A 1KIQB 5F71A 3MV8A 4PJHF 1LEKB 4KQ4H 3GJFH 2DI7A 3RDTD 3GB7B 1ED3B 2EH7H 3D2UD 5TPWH 2XWJA 4ZUSA 3T1FA 3QULA 3OXSA 4Y5YA 2VZUA 3OPZH 4L4TD 1KELH 4EOWL 3A6BL 4W6WB 3CVHA 4M7ZB 3QXWA 1IKFH 2MQ0A 2FIKB 1AO7D 1JHKH 1YY9C 2DWDB 1T1XB 4N9OB 1WICA 5CSZA 1I3VA 3AROA 4U6VH 3O9WA 4JM2B 5T1MA 3GHBL 3MRCB 5F9JA 4PBVC 2B4CL 3AS2A 3MCG1 1I7RB 3NCJL 4QEGA 3HLAB 3KXFE 4CRPA 1ORSB 3DLQR 1FBIL 4BQBA 1TJHH 4GS7B 4K7PL 4OCXL 1BFTA 3A67L 3BH8B 4M6ML 3V6BR 2IEPA 1XAUA 2HJKA 2GJ6E 4EI6B 3O8XA 1LK3H 4QRRA 5FM4A 3QCVH 3PL6A 4PRIE 1RK0A 1G0DA 4X98A 3WN5B 4BSVA 1SMAA 3KXFD 3QXVA 5GRJL 3T2OA 5D6CB 5K9QI 1BFVL 3P0YH 2JJVA 3IRPX 3EOTH 1GOHA 2ADJB 3LEXA 3CCHB 3X12A 2BX5A 4CVXB 4P5TA 4YHOH 3SDCB 3BZ4B 1HXMB 4FN0A 3LEVL 4BFGA 3VFMA 5L88L 4FXKA 1CQKA 1ZLVK 5EIVA 5GIRA 3HFMH 3S35L 1TVHB 3DTXB 4YWGH 4C59B 2GY7B 4LCUB 4QHNB 3RVTC 4HIEB 1NAMH 1AC0A 1NGXB 5E4EC 2CMRH 1MCWW 3TYFA 4RNRB 3T1FB 2R0ZL 4K3DL 2DLTA 4R96A 1WZ1H 4HWBA 2ENYA 2KL6A 4R97B 4P57A 3T8XA 4U2ZA 1B6DA 4RFOL 2Y5TA 1DQTA 3VD7A 2M1KA 3VA6A 4GG6A 4HPYH 3CFCL 5E2UL 3T8XB 1A7BA 1HKFA 1HSAA 1ETZA 1X7QA 3U30B 3JV0A 2EXWD 4H0GA 5DSCA 3ULVL 4NGHL 3W5MA 1T5XA 4Y16C 2CQVA 5GRXG 5L2JA 1KN2L 5ICZB 2ID5A 4Y4HC 4XNXH 4PGEB 5DT1L 2V2WB 3GSRB 3F58L 4L4TB 5D9SA 4CUCA 5EC1A 3QHZL 3P0GB 4YBHA 1JYXA 3VFMB 4DWHA 4JDTL 3KG5A 2NX5A 4CMHB 5HGAA 3STLA 3LN4B 4PV8A 1FHGA 1EUUA 2A9NL 5D7KE 5FA4A 3HR5B 4YUEL 4K71B 2VO5A 4D9QE 1PZUB 3OKMB 4FS0A 4G8EB 4R90H 5IHBA 1C5BL 5DQJA 4PRDA 3FQWA 3CSYB 2HT2C 3ZLQC 3O8XB 1YYLH 2XKSA 1YMHA 5DHYA 1W0WB 2J1KA 5IB3A 3BPLB 1GZPB 2VYRE 1PZ5B 1SM3L 2ZCKH 1ZHKA 3ALXA 1GCFA 5C6PB 2X40A 3I6KB 4UV4L 3ZKNC 1SMOA 3RL2A 5CSZB 1Q1JL 4D9LL 3VG0L 4JCMA 4WEMB 1KEGH 1FAKT 2W0FA 5DMKA 4X5LA 2H2SD 4HUKB 4YHKL 3HPJA 2GSIA 2JK5B 4DUWA 5TE4L 3VXSD 1D5XB 1QP1A 4E42B 4ODSL 1FFPA 3BYYA 5C09D 4I4WB 5GS1B 4H0IA 4M9PA 2VDRL 1QRNA 5IK3B 3QDME 2X9YA 4L3CA 1QR4A 2VDKH 5C07D 5HJ3B 3FN9A 4NHCL 5F9OH 2B4CC 3FB5A 5BZWA 3OF6A 2XY1A 3QQNA 1YC7A 5L8KB 4I2XE 4OZFH 5GS2D 3ZL4L 1P4BH 4HDIB 1NANH 4GRLB 1FL6B 3L3DB 2OL3L 1XEDA 3HN3A 4I0PA 4PD4K 1VEPA 4PY8I 1OLLA 4M9OA 4U6HB 1JYVA 4M62H 3MV7B 1L0YA 3IETB 1AD0B 5IB1A 4X5XB 1P7QB 4AMKH 1WZMA 4QY8A 4ZUSB 3RGVA 2XWJB 3BKJH 5JHDB 1JCKA 1CICA 4ELKB 4U6XB 5A2LH 3NGBC 3RIAK 4G42A 1BFSA 1B2WH 1RJYA 2GEEA 5CJXC 1X5XA 4POUB 4R0LB 1OAUH 1W2KT 1TDQA 3O11B 1ZGLP 4L29B 1IC5H 1U58A 4LMQI 4B50A 4KPHL 3VG9B 1S9YB 2BVUA 4K7PH 1CFVH 3FFCB 1N2RA 3VWKB 1CQYA 4RSVA 5KW9L 4Y16A 1IAIH 5C3LD 4JZJA 2FZ3B 2JF1A 2BJMH 5C9JA 3MA7B 5GGVY 2E8YA 4CNIB 2AK4A 2Z8SA 4P2OD 3RX5A 4MWFA 3WO4C 5FUCC 4JRXB 5E08L 3GJFB 2X4QA 5HI3D 1HXYB 3Q6FA 1JE6A 5F44A 4XXDB 1DP0A 1KELL 4EOWH 1EGJA 2MJWA 3U2SA 3LKPA 3VXSB 2ZKHH 1M05A 4CGTA 4GXUN 3VXUB 2Z35B 5IQ7H 4RAVA 3OL2A 2ICES 1MRFH 1XGQB 1R3HA 4FP8H 3FO2A 5C08A 3VFUA 3SE9H 4ODHH 3MBEC 2V5MA 3OGCA 4X7TA 4TUOB 1PKOA 4HEME 5C0ND 5D5MA 4B7IA 4K8RC 2G75A 4XP6L 3LDBB 5C08E 2ZP0T 4ZXBB 3PJSA 2M8XA 1FVEA 1J8HA 3HB3D 3U82B 3VD4A 1F2XK 4N8VB 4NZRH 2DIBA 1A14L 4KVCH 4PJ7B 5KANG 5GPRA 4O51B 1IEAA 5JHLH 1R5VB 1LEIB 4PJCE 4AH2A 5CP7A 4OGAD 3VXRA 2BNQA 7CGTA 3PDGA 4WI8A 3TH4T 1A3QA 3R06A 4EBQL 4IOSD 4PJBA 1MHEB 2YD8A 1JF1B 3TA3B 4JGUA 2OSLA 1UKSA 4P46A 3MCLH 1I3UA 1QLRA 1H5BC 3O2WH 1BQUA 5LGHH 1QSFA 4GAYB 3KNBA 2YPKB 4Q9BA 1HQRA 2VSCA 1ORQB 3KYMB 2ZJSL 1IVLA 4LCYB 4K23L 3R8BB 5JDJA 5E70A 3KPRB 4OM0L 5TH2B 8CGTA 4RISL 4YHMH 4ELMF 1XGYH 2XPGB 3DV4B 3MNZA 3WFHB 2YD1A 1ZE3C 3RY6C 3VI3E 5E08H 3SDYL 2BDNL 3C5JA 1BWMA 1INEL 3SGKA 5DRZB 2BK8A 1Y6KR 2HJFB 2YEZB 4ZXBC 1I4FB 3H9HB 5HI4C 4NRYB 2UY7A 3PWPE 3C5SB 1ZS8A 3T0VA 3U4EA 4A2LA 4DOHB 1JNLL 1PAMA 1YQVH 3OXRB 3T4YA 4LCYA 1KGCE 3NAAH 3KPOB 2A74A 1NJ9B 4KTYA 5B39G 1XF2B 1HZHH 4MJ4A 1MCEA 4ZUTB 5HD8C 1S9XA 1FL3B 3F6IA 4FQQA 3QDMD 4M5ZL 1BIIA 5I76A 1I1AC 4O02L 4Z0BH 2ICWI 5GZND 5H94B 5IGXH 4XPTL 4PBXA 3RDTC 1QLRB 2XWTA 2NY1D 3EO9H 3HAEH 4NBYB 4H26A 2VC2H 3AAZB 4TTGA 1CDIA 4N8PA 3P4OA 4WGVB 2PR4H 1ZANH 3FT3A 2W9DH 2J8UB 1F4XL 2HKHL 4Z7NE 4NDMA 3KJ6H 3BHBA 1K8IB 1ZHBA 2FO4B 5DZLA 2NW3A 3ARGD 3WHXA 3LB6C 3LKNA 3GSQB 2BHUA 4HIXH 1R5VA 3QAZC 1I9JH 4J3TA 4X0KB 2WIIA 5E2JA 5I17B 5E9DA 2F8OA 3M17A 4BZ2L 4FQXC 1LO5A 2GJZA 5FDWB 2PO6B 5C0BE 3QA3B 5ITBL 4ZXBA 5FO7A 4FQ1H 5CBEA 1RUKL 3AXLB 4G9FB 2XTJC 5K9QG 1JUFB 4LVOC 2DLHA 3MV01 1MHHA 3EYVB 4EN3D 3KS0J 1J9CT 3PWVB 4H1LH 5SWZB 2NQCA 4RGNB 5IUSA 4S1QH 2XKNB 4PRHB 5GGTA 5IESL 4XNZB 2DD8L 2ESVD 5HHXL 1G6VK 2XXCB 1K4DB 4H8WH 1P4LB 3DRQA 1NC4A 4Z5RA 4RDQG 1NCDH 4LLMA 3CLEH 1J8HD 2MTPA 4XHQA 4PRBB 2ED8A 1NFDE 1SBSL 1ZT7A 43CAA 2BC4A 1B4RA 1GC1H 4M3KB 1YC8A 1HH9B 1MFBH 1QSFD 4P5TC 3IDXL 4LDLB 1H9VA 2UYLB 3QDJE 3P4OB 1QSED 3EBAA 3R0NA 2OXHA 5I1LA 3TEUA 2DLEA 3TLRA 5C0RH 5HHMD 2J5LC 4U05A 2F53E 1OP3K 2UVFA 4F7CB 4PJXA 3LQAL 1A5FH 2B1AL 3F6LA 1U95B 2L0DA 4HKXA 2FX7L 5DI8B 1BJMA 3QIWD 3MRFB 2YD3A 5DFTA 4NQDA 1WAAF 5I1EL 1ZHNA 1ZS8B 1BM3H 2P43B 4OD2A 2WIIB 1NGQL 4LSRL 3VXPA 4TTDC 2HKFH 