1N5AB

Crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title A Structural Basis for LCMV Immune Evasion. Subversion of H-2D(b) and H-2K(b) Presentation of gp33 Revealed by Comparative Crystal Structure Analyses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 15
structure length 98
sequence length 98
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n5aB00
4PGBB 4ZOCA 5B22A 1KC5H 4ESKA 4XI5D 4GW4A 4N8VB 3TT3L 3EJYD 2AGJL 3NPZB 1MI5E 4BSVB 5C0AA 2BVPA 2HRLA 1ZS8B 5BS0A 4E41B 1F02I 4OLXL 1OAYL 2F8VA 1N0XH 1NGPL 1UYWH 3DV6B 2D7NA 5CEYB 4ELKA 3DYPA 4JANB 3P0GB 4M7KL 1E4JA 1SJVA 3G5XA 2NY2C 1S78C 2NY1C 1JPFB 3HUJB 1WJ3A 3JUZA 4LRNL 1MCRA 2XZAL 1KB5H 5INDA 1RK0B 4X4XA 2C7UB 4OFPA 3KPRD 2G2RB 4KTDH 1QSVA 3U30B 4R97C 1N6VA 4HKBB 5C0CE 3RZCA 3B5GA 5HI5D 1NGQH 4F8QA 1OLZA 2DS4A 3PDGA 3HI1B 3G5VB 1JPGB 1KENL 1XR9B 2P24B 4WRLA 4GUPA 3RWEA 1YUHA 3EO1A 3RDTD 1E6OH 1MCQA 3NCEB 4HHAB 1D5XA 1BP3B 3C2SA 4PRHA 3UDWA 2Y72A 1Q0XL 1KJMB 1P2CA 4FXKB 4OD1H 1RK0A 4JFEB 1C5CH 2R2HB 3NTCL 4NUJB 4RBPK 1NCWH 3FT2A 3UTSE 3DRTB 4AL8L 2VKXA 4KKLD 5DTFB 3UTQB 4C58B 4EEEA 2D4FA 3GHBH 4YXHH 4YH6A 4TPRH 3VXPA 2F58H 2UZYB 5MENB 2BNRE 2EDNA 4E42A 3MXVH 2E27H 5IB3A 3HPLA 1TENA 5ANMB 4M6OH 3RVVD 1CWVA 4G8FB 4XNYH 1CGYA 4RMVA 1CL7I 4ERSL 1Q9KA 2B2XL 4HV8A 2EDJA 4FXKA 4JDZB 2N56A 2FRGP 4ZYKB 4RNRA 3RGVC 2P46B 3I3EA 4LAJH 2HJKB 2JCCF 3TCXA 5DTFA 1C5DB 2P5WD 3TZVB 3AFLA 1X5GA 5GIRB 5KSAC 1DN0B 5CSZB 3WXVH 4APQD 4RAUA 5DJYB 1FRGH 1SBSL 1IL1A 3HZMA 4PRPB 3SEPA 1WWBX 1P5UA 4G8FA 3D1MC 4OLVH 3GDBA 3U9PH 3WLWC 2NY5H 5JW3H 2FWOB 5IT2H 2NY4B 1TZIA 2JJVA 3SDCA 1VFOA 4F15C 4HWZB 4TSCL 1IGCL 2HJKA 4HUUB 3QZWG 2PO6D 5E99H 1IQDA 2Y9RT 4XP6L 5MHSE 1GPOH 4HUKB 3EBAA 3DVGB 4Y4KC 4ZS7L 1OHQA 4U1KB 5GIRA 1DN0A 3UO1L 3O4LA 2GJ6D 1YEFL 2BZDA 3CZJA 4R90H 2IADB 4NNXB 4ZAKB 1G9NL 1CFVL 4IEFB 4OKVB 1G6VK 1KUMA 5KN5B 2XN9E 4KKBD 3HC4L 5DRXA 3OKDB 4HBCH 1CG9B 4M8QB 5D7SH 2EIBA 3QWRD 1S9VA 3C60D 4LFHD 5E1AB 4J1UB 5SWZA 1R0AL 4M7ZB 4JB9L 1SVCP 3VFGH 4NM8H 5IHZA 4N0FA 4YBLB 2EXWC 3QIUC 3MBEB 5I19L 4U1KA 5CZKA 43C9B 3NACL 1N6UA 5C0DA 3U0TB 5J11C 1N8ZB 3MRQB 1KB5A 3E3QC 3NFNA 5JNYB 1JPTL 3F5WB 3QHFH 5KVFH 3RGVA 1NPUA 3QG6B 1G7QB 2YPLE 2Y07H 4J1UA 5KSAA 4HULB 1UGNA 3UTOA 4PP2A 5DVMA 5HGBB 4F3FB 5IESH 2KZ1B 4KDWA 4XCCL 4D3CH 5SWQB 4DKFL 4OAWB 4L8CA 3REWA 4X9HA 3OJDB 4JLRB 1BQHG 4PRIB 3GSVA 4KUCD 4LCUB 2WANA 3GM0A 4NRZB 2VUOA 