1N5AB

Crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title A Structural Basis for LCMV Immune Evasion. Subversion of H-2D(b) and H-2K(b) Presentation of gp33 Revealed by Comparative Crystal Structure Analyses.
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 98
sequence length 98
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n5aB00
3DX7B 1EFXD 1MELA 5TDNA 2V7NB 5DK0B 4A6YL 4LLDB 2EDNA 4M5YH 2NCMA 1LEGA 1G9MH 4GRMA 5I66A 1CE1L 4K9EH 5F7DB 4EDWL 5LAXB 3HMXA 4M03A 1H9VA 4Z7VE 1R24B 2A9MH 5J8OA 4DVBA 4DOHE 4NKMA 4X9BA 5IOPA 2CDGB 1HNGA 3K74B 1WEJL 4NO3A 4WFHE 4R97C 5GGSY 1F6FB 3ZE0F 2VC2H 5H2BA 4JRXB 3RWDA 4FMFA 1IC7H 4NKMB 5FUZH 4NHCL 3MRCA 2MCPL 5JUEH 5H2BB 3QFJB 1E4WH 2VRAA 4KH2A 4DN3L 4OKDA 3ZT6A 5A2JH 4WNQA 5HY9A 4D2NA 1XZ0B 3QDME 4RCAA 3QWOA 4HC1L 2EO1A 1J1OH 4ZUWA 3GIVA 3TBWA 2P8MA 3Q48A 1LDPL 1J05A 5HY9B 3F7QA 5E7FA 5FYKE 2H2SD 2XWTB 2FHBA 5SV3A 3H0TA 1ZA6A 3L5IA 2FX8L 4ZUWB 3KPTA 1HOCA 3GIVB 3TBWB 1K8DB 5TDPA 2P8MB 3F12B 1JI1A 2FEEL 4HKBA 5GGSA 2YD5A 5GS0L 2VO5A 1J05B 5F6IC 1DFBH 3EZJB 5JDJA 1IEHA 1T4KA 1WAAF 3K4ZA 3PGDB 4IMLA 3S34H 3S98A 4CN1A 2ADFH 1K85A 3CZFA 2XYCA 1ZA6B 2A6DA 3INUH 1HOCB 2E7BA 4HKBB 3GSRA 5GGSB 2EIDA 2RAMA 2YPLD 1IGCL 3HNTH 1H8NA 3UMTA 3CZFB 5EU3A 2A6DB 4WHYH 1D5IL 4Y2DB 4P9HH 5EU6A 2MQ0A 1FL5A 4GKOA 1A7RL 3O6KH 4EQ2A 6FABH 4NNXA 3CJJA 5EU3B 1QR1A 4R2GD 5L0QC 1QA9A 2NX5A 2DQEL 4XNMA 4KKBC 3G6DL 2AEPL 2YPVL 4CU6A 1CFNA 3R1GL 3G6JA 5F9OL 1HNFA 1OF2A 4Y19A 3PNWA 3NIFE 4D9LL 3FQWA 5D2NC 2V2XA 1QA9B 4XNMB 3BGMA 1Q1JH 1KOAA 3DROA 1NDGA 2W60B 3T2OA 2F74A 2IG2L 1CFNB 1OSPL 2J2ZA 3GIZH 1OF2B 4JFXB 4H88L 3PNWB 5L8JB 2V2XB 1HH9B 3MYZA 3BGMB 4LPYA 4UI2A 3C5SB 1YECH 3RZWA 4O5LL 1RAMA 2F74B 1PLGH 2WWKT 4K7PL 4JFPB 4WFFE 3MLYL 5I30H 4G42A 1I7ZB 4C59B 3MODL 4PRDA 1MFAL 2XWBA 2GYSA 1NJ9A 1CLOL 4HW6A 3VJ6A 3D85A 3TPUA 4D0BA 2DQFA 3D3VE 4U3XA 3O4LA 3RPIA 2OCFD 2W9DH 4N0FA 1HYSC 2XWBB 2DQDL 3CU1A 1BMGA 1F3DH 1IZKA 2NY2C 2DBLL 3D85B 3TPUB 4PJCE 3D39B 4D0BB 1XGYL 2DQFB 5FOBB 4ISVA 2F19H 4MQXD 5E9DE 3O4LB 3GFUA 3QEQB 2ZOLA 4IDJL 2BDNH 5ICXA 3RPIB 1C5DA 3QCVL 1ZLSH 3TBVB 3KXFB 1CF8H 3RKDC 1U8IA 3AVEA 4NUJB 2E7HA 2F5BH 4IOIA 4U1LB 1QRNE 4ISVB 4P2QA 4HWEH 4OLXH 3EFFA 1C5DB 5ADPH 5DC9B 2XNAB 2PCPB 4KGJA 4LSTL 4XAWL 3NMEA 1GAFL 4GAYB 4HKXB 1AHWC 4P5TD 4P2QB 3VRLF 1JHKH 1IM3B 5TE7H 4N0CD 1R0AL 5GJTH 3WJJC 1EJOH 3CFEA 4POUB 4IRSC 3OG6B 3VRJA 5EO1A 3TA3D 4A2MA 4BSJA 3WNNA 43CAA 2R29H 5DFVD 1NUFA 1WCBA 1KCRL 4Y4FC 2MMXA 5TGBA 5GGQL 4D9QD 3CFEB 3KHQA 3WJLA 5EO1B 5CZXD 43CAB 3RTQB 5FYJH 3JV5A 1P9MC 4HX1A 1WCBB 1P1ZB 2FYYA 2XZAL 4U3CA 1F11A 3TCXA 5D6DA 3U79A 3R0MA 4L1HA 3HUJA 1A5FH 4AL8H 3H42H 1FE8H 1KFAH 1WSST 3WE6A 3BIBX 2VLME 2AK4D 3MRKA 1CL7L 3VRIB 2QSVA 2VDQH 4TUOA 3B2UD 2I60H 4OM1L 5I1CL 1F11B 4NWUH 1IGTA 1WC7A 1JGUH 3HUJB 4ODHL 1ZHBA 1I8KB 2VDRH 4HMCA 3V5DA 3WE6B 3KPRE 4NKQB 2KQNA 1SEBB 2BY0A 3MRKB 1FVCA 4HS6B 1X4YA 1FNGB 1RULH 1WC7B 2GAZA 3DRQA 4HUKB 4KTEL 1S9WA 4JR9L 1DBBL 3JZ7A 2CO7B 1FVCB 2NXZC 3CLFH 4MS8C 4OUUA 2MQCA 2IFFL 2OR7A 2GAZB 1IL1A 1MFBH 3T0DA 1BIIA 4RGND 1HI6A 1X5AA 3JUZA 4ZFFA 5E99L 1T1YB 1HWGB 1S9WB 3HCVA 4FRWA 5EUOF 2AQ2A 3DYPA 4H20H 4AEIH 3QUXD 2F9BT 4PLKC 3L7EA 3G08A 4POYA 4NN7C 3ZDYF 1K5NB 1BIIB 5T1MA 4LSSH 4YK4B 1AXIB 1MOEA 3AMKA 4DAGL 4ZFFB 5FYKH 5CSGA 3QDJD 5DRZA 4GS7C 3L7EB 2H6PB 3G08B 4JN1H 5HVFB 4KZDL 4LSVL 1CVRA 1QLRB 3UJTH 5T1KA 4P4KA 5ANMB 4HWZA 4U05A 1A7OL 1BEYL 3QR2A 2VDPH 2JB6A 5DRZB 3WFZA 4JZJC 1WBXA 1AJ7H 1CFBA 1NLDH 1A02N 3HMWL 4G8GE 4K3GA 4PTUA 2QQNH 5KTEL 3LDBC 4P4KB 1BLNA 1N8ZA 1YEGL 1Q9KA 3BMVA 3IU3B 4HWZB 1F2QA 5C0AE 3RVUC 2JB6B 2CXGA 4V1DD 1I1CA 3WLWD 4IDLA 3DXAA 3ZE2F 4PRID 1MCSA 1C1EH 4PTUB 3KPSB 2Q3AA 1GPOH 1N8ZB 3VXUD 4LEXL 4PJIA 4OZIA 1T5WA 2IWGA 3QFDA 4OUOA 1L6ZA 4W68A 1BQHA 3QNXA 3MOAL 3HAEG 3L1OH 5D5ME 3UBXA 4PRPA 2FEDD 2F54D 4MAYD 1T5WB 4BH7B 5BOPA 2FGWL 5HHPB 1U2CA 2FATL 4F2MA 2M2DA 2DQIL 1H3PH 3HE6C 3WHXA 3UBXB 5CAYB 1AGFB 4FFVC 3W9EA 3WS3A 2Z31C 4F2MB 3UAJC 4QO1A 2X2YA 5BJTA 4RRPA 2XZCH 3WHXB 1ZMYA 5C0CE 1VPOH 4F7MB 4GXVL 3W9EB 3IKKA 1FNSH 4WTWA 3SE9H 3WS3B 3BVNA 3FONB 4PJHF 4HIXH 5KG9A 5HDOA 5BJTB 2A77H 1Z9MA 2OZ4A 3S9DB 4RAUA 1YDPA 4BFEA 4LLWA 4QTIL 1UH3A 5C09B 1JPTH 4ZFOL 3CX2A 1MWAH 2ZG2A 5BQ7A 5KG9B 5HYQA 4YLQT 4DEPB 4RAUB 1YDPB 4U0QB 5FGBC 3WNPA 2H8PB 2Y25A 1X5YA 3L3HB 3NA9H 3C60A 3OF6D 4S1SL 5C0JA 1TZIB 4ZFGL 3T3PE 1W0WA 4XNQB 1T2XA 3VGAB 1F6AB 3NIGF 1T2QH 4ZNCD 4S1DD 3U46A 4C56E 2IBGA 3GRWA 4J3VA 1JNLL 4KPHL 2HJFA 5GS1C 5FFLA 5HHNA 5C0JB 3T0XA 4PJBF 1S7SA 3LPGA 3RA7L 4EIZC 2CR3A 4M48H 2P44B 2DYPA 4PS4H 1J12A 3RUGB 3U46B 2VDMH 4CVWA 3MBEC 2Q1EA 4JRXD 2XT1B 4GMSL 4ZNEA 3B2VH 1DVFA 4X6DF 5J1AA 2HJFB 5DEZA 1IAOA 1BREA 5LCVH 1GXEA 4XC3L 2BNQA 5EO0A 1L0XA 1LVEA 2RBLA 3QFJD 1WT5C 1DVFB 2VSDA 1A3RH 5J1AB 4DKEL 4FTVB 4B50A 4Q9RH 1BBDL 4N9GA 5T1DH 2BNQB 3BSZL 3O3UN 1IT9H 1XFPA 4LEOB 5EO0B 4NZDA 1HYSD 3GI8L 5FKAA 3GBML 2NY2D 3IJSA 5D8JH 2J88L 1OAKL 1OP3K 4N9GB 3L3KA 1FC2D 4FNLL 1AO7A 3O2WH 1RIUH 3VWKD 5FKAB 1WWWX 5C0BA 3SDDA 2DDQL 