1QFWM 5EO9A 3RGVB 4ZODA 4PJ8D 2G5BA 5I75B 2CH8A 2AXGB 4B41A 4R0LC 3B43A 2XOTA 5ESVA 1YY8A 4CADA 1JWMA 4R2GC 3GIZH 4HUXA 4IOIA 4PJ5E 2EDKA 3I2CL 1RJZB 4Z7WF 3ARGC 1IGIL 2XRAL 1PKQB 4LVNC 3X13A 4DVRH 5FGRA 2XNAB 3F7VA 1OGTB 1R3JB 1FZKB 2V7HA 4ZFFA 3U7YL 1DDHB 2R1WA 5DA4A 5J3HC 2DYPB 4PD4J 2P5WE 2F54D 3CVHH 5E00B 4R8WH 3FAXA 5HD8D 3C5SA 1OM3H 3QI9D 3U4EB 1L6XA 4HK0A 1OTUC 4QRRE 1IAIM 4OLWH 1J8KA 1MRCL 2HWZH 2IFGA 4MD0A 1X5GA 5CP7B 4OIIL 3WDIA 2GT9A 2I60H 4LOUD 4YHNA 1DQDH 4L4TE 1NBVL 5E24E 4Z77A 4KJQC 4TUKH 4JG0L 3KPRA 4PJEB 1F11B 4M8QA 1KIPB 1J8HB 5BVJB 1AXTL 5I2IA 5D2LB 1KB9J 3HTLX 5E56A 3SHSA 3RDTA 3GSVB 1IM3A 2IAMB 4GMSH 3IKKA 4O2EB 3QXAB 1RUQL 3C6LA 3O6FB 3RGVC 2AXFB 1ZHKB 2B2XL 3MRHB 1NH6A 1KG0B 5CIPB 3K8LA 4XVSH 1QSFB 4KU1A 5A3IC 4WWKA 1XZ0A 4KRPB 5CMAB 4ZMAT 2NY7H 1E4WH 5SX4I 5I1LB 4IIQB 1MVFA 3ZDXE 1L0QA 1U8NB 5A2KH 2VJXA 5J1AB 3SDXA 2PCPA 5AUMB 4LRIA 1WQVT 3CFEA 4NFCA 5EOCH 3NAAL 2R0LL 3IKCB 1EO5A 2XT1B 5ETUA 1JGVH 4NO0B 1KPUB 1I3GH 1OAYL 1QYGH 1TCRB 2W9EH 1J1XH 3CXHK 1NC4B 1FORH 4YX2L 5JOFB 3FJTA 5J8OA 1HCFX 4GG6E 3PJSB 4WGWB 4V2CB 5C0CB 3IVKB 4BFEA 1G6RL 4R8WL 1NLDL 2X4UB 2FBJL 4K23H 4WU7A 1NEZB 3CC5A 3FHAA 1H5BA 3MLWH 1I9RL 1P5VA 4HCRH 4CW1A 4P2YA 3BKCL 3VMOA 3IS1X 4NOBA 4YH6A 4HH9B 1FZMB 1UKTA 2Z35A 1IEHA 1U8KA 1IGTB 1A6VL 3TP4A 5JZ7C 2NMSA 5FOBB 5I71B 5FB8A 4HGMA 1I1YA 1U3HD 1N64H 2B0SL 5FUCE 5B38G 4P49A 3B5TA 1CFNB 4OGYH 3PWJB 4NQDD 4QY8B 4YPGA 1EXUA 2EDDA 5DHVB 1YUHB 2AJZB 1Q94B 5ALBL 1EFQA 5EBWB 2E9JA 3MA7A 4Z7NF 2PTTA 3OX8A 1BF2A 1ZT4B 4P4KD 1YEDB 1BM3L 4IRZH 4HKZB 1MVUA 5EFIB 3GFUA 4JRYD 2UY6A 1ZVHA 4GQPH 4HAGA 5D1ZA 3O4LD 1ZOXA 4QXGL 5EU6E 4MLSA 3JTTB 3F7PC 3KYAA 4XP6H 4G5ZH 3VWJD 2YBRB 5A16B 3BXNA 1KCSL 1BQHG 2YUXA 1T22B 2XZCH 3OZ9H 1C5BH 4ODUB 1P84J 3Q3GB 1SBBA 3FO9B 3O4OC 1NAMB 32C2B 5E8NB 2WWMD 3TZVD 2GAZA 5F7WC 5IF0A 3ETBF 3MZGB 3PE9A 4WUUD 5IK3A 2EH8H 4NRXB 4P23C 3JWOC 4HV8B 4LLVB 3UJTH 2YPLB 3MOBL 3RU8L 4W4OA 3MRBB 3ZE1E 3GNML 5EG6C 3UTQA 3BGMB 2N7BA 4LEXH 3MX0A 3QI9A 3KLAA 3BKYH 3MV11 3QNYA 3HLAA 5DT1H 5D1ZC 3X14B 5EU4A 3HNSL 3SDAA 4H8WL 3CSPA 1YEIL 4XVJL 2GTWB 2J6EA 2W1NA 1GXEA 2V5RA 1G9NL 1BD2B 1U8LA 5MEND 3NPSC 5FECB 2ERJB 1RFDH 4LOUC 5DO2D 1GPOH 4PTUA 4EN3A 5DJ6A 3P0VL 1CTNA 1CFVL 1YMHB 5DHYB 1RMFH 1PG7W 4P4RB 1FL5B 2FD6L 3MOAL 1RQ5A 5HHOE 1IT9L 1M6OB 1FFNA 5HGDA 4DN3L 4FQ1L 1SY6H 3E8UH 4P2CG 1FNGB 4PJAA 1FP5A 4C56A 4OCRL 3B83A 4GAGH 5BJTA 4I18B 4FZ8L 3ME0A 4NT6B 4ZOEA 3HR5A 4B53A 2GQHA 3LQZB 1MCLA 4PJFA 3F65A 5IM7B 1T0MA 4HIJB 2BCKB 3BFOA 4LHUG 2W65B 4L3EA 5CINH 3ARVA 3B9KD 4NN5C 3SGEH 1U3HC 2PXYD 5CEXB 4JPKH 3FO0L 2D7OA 3OMZA 4BSWB 3ES6A 2R2CA 5DK2A 5D6DA 3A0OA 3MGTA 4Q97A 2E8ZA 2WP3T 3WDHA 2H2SC 2X70B 2BSRB 4GLRH 5KS9E 1PZ5A 1F90H 3MLXL 5MEQB 3LN9A 5DMIL 2WAHA 4PJCA 3VFTB 1YMME 1CZ8H 5KG9B 2OJEB 4M93C 5AG8A 1GYAA 4XZUA 3AC0A 2VZSA 1MAKA 5F7UA 5CGTA 3TZVC 3X11B 3F8UB 4HGWA 2WWMC 5C09A 1RJLB 1F4HA 4JQVC 1GIGL 5I1AB 1KT2A 1EIBA 4XXDA 3M45A 3KR3L 1AGEA 4LVHC 4K3JL 2AKRA 5AZEL 5D6DC 1QZ1A 1BLNA 3LY6A 3C5ZB 1Q9WA 2AK4B 4ZPVB 5D1ZD 2BDNH 2BSRA 2RCSL 1S3KH 1NUFA 4WHTB 3ARDA 3L6FB 5EWIL 1AJ7H 2EDQA 1X44A 1LP9F 1LO3L 3WJJC 4GW1B 4F57H 4ZO8A 2IBZY 3GNMH 4S1RH 4Y5VC 5C0AD 2ZCHL 1BPVA 2XACC 1T89A 4NKDA 2CGRL 2HN7A 4CVXA 4UB0L 2ZUQB 4Y16D 4L29A 1TNNA 2V7NB 3H9SE 5KN5A 1OSPL 5CWSA 2H32A 4MQXD 5F70A 5GGTL 4OGXH 3B2VH 3PWPA 4IMLB 5DQ9B 1GGBL 4WV1B 4M93B 3NIFE 4FXLA 3WEXA 4R90L 1A3RL 4APQD 1QSEE 2F15A 5I15L 4Y8AA 5KOVC 4IBLT 1NMAH 2ADFH 5EDXA 3DSFL 4MNHB 3FHQA 3GMLB 3BP6A 1WFOA 3MRCA 5F9JB 4X7CC 3D39B 3QIWB 2VOTA 4I9WD 3HAEA 5CEXA 1MCCA 4KHTL 4M6NL 1OQXA 2AJVL 3GMLA 4BA8A 3G5YB 5KVEH 3QRGH 4R26L 1AGCB 3V5HB 1KN2H 1GOFA 3VDBA 4OLZH 3IXAA 4D0DA 3N9GH 3BGMA 3OXSB 4Y5YB 2E6JA 3P9WB 5BZWB 3IFOB 4PJHE 1RZIB 1MEXL 3LD8B 4GXVL 4KK6D 4HT1L 4PLKD 4P4KB 4AL8H 4DZBA 4CKVX 5ALCL 4LASL 4X9GA 3IU3B 2J4WL 5AZ2L 1N26A 4P4RA 3L3GB 2FB4L 5ESAB 1CGSL 5LWYL 4F37F 2FCBA 3VGAB 1KEML 3GMMA 1NCTA 2VZ3A 1IGJB 1AP2B 3SGDI 5GS3A 1X9QA 4Y4HD 4OIAA 5FECA 1EEQA 4M5YH 3G5YA 3OG4B 5JQ6H 4K3EL 4YHPB 1IZJA 2NY5L 2AQ2A 3O2DL 1DVFC 4Z7UA 5C1MB 4KZEH 4MNQA 5C9KA 1EEUA 3CH8A 3OX8B 4KK5D 4OZHE 2A6JB 5EUOA 3TBWB 4WHTA 3QUYD 2I60L 2P5EE 4MA1C 1U9KA 2W9EL 1A4JA 5DD0L 2EDWA 1FYTE 2HWZL 4DKFH 2VKXA 4M43L 4NYLA 3BPOC 2QTEA 5IVXF 1Z2KA 3THML 3RHWK 4UV7L 3ZDYF 5BVPH 3U1SH 3V6FB 3MV8B 1MCQA 4E41E 5J57B 5DUMH 4KZDH 5E8NA 1JGDA 1X5ZA 3U7YH 1WBZA 4UINL 4R7DB 1AGDA 2YBRA 3ZO0A 5T5FH 1UA6H 4G43B 5JDSB 4P5MA 2V5TA 4QRTB 4UIMA 3OR6B 4NNXB 3TBTA 4P2RA 1YNLH 4LSDA 3WD5H 3OBAA 2VR9A 1QSZA 1HNFA 4FQXA 1JRHL 1QFUL 4OI8A 5C2BL 1T0NB 1WCBB 3VFPB 4O2FA 4YHYB 1JJUA 1T0MB 3RBGA 3DSFH 3ECBA 1DTUA 2XN9D 5I1CL 3H3BC 1KT2B 4G6MH 1LDSA 4LLWA 3CDFA 5FB8B 3FB8A 1CGUA 4XC1L 1S7TA 3E6HA 4NZUL 3S37L 1PQZA 2FX7H 3G9VA 2FB4H 3QEQE 4M6OH 1CD9B 2VLKA 1D6EB 4M03A 4XGZA 1RU9H 3W9EB 2A83A 4AL8L 1K85A 3U7WH 4Z8FL 4F7TB 1WBXA 3TYFB 1WFUA 3Q1SH 2IBBA 