1N5AB

Crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Basis for LCMV Immune Evasion. Subversion of H-2D(b) and H-2K(b) Presentation of gp33 Revealed by Comparative Crystal Structure Analyses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 15
structure length 98
sequence length 98
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n5aB00
3F7YB 1QA9B 5ID0B 3L3HA 3NGBB 3H7BB 4FQ2H 4KWUA 2J2ZA 1RIVL 3W9DA 1W0WA 5JW4N 3M8OL 4PG9B 3MRCB 1URLA 3BP5A 1E27A 5GGVY 3RZCB 3L7FA 3BRDA 4XGZA 5FM5O 5IB3A 4U1IA 2R2BA 2B5IB 4PB0H 1C16A 1B90A 1JMZA 4I2XA 1I3GH 3CSPA 1T1XA 3CCHB 5F3HA 4UAOB 3E6FA 4EQ2A 1MJUH 3O6FC 3GMPB 1KCVH 4L3CA 3SE9H 3ARYA 4HEME 2QQKL 2G60L 5ABDE 4P9HC 2HTKD 2NZIA 2X7LB 3H3PH 1S8DA 4KVNL 2VLRE 2E8YA 4JVPA 5HHOB 2ADFL 1EGJA 3MLSH 1CG9B 2AK4A 3ULVE 1IKNC 5A3IC 3G6JA 4Z7VB 1D6EA 1BM3L 1U92A 4PGEB 5IT2L 3MCKB 5JW4Q 4PJEF 3RGVC 3QWRD 1HH6B 2X4RB 4OUOA 2WIMA 1I9RH 5HHOD 1A1NA 2Z31D 4K3JL 2AGJL 1AI1H 5J8OA 5EU6A 1PZ5A 2ZG1A 4LQ1A 3V7AG 5GGSA 1AD0B 4GBXC 3W82A 1LO5B 3WSQH 4LKCB 3P0VH 5HSFA 5I73B 3MLWL 3MRQA 2GITA 1CE1L 1RHHB 5CBAA 4GFTB 5C0BB 2CDEB 5DJDA 1S7TA 1SYVB 1NCDH 3TV3H 2XY2A 4PLJD 2DI8A 4N8VG 1F58L 5BRZD 1HH6A 2X4RA 4UOW0 4WHDA 3INUL 3OR6A 1ZOXA 4KPHL 5F8QC 4WUUB 5KJRH 4GAGL 4NJ9L 4OD1H 3NOIA 1EAJA 1AP2B 4JZJA 1DBKL 4E41A 1MCWW 1QLFA 3VFUB 4JDVB 2V2XA 5DR5L 3BDYH 4OZIA 3O2DL 2VL5B 2YKLL 4LQFL 3ZKND 5JHDB 4NHUB 3MRQB 5DTFA 5JQ6L 3O4LD 3U7YH 3RY4A 1ETZB 3DJ9A 2EEBA 3RAJL 1BVKA 3MRFA 2G2RA 4D3CL 1A64A 5BW7A 5IF0A 2D31B 4FG6D 3W39A 5ECJE 4AH2A 3MV9A 4N0RA 4X8JA 3WLBA 1TZGH 1BD2A 4MJIA 3RWEB 3QDJD 1XGUA 2V7NB 4G8GD 3VFWB 4Z8FH 1FL6B 5EOCJ 1I8MA 3O3EA 5EU4A 4PJIF 4HPOL 2DLFH 1ODAA 4HIHA 3QXTA 3UMTA 4A6YA 3LRSB 3GJEA 5DK2B 1I1FB 3O6MH 3PHOA 1EH9A 3PP4L 1XGPA 1T04B 3BSZH 3OJDA 4F15B 4XNUL 4TVPD 4D9LH 5IWLC 4JREB 4HWEL 1IFHH 1J9CT 2RB8A 1R3IH 4EOWH 4NKMB 5I1JL 1T03L 4TUKL 1B9ZA 1P6AB 5DYOA 4BSWA 4Z78B 3RRQA 2JB6B 4OM0H 3WUWB 4NN5C 3EO0A 4OAWA 3QPXL 2P24B 1ZT7B 4IMLB 5DDHA 5IG7B 2C1PA 3CDGB 5GGVL 3U7AA 4A6YB 2HT4D 3GUTA 1JK8B 3C2AH 3ZMRA 4OLYH 3Q5OA 4P59H 5ICXA 4RWHA 3WJLA 5L9DH 3QIWB 3MLXH 5TH2B 4EQ3A 1L6XA 4YBLB 3MBEA 4A2LA 2ZJSH 3P9MB 4OF7A 2NX5D 2OJEA 4C56D 2F8VA 3MRRB 2WZPD 5IMLA 2VZTA 3PP4H 4AIZA 2Z8SA 3O6ML 5J7CC 4XNZC 3CLEL 3MRNB 4DAGH 1G6RH 1XGYH 1YEIL 1ZV5A 3MTRA 5DQ9A 4D9RE 3MOAL 3RIFF 5E8NB 4XPGL 5FGBC 3BRGC 3WMSA 4NO2B 1A2YB 3UTQB 2QKIA 4PV8A 2IBGA 4KC3B 1HWHB 4N8VB 4PV9B 1IAMA 1HCFX 5HDQH 4WWKC 5KZCB 2Q87A 3VFMA 1NDMA 2R0KH 4PLNC 5J12B 3QUXB 2AEQL 2C4FT 2BSSB 5D96B 1P5VA 1TQBB 1X5ZA 1IQDA 3OTTA 4QGTA 3KHQA 3O0RH 5E00B 1BBJA 3MFGB 2X1XR 5D8JL 2G9HB 4MA1C 2J5LC 3QDJB 4G8GA 3W2DL 3SDXE 1CGWA 1MCPL 5E94A 1DBKH 2XN9E 7CGTA 1WEJH 2ZWLT 2VABB 3EJYD 5L8LB 5GJTH 2QV2A 4PPTA 3S88L 4RZCB 2VZSA 2EC8A 2J8UF 4G42A 4NQCB 2HWZH 4DW2H 2BVYA 4OCSH 4C56B 5FKPA 5I1CH 4NQDD 5EUKA 5LGJA 3TA3A 4KKNA 1S7WA 4F7PA 4WCYL 5B38B 3T1FB 1P4LB 3BUYB 1NKOA 3TO4B 5BMFH 5JXEA 2NNAA 5JPMB 3BH8B 4L4VE 2J3SA 4ZOBA 4J3UA 2QSTA 3NBNA 5BV7H 3BP4B 4PRDA 3ARSA 4LVNB 1CLYH 1MRFL 1QSED 2A74A 4Z77A 4NNXA 1I8IA 1Y6KR 1LP9F 4PRPA 2PTTB 2VWEC 4L4VA 1NFDB 5DJCA 4UNUA 3CZFB 3QPQC 2BRRH 3HFMH 2NYYD 4XP4H 5FFLA 4H20H 2VLJE 2VL4A 1DQMH 4HXAL 2PXYC 4LKXB 3VFPA 2B20A 5D7IF 3BHBA 2JJVA 3UTSA 2FEDD 5DD6B 1WSST 3ES6B 3VXMB 2NLJB 3I3EA 2F53A 2AJ3B 4N0CC 4X9GA 5I76B 3OQ3B 1QBBA 1S9XA 4JKLA 1FNLA 3B5TA 2XA8L 5GGRB 3THML 2H3NA 4OLZL 2GJZB 2AW2A 3FO2B 3PHQA 4WEBL 1UEYA 4GRMB 1BX2A 3X17A 5DD6A 3RWCA 2NY3B 1IGCH 4TSAL 3AGVA 1M7DB 4ZOAA 2E27L 2QADD 4QXUH 3WYRA 2PCPB 1ZAGA 3FT4A 3NIGF 3O4OC 1XF3B 3WJLC 3JWDL 4W68A 4PJHA 3BP6A 4ZAKB 5KSBE 5FYLD 4ONFL 1MCFA 4JPVL 4KUCD 3W9EB 3FT2B 4ODHH 2XTJE 3ARDC 4IRZL 1GGTA 4ZAKD 1GGIH 5ETUB 1UH3A 1DE4B 3PDOB 4FQPA 1CD1B 1MHPH 1QPPA 1MPAH 3GMPA 4I9WD 3MOAH 3K74B 2NZ9C 3TPKA 5BVPL 2PYEA 4CNIB 5JPNB 4LSQL 1VDGA 3W9EA 1MJJB 1J1XH 2OL3H 5I8EB 4Y5YA 2MPAH 1MIEL 2YZ8A 3NCJL 4H1LA 2EH7L 5CCKH 1FYTA 2HH0L 4I3SH 5IJKA 2VE6A 4JM2C 3SJVA 2I07A 3BKYH 1FLTX 4FRWA 3RZCC 4JLRA 1O7VA 1KPVB 4U7SA 2WUBH 4PJ9D 3GB7B 3VFOB 2XZCL 1YEEH 1YC8A 1NEZA 1QD0A 4AL8L 4O02H 2Q3AA 3KPPA 1UKTA 3PUCA 3MV8E 2LU3A 15C8H 5DK0B 3UCRA 2FGWH 4F7EA 5CSGA 3ULVF 1BBDL 4K07A 4M6NH 4S10A 4XNUH 2L4OA 4LCCB 4RWYH 4ZSOA 2R1XA 3S37X 1FC2D 1MAML 1QYGL 1KENL 5D1XC 5DJ6A 3QIBB 3MGOA 3U4BL 1DR9A 3TT1H 4LIQH 2ZCKH 1MRCL 4YDVA 3FAXA 1J0IA 4G8IA 4OSUH 3L6FA 3BUTA 4R9HA 1DVFC 1QFPA 4P23D 2CO7B 4MQ7B 4L8BA 4O5LH 4J8RA 5IJKC 3OMZA 2G2RB 3QQ4B 3B3IB 2Z4QB 4OKVB 3CUPA 4PS4L 3UTTE 2DLEA 1KGCD 4UMGA 5A2FA 2DMBA 5CAYB 4JE4B 4PYGA 3WFDL 2FNBA 4LCIH 3OZ9H 5EG6C 3JWDC 4KROD 3QEQE 5E7FA 4BSWB 4Z78A 5GPRA 1I75A 1TCRA 2UYLB 3GI8L 4OF0A 3O8XD 1EEUA 5KJRL 3T1WA 3DGCR 3TO4C 1UVQB 2CIIA 4JJ5A 2CMRH 2P8PB 3BZFB 1PQZB 2VKWA 4U2YA 4NT6A 2X4PA 3P11H 3OAZK 4LKCA 3UTTD 1B0RA 4L9LA 1NBZB 1HHIA 1KG0B 3MXWH 4H0HB 3PWPD 1S7TB 5AZ2H 3MV7A 2J8UB 2HT2D 4ODUB 4HJJH 1EPFA 5CMAB 3QDGA 4HIJA 3TWCH 1MRDL 3VFRB 4RA3A 2CMRL 4MA1B 4F7TB 4QHNA 3MRGA 4PY8I 3NZ8B 1FFPA 5LXGL 5D7IA 3P4LA 1ZWIB 4FA8A 2BC4B 