3P9MA 3QPQC 4OZHB 1CBVL 2V5YA 1A14L 4JFFE 2B1AL 3LSOA 5CP3A 3KS0J 3L3KB 1AO7B 2NY3C 4PJXE 2W38A 5EWIH 5C0BB 3TZVC 3SDDB 5CUSH 3P9MB 5HGDA 5MI0B 2XKSA 5KAQG 3ECBA 2DD8L 4YHMH 3RIFK 4Y2DD 1D6VH 4XNYH 3GJFH 4NKOA 4NC0B 5E5MA 5HGDB 1P4LA 4NZTL 3W0WE 4LGRB 1JWUB 4RMUA 5DRNA 4XVUD 2FHFA 4GAFB 4BM7A 1NLBH 5IFHL 2DLGA 1MHHA 4NKOB 5E2VL 2UVEA 2ZSVA 3FHAA 3QCUL 4HMEA 3C5JB 1IGFH 5JXED 3REVA 1E6JH 3B9KB 5SWSE 1NPUA 3MV8E 3TO4C 1MHHB 4QHUA 2E8YA 2QEJA 2WUBH 4HLJA 4G8IA 4YDLC 1MCKA 4M6ML 4PJ9C 3HG1E 2D31A 4ZOBA 1DQLL 1A2YA 4EIGB 3LS4L 4ODUA 4DZBB 2HMIC 4TTDC 4QHUB 1C08B 1NBVL 3DTXA 5ETUB 4MXWH 2OMNA 3HRPA 3AXLA 2A0LC 4M02A 2XPGA 4ODUB 3PF2A 3WIFA 5DQDL 2EXWC 5B39B 2WIMA 4XX1E 5ESAA 3ARYA 1GGIH 4UB0H 1FAKT 3MRIA 3PV6A 1SBBA 3P77A 3AXLB 1PKQA 1RZJH 1LO5B 1YNTA 4LSRL 4RGOL 5B4MC 4MS8D 2PXYA 2OL3L 4Z8FL 2XPGB 3D39D 2IGFH 3OAUH 3QEQD 3KPLA 2GIYA 1FSKC 2XACC 5ESAB 4ZXBB 1U8QB 3KXFD 3MRIB 3C08L 3P77B 4I0KA 4PLKD 1ZANH 2PXYB 2D7TL 4X6CB 2DJ4A 5J89A 3M07A 2KZWA 3KPLB 1BGXH 3QT2A 1CLZH 2PO6A 5SX5H 1OVZA 3MA9H 5ISZA 3IFNL 1EBAA 3BRFA 1G9NC 3WEXB 4L8CA 4JKMA 3V6BR 3C09B 1N26A 3WL9A 5DVMA 5FECA 2NQCA 3OKMB 3CGTA 1EJ6A 1HE7A 3KWWB 5HHOD 5FDWA 4JHBA 4X4XA 3CZJA 5ISZB 1YEJL 1CDGA 4CVXA 1UJ3C 3WFCL 1YEHL 3UTPE 4O4YL 3EZ8A 2VUOA 5HJ3B 4FG6C 3WL9B 3L5XH 1XIWC 3JVGA 4G6ML 4MJIA 5GIRB 4W70A 1EHLH 4X4XB 3U0TB 1ND0B 4QRRD 4JJHA 4HQQL 5KOMC 1Y6NR 3PDGA 4Z76A 2F5AL 4G6AD 3RTQD 1CD8A 1ZTXH 2HTLC 4MDJB 4YDKH 4WCYH 1T1ZA 2FO4A 2JJTA 2YN3A 1V3MA 1AXSA 4ODTH 5HVGB 5GS2H 4RQQB 3H9HA 3QG7H 2HRLA 2QQLL 3TC9A 2XG4A 1FCGA 4MHHG 4ZO6A 4UIMA 5IP4A 2CRYA 3V6OE 1T1ZB 1WFUA 3ELAT 2GEEA 1JRHL 3HE7A 1AXSB 1K9TA 2J7LA 3TEUA 2YZ1A 3O45B 2F53A 3H9HB 3SDAC 4WI3A 5IB1A 5DYOB 3RY5A 2MPAL 2ZUUA 1U8NA 3QQ9C 3JV0A 4UIMB 3A6BH 5EZJA 4ZUSB 1JYWA 5E0QA 5HYIA 3MLWH 3NTCH 3HE7B 4DZ8A 2F53B 2Z31D 1FYTD 5KJRH 1F3JB 1CDYA 4UT9H 3O0RL 3BZDA 3VWJC 1JNNH 4NN5C 2IANA 1T2JA 1CT8A 1Q9LA 4M6AA 5LGHH 4PV9B 4P5KB 2MKLC 4NYLB 1DANU 3W2DH 4DZ8B 2HKFL 2V5RA 3QIBD 4F15C 4WENB 4JFQB 3VD9A 3AREA 2IANB 1CT8B 1P2CA 2DAVA 1C5BL 4UT7L 3SKNA 2OK0L 3MLSH 2PTUA 3GHEH 1MFEH 5F1NA 1TNNA 3ALXA 1ZLWK 1MIEH 2I9TA 2P8PA 5IB4A 3ZYZA 1J10A 3C8HA 3O6LL 2DQUH 4QXUL 4BFIA 3Q6GH 4PJ8A 1YEEL 4Z7VA 4KTDL 2E6PA 2P8PB 5IB4B 4MYWB 5IMKA 2VDKL 2GK2A 4Z95L 1RUPH 1I9IL 3O4OB 4XPHL 1OM3H 4FQXC 5EUKA 2Z4QB 4PJ8B 2YMXH 3B4NA 1JWMA 3X13A 4DOHB 3P30H 3LKRA 4GW1B 5IMKB 1KJVB 1NCCL 4XWGL 1YNLL 1CE6B 5EUKB 1P5VA 3KPSD 4I18C 1JWMB 3SDCA 5D1QB 1XGRA 4LL9A 1A7NH 2R8SL 4LSUH 3WCYA 4Q6IA 3QDMA 3UDWC 1C5CL 3ARDB 3FQUA 3VFOB 2C26A 4DGYL 4K2UL 4OGAC 1FNEA 1ZAGA 4WFGE 4Q6IB 3QDMB 3UJIL 4UBDC 2HLAA 3WXWL 3FQUB 5CIPA 2OSLA 1V7ML 5GGTH 1FNHA 4XCFH 1FNEB 4X9GA 2B1HL 2YD4A 3P11L 1OCWL 1AD0A 2HVKA 2VZUA 1CQKA 1KTKE 1IFHL 5DHVH 5TDOB 5T33L 5CIPB 5GJSH 2VXTL 4OZFA 4Z0BH 1OLZA 4NCC1 2R2EB 2KZ1B 3VFUA 1QFHA 1AD0B 3S6CA 3KR3L 4JREC 1J87A 4NQSA 3D87B 3EFDL 2VZSA 2QBWA 3UYOD 5C6WH 4O51A 4YHOH 1R3HA 4OZFB 3S37L 2DRUA 4YBQC 4LU5H 3DO3A 2EEDA 3TCLA 5CILL 3KYKH 5C09D 2ZKHH 4OLUH 1BZQK 2BVQA 4XMLH 1R3HB 4XNZB 2DQJH 3LKQA 4JQIL 5T5NF 2IAMC 3VXOA 2APTA 3WMSA 4HJGA 3TCLB 4OFDA 2P1YA 3V0AC 1A4JA 2CIKA 4X4ZA 4MJ6A 3F8UB 4WEBL 3GSNB 3LKQB 5F1IA 2LFGA 1HSBA 4YQXH 2WIIA 4OCXL 3HNSL 3VA6A 5GRUL 5DUPH 5I1DA 4HDIB 5C2BL 3JXAA 1BQLH 1A4JB 4YR6B 5JDSA 1G7LA 1JPFB 1TPXB 5F1IB 2RFXA 3RY6A 1I85C 5K9JH 4UNVA 2AV7A 3MV7E 5I1DB 2BJML 4MB3A 4ELMF 4TTDD 2HMID 2WLZA 3D3VA 4G9FB 5IQ9A 2A9NH 5EORL 2R2BB 2A0LD 3WXVH 2AV7B 3QDHA 4KTYA 1DVFD 2YUXA 1MWAA 4PJCA 1Y6KR 1I1AA 3D3VB 5E9DA 4FTVD 5AYUH 3THML 5IQ9B 3BPLC 5J11C 4PV8A 1UZ6E 1N6UA 2X40A 1MJ7L 1Q94A 1X7QB 2KH2B 4H8WC 2ZCHL 2YSSB 1QRNA 1YY9D 1I1AB 3CC5A 5E9DB 3UPCA 4RWYH 3TYGH 4AYFA 3OKLA 1JFQH 3CVHL 2BC4A 2DQCL 4M6NL 1Y0LB 1Q94B 4CVUA 1QLEL 4GT7A 5E8PA 2EDLA 1KXVC 3ILPA 1KCKA 4KHXH 3CC5B 1UH4A 4GRLB 1H15B 3OKLB 5CJBA 2AJXL 3QUZC 3J7HA 4I77L 1GC1H 2F8VA 4M9PA 1I3RA 5EBLA 2JJUA 1KIPA 4MCYB 1ZOXA 5E8PB 4AG4L 5I16A 3V79C 3MUGB 5IVXF 3OKDB 3MRDB 2WBJC 2HFTA 4KJQD 1WICA 1WGOA 4AM0A 4Z7UE 2IALA 1I3RB 4N90E 5EBLB 1KIPB 1QFWH 4YUEH 3RVXD 5L88H 4L8SA 3O2VH 3AU1B 3G5VA 5I16B 4NP4H 4NZUL 2CDEA 5IWLC 1GHFH 4BKLA 5KSAA 3PGFH 1NMBL 4HS3A 3TN0C 2F8OA 3EYVA 2O5ZH 3SPVB 4G5ZL 2CDEB 1U6AH 4BKLB 3B9KD 1LO0H 3UTTE 3ARFC 5D72L 4LPUA 4L9LC 4XPFL 5I73C 3NPSB 3EYVB 1VGKB 4P49A 3TBSA 3VFSA 4X5WB 3KPRA 3C6LC 3T0VA 1X6LA 3KJ6H 2EIEA 2FRGP 1G6RH 3ETBF 2YD1A 4UUJA 3BKJH 5HI4D 1M71A 2ADGA 3CD4A 3O81A 1NAMH 3WFHA 3VFSB 3S8WA 2M1KA 3FZUD 5L2JA 1KEML 5I8KH 2ADGB 4M7JL 2IMMA 3CAFA 4OQTH 3IS1X 1PAMA 3VI3F 3LZFL 4GSDL 5L2JB 5GHWH 4E0RB 1NC4A 3RUGF 4CL7A 1PG7W 3ULVE 4NOFA 4P3CH 4JRYD 1UB6A 5FHAL 3Q5TA 5E2TL 3RWFA 5KSVB 1HIML 2AK1H 4ZXBD 3GGWB 3SO5A 5FCUH 5IB5B 2CQVA 2XA8H 1XR9A 5I18H 4KKAD 1UB6B 3V5HA 3ZKMD 5L8KB 1WQVT 3RWFB 3S35H 4R0LB 3MUHL 2GTZA 5KANG 4AT6A 3V5HB 5EIVA 1FJ1B 4XPAH 5KN5A 4P3DB 4G8GA 1KB5L 4S0SD 1P6AB 2HFEB 5F3HA 2GTZB 4YNYA 1CGSH 5C0AA 4AT6B 3I50H 5LGJA 4YC2C 1IC5H 3PL6A 5KN5B 2EDXA 4G8GB 4OZHF 3MXWH 4Z7WE 1ODAA 2DTML 3HAEH 4U3HA 4YNYB 