5DJDB 4ODSH 2G9HA 2CIKB 1ODAA 2VLME 3LOWA 5I16B 2AJVH 3I6GB 1CE1L 1S7UA 1H3GA 1UACH 3VXQA 3FZUD 2DYPD 4XVUC 3S36H 4XBGB 1JK8A 3SN6N 3V6OE 4HXAH 4NPYB 1KV3A 3SOBL 5GJTH 3VA2C 3WLBB 1X6NA 5IEHA 2WW8A 3QI9B 5I1JH 3OKOA 4F7EA 5H35B 3BEVB 5D1QB 3KLHD 2EZ0D 2BNRE 1Q9KA 3CVIL 1S7VA 3E6FA 5D6CA 2VLLB 3VWJC 1QPPA 1FNGA 2MHAB 5F72S 1I9EA 1G6RB 4I77H 4Y2DB 5DYOB 5B3NA 1OTUD 5J56B 1BAFL 5ACZA 1BZ7A 4F9PA 4X5WA 4NM8H 5E9DD 3IJHA 2R56H 3MYZA 3D69B 4LEOA 1CZ8L 3WFEL 2OQJB 5HHME 4P46C 1I1CA 3TCXA 2CDGB 2H3NA 4MAYB 2CD0A 4JDTH 4RQQA 2ITCB 2Q7NA 4L9LA 4Z9KB 4PGDA 3QHZH 5IBUB 4K7FA 5IOPB 3MMEB 1HI6B 1GVIA 2F19H 3V6OC 2NZ9D 4OCWL 5DJ2B 3DGGA 4HWNA 3DYMA 3P30L 1OGAB 3P9LA 5DJXA 5L2KE 2XY2A 5TFSH 2UZYB 3HA0A 15C8H 2O5YL 3OJDB 5JIIA 1G7JA 1UEYA 3BE1H 4ZFOB 4KK5C 2NTSP 2DDQH 3N1QC 4PJHA 1T7YA 5E94B 3U0WL 3NH7L 3UXFA 3MBEB 2ZOLA 1D3CA 5D5MF 5L6YH 4X7SH 1AQKH 3QHTC 1CF8L 2R9HD 3HS0A 5DEGB 3VJ6B 5F7DB 5D7SL 2HVJB 1ZSDB 4NWUH 5FA3B 3SCMD 5FKAA 3P0VH 1NAKL 2ZCLH 5D96B 1MOEA 3QIUB 3MODH 1NCWL 1NAML 4HCRA 1FAIH 1KPRB 1F42A 2VXSL 5DMGC 1MCRA 4HS6B 2XA8L 4GKZB 5KSAA 4RGMB 1PEZA 2QADD 2R2BB 4JFQB 4P2RD 1WISA 3V2AR 1CU4H 4QXWA 5C0AA 4C58B 3V4PL 4WUKL 5ENWB 3B4NA 3C60B 2YUWA 2BP3A 4PY8J 4E5XB 4LBEB 4Z7UF 5MEOA 5I19L 4U1IB 5GRWA 5BOPA 1UB5A 4Z5RB 2IAMC 3TJHC 2J12B 3PWLB 5J4MA 4TULH 1TZGH 2ESVE 4UIKH 1HHGB 2IANE 4WWID 3MV9E 4OB5H 1KJVA 3RGVD 1R5WA 2DBLL 2FLRT 1U8NA 3SKJH 2FD6H 1EO8H 3IXTA 2ADGB 1GL4B 2GUOA 3T1WA 1J1OL 4UAOC 2VZOA 3G6JF 1C12A 3MLSH 2CLRA 2DLGA 4S2SA 5KS9B 4E0RA 1RUAH 1WAAA 2VZ1A 3DI3B 1J05B 4D2NA 4IRZL 4OZFA 43C9B 1UB5B 4OCYH 3ARRA 3EO1B 1JGLL 1QA9B 1J87A 1IKFL 5CGYD 4KKLC 2MPAH 2EO1A 3A6BH 2EE3A 5MHSE 2Q76B 3G5ZB 2J7LA 1U3JA 2O61A 4PJGA 4OGYL 4JKPL 1BD2E 4AT6A 4LLQB 2AEQH 4RFNC 1Z9LA 5F8RC 5ECJE 3MRLB 1KCRL 4YNYA 3DETC 1O7VA 1MPAH 1KCRH 4G8FB 4OBSA 4ETYA 5B38A 4M6OL 4HUVA 1BD2D 3IT8D 3X13B 1IAKA 3QXDB 3L5HA 1N6QL 1EFXB 3ZKQD 1RIUL 2BMKA 3PP3K 3IFLH 5D2NB 2AEPL 4MB5A 3T08A 1R3IH 1HEZB 1TXKA 1YY8B 4MA8H 3E3QE 2XWBB 1YEEH 5E8OA 4C4KO 3PABA 1A14H 3ULUE 5FXCH 2FO4A 3ZTNL 3O3DB 4K7PY 3WXVH 3MLSL 2BJML 4DGYH 4OF5A 4LPCA 1NDGA 4LLUB 1NCUA 2NZ9C 4EIZC 1I3GL 2YUVA 2X4PB 1FH5H 4PUBL 3P4LA 2BMKB 4GQ9L 4NKOB 5KBNC 4X9FA 5CIPH 1P1ZB 2BNRA 5C6TH 1N4XH 1DQML 5I8KH 4S0SD 2Q1EA 3L7FB 4D8PA 1DVFA 3QZWB 4U3XA 4ZSOB 4HJJH 3WO4B 3GK8H 1SVCP 1YEJH 2JKXA 5HHOA 1HH9A 4U1HA 4HUXB 2JE8A 3BT2L 3BKJL 3BKML 1DFBL 2CPCA 3O3DA 4NIKB 5T5NF 4F8TA 5JMOC 4XP9L 2CXGA 3HNVL 3J8F7 1IKNA 3RPIA 2R29L 3PV7A 3BRGC 2VL5A 2E7LA 2FH8A 3AU1B 4OLYL 2A6KB 3OKKB 1BWWA 3VXQB 5L0QB 1FPTH 4O58H 2NY5H 1NAKH 1MRCH 5D2NA 4YIQB 4CDHA 3NPZB 1B0RA 4OUOA 4MZ2A 4HF5H 5DMJB 2G75B 3RZCB 4W68A 4F7CA 1AC6A 4KKAD 2W0PA 1MHHB 1G7HA 3EYVA 5C0EA 4OIBA 4YR6A 2DDQL 4PP1C 2AJUH 4YGAB 3PV6A 2NY4D 1MIEH 3FOLA 4NO0D 3TA3A 5C08B 1V05A 3QA3A 3T0DA 1F6FB 1B4JH 1JPSH 1TIUA 3EHBD 4OZGF 1R3KA 5DHVH 3GMRB 1NEZG 3DV6B 3GGWB 3NZHL 4POZD 3BAEH 2Y4SA 3NACH 3DX8B 4IHOA 4O9HL 4ZDHA 4OUUB 1W0VA 2XZAL 4MSWB 5IFAL 3LKNB 4EDXB 3MRRB 5C0GB 2CIIA 4WVRA 1ONQB 1N8ZB 4PRNB 3U9PH 2UWEA 3D39E 4HUWB 4CNIA 5IMOB 4ESKA 4LU5L 4NDMB 3KVQA 5E8DL 3DX7A 2QSCH 3ABZA 3REVB 1NGYA 4JAMA 4L8DA 3PV6B 4I1NB 2X4OB 4I3RL 4O00A 4PR5B 5KVMC 2XIDA 3V8CA 1FL3A 4FQQB 5HY9B 2C4XA 1F5WA 5I66B 4TVPL 2HVKB 3QJHA 3FOMA 5F21B 4N0YH 5E94A 3FFCD 3OXRA 1E27A 3C60C 5EA0L 3BIAX 3DUSB 4Q9QH 2YPVL 1KJ2A 1XF3B 5BZDA 5KSBA 5DVNA 1CGVA 4LQFH 3PDOA 1KN4L 4FXGA 4JO4L 4DTGH 3O9WC 2OZ4A 4N5UA 3DV4A 1S3KL 2X7LA 1OHQA 3SKOA 5CAYB 5EU3A 1A9BA 4PGDB 3RVVC 2FBOJ 3U79A 4L1DA 5BW7C 5BW7A 4WRLA 2P1YA 4P9HL 1N2RB 2I25N 2YA1A 1QFHA 5BQ7B 5DRXA 3DVIA 3BVNB 1S7SB 2BNQD 2F54B 3KS0H 3BP7A 3CFCH 1P1ZA 5BV7C 1NBZA 1YNTB 3VH8B 1VFBA 3KWWA 5ANMA 1NDGB 1ES0B 4HFUH 4AEIL 2J8UE 4FFVD 4L9DA 1QO3A 5GRUL 1LO2H 5JW3L 2R0ZH 4K3DH 3MCKB 3IFOA 4NUJB 1J18A 3QFJA 1S8DA 1ZEAH 8FABB 4BFIB 4J3WA 5FKPB 5BRZB 1S7RB 1IEAB 5GGSY 4PJXE 1EAPA 2NY6D 3X17A 3V4PH 1D9KD 2GSGB 4U1MB 1W72H 3DYOA 4NQVA 3ZE0F 3F12B 4W6YB 4KJQD 4G9FE 5IFHL 3WUWA 1IM9B 5DC0A 3SDDB 1C5DB 1KJMA 4QF1B 3TN0A 2X42A 4QTHA 4GRWH 4AM0A 4Y2DA 1G6RA 1AR2A 4JFDB 4ORGB 1P7KA 1AQKL 2EIEA 1UKQA 4LDEB 1V7MH 1F3RB 3DOSA 4MX7B 4LLWB 5DWUL 5KN5B 2FX9L 4R9HA 3S4SA 1AE6H 2NYYD 4E42A 5IEHB 1RZFL 4W4NA 3SKNB 4LVEA 3G5XA 4NFBA 5F3BA 4JRWA 5FYJL 2PN5A 3NCCB 1CGYA 5GGUB 5D7LD 1BQSA 2CLRB 4J3VA 4LKXA 3RWEA 3SQOH 4K9EC 4JM2C 3NIGE 4NKQB 4FQHB 4MDJA 3WUZA 1T2QH 5ERWB 3QPXL 2GJ6A 1BEYH 3O81A 1URLA 1RULL 5BV7B 3DBXB 4XHJC 4P2RB 2VISB 1F6AA 3QJFA 4JG1L 2CK2A 4ONGH 1FZOB 2VDNH 1DJSA 1X4XA 2FGWL 2EDNA 1LQSR 4TSCL 1AGDB 3TT3L 2HFGL 4CL7A 3FMGL 1KJVB 4JO2H 4ZFOL 2MOVA 4HD9A 1E4XI 4G8EA 4WWKD 3VH8G 4XBPB 4JFED 3FB8B 1FG2B 3OQ3B 3VFRB 5DJ0A 4RMTA 1CICB 4ELKA 1JP5A 6FABL 1BJ1H 4HEPG 1EJOH 2P5WA 3H9ZA 4NM4H 3Q0HA 2XQYG 2P44B 1QEWA 1UWXH 4G80A 2R2BA 1CIUA 4UOW0 4ZYKB 4PJ5B 5TQ2L 1XF5B 3K4AA 4NQCD 4I3SL 3NN8B 1OSZB 5E5UB 4UU9B 3ES6B 4TPRL 