3L5JA 3C5ZB 3WIIL 3VXUE 3QI9B 2VL5A 4LSPH 3G5VA 5D5MF 3EAKA 5I75B 1OM3L 3ALPA 2P5ED 1AR1C 1WCBA 1KB5B 1EHXA 5E2TL 2BVEA 4NO0A 2VITA 1BGXL 1MJUL 4MYWB 4UUJA 2B1HH 3T0VA 4PB0L 3EOYG 1P5UA 3DROA 3LN4B 5DD0L 3VWJA 1QSFD 1OAYH 3MLUH 2DQEL 2IANA 3LZFL 4DTGL 5DC9B 1J05B 4KDTA 5KOMC 1LDPH 1B4JL 4DUVA 3EOBA 2FB4H 1DBJL 2PNDA 2OI9C 3J8F7 1PG7X 3S4SG 5ADPH 1UB6A 2KZ1B 2VLRA 1YC7A 3T4AA 5C8JB 4KDTC 3VXSE 5C09D 4WTZA 4Z6AT 4FXKB 5LGHH 4M1CC 4LVNC 4NM4H 3VG9C 3JWOC 5SWQA 4LEXL 3VGAB 1T22A 2ZG2A 1RFDH 4JVUA 4ZPTA 4HLZG 3EOBB 1H0DB 4LRIA 5E8EB 5KSBF 3T3MF 3FO9A 3MLYH 1NCAL 2GSIB 3IDXH 2WM0A 4BA8A 5ELIA 1FG9C 4UI2A 2YBRA 4JKWA 2FL5B 5DD1L 1W2KT 4Z0BL 1IC7L 3MGTA 4Y19E 4Y16B 5GHWL 2VDRH 4WUUD 1KTLA 2VR9A 4G6KL 4IMKC 2QL1A 3BZ4A 5D5MB 3MLRL 1FFOA 1EMTH 5GS1A 1M71A 3PWUA 4Y19A 4MVBD 5EZIH 1B0GA 2IMMA 3VFNB 5KAQF 1WISA 1MPAL 3VU2A 2PYFB 3ULUL 1I8LA 3VJ6B 4OZIE 2FX7H 4R3SA 2WBJA 1A6WH 4Z5RA 4LGRB 3KPSE 3CC5A 3H9HA 1T1WB 1MFNA 4YPJA 3QIBC 3L3DB 2CPCA 3HI6H 4G80A 4AMKL 3QIUA 5C9JB 3LQAL 1CGYA 1XGTA 4XP1H 5IVZB 2DM3A 4R97B 5E1HB 3RPIB 3FT3A 1KTRL 2E3VA 1FORH 3DVIA 2DKSA 4HMEA 4R4FH 1F8TH 5HJ3B 4D9QE 3QH3B 3HC4L 2GQHA 3V6OC 3G6AB 3TT3L 4MAYD 5KVFH 4MXWH 1EA9C 2X4TB 2WWMC 1GC1H 5E24E 5CGYC 2CO6B 3E3QC 4BZ2H 2FX9H 2FWOB 5C07B 3WN5B 5EC2B 4JFEE 4HUWA 3GHEL 1KIRA 2EIZB 4PJBE 5BRZE 2YK1H 2CXGA 1A6AA 1H8OA 3GMRA 1YPZB 1WCQA 2VR5A 2Y07L 4LOUC 5KSBB 1CL7H 4TQEL 2ID5A 4YXLL 3KYNB 3VI3F 3WFEL 1EV2E 4H0IA 1EFXD 5DUPL 1MI5A 4FXGA 1INQA 1EJOH 1RSFA 1T83A 4HUNB 3HAEH 4OQTA 1R6VA 3QUYB 1A7BA 4OUUB 3V5HA 2OZ4A 1U93A 3GMRB 3T3PF 5TF1L 4WJ5B 5H37G 1TTUA 3MRPB 1NUGA 3QIUD 2J6EA 4QXUL 3NPSC 3PNWA 5EO0B 2NCMA 4GMSH 3FB7B 2R8SH 3PWJB 3EYVB 4AYFA 1C1EL 3U9PL 3RVVD 4DW2L 3U4EB 2NY2D 1BP3B 3CFBB 4S1QH 3VRLF 1GZPA 1FV1A 5I30H 5F1NA 5KVGL 4RDQG 3QNYB 1N8ZB 4RGMB 4P2RB 2VN4A 3DV6A 3FRPA 3PL6A 4LF3B 3OJMB 2JCCA 1FJ1A 2GAZA 4J7RA 1TNMA 2NYYC 2OP4L 5E99L 4HKBB 5I1KL 1WZ1L 2A0LD 4IRSD 5HY9A 4JHZA 3U1SH 3OB8A 4GBXA 4Z7WA 5F89B 3KWWB 5D6CB 3ARBC 1JHTB 3KNBA 1MFEH 3GSVA 5IQ7L 4P4RA 32C2A 3QUMB 1FAKT 2YPLE 4YQXH 1O5DT 3PL6B 1ZMYA 1VENA 4YEFA 2DQFA 3I84A 4HX1A 2F19L 4W70A 3G6DH 1BFOB 2PN5A 3CXDH 2OQJB 4LCUA 5DRZB 4I0PC 5ESAB 3A6BH 5C86A 2Z92B 3BEWB 2A6KA 5EORL 1CLZL 1QFHA 1N0XL 3BAEH 5E4IA 4UV4H 1EUTA 4UTBL 1TLKA 2Z0BA 1NDMB 1T5WA 1G7PA 4UDTB 4LLVB 5F6IC 3SE4C 2X1OA 4AY0A 1IAOB 2Y7QA 3F7QA 1XGPB 5IGXL 2APXA 3GSUA 1T04A 2HG5A 3CXDL 3DX8A 5E00A 4QRPE 4NZJA 1RZJL 5GRXG 3MREB 4HKJB 1XR9A 1MCCA 2EXWD 4MB4A 4NNYA 2A6KB 1NGWB 1E28A 1IAKB 5I74C 2BDNL 4QXTA 1X5FA 2FH6A 3I85A 2DQGH 4DK6A 3P9LA 5BZWA 5TDOB 5CS7A 1RIUH 1TMCB 4WO4B 3C2SA 5TQ0L 4GW5B 1IFHL 5CUSH 2VQUA 4Z7OE 3HC3H 3BPNB 4XNQA 4UT6L 4Z95H 3QO1A 3IDJB 3DX8B 3ZDYF 2EZ0C 5HGHA 5A2IH 3MGOB 4B50A 5DSCA 3LKNB 1Y0LA 4XNMB 4WI9A 5GRVL 2K3TA 3Q3GA 3OB0H 3DMMA 2GW5A 5IVXA 3SCMD 2FJHA 1UWGL 1G0YR 3DV4A 4IOIA 1FCCA 4WHTB 2E9JA 5EFIA 1BAFH 3EKCA 5E4EC 2X40A 1UM6L 3GJFH 3B9AA 3G9VA 3LKRB 2B39A 2BNUB 3VGHA 5A43C 3VXNA 3T77B 2NY0B 1OGTB 1HH9A 2ORBL 1Y0LB 3VI4F 3C2AL 2X9YA 3BEVA 1U8KB 4IMKA 3VD4A 3D3VA 1MAKA 1WV7T 1VEOA 4PB9L 4OF3A 2CIKB 5TE4H 1YEDA 3T8XA 2C9AA 1CXEA 1D5BA 5D93B 1C08B 1CFQB 5FIEA 2AK4D 3TYGH 3UBXB 4Y2DD 5C0DB 3S37H 4L3EE 2VABA 2GSGA 5GRUL 4WHYH 3L9RB 4J1UB 4F37K 5MEPA 3R06A 2BNRB 1MH5B 3VRJA 4FNLL 1TXKA 3MV9E 4MNQE 2IBBA 4MLIA 1RJZB 5LKNA 3ARGC 1KYOK 2BSRB 3LV3A 4RAUA 1RJCA 4AENA 2B1HL 3OR7A 3RU8L 1GC1L 2MHAB 1CFTB 3D9AL 1D9KD 4MXWL 4PR5B 4KZDL 2PR4L 4MNGE 3DVGA 1E4XH 3S97C 4ZD3H 4M8QB 3M17A 3ETBF 1DN2A 3UTZB 1H3GA 1Z9OA 4PB9H 4PJ9B 3MLSL 1BOGA 2V5YA 4YXHL 5C08A 4OGYL 5H35B 1W0WB 2F5BL 3HTLX 1T2JA 2YEZA 5KN5B 3ULUF 1S7QB 4LPUA 4M03A 1D6VL 3BYTA 1NMBH 5EC1A 4QEGA 4R8WH 4YZFE 1WC7A 5E6IA 3ARED 1E4KC 1T2QH 4G9FB 3DX7A 5KG9B 5DMIL 4HG4J 3LB6C 1X7QB 3C08L 4OB5H 2OMBA 3RNKB 3D2UB 1JWMA 1KBGL 3P73B 5DMYA 4PJ8B 5CJ5A 4QO1A 1S8DB 2AV1B 4OTXL 3FO1A 1NEZB 4F7CB 4YR6B 3V5KA 2GCYB 3FFDA 3HPLB 4IOFC 3QO0B 1P7QA 5L2JB 1C12B 4Z0XB 2WANA 1T1XB 2PYED 2WNGA 4Y4HB 4Z0BH 4LVHC 5EH1A 2CKBH 2ATPA 1NCAH 1TZIB 4PJCB 2MSPA 1L9MA 5C6PB 1EBPA 1ZHNA 4MD4B 4OQ1A 1CE6B 3ARFB 3QDGE 5FYKU 3FMGL 1LO3H 2AV1A 2AI0H 1KJ3L 5DD3L 3LEXA 3DBXA 2YMXH 2BVQA 4CBPA 1OB1B 4HC1L 4PRNB 4V1DB 4CVZB 5FYLH 4UIKL 4UQ2A 4HIXH 5L6YH 1G7LB 4PTTB 1Q38A 5C0CB 1DSFL 1FO0A 4MLSA 1U8NB 3KPNB 1X4XA 2C3GA 3W0WB 2CKBB 1CL7I 1N2RB 5F1SA 3LN9A 4EI5D 5ADOH 3PXHA 4OGXL 5I1HL 1XIWC 2X41A 4HKXA 4LCYB 4XVJH 3U4BH 3I2CH 3EDKA 2D7MA 4FFWC 4BJLA 3HHRB 2Y36H 4OUUA 3C08H 4O2CB 3MROA 3EBAA 3MJ6A 4P23C 5DJYB 5DGQA 1KPVA 4MS8D 4UINH 1CDJA 1WZKA 2G75A 3PWNA 3WNKA 2PO6B 4DOHB 4QRTA 1XR8B 3HMWL 2VLLB 3BGMA 3RQ3A 3CH1B 1REIA 3RZCD 3PHSA 4HIXL 2GAZB 5FUZL 4Z7WF 2O5YL 1F3DJ 1NMCC 2EZ0D 2R9HD 2H32B 4XBEL 5ANMB 5J56B 1ZT4B 1K8DB 4OZFG 5HI3D 3DHMA 2XQYK 4MD0A 3RX7A 5T3ZE 1JTTA 5F1NB 4OZHA 5DJAA 4M1DH 3IU3B 4PBWD 3TIDA 4UTAL 4EN3B 3RBGA 5J6GA 4UT7L 2BJMH 1VACB 4PJCF 2HH0H 4I3SL 3MOQA 1J8HD 5EOQH 4X0KA 2OL3L 3DX9A 3FB5B 4MDIB 2MKWA 3CPLA 4Q7DA 1RD6A 1DLFH 5D7IB 3NPSB 4G8FA 5JNYA 2F53E 4F33B 3B5HA 