5KANG 5D2LB 4PTTB 4MAUL 5KZCB 4G6JH 4OQTH 3H3KA 3QG6A 2BRRL 4HWBL 5I66A 1GIGH 1FGVH 4JHAL 3T3MF 4YNYB 4XMLL 1G84A 1XIWB 4NWTH 3PGDA 3KPNA 4HJ0D 1MHPL 4PJXE 4M62L 1KV3A 1SMOA 5EDXA 4PJ8C 1JVKA 2FSEA 3Q3GA 4PLNC 4JFFE 1SYVA 3BGAA 4S1RH 2MQCA 2NTSP 2Z91A 5H35A 4MNGE 1WFTA 5KVEH 4G43A 5EFIB 1UT9A 4XPTL 3TVMD 5GRUH 2VXQL 4YGVA 1YA5A 2QHRL 5DK2A 4NJ9H 5JIHA 3GSXA 5DZLA 3U79A 4MAYA 5AD0B 4XVUD 1KIRA 4XAWL 5F9DC 3SE3C 2M8XA 4HJGA 5HI3D 1WWCA 1IILE 3KPQB 1D5ZB 4OIAA 2BHZA 1T2QH 1X5FA 4LBEA 1MCIA 1BLNA 4I5BB 1A6UL 1MI5B 1NCTA 2HKHH 2C5DC 1MWAL 1DQDL 5AAWA 1MQKH 1HIML 5D9SA 1CI5A 4WV1C 5DJXA 4V1DA 1GC1H 2BNQA 1HHGA 5ID1B 1YPZA 4LU5H 2NXZD 4PV9B 4N0UE 1FG9C 2ESVA 4LVOC 4B41A 4XCFL 5HHVL 3G6DL 1RV6X 4LSPL 4YEEA 1MHCB 2DJSA 4IRZL 4WU7B 3ALWA 4I77L 3C09B 3EDJA 5TE7L 4X6DE 2Y1VA 3FRPG 1A1NA 5C86A 2EDBA 1NGXA 2QJDA 1W72H 3ZLQC 3RUGF 5K9QI 3QDHA 1T21B 3F8UB 3K2MC 2FIKB 1G1YA 3VXNB 3N50A 4KRPC 2DMCA 1F4WH 1CFSB 4PGEA 2CDEA 3EDKA 4F33B 1P1ZA 2X1XR 2VQ1A 1GZQB 3BGMA 3CFEA 3D2UD 2EDHA 4Y4FC 5H37G 4D8PB 3A6BH 1P4IL 2CRMA 1GCFA 2A77L 3VXOB 1KPVA 4OZGE 5L7XL 3UTSB 5JHLL 4M6AA 3MACH 5TFSL 5KSBA 1GC1C 1M7DB 2DYPD 4MDIB 3ZE0E 5E6ZA 2BNRB 3GMQA 3OB8A 4UBDD 3P11L 5DDHB 1J0YA 2FX9H 1KSRA 3JV0A 1U8NA 4OQTA 1ZT4B 2Y06H 5DD1L 2ADIA 2AEPL 3QSKB 1AO7E 5GRJH 4WV1A 1A2YB 5IMKA 1QQDB 1FO0L 5DQDH 2IC2A 3TH4T 4LSDA 4XPFL 1IKNC 5ICYA 5GGQL 3OKKA 1RZ7L 1G0XA 5DJAA 2C3XA 3ULUF 4LEOA 3FN0L 3F12A 4MDIA 2OL3L 1D6VH 5E2WH 1TETH 3H7BB 3QWOA 1WEJL 2VYRE 4G9FD 4QHLA 5FYKU 4YZFF 2ZUYA 1KN2L 2XWTB 1AGFA 1CLYH 5IW6A 2DQUL 1U91B 2OXHA 1I7ZB 4FRWA 1KLUB 4R7DA 3GB7B 1FAIH 3QUZD 5I76B 3TO2B 4K94H 3H9SE 5A2LH 2YR3A 4OKDA 2BSRB 2IWGA 5JW5A 1YEEL 3KR3L 1NLDH 4HIHA 4GRLB 1NMCC 3UZEA 3H7BA 4LGPB 3OKLA 1K8IB 1PEZA 1EAJA 4TSBL 2X4RB 1Z0NA 4QF1B 4NQDB 4Y4FA 4M8VA 2HKFL 2R1XB 1SEQH 2DI9A 1BBJA 4MNQE 1C7SA 1A8JH 5B3JF 1N26A 1OQXA 2CKBB 4LVHC 1MIEH 3NA9H 4L9LB 1U0QA 3ZYZA 1A02N 1HYRC 1JPSH 4R4BA 3RDTC 5E4IA 5CP3H 2DQHH 3IJSA 3L3IA 4EIGB 5JXAH 1FYTA 3OAUH 2I9TA 3KPSB 4YDJB 4JEGB 1ORQA 2WAHA 3FT4A 2YKLL 1SM3H 3KJ6H 4AEHH 5IG7B 3ETBF 2P45B 5CEZE 3MRMB 1UADC 3GIZH 2AK4A 3CK0H 1F3JB 4M48L 3IVKB 3Q1SH 1BIIB 3VMPA 2ZSWA 4Y2DB 1J88A 5ADPL 1W72A 4YAQA 1KBGL 5TH2B 3UTTE 5HVFB 5CJOH 3CFJB 2YEZA 1A1MB 4K94C 1CK0H 3QHZL 4NZTH 1AKJA 3LN5B 3ZHDA 1HOCB 5T5FL 4CUCA 3SKJL 4KK9C 4L4TD 2HFFB 5E9DA 5ETUB 4ZFGL 5BZWB 1CD0A 4Z7VA 4JHZA 4LQFH 3EGSB 1F3JA 4NC1C 