4JLRA 2ESVA 4FMKA 4Y16B 4HKBA 1NUNB 5FA3A 3KPPB 3GJFK 2F74B 1Q72L 4OV5A 3RWGA 1OPGH 1PLGL 3C8KA 3LQZA 1T1WB 4PJFB 4PJAF 1OAQL 1OF2A 3TFKC 2QHRH 3O3AB 4LGSB 1IL1B 1O5DT 4LHJB 3HUJF 4YQXL 2YD6A 5C3TA 3MCLL 5GRVK 2DQIL 1AI1H 4U1SA 1M6OA 1A6UL 3PG2A 1KXQE 5T3XH 5HI5C 2HFFA 2ZKHL 2IALB 5L9DH 3UTTA 2CKBA 3PWUB 4ZS7L 3O45B 1IGFH 5HDBF 1K3IA 3I84A 4PTUB 4D9RD 1VADA 2HMID 4OZIA 4X5XA 1NMBL 4A6YB 4OCYL 2X4RB 1T66D 1T03L 4XC3H 3D1MC 1EEZA 5DK3A 3W39B 2P46B 1CVSC 3P4MA 3TH2T 2X1QA 4MAYA 1K4CA 2VLKD 4XPGH 4YHPA 3D2UB 5FUOL 3SDCA 3MFFA 4PYHA 4AIOA 1NC2D 3MLUH 4M7JH 2ATPB 3UTQB 1YY9D 2ED7A 2J88L 2DQFB 4KRLB 2Q8AL 5GS0C 3VDAA 1RZJH 3HC0B 4ZG1A 5DHXB 3RTQA 3SE9L 3FQWB 2OI9C 4TSCH 2GAZB 1NBYB 4WCYH 4Y4HB 4XNUL 5FUZH 1ZLVH 4IRSA 3OAUL 2NY7L 3MXWH 5FGBA 1Z5LB 1ZGLB 1T22A 1A6PA 3L7EB 1LMKA 4GMSL 5L2KA 5JORA 3C8KB 3LSOA 1MUJB 4P2QA 2ZUYA 5F7YC 4D0BA 3ULUC 4X6EA 2ENSA 4MJ6B 3FO0H 3MREB 4JG0H 4UQ2B 4XNQB 5DJZB 2ZOKB 3VXMA 5LGKA 4V1DB 1MVUB 3V4UH 2Z31B 4ENEC 4JHAH 4GRWE 2QEJA 4IRJA 4URTB 5BS0E 2FSEA 4F7PA 2FEEL 4QRUA 2YMXH 5JHDE 1G9ML 3FQTB 5CP3H 3ZL4H 4Q74A 2B7DT 5C0FA 1RJLA 5CLWA 2BVOB 4CJ0A 3QQ9C 5CWSB 5LWYH 1PX4A 4QWWD 4OV6F 3ROOB 4LASH 3A6OA 4HT1H 3UPRA 4PJCB 4PRAB 2HLFD 2ZUUA 3LKQA 1ZK9A 4U1GC 5FK9A 3BPOB 5MEQA 2XRAH 4Z78A 3VFPA 5GGRY 1CXEA 4AJ0A 2JB6B 12E8H 3W0WB 1UH2A 2Z31C 4WHYG 2EDYA 1AH1A 1WT5A 4KJYB 1WWCA 3U0PA 5IB5A 2D9QB 1FNEA 2XYCA 4HXBH 3RX7A 1T5XB 3EYFB 5EBGA 5DEFB 4UV4H 5F3HB 5CJ5A 2JCCB 3VWKD 4MNGE 2UZXB 5IM7A 1Q8MA 5FHBL 1A1NB 3L7EA 1MAML 4I0KA 2WUBL 1BQLL 3MACH 5HYSA 2DJ4A 4AYFA 5TDPB 2VLJE 3QUZA 4ODTL 3SE3A 1F02I 1CE6B 2JJWA 4IDJL 4YAQB 5E7FA 4MA3B 1DN0A 3EDDA 3PGDA 3LQAH 2QR0A 1NCAL 1GAFL 4NNYB 5C0BD 4Q0XH 1EMTL 1IAOB 2A9NH 4Y5YC 4M8VA 1U3HB 5GJTL 5EUOE 3UTTD 5ADPL 3DARA 3MGTB 3ULUD 1ACYH 1RZ8B 4NO5B 3UYOD 1MWAH 4ZQKB 4Z76B 2GSGA 4U1MA 5DJZA 4YE4H 4IRJC 4Q6IA 3MA9H 3NIDF 4UAOB 5KSUA 1HXMA 1PG7H 2KKQA 2VIRB 4I18C 5C0CD 2WINA 3C6SB 1PYWB 1MREL 2FX8L 1AP2A 1LILA 4KTDH 2YPVH 3O45A 8FABA 3STZA 4WFFE 4Y2DD 2HFFB 4MA7L 2Q86B 3WV0A 1MLCA 1UYWH 2YD9A 4U49A 1F3JA 4P4KA 5DJ8A 1MIEL 4MD5A 1GIGH 4UUJA 5CD5C 4HCRL 3ZDZF 3HC0A 4JY4A 4BZ1H 4PJGE 1RIVL 3SE4A 4HPYL 1HH6B 1KOAA 1Q9OA 3MRPB 2R1WB 5AAMA 5J0BA 5CKAA 2VE6B 1TZIA 1N0LA 2DN7A 2Y23A 3PWPD 4RGOL 4RMWA 5GRYA 2NY2D 2VSDA 4Z0XB 2A77H 1CK0L 1HHKB 1G7IA 3P3YA 4KJPC 4ZUWA 3F12A 5D1ZB 1WWWX 5DRNA 4BZ2H 2P8PA 1I1AA 4O5LL 1FORL 1P2CA 4JB9H 2C5DC 3MLTB 2IFFL 3DGCR 3F58H 1PGRB 3X14A 1OGAD 2XZZA 1JWMB 4Z95H 4WI9A 1Q94A 2DI8A 35C8H 3QNYB 4N5EC 2I5YH 3BZDA 3T0EE 4BFIA 3LB6D 2IPUG 2GK0B 4NN5B 4YHOL 1FRGL 4WHYH 2FEDD 3GMQB 1E27B 4LLDB 1E4KC 3CXDL 4OLVL 4G6JH 2YC1B 5DD6B 3QSKB 5I8KL 2E9IA 3BVNA 3I85A 4WI3A 5KVFL 5CD3A 4EQ3A 1S78C 1FLTX 2IAND 3UX9B 1F6AB 5FHAL 1QFOA 4PJDB 1WTGT 3D85D 3PWNA 5EUKB 4NQED 4CN1A 3FQRB 3C9NB 2IBGA 4PP2B 1AIFA 5ERWA 1AQDA 4UU9A 2DB8A 5EU3B 4LIQH 5MEPA 3FO1A 3QDJB 4NO2A 3TCLA 4C56D 4L4JA 5E1HB 1NC4D 3RIFF 4JFZL 4HLZG 3G5XB 1K2DB 5IMMA 1ZLSH 2CIIB 3ORJA 3C2AL 4H5SA 4LLMB 5D7JA 4ZDHB 5J12B 4NC2B 2NLJA 3QEHA 3C08L 3PHQB 4Y5VB 4ERSL 3B9DA 2Z31D 1JRHI 1DLHA 3MXWL 4DGIL 4KDTC 2OZ4H 2DJUA 3SE3C 4WCYL 1UC6A 3MGOA 1QQDA 2AJ3B 2IG2H 5I66A 4AM0B 2NY0C 5K59E 3PDDA 3TESA 1MPAL 5L7XL 4Z7QE 3RWHB 1AFVH 2EKSB 3FFDA 3TM6A 1I7UA 3M1BB 4YPJA 1GGIH 2HRPH 4K2UL 4Y4FD 1Y18B 3IRZA 4RGNE 3VDCA 1YECL 2Y5EA 1CI5A 1IFHL 3BIKA 3STBA 4N68A 5B8CC 5ADOH 1C5CH 4PRNA 4EUPB 1JHTA 4K07A 1LK2A 3EYOA 3P9MB 2NX5D 4FQXD 1NMBH 4OM1L 4ONHB 1N0XL 4XNZC 3FB7B 1VGEH 2AVGA 1SJEA 1RK1A 4NO0A 5ADOL 1RHHA 3TV3L 4H1LA 1YPZE 4XP1L 3RZWA 1U42A 3FT3B 3SGJA 4NKMA 1UXSA 1GZQB 2AI0H 3N85H 4G7YH 3B2VL 2P47B 5JPNA 3O6KH 3DRTB 4HG4J 1LNUA 2VLJA 3PHSA 5A2IH 3WFZA 4ORZC 4AENA 3O0RH 1JWUB 3LKOA 1S9KC 5EZOH 2Y06L 1YEHH 1IAMA 1ADQH 4JFDE 4RFNB 1YN6B 3VRIA 5J9PA 1GC1C 4NQVB 1VB9A 3CFKB 4YGVA 1I8MB 3ESVF 1AD9B 4KAQH 1G6RH 4KGLA 4UQ3B 4J6RL 4H88H 4HMDA 3OG6B 3QQ3A 5F96L 1ZLSL 5IBUG 3SE8L 2DQGH 5DRZA 2WZPD 4YFDB 1UZ8A 3RNKB 4LQ1A 1EV2E 1BF8A 1T20A 4NUJA 4RDQF 4GG8A 2JB5L 3ARBC 4P3CL 4WIQA 1MJJA 4M7LT 1C7TA 2PYEB 2ARJA 2EEBA 1OD7A 3I02A 4OD1H 4KY1L 5CSBA 5EBMA 1YNTA 1V7ML 4WW1A 2HYMA 3SCMB 1B0GA 1CF8H 3FMGH 1AKJA 2OR7A 1MELA 3PGFH 5LXGL 1BX2A 4M1CD 1V3LA 3ARGB 4H25A 4K8RL 1N3NA 1T1ZB 4JHZA 5DMIH 3UO1H 2APFA 4JR9L 3RUGA 5ILTL 1NGYB 1J7VR 1A7RH 4R4FH 2IJ0C 2CK0L 4LHUA 1T7XA 3CLFL 4WU5A 3O41B 5D7JD 5BV7L 4OCWH 1TNMA 2XTLA 2G5BB 2D0GA 1L6ZA 1L9NA 4Z95L 3C2SA 1NUDA 3IAQA 1I9IL 3NOIA 3CIQA 2IFFH 2CK0H 1J0ZA 2EDFA 1BMGA 4IHOB 1JHTB 1UM4L 2NY6C 4U2YA 4JDZA 1DQLL 4MNQD 1U8PB 4GAGL 1FZJB 3EJYC 4PRHA 2YD7A 4NZTL 5EPMB 4OFIA 2R56L 4JE4B 1LVEA 4X7SL 2GUOB 2R0KL 1H5BB 3BZFA 4MHHG 5D5ME 5INCA 4WU7B 2E5EA 4DN4H 2X9XA 5HDQL 4L8DB 3ILPB 4G6KH 4CN6A 1XGQA 3MUJA 2ZZUT 3L1OL 2Z91B 4W70A 4P9HH 5JNYA 5GQBA 4KUZH 1VA9A 1HYSD 1W72L 1DCLA 1ONQA 3RKDD 2AK4D 1EVTC 4PLJD 1A4KB 4FQJH 2DQHL 1QFWL 4LBEA 2X1WL 3WFBL 5CJ8A 4NQEB 1KEGL 