1CGVA 5DHVH 5IESH 1G7QB 1KXTB 3BESR 4Y5XB 3DURB 4DKEL 5IG7A 2YD7A 2Z9TA 1A5FL 1JHTA 4OZGF 1HN1A 3L3KA 2NY6B 4YXKL 3B3IA 2BOCA 1ZGLP 5GGSB 3MJ7A 4M7ZB 4ZQKA 5J9PA 5DFVD 1TQCC 2HJFB 3UROR 1A3RL 4QHKJ 1P53A 4KK5D 1A9EA 4O4YH 1KLFA 3TIEB 1HKLH 2GK0A 1UQSA 4XAKD 4HJ0C 2IWGA 2IG2H 5DEFA 1GIGH 4YNYA 2OX5A 4X6DF 4JFDE 3SGDI 2EYTA 4QT5A 4R2GD 2LAAA 2R69H 1T7XA 2Q8AL 2ORBH 1GGCH 5FO7A 4BZYA 3C6LC 3ZO0A 3X13A 1VADB 1NBYB 3VWKC 1DDHA 4NO3B 4WEBH 4QKXB 4HUUB 2LABA 4ACPA 1MHEB 2BCKB 1R5VB 5JA8B 3PQYD 1OT1A 1NGXB 5BXFB 1BPVA 3QUXA 2C4XA 1JGDA 2O5XH 3TJEL 5LQBH 5KVFL 4M7ZC 3MZGB 2EICA 3S34H 4FNLH 1RUPH 3V6OE 2F8XC 3UJTL 1KCSH 3F12B 3OXRB 5DI8B 5TE7L 5I1IH 2HJLB 2BNQE 1H5BC 2HVJB 5E8EA 1V8HA 1J12A 5IB2A 2ZUWA 1GIGL 4NKDA 3MMEA 4XVSH 5HI4C 2XKUA 3ELAT 2VUYA 1HKLL 3WXVH 4K94H 3IAPA 1J1PH 3SCMA 2E7BA 4HAFA 4FP8H 5MI0C 3QIUC 5K9KA 4UINL 2VITB 4PJXE 2F8OA 1BFSA 3LKOA 1AR1D 1MHCA 1RUKH 2YSSA 2EDEA 3RVVC 1RZJH 1KT2B 3DUSB 2HT3D 3KR3L 3BMVA 3RDTC 4NQXA 2XTLA 1G9MH 4DEPB 3DROB 2RQ8A 1JPGA 3VWKA 3IT8D 3MUGB 1IBGL 3UZEA 3TJHD 1RZGB 2YD1A 4F3FB 2VDRL 3MRKA 2VXUH 1OAXH 3LKSA 3VFGL 1IAOA 4XZUA 1W72A 5DD1H 1H5BA 4JFZL 4NM8H 1RUML 4WW2B 1YYLL 1X5KA 1ZA3A 4JG1L 2CDFB 2F58H 5C6TL 4GXVL 3RPIA 1EFQA 4PRAA 3BH8A 3U30B 1NFDE 3I6LD 5D1ZC 3ZTNL 3UBXA 1U8JB 3DPBA 1KUMA 4KK9D 5SX5K 3FMGH 5SWQB 3QIBD 3BIAX 3L9RA 4J1UA 4LBEA 4MQXC 4XMPH 5A1AA 4XWOC 5KVMC 2A83B 5K93A 1NFDA 3SY0A 5IW6A 1BIHA 1IARB 2R4RH 3RY6A 3TGXA 4DEPC 1CTOA 3HMWH 4OZFH 4LVOB 2A9NL 3HMXA 4J3OC 1W0VB 2AK1H 5DUBA 4U1KA 2OP4H 4Z76B 1FNAA 4H8WL 4NRXB 4M61A 1N7ML 1F45A 5DRWA 1OF2A 1Q0XL 4ONHA 3MPCA 1QRKA 5C6TH 3RY5A 1NMCB 5HHQA 4P4KC 3A0OA 1JZ6A 4LCCC 4YHZL 4JY4B 2XACC 3RL1A 1A1OB 4PJ7E 1UEMA 4M8VA 4IRSB 4JM2F 4Y4KC 5F9WB 4WUKL 3GZKA 1DBML 3BXNB 2YC1B 3RTQC 5JHLL 3LH2L 4WI5A 2VISA 1U95A 1XCQA 1YEFH 2ZCLH 3QXWA 3FL7A 5TF1H 3WFBH 4ZNEE 4F7PB 2A6JB 4NCDA 3KPOB 4YHLL 1BZ9B 2WMPA 1WTLA 2FX8H 3ZKNC 4JRYA 3UTSE 1ZLSL 3RUGA 5MEOA 1LK2A 3ULUC 2ADGB 4MB3A 4YZFF 1KEMH 4DGYL 1H8NA 5I1IL 1PSKH 3BN3B 4KHXL 4I2XB 5AZ2L 4LLWB 3RL2B 2BVPB 3DETC 4OLWL 5HYJA 3RFZC 2QADC 1YEJL 2XNAA 5I30L 5KVGH 3IFNL 3G6JB 4Z7VA 4JFYA 4RBPK 3OJVC 3S35L 3MBXL 2WUCH 3E3QE 1EEZA 4FQJL 1YY8A 2C7UB 4ZUSA 1B2WH 1ZVYA 1VKXA 1WBYA 3RTQA 1CF8H 2QQNL 3IDIA 4O2CA 3B2VL 4U33A 3GB7A 4CL7A 3MX0A 2HYMA 2A0LC 4QRSB 3ARBB 3OHXB 1M4KA 4Y2DC 1C5BH 4AMKH 1FVCB 5T5FL 3L6FB 5AG8A 4OCXH 4BFIA 2ADIA 3D18B 5D2NE 3GMQB 5TFSL 4HWBA 4P2CG 5TDPA 4QRSA 1HINL 1N64L 5IMKB 1UKQA 4YR6A 5HGAB 3BPLB 3RWFA 1FFNB 5GSRB 3SO5A 4E41B 1X5IA 4Y88A 3KYMB 5B3NA 1CBVH 4HQQL 5GGQL 4XX1G 3NFNB 3FRPG 5D1XA 4E41E 2VO5A 1ZKAA 1WFUA 2D31A 4U3XA 4K3JH 4M6NL 5CHNB 2ATPB 1CTNA 5F3BB 2NW3B 3SKMA 4XI5C 4L8BB 1RIUL 4KGLA 1F5WA 4HKBA 3EDFA 4JDTL 4X98B 2DJSA 4P3DA 4K8RL 4UU9B 3GFUA 2P8LA 1I7UB 4PP1D 1JZ3A 1H3VA 4KAQH 4X6DA 3V95A 1B0RB 1YEEL 4X9BA 2ZSWA 4QRUA 4F80A 4KRPC 2BFVL 4JG0H 4LFHD 5IV2B 5JO5A 5K9OB 1MEXH 5J0BA 5E6IC 1DFBH 1R3IL 3BVNB 4URTB 4EOWL 5JXEC 2CKBA 4QLRA 4X6BA 2MPAL 3NCJH 1NJ9B 2XWJA 4E0RB 3LKQA 1N6QL 2DL9A 3CJJA 2GUOA 3H8NA 4ODXB 4XXDB 3NIDF 5DHXB 1B6DA 1CQYA 1UWGH 3H9ZA 2B4CH 1FCGA 1AD9A 2J8OA 1LO5A 2E5EA 4J23A 3MR9A 4LARL 5DMKB 1WIUA 2ZSWB 3SCMC 5EZIL 3HZKB 4NSKB 3GNMH 4FQ2L 5DD0H 3BPCB 1KLGA 3GK8L 1HK6A 4X6CA 2NY3C 4CMMA 4HS8L 4ODSH 1FFRA 4DQOH 5MEQA 4GSDH 1HCVA 4POZD 1HNFA 5J1AB 3ARZA 3JV6B 4RRPG 4P5KA 3MBEB 4NO3A 4L8SB 4ETQB 2VDPL 2KDGA 1U8PB 3U2SA 4I4WA 5CP3H 1CR9L 4M7KL 1KNOA 1XEDA 4L8DA 5DT1L 2E27H 1BVKB 2ARJQ 3K2MC 4AEEA 4F37F 5DHVA 1ZSDB 3MV11 2W60B 4AM0B 5K9KB 3RWJA 4PJDB 4NM8L 4KK6D 2YD8A 4R97C 5DQDH 1RZJC 3VFGH 4NZTL 2D03L 3ESVF 4GG6E 2NY5L 3QZWA 2UV3A 4U0RC 2NLJA 1KIQB 2FR4B 4HJJL 3SEPA 2ICEB 2QQQA 4PV9A 3LN5A 4XXCC 2G5RA 4PY7B 4JO1L 1NUDA 4L8DB 3UAJC 3H9SE 4HLJA 2CLVA 5C08B 4ZTPH 5JIKA 3MACH 5K9JH 4WI6A 1IC5L 1JNNL 3VXNB 3T77A 1J8HA 2W0PA 4KVCL 1F4AA 3RWIB 3VXUA 4CRPA 1ACZA 5EPMB 2YD6A 3L3GB 4GUPA 4XPHH 4CKVX 1J1PL 1NMBL 5I8CB 3O3BB 4FTVA 5KG9A 3DXAE 1JPGB 1PG7L 1JWUB 1QOKA 4U1NB 5BVJA 1CLCA 1M6OA 2H26A 4X5WA 2HJKA 4MNGB 4FTVE 1ND0B 1YPZF 5FUOL 3VG9B 4YGVB 5LGJB 1Q9WA 3EO1B 5HGGS 3QI9A 4UZGA 3QNXA 5EWIH 5D9SA 4X5LA 3ESUF 2CR3A 2P5WB 3GRWA 4Q58C 3RKDD 1P7KA 3ARFD 1DZBA 3C6SB 2ZCHL 2I9TA 1OTUC 1NLBH 4AIZB 2IPKA 3E6FB 4YHOL 3WJJA 3VGFA 4I3RH 1YN6B 1T0MB 4J2XA 2QLVB 1PY4A 4RAVB 1U2CA 5JMOC 3UPRA 2ESVE 5GSVB 5ICZA 1CXKA 4NBYB 3P11L 4QRRD 1CD0A 5F6HI 4EI5A 4XC1H 1KFAH 3DVGB 5EU6E 2QEJA 3EFFA 3DNKA 2IANB 4UILL 2HA1A 2IG2L 4OFDA 3DTXA 1XF2B 1PKOA 2GI7A 1FH5L 2JB5H 2QHLA 3Q5TA 5FB8A 4DQOL 1EJOL 3PE9A 3MODH 3QCVH 2P7TB 4JFFD 1S7QA 1TZHB 4CAGA 4YXKH 2X4QA 4MJ2A 4HDIB 1F97A 1S5HA 4OFIA 1A6AB 4CUCA 5E94B 1YY9D 4ODWB 4Y8AA 4ZUTB 4XNYL 3BKYL 4OJFL 4DAGL 1YYLH 1EAPB 1F4XH 4R4BB 1MCSA 1UXSA 4U1SB 1MLCA 2Y5TA 1FN4B 1S7VB 1UGNA 3VG0L 1J87A 4X83A 1H5BB 5C0AB 3QIWC 5F9OH 2A6JA 1F4XL 3MC0A 3IKKA 2ZJSL 3GSXA 4F2MA 4F7MB 4XGZB 2XY1A 4MNHA 4PP1C 3BIKB 2VLME 1CFVH 1MHPL 5EU7C 5L9DL 1V3MA 1U8JA 4W6WB 4Q9RL 5KSBA 2H9GB 3IDNA 1CGUA 3L5WA 4MS8C 3ZT7A 3HKFA 1FYTD 3DO7A 2EC9U 