3QBTB 4Q0XL 3GO1L 3MJ6A 4OTXH 5LGJB 2UZXB 3PL6B 2FL5A 2O5XL 2C7UB 1KENH 5TPWL 4NPYA 5D5MA 5HDBF 5FUOL 2XTJE 4GG6E 4OCNC 5K9OA 4DJMA 3Q6FA 2R69L 4CMMB 3N1FC 4ZPTA 3K1KC 3GK8L 4PRAA 1B4RA 4OIBA 3LEVL 2IH3A 5I1KL 4NPYB 1AR2A 1U3HC 5I15H 3I9GH 4WO4D 3TH4T 4LOUC 2FR4A 3Q6FB 4P46C 1UM5H 1YQVL 4F7EA 1CU4H 4WWKB 4ZPTB 3TT3L 1G0XA 4R4NC 5F93C 2IH3B 4FFYL 5CEZH 1RI8A 2EO9A 5C0CA 3Q5OA 3QDGE 4M93C 2FR4B 4ENED 1J0JA 4F7EB 1WJ3A 1CXKA 1FO0L 4RISH 1KJ2H 2E27H 2BSRA 3ARTA 3EDKA 4BZ2L 2VDLH 2DLFL 5E1AB 3MACH 2XZQL 5ACLA 5C0CB 2NY5C 3FO0H 1MJUH 1X6NA 3LKSA 4HPOH 3LB6C 5IFAH 3EDJA 1SM3L 4YBQD 3SE4A 3E2HB 1CGXA 1IGMH 1RK1A 1U8JA 2BNUA 3LKSB 5IROA 1MEXH 1MUJA 2D0HA 1FH5L 2CH8A 2R4RH 4TSBH 4EBQH 5JR1L 5LG1A 2XN9D 2FBJL 3QHFH 4MA7L 4PG2A 3D69A 5FO7A 1DQJB 2BNUB 1FLRH 1U8JB 5D96B 4C56A 1YNKH 2ESVE 2YEZA 3BEVB 2I5YL 5HYSA 2C3HA 3O3EA 3U83A 5HI3C 1NBZB 1NEZG 4OGYH 3FRUA 5AZEL 5FO7B 1EEYB 4OB5H 2YEZB 4JPIB 3F7PC 3SKMA 1YN7A 3HI5H 4FQQA 5HYSB 3O3EB 1GZQB 1T7ZA 4MNQB 1MFCL 1YYLH 2EYRB 1UM6L 5HI5D 4WFED 6CGTA 1RHFA 5D2LF 3WO4C 4LLUA 3FRUB 3IXAA 1UZ8A 1OAYH 4NHUA 1HKFA 5GGRB 5H94A 2E9BA 4HS8L 4PJFE 4WI2A 2X1QA 3SKMB 5D1QD 4FQQB 5KSBE 1RZ7H 1LK3L 1S7TA 4OZ4B 1S7VA 4J6RH 3I6GA 5IBUB 4LLUB 2RB8A 3C2SA 5HSFA 3RQ3A 1UZ8B 4NHUB 3ARDD 4K71C 2NY6B 3T1FB 5IHZB 5DD6A 1OTSC 2G5RA 1NKOA 1UWXK 1S7TB 4KJPC 1S7VB 3I6GB 4Q9QL 1DLHB 3WFEH 3SKJH 3GI9L 2NMSA 3NFPA 3SDXF 2IH1A 3HZMA 4QRPB 3RWGA 3SGEH 4DK3A 3L3JA 5DD6B 4JFFA 1PQZA 1Z0MA 4JFEE 4FQHB 3NFPB 3MRHA 4PJXA 2BSTA 3HR6A 3RWGB 3LMJL 1KIQA 1MHCA 3U1SL 3L3JB 5F89A 5DZOA 4JFFB 3SY0A 1S9KC 1C16A 2X1PA 3MCLL 4G3YL 5JZ7D 1PQZB 3BYYA 1GCFA 3DSFH 3KYMA 3QUZD 4DGVH 4M3JA 3CSPA 3MRHB 4PJXB 2BSTB 3ZZ1A 4JQXC 5IEKA 1EAPB 1FGNL 3GSWA 4OLYL 1MHCB 1YEFL 4EXPX 5IMLA 2DKSA 3SY0B 1C16B 3BESR 3BQUB 3TNNA 1KJ3L 2X1WL 3KYMB 2HKHH 1N3NA 1UXSA 3W0WA 3IDIB 1GGUA 5BV7B 4KVCL 5LQBH 4R4FH 4F57H 5DRXA 5IEKB 5B21A 3MOBH 3UPRA 4Y1AB 2NLJB 5IMLB 2NY1B 5ABDE 4YHKL 4P5MA 3TNNB 3FQXA 2FCBA 1U8LA 1N3NB 3W0WB 1N5YL 3VXRE 2VDNH 5SWSA 3DVNB 3MV8A 2JIXA 5DRXB 1OP9A 3GJFK 1MLBB 2R0LL 4MXQC 4LLYB 3WIIH 1MCPL 4EI6B 3U7WL 3ZE1F 4P5MB 3WDIA 3FQXB 1OD9A 1U8LB 5FAAA 3HG1A 4I9WD 4YHLH 4RBPK 2IADA 4C83B 5FM4A 5SWSB 3OKKB 3MV8B 2JIXB 4JY6B 4KAQL 1D6EA 3NFSL 1IAIM 4QYOA 2ITDA 3NACL 1VCAA 4Y16A 3E0GA 1T04B 2VLLA 4RDQF 3BJLA 2C3VA 4G9FD 4QYOB 1YUHA 1PD6A 3I3EA 1UT9A 4IOFC 4LQFH 3FQNA 4MZ3A 3VGEA 3ZKXB 3RGHA 5I8EB 4Y16B 5SWQA 2WBWB 1MI5D 2VLLB 2R0KH 4X0KA 3D48R 5INDA 5FO8A 4HAGA 2WWMD 1NCAL 1MCWM 1YUHB 1U9KA 3OXRA 3EOTL 3FQNB 4P2OD 5SWQB 4C54A 3U7YL 3SCMA 4NWTL 3QIWB 2DI8A 1R3IL 4X0KB 1CDIA 1MCNA 4UIKH 4QHNB 1T03L 3P4MA 4HIEA 1M7DB 3OXRB 3U9UA 5I1AB 1I9JH 3HNVL 4ZODA 5DJZA 3MJGX 2KL6A 2IJ0C 3LEXA 1CLYH 1B0WA 1T89A 4WEMB 1JWSB 4UV4H 5I19L 4HIEB 1URLA 4GRLD 1OB1A 5J06A 4ZUVA 3T4AB 3LEXB 2CUMA 2UV3A 3DV6B 3U82B 2V2TA 4JAMA 1A21A 2ZWLT 3WN5A 4ZUVB 3LEYH 3RVTC 1TZHA 4CN6A 5ID0A 3CVIL 4AIXA 4UT6L 4JAMB 1ZHKA 5HGHA 5KW9H 5D1XC 4Z7NF 4I0PB 1TZHB 5ID0B 1X9QA 1OGAD 4YBLC 2DQGH 5DMIH 1ZHKB 4ORGA 1Q0YL 1BZ9B 1MY7A 1OLLA 5HGHB 5I17A 1B3JA 4IMKC 1DSFL 4XVJL 3V6OA 2EE6A 3ARGD 4KQ4L 1PYWA 2I27N 3HB3C 4XP4L 1DBAH 5T3XD 2WINA 1Q9WA 4JHWL 1G9EA 4I1NB 5JHLH 5I17B 2OM5A 2AJ3A 4M5ZH 1H3WM 5FV1L 3LCYA 2EDOA 3SJVE 3QUKA 4J3OC 3BMWA 3LS5L 1PYWB 1IKFL 2WINB 1B0GB 3TLRA 4O00A 2VLJB 1S7WA 3FN0L 3QUKB 3A6OA 2AABL 3N1QC 4XP6L 1LILA 3X17A 4XPGH 1HKLL 4OT1L 4NJ9L 1UXWA 4CJ1A 4K3JL 9CGTA 3DNKA 2IQ9L 3C2AH 4N8CH 4EJ1C 1WZLA 1WCQA 2ZG1A 1L4IA 3EGSB 3LB6D 2VXSH 1UXWB 2H9GA 1XGTA 4JJ5B 5IQ7H 1CD1B 2J8UF 1JGLL 2FIRT 2VLRD 2FLBT 1KG0A 3BN9D 4LCYB 2V9QA 3MJ9L 2MQ3A 5CGYC 4OM0H 5K33A 1T3FA 2H9GB 3I2CL 3RGVC 3B9EA 1XGTB 1MCJA 2R2CA 3O2DA 2R0WH 4WV1A 5DC0A 1AGCA 3BKCH 2FX7H 1KG0B 3DUUA 3S3SA 5FUCC 4BQCA 3OB0H 4C4KT 1T3FB 5DK3A 3ROLA 3NCCB 3F7RA 4WV1B 1ITCA 2D2OA 3RWIA 1AGCB 1GGCH 2JJVA 1BVZA 3DETC 3TIEA 4YPJA 4OQTA 3T2NH 1QSEE 3D0LA 3ROLB 3OKEA 1KJMA 4G6JH 3T3ME 3RAJL 1DL7H 2X89D 5F96L 1O0VA 3RWIB 2ICEB 1MRFL 5I9QB 2UYLA 3TIEB 2Z8SA 5BOZG 3MPCA 3WJLC 3IT8D 3D0LB 4LCCA 2X4QA 4FQ2H 1KJMB 4FQJL 4CDGC 4JDTL 2UYLB 1EIBA 3AS0A 4QOKB 1QUNA 4MAUL 3U9PH 4LHUG 4GAJL 2HLFC 4KJPD 1FZKA 4BK4A 4GAGH 2HT3D 3D6GA 4PRNA 4LCCB 2YC1A 4R7DB 1J8HB 4FQPA 2X4UA 4YHNA 3V6ZB 2A73A 3BKYH 2PETA 2GQHA 4WWKD 4XNUH 4ZDHB 3ZTNH 4EDXA 2BOCA 1FZKB 1I9RH 2DIAA 1T0NA 1U8PB 5C6PB 3QG6A 1WFOA 4A6YH 1NGWA 5D6CA 4EDXB 1XF1A 1RD6A 3I75A 2BOCB 5C0FA 1CIUA 1RUMH 1DLFL 2GJ6E 4EDWH 1ZGLP 2JTDA 4JPWH 2JJSA 4XT1C 1EZVY 1RJCA 1NGWB 2ENSA 5D1ZA 5D6CB 1WEJH 3LN9A 2QV2A 3I75B 4HZLB 3WLBB 1I7TB 2HWZH 1A6TA 1GGBH 4YK4C 1BIHA 2G75A 1V3KA 2BVOA 5E2WH 2OP4L 5BXFB 1EZVX 4DKDC 4NHCH 1N64L 2MCPH 1J5OL 3PGCA 5GSRA 3SE3A 5F9DC 1U92B 1A6TB 2G75B 1L0YA 4F58L 2X4PB 4EZMA 2BVOB 4DN3H 1BX2A 2O61B 1NBYA 4X83A 1QQDA 3SGKC 4D9RE 5KVEL 5GSRB 1HXMA 3W11C 3LQZA 4P4KC 4GRWF 4OQ1A 3DYOA 1LO3L 3OJ2C 2VAAA 3MV7A 3LPFA 4PJ7B 1JK8A 4W6WB 2VSCA 4MNQD 1EMTL 2ATPB 2DICA 1QQDB 5I1EH 1MF2L 1VEMA 3LQZB 2UWEF 4M6OH 1FIGH 1BF8A 2ICWJ 2VAAB 4LGSB 3HI6L 4KVNH 2QSTA 2YWYA 