1R3LA 1DBJH 5F6HJ 5HI3C 1KN4H 2BHYA 4JM2D 3HAEG 5FF6A 1JFQH 5MEPB 1C12B 4KGJA 1Y0LA 5DK0A 3MV8D 1AQDB 5C08D 1YEKH 2WK2A 4Y4KD 3P77B 1KULA 2XXMB 3TBVA 1OP9A 2PO6C 4F2MB 5I1KL 1T21A 1E4JA 4S1DD 2KQNA 3RDTB 4DZ8A 1OTSD 3H7BB 1IRAY 4XP1H 2BNUB 4QYOB 4JN1L 4XC1H 4CMMA 5HYJB 1LE5B 1IGCL 4TRPH 1KYOJ 3CNKA 4KI5D 1X3DA 3MROB 4U6XA 1XFPA 4YFEA 2NY3C 3D25B 4D3CH 3REWB 2BXZA 2DM3A 3ARFB 3INUH 1UZ8B 4LSTH 3WLWC 5E0QA 3HI5L 4KDWA 4NQSB 2BOBA 4HFWA 3KYKH 1MJ8L 3UAJD 4J3SA 2XN9B 2DQEH 2WM0A 3OB0H 4UDTB 1MIML 4CJ1A 1U8QA 5I74B 3AAZA 3Q5OA 3PIQB 2XQBL 2J6EH 3W11D 5H94A 3WS6C 1DVFB 3QZWA 4Z0XA 4ZFFB 2YZ8A 1XCQB 1ZT1B 3HG1D 1CLOL 4YDVB 3N1FC 4FFZL 1NJ9A 1II4E 1IE5A 4W81A 1R24B 1X5JA 1E0OB 3I50L 2RFXA 4U6YA 3UTOA 1GZQA 3QUZC 3L3IA 5F1NA 4XX1E 3OJDA 5HDOA 3EUUA 3LAFA 1K5NB 4U0RB 3FRPA 3MV7D 4JJ5A 4JFHD 4OLYH 1UM4H 2PTUA 4GFTB 5DO2C 4EI5D 2BY3A 5FM5M 3KGRA 3MRJB 3HE6C 4O51A 3CJJA 5CCKL 3MRNB 4LIQL 3WFHA 3HFML 4DCQB 4TVPD 5K9KB 4K7FB 5IOPA 2F8XC 4D9RE 3VFOB 2OL3B 4ONFL 3JXAA 3RL2B 4QYOA 4MCYA 3RZCD 1NL0H 4XI5C 1T1YA 3H7BA 1GH7A 2W9DL 1WC7B 3D3VD 5T1DL 5I0DA 4RGNC 1WV7T 2ADGA 3JWOH 4NQCA 1JWSB 3QEUA 1EGJH 4G8FA 4XB8A 3L5WA 4MNGA 1T83A 4DFHA 5I75C 4J4PA 1K8DA 3HHRB 3HI1B 5MERB 5JO5B 4NKMB 3VXUA 3A6CH 4QHUA 1DLHB 3LRHA 4M43H 5C92A 3LKPB 5I8CA 5D93C 2NXZD 3U4AA 4XPBH 1AGBB 3WIFB 2DM7A 1GJIA 3LN4A 4PV8B 1KB5A 4KI5E 3P9MA 4OSUL 4IDLA 4JO3L 1X4YA 4ZOBA 4XP9H 3EFFA 3HC3H 1L7TH 1FNEB 1QBBA 2RQ8A 2J5LB 5BCAA 3SDYH 3TCLB 1FVEB 1D5BB 1ND0B 4KROC 3BT2H 2BHZA 3KLDA 3HMXA 4J6RH 3RVWD 1SY6A 3FT2A 1JTPA 2DKMA 2VTFA 2YSSA 1QFWI 1WZKA 1E6OL 4GT7A 5EZLA 1KIRB 4KVNH 4P2QD 5T3XL 2OXGA 2FEDC 3QR2A 4IS6B 3QUXB 2VLKB 5DD6A 1XGPB 4JREB 2K3TA 4NQTA 3K3QA 3U2SB 3L3JB 25C8L 4E41D 3OV6A 2QKIA 4YO0B 2HT4D 4IRJD 5GSRA 2MCG1 5T1KB 1HOCA 4OQTL 1PG7L 4R96B 3RTQD 3ZYZA 1DL7L 3UYRL 3WJLC 1ZHBB 4TPRH 4JFQA 2Q8BL 3T0EC 4KK8D 4FQCL 4ODVL 5IJVA 5FAAA 4I3SH 1AJ7L 2HKFL 4XTRC 5H2BB 1G0XA 2RCSH 1TMCB 4KWUA 4HG4K 4YXKH 5KTEH 2ZOKA 2XWTB 1RUAL 4DK3A 2RBLA 5FDYA 1SJVA 1ZSDA 4D0BB 4YC2C 3MRDA 4XCNA 3D3VE 1A5FL 1KFAH 3DXAD 1IC4L 1C16B 1IGJA 4UT9H 1BZ7B 2O5ZH 1HH6A 4R0LA 1FJ1B 3KPMB 4D94A 4N8CH 4ACPA 4HQQL 1MAMH 1G7QB 3F5WB 2CJUL 3HMWL 4OZHB 2FGWH 2AEQL 1PSKL 3EIFA 2VB5A 3BH8A 1MWAA 3BN9C 4PIRF 5LQBL 4LSPL 3WL9B 4JVPA 1N6VA 1FFPB 5DD1L 1EPFA 1RULH 3QDGA 4FFWD 3ZT6A 3V5HA 3T4AA 5HVGB 1A4JB 4LDOB 4XWOC 1JK8B 3QFDA 3C2AH 2FECL 5C71A 3IDMA 5HHVL 4RBPK 4Y89A 3BDYL 3HNTH 3MV7A 1KLFA 5HYJD 4ZS6D 1FO0B 4KRMB 4YGVB 4F3FB 1CLYH 1OAZH 1FNSL 1YN7A 5E5MA 3T77B 4Y19A 2YPLD 1TENA 1UM6L 1BJ8A 1BQHA 2FIKA 3DVNA 2NW2A 2NXYD 4JQXC 4RGMC 4OCRH 2KH2B 2CUMA 2QR0B 3OHXB 5HJ3A 1RUKH 1GHFH 5D96C 4QXTA 2VDLL 2VUOA 4L3CB 1MHCB 3PQYE 2DBLH 4MVBD 2C3WA 1OAUL 1S7TB 3E6HB 3TVMD 1FIGH 1FVCB 4C55A 2V7NA 1B2WL 2D0FA 3WDJA 5E1AA 3HG1B 3WJLA 1MFEH 5D7IA 4JHAL 2PW2B 4JHWL 1G9NH 1V8HA 4GKNB 3P4NB 1B3JA 5DMKB 4MJIB 4GW1A 4K8RD 3S97C 1CU4L 1OSZA 4EDWL 3HRPA 4HK3N 1XF5A 2QL1A 4PLOB 4NCC1 4LEXL 3MODL 1FYTB 1NCBL 3QBTB 2QSVA 3AREB 2O5XH 1PSKH 3ZDXF 2I07A 3KHQA 4OLUH 5IB2B 3WMSA 3QCVL 1UH3A 3P11L 4GS7C 4GXUM 4BUHA 4ZAKC 5FYKE 1EBAA 3QUZB 3ILQC 3RUGE 3OAYH 3MRQB 3BE1L 1P53A 4P57B 2X4QB 2CLVB 3BH9A 2HN7B 1KNOA 3TN0C 1FZOA 5CD5D 1VACB 3HCVA 4N9GB 5C0IB 3P30H 1XIWD 4F7PB 4G3YH 1KUMA 1FYTA 2P24B 4XWOD 4ZTPL 3HE7B 4P9ML 3MRMB 4HXAL 1JHKL 3VXNB 3ARTA 5IBTL 3S7GA 2H1PL 4JFOA 3GJEA 1G7LB 4ZFZA 1A6TA 2F54E 3CX5J 3ZYJA 2MWCA 1YEHL 5HHMB 3TFKD 1PFCA 2YC1A 4UBDD 5T33H 2AK1L 2VDOL 1W72A 2CDEA 5KZCD 1LEGA 2EICA 1OAQH 1WK0A 3ARDC 3BD5A 1RU9L 3JTSB 3VD3A 2IH1A 3BRDA 4M7LH 4KVNL 1LO0H 3FQTA 3KPQB 2GK0A 2H6PB 2L7UA 4I0PD 4L8SA 3OJ2C 4HUUB 3K74B 3MACL 3UJJH 2ATPA 4ODWB 3B3IB 1J86A 4YXKL 3HI6L 4WI4A 5E5RB 1P7QA 4ONOA 1I7RA 3G6DH 2UWEF 2ITDB 3QHFL 3S34L 5IFJA 3SOBH 3ZKXB 5F1IB 3ULVF 2AEWA 3L95B 5E8DH 2I9LA 1VFAA 4N1EA 5DJYB 5F1SA 1UQSB 1HHKA 3P4NA 4YHZL 3BN9D 5JR1L 2P45B 4KI5F 1CFTB 3D5OF 1N64L 1U8IB 4L8CA 4F37K 5FCSH 5E1AB 3WL9A 4NT6A 1F3DJ 4RAUA 4UBDC 2YPLA 1JF6A 1MWAB 5HGHA 3ARZA 3L3OB 1UA6L 2E27L 2EYRB 3WS6A 4C56B 4FQPA 2IH3B 4F58H 3HE6A 5HPMB 4PJAE 2IG2L 5C7XH 2WV3A 4XVTL 4U1SB 2DQUL 4AG4L 2PW1A 4UOJA 1QVOB 4D9QD 2WQ8A 4DVBB 7FABH 3FTGB 5I1HL 4WUUA 5L8JB 3MRIA 3IJYB 4RWYL 5DA0B 1BJ1J 2Z8RA 4LFHG 3DVNB 3MFFB 2EIZA 5T1DH 3GJEB 3ZE2F 5KVGH 1UQSA 2IBZX 2IWGA 2ESVB 4KK9D 1EHNA 1NBVH 2FO1A 3EDJA 1MCHA 3EOBB 1T1XA 2DWDA 4PGCA 4YXLL 3ZT7A 2IQ9L 2NY6B 4OIIH 4LAJH 1MF2H 1QEWB 3RWDB 2HT2D 4GAJH 4NQEE 4EJ1C 4GBXB 5JW4N 2VXQL 2OK0L 3V5KA 3CZFA 4TNVK 3OGOE 3PWJA 4JPVL 1ED3A 1AGEB 4NWTL 1B9ZA 5BZDB 5KSBB 5DJ0B 3UBXG 2APWA 1KJ2B 1KEMH 3FONB 3I9GH 1CE6A 4M1GH 1XIWA 5TDPA 1BVLB 1YNKH 4E41A 1JYNA 2XFXB 2DI9A 3MUZ1 1AO7A 5GGQL 3D85B 3CK0L 1F8TL 1KCVL 5SWZD 1HDMB 4PREB 2AJYL 1C16A 1T1WA 2WLYA 5DZOA 1MEXH 4GXVH 4LCWE 4WTZA 3MRDB 2BY1A 2IF7A 4OTXL 5D93B 1NEZA 3CC5B 4IRSD 2A38A 4GRWF 3KPSA 5ESQA 4XMPH 5IW3A 3U6RA 3SO3C 3RIFK 4QRSB 