3CAFA 3MV01 1WBYB 4R0LC 4XP1L 5ETUA 3GMLA 4XXCA 5SX4H 3KXFB 1NUNB 1BBDH 1AO7E 5HHNB 43C9A 5FO9B 5I0DA 3HUJF 3STLB 3ZE2E 3VXQB 2OM5A 2V9QA 5AYQA 3WXVL 5HBBA 1MF2L 4NKQB 3U30C 3JWOL 4APQD 3B6SA 1TCRB 4JLRB 2P1YA 4Y4HC 1CXHA 4PGBA 1QBML 1A7OL 1PYWB 1FYTB 4J4PA 3MXVL 3FTGA 4Y16D 1QLEH 2FO4A 1FYTE 1PZ5B 3V6OA 3STZA 4ZG1A 2V9TA 3ZDYE 5JQHC 3IFOB 1AD0A 5MHSD 2IMNA 4YBQD 1CIUA 1ZGLB 4R96A 4G3YH 2BNQA 3VG0H 4M7JL 4WV1B 4POZC 4OF5A 4NKMA 3C9NB 5D2NB 1XF4A 3MYJA 4PTUB 5HYSB 5FUOH 1DUYB 1M7DA 4OCLC 5FYJE 4UOJA 4JANA 5SX4I 4BSJA 1LD9A 5CSZB 4FQ1H 2J6EH 2JCCB 3O6KH 3C60B 3L95A 3IS1X 5D7SH 3ALWA 4LMQE 4ENED 3PG2A 2WBJC 1A7NH 3T08A 2BC4A 3F62A 1MFEL 1AHWB 1T7WA 5IOPB 1QSVA 1ZT4A 4L29B 1G9NL 2AV7A 3S96A 4OZIB 4MCYB 4GO6B 2QBWA 1J5OL 3LQZB 2NY4C 2WUCL 4MA3A 4BUHA 4IRJA 1MI5E 4OM1L 1BJMA 2IQAB 3UDWA 4PGCB 1CLYL 2OJZH 4EN3A 4XC1L 3TV3L 3L3JA 5EUOF 1PLGH 4R6UA 4HX1B 4HHAA 3VWKD 4PP2B 4K8RD 3KYOA 4HCRH 3P0VL 1QO3B 1U3HB 5FGCE 4N5UA 2I25N 2GUOB 1C7SA 4F9LA 1KBGH 2IAMB 1PBYA 2YPVL 2B4CC 4L8SC 4YHKL 1QQDA 4OIIL 5GGTA 2B8OT 4BFBD 3ILQD 2XRAL 1AC6A 1AI1L 3T65A 4LCWD 1T5WB 3C6LB 3G08A 3PDGA 1SJEB 5D71L 3BKJL 4PJGF 2NXYD 3QEQA 4HW6A 4OZGE 2H6PB 3TNMB 3CK0L 5M95B 4LPTA 1KJMB 5TGBB 5LAXA 1ORSA 1D5IL 4NO5B 3ULUD 1A22B 2WAHA 2A73B 1NC2D 4HT1H 4BFIB 1DBMH 4RZCA 2BVUA 4MQSB 4UNTA 2L0DA 3VD7A 4PJFF 3MV7B 4NP4L 1I1AA 1VGEH 2AERT 5SV4A 4EUPG 4XCFL 1NBYA 1TENA 3WL9B 1MRFH 5AZEH 4FZ8L 2YPVH 1Q9OB 4JN2B 1MCKA 3QRGL 5KS9B 3I2CL 3M8OH 1KCLA 2EDNA 4P5TC 4A6YH 4HCRL 5JPMA 3BT2L 3BW9B 3BP4A 4PRDB 2A6DA 2R2EB 4U31A 1FL3A 4PJEB 2ICEA 2ZKHL 3ZSSA 1BVZA 5FO8A 1N6QH 2LE9A 4ZUWA 2CLRB 3HE7B 4PJEE 1OAUH 3P4MB 5I19H 1QACA 4ZFOL 2D9QB 2NR6D 4KV5E 5HYJE 3HC0B 5I1EH 1CQKA 2BNQD 3K80A 2H2SD 3VXRD 3MV9D 2KZWA 4OLYL 4QCIB 3OXSB 4ELKA 4R26H 1JNJA 4NOFA 4MQXD 1MI5D 5IV2A 2XA3A 4LMQI 3ES6A 2GJ6E 5IEHB 3CVHH 1UC6A 3IU4H 5DJZB 1SM3H 1S7RB 4TUKH 1BBJB 1WWAX 4DVBB 4JPKL 5CCKL 5C0ND 1C08A 2D0HA 1JFQH 2MMXA 2BNRE 4MCZB 4KKLD 4NQXB 3SDAC 3HC0A 2EXYC 2R23B 4JFQA 4XCCH 5EU3B 1Q9WB 1JP5A 3T0BA 4GG6F 1MRCH 1QFWI 2BNRA 4ELKB 4XNYH 3HZKA 1HILB 3RWGA 2WK2A 1T1YB 1VGKA 4NZDA 2XWTA 2FGZA 1MCOL 2N7BA 1F4YH 1FNGB 2VRAA 3NFPA 5HYQB 1XZ0A 3F7VA 2R1WB 4JY5L 3QDMB 3ALXA 4Z95L 2O26U 3WNMA 2YPKB 1IKNA 3MODL 1A9BA 1P1ZB 2Y1VA 3NZ8A 2E7LC 1AGCB 4Q9CA 4JO3H 3O3UN 2DRUA 3T04D 1DFBL 3SKNA 3V8OA 2VDLH 3QEGH 1AC0A 4FQQB 3WHXA 1MFDL 2DDQH 2FGWL 4D0BA 2L7UA 5F9JB 3IU4L 3RAJH 3HZVB 2BFVH 4JG0L 4ZUUB 4P9HL 3JWDH 2GKIA 5JQ6H 3CFJA 3LCYA 4BH8B 4R26L 3QULB 4M9PA 4FQXD 5BV7B 2NY1D 3HUJB 3SE3A 1BWWA 1JCKA 5DUBB 2BRQA 5GQBA 3S3SA 1U93B 3KPSD 5TF0A 5BCAA 2I5YH 4LSTH 3TO2B 1MIEH 4JHWH 1KIQA 2FR4A 3K3QA 4XB8A 5C0IA 1YY8B 4S11A 4ZUSB 1YEDB 3P2TA 3T8XB 1QP1A 2FEEL 3BAEL 4PJ5A 1KIPB 2NTFB 3VRLE 3WFHB 4OLEA 1FVDB 4HPOH 1VFOA 5T1KD 3VFOA 3UPAA 1GGCL 3MNWB 3BPNC 4R4NC 3BMWA 1AGDA 3L1OH 1MY7A 3AS1A 2APWA 4ZSOE 1INDL 3BPOC 4K2UL 3V0VA 2DN7A 4P3CH 1DVFA 4Y4HA 1K4CB 4OCXL 5F3HB 2BRRL 1OAKL 1A3RH 5GGSY 2QADB 3QCTL 4FQLL 2ADJB 3QJHA 5LWYH 5I17B 5F7EH 4BUGA 3ARUA 3TCXA 1G7JA 5I71C 5F44A 1DQQA 5ITBH 4L4TD 1A6VH 5HHOA 4ODBD 3BDXA 4GKZB 4JFFE 4GAGH 4GRWH 3OL2A 4O2EB 4PJBA 3WE6A 2VDOL 1HHJA 1U92B 4PJGA 5FK9B 4PGEA 1R5IA 4QY8A 3FONB 3LVEA 5E8OB 2NW3A 3SKMB 4QGYA 1I9JH 1U91A 1U8IB 1KJVB 2ATKB 5GJTL 4UT7H 3O4LE 4JRXB 4LPWA 3O11A 3PHOB 2HP4A 5I17A 4N1HB 4S0SD 5ANMA 4WJ5A 1QR1B 4KV5F 4FFVD 2IPUG 1HKFA 1OWWA 5C0BA 5I1LA 2GITB 3RTQB 5LWYL 4E9LA 2G75B 1E0OB 3PWNB 1S78C 3QQ9C 4LLDB 1J5OH 3GKZA 2VDML 4FQIH 4HLZH 5ALCL 1XCTB 4LLQA 4Q2ZA 1R3JB 2EDXA 5F88B 1IGIH 2AJYH 2FO4B 4JJ5B 4WW1B 5EIIB 1WWCA 4ONGH 5E2UH 2OS7A 4K2UH 4PGZA 3BDBA 1JMXA 4X99B 5HYFA 4JDVA 4BFGA 2ED7A 3DV6B 3WFEH 4L29A 3ZTNH 3LSOA 5BV7L 2YRZA 5DTFB 3V0WH 2FCBA 4OZHB 5I9QC 2X4UA 4I48B 3GEWB 4JO1H 4NSKA 4WCYH 4YWGH 4PJFE 5TDPB 3PJSB 3QI9D 4Q9BA 1P6FA 1MCEA 2HJFA 3NA9L 3MRGB 3GSXB 4UOW1 4WU5A 1DSFH 3FN0H 1ZVSA 4XVTL 1CIDA 4PGDA 4S2SB 5FYLL 5C7XL 4L8CA 4QXGL 1JBJA 4UBDC 1Q0XH 2DTML 3FQNA 4AEIL 1I1AC 5KSAD 4HZAA 1WFTA 2E7CA 1MAMH 1QYGH 1JPFA 3T2OA 2NXZD 5IKCB 4LCYA 2CLZA 4Q6YA 3V7MA 3EOAA 1DQLH 1H9VA 3B43A 2W92A 5DD5H 1F6AA 3SDAD 4UUJB 3I6LE 3KPTA 2JB6A 4OF6A 2MWCA 4WUUE 3KJ6H 3I6KA 4WNQA 3AAZB 1IQWH 5TPWL 4O02L 1PKQA 1U0QA 5EO0A 1X5JA 3MSPA 4OTXH 5F6IB 3TN0B 2HKFH 5J6HB 3GSOA 4H26A 4PRHA 1JWSB 3E8UL 5DI8A 2V9RA 3WL9A 1KYOJ 1YNKL 2O5XL 4PRHD 3K4AA 3TJEH 3QPQD 3GRWL 4AEHH 4GQPH 1A7QH 1HHKA 3SBWA 2VDOH 4JZNA 1NAKL 3X3GL 3MLYL 2YN3A 3VFRA 4RMWA 2X9XA 5JHDD 4OZHF 4GQ9L 3RGHA 3AMKA 5D7JA 3O2VH 4M5YH 5E8NA 4H26B 4PRHB 3IETB 3OKMB 1UM5L 4CU8A 1CFNA 1R0AL 1L9NA 2XPGB 3RWDB 3C6LD 1UXWB 4I13B 1UT9A 2X4SB 1XIWA 3TYFA 1E4XL 3TCLB 5HHPA 2DQTL 5LGHL 4NC1C 3D9AH 3IVKB 1PVHA 2FL5A 3QAZC 1I1FA 4ZS7H 4NWUH 1UA6H 1VFBB 3BW9A 3MBXH 4KMTL 4QNPE 1RAMA 4XNXH 3RU8H 4HWNA 3EFDH 4G6AD 3WD5L 4KRMB 1CD8A 1CL7L 3V7AE 1QO3A 2WLYA 4Y19B 3SBWC 4KXZH 3IF1B 3QXAB 2X89A 4G8GB 5FA4A 2P8MB 3P30L 4DGVH 1KCUL 1HXYB 1U41A 3N1QC 2XT1B 1C5DA 2A2QT 1VA9A 4MXVF 4P23A 3AXLA 4BSVB 4YHOH 5D2NC 3FOMB 1CFBA 1X5GA 2IH1A 