3TJEH 4H20H 5BV7L 5HVGB 5KVGL 4APQC 1AY1H 4UT6H 1DBAL 3CFJA 1K2DB 4LARL 2WBJC 4ZPTA 4OZIE 3IS0X 4W6XB 1A1OB 4ZMAT 4PJXB 3X3FL 4OJFH 4YWGL 3MSPA 5KBNC 1ZV5A 2X4QA 4ZFOA 1HH9B 5I75B 4X0KB 1IC7L 1YNTB 4QXUL 5E2TH 3STLB 3GKWH 4AQOA 4MXQD 1TJIH 5E7BA 3UPAA 1JBJA 3QO1A 1CBVL 5FDWA 4TUJB 1F97A 3LDBB 4WW2B 2DMKA 4NJAL 4R96B 1XF3A 3QYCA 1AQDB 2EYRA 3QNZB 5F7NC 1FGNH 4LIQH 4JPKL 4OD3H 4ZO6A 4U6YA 1Q38A 2UUDK 1BEYH 5DK0B 3LN4A 1MRFL 1EFQA 3RAJL 4GW5B 1D5BB 1MRCH 2EH7H 1JHKL 1QBLH 5AEAA 4Q9RL 4KAQL 1FQ9C 4KKAD 3IETB 4WUKL 5B3NA 1T1XB 2DF3A 4DGYL 1IT9H 4XXDB 1DANT 3KWWB 4WVRA 3QH3A 2QBWA 4XH2B 5D2NE 4N0UB 3LH2H 2VXUH 5IM7B 3MUGA 3HMWL 1ETZA 4HS8H 4LLQB 4X5LA 2MQ0A 1ADQL 4CW1A 1OTSD 5DK0A 5J0BA 3C6SA 4ELMF 5L2KE 3BYYA 2X4UA 4OZHF 1WAAF 1IAII 5CSGA 1IEHA 3FOLA 5C8JA 2WBJA 3CFDB 2ADFH 5DRWB 4AG4H 4X6DB 5CP3A 1I8KA 2LE9A 4BQ8A 1OAZH 4X99B 2XT1B 3G6AB 1A4KA 3IETA 1FL6B 2XZCL 4M00A 1A6ZA 4PLOB 1F4XH 4XXDA 4XBPB 1P7HL 1KYOJ 4ZQKA 3V0AC 3CH1B 3QXDA 3QUKB 5JZ7D 3MLRL 3W2DH 1XT5A 5I1EH 2DRUA 4U1NA 4ONHB 1YN7A 2LABA 2I60L 2PNDA 4CU6A 3PHQB 4WWKB 1D9KB 4NO5B 5DRZB 1CXLA 3MRFA 5J1AB 3HG1A 3FHQA 3HC0A 4HJ0C 5C6PB 4DQOH 1F3RB 2AVGA 3CPLB 3NN8B 4HAFA 2DLTA 2APWA 1ZEAL 1NCUA 5CZVH 3VFWA 4TULH 2E3VA 4P2RE 1I8IB 3HE7C 4ZSOB 4GRWE 2VITB 2PW1B 4I3SH 2A1WH 2R2BB 4HLJA 3GI8L 5F7HA 1XGQA 4XC1H 2BSSB 3TVMC 4IJ3C 5FO9A 1J86A 3EYSH 4C83A 4DKEH 3W11D 2VXTL 2DWEA 2Y25A 2ICEA 3BEVA 2HN7B 2N7AA 3AXLA 5T1LB 2FBJH 2Z92A 3SO3C 2YPVL 5GZNC 4MJIE 1JGEA 1RIVL 2W38A 5HI3C 5DMYA 2YD3A 1AD0A 4Y5VC 5C08E 4Q9CA 4JZNB 1WC7B 4WFGD 1HCFX 4CMMA 1KPUA 2E7LC 3QCTH 3WMSA 4S1SL 5JXED 5I9QC 1OM3L 2AK1L 2BSSA 1JYVA 2FH8A 2D7MA 2ZJSL 5D96C 1IGIL 1YECH 4ZFZB 3RIAK 3T0EB 5FECA 4TUOB 3V4PL 1I1RA 3U7AA 4WW1B 4JRXB 1QPPA 2KZWA 3ROOB 4QRUB 5IEHA 1XGRB 1I7RA 3GRWL 3TWCH 3UPRA 2VABA 1BOYA 5D6DC 1YEDB 2EDDA 2F54A 4G8GE 4OUOA 3WIFB 3PWJB 4MNQB 3RWFA 2EDLA 2GSGB 3V4UL 4U1SB 1FNGB 2D2OA 3QEUA 3HE7A 2PW2A 3X13B 4OFKA 3K1KC 4OCMC 3NOIA 2MCPH 5ITBL 3KXFD 2WW8A 1ZA3A 4I3RL 2UVFA 3MQIA 4M6NL 4IHOA 4GS7C 2R0WL 4Z0BL 4NO0D 3JV4A 1G9EA 1C16B 1JZ4A 4KK5D 2BVOA 2C3WA 4Z9KB 5FYKE 4OCXH 1PLGL 3H3PH 1UM4H 5JO5B 1IE5A 5I1KL 3GBLA 2RAMA 2NZ9D 3V5KA 5GS0H 1G7IA 2G75B 1U3HD 4UBDC 1T1WB 1BD2E 1PDKA 1WISA 3Q2CA 2ADJA 5FYLH 1NC4D 5BZDB 1ORSA 5ENWB 4JFYB 3QXTA 3O3AB 4LSVL 2FJFA 3MJ7A 4K8RH 3L7FB 3TO4D 3BP6A 1K9TA 1HHHA 2WWMD 3BPLC 3JWNC 4EVNB 5GS1B 2GY5A 1LE5B 4BH8A 