1KUMA 4IOFD 2A83B 2DMKA 4QWWD 3AC0A 5DEFA 2X4TA 1KELL 1F4HA 4Y7MA 5ESQA 1QFWI 4K3EH 4B7LA 4EEEA 1G7MA 1FBIH 1Q0XH 3QXDB 3BPCA 4ZO7A 4KROB 1HN1A 5DEFB 2J6EH 2X4TB 1RQ5A 2N7AA 2CLVB 5DHXB 1QFOA 1QLFA 3G5ZA 3QEUB 4QRPD 1XEDA 5ESQB 1G7MB 1FORL 4G7YL 1A7RH 4F9PC 3BPCB 1P7KA 3QXVA 3ZE0E 3GNML 1ADQH 3DMMA 2GITA 1BFVH 2DQEH 3T0EE 3ZYOA 3G6DH 1Y18A 1ZHNA 1QLFB 3U48A 1KSRA 3TJHC 3WKML 3VFVB 3R1GH 4Y5YA 4ALAH 4F7TA 1P7KB 4D9LH 3A67L 5BO1H 3H9SD 4D3CH 1D9KD 5AEAA 5L6YL 1KPRA 2ZPKL 4KQ3H 4UTAH 1ZHNB 1WIUA 4Z7UA 1R3JA 4XBGB 5JQ6L 2IG2H 1Z0NA 4Y5YB 4HIJA 4F7TB 1P6FA 3BQUD 1JP5A 1AGEA 3OHXA 2CKBL 2NY7L 3O3DB 3LKOA 4O5LH 4H8WL 4HCRH 5IBLC 4Y1AD 3O6MH 2RCSL 4HIJB 2DQTH 5D1XD 3O9WA 3QWQB 3RVWD 1MFAH 3OHXB 2MCG1 4LDEB 1HZHH 5IG7A 3UTTA 1WAAE 3LKOB 3MFFA 1WZMA 1G7HA 5JA9A 4UDTB 5EU5A 5BRZD 2ICES 3C60C 1OAUH 2A6IA 4PD4K 1RU9H 4X9FA 2DBLH 3WFDL 4YGAB 4Z5RB 3AS3A 1G7HB 2CDFA 1JF6A 5EULV 4IDJH 4U49A 3ZKND 2R0ZL 2NYYC 4WY7H 4O02L 1KB9K 3BOVA 2CDFB 4P9ML 1CICA 5CJXA 1SQ2N 2VQUA 7FABL 4EVNA 1ZXQA 4LSTH 3PP3H 3QEGL 3RDTB 3UJJL 2YD8A 3CSYB 5F1OB 3BISA 3QUML 2EC9U 1OAZL 3CNKA 4AMKH 1INDL 4X99A 4S1RL 1TJGH 2XWJA 5D4QA 1U41A 4WDIB 3GSNL 3BD5A 4EVNB 1M4KA 1IGIL 12E8L 3L7FB 3QIWD 1U8KA 4M4PA 4M1DH 2UZIL 4QRUA 4XVTH 5FYLD 5B3NA 1XR8B 4LVHB 1KCRH 4F33A 4PRHE 3BW9A 1PFCA 1XF2B 2HFFA 2ZCKH 4MVBC 5J6GA 1U8KB 1SBSH 3IJYA 4OF8A 1E4KA 1LMKA 5ENWA 1A7PL 4WU5A 5CGYD 4F33B 3LV3A 1N4XL 25C8L 4O58L 3RGVD 5MI0C 2HFFB 1MRDL 4LVNB 1ZE3C 1M05A 3GMQA 3IJYB 3EYQD 3WNLA 2YUZA 1PX3A 2X9WA 5ENWB 1G9NH 4WU5B 1T7VA 4Z7WA 3LV3B 1N7ML 3F58H 2ZNWA 1F4YL 4X5XA 3GMQB 3NVQA 1HILA 2Z91A 5F9JB 1KEGL 2ED7A 4Z7WB 1DCLA 4I0PD 1I7RB 4GG6A 2JB5H 1E6OL 4U1GB 4MMXC 4QKXB 2MTPA 4TRPH 2Z91B 3HR5B 3VG9B 4JR9H 2BVPA 2G60L 2OI9B 5JIHA 3HFML 4PUBH 4M1GL 2XTJB 2IFFH 2A38A 4KU1A 4GG6B 5F7KC 2EH8H 2P45B 4AENA 4GW4A 5C7XH 3TESA 3CSGA 5HD8D 2BSED 1CGUA 4LCUA 2BFVL 5TQ0L 3IAGC 4PRBA 2OBGA 4GW4B 3QDGA 1B0RB 4DAGH 1MCRA 2R56L 1F8TL 2YA0A 3MV11 5DS8A 3MRFA 1TNMA 2VLJD 4OF6A 4PJDF 4LPVA 2XFXA 4LF3A 4PRBB 3UTQB 2YPLE 3QDGB 4NUGH 4CVZA 4LLQB 1WBYA 3QJFA 4UILL 3HZVA 3BGFB 3WFBL 1BEYH 4P9HC 3V52H 1CTNA 3MRFB 1FFNA 4MNHA 4XHJC 1IEAA 3FN9A 2B0SL 2NW2A 5E94A 5HPMA 1F58H 1CFQA 4LF3B 4F80A 5T3XL 4G7VL 4CVZB 2A1WH 2F58L 1WBYB 3QJFB 3PXHA 2PXYC 3HZVB 2G9HB 3EUUA 4NBXB 4Y4HA 2RJMA 3OZ9H 2ZUXA 3BH9A 2D4DA 2B20A 4MNHB 5E94B 1IEAB 4HGWB 5D7SH 5HPMB 1RUQL 1T22A 2CRMA 1QBML 4OI9A 2ESVA 2UY6A 3K0WA 3L3OB 4K8RH 4LFHD 4KI5D 1QSZA 4LLAA 4LASH 5I1JL 5IV2A 3M8OL 3REWA 1N6QL 4ERSL 1T22B 2BMKA 2PO6C 4ZS7L 5EZLB 2ESVB 1KC5H 4UAOB 4AH2A 5EOQH 1P84K 2YXMA 4RZCB 1CZ8H 3ALPA 3W11D 1ZK9A 3GMRA 3H7LA 3REWB 4R90L 5EOCH 4NM8L 2BMKB 4PGCA 2ICCA 4PJFA 5EUOE 2CSPA 4AH2B 2PW2A 5EC2B 5KSBA 2Z8VC 2YWZA 3GMRB 2WBKA 3ZDYE 2ZCLH 2CLRA 3U4BH 4N8VB 2Y4SA 5EFIB 5L9DH 5IKCA 2VH5H 4HGMA 2P5WD 4PJFB 1MCOH 3MFGB 2VZ1A 3ILQD 5F6HJ 5FYJU 5GSVB 2VZ3A 2I07A 2D03L 1AY1L 3V2AR 5KSBB 2R23B 1CWVA 1NGPL 1X5FA 4LNRA 5IKCB 2JJTC 3RZCA 4QOKD 4APQA 1W0VA 4GJTB 1HWHB 4KJWC 2I07B 4UNTA 5DGQA 4ZSOE 4XNXH 5DJ2A 4QTIH 1J8HD 4JFEA 3D9AL 4ZUTA 3RZCB 3HE7C 4APQB 4EI5C 4D0CA 4F7CA 1B2WL 5DJ2B 3ZE2E 1SYVA 3DX6A 4JFEB 4ZUTB 4PP1C 1CR9L 4D0CB 4F7CB 1T0MB 4ZG1A 4NO0A 1KIRB 3DI3B 4CDHA 1ZSDB 3Q1SL 1SYVB 2FHCA 1F4AA 3QHZL 5SX4I 3JWOL 3IU4H 4LARH 2WAHA 4TTGA 1TETL 1RVFH 2AVGA 4NQDB 4ZYKB 4KKCD 1V8HA 4NO0B 5D70H 2AJUL 4FFWC 4D9QE 1R5WA 3PIQA 1ZLVH 1PGRB 3AREC 3QAZB 2X10A 3VXRA 1ZEAL 4WI8A 1P4BL 3FB7A 1F4WL 5FYKU 4TNWF 1S5HA 4M1CC 1A0QL 4MQ7B 3PIQB 3HLAA 3VXRB 4BUGA 2B7DT 1EV2E 1T21B 3MGAA 3FB7B 3L5HA 2AK4E 5DLMH 5F7UA 1VKXB 1D5XB 1S5HB 4L3CA 1Z9LA 3M45A 1TTUA 3SOBL 5IT2L 4PJHE 5SWZD 3WD5L 4OLWH 4A6YA 4BA8A 4FQCL 1OAKH 3K4AA 5A1AA 5CGMA 1ZGLM 4KKNA 2LV4A 1OAXH 1A14H 4Y8AA 1WBZA 2V5SA 3SDCC 3OV6A 1M7IA 1L7TH 5E5RB 2DLIA 4O2FA 1RIHL 2VIRA 3GKWH 3MLTA 4Q6IC 4RGNE 1WLHA 3X12A 1ES0A 4B7IA 4UOW0 3T4YB 3NIGE 5HPOA 1UEYA 4MHHI 3V4VL 4O2FB 2D0FA 4GQ9L 3MLTB 3X12B 1ES0B 1LP9E 1QNZH 4PJBE 5K9QG 5CZKA 3SO3C 3ULUD 1N2RB 2PR4L 3WDHA 3QDJE 4HC1A 1LO4H 3RNQB 1INEH 4LRNH 5IM7B 5IFHH 4X6DE 1BWWA 2E5EA 1ED3A 2ICWA 4PJIF 1GGTA 4M43H 5HHVL 5DR5L 4XRCB 1NC2A 3L3GA 1NMAL 3EIFA 4URTB 1IAKA 3VG0L 3O41A 2ICWB 3UBXG 1FPTH 4HG4K 4U7SA 4V1DE 3L3GB 5F7EH 2RGSA 4POZC 4PRIE 1DQLH 2IPKA 4XNZC 1EO7A 1IAKB 5I1LB 2W1NA 5F7MC 1NBVH 3VXUE 1RJLB 2BRRL 4M00A 1QFUL 4Y4KB 2IPKB 2AXFB 5DD3H 4K7PY 5DQDH 5CD5D 3MRMA 5DMGD 4E42A 2F54E 1NUGA 2KBGA 3V8CA 3SJVA 3FFDB 1E4XL 5I1GH 4Z8FH 4K7PX 4KKLC 3ET9F 3MRMB 1PZ5B 1UWGH 2VXQH 4E42B 5L7XH 4OAWA 1A6PA 1A4KA 2QR0A 1IZJA 4R6UA 3TWCL 3SJVB 4IM8A 3VFTA 3QNZA 2H32A 2AEIT 5JPMB 1X5HA 1QD0A 4PIRF 1JTTA 3ES6B 3U0WL 1NAKH 1A4KB 2NNAA 2VE6B 1AKJA 5F9WC 3IFNH 3RDTD 2QR0B 4HBCL 3VFTB 5EOTA 3QO1A 2H32B 4E5XA 1DN0A 1DQDH 3TJEH 2ZUQB 3BRGC 1JMXA 5MHSD 5FIEA 1I1AC 1BOYA 3LRGA 1D5ZB 1NBQA 1W72L 5EOTB 3WFCH 4O4YH 2ZOKA 4HV8A 1J1PL 1NCBL 1DN0B 3QQ4A 2Q8BL 1KLUA 4LLMA 5I8OL 3IDYB 5J3HC 1SJHB 2CLZA 4HQQH 1N5AB 3V95A 2BK8A 4X7SL 4HV8B 2KKQA 3NIDF 1MVUA 3QQ4B 1KLUB 2OX5A 3CU7A 3QDAA 4D94A 