2HTLD 4RMVA 2EDTA 5A2LH 5IW6B 1AO7D 4ISVB 4D8PA 4IOFD 1XF3A 1BJ1H 3NIDE 1R24B 4G6ML 2GCYA 4ZYKA 3FFDB 3QDMA 4YH6A 4Y1AE 3TLRA 1BEYH 4OBRA 1P4LA 3BUYA 2P8MA 2R2HB 2AQ2A 2ZCLL 4NRYB 4GXUM 4QXTB 4XHJC 5I8CA 4KU1A 4HWUA 5DJ0A 3BDYL 5HYJD 3MRNA 4RMQA 3GMMA 3TFKC 4U7KA 5BS0E 2F54B 4XX1E 2Y5TB 1IEAB 5SWSA 4G6FB 5DJ2A 4Y0GA 2W65B 5IJVA 1YJDC 1ONQA 1VCAA 2HRPH 1G6RB 3RDTB 1O7SA 4EN3C 3EIFA 5K9JL 5E9DD 3SQOL 1OB1A 4YIQA 3D69B 4D0DA 1Q94B 5K33A 1JF5A 2C1OB 4APQB 2IPKB 1KACB 3FJTA 1A1NB 1KN2L 3ARFC 3S7GA 1PSKL 4ZUUA 1DLFL 4FFZH 1P2CB 2I07B 5GS1B 2B2XL 1S78D 2HWZL 1KEML 1BZ9A 3PWVB 2UY7A 4YBHA 3LPGA 1ONQB 3OGCB 3WUZA 3WBDA 1AGDB 2G5BB 5CGYD 4KI5F 4Z5RB 4OLXL 2YMXL 3QDAA 2BDNH 4FHBD 1A1MA 3FQUA 5C0FB 1BFVH 2NY7H 2HKHH 2ZUTA 2Q7YA 4KKAD 3CH1A 3CNKA 4OLXH 5F97E 4L4TB 4LEXH 3D0LB 4ZSOB 2P47B 4JKPH 5IGXH 3FB6B 2O93L 2ILLA 1CFQA 1ZLUH 4APQC 2J8HA 3QXDA 4XCNB 3NACH 3RVTC 1OAXL 2IALB 3BWAB 2DOCA 4I18A 3FFCA 4JFHD 4LPXA 1MREL 2YOCA 4XBPA 3SY0B 3MRFB 1JIBA 3P77A 4Z0XA 1GXEA 2WP3O 1S7VA 1I1YB 1OHQA 5M7QA 4Z7WE 3RP1A 2LTQC 5FV2A 4NN5B 3BP7B 1M1SA 1FJ1B 1YA5A 4OFVA 4MJ5B 3TBTA 5F9DC 4GS7C 1RK1A 5CZXD 1GHFL 1L4IA 1ZHLA 3SKOB 3FHAA 1G7LA 4PTTA 2XFXA 5I1AB 4D9RD 4Y4FD 4P2OB 1BGXH 3SDDB 5I16B 5C0RH 4K7FB 3VFTA 3DO7B 1KN4L 4NQTA 4N90D 4UQ2B 1OTSC 3L3KB 3UTOA 1S9XB 4RX4D 2F5BH 4NCC1 1I3UA 5GRJL 4U1LB 4V1DD 3CZJA 3AS0A 3NIFF 3DVNB 4LCUB 3OHXA 4LHJB 4MA7H 4K9EH 3UEZA 1CVSC 5AWNH 5E08H 2HMID 4HS3A 1FGVL 5EIIA 3B9VA 5DUMH 2WINB 5IK3A 2Z35B 1KPUA 3NFNA 5D1XB 5D7JD 1OSPL 3EGSB 2XWBB 3B8SA 4E5XB 1KTKE 3IAQA 2XRAH 3IFPA 2XTJB 3BPLC 4YHKH 5E8PB 3V6FA 4U6XA 1NSNL 4GRWF 4U1JA 4NZRH 5BVPH 3AM8A 4MD0B 2YN5A 5HGAA 4NHUA 2FRGP 4JRWA 2GHWB 4IOSD 5GSRA 4WW1A 3NFSH 3MYJB 4PTUA 5T1LA 3S37L 5HYSA 4QRPB 1KB9K 4OCNC 3D2UD 4R7NA 3MRIB 4H25B 2AQ1A 4JPVH 3V79C 4X6BB 4HD9A 2RFXA 1MJ7L 3QFJB 4M93C 5ACZB 1U58B 5GXBB 4E0RA 3MUZ1 4B41A 2AK4E 3GI8H 3IXAA 1DP0A 5HVHB 1IILE 5DUPH 1ES0A 1JN6A 3QXVA 4X80H 1I7UA 2DS4A 1J0HA 4TSBH 3S5LB 3O2DH 2GY5A 1W0YT 4TSAH 4XPFL 1HWGB 3X3GH 3QUMA 4OD1L 3L3JB 1RY7B 2VLKD 1QG3A 4LK4A 2IEPA 4ZNCD 3OJDB 4KPHH 1IQDB 4ZXBC 4D2NA 1CICA 4G3YL 1UJ3C 3GBMH 3OKOA 2J4WH 1NANI 3WFCL 5EOQL 1G0DA 3TIEA 4KJQD 1G0XA 1MQKL 3Q6FA 3LS4H 1U8QB 2E7MA 1YNKH 5I71B 1NCDL 3HPJB 3EYOB 1UYWL 5GIRB 5CEXB 5ERWA 4X4ME 2VC2H 4XMLL 2DIAA 2I9LB 4GMTH 3T65B 4UDUB 1G9NC 3KPMB 3WIHH 43CAA 2DYPD 5DEGA 5IBTL 3VE0B 4I4WB 1KOAA 1FORL 2GK0B 4JGUA 4R4FL 1VFMA 1YMHA 4FABL 1A6UL 4BK5A 3L3IB 3WNOA 2Y7QB 2W9EH 4C56A 4WFFD 5DJ6B 3FCTB 1I7RB 4NC1E 3WEXB 2O5YH 1U8MA 4HBCL 3ZLQC 4QHNB 2GJ6B 1R5VA 1X5LA 2DLIA 3CX2A 4MCZA 3MRRA 4C56E 1IGFL 3T3ME 4KVCH 1RV6X 2Y4SA 5DO2C 1QFWM 2IFGA 3AB0C 4C83A 2AXGB 3R4DA 1A6PA 3KPMA 1RURL 3GBLA 2A83A 3V4VH 1DEEA 4ZTPL 4RNRA 1SMAA 5IESL 3SDYL 3KPLB 5GZOD 3QEHA 1IM9A 3OF6D 1TVDA 1A6ZA 4KDVA 3JZ7A 4OCSL 1OOAA 4X7SH 3EZ8A 4POUB 1I3GL 3MJ8A 4ZS6D 1Z0NA 1CFTA 1XFPA 2UYLA 5GZNC 3LOWA 2ZP0T 5LBSL 4OGAC 1CI5A 4BKLA 2FJHB 5FO8B 4A2MA 3CDFA 3TBVB 1XIWD 1FNSH 3A6BL 1EX0A 4HULB 3OB0K 3F65A 2Y6SD 1BOGB 2D7NA 2IAMD 2BNUA 1J8KA 2WWKT 1EXUB 3FO2A 3PHQB 5CUSL 1UB6B 2VLRB 3JV4A 5JHDE 5C8JA 4MAUH 5HHOE 4G7VH 4JRXD 5J1SC 4GSDL 4CJ0A 1WUNT 2I9TB 3EJZC 3QSKB 1XGRB 4ZFGL 3EYUH 1JPSH 3IFLL 4MXQC 3NCYS 4UILH 1ADQL 5DJZA 1X3DA 3UTTB 2CIKA 1VSCA 5HHMB 3GSOB 2IF7A 4GT7A 1JYWA 4PUBH 3E2HC 1EEQA 4TNVK 4CDHA 2BP3A 2GSGB 5LBSH 4WI2A 5CBEB 3BQUD 5KANG 3VGAC 4XAKE 3R06B 2D2OA 1GJIA 3CFIC 1CYGA 2I24N 4YHNB 35C8L 3H9SA 4YUEH 1SYSA 4KI5E 5C9KA 3MZTA 5I1GH 4YWGL 4D94A 1EO8L 1NL0L 4UIKH 4J3WA 1BQHA 4I0KA 5FA3A 1P2CA 4WWKB 1CE6A 3UPRB 3G6DL 4P2OC 3VFNA 2VAAB 4QHMA 5D7IE 1KPRA 4U05A 4FQLH 2HMIC 1VESA 4D0BB 5MI0B 3VGBA 3HCVB 3QNZB 4YDIL 1MLCB 2CKBL 4N9GA 4G8GE 1TNNA 1J8HE 4P3CL 1LGVA 1R5IB 4QY8B 3SDXA 4HWEH 1D5XB 1IEBB 3AFLA 2FEDC 1F11A 1IC5H 2I60L 4KTYA 2JIXA 4FABH 3F8UB 4U7MA 4CVXB 4DKDC 1SJHA 3U46A 1DCLA 1JUFB 3PV6B 5D96C 5I18H 2ADIB 2VC2L 3MUY1 5LQBL 4LCCA 4U1SA 1KIPA 2NTFA 3S5LG 1ZE3C 2B1AL 1BJ8A 3HMXH 4N0UE 1W72B 1RJLA 3I02B 3S88H 5EC2A 5C07A 4JGMA 1D9KA 1ZGLM 4UQ3B 5T1KA 4ZNEA 4AT6B 1P7QB 1HE7A 4J6RL 4KKCC 4TNVF 3V0VB 1WWWX 4GMSL 1AQKL 2W38A 4G8IB 3VXSA 3O3AA 3MLTB 1LP9E 1GAFH 2R0LH 4MQTB 1LO2H 4DN4H 1YN6A 1I4FA 4KK9C 4OCMC 2VLJA 5CJXA 2YUWA 4K7PY 4OV5A 5EU6B 1OVZA 1CFSB 2NX5E 1T3FA 3KS0J 3V52H 4FXGB 4PRHE 4UU9A 4ZD3L 2DYPA 5H37H 1CDYA 3DI3B 3B9KB 1B2WL 5EO9B 5JR1H 3U79A 3C5SB 3CFEA 1H3UA 2MTPA 4GKZA 2CUMA 4XTRD 3QWRA 4KFZC 3IDGB 3H9HB 3WNLA 5JO5B 1P69B 4XPGH 4OCYL 1F13A 5I18L 3QJFB 5E9DB 4PJHE 1JYXA 3V6ZB 1IZJA 1ZHKB 4NN6C 2DKUA 4YHIB 3RDTD 2XIDA 3JUYA 4LNRA 3IDIB 1Z3GH 3TVMC 1FZMB 5HGBA 4DGYH 3IJHA 2FX9L 2IFFL 3UBXI 1U6AL 1OP9A 4PJAB 1AXTH 2BX5A 2YPLB 4KJPD 3TYGL 4LSDA 5DD5L 8FABA 3QH3A 3BO8B 4N8CL 4QF1B 4G6JH 4XHJD 1I1AD 5KSAC 5CMAA 2NY3D 1ZLVH 1RJYB 4JFPB 4LRNL 1KLGB 1FVCA 4JANB 5TDOA 4LF3A 1FLRH 1UWXH 3V6ZA 4KVNH 4P2QD 4MWFA 2V5TA 1WVZA 5LCVL 3IDJA 4PJ5D 4XWOD 5J3HC 4ETQA 4ZOEA 4WDIA 3FN9A 3DI2B 3LPWA 5D1QA 4HH9A 3X3FH 1I3VA 2V5SA 3G08B 4RBPH 1BZ7B 4YHZH 3EYFB 4ZMAT 3PQYE 4XPTL 