2DQJH 3ULSB 3PNWB 2BXYA 4X8JA 3VW3H 2GUOB 5I1GH 4OZIB 3QEGH 3IKCA 5IVNA 5CKGA 1HHKA 5ENWA 4OD2B 5D6DA 3EFFA 2GJZA 4OLYH 3LKNA 1AQKL 2W9DH 4R3SB 5ACMA 3UJJH 5CILH 4UOJA 3L7FA 4Y0GA 2FHBA 3O2VH 2IPTH 5IMOA 5FGSA 2DLHA 3H2WA 4GFTB 5D72H 2DQFA 4O2EA 4O2CB 4YHOL 1N0LA 5HHOD 1PAMA 4AY0A 3WO3B 3B8SA 2D03L 3U7WL 3NZHH 4X4ME 3MRGA 3UMTA 4RMSA 4W4OC 2PETA 4XWOC 2IGFH 5IHLB 4G5ZH 5TPWL 2UY7A 4R3SA 1AHWB 5HVWA 4G42A 1UH2A 3VGAB 4NKQB 5DR5H 3CU1A 4CMHC 1ZGLA 1UZ6E 5BS0E 4JO4H 1OD9A 2JIXA 4O02H 4Z8FL 1RZKL 1SVZA 5IFJA 2QL1A 5E70A 4UNTA 4R9HA 1NC2D 1UQSB 3HLAA 2AJVH 4PUBL 1DQJA 1S7RB 4HH9B 2AJ3A 4MQ7B 5C0GA 1EMTH 4GAJH 2LVCA 1F4YH 1J8HE 3MUJA 2CR3A 1JNLH 2Z35B 3MJ9H 3MOAH 4IMKC 5E8EA 3MRBA 5L2KB 3QXAB 2R8SH 4XX1G 2UVEA 1ZK9A 4HEME 1RUQL 1HSAB 3VI3F 5KOMC 1KJ2A 3ZKND 1JWMA 1LDPH 2JJTC 4DCQA 3L5XL 4MCYB 3VWKD 1E27B 1UM5L 5F7MC 3OB0H 4UT7L 1KACB 1VACA 3V4VL 1NEZB 4H26A 2GFBA 3ZDXF 2Z35A 3EZJB 1ZHLA 4WEBH 5AZEH 5F7DA 4S2SB 3DROA 1EVUA 3W81A 4D0CA 4NHCH 5KS9B 4W4OA 2AV1A 3I6LD 1HINH 4LVEA 2JB5L 1JGDA 2CRZA 3RGHA 1J0HA 1DQLL 3ARBB 4P2RB 4WTXA 4MXQC 1A3LH 3WFEH 3MV8D 4MCYA 4RQQA 4HWUA 4UIKH 1C08A 2IANA 4UIMA 3IU3A 3RPIB 1IC4H 1IMHC 5D1XD 5IB4A 5E8PB 5D1QD 4ODXB 4F37F 5FUOH 2HLAA 4I4WB 2X4PB 2NTFB 2XG5A 1UJ3C 3WUWB 3DYOA 4PJDF 4UAOB 4KKCC 4Y89A 1ZA6B 4XP4H 3AREC 1QSFD 2DQDL 15C8L 2A83B 4FTVD 4IMKA 1QFWH 5M7QA 3NIFE 3QIBB 4KKAC 2Q86A 3WFCH 2EC9T 3WIIL 1UFUA 5GRWA 3DO7B 4Z76A 2ZG3A 5E8PA 3RU8H 4YUEL 1JRHL 2DN7A 4DN3L 3O45A 4OGYL 4I0PC 2DI7A 3D85D 5LCVL 2EIZA 4PREB 1BGXH 1XGUB 4JAMA 4YDIH 1Q94B 2BOBB 3MFFA 2FX7L 4LSTH 4QRTB 5I1JL 3O4LE 3PGFL 4AEIH 4JM4L 1Y0LB 5K9JH 3ARDB 4PJEE 1MFNA 4NN7B 2ITDB 1EEUA 1UCTA 1ZVSA 5DRNB 1TJGL 4ISVA 1MCPL 2H9GA 2J8UA 1QACA 4G8GB 4JDTL 3V5DB 2FJHB 5MP6H 4FQ2L 4JRWA 2MPAH 4QHNA 5MEOB 4ZUUB 4IRJB 4C56A 3Q6GH 4MD4B 4QTIL 2AEQL 3GK8L 1JF5A 5IEKA 4JKMA 1JNHA 4QHMA 5FOJA 4MJ6B 1OCWH 5C0EB 5D7JD 3O3BA 3ZDYE 1LO3L 3MRHB 3R8BB 1RUAH 3HR5B 2XQYG 1JN6B 1RURL 4YGAB 4UINH 1I1AA 4MSWA 1NUGA 3MJ9A 3OV6A 1EEZA 3O8XD 3DOSA 1CE6A 5ALBL 4Q9BA 4HDIA 3VRIB 2FYYA 2VE6B 2XPGB 4J3SA 1MCWW 1QRND 1JJUA 3U4BH 3BRGC 5D7LD 4NGHH 3JVGC 3AREA 3V6OA 1DBJH 4MA3A 3T3PF 1VFMA 1IZJA 2ED7A 2OI9B 4OCLC 5F21B 3SGEH 5C92A 2P5EA 2XWBA 1JUFB 3W11C 1H5BB 1URLA 1BBDL 3IJYB 4JFPA 3HC3L 3OX8B 4I0PA 5JW4R 4CJ0A 2GSIB 3RWDB 2QADC 2X7LA 3H8NA 5F1KC 3I85A 1DQTA 1IAOB 1FZKB 1JTOA 3S36L 3DTXA 4GMSH 5JXEC 1QBMH 