3JTSA 2P46B 4Y8DC 5J13C 5DMYA 4FOMA 2H41A 5K59E 3ULUF 2IPUK 1MVUB 4ODSL 4XBEL 5DFTA 1JRHH 4LMQI 4JRXE 4I3SH 1P5UA 1QSFB 1QSEA 2H2PD 3WDJA 2X05A 5JOEA 2BXYA 2Q8AL 1F4XH 3KPPA 2FJFB 5FYLL 3MLRL 5TE6L 4L8SC 4Z7OF 1S3KL 4KFZC 5CD3A 3HC3L 3QFJE 2HH0H 3OJDB 5KSAC 1HHJA 2XI9A 1IILE 2AV1A 2EEAA 3FRPA 3DRTA 5DI8A 5CD3B 3QWRA 3KLHC 1JIBA 3IDUA 3IDGA 5E8NB 5C08D 2C4FU 1TVBA 1HHJB 1ZT7A 4RMTA 4TSAH 2AV1B 5I0DA 3WIHL 3NBNA 4PJAB 3N85L 4JPVL 4UT7H 4G9DA 3BT2L 1XF4A 5DI8B 3EYSL 1QO3B 1BAFH 4J3XA 1T5XB 3QUYA 2NY0D 2FD6L 1AQDA 1TVBB 4NQXA 1ZT7B 1GIGH 4EI5D 5DD1H 4NIKB 3OGOE 1OGTA 4OSUH 5BVPL 3G5XA 3O8XB 2GJ6A 1YEEH 3QUYB 1RZGA 2OLDA 4KDVA 4NM4H 5DJCB 2ICWI 1JZ5A 4PP1D 1MSPA 2XQBH 4P57A 4UV7L 1BFTA 2IBZY 1I9IH 4DW2L 2O93L 1J11A 1OGTB 3U36A 2OJZH 3G5XB 5DT1H 5ID1A 1IQWH 2GJ6B 1D5BA 2FEEI 1RZGB 4NBYB 4CU8A 4U1MB 4DVRH 1YNLH 3U36B 3FQTA 4PYHA 5MEQA 4YDIH 4OV5A 4MWFA 5B39G 3TM6A 3QI9B 5ICZB 1NFIB 3UZEA 3K3QA 1S9YB 4M1CD 4HJJH 3FQTB 4XP1L 1C5CH 4OFYD 4OV5B 4Z7QF 3I6LD 3P0GB 2V5TA 4QCIA 4R96A 4F37F 2QQKL 2J5LC 4K2UH 1YPZF 1JGDB 4HF5L 4NC2B 3IDXH 1FDLH 3GMOB 4JG1L 1VFBB 2FB4L 3VFRA 4WGWB 5FGCE 1NMCC 5DJYB 4U1KA 1Z9OA 1LEKA 4R96B 4Y5VA 4YJZL 4OIIL 4XXDA 1EGJH 4L4VB 4JO4L 3PL6C 3D25A 4O9HH 3U30B 5JW3H 1Q72L 4U1KB 5DGRA 2ZSWA 4JG0L 4X6BA 2VXTH 4IRJA 4XXDB 3X3FL 2XOTA 4WW1A 3BPOC 1B90A 3D25B 3GB7A 3JWDH 5CLTA 1NEZA 2FX9L 3D39E 2NY4C 3CMOL 3QEQE 2ZSWB 4X6BB 4IRJB 5B3JF 3KXFE 4LVOC 4XP5L 1MY5A 4WW1B 5DUML 1T7WA 2GSGA 3PP4H 5JPNA 3GB7B 2V7HB 5C0GA 5CILH 2DB8A 2Q86B 3T0EA 4K94C 5IHBA 1WFTA 2Q7YB 3RWJA 5C6TL 5MP6H 4JQIH 1OTUC 3MRNB 1I1RA 4OI8A 4ZTOL 5JPNB 5DJDA 4BZ1L 3ARBA 3T0EB 4ZAKA 1UCBH 4PB9H 5AWNL 5D7JB 3PWPB 3RWJB 4D0DB 5HHOE 5E8EA 3TH3T 2V9TA 3PHOA 2BSSA 3RJDA 3OGCB 4YHYB 4XCYB 5DJDB 1SY6L 3VCLB 3D1MC 4YDVA 3T0AA 4L4JA 1EO8L 4Y5XA 3GDBA 4NGHL 4NQDD 4R7NB 5LXGH 4QRRE 1HHKB 1AI1H 2VAJA 2I26N 4H5SA 2IBBA 4YDVB 3B9AA 4PBXA 2G2RA 3SE4C 2BJMH 1WAAA 4Y5XB 4BQ9A 1DUYB 1IC4H 4JFDB 1EPFA 4LIQL 3KPMA 1HINL 4XXCA 5FHBL 5IROC 1YEDA 4XMKH 5KANI 4ZFOA 4PG2C 4V2CB 5ICYA 3DI2B 3WUWA 3GUTB 2YZ8A 5JXAH 2ERJC 4U1IA 5GZND 4GBXB 1ZS8B 4FABH 1QBAA 4ZFOB 1MRCL 2EEBA 5I2IB 1CFVL 3WUWB 4KUZH 2VERN 4U1IB 2E6QA 1JZ8A 5E4EC 3HMXH 3GSQB 2DQCH 1H3XA 3C5ZA 1FYTE 1QLEH 3ZSSA 5IW1A 2OTUB 3CDFA 4BFGA 2KUTA 5AD0A 1XCQA 5KVDH 4AY0A 3EW3B 1CL7I 3TVMA 5B8CA 1U93B 4JM2B 1ZT1A 3UYRL 1B6DA 3MJ8A 4HH9B 5IW1B 5J1SC 1JBJA 5AD0B 1XCQB 1IMHC 5ERWA 3TVMB 3K2UL 4PRHA 1ZT1B 4P59H 3CX5K 3MJ8B 1EFXA 3U0PB 3X11A 4NZUH 5C0RL 1DN2A 4TULL 5ERWB 2N56A 1F90H 1LK2A 5ILTH 4ELME 5ANME 5I1HL 1UM4H 1FNFA 1BQUA 1A1NA 2K9UA 1LO2L 3T2QA 4P23C 3QXAA 1BVLA 3VD5A 4TVPH 3SDYL 1LK2B 2J4WH 4ZFZB 1K6QH 4RFOL 3CXDH 1TMCB 3K8MA 4OCSL 5E08H 5IB3B 3ZHDA 5JIPA 3P4LA 3QXAB 3PQYD 3TF7C 2D7QA 4HFWA 2NY1C 3KPSE 3ULUL 4KC3B 2YD3A 2CPCA 1GZPA 3GSUA 3BD4A 2AJVL 4Y4KD 1UKQA 4HFWB 4M5YL 4YXHH 3STLA 1G9ML 4JHZA 1OTTD 4LDOB 4K9EL 4OZFG 3EDDA 3LIZH 3EHBC 5HYFA 3N1MC 4A2LA 1GZPB 2A9ML 4GSDH 1NUDA 5IJVB 5FHAH 1MPAL 4J4PD 4W4OA 5CGTA 4HEME 4ETYA 1REIA 4UDUA 5IVXE 2VYRE 4MD0A 3L9RA 2VC2L 4FQLL 2Y06L 3VXQA 5FUZL 2ED8A 2DIBA 1TCRA 4GMTL 1OQXA 3NCYS 4Y16C 5GZOC 2YPLA 3BRDA 4UDUB 1CG9B 3NIFF 4MD0B 3L9RB 2Z0BA 1AR1C 5J12C 1BZ7A 1E4WL 2Z93A 1MFDH 2E6JA 3OAYH 1S78C 1U58A 4FXLA 5DVNA 3W81A 1J1OL 5D7IB 4WWID 2P7TA 5F6HI 2C3GA 4S10A 4QGYA 3ZYIA 5C09E 2Z93B 4U6VL 4WUUD 1EEQA 5EH1A 4PJEF 3S7GA 1I1YB 2P7TB 3SCMC 2OR8A 3BPNB 3FFCE 4CAGA 4OGXH 4ONGH 1KYOK 4R2GB 1PBYA 3S34L 2OL3A 1RUAH 2ADFL 3LRHA 1R5IB 3RVVD 3OBAA 4J12A 5DUBA 2PYEB 2EYSB 5DQJA 4EUPA 4KY1H 5T3ZH 4XGZA 1T89C 1TTGA 1ULVA 5FUOH 3JSSA 3NA4A 2R4SL 2C5DC 2GK0A 4NZRL 4CU7A 3O3AA 5C71A 2R69H 1YMHA 3HNTL 2OL3B 3HPLA 5HGGS 1DDHA 5DQJB 3VI3E 4EUPB 5EUOA 1A1OB 3LEVH 5I1KH 4P9HL 3BDXA 3RUGE 4RGMC 3CXHJ 1QSFD 3O3AB 3WN5C 1YMHB 3O6FB 3HPLB 5LKNA 2X41A 3TT3H 5EUOB 2ADJA 3E6FB 5I6XB 3RWEB 3IDJB 3ZHKA 1VACB 3MRRA 4FTVE 1Q1JL 2ADJB 5CHNA 4ZSOA 3D18A 5I8CA 3VFPB 3CFCH 3GIZL 5F21B 5IMOA 3V6OC 3MRRB 2NY4D 1A6AA 4YHZH 4I4WA 3RU8H 3MNZA 4S0TD 1SM3H 2I9LA 1YECL 1EUUA 5CHNB 4ZSOB 4PY8J 2EYTA 5I8CB 1PLGL 2P24A 2NW3A 4OZHE 4P5TA 5I30L 2QQQA 5IMOB 1VFAB 3GJEB 3GSXB 1GC1C 1FH5H 1RMFH 3MROA 1HDMB 4NNPL 4HUVA 5EZIL 2K3TA 2XV6B 2I9LB 2EYTB 3O8XD 2XY1A 2P24B 4RIRA 3MR9B 5GRJH 3B3IB 2NW3B 2L7JA 3QUYD 2AJZA 4P5TB 2BY1A 3TA3A 3MCKA 5HDBE 2Z9TA 3MROB 3U4EA 4JFHD 4HH8A 4JKWA 1ZGLA 4OCRH 2F19L 2JKXA 2GJ6D 4L5FH 2BDNL 1DR9A 2G5BB 2NZ9D 2W65A 4BQ6A 1CF8L 3TA3B 3MCKB 5I75B 3U4EB 4KGLA 5ITBH 2F5BL 1FCCA 2Y36H 1ZGLB 1FAIH 4HWEL 2C1PB 3FO2B 1GYAA 2W65B 3QI9D 3KNBA 4JO2H 4PREA 5GS2D 2AK4A 1V5JA 5F3BB 1L6XA 4H26A 5JW4Q 1JHKL 2GFBA 5TE7L 4PJHA 1WISA 5JOFA 4WV1C 1EJOL 2AK4B 4KV5F 1RJYA 5CBEB 1MQKH 4GO6B 2R29L 2BVUA 3F6LA 3SGDI 4PJHB 2B8OT 5JOFB 2X4NA 4L4VD 5I9QC 3N1PC 4RNRA 1RJYB 1FLTX 4M8QA 5B22A 2LTQC 4G80A 1G7PA 5D7LD 3GHBH 1U95B 1RIVH 2CGRH 2EIBA 2JF1A 3U1SH 2X4NB 3TIDA 3MCLH 1A5FL 2CRIA 3RX8A 3H42L 4AL8L 1FE8L 4M8QB 5ADOL 1KFAL 3QUXA 4G80B 1G7PB 1DBJL 2CD0A 3LHPH 4JRYE 4RGNB 4LCCC 2VDQL 1LP9A 4XB7A 4PJBA 2I60L 