3FOLB 2XZQL 2FHBA 3MA9H 2V2TB 3QXUA 1IC4H 3G5ZB 1N5AB 3CPLB 3ARDD 1F90L 3IXAB 1JGEB 2P49B 2EDDA 3EDDA 3GIVB 4GAJL 5D2LB 2VZUA 3SDDA 1XIWB 3TYFB 3O8XB 1QSFE 2CDGB 4F58L 2VLKA 3ZKQD 3F6IA 4LLVA 1HHHB 4KKAC 4MMZC 1XF5A 3T2QA 4IDJH 4IRJD 4N0FB 4DWHA 4ZOCA 5E2TH 1NBVL 3RVUD 3CVHL 5DVOA 2R15A 1YECH 3KLAA 3N1MC 4YDLC 5DJXA 4LQFH 1NBZA 2VMFA 3QUZA 3Q6FB 4XHQA 5DR5H 3CMOH 2GEEA 5C09E 4XVUD 3AAZA 5ID1A 4XH2B 3TBWA 4MJ4A 4C83B 1JWUA 4M6AA 2V17H 4OLZH 1QPXA 5C6WH 4GW5A 1LO4L 5KANI 1ZWIA 1UWEH 1EZVY 1IBGH 3Q0HA 4TUJA 5E95B 2GJ6D 5JIPA 3M07A 1GRWA 5EZJB 4JPIA 1MCLA 4CMHC 4D0CA 2UVFA 1B4JH 2BSRA 3JVGC 3OXSA 2NY4B 3O9WA 1DBAH 2DQJL 4P2QA 3VGDA 4KTDH 4UNVA 3SDCD 3O6FB 1FRGH 2Q8BH 2X09A 3W11C 2W0KA 1HZHH 4YDKL 3D0VA 3ARXA 3MRIA 5KZCD 5F3BA 3BZ4B 1MLBA 4ORGA 1E4JA 1TETH 2CKNA 3HFML 5ANME 3LB6D 1IEAA 3MNVA 5F6HJ 5GGRA 2HJLA 4IIQC 4U49A 3CXHJ 4Z7QE 3VJ6A 1H3PH 2APFA 2F54E 2OTUA 3O9WB 3FFCE 4WV1C 5CJQL 4RX4A 4PRBA 5HDBF 3E6HB 5BMFL 3D3VB 2EDFA 2EEDA 5D2LF 3HS0B 3SE9L 3SDDD 1PEWA 2VZVA 1JVKA 4GOSA 4M7JH 3OF6A 4KI5C 3DO3A 1K2DB 1V7NL 4JHWL 4EKXA 1C5DB 3IXTA 4NKIL 3SKNB 2I5YL 2R23A 4ZUTA 3P9LB 4YPGB 4P23B 3KHOA 5MP6H 4RMSA 4R4BA 2B7DT 2H45A 1UCBL 3RA7L 4X6CF 5H94A 3MJ9A 5T3XE 3FQXB 3FRUA 1A0QL 4P5MB 2R0WL 5E5UB 3LQAH 2XOTA 1GGBH 1MJ8L 3RI5F 4Q6IC 2DQTH 1G7MB 1N3NA 4XI5D 3MJGX 5IVXB 4MSWA 2LFGA 2HT2C 4PJEA 5IQ9A 5D9SB 3OKNB 3I6GB 3MLPA 1J11A 1LO0H 5FGSA 1R0AH 1TJGL 3PWUB 3VD5A 3UJJH 1ZLVK 1MVUA 3SGJA 3WFDH 3LKRA 3GSWB 4EI5B 4GXVH 1TVBA 2VH5H 1RUMH 3QUYA 4P46C 3RVTD 4Z76A 3V5HB 2IANE 1G7IB 3FO0L 3PP3H 1J1XL 4EN3D 3S3PA 1K4CA 4OZFB 1UJTA 4LSQH 5JUEH 4QOKB 4DVRL 1QFUH 5DUML 1HI6B 3BPOB 4OIBA 2BY3A 1A02N 1DUZA 5FDYA 2CLVB 2ADJA 1OAZH 3K8LA 2LU7A 5C0DA 3FQWA 1NGYA 5I2IA 4G8EA 1RFDL 5MEPB 2MCG1 4OQTH 2F54D 3CH8A 3AM8C 2CK0L 3BX7C 2FIRT 1EBAA 4K71B 1DQLL 1T66C 1G9EA 3GIZH 4FTVB 2FATH 2IBZX 4QRQA 4U6YA 4HF5H 2NW2B 3KPOA 1A6WL 1FAIH 5CJOL 2A6IB 1AQDA 3BQUA 1T83C 5IB4B 3CFCH 2XZCH 4P0DA 1QSEE 5IP4A 1ND0A 1G7JB 4Y5VB 2Q86B 4R7DB 2Q7NA 1BWMA 4A6YL 3QG6B 1OQXA 4ZS6C 3S34L 1T2XA 3KNBB 3QRGH 4G9FD 5GZND 3NCMA 1FZJA 2P42B 3D1MC 3MRDB 4FZ8H 4OGXH 3KLSA 3DXAD 1U8NA 3BD4A 3KPNA 4G6KH 5HHMD 4DFHA 4F33A 5C0CA 1TVHB 2CGRL 5IBLD 2XA8H 3V2AR 5I74B 1Q72L 4DN3L 5BZDA 3NACL 2YD5A 5KVDH 4M1GH 3BN9C 1G7HB 5DRZA 1WIPA 4F8TA 2P8PA 5E70A 4OJFH 5T3ZD 1RK1B 2BOCB 1U3JA 5E6IB 4JQXC 1J0ZA 2VLRD 2VAAA 3O81A 4WI4A 4NC2B 4OLVH 2CRMA 2IBZY 2O5ZH 2YUZA 4MJIE 4BH7B 3D87B 2YKLH 2R0ZH 3U0PA 2DIBA 5EU5A 4HC1A 1GCFA 3VFVA 5DLMH 1RK0B 3BKJH 4JQVA 4JFEA 4NM4L 3B83A 4LLQB 4Q2ZB 1IGTB 3V5KB 2Y23A 3U36A 3HPLA 2UZIH 4YGAB 3LQAC 1QLRA 1VADA 1WIOA 1IAIM 3GI9H 1N6UA 1XGQA 4PJ8D 1DVFB 4MWFB 2A73A 1ZGLA 1BZQK 4Y4KA 4PJGE 5JHDA 2BERA 5D6DC 1Z2KA 4BH7A 1R3LA 1QHOA 1YMHB 1JGLL 4P4KA 4XNQB 1RJYA 4FFVC 4JFPA 4RA0C 3RNQB 1NLBL 4OM1H 5FF6A 3LHPH 1NAML 3VXTB 4OCRL 2R4SL 5LVEA 3KYKL 3QIWD 1BM3H 3C60C 3TPUA 2JJWA 4KZEH 4M4RA 4U2ZA 3KYMA 3HNSH 2A6DB 3MFFB 2OTWB 3DURA 3IDNB 1BIIA 4HV8A 1F00I 1BFOA 3O6KL 5IMOA 4YXHH 1U58A 3EW3B 2B0SL 4JRXA 2LV4A 4MDJA 5E1AB 2Q76B 2WW8A 2P8LB 2YHGA 4WFED 1OT2A 5HHXH 1OGTA 1KSRA 4GW4B 5AD0B 3SDCB 2BSTA 4P2RE 4KQ3H 3MCG1 1BJ1J 1QLEL 3LPFA 1S7WB 3MV8D 1ORSB 5D2LE 4ZPTB 4YHIA 2R56L 3TP4A 3WN5C 1WBXA 4M6OH 3NIFE 3TO4A 4LLAA 4KK8D 1XF5B 4PJXF 1WAAF 2DJUA 1FAIL 5LG1A 3F7PC 1VERA 3OPZL 5EUKB 1ZA3B 2XXCB 4HF5L 4FS0A 1NC2B 4P99A 2CDFA 3SGEH 2DQDL 4WV1A 2D03H 3UX9B 4YBQC 4OGAD 4WO4A 1UA6L 4KMTH 4LSTL 2IPUK 5JOFB 5IMLB 3UYOD 4BM7A 3L3IA 4TRPH 3CLFL 1RJZA 1MCPH 1AXIB 1EGJH 1A14L 4B7LA 2HTKC 3IJYB 4LFHG 2B5IC 4DCQB 5HTSA 3H2WA 1LE9B 5E2JA 3TBYA 3QIWA 3QXAA 5D7KE 5TH2A 4G8FB 5JNYB 2V2WA 3MNVB 4XNZB 1E6JL 4PGDB 3HG1B 4MX7B 4HS6B 4HIIA 3MRLB 3UXFA 1ORQA 1YNLL 3QDGD 2ESVA 3IVKA 1ZLUK 1ZHBA 1ZT1B 5DJ8A 5GGTH 3WJJC 5DHVB 2J88L 3QEHB 3HUJA 3D0VB 3KYAA 4JZOB 2EDKA 5KN5A 1F4YL 2MOVA 4WTWA 2YEZB 2VR4A 4K9EC 3N85H 5C07E 3I6KB 4WNQB 1RZ8A 3ARBD 3H0TB 1CT8B 1R3HA 3MLRH 4Y16C 3PGCB 2VDNL 4TYUA 3NPZB 4EI6A 3O8XA 4L9LC 3C6LA 4PJHB 4ALAH 3MRKB 3QUKA 2IQ9L 5TQ0H 4TSCH 3SDXB 5HVGB 4Y4FA 3BP5B 3FO9B 3RZCA 5K9QI 5JXAH 3KDMA 1T5XB 1IAIL 1T7YA 3N9GL 5B39A 1Q94A 1ZTXH 3WDHA 4G6AC 5BS0B 1MUJA 3MRHA 1CD1A 5EU3A 4JHAH 2MJWA 3F7YA 5E56A 2UUDH 1QA9A 2YRLA 4JPWL 1BQLH 5GJSH 1UH2A 3QUYC 4P46A 2OR8A 4G42B 2C26A 3RX5A 5JPNA 2HFEB 1OAUL 1I3RA 2DQUH 5C0GA 3GBNL 1NFIA 2P43B 1YYMH 3CSGA 4WI8A 4ZFOB 3DX6B 5GGQH 4NGHH 1TVBB 1GGUA 2HN7A 3DBXB 4R0LB 1UCTA 4D0DB 3BHBB 4WY7H 4PREB 6FABL 5EOTA 4PJBB 2CK2A 1CGTA 1LDPL 1DANT 4PJ7B 3EYSH 5CEYA 3V0WL 4ONHB 4NHCL 5IQ9B 1FZKA 1Z5LB 5E2VL 5EIQA 1PG7H 3O11B 4MA8H 3HNVH 4NWTL 4YO0A 5DS8A 5HHXL 3OKKB 4ZFOA 4PYHA 5EA0H 1QRNB 1IKFL 1EO5A 3U1SL 4G8EB 3E0GA 2E6PA 2OBGA 1JZ4A 2ADFH 1NGQL 3U7YL 3KJ4C 3MACL 2ICCA 4IS6A 4AEFA 4F9PA 1FVDA 2CRZA 4PGBB 1X4YA 3GSNA 4WW2A 3QIBA 1DBBH 4QOKA 1F11B 2G60H 3VFSA 3D18A 5FM4A 1TZHA 1FHGA 4PRAB 4N5EC 4PG2C 1NCUA 2BVTA 1FO0L 4PLKC 4TVSa 3NAAL 1WK0A 3WXWL 1QRNA 4KKLC 4P2OA 3ZDZE 4JM2A 3RGVD 4MQ7A 1Q9KA 4WVRA 3U9PH 1RU9H 2Y5EA 3GMNA 2VLKE 4PUBL 3FT4B 