2FNBA 1ZLSL 12E8L 3MRNA 2EE6A 4JCLA 1A6PA 2VDRH 4KZEH 1ITCA 1Q1JH 1CDIA 5EBLB 3L3GB 4PB0L 2MCG1 4JKWA 2Z8WC 3WNMA 4Q6IC 1OGAE 2Y6SD 4FFYH 4QXGL 1TQCB 1T03L 1UCBL 4NSKA 2PUQT 1FZKA 2Z8SA 1ZSDB 3K1DA 4L29B 1BVLA 3MLZL 2UYLA 3PWPD 1JV5B 1K4CB 3LY6A 3MRLB 2HTKC 3IDNB 3E3QE 5L88L 3RIFF 2P49B 4BJLA 4LKCA 3SKNB 5HYSB 3UYRH 1HILA 1XR8A 5D71L 4OLUH 4OBRA 1HZHH 3RI5K 3BN9D 1VA9A 2VLLB 4J6RH 1CDBA 1FP5A 3JVGA 4WTWA 4N5ED 4YHKH 5AG8A 5C0IB 1WUNT 4FN0A 4WO4A 4UTAL 3HE6D 4JFHE 4V1DE 2BNQE 3GKZA 1KIQB 1ND0A 4KK5C 3TIDB 2G5BA 3GHEH 2GT9B 4KPHH 1MCOL 1G9ML 4K7PY 1TPXC 2ESVE 3AS3A 2R4SL 4ORZC 4DK6A 1I1CA 4DVBB 4P5MB 4ZUSA 2ERJC 3RX7A 4HK3N 1L7IL 1J8HB 1FSKB 2DB8A 1U3HC 5L0QB 1HHIA 1LEKB 4U4BA 3G6JE 4PJIB 3OZ9L 4P2QB 4FQXC 4TOYL 4UNUA 3EJZD 3IDYC 1J12A 3BIBX 1KIQA 3DGCR 2I25N 1ERNA 3WNKA 1NCDH 3TO4C 2V2TA 1MELA 3KPTA 1IQWL 1YYML 4HAGA 3IU4H 3VRJB 2VLKD 3T65A 2YWZA 6FABH 5GGTH 3BDXA 4XHJC 3TT1L 4S1QH 4AMKH 4DOHE 5EULV 3LB6C 1YC7A 3WNLA 5FUZH 1I9IH 5ADOH 5ECJE 3QDJD 3N9GL 4NCC2 5IMLB 2WUCL 5DA0B 3TBSB 2NY7L 4OCWH 1A47A 3QXVA 5KSBE 1CE1H 1FCCA 4HKXA 3PDOA 3V2AR 4Q74A 2YZ1A 5T1MB 3LEYH 5BRZE 3TCLA 1SYSB 1XH3B 2V6HA 3PJSB 3HNVH 2HJLB 3MROA 4ODBD 1JMXA 4J3TA 1VGEH 5DD3H 3VCLA 3DI3B 1OTUC 3SJVD 4OZ4A 4O4YH 2X4SA 4OM1L 2E7HA 1QBAA 5CMAA 4ODVH 4GBXB 1UXSB 4P46D 4R2GD 5J9PA 4XTRD 8CGTA 5DFTA 3LHPH 25C8L 3L9RB 3BSZH 4TYUA 2ZCKH 2H26A 4XZUA 3BH9A 1KEML 3BZFB 3S96A 1JI1A 1Q9LA 2NY1B 1WZ1L 3A67L 4PY7A 4UDUB 2Q76A 1RZ8A 1FLRL 4WFED 4FQXA 5EBWA 1HHJB 2GTWB 3PHOA 5HYJA 2MTPA 3P0YL 5HGHA 2A73B 3MV7A 3MUZ1 1NAML 4FQHA 2XKSA 3CVHH 2VZVA 3RX8A 3S7GA 4N8CH 3O6FB 3TV3L 1JHTB 1BAFH 3CX5J 4JO1H 5H2BB 3LZFL 4XP9L 1P5VA 1RZIA 4WCYL 3HI6L 5E8NA 3S3PA 3QNYB 3CUPB 4JFDD 1KLFA 3WFHB 3NCJH 4PJEB 3DMMC 4EI5A 5CP7A 5HHPA 5JQ6H 2XI9A 5AZ2H 1QBBA 4K3EL 2YK1H 1REIA 3JTTB 3ZKNC 3V0WL 5IHBA 4LPTA 4Y19A 1RJLB 5IVXA 3VWKC 1YEIH 5F89A 3PWVB 5ISZE 1A7NL 1KT2A 2NXYD 3K8LA 1PY9A 4K3DH 5D8JH 5IOPB 3V6FB 3HNSH 5T3XH 1TZGH 4YK4B 5HJ3A 4JY4A 1KXTB 4E5XB 2ZOLA 3W9DB 3MX0A 1HQRA 1C1EH 5H8DA 1TTGA 4BSWA 4NZUL 2IBBA 2AK4E 1JNNH 3CUPA 3WFHA 1LHZA 3TA3B 3PUCA 3QDGB 3RVXD 3FKUS 1NSNL 2Q7NA 4LHQB 1XGTA 3ES6A 5GGSB 1MCHA 4F57L 5GSRA 2PXYD 1RJLA 4CN4A 5ALCH 4ZTPH 5LWYH 1RULH 3MRPB 4CVXB 1FAKT 4JKKA 2IALA 3P0VL 1UXWB 1AI1H 4U49A 5GGTA 1I7UB 2PTTB 4Z78B 3V79C 5D1QC 1S3KL 4U1LA 1DBML 2G9HA 1R5WA 3CZFA 4DEPC 1B0GB 3DXAD 1JF6A 4EOWH 2J3SA 3ILPB 3TBWB 