4NWUL 3LVEA 3U2SB 4JM4H 2QHRL 3QDJA 2VDRL 5F71A 1FGVH 3IXTB 4FS0A 4X6CE 4I8DA 4X6DA 4PGBB 3RWHB 5MEOA 2AKRA 4PJBB 2YRLA 2UZYB 4R3SA 5D2LE 1RULL 4YHKH 4K23H 3QDJB 5A16A 5FEBA 3OXSB 4XTRC 2R1XA 1PG7L 4X6DB 2XIDA 3AGVA 5D7JD 3SKOA 1BJ1H 3S37X 3PWPD 2R0LH 2AKRB 2KDGA 4R3SB 2LVCA 4TYUA 5F7LB 1MCPH 3S88H 3U7WH 1MFBL 3P4OB 4PJAF 3L3IB 1IRAY 4V1DA 3VDAA 3OPZH 1F02I 2QADD 4PRIA 4ZOCA 1BJ1J 5AYQA 3SKOB 4H20L 4JO3H 4AEIL 2JJSC 3NACH 3JTTA 4MA3A 3VXUA 4K7FA 2NXYC 3D0VA 3MX0A 5D1ZC 5E6ID 4PRIB 4MA3B 4JN1L 3VXUB 4JFDD 4Z77A 3EYUH 5DURB 1A3LL 2F54A 1KN2L 3D0VB 5DQ9B 3UJTL 4MAYA 1OARH 5HTSA 5IR1B 1XF3B 1OT2A 5LWYH 2AW2A 1K4DA 2VDPL 1NCAH 5AZ2L 3BZ4B 3OR7A 1AJ7L 3RBSA 3CFJA 2QQNL 4GBXD 3U7YH 1HSAA 4N5ED 1R3IH 5FOJA 3NZHL 5IF0A 4WI6A 3OR7B 5AAWA 4LNVA 1C1EL 3HNVH 3CFJB 3DUHA 1GPOL 1HSAB 3GRWH 1PSKL 5I19H 2W9EH 5F6IB 4PFEA 2EDYA 1AR1D 5IVZA 5IESH 5DEGA 4JM2D 1JRHI 3R8QA 3IFLL 2ADIA 1WITA 2X4RA 5HYSG 3C9NA 5FKPA 5IK3A 3P73A 3ZE1E 4LPWA 4PY7A 4QHKJ 4ELKA 5IVZB 1UYWH 1H3PL 2ADIB 2X4RB 3STBA 4UZGA 2DL9A 5DK0A 1SHMA 1VADB 3C9NB 5IK3B 4LLDA 5IBUG 2CR6A 3CFIC 2XN9E 3OF6A 4R4BA 4L9DA 1CK0H 3BD3A 3IDNB 3K80A 5F7DA 5DVOA 5L0QB 1R24A 2XZCL 1NQBA 3DMMC 1YC8A 1VPOL 5ALBH 1GH7A 1QYGH 2CDGA 4R4BB 3SE9L 1ZLUK 5J57B 3S36L 3CVHA 5D2NB 4TNVK 2WM0A 4HIXL 4JRXA 4NKDA 5DZLA 4HUWA 1JUFA 3FAWA 4WFEE 5CP3H 2YN5A 3CVHB 1MWAL 4EN3C 2WZPD 5JHDD 1NFKA 1JGVH 4NKDB 3QFJA 3S96B 5JORB 1QR4A 4HUWB 2X5PA 1J88A 1JUFB 1L9MA 4DFIA 3LKPA 3FB6B 1XZ0A 3P4NA 1VGEL 1CFTA 2X44D 3O9WC 4XP6H 1A64A 1T2QL 4W6YB 5F88A 1T7YA 3LKPB 1T1XB 1T80A 2XWTA 3ROOB 3P4NB 3VWKA 1CFTB 2XICA 1K8DA 3F12A 1FFPB 2NY2B 1FQ9C 4OKVA 5C0ND 4PS4L 1J0KA 3FTGB 1CXFA 3PGDA 5F88B 35C8L 5HYJB 1JGEA 1UACL 3VWKB 1JGLH 3QIUC 5LCVL 1UQSA 3V6FB 4OKVB 4Z7NE 3MJ9H 1MLCA 1VFUA 1IM9B 3WJJA 1JGEB 1CICC 4P2RB 1A3RL 5CJXC 5TE4H 4BYHA 3VH8B 4DN4L 4Y2DA 4Q9RL 5IBTH 1UQSB 5T1DL 1X5JA 1MLCB 1U91A 3ULVC 1F2XK 5CKAA 5JOPD 3P9LB 1U8HB 3SN6N 4QT5A 4JFOB 3I6KA 3KPNA 3MMEB 4IRSB 4ZD3H 1U91B 1KLGB 1JHTA 5JXEA 2W9LA 1CYGA 4PJ5D 4QRTA 4JM2F 4OFKA 1PDKA 4QT5B 3I6KB 2W60A 4MCZB 3KPNB 4ETQA 2PYED 2QL1A 4XX1G 1OAQL 2W59A 4JFXA 4LP5A 3DECA 3OSKA 1JHTB 5EWIL 4I9WE 5CUSL 1E4KC 3ZDZF 4QRTB 1HH9A 2FDBP 3C5SA 4D8PA 4RAVA 4ETQB 3NCJL 4JFPA 1I7ZA 1MHPL 4OD1H 4TUKH 1MH5A 3UEZA 5FGCB 3O6FD 3S3JA 1TITA 4D8PB 4RAVB 1BHGA 4FFZH 4G9FE 3BJ91 3VW3H 4U1GC 3IGAA 3GSOB 1MI5E 2J8UE 5DJAA 1MH5B 1O7VA 4Y89A 1IGFL 3D39A 5FOBA 3W9DA 3VFGH 2XTJC 3QEQA 1KB5B 4ODBD 3TBVA 3IGAB 3KXFA 5DJAB 3EJJX 4NUJA 2WUBL 1AC6A 3OL2A 4U1LA 1A6VH 4WUKH 4NQTA 3W9DB 4M7LH 4U1NA 4ZMAT 2XNAA 2PCPA 5A3ID 1V3JA 1BWMA 3OB8A 4H1LA 4KK5C 3B5HA 4RMVA 4MXWL 2OP4H 4GAYA 4HKXA 4NN7B 3AM8A 1KTDA 4UTBL 2A6KA 3PWNA 4U1NB 1IM3A 2ZUYA 4XP9H 5HHOA 3V4UH 4H1LB 4GS7B 3VXMB 4UB0L 3OX8B 5DZNA 3GZKA 1KTDB 2A6KB 1RZJL 3PWNB 5KVEH 2VQ1A 3QZWA 5HHOB 4L4TD 4MLIA 2IGFL 4QRRA 5CSBA 4JZJB 3RJQB 2D7NA 4J7RA 3DSNA 2DLTA 1H3VA 1EMTH 3RTQA 3LDBB 1BM3L 1MCLA 2PTTB 1ZANL 2B4CH 4KK6D 2VQ1B 3QZWB 1CXEA 1P1ZA 1T66D 4QRRB 4MJ4A 1OGAE 1BGXL 4Y4HC 3VFWB 5EBMB 1CLZL 3MA9L 1FO0B 4JO1L 2AERT 4HUXB 5D7IF 3W82A 3B5TA 3VRIA 1FN4A 4Z0XB 5GXBB 5JLZA 1NGYA 4RX4D 4LKCB 5T3XE 1I8KA 4GFTB 4N5UA 1SEBA 1IBGH 1FN4B 4HKJB 3WSQH 3L5XL 4HS6A 1FNGA 1NGYB 5JLZB 4YEFA 2MKWA 2Z31A 1FYTA 3NH7L 4X7DC 4YIQB 5CEZD 1EHNA 1NGQH 4IEFB 5F9AC 2X09A 2GHWB 4LKXB 2DF3A 5I1IH 5E24E 5D93B 4MXVF 1ZTXL 2NTFA 2Z31B 4N0UB 1FYTB 4WCYL 3WKMH 3QIBA 3TFKC 4ODTL 1T1YA 3A67H 1YY8A 5L6YH 4IJ3C 4U7MA 3QG7L 2VL5B 2D7OA 4OLEA 3VMOA 1K5NA 2NTFB 1MNUH 3GBNH 5JQ6H 3QIBB 4CADA 4X6EA 3BIKB 1TJIH 1YY8B 4YXKH 3T65B 2H6PA 2VLRE 1L0QA 2IPTL 3A6BL 4ELMA 4S2SB 1QLRA 5ANMA 4CADB 4X6EB 2RCSH 3R4DA 3MNWA 4OLZL 3U6RA 5KJRL 4UT9L 4H0GA 3MLXL 4IBLT 5EIQA 5FA3A 5CIPH 1JNNL 3EOAA 5FV2A 4OLVH 4ELMB 5LGHL 2YPKA 2VZOA 3IU3A 5E8OA 3W2DL 3MNWB 3U6RB 2AS5M 5IEHA 1YJDC 2XQYK 5FA3B 3G6AB 3EOAB 3KPSA 4ZS6C 3GHEL 4OZFH 2R0ZH 2YPKB 4H25B 5E8OB 1MFEL 5BW7A 1XGPA 4I48A 4Q9CA 4ONOA 1MIEL 4EN3D 2D4FA 1RZIA 4OD3H 5H35B 5IEHB 1J86A 3MBEB 2OR9H 1WT5A 2UVFA 1KPUB 2GI7A 4XAKD 1UC6A 4P99A 3Q6GL 3TBYB 5DURD 1XGPB 5HHQB 4I48B 1CS6A 1MCCA 1RZIB 4BH7A 5HHPA 4XPBH 2XY2A 1OAZH 5C86A 1TFHA 1INDH 1RUPL 5IVXA 3GSNH 3V0VA 4CMHB 5C9KA 1AGFA 2YMXL 3NN8A 4ODVH 5ALCH 3P30L 2Q87A 3TV3H 1CDUA 2APFA 5A2LH 5IVXB 1EK3A 3V0VB 4NNYB 4LRIA 4HWBH 3A6CH 3NN8B 4F7MA 1A7NL 4LSUL 3FONA 4BELD 3I85A 5C0DA 1MIMH 1N4XH 4BSWA 4J23A 5C09A 2LU3A 2FSEA 3TZVB 1FG2B 4GXUN 1MCDA 3I3DA 1H5BC 4KRLB 3FFCA 5C0DB 4BSWB 5GGTL 2H8PA 2IF7A 4XCFL 5E95B 3QEHA 4X7TB 5F7FA 3RL2A 2FSEB 3OAYK 3L3HA 4ZPVA 1TZIA 4QXGH 5E2UH 4KMLB 4XNQA 3GM0A 1F6AA 3FFCB 2DM3A 3CFBB 3WNKA 5GJSL 4PY8I 1E6OH 3QEHB 4KKBD 3RL2B 2EE2A 2CMRH 2VZTA 4PGDB 4ZPVB 1B88A 1DE4B 3WNMA 3HFMH 3HC4L 1KIUA 4M1GH 3RUGA 4I3GA 3V7AE 4YHOL 3Q2CA 3TO4B 5I74C 4MNQE 4UQ3A 5IHUH 5DK2A 5CJOH 3KYKL 3DHMA 2RHEA 5GS0C 4IIQA 5DJ6B 5TQ0H 4XMLL 3ZDXE 5HYEA 4ONHA 2DQJL 3FOMB 4G6KH 4UQ3B 4HXAH 2R56H 4FZ8H 4FTVA 5DK2B 4OCYL 4IIQB 4LEOA 1TENA 5DO2C 3RPKA 1TQCC 3H3KA 3OTTA 3EJZC 4ONHB 3TT1H 4R9HA 4YQXL 