4U1LA 3BP7A 4CU6A 1EEYB 4LEOB 1G6RA 1LDSA 4PG9A 1E27B 5HXMA 2JE8A 4EXPX 3SPVA 2QSCL 3HR6A 1P1ZA 2NQCA 5IFHH 2A6IA 2UZIL 4H20L 1SY6L 3U9UB 4NQDA 1I1RA 5ENWA 3FONA 4Y5YB 3W0WA 5FECB 4P2QE 4HH9B 2XQBH 4JB9H 2HRLA 2VXQH 3MRDA 4NC0B 5DK2A 5J11C 1MCWM 4F15C 4U6XB 3DRQB 1D5MA 1LEIB 3GSWA 3OBAA 3VXRB 2Y06H 2Y72A 3VGEA 5EO1A 4FQXC 3VI4E 4GG6B 4WFGE 4FQXA 1XGYL 1YEIH 2E7HA 2RHEA 2ZOLB 4EEEA 2V7NA 3VFWA 1IJ9A 1QLRB 4HIEB 4LIQE 4YHPA 1UQSB 5I1CL 2V7HB 1MNUL 5B8CA 2CSPA 4JFDD 5A3ID 2YA2A 4Z7VF 2VE6B 3EYQD 5F7UA 3QUXD 4HUKB 4M48H 4Y4FC 1WEJL 3QDGB 4HIJB 3G5YA 1S7SA 1UZ8A 2CD0A 4JFOB 2DMKA 3FQWB 1OTSD 5CD3B 3TVMD 1N7MH 4GG6A 3OKDB 1ZTXL 2W0LA 4M93B 5DYOB 3LMJL 3CX5K 2X4UB 4AG4H 2ZUXA 4NO5A 1IAIH 3C9NA 3ILPA 2NY0C 1DL7L 2P5EE 1IGFH 1H15B 3SGJC 4JKKA 3KJ4B 4WHTA 2YD4A 5I1JH 1T03H 1DQDL 3VXPB 5FGBA 4JY6B 4TTDC 1VPOL 3OKOB 4JO3L 5DWUL 1KIUA 2PXYA 2KKQA 3BEWA 2W9EL 1S9VB 4LSUH 1ZSDA 4XMKH 1AHWA 1UXWA 2Q76A 4JN2A 1KCRL 2K9UA 1MCOH 5EZJA 4D0CB 4WFFE 1GPOH 4QRUB 1IGYA 1WQVT 2AVGA 1BZ7A 4OCYH 1CDBA 1A3LL 5CEZD 2NY1C 4PGCA 3TN0D 3MBEC 3DYOA 4LDOB 1Z6JT 3MFFA 3O9WD 1NDGB 4KJWD 4HHAB 3VXPA 3VDBA 4RIRB 3MV9B 4X8JB 3EHBD 1II4E 5EBMB 3FO0H 2GJ6A 3CU1A 2YWZA 3OWEA 4G5ZL 2X70B 5SWZD 2IH3B 4WHYG 1T0NB 1LP9B 5JZ7D 1L0QA 1EZVX 4LHUD 1SM3L 2VH5L 3EGSA 5C1MB 3U82B 3W81A 5GS2D 4Q74A 1FGNL 5FDWB 4PJIE 5BJTB 5DMKA 1QSZA 1UJ3B 2IGFH 3C5ZD 3OKYA 3M1BB 1RUKL 5DFWH 5F7LB 5ISZD 3X13B 4PJHF 4PRBB 1S9YB 3HRPA 4RNRB 3IJSB 1AQKH 4U1JB 3QCVL 4WTXA 5I8KH 4LLDA 1OTTD 1FPTL 1RULL 1T20B 4CN1A 2JB5L 5TGBA 5EBMA 5F93C 3RWHA 4F7TA 2APBA 3ARDA 2YBRB 4FZEH 5C2BL 1LP9A 1X4ZA 2CRIA 2VXVH 1WT5A 1CZ8H 2FLBT 3VWJC 3T0ED 3E2HB 4XH2A 1JPST 5ISZA 5ID1B 4F57L 1NCCL 1SEBA 4ZAKC 1DEEB 1I8IB 4XVUC 4BK4A 1IGCL 4JDZB 4HWZB 2DM4A 3ZDZF 5FYKD 5ISZE 2Z93A 5MERA 4X98A 4P3DB 5DURB 3GM8A 2DQEH 3LZFH 2HT4C 2CXKA 4DTGH 1YQVL 3PJSA 5JW4M 1T0MA 5TJWK 5HHVH 3T1FA 2YD3A 4NRXA 1V7NH 1WAAE 1OGAE 3D3VE 1AGCA 3JTTA 5D72L 1OSPH 3DIFA 1EO7A 1W72L 3QZWB 4PJBF 4V2CB 5EWIL 2ICWJ 5BQ7B 4KJYB 1QVOB 4R3SB 2WBJB 4I77H 3NZHL 4X4YB 4C4KT 2QR0A 3T4YA 1JHLL 3NMEA 1D5IH 2R69L 5C0BD 4GRLC 3KLHC 4UB0L 1AD9B 2SEBB 5IW1B 2QQKH 3WFZA 3WDIA 5H2BA 3RWIA 2R2BB 2A1WL 2DQIL 2AJXH 2EXWC 5HVFB 2KBGA 3BD3A 3RZWA 5E6YA 3NCYP 1KCKA 3N06B 1AGBA 1MRDH 3KVQA 2JCCF 3D0LA 4RCAA 2D9CA 4QYOA 4PJ5B 3SO3B 3ARGB 5IWLA 3ZKMC 3A67L 4X6EA 2W91A 3MXWL 4S1RL 1CD9B 1MCDA 3WSQL 5L8KB 1V05A 5FYLE 1EMTL 5C0AD 1PLGL 3C60D 1I7ZA 4K3DH 4R90L 4OLUH 3GI9L 5I15H 5GHWH 2DICA 3IFLH 2ITDA 4P57A 2AABH 2A77L 5DJ2B 1KB5L 1RZKC 2BJML 4MB5A 5EUOB 3ZDXF 3D5OF 4PJDA 1NEUA 3C5JA 1FZKB 3UTPE 3MLZL 4X6CE 4Y4HD 2BXZA 3DSFL 1SQ2N 5DRWB 4EJ1C 3VXUD 2ERJC 2J6EL 4LCIL 4DGIL 4FQQA 1KLUA 4LCWA 4YIQB 5BRZA 3RNKA 3HZVA 2WV3A 3V4PH 5CEZH 3CFJB 2FZ3A 5EBGA 4PJGB 1T21A 3WIFB 1UB5A 4CW1B 5HDQL 3G5XB 3ECBB 5FOBB 1NFDF 2CGRH 4OLUL 4AQ1B 5C9JA 5I15L 5JDSB 2D3VA 4JVWA 2ICWB 3VXUB 3VFSB 3GNML 1S5HB 4LIQL 5C0FA 5AAWA 2I26N 4K71C 4P46D 1PD6A 3R8BB 2UUDK 3L3OB 4YC2B 2G5BA 4QHUB 5CD5D 5FXCH 1DUZB 4CMHB 2UWEF 2HJKB 4P2RA 3SGKA 2HVKA 5BV7C 5FYJL 2D4FA 5DMGC 5E7BA 1P7QD 5C0AA 3SKJH 3CVIL 1ZEAL 4LLUA 4U1IB 4XVSL 4C4KO 4K8RC 2OR7A 4MNHB 1CGSL 4CGTA 4PRIE 4LAQH 3DUUB 4D9QD 5EU4B 5TE7H 1Y6NR 5F9WC 5IEKB 4Y5XA 1LO3L 4Y4KB 5IM7A 3EOTL 2EDHA 1HXMA 1QNZH 4YE4H 1G84A 1GOFA 5CWSB 2NW2A 4P4RB 2DBJA 1QFUL 5I66A 3D6GA 2PR4H 5GSVA 5ICZB 5SWSB 1MCHA 5IUSA 5LXGH 3U0WL 5JUEL 1NFIB 5D72H 3DHJA 3STLA 3C5SA 5I16A 2HN7B 4Z7NE 1A9EB 4HQQH 1SJXA 1LVEA 2E8ZA 4HWBL 4EDWL 5IVOA 1KCUH 1WBZA 3QFDB 4Q6IA 3QZWG 3KYNA 3RY6C 3SE8H 1MWAH 5D93C 3RJQB 5HPMB 1NUFA 3OKLA 2FSEA 4I5BA 2M8XA 1RPQA 1N6VA 4OB5L 1KJ2H 4OKVA 3CUPB 1NLDH 1GGYA 1F2XK 2XKNB 4NWUL 4LP5A 1TZGL 1L7TH 1L0YA 5ESQA 5F1KC 5D1ZB 3VA6A 1MJ7H 2BNQB 4H1LB 4YK4C 4ONFH 4GH7B 2OJEB 5DURD 2H8PA 1U2HA 5I1LB 4D3CH 1EAPA 1NCWH 4N0UA 2WINA 2DQCL 5IK3B 2R29H 3MA7B 5J89A 4X6CB 4FXLA 1A5FH 5A16A 5E4EB 3QAZB 3RVXC 4HSQA 3VFUA 1KJ2B 1S9VA 2X4PB 3ZYZA 3CDYA 5HVWA 4IIQB 5TDNB 5GS0H 5K59F 5L88H 1X6NA 5J06A 5IVXF 3S35H 4HXBH 2GTWA 4H1LH 2EKSB 1GZQB 3IFNH 3GJEB 1R3LB 4JR9L 2DWEA 3AREA 1SVCP 5ITFB 1FL3B 3MLWH 3DV4B 5E08L 1EEYA 4K9EL 4ZODA 1MHCB 1K6QL 4X6DB 4DCQA 4MJ5A 5SX5H 4DKFL 3IETA 5HI5D 5T33L 5ESAA 2LVEA 5ALBH 1P4IL 1SVZA 2V2WB 4M4PA 5C08D 4J12A 1RUQL 5C0NC 4L8CB 4M3KB 2OMNA 1T7ZA 1R3KB 3LN5B 2V5RA 1AGFA 2Y6SC 2VDQH 5CKGA 3JVGA 5B4MD 4IBLT 3GSVB 4QTHA 4MHHG 3VXOB 5FCUH 2Z31C 4YHLH 15C8L 2FIKA 4U6TA 3LIZH 5CINL 3HAEB 5AYUL 2DWDA 4UDUA 5B38A 1MFAL 2OQJA 3EDEA 1RQ5A 5L2KE 2O61A 2WUBL 3PDDA 2IH3A 3KS0H 5EBLA 3X14A 3LH2H 4MD5B 3M45A 1LQSR 1ZT7A 4IMLA 4JFQB 3PIQB 1MFBH 2EDRA 3QUZC 2NY5H 3NN8A 4ISVA 2F5AL 5F70A 1HIML 2AXHA 1N0XH 2DLTA 3O41B 3LY6A 3S98A 4EXKA 5CD3A 3MV8A 3KDMB 1SEQH 4XPAH 3CMOL 1HEZB 4IRJC 5C0CE 3ULVD 4Q0XL 1TQCB 3KPRA 1KJ3H 2BSSA 4L3EA 3FQRA 1M7IA 3WHXB 3O0RL 5H35A 1SEBB 4M8QA 5HDOA 2P5WE 1A21A 1A47A 3EO9H 4O51B 5EFIB 3P4MA 2AEPL 2A77H 1I3RB 2R0KL 2PKDA 2NY6D 5IFHL 4X7TA 2ARJB 1AHWC 3STBA 1AKJA 4FFZL 2EE6A 3KAAA 4M1CD 1OLLA 2F74B 5E5MA 2Z8RA 5INCB 4YHYC 