4I3GA 1P4LA 5C0FB 5F9JB 4CDHA 4CVXA 4ORGA 5E4EC 3X14B 4NIKB 2XA3A 1UZ8B 3DMMA 5EOCL 3C6LD 1I7UA 4LCCC 1Z9LA 1JE6A 2UWEB 4EKXA 1UG9A 3MNZA 4YQXL 4NQSA 1GGYA 1OGAB 3R4DA 3HPJB 4R7NB 5DS8A 3CMOH 4UOW0 4RWYL 3M17A 2P7TB 3QIUB 5C0FA 1UENA 5D6CA 4OZFA 3G5ZB 3C8KB 2VDPL 4NO3A 4OF0A 1DEEA 4G80B 2DM7A 4BELD 1VESA 3VWJC 4LSUL 1OPGH 2NY3D 5E5MB 4IMLB 5TDOB 1PSKH 3TBTA 1ZWIB 4GAYA 3RNQA 4XX1E 5E8DL 4JN2B 2HA1A 4M1CC 1I1YB 1K8DA 3T1FB 4XNZC 1GGTA 5D7JC 3VFSB 3CVHA 2ZPKL 3BKYL 5C09D 1WQVT 1U8PA 3ZTNH 2P8PA 3RTQA 4I8DA 3BP5A 4DK3A 2QSCL 3PV7A 3TN0B 4LRIC 1H3WM 3NIDF 4NQCA 1WITA 1EFXB 4HIJB 4RFOL 1IVLA 5TDOA 2P5WE 4NC1E 4G6AC 1NDMA 1T66D 1CL7L 4JN2A 4QRRD 1OB1B 1I1YA 1H15A 2HTLD 4LLVA 3LOWA 4O51B 2O5YH 4NRYB 4NYLA 2UZIL 3T2NH 3G6JB 3TBYB 1E6JL 4X7TA 3SY0A 3CFBB 4GAFB 1DZBA 5JHDB 2NY0D 4D2NA 3UAJC 3PIQB 5C9KA 3KNBB 5CINL 3ARGD 3QDMA 4PGDA 4PJ8B 3DRQA 2CIKB 2DBLH 4YHZL 3FMGH 1DDHA 1D5IL 3KYOB 1FCGA 1ODAA 3WCYA 5J89A 3SDYL 3DURB 3WFZA 4Z7NE 1A4JA 1QA9A 4K07A 4ONFL 4JJ5A 4U1HB 1QR1A 4FQPA 5ACZA 2GJ6E 4ZDHA 3O3EA 4OIIH 3R06B 3V95A 4IOIA 2K7PA 4O00A 2I9LA 3HS0A 5DFVD 3FQXB 2OSLA 2UY6A 3VWJA 1CXEA 2APTA 4JKLA 5CCKH 1R3KB 3KYOA 2Q8BH 3RZWA 1E4XH 1V3KA 5FM5M 3ZSSA 2Y6SC 4POZC 4PJFF 5BRZB 4J2XA 4DZ8A 2JCCA 2V9QA 3MODL 3MV01 2AXGA 1DQML 4L8SC 3HRZB 1UA6H 4LP4A 2B20A 3ZE1E 1S8DB 2EYSB 4N68A 3R06A 1NMAH 3IJHA 1VDGA 4JM2B 4CBPA 4LRIA 4Z0XB 1I9EA 4FZEH 3QIWC 2X09A 4LVOB 3HZKA 1ONQA 3OJ2C 3U4AA 2A0LD 3F65A 2QTEA 2OZ4L 1QKZH 1R3KA 3OAYH 2J8OA 4CU8A 1HI6A 1PFCA 2LV4A 3BXNB 4OFDA 3D3VB 4M7LH 1XGPB 4KDTC 5GJTH 3FOMA 3WHE0 1RJYA 4B7LA 4HUVB 1EJ6A 5JLZB 3VFNB 2OR9H 5DMKA 4EUPG 5KVMC 1UACL 5LG1A 5BVJB 4XP1L 2OQJA 35C8L 2ZCHL 1TVDA 4QRQA 1MJJB 4PJCF 1UKQA 5CKAA 3FFCA 5ICZB 1G7MB 3ALPA 3BP4A 4JO2H 2BOCA 1NBZB 1UB6A 3NFPB 4HX1A 2XA8L 1T04A 5EBMB 5IV2A 4NKIL 5E94B 1CCZA 3CH8A 2Z31A 5HXMA 1BPVA 2LVEA 5C07B 3EJZC 3L5IA 4P2OD 1CLOH 1QLFB 3I6KA 4HUVA 1DVFD 2F54E 5CJ8A 5JLZA 1BFVH 1RMFH 2NY6D 1S9WA 4L3ED 3DUSA 3F6IA 1I4FA 5F7EL 3ZHLA 5JPMA 3FRUB 3VXUA 1F4AA 1I3UA 3OR6B 4YXKH 3D39D 2H2PD 4HLZH 2D7PA 3QEQA 3RY6C 1J0ZA 4GG8A 5GSVB 5JOEA 1FFNA 5ISZB 2I5YL 4TNWK 2V5YA 1A3RH 3NFPA 3S5LA 2HFEB 3AC0A 4S1DD 1HYSC 2XKUA 4JRYA 4HKJB 3GIVB 1KXQE 2AEWA 3VD9A 3DUHA 3SE9L 1Y18B 2BY3A 3QNXA 1XAUA 2A6KB 3ULVL 4XRCA 5FA3B 2ORBL 3QIWA 4LHUD 1H3TA 1NCCL 2CIIB 4BZ1H 3BPOC 3OF6A 3CLFH 1IGMH 1EPFA 3GFUA 1H8SA 4TSAL 4OF5A 3DUUA 4KDTA 3HUJF 