3NCFB 2UVEA 4O5LH 1CFQA 1U8MB 2KBGA 3TPUA 1N5AA 4PB9H 2CSPA 5F3BB 1JMXA 1V7NH 2QQLH 5SWQB 3HRZA 5KVGL 5JQ6L 3UPRB 5IV2A 4Z7OF 5T1KA 2D9CA 1V5JA 2BZDA 1CICC 2Q7YB 3OWEA 5C8JA 4DUXA 1KC5L 3L3JA 4S1SL 4TSAH 2ZSVB 2BVOA 1HSBB 1IGTA 1CLOH 1HNGA 2C3GA 4WEBL 2AW2A 5KG9A 4QRUB 4XH2A 1JTOA 2E27H 1S7XB 3MUY1 4Z7WA 4YQXH 2YHGA 3DMMB 5F6IB 4WWKB 4K94C 5DC9B 4ZUVB 5IG7A 2CR6A 4MXWL 1U8LB 4LAQL 3QRGL 4R26H 4JPWH 1CWVA 4LVOB 3V7AE 5JR1H 5GIRB 3KPSE 4OQ1A 1H15B 4QKXB 3CD4A 4R3SA 3WFBH 4D3CL 4HIIA 2VLRE 1QOKA 3NA9L 1KTDA 4M6AA 1MFNA 3D9AL 3HI6H 4TNWK 4M7ZC 4TRPL 5HHXH 1MFCH 2Z8WC 1Z5LA 1ZGLA 1D6VH 1NBYA 4OD3H 2E9WA 3I75B 4QHUB 3SO5A 2PO6D 3D0LA 3KR3H 4M48L 2BSTB 4UTAL 3QO0B 1FL5A 1ZTXH 4C4KT 3KWWB 4ZSOA 2D4FA 4Z7VA 1XZ0B 2XKUA 1CD1B 4EN3B 2LVEA 1KG0A 4KROB 4RBPH 5CIPA 2X6MA 5CP3A 2DJSA 2B1HL 2XA3A 1BBDL 1RD6A 1MI5B 1JF5A 3WNNA 5J6GA 4G6AD 3RUGF 5BVJA 1FO0A 4F3FA 1KJ3H 5JXAH 2X4PA 2OTUB 2CRZA 1VEOA 2PTTB 4AEHH 4I3GA 4JKWA 4UILH 2YD4A 1TJIH 2BOBB 5GSVA 2H9GB 4JPKL 5ID1B 4YPGB 1P5UA 3NZ8B 1FE8H 5MENB 3SDAC 3GSUA 3DETD 4LSSH 3GZKA 4HK0B 1KIQA 4DKEL 4OD2B 5CZVH 2GTZA 3OKEA 2CRMA 3IDJA 4MAUL 2ARWA 3O3AA 2I9TA 4WW2A 5DD5H 1JPGB 4P23A 4Y4KC 5LG1A 4DZ8B 1OP5H 1WEJH 2V7HB 1RMFL 4PJIB 3SKMB 3TNMA 1WZ1L 2QQNL 1G84A 3MUGB 5IHUH 5I1GL 4HKBB 4M4PA 3WS3A 2LE9A 1OB1A 1JVKA 4U1NB 2VQ1A 1A9BB 3IVKA 3GM0A 1UM6H 1E28B 3EGSB 2AS5M 1OWWA 2WNGA 2ZUQC 3S5LB 1G9EA 1J1PL 2PXYB 4OF3A 1IQWL 43CAB 3NABL 3KPSD 4Y2DC 5DHVA 1EXUB 3WHE1 5IVXE 4N0UE 3HNSH 1FGVH 3CLFH 1N5YL 3W81A 3TBSA 4EVNA 3WIFA 2YRLA 3OR7A 2EDJA 3ZT5A 4WJ5A 4G8GB 2DQCH 2K7QA 4S2SB 1X5AA 3OAUH 2EH8L 4O02H 1U93B 4K3HA 2YKLL 4H0HB 1DSFL 1S7WB 2R23B 3OJVC 3TC9A 1BOGB 4XPFL 5CMAA 3W2DL 1BAFH 1N59B 3QNXB 3TBVB 3OB0K 1P7QD 4UNVA 4R4ND 3BX7C 4O2EA 4LHQB 4HH8A 5C0DB 3WXVL 3O2DA 2EDBA 4PTTB 2OLDA 1WBYA 5ID0A 4YHNB 4AIZB 5GJSH 2GITB 3GMNA 4AEFA 4OCMC 3UROR 1AGFA 1TCRA 2IADB 1VDGA 5AYQA 3X3FL 1FSKB 4NZRL 2DWEB 3IDYB 4WENB 4I8DA 5C0AB 1J0JA 3IFLL 4HZAA 4LSPH 3ARWA 4KC3B 2PYFA 2ORBH 4U1HB 5HXMA 3QCUL 1VFUA 3TZVA 5AAWA 3EO0B 2ZG2A 2HP4A 2DIAA 1OB1B 5D7KD 5C0EB 1QR1B 1BZQK 2QHRL 3VGGA 3UCRA 4OZGE 4LRIC 3SDDA 4XCCL 4F9PC 5JZ7D 2AV1B 1F13A 2LFGA 1AKJB 4QCIB 1XCTB 2NY4C 2WBJD 1I9RH 5I6XB 4LMQE 4BH8B 3JV5A 3S6CA 3AMLA 2AGJL 2HAZA 4XMKH 3S4SG 1EAPB 5IROA 2QSCL 3P9LB 5DJXB 4ZTOH 5FKPA 1U0QA 3C8HA 3RNKA 3JWNC 3BD4A 1DL7H 3H9YA 1CL7H 1S9VA 1ZKAA 1HEZA 4RWHA 1KXTB 2XZAH 3E3QC 3NFSL 3BAEL 3NACL 25C8H 3U36B 3U46B 4WO4D 1R24A 4PB0H 3O2VL 5IWLA 4MJ2A 2YXFA 4HIHA 3FL7A 4LSVH 5DXWA 2GI7A 1CLCA 1A1OB 1T1ZA 1UM5H 3CXHJ 1NPUA 5FO8A 4OZIE 2XZQL 3FRUA 4LL9A 2N7AA 5F1KC 3CXDH 4GW5B 2A74B 4AEEA 1PKQA 4R2GD 1M71B 3RI5K 2NCMA 3QUMA 5JPNB 1JV5A 3U1SL 2VZVA 2BSTA 4NWTH 4NOFA 4HFWB 4PJBB 3VGAC 4HW6A 1T6WA 5FYJU 3I6LE 2OK0H 3ARUA 3FB7A 3C5JB 5IEKA 1KB9K 1DQDL 3K1DA 1Z3GL 5EO9B 1ZLUK 1R6VA 5BRZE 2GITA 4PRIB 4UQ3A 1G9MC 1J12A 1AD9A 3FQNA 5D2NC 1DBKL 5JNYB 2R8SH 5I1GH 4K55A 5IHUL 3GMPB 4RGOH 1DEDA 3G6JB 3UDWC 2UZIH 3QEQD 3QNZB 5KJRL 1FGNL 1B88A 3KNBB 3QIWC 3DMMA 4MAUH 5HPOA 5ALCH 1EZVY 2C7UB 2Y36H 3MGOB 5HI5D 4KRPD 1JF1A 15C8L 2O5YH 3EAKA 3DX7B 3V8OA 3KYOA 5T1LB 3AREC 4JFEA 4X6CA 1PQZB 2EC9T 2BC4B 2Z93A 5F1OB 4DUVA 1Q38A 3HZVB 2V2TB 5BO1L 4RX4A 1SJEB 3O6LH 5IW1B 1MIMH 4DKDC 1ADQA 3MJ9A 3QO1A 1HXYA 3IU4L 3Q6FB 4ONHA 5IV2B 3GJFA 4YHZH 2NW3B 1P4LA 1MHPL 3DRQB 1K4DA 1RUML 4WW2F 5ICXA 3TF7C 1CT8A 3FRPG 1YPZB 1LD9B 1H3TA 1UZ6E 5JW3H 2PYED 3PNWB 4C83A 4X9IA 4PG2C 3OKLB 1IGMH 5EUKA 5FKAB 5L0QC 1WT5C 1GAFH 2ZUXA 1RIVH 4I77L 4PJIA 3SKMA 1YJDL 3QCTH 3CFBB 4JFFB 1C1EH 5D70H 4DQOH 4MJ5B 3LKRB 1UYWL 1AO7B 3K2MC 5LBSH 4MA7H 1QHPA 1BVLA 4KKNA 5C0NC 1MFCL 5T33L 4Q6YA 5LVEA 2F53D 2V6HA 4WJ5B 3CUPA 2YRZA 4LF3B 4XVUD 2QHLA 4GRMA 5D7JB 3IDXH 1CFSA 3RPIB 1O7SA 3QDJD 4J2XA 3F7YB 3WHXB 4XNMB 4KXZH 4UZGA 1UT9A 3QFJE 3DHMA 2CKNA 2H26B 1CG9A 1CE1H 1MWAL 2Z4QA 3INUL 3V6ZB 5GJSL 4J8RA 5E6IB 1QBMH 4MNQB 4ZTPH 4Q9QL 2JTDA 1ERNA 1NSNH 2Y6SD 4H25B 3C09C 1S9XB 4I13B 3D48R 1ITBB 1U8OB 5FYKD 3LHPH 3SDCC 1I1RA 2P8LB 3C6LC 2QSQA 3MRIB 1A6ZB 4MZ3A 2QQQA 1EO8L 5DR5L 4YBQC 1DSFH 3EKCA 3ILQD 4G6ML 3CFDB 1PBYA 9CGTA 2MHAA 5FHBH 5T3ZD 2IH3A 5HPMA 4GW4B 1MLBA 1QRNB 5JPMA 3CX5K 2KUTA 4C57C 5ID1A 2BNQB 2PUQT 1QSEA 4OQTA 1UXWB 1NGWA 1S9WA 3RTQC 5IT2H 3NMEA 4R3SB 4OBRA 5KAQF 4P59L 2ADIA 1H15A 4N8VA 3VRLF 4RQQB 3IS0X 4BH8A 3WHE0 5JMRA 1EFXA 4GRLA 4RRPG 1Y18A 2D7MA 4I2XB 1FNHA 1MY7A 4GMTH 4OZHF 3ZSSA 4P2QE 1HHIB 4LARL 3JWDL 4QRPD 5D5MB 1TTFA 1T04B 2CKBH 4X5WB 3ULVE 3B6SB 3WIHH 4XH2B 5D7SH 4U0QB 2C9AA 2C3XA 3WFDH 4GAFB 3RPKA 1IT9H 4HPOL 3W0WE 3PUCA 3HMXL 1U36A 3ZHKA 4YHIA 4NQUA 1M4KA 5E9DE 4TQEH 1RHHB 4KY1H 3T0AA 1DQLH 1FPTL 1NFIB 4F8QA 5F7EH 3WNOA 4NCC2 3LKSB 3O3BB 1AKJD 3VXRB 4LP5A 2IADA 4QGTA 5CEZH 3ECBB 5B8CB 5E6IC 4NP4L 2WINB 3C6SA 3GHBH 2BFVL 4R2GB 1INEH 1QKZH 3ZTJG 2VXUL 4XVJH 2W0FB 3BSZL 2DQGL 1OGAE 5D72L 3ARED 1A2YA 1INQA 5LAXB 2E7BA 3MLRL 1Q0XL 1TETH 