4WW2F 3LKNA 4L5FL 3BFOA 2Z91A 5FHBL 1TTFA 1M7IB 4XZUB 5DJ8B 3W0WE 4LARH 4G9FA 2Q6WA 3UPCA 1SHMA 2BSED 1ZK9A 3ZL4L 2AP2A 2NX5B 4JFZH 5HYIA 4DVBA 3K0WA 4QYOB 4GUPB 5I73C 1U8QA 2P45B 2PUQT 4YO0B 1EVTC 4K23H 4ODWA 1S3KL 3LEYH 1T1ZA 4Z7UE 1ZLWH 1X5AA 4C58B 1QUNA 3AXLB 4BSVA 5L8JB 3FAWA 2E6QA 3UJIL 2RIKA 3F5WA 1T1YA 3RWGB 5GRWA 2ZPKH 1FLRL 1MH5A 5DRXB 4XCYA 4GG8A 4NQEA 5C0EB 3JTSB 5IQ7H 3TBSB 3FT3B 1QFWH 1UG9A 4JFED 4XAWL 1P7KB 5IR1A 4N8CH 3S3JA 4KZDH 1BECA 3QEUB 1NCNA 1FO0B 5DHYB 4KI5D 1VKXB 5HHQB 5E99H 4C54A 3G6AA 1YQVH 3L1OL 4DKFH 2YD2A 1KCSL 4HKXB 1X9QA 1I9IH 5DRXA 5ACMA 3GSRA 1Q0YH 2Z31B 4NQSB 1NC4A 2VDKH 1HHGB 5EOTB 3ORJA 1E4WH 4BZ2L 3DXAA 4GW1B 5C0CD 1AH1A 4FQCH 2YZ1A 5GJSL 1Z5LA 4KJQC 4QRQB 2EE2A 4XAWH 3VXMD 1RULH 3AVEA 4JRYE 4LNRB 3STZB 2X4QB 1A4JA 4JRYB 2V2XB 2D7PA 1AKJD 4KKBC 5EIVA 3TZVC 1ITBB 4K3HA 5KVEL 4YFLF 3PABA 2DM7A 4IS6B 4JKMA 2OR9H 4OGZA 4ZPVA 5B8CB 4E5XA 2FBOJ 4HH8A 5IFJB 5EZLB 1D3CA 1E6OH 3ZE2F 1G7HA 3GRWH 4AEHL 1ADQA 3BP6B 2FJGB 2JK5B 3L7EB 3QBTB 4M02A 1AQDB 4JRYD 5IB4A 3TA3C 4O9HH 4U1MB 1MWAL 5HJ3A 2NXZC 3L5WB 4NQED 4NZRL 2P44B 4QOKD 7FABL 3CLEH 4NQUA 4LLUB 4MA3B 4AT6A 3JXAA 3S8WA 3MLVL 1AO7B 5TPWH 3HN3A 1WWBX 1OY3B 3HE6B 2V2TA 2JLLA 1I9RL 43C9B 1CXLA 1VPOH 3IYLW 3DRTB 2P4AB 4WU7A 1DEDA 1U36A 1WGOA 4UT9L 1U8LA 4YX2H 5IFAH 3ARQA 2VXTH 3RIAF 3HC4H 4NPYA 3ROOA 3ZE0F 4XBGB 5AWNL 2X7LA 4M1DL 3WLWD 5C92A 4XC3L 3D85A 1EFXA 1PFCA 1L7IL 3QJFA 4HIHB 3SE4A 1YUHA 3UJIH 1WICA 2H8PB 2FD6L 1YEGH 3IDGA 1T0PB 2AJZB 3TM6A 2DQHH 3PL6C 1NDGA 3WHE1 4NUGL 4PRID 3ECBA 5FOBA 1NC4D 1R3JA 1INEH 1F4HA 3QDMD 5J1TC 3UYRH 5F88A 4QRRA 5C0JA 1H3WM 5DK0A 5CJBA 5BXFA 1E28B 4P2YA 5F7DA 3Q5YA 5BW7C 4RFEB 4HUUA 3MRPA 1YUHB 3PV7A 1U9KA 1BIIB 4QWWC 1JK8A 2AJSL 4L5FH 4YAQB 4QHUA 2F19H 1PEZA 4CN4A 3ARWA 3FB7A 1EK3A 1W8NA 1MREH 2X4NA 2Z4QA 2CQVA 4I0PD 2I27N 4RGNE 5JW5A 1Q1JH 5KAQG 1I7RA 3JUZA 3SGEI 1RJLB 3I02A 1JPSL 2A9NH 3VXTA 5IHZA 1U8HB 2ZSVA 1NH6A 5B38G 1D9KC 1TTGA 4KY1H 3ZSTA 5A40E 1FZJB 4YDVB 2NPLX 5EOCH 3DECA 4IIQA 5TDNA 3DUUA 2B0SH 2EO1A 4ORGB 4BQ8A 5EUOE 1R5WA 1U3HA 3BISA 3GHBH 5GISH 2G9HA 4J4PC 3H42H 4G43A 1SEQL 1XGUB 4Z7UF 4J3XA 1VFAB 3AB0B 4X5XB 3O3EB 4NT6B 2D7TL 1JTOA 4Y19D 4AH2B 3LKOB 3RHWF 3NH7L 1RMFL 3F58L 1Z9MA 1LWRA 2F5AH 4P5TB 3KWWA 5D6CA 1F58H 5JLZB 3HZYB 12E8L 3GGWB 1KN2H 4AK1A 1I8KB 1LK3L 1CE1H 3SDXF 3O2WH 1S9WA 1G9ML 2R8SL 4K3GA 2FDBP 3H3KA 5HD8C 4HCRA 3OKLB 5F7EL 2NNAB 5E03A 1VFAA 3WUWA 1JNLL 2J8UE 4P5KB 3HPJA 5I6XC 4JEGB 1R24A 4ZYKB 5GS2H 5GGUA 5DJXB 4QTIL 3SO3C 3ARTA 1JF1A 4M3JA 1P9MA 5KSUB 1HQ4B 5C0BE 4ZUVB 4NQCA 2W9DL 4NIKB 1NGXA 1G9NH 1D6VH 4NJAL 1Q9LB 4Q9QL 4L3EB 3O4LB 4JRXE 4KMQA 5C09A 3T09A 2AKRB 2A9ML 1RUQH 1RZ7L 1FYHB 3OZ9L 1J0YA 3UTSB 1IRAY 1ZVSB 1CFNB 4GMTL 3RDTA 4HWBH 4EDWH 3OKNA 3MV8B 3MOBH 3LS4L 1Q72H 4DN3H 2D7QA 3BRFA 3VWJD 4BFEA 4Y1AB 3EYFA 3VRJB 4ENEC 1U8OA 2HFFB 4P5TD 1DLHA 4PJAF 3U0TB 1K4DB 1K5NA 4N8VA 2Y9RT 4PJFA 4W6XB 3LRGA 1MLBB 5IMMA 2GIYA 5C70A 1AJ7L 4NDMB 2XG4A 4NO2A 5F71A 1WZMA 1RZ8B 1A2YA 3UTQA 1CCZA 3PGDB 5DRNB 4KROC 3O3BA 2AXFB 1CGSH 4PRIA 1FDLL 4BKLB 5KSAB 4UV7H 2A9MH 4FZEL 5C2BH 5FV1L 1FE8L 4ZO9A 4RAHA 1T22B 4ZAKA 2X4TA 2YWYA 3QHZH 4KUZH 3OAUL 3MNWA 3GSQB 2ZG3A 1OAQL 3PWPE 3QNXB 3MCLL 3ET9F 1FNFA 1SJVA 4AL8H 5HI3C 1BHGA 3LD8B 1C12A 2VZOA 1NGPH 4ZO6A 1BLNB 2PW2B 2AEWA 1KTLB 2RGSA 3PWPA 3QA3B 2IALA 5IHUL 2NXYC 2BK8A 1NAKH 3EUUA 1X7QA 4NFDA 4TNWK 4KQ4L 5CIPA 1RZFL 4M43H 1PKQE 2GT9A 4JJHA 3V5DA 3H7LA 2XNAB 3DLQR 3O3DA 5I1DA 2CRYA 2OL3A 3LDBC 4OSUL 3AREC 3MRLA 4WI3A 4PJ7F 3WO4B 4M62H 3BE1H 2ZCKL 5HDLA 1SBSH 2BVQB 4UTAH 2Q1EA 1N0LA 3TT1L 2PETA 1C16B 3NTCL 1YEHH 2BHZA 1GC1C 3GSNH 5CEYB 3VMNA 3ZYJA 4TULL 4NZUH 4Z7VE 2C1OA 5M94B 1WITA 4L3CB 1I4FB 2X4OA 2ATKA 4HJGB 1NGZB 3KPSB 2ZUQC 3D48R 3C8KA 3OAUH 5I1EL 1BF2A 5FUZH 2MHAA 3MGAA 2LTQB 3ZHLA 1R3HB 1T80A 2NY1B 4JQIH 5FYJH 4DZBB 3HA0A 1FVEA 2FHCA 5KS9E 5HYEA 3RA7H 3DXAB 1DUYA 4GW1A 4Z7QF 2Z91B 3VXMA 4LLYA 2W9LA 4M6OL 3G6JE 3GSNB 3K8KA 1OL0A 2NR6C 2ICWA 2XN9D 1FP5A 5KBNC 5IVZA 3IFPB 3RWFB 4DZ8B 5JMRA 4RMUA 1PY9A 4ZDHA 4CVXA 4L1DA 4MAYB 4YLQT 1NFKA 1MNUH 3BO8A 1C7TA 3B2UD 3A6CH 4HC1H 2VXSH 4JQVC 1TIUA 1XCQB 3RKDC 4HUVA 4LVOC 5F7MC 5HYJB 3FO1B 1KGCE 4F7CA 4JFFB 4N0YL 2EXYD 4Y2DA 1V7ML 3L7EA 2XZAL 4TPRL 5T1KB 3WCYA 4WU5B 2AJYL 4X4MA 1M7XA 4NFBA 4WI7A 2XFXB 4NYLB 5I1AA 3O3AB 2OTWA 1W72H 4JAMB 2ZOKB 4N5ED 2GTWB 3V0AC 4PJ5E 2ZNXA 5FKAA 1PAMA 2X6MA 4J8RB 4JM4L 5I66B 3TIDB 3TWCL 5J6GB 5K9OA 3O45B 3CFDB 4KTDL 1D5MB 1LEIA 1OQOA 3MJ7B 2P46B 1YN7B 2R9HC 1FL5B 5LAXB 4RQQA 3N50A 1CDHA 1A4KB 1G7IA 3EYOA 4I3GA 3TJHC 4PRPD 1PKQB 1R3KA 3QR2A 5DQDL 4Z7OF 4LPVA 5DO2D 5MEQB 3O6LL 5C08E 4OFYA 3NCEB 2ENSA 3V4UH 1FZMA 5HGBB 2XI9A 1DQJA 1A7NL 1DDHB 3ZKXB 3W2DH 4JFEB 3U83A 1PX3A 2GFBB 2ICWI 3REVB 3T2NH 2X42A 3HG1D 4FQ1L 1A7RH 1IGYB 1FGNH 1N8ZA 5F1IA 1BEYL 2ZNWA 4PS4H 2IQAA 4M7LH 4Z7UA 5C71A 4IOIB 3WS3B 4IEFB 1JHKH 1QFOA 2RFXB 3T2PA 4L3ED 4MA8L 4HS8H 4ODSL 5T3ZL 3OXRA 3QT2A 1ZVHA 3HAEG 3P0GB 3OAYH 2W60A 4AM0A 4AJ0A 4RGOL 4KUCF 4E42B 2R1YA 1Q0YL 3S5LA 3FZUC