4L3CA 4JR9L 5E2UH 3UJIL 2B5IC 1K4DB 5J13C 3DV4B 3MCLL 2RCSH 3TESA 5F1NA 2I24N 2QQKH 2X41A 1A7PH 1F6FB 1IM9D 1OTTC 2YXMA 3VG9B 4F9PA 3SPVB 4UTBH 4FQLH 5GRVK 3GSUB 4Y5XC 3ZMRA 5L2JB 3ULUH 5JDSA 1JZ6A 1FJ1B 3RBSA 1OARH 3EO0B 5EU4A 1YMMD 1VENA 2Q7YB 1G7LA 5IW3A 1BQSA 1MRDL 2EDWA 4M5ZH 1KEGH 4N0YL 5GS2D 1A64A 2EDKA 3KPRB 5CHNA 3U82B 4A6YB 4YHML 1LVEA 1JGVH 3BD5A 3LRGA 5F3BB 2FEEL 5J56B 2XNAB 4XBGA 1GGCL 3M07A 5KW9L 3MXWH 5C0CD 3QA3A 1VPOL 1NBYA 3HZYB 3RDTB 4P3DA 2DD8H 5ILTL 5J12C 5I71C 5IBLD 2X89A 5JUEL 4NBXB 1W0WA 5T1KD 4C4KT 2DQIL 2P43B 2F19H 3DJ9A 4U1IA 4MX7B 1H3GA 4EQ3A 4PB9L 2J88H 1TLKA 2ZUTA 1ZT7A 1BM3H 4B0MM 1EEYA 4QRPA 3QUYD 4PJBE 4WHCA 2VAAA 1EUUA 3DBXA 1KTLA 3ULUC 1CXKA 4NBZB 3C5JA 5C2BH 3KHQA 5JPNA 4ZNEE 3BO8B 4U6XA 3WKNA 4NC0B 3RVXC 5CJXA 2R23B 4YHNA 5BQ7B 3STZB 3H0TA 1JNJA 4XP5L 3RUGA 3LEXB 3U46A 2P5WB 4OZFG 1KCLA 1FVDB 4GO6B 1EBAA 2XRAL 3MO1A 1UVQB 3C87A 1AFVH 4APQB 5DJ6B 4MA8H 3QI9D 3BEWA 2KDGA 4QOKA 1G9MC 1NKRA 4U2YA 4L3AA 5E8OA 2JTDA 1T83C 2R9HD 1A7RL 1NBVH 3H9HA 5BQ7A 3BD4A 4N9OB 3T04D 2PO6B 2A6DB 1JWUB 2W0PA 1FV1A 4AL8H 1TJHL 4MMZC 2GJ6B 2JLLA 1ZT1B 2Q87A 2LTQC 1DSFL 3ZT6A 4ODSH 3C6LC 3KPMB 1HSBA 1TNMA 3ZKMD 5HPMB 4DGVH 4QTHA 1H3PL 1T80A 3C60B 1RFDL 2N7BA 5BJTA 2VXSL 1IC1A 3G04B 2XN9D 3VXRD 1OAKH 5DC9B 2HJFB 4KJYB 5CWSA 4JHBA 3D69B 1D6EA 1MAKA 1PGRB 1Q0YH 3FTGB 3LAFA 1JGLL 4OTXH 1EHLL 4Z6AT 2VLRA 2J6EH 1NJ9A 4XMKL 4YPGA 3FONB 3FAWA 3DIFA 2CDFA 3L6FB 1LO5A 5HHNB 3C5ZA 3IFOB 2AJZB 1F90H 1AXTL 1RJZB 1I3RB 2J1KA 2O5ZH 1XZ0B 1FL3B 5CD5C 1VKXA 4NFCA 3HKFA 3GUTA 4UT9H 1JZ5A 1GOHA 3VGFA 4QWWD 5D2LF 4F7MB 2Z4QA 5CLTA 4NP4L 4JGUA 1G6RH 2YPLD 3GMRA 4JPVL 1MVUA 3MRRA 5DQ9B 3NCFB 3C5SB 3OPZL 4YE4L 43CAA 1CD1A 4J3UA 4OGAC 2W0FA 1AD9B 1T83A 3SGJC 3HMXL 3EYFB 1YEJH 2IPUK 2ZUSA 4U3CA 3OSKA 5HHNA 5IB1A 2JELH 3IFOA 1YEFH 2CH8A 3E6HA 2HTLC 4HUNB 3S34L 3GMLA 4OCRL 4LCWA 3O81A 3PP4H 2E6PA 3T77A 3CX5K 1JCKA 1RUML 2W1NA 3UP1A 1KN4H 3ARGC 1Q72L 2J8UE 4JDVB 4R8WL 5J3HD 1TTUA 4HIIB 8FABA 2DQGL 4NZRL 3NACH 4KQ4H 3SCMD 4RAHA 5HY9B 4UB0L 4JFFD 3DGGB 3O9WC 2BVQA 3N1FC 3TVMB 3BQUA 1CTOA 4IS6B 1FIEA 1J05B 1CR9H 3C9NB 5EOTB 5F9WB 5GJSH 4MCZA 1JHLL 4EI6B 3T4YB 4UMGA 3NIGF 4WU5B 3N06B 3EOBB 3ZYOA 1NDGA 3BRFA 4FP8L 5L9DL 2GAZA 3SBWA 1FFOA 3U6RB 1FPTL 5CEZL 3P77B 1M05A 4MXWH 4N1HB 4WI6A 4CRPA 5I9QB 1LEIA 1HXMB 4BQ6A 1OSZB 3JV6B 3FQRA 2VDNH 1FYHB 4X7DC 3AM8C 1MIML 4O9HL 4PY8J 4O2FB 2X4OB 