4KMQA 3MRMA 5CJOH 1MJUL 2MFNA 3VWKA 3C5ZA 2VNCA 2X4NA 3QNXA 4JR9H 3RWFB 3DURA 3P2TA 4P5MB 1NCCL 3AMKA 4HBQA 4LLYB 2OX5A 4XGZB 1R3HB 2X05A 4YAQA 3MBXH 4B0MM 2F9BT 1Z0MA 2XZCL 3DO3A 4QT5A 4X6FB 4M7JL 1NEUA 4G5ZL 1YEGH 1OTSC 2R69L 4N0UB 1OPGL 1PLGH 4PV9A 1MI5E 3ISWA 4EXPX 3P40A 1NGXA 2OR9H 1A7QL 1MAJA 1N0XH 2EYTA 5K9JH 4HIEA 2ZUTA 4XCEB 4XC3L 5IB1B 4ZTOL 1ULVA 5GRVL 3EGSA 1W8NA 1DQJA 3GEWB 1UACL 1IGYA 1QBLH 3V4VH 1D5IH 1FL6A 1MI5D 4N0CD 4YXHH 4X6EB 3NCYP 3RVXD 3FT4B 2JCCE 1YECH 4YFLI 2YOCA 1LO0L 1UWXK 2VE6A 3MJ9L 1A1MB 1XR8A 3X12B 2VITB 1YJDC 3TA3C 5EIIB 1Q9OB 3MRPA 3O11A 2L7JA 3IB4A 5ESAA 4GSDL 5ISZA 2APTA 4UUJB 3IJSB 3JV4A 4Y4HA 3WN5A 3TIDA 4BSVB 4YZFF 5D7IF 1NLBL 1D9KC 2NY1C 1FSKC 2HJKB 2LTQB 2VDNL 4G9DA 5IQ7L 4HC1H 3L3OA 1Q72H 2EXYD 4JG1H 2R2HB 1YZZA 3V5DB 4PP1D 4ERSH 4RNRA 1NLDH 2DKUA 5E03A 1LO3H 1X4ZA 1PYWA 3GSOA 2GCYB 1HI6A 3LQMA 2OMNA 4JFPB 5EUOB 3TBWA 5DDHB 5T3XD 1KBGL 5E5MB 3W9DB 1P2CB 3WJJA 2V2XA 5EC2B 4OCSL 4J7RA 3TT1H 5F7NC 4OSUH 1QFUH 1EJOL 4MNHA 4HSQA 4OLXH 4R97C 3BUYB 1KLGA 1VADB 5IR1A 1IAOA 2L4OA 1JHLL 4AQOA 1EHAA 5FHAH 2NYYC 4L8SB 4LCCB 3IJYA 1W0WA 3W2DH 4MCZB 4G9DB 2RIKA 4EEEA 4QRPA 4BQCA 4MA3A 4Q9RL 4V1DD 1F8TH 1KCVH 2YRPA 3KDMA 5J6HB 4PRPE 1QNZH 2ZSWA 4NQXB 1IL1A 3O6ML 4ONGL 1NKRA 4P46D 1FNAA 2DQFA 5D1QA 1HIMH 3JWDH 4OGZA 2GJJA 5IFHH 1BEYL 2J3SA 4GMTL 4PS4H 1TETL 2PXYC 3NIDE 1SEQL 1CFTA 1FGVL 1NL0L 3B9KC 5JOEA 3FT4A 5CS7A 4DOHE 3LIZL 4LRNH 5T1MB 4N8VG 4QXUL 4JLRB 4Z76A 5BMFH 3NABH 2ZNXA 2C3VB 4AMKL 4Y1AA 1TJGL 2I9LB 3VXNA 1G1YA 3H42H 3RWJB 1Q9LA 1U3HA 5IG7B 4XCEA 4YDLC 4ZUVA 4QRQA 4G80B 4BSJA 2W92A 5I18L 3BWAB 1PX3A 3V5DA 4N9GA 3EDFA 5FYLE 1T0PB 5KVFH 2QKIB 4YO0A 4WEUD 4F9LC 5JQHC 5FOBA 3NH7H 4G6JL 1BFOA 4FFZH 3MNWA 1E6JL 4JRYA 4J12A 4OZGB 2DQUH 4AG4H 4LARH 5CZVL 1A1NA 3OSKA 2Z0BA 1HE7A 2R1XB 2AV7A 3LEYL 1I8LC 3KPPA 3FT2B 2VISA 2MQ3A 4UI2A 4Y4FA 1JZ7A 4R7NA 1Q9LB 4LCUA 1KJ2H 4KTEL 2B8OT 1MJ8H 5KSBF 3O4LE 5J1TC 3QISA 3ARDB 3L6FA 3U6RB 5F88B 3BKYL 4BSWA 4XHJD 5DD1H 2ICEA 2JIXB 5DFWH 3EFFB 3TBTB 5FK9B 2VR5A 1CIDA 2EEDA 2A77L 3QEGH 4K9EL 1KNOB 4P5TB 3QHFH 3EYUL 5GHWL 1OCWH 3Q5YA 4NBZB 4PFEA 5IVXA 2OCFD 3JVGC 3VGFA 4PRHE 4P2OA 3LPWA 5I15H 3IKCA 2Y5TB 1NCAH 2E6QA 3WN5C 3MJ6A 5HGDB 4M7LL 4QRPB 3IDIB 4APQC 3H7LA 3QCTL 3E1F1 3MV9A 4QXGH 1J10A 1ACZA 2FDBP 3MLYH 2FWOB 1U6AH 4S1DC 3PGCA 1IGML 2X89D 1T04A 3ZDZE 1Y6NR 4QF1A 3TN0B 3O9WD 3D0VB 4KK9C 1RIHH 2VDML 1X6LA 5F89A 4JFFD 1JFQL 3SY0B 4MDJB 3D2UA 3T77A 2R4RL 1WVZA 5C09E 3S36L 3NGBB 2D7TH 4JY5L 1FV1B 3VXRD 4HMCA 1XGTA 2HJLA 3U83A 1YEFL 3L9RA 3LN5B 3MXVH 1TPXB 2VXVH 3TJEL 4JVWA 4JPWL 4JZJC 2PW2A 3L5XH 2XV6B 3BDXA 4LAQH 4X8JA 3CZJA 5FEBA 5EA0H 2AK4E 2VQTA 3UTTB 1A6VH 5D4QA 3GSNH 1UB6A 1QVOA 3KYNA 4DVBA 5D1QD 4TVSa 1RK0B 3VG9C 5E6ID 1YYLL 1E6JH 1J88A 2WP3O 4Y5XA 5IMKB 3FAWA 1T2JA 4I3RH 2UZIL 1QD0A 3BUYA 5TE6H 1F45A 1HHIA 4JKLA 2F74A 4OV5B 3SQBA 1L7TL 3HC3L 5BRZD 3QIWA 1PKQE 1RUMH 4TNVF 2F58L 4PJ5A 3GKZA 1J1XL 4A6YA 4CADB 4M61B 1YUHA 1QSEB 3LRSB 5H37H 3LZFH 5EORH 4NN7B 5FYKH 1S8DB 2P5WB 2R2HA 4IOFC 3WEXB 1OT1A 3WLWD 1KCUL 1LEKA 3ZYIA 4UDUA 5IF0B 1ES0A 4ELME 3CK0H 3CAFA 2EDOA 4X6BA 2H32B 1FIGL 3BW9A 3VXME 4BH7A 1EGJL 4Y19D 1EERB 2BNQE 4KXZI 2RGSA 5AD0A 2QSTA 3RNQB 3UC0L 4GQ9H 4ALAL 1JNJA 3D6GA 3JV6B 2DM2A 4OFYD 1J8HE 5I18H 3ULVD 1PDKA 1RFDL 2AXHA 2IQ9H 1U8JB 4MXQC 3RL1A 1FN4B 2C4FU 2WWKO 5H37G 4ZPTA 5ICXB 1VESA 3LEVH 4YZFE 3PDOB 1P7HL 4N0FA 1MCOH 1P6FA 4PV9B 4CBPA 1R3IL 3QO1B 5IHLB 1F3DH 3OPZL 5J11C 4M7KH 4PRPA 2WBKA 4RMQA 3QWOB 4F33B 4RMSA 1X5HA 3KHOA 5I1HH 5FO9B 4KKAC 2Z91A 2GKIA 2P5EB 4WY7H 4IIQA 4JFFA 1I8LA 4U7MA 4GSDH 3BZEB 2ZPKL 4NC1C 1JPFB 4KRNA 5DZNA 2C1PB 2X4NB 3RWFA 5EO1B 1YQ2A 1I3RA 3VFWA 2FR4B 4WO4A 1K3ZA 4QHLA 3MJ9H 1JUFA 3NFSH 1IC4H 3I2CH 3ULSA 3MV8E 4GKSA 2VN4A 5IKCB 5MI0C 3HI5H 4NSKA 1UCTA 2FEEI 5GGUA 2ZUSA 2OL3A 4MJIA 3VU2A 3BOVA 4PRIA 3SGKC 2VL5B 1S7RA 2CRYA 1NGQH 3GSXA 4FQCH 4KKLD 4ODVH 4P2RE 2W9LA 4GBXD 5D2LF 3TO2B 5I9QC 3MTRA 5I1EH 1EEYA 1FYTD 1K5NA 5IB4B 1TVBA 4PJAB 4OQTH 1N6QH 2SEBB 3PL6D 4BK4A 4NN6B 5TF1L 2RFXB 4U6YB 5ISZE 5F7LB 4Y5XC 3KPLA 1G7HB 4P5TD 3MLZL 1MNUL 3SKJL 2G2RA 1NUGA 2Y1VA 3V6OA 1A1OA 2N1KA 4Y19B 3GMPA 4S1RL 2XI9A 5DLML 2GTWA 4M7KL 1DBJL 2HTLC 3ROLA 3QEQB 5EOCJ 2PYEA 3VXOB 3SDXE 2XN9A 2BRRL 4HS8L 5EU6B 1ITCA 4IEFB 5K9OB 2IAMD 3TJHD 5HHQB 1M1SA 5BRZA 1OARH 4N1HB 2VUYA 3TN0D 4FXGB 4LLVA 5E8OB 3VGDA 4NCDA 3DVFA 1MLBB 4GW4A 4S1QL 4KDVA 5MI0B 1I7ZB 2NY0B 3B9VA 2FLBT 4PJGF 4PLNC 1OVZA 4PJ8A 2GY5A 4HBCL 3QUMB 4PJDF 3MLPA 1BHGA 4KJWC 4ODUA 1U95A 3L3HB 2HVKA 3DIFB 4FZEH 2F54A 1RZGA 1T4KB 2HFGH 3F7VB 3VGHA 1IC5L 5HHNA 5FO8B 1VCAA 5CEZE 4KHXL 2BNRB 2R9HC 4OLVH 3FQXA 2O5XL 5HTSA 5TF0A 4NKOA 2DQCL 4XVSL 3B5HA 1TZHB 2B2XH 5DK0B 1ZA3A 2UYLA 2BOCA 2F5BL 4WNQB 5IP4A 1FE8L 3QH3B 1LP9A 4RMRA 5ESVB 1WIPA 2QADC 5FGSA 1JN6B 2V9QA 4LSUH 1FDLL 4X4XA 3IGAA 1HILA 3TO4D 3REWA 1TJIL 4U33A 1RZFH 4NN6C 4M62L 1UCBH 