4UILH 1PY4A 2PYFA 3KHOA 3WFBH 3HC0A 2YD9A 5DUPL 3UC0H 2B0SH 3UROR 3MZGB 4QRPE 4TQEH 5T3XH 4LCWB 5LGKA 2E7CA 4OZHA 2ZJSH 2JCCF 1YZZA 5J6HA 2PYFB 2EZ0C 3HC0B 5K9JL 1FSKB 5HYJD 3KS0H 3G9AB 2DWEA 1KBGL 3RKDD 5D9SA 2WWKO 4KK5D 2FECL 1UA6H 3MRQA 4HK3J 4M62H 4V2BA 2A9NL 5J6HB 5C07B 3WXVL 3QO0A 3H9SE 3IRPX 4BJLA 1IM9D 1QBLH 1N6QH 4P2RD 2DWEB 2ZUQC 1A1MA 4HPYH 1NCUA 5D9SB 2Y5EA 5AYUL 1BP3B 2YUWA 2GCYA 3MRQB 3MO1A 2PN5A 1EX0A 5KAQF 1BD2B 3QO0B 2J8HA 3LQMA 1AIFB 3WHE1 1JZ7A 1JWUA 3W5MA 4M7ZC 1A1MB 3FT2B 3IDYC 2GCYB 4IRSD 1JFQL 3MO1B 4Y1AE 2AJSH 1XIWB 5K9QI 3C5JA 3D2UD 1RZKH 4Y4FD 5DVKA 1FL3B 4KHXL 3B9KA 3TH2T 1HH6B 4TNWK 1H8OA 1RURH 4RFNC 3RX7A 4PJDE 2BNRD 1GC1L 4HK0A 5BRZE 1AY1H 1SVCP 3MLUH 4CKVX 3BKMH 4GXUM 1JJUA 1QP1A 1NSNH 4QXWA 4DZBA 1MJJB 5IHLB 3ZKQD 3KAAA 4X4YB 1C08A 1S5IH 3F7YA 4HK0B 3MJ9A 5ETUA 3UBXI 5L88L 1QFWL 4FQ1H 4LSQH 4YUEL 3F65A 4NP4L 1CXHA 2CKNA 2FZ3B 1GHFL 5B39A 3PGFL 3F7YB 1B2WH 4LVEA 1LO5A 4LBEB 1S8DA 4YE4H 4JRYA 4JVWA 3VI4F 1U6AL 5EU7E 2R9HC 5IB2A 1LO0L 4ZXBA 4NT6A 1U8QA 4NN5B 2NXZD 3QHZH 2DM7A 4KRPC 1S8DB 4E9LA 4YWGH 4X6CA 5DRWB 3TYFA 4JRYB 3X14A 4YXLL 3KG5A 5FYLE 5T1LD 1KN4H 2MFNA 4F15B 5IB2B 3KJ6L 1ETZB 1G6RL 4NT6B 5D2LA 3BKJL 1JZ3A 1NAML 1JTOA 3WEXA 3TYFB 3X14B 1BOGB 4EQ3A 3ZL4L 1F4WH 2WV3A 3OKMA 4TSCL 3KWWA 5D2LB 2IMNA 3MLVL 5I8KL 2LVEA 2C4XA 4K94H 3VXMD 5EB9A 4ONFH 2MHAB 2QTEA 5HJ3A 2VJXA 1JE6A 4HKZA 1I1FA 3LQAH 2L0DA 5GIRA 3LY6A 4P3CL 4JDZA 3U0TA 1ND0A 1AXTH 2OMBA 1U42A 3CFDA 1EDQA 5IGXL 2AK1L 5FCUL 2JLLA 2XA8L 4B0MM 4HKZB 1I1FB 4MDJA 3UO1H 5I18L 4QHKI 4WJ5B 3BP5A 4JDZB 5MERA 3RVUD 2FJGB 2Z92B 3CFDB 4RQQA 2VR9A 3S35L 3SDXB 1F13A 3QXUA 4I18B 1JV5B 2WSKA 3V8OA 5IW3A 3BP5B 4XPAL 5MERB 4WO4A 3K8LA 2DI9A 3O45A 4OIAA 1GOHA 4JKLA 5CKGA 5FO9B 5DYOA 4DCQA 1CGSL 1AP2A 4HJ0C 2QSQA 3MA7A 1GVIA 4ZUSA 1AH1A 1RUKH 1IC5L 4WO4B 4NFBA 1G1YA 2Q20A 5FGRA 3MXWL 1JNHB 1ZWIA 1A6ZB 1F3JA 2VWEE 2HRPH 4DCQB 5CWSA 1AP2B 2VLJE 3HE6D 1YEIH 4F9LC 3MA7B 2GY5A 3ARUA 4YZFF 1TZGL 4Y5VC 4BH8B 4FFVD 4PV9A 4P5KA 3BUTA 8FABB 4NYLA 1KCVH 1WFNA 4YFEA 1ZWIB 3MGOB 1NCWL 3B6SA 3UAJD 4JFQA 5CWSB 5DR5H 4BUHA 3B6SB 4XWOC 5I15L 4JFZH 3I9GL 1WTGT 2XN9A 4N8VG 2OXHA 1UM5L 1Q8MA 1CU4L 4K8RC 3EOYG 5CEZL 3UYPA 3EO9H 4KI5E 1LNUA 4OD2A 1YC7A 4WW2C 2NR6C 3T0EC 2XN9B 4R26H 1N0XL 1G84A 4MGXA 1LQSR 1QFUH 4RISL 1KJ2L 2Z4QA 3MV9D 5KVGH 4HSQA 2Y6SC 2VDLL 5L2KD 2BCKB 3MACL 1LNUB 1ERNA 4OD2B 4GG8B 2O5YH 3ARBC 1TCMA 4GW1A 4ZAKC 1XT5A 1KJVA 3WS6A 4NN6C 3FO0L 1MJUL 3C87A 5GISL 1ITBB 1I85A 1S7RB 5IFAL 1CE6A 3ULSA 3TNMB 4TUJA 5D1QA 3CSBA 1Z9SA 4PLNC 1IGML 2X9XA 1OQOA 4RFEA 3ALWA 4Y5XC 5BV7H 5K93A 3ARDA 1MEXL 2R4RL 4TSBL 3ULSB 3MBED 4EBQL 2P5WE 3LD8B 3VFOA 2CK0H 3QHFL 4TUJB 2AJYH 3PHQB 2ZP0T 4PLJC 4RFEB 4HLZG 4HBCH 4X8XA 3IKCA 3B5GA 2CKBA 5DO2D 4QEGA 4QOKE 4XXCC 4MZ2A 5IIEA 2CXKA 3IYLW 4OB5L 1H3GA 4JGUA 1J8HE 2P5ED 3HI5L 5TDOA 4OI7A 3IKCB 2CKBB 1YYLL 5EZOH 4ORZC 3IS0X 1NCBH 1S9XB 2Q8BH 5IIEB 1OAYL 2DJUA 4LIQE 3K8KA 4U31A 5D7KD 1Z3GL 3QRGH 2Y5TA 2R2EA 3QUZA 5CBAA 1RZ7L 1DANT 1LE5A 3QPQD 5EN2B 3C5ZC 3NGBC 3AAZA 2Y5TB 3QUZB 2E7LA 3CH1A 5CBAB 15C8H 2NY3D 2YKLH 4PB0H 1D3CA 3QPXH 5B8CC 3TZVD 5C0IA 1LE5B 3ZMRA 3B9DA 3SKJL 5C92A 3WV0A 3V5KB 2OTWA 2YD2A 3AAZB 4U6YA 4DKFH 3CH1B 2YD6A 3QUMA 2Q8AH 3L5WB 4DGIH 5ITFA 5C0IB 3MLRH 3SQBA 3GSNA 5E56A 2OTWB 1KCSL 3Q0HA 5CP7B 3FFCD 4U6YB 1P4IH 1S3KH 3LRSB 2P8LB 4HFUL 3TN0B 4HDIA 2GT9A 3QUMB 3H6JA 2YR3A 5ITFB 1JPSH 1I8LA 3DSFL 1J0HA 4YR6A 4HXBL 4DGVL 3DVFA 1JPFA 4JKPH 2VUYA 4O2CA 4HWBA 5SWZE 5DDHA 1SJEB 4F37K 3OJVC 4X4ME 2GT9B 3QB7C 4PJ7E 3TO4D 4E41B 4L9LB 2P43B 1QSVA 5I73B 1HQ4B 5BZWA 4JPKH 1TDQA 2HKHL 4FP8H 4G9FA 4NRYB 4OCWH 3N85H 4R4FL 3CPLB 4F57L 4O2CB 5LQBL 4PJ9D 1MI5A 2J8UA 3MOBL 1X3DA 2R2BA 5DDHB 3P0YL 1P7QB 3NCEB 2X4SB 4WTZA 1JTPA 4X98B 5EU4A 5BZWB 4KXZI 4P2OA 1S7QA 3BZEA 1MI5B 2J8UB 1K8IA 1OP3H 1VSCA 3WIIL 3DARA 1X7QA 3NIDE 3OKNB 2YSSA 4R8WL 1FIEA 5EU4B 3PWVA 2EXWD 2VLKB 2GKIA 1HCVA 1NKRA 4YHLL 1MVFA 4UV7H 1HHGB 4QLRA 4P2OB 4Q7DA 1S7QB 5CMAA 5F7NC 3BZEB 1K8IB 2H2SC 3BAEH 3IAQA 5B4MD 1Y0LA 4LCWD 3ULUE 4XVSH 2BHYA 3PWVB 4GRLA 4W4OC 1H15A 2JE8A 5CMAB 1U8MA 5EBWB 4MCYA 1AQKL 4LQFL 1FVEA 1MREH 5C07D 4Z7OE 3MUGA 3OKDA 2R0KL 3MRDA 5B38A 3OQ3B 1CIDA 1U8MB 3J8F7 3VDCA 4J1UA 3CDGB 1IARB 1FVEB 2QQKH 3AU1A 5DD5H 4HF5H 5TJWK 1BD2D 1G1CA 4UINH 3ARZA 5EG6C 5EC1B 4IRZH 4QHLA 5B38B 43C9B 4UIKL 4J1UB 1OGAA 3BP4B 4R2GC 2WLYA 4YC2B 5HVHC 4FG6D 4U1JA 3SPVA 1XIWD 4QHLB 3C8DA 1KULA 3AUVA 3ARGA 2BXZA 3SBWC 4GKNA 1OGAB 2Y1VA 1VGKA 4U1JB 1CD0A 4X5WA 4FQIH 2HTLD 1G7JA 3R06A 1TVDA 2Z35B 3ARGB 3MRJB 4GKNB 3LEYL 1EO5A 1KGCD 4TVSa 3T77B 3R06B 1G7JB 5TQ2H 3IVKA 1U3HB 3O2DH 4ZUUB 5KW9L 5E03A 4P46B 3SDAD 4NQEB 4JCMA 3BO8B 5F8RC 3QQ9D 2VXVH 1A6UH 3VFNA 3IVKB 2APBA 3QSKB 4E0RA 4JY4A 4M93B 3UXFA 5KVFL 3VU2A 5KSVA 1UH2A 2N1KA 3CDYA 5MHSE 3GGWA 3VWJD 1JZ2A 1DBAL 3VFNB 5FA4B 5IB5A 5E8DL 4MA8H 1SEQL 1WK0A 2YK1L 1TTFA 4JY4B 5JHLL 1YPZE 2VLRA 2VISA 4NQVA 4MD5A 5BS0E 3QH3B 4M5ZL 4U7KA 4GLRH 4I0CC 4R0LA 4KHTH 3AFLA 4NQCD 4GRWB 5E6ZA 1KTLA 4K8RD 3RIAF 2VLRB 