4MA1B 5JXAL 3JZ7A 1LE5A 3AS1A 2VH5L 1LDPH 4L4VB 3CFJB 5IGXL 3Q6GH 1MFDH 4H20H 4HH9A 4IS6A 1HK6A 5HVHB 2NY2B 3B5GA 2FJGB 1WEJL 5DJCA 4F2MA 2P5WD 2C1PA 1KCKA 3OKLA 4M48H 3QG6A 1B0RB 2ED9A 3UTSE 2XTJE 3DXAB 3VD5A 2C26A 4DVRL 1CS6A 1ND0A 1MJ7L 2D03L 1NSNL 1A0QH 1JZ5A 3FQNB 3B8YA 3P73B 4ZUUB 4HX1A 2K1MA 1CXFA 2OR8A 2F19L 1KTLB 1WITA 4YHKH 2YR3A 3GSQA 2CLZA 3VD9A 3VWKC 5KANI 1J5OL 4YE4L 4TYUA 1Q1JH 1FO0H 4FTVE 1HKLL 3B9KA 3GMRA 4JY5H 3G6AA 3RU8H 2PXYA 3O41A 2ZJSH 4PGBB 1A7PL 1OW0C 5C0JB 2DOCA 1U8JA 5J1AA 3RVUC 4G7VH 2OTPA 1IGCH 4HQQH 2VAJA 5GGRA 5JHDD 4KJWD 5EOQH 1CXKA 5LBSL 1N59A 1VKXA 4XAKD 5DEGA 3SBWC 1KCSH 3QNZA 3RBSA 1RZGB 3G6JA 1WC7A 4QWWC 5DVKA 3KPOA 1U93A 2VLKE 3QQ9D 3TV3H 4MCYB 4BH7B 4WW2B 4S1SH 4PJEA 1LO5B 2GJZB 1OW0A 2UUDH 1FQ9C 3RRQA 2V5SA 1A7NL 3GMQA 3NTCH 4MQTB 1OCWL 3MO1A 3D9AH 5GGSB 5EB9A 2K9UA 3QAZB 5I8EA 3LS4L 2QQLL 3SJVA 1T5WA 3NZ8A 3C60A 3PABB 1MHPH 4OT1L 5MENE 2DTSA 4YEEA 2EEAA 2CUIA 5T3ZE 3IDYC 4D0CB 3QG7L 5CGMA 5IFAH 4R4BB 5T3ZH 1KPRA 1YNLL 3Q1SL 4W4OC 2P8PB 3GI8H 1A9EA 5E2VL 5D1QC 1PVHA 2ZPKH 2D03H 4N0YL 4YDVA 4DAGL 2YWYA 2AV1A 3HS0B 3T09A 3I3EA 4DGIH 2V9RA 3T2PA 4LCIH 1GGYA 4KRPC 2I9TB 3OKNA 3C5ZD 5B4MC 3EO0A 4UNTA 3VMPA 2UV3A 4XX1G 4EN3C 3PHOA 2DMBA 2DIJA 3Q6GL 4HLJA 1S7VB 3R06B 5F7MC 1RK1B 1LDPL 5D7LA 5IW6A 3FN0H 4S11A 3BEVA 3S5LG 1F4AA 3UTTE 3GSXB 2XWBA 3CFIC 4ZXBD 1LK2B 3PQYA 3H3PH 5K93A 3O4LB 4QOKA 4PY7B 2DL2A 5GISH 3L9RB 4IJ3C 4G8GE 1CD8A 3ROLB 3GRWH 3MRFA 1WFNA 4ZQKA 3T2NH 3TO4C 2VZTA 4PBWD 4OZIF 3BIKB 3UMTA 2Q20A 5CUSL 1HQRB 1HHJB 3JVGA 2ZG3A 1ZLUH 2BVPB 3IFPB 3EOTL 1CGXA 2BVYA 1E4XL 1SEBA 1T89C 3UO1L 2EC9U 4M1GL 2FWOA 1A64A 3GI9H 2XZQH 3TNNA 4KFZC 3RZCC 1DN0B 4OAWB 3A67H 4X4MA 4PGBA 4Z18A 3MLVH 2ICWB 1TVDA 3N9GL 4O58L 5C8JB 1H3UA 4X6DB 1MF2L 5H35A 1QA9A 3PL6C 3QT2A 1S5IH 5C0AE 2N4IA 4OFVA 2Y7QB 4ELMB 2DL9A 2VDQL 3BQUD 5D1XB 5F88A 4NSKB 2V2WA 4L4TA 5D9SB 4XTRD 2APXA 1NMAL 2ADFL 4A2MA 5ICZA 3HZMA 3UDWA 1MRDL 5I1IL 1EBPA 2G9HB 2HTKD 1MCBA 4XP5H 5DLMH 1A3RH 2E7CA 3TO4B 3IXTB 3HZYB 3HC4H 5HHOD 4KK6C 7FABL 4FNLL 1QLFB 1HDMA 4IMKC 4PREA 3Q2CA 5FO7B 5EZOL 5TE7L 3MNWB 3SJVD 3GSNL 4PJDE 2A2QT 3CFJA 2Z92A 5FDWA 3BW9B 3C60D 5E2VH 1D5MA 1C8PA 3BGAA 3GSNA 3DMMD 1CLZL 1MCKA 4IIQC 3MYJA 3LH2H 4OLZL 2FECI 2R39A 2BNRD 5KVEL 1RAMA 3DGGB 1ZMYA 4HKJA 5C07B 2YWZA 1R5IA 1RURH 2H1PH 3RWDA 1DVFD 3QUMH 1K8IA 2J8UF 5EZJA 3GSWB 4WTXA 5FGCE 5JIKA 4XAWL 4WNQA 3DUUB 5ADPH 3DROA 3SBWA 2FATH 1BIHA 3EJZD 4XPHH 5ESQB 1A7QH 5JUEL 4G3YL 4JN1H 3BWUC 5F7DA 2X4TA 5TGBA 4DGVH 4YDLB 1WWAX 2X4SA 1B0GB 4R7DA 3O3EB 4OGXL 5E99L 3ZE0E 2A6DB 3W11C 4ODTH 3TPKA 5DYOA 4XRCB 2R0WL 4LLDA 4HUNB 2AK1H 2VDOH 4JO2L 3FONA 4G42B 3PL6B 3TT3H 1MJJB 3BGFB 4X7DC 1WLHA 1RUPL 1EDQA 2OZ4L 3GSUB 3R1GL 1OGAA 1YMMA 2ZCHH 3OKDB 1GC1L 5DJ2A 4UIKL 1HYRC 4HS3A 4PG9B 1C08B 4RGND 3WSQH 3DO7B 1KTDB 1U8IA 2H9GA 3RKPA 1DLFL 1XGTB 1LGVA 4EQ2A 4U6HA 5FM5O 4F9LA 1BVZA 2IQAA 2VN7A 1I85C 4I0PB 1IQWH 1GGUA 2DLFL 1MJ7H 1AHWA 4K3JH 3TVMB 3WNKA 4UMGA 2M2DA 4LSQL 2DQTH 1GGTA 1DUZA 3L3KA 4Y19E 4FZ8H 1OT2A 4G6AC 5CJQH 5EU5B 3VXTB 3DYPA 4Z7VB 5J06A 4OF6A 2A83B 2DQDH 3CSYA 4YLQT 3QI9C 3EZJB 4H1LB 1FFOA 4JFYA 1JGUH 4X9HA 3PXHA 4FQLH 3BQUA 4WDIB 4LVHB 3TO2A 3D39D 3EYSH 2OMBA 3STLB 1DBMH 4GJTB 5KAQG 3VRLE 3RWGB 3QUYA 2JCCA 2NXZC 3LN5A 3MV9D 5F3HA 2YUZA 5ACLA 3LIZH 4LRNL 4JQXA 2A0LD 3CDYA 4FQ2H 1DQJB 3ZMRA 1RPQA 4QOKE 1JIBA 1FFQA 4CVZB 1ZANL 5ABDE 1HHHB 5ICYA 1DBML 4BKLA 4JB9L 3DJ9A 4R7NB 4X4YB 1UJTA 3D0VA 1XGRB 3VCLA 4WO4B 5IQ9B 4ODWA 1Q9WB 1W8OA 4XXCC 2OTWB 4ZPVA 1SJHB 2W60B 3MOBH 3R4DA 1IARB 2EE6A 1VACA 3HCVB 3R1GH 4Z7WB 5C0IA 4KV5E 4AQ1B 1XF4A 4RIRB 1LK3L 1H8SA 4FZEL 5C0BA 4NC0B 3VXSA 4U1JB 3OAZK 3ZE2E 5DJAB 4OCNC 3BMVA 3U0WH 5CJQL 2X1OA 4Z7QF 4L3AA 3GIVB 4I0PC 4KKCC 1KFAL 2P42B 2R1YA 4PG2A 4U1KA 3T04D 2NNAB 2IGFL 2I07B 3HRZB 4CMHC 3CZFB 4LFHD 1N5AB 2VERN 1FN4A 1CICD 1OARL 2FATL 2FX8H 5DURD 2N56A 4X4YA 1A47A 4BKLB 2D4DA 3NA9H 3GSRA 1UJ3B 1YDPB 3HZKA 2OBGA 4FQXB 5KZCB 1MFAL 3TJEH 2BRRH 4HS8H 3RVVD 3WSQL 4OI9A 5I6XC 3PWNB 4OM0H 4Z78B 1OD9A 2CO7B 2QV2A 4L3EB 3LDBC 3K7UA 4PJEF 2ICWJ 3GMMB 3HE7D 5ITFA 3S4SB 3GIVA 2X1PA 3EHBC 3G04A 4S0TD 1U91B 5IHZB 3VRJA 3UZVB 3DWTA 3KDMB 2PW1B 5LJYH 4LKCB 1C1EL 1HWGB 3ELAT 4Q7DA 1M7IA 3MPCA 5HVWA 1SJXA 4HUMB 4CN4A 3B6SA 1JGEA 2OTWA 3BWAA 5IR1B 1MQKL 1C5DA 1KJMB 3T0XA 5I1CH 2W07A 4OF0A 5I1JL 5C6WH 4HZLB 2YK1H 1L0XA 1ZHLA 1ZAGA 2YN3A 5TQ2H 1FFRA 2VXTL 3CH1B 5HYIA 1C5CL 3Q5TA 5C2UB 1F2QA 1RURL 2OS7A 4JO3H 1S5IL 4P2QB 5JLZB 2ITDA 5IFJB 1DBBH 4HIJA 2VLRB 3DVGA 1QYGL 4K2UH 1JI1A 2HA1A 1J11A 3HPLA 3NZHH 3BQUB 4WDIA 3GBNL 5KSVA 4ZNCD 3LCYA 5F93C 5J13B 3VFSB 3BEWB 3FB5B 4L4VE 1CDYA 4G8IA 4WHCA 1QO3B 4HJ0C 1IAII 4OF8A 5CILH 3RTQB 4MJID 2Q86A 4LNVA 4P23D 1W72B 3VFSA 3WO3B 4RAUB 2HFTA 4I4WA 4XP5L 3JWOL 5KJRH 4TSAL 1U8OA 4RFOH 5ISZD 4KI1A 5IWLC 5KS9F 3IXAB 1KLGB 4FG6C 5CUSH 1IBGL 5JLZA 3CDCA 5GS0L 5DMYA 1BD2A 1OTTD 2AQ1A 5INDA