2VISB 1FJ1A 3OAZH 2ATKA 4MD5B 4NQVB 5FB8A 4P3DA 4P5TC 4OF0A 2HFEA 2UWEB 1LDSA 1RZFH 2WUCL 4XPGL 4N0CC 1KTLB 4TPRH 3AB0B 4M7KL 2ATKB 5FB8B 3BGAA 2AQ3A 4KWUA 4LCIH 3FRPG 1DBKL 4ODXB 4N8CL 5GGVL 4X8JB 1A22B 1J1XL 3TA3C 5DFVC 2X89A 4FQXD 5IMMA 5J7CC 2VXSL 1G6VK 3FO1A 5B3JE 1WVZA 1GL4B 5BMFH 2C7UA 1KCUH 4F8TA 5CZXC 3HPJB 3CDCA 3WO4B 4G43B 2AXJA 4MJIE 4L3ED 5IMMB 4CMMA 3NAAH 3FO1B 4OM0L 1VB9A 1NFDF 4FA8A 2Y7QA 4N1CA 2Q7NA 3MBXH 3NABH 4FZEH 2FX7L 3BDYH 4N0YH 5J1TC 4AZ8A 2B5IC 2VMFA 1IJ9A 4K71B 5C08E 3ZHLA 2AEQH 3B2UC 3TBTB 4WWKA 2Y7QB 5MENE 3MREA 3N50A 4OGAD 4UOJA 3LOWA 3BEWA 2XRAH 1U0QA 3S4SB 4KDTA 4QY8A 1DBMH 4UBDD 4NO2A 3SE8H 1EUTA 4G6JL 3MREB 5CZVL 4TULH 3BEWB 5E1AA 3BH8B 3S5LB 3SQOH 4QY8B 4DWHA 4LAQH 1ZA3A 4NO2B 3VA2C 2OXGA 1GOGA 1EXUA 2ID5A 4MQSB 5GGRY 3CFKA 4RGNC 3Q3GB 4PGEA 1SJXA 3U9PL 1ZA3B 2YBRA 1CGTA 3QUXC 2N4IA 4HT1L 2P48B 3LH2L 4XCCH 1EXUB 4ODWA 3CFKB 1Z6JT 2LAGB 3EAKA 4DUVA 4PGEB 5LBSH 3ZTNL 2RR3A 3BKYL 3OKOA 1DQJA 1KTRL 2H26A 1TVHA 2JELH 2C1OB 3BEVA 1AC0A 2YBRB 3DX8A 1I9RL 2VXUH 3WUZA 4ODWB 1TQBB 5E1HB 2IAMD 1NBZA 2AJVH 1MJ8H 1EEYA 3PWUB 3OKOB 4LPCA 2H26B 3I6LE 4OZGF 1TVHB 3QXWA 4ZTPL 4JPIA 3DX8B 1RUML 5CEYB 1GZQA 2H1PH 4MNQA 2EDJA 4JPWL 2EYRA 3GMMA 5TDNB 5GGRA 1LEGB 1MPAH 4GRMB 5I66B 2OJEA 2HWZL 1B4JL 1GGBL 1I3GH 3WLWC 4OZ4A 4FQLH 3SEPA 2Y06H 4OBRA 4WW2F 5E2WL 3GMMB 4DVBB 2VDOH 5IOPB 3FHQA 2DIJA 4GMTH 4NO3B 2OJEB 3T1FA 3JWDC 5IHZA 3NCYP 5FM5O 3RWDB 1DLHA 5KSUA 3MRCB 4L3AA 4OBSA 4LPXA 2FEDC 4QRPA 4MAYC 1FFQA 4AEHH 1A47A 4K3DH 5KSUB 4U6VH 4WNQB 4FQHA 5I1EL 1CQYA 5IVNA 3QWOB 1UWEL 4M6OL 2B2XL 1FIGL 1WF5A 3H9SA 1D9KA 4KVNL 1R6VA 5KZCD 1KF9B 2DQHL 4L1DA 3DYMA 3H0TB 4NJAH 1EAPA 3MSPA 5TDPB 3BQUA 2R4SH 3H9SB 4NZRH 1D9KB 4K3EL 4C58B 3VGHA 3IDIA 5HHMD 1T4KB 1FBIL 1Q0XL 4IMLB 5CCKL 3WUWG 1F45A 4NQDE 4Y1AA 2J6EL 2NLJA 3GSRB 5D1XA 2HFGL 1NCTA 1U36A 2WBJD 3DVNA 3ULVH 5HHXH 1ADQL 1MLBA 1BFVL 4LLYA 4PJDA 3V0WL 1Q9OA 3UTZA 4EI6A 4YDJA 5EU6B 4IMKA 5D1XB 1FL5B 5BRZA 5C3LD 1VENA 4KZEH 1W72A 3TN0D 4ALAL 4C83A 2Y07L 3OKKA 4NNXB 4JY6A 5BO1L 4D3CL 4YBLB 4S1DC 5KBNC 1QR1B 2NX5B 4KQ3L 3ZTJH 4UTAL 4PJDB 1Q9OB 3UTZB 4YDJB 5BRZB 5E7BA 5LVEA 5I76A 1T04A 3G6JB 4Y88A 2V5MA 1W72B 4Y19B 3VXTA 4TOYH 3ARFD 1A7QH 3IETA 4E41D 3FQWB 4F8QA 1QOKA 4GOSA 5GRVK 3C6LD 1JHLH 3DROB 1NDGB 5I8EA 4HCRL 5I76B 5SX4H 1P7QD 4PJEE 3VXTB 3O6ML 1XF5A 2DQTL 3IETB 4N8PA 1Z2KA 1L7IH 3UTSD 3ME0A 3HI1A 3EOBA 4NNPH 5EZIH 2F8XC 1HZHL 3H9ZA 5DWUH 5EDXA 1OSZA 3QXTA 2V17H 3QIWA 1XF5B 4G42B 4JY5H 4OF7A 4PRDB 3H3PL 3QNYA 4QHNA 1IQDA 1M7DA 2BY2A 1OAUL 1NJ9B 3HI1B 2VLKD 3EOBB 1RU9L 3VJ6B 5I1AA 5K9KA 1UCTA 3VGFA 1IEBA 5A2IH 5TF1H 1OSZB 3BYTA 3VXPA 5GS3A 1JWSA 4N0FB 3QNYB 1IQDB 3VWKC 3ARRA 4DFHA 1F3DJ 4WY7L 1EHXA 1OOAA 3E8UH 5K9KB 3T4AA 1IEBB 1CCZA 3RGVA 4H0HB 1GRWA 4S1QH 1QRKA 2ZOLB 3CK0H 3G04A 5ICXB 2GJJA 3DV6A 3VXPB 3BXNA 1U8IB 3C8KA 2FLRT 1G0YR 3L6FA 4OJFH 5CJQH 3WIHA 4IOIB 1XMWA 5TFSH 4AMKL 4RMRA 3RGVB 1TJGL 5CLWA 3EFFB 3G04B 3UPAA 4P48A 3BXNB 3C8KB 4Y2DC 3L6FB 3PQYE 4I0PA 5HGAA 4M1DL 4XVTL 5SX5K 4Q2ZA 2RIKA 4LHUD 4XVUC 1BZ9A 2ZCKL 2AQ1A 1FRGH 3N9GH 1SBSL 3VRJB 5HGAB 3QRFM 1V7NH 5JXEC 4U1SA 4Q2ZB 4K07A 4NKIH 1FHGA 2VITA 5TGBB 1YEKH 2MNUA 2OQJA 5ADOH 1DBJH 1G9NL 4U1SB 3KDMA 4HX1B 3BFOA 2FYYB 2BX5A 1B0GA 2X9YA 2VITB 3F58L 2AGJH 5DHYA 1OPGH 2VLJA 2OQJB 2QHRH 1U3HD 4WI9A 3I84A 3P2TA 3WO3B 4LOUD 3KDMB 4P46D 2MJWA 1T6WA 4NQED 4TUOB 3VXSD 1IGTB 2JB5L 5DHYB 3BI9X 4R4ND 1ZHBB 4WI7A 4TRPL 3V5DB 2HTKC 4FMKA 1PG7H 4EUPG 1F6LL 1E4XI 3EGSA 4PUBL 2W0KA 2EH8L 5C7XL 3DRQB 4JJ5A 1JVKA 4WUUE 1CD1A 1MCEA 2HJKA 4BSVA 2X7LA 4LCYA 4KV5E 4OUUB 5T5FH 1IL1B 3FMGH 3EJYC 1HI6B 5F44A 4U6TA 2HJKB 3HCVB 2GSIA 4BSVB 2X7LB 5HDQH 3SGKA 2M8XA 3AM8C 1A3LH 4YH6A 4NUGL 1KN2H 4DTGH 5T1MB 2OS7A 3EYFA 4WI5A 2GSIB 3V52L 1BECA 3IFPA 4LHQB 4TNVF 5AZ2H 1MCIA 1F58L 5HI3D 1QSFE 1WZ1H 2A1WL 5T1KB 1UFUA 1JYNA 2XZZA 3EYFB 4HLZH 2ICEA 3NZHH 4DQOH 1IAIH 3OZ9L 2P5WA 3IFPB 4CUCA 3K7UA 3DJ9A 5D7SL 1WBXB 1YJDH 4XHQA 3FJTA 2BRQA 2GJZA 3E3QC 4G6AC 4QTHA 3RTQC 1SY6A 2VR5A 2CUHA 1BLNB 1PSKH 4K8RL 1Q9KB 4BZYA 4QOKA 2P5WB 4LASL 3QCTL 2CJUH 2PTVA 1YN6A 4I3RL 3W39A 3DXAB 4MDIA 2GJZB 4MA1B 4QTHB 1KC5L 4R7DA 3IFLH 1J8HA 5EOQL 1CZ8L 4PJIB 2EH7H 3RY4A 4OZIB 3V6ZA 5D6DC 1T83A 5ACMA 4ZDHA 1YN6B 3QFDB 1OTSD 4PJAE 5EOCL 3W39B 4F9PA 1A9BA 2EDFA 1BQHB 4MDIB 1U8PA 1AE6H 3QNXB 4PRPB 4C55A 3B43A 2ZCLL 5D93C 3U4BL 5L9DL 1A9BB 2VH5L 1MCOL 3RL1A 4YGVA 5FCSH 1IVLA 1U3ZA 4JFHE 4HZLA 1CE1H 3WLBA 1I7TA 1I9EA 3S36H 4QXTA 3QIBC 4Q58C 3IJHA 3RL1B 1N59A 5BXFA 4YGVB 4XNXL 4QNPF 4WTXA 4QXTB 3T0BA 3BVNB 1U92A 5KS9F 3VFMA 3IJHB 1Q38A 5JNYA 1T1WA 1UB5A 2X4PA 1JPGA 1N59B 1OWWA 2O61A 4LLWB 4NC1C 1VGEH 3VFMB 5BQ7B 4FHBD 5SWZA 1T1WB 1UB5B 5JNYB 1JPGB 5HYQB 1KLFA 4X4MA 2EECA 4PJ7A 2ATPA 4MXQD 4S11A 2GTWA 3ESUF 4HC1H 4MB5A 3IU4L 3S3PA 4LARL 3C60B 1LP9F 1RVFL 5SWZB 1W0WB 3HS0A 1LDPH 5D70L 3F6IA 4L4VE 3VD4A 35C8H 2GTWB 3X3GL 4N9OB 3LN4A 2A83A 1IAMA 1UWXH 2FX8H 5D7LE 1UACH 5HHNB 5BW7C 1S7SB 4RMWA 3HS0B 5GS0H 3MLZL 2DYPB 3QXDA 1F97A 3LN4B 5GRZA 2CLVA 3DURA <