1T0PB 3S5LG 2R56L 2NXZB 2XFXA 4GAGH 4XMLH 4RGOL 5C6TH 2FO4A 4K71C 2A0LC 3T4YA 3MTRA 3UROR 5IW1B 2Q3AA 3VXTB 2J8HA 1RZGA 1CD9B 1B0WA 1FFPB 1VSCA 4IM8A 4IRSC 3WSQL 5F3HA 1U36A 4NFBA 1RD6A 4HK0B 1CD8A 2F74A 1OD7A 3RWIA 5F7YC 3P4OA 1NL0H 2J6EA 3KYAA 5B4MD 1A9EB 2HH0L 4GXVL 1YN6B 4RISH 4MB5A 4TRPL 1OAXL 3I6GB 5FCUL 3FAXA 5TQ0L 4KGLA 1E28B 4FQJH 4LOUD 4P57A 3MR9A 1Q8MA 1FN4A 3GJFH 5IW1A 4CL7A 1JGUH 1UWXH 3UJTL 4KK8D 3D2UB 4E0RA 3O9WA 3LKPA 4P2OC 4OZHB 4NDMA 5HYQA 1DVFC 4G9DA 4WI2A 3QCUH 4XPBH 1U9KA 2H8PA 2B1AH 1B0RA 3OXSB 1G6RA 1J8KA 3OL2A 5IHUH 1MY5A 1U42A 1NGZB 1XGYL 2XYCA 2DYPB 5CJQH 4PGCB 4U0RC 5ERWB 4XNMA 1FNAA 4MB3A 4PJBB 3R8QA 1GZPB 2V2XB 5IGXH 5ESVB 1WBZB 2RIKA 4ONGL 4PJ9A 4HW6A 5IQ9A 1CT8B 5DEFB 4GMTL 2WIMA 1FH5H 7FABL 4ELMA 2DLFH 4LSPH 4OZHA 1YEKL 1WAAA 3KPOA 3MRKB 4IDJL 3BPCB 5B8CB 4UV4H 3L3JB 1PBYA 3ARFD 1OGTB 3I2CH 4NCDA 2VLJD 3MOBH 1I1FB 1YQVH 2AJYH 2XQYK 2W65A 3LKOA 1AO7D 5I0ZA 3IDXH 2BSTA 3BPLB 3PGCA 4UOW1 4G9FB 1L9MA 4IRSA 5I8KH 4X5WB 3LQAL 1CIDA 4RFEA 2R0ZH 1EERB 3VGDA 4ZXBC 1KNOB 2X40A 3L3JA 4QHUB 4ZD3L 1J1PH 3QUZB 3S4SA 2H41A 4JKPL 3FQNB 1MCEA 3HN3A 5E00A 5EZOL 5MERA 5C71A 2R1YB 3FQWA 5EN2A 2Z93A 4WNQA 5GGUA 3RVUD 5HVHC 1ZLUH 4HUWB 4JFXA 3H9SD 1QP1A 2IQAA 4OUUB 3MLWL 3ARYA 4Z7QF 4LASL 2IH1A 4ETYA 4L9DA 1XCTA 1P4BL 3S35H 1QFWI 1O7VA 3DX7B 4HPOL 5DZOA 2X9WA 3P9WB 5A3ID 5E24E 3BKML 3OHXB 2ZCLL 3SKOB 2FO1A 3PP3H 3LPFA 4BH7B 3ARTA 3FQNA 3KYKL 4CMHB 3DECA 2ADGA 1B6DA 4ZO8A 1J1XL 2J4WH 1QEWA 1TFHA 1HEZA 4NC2B 5I73B 3QUML 3I9GH 1C5BL 4OLZH 1XF2A 1B2WH 3CXDH 3KPLB 4KRLB 4V2BA 5CGYD 1OL0A 4J8RA 2XTLA 3TJHD 5CEZD 5LBSL 3DX7A 1ZGLM 1MWAB 3SDDD 1TQBB 3Q0HA 1WIPA 3OHXA 1HQ4B 4BH7A 4HIXH 3SDXB 5FO7A 1AGCB 1A6AA 1GHFL 1CGVA 4XNQA 2CUMA 3UTTD 3GJFA 3CX2A 1DUZA 3GSNL 4N5UA 4L4TB 3UTZB 1J1OH 4HQQL 4C54A 1BZ9A 1I85C 1OT1A 1IC5H 4DZBB 4ZXBA 4DJMA 1PQZB 4PJXF 3T4AA 3RIAF 2CGRH 4ODTH 2V5SA 2AABH 1EHNA 2VZ1A 1MPAH 3JWDH 4XMPH 3UZQA 5I18L 4P59L 3QI9C 4LSSL 4KQ3H 3SN6N 1RUKH 4B5EA 1GH7A 5CBEB 4FQCL 3DX8B 3KJ4B 1QYGL 3HNTH 1BZ7A 4OV6F 1KCVL 4WW2F 2R9HC 4BA8A 1YY9C 1U8QA 3SGEI 4XCNB 1RK1B 4JZOB 5IVXE 2EE3A 4NNYB 4AH2A 4JREC 1EO8H 5EO9B 3KLHC 3FO1A 2E8YA 1NGYB 2H2SC 3U2SA 4WTZG 1ES0A 4RX4D 1AXIB 1OSPH 4Y1AB 5HHOE 2ICCA 1INEH 3WNOA 4D0BB 1QPXA 3BT2H 1E4WL 4KRMB 3ELAT 3O41B 1MCJA 1KCKA 1LMKA 3WHE1 3L95B 1MFAH 3ZKMC 4LEXL 2IQ9H 1NMBH 3WFBL 4WHTB 4G3YL 1EVTC 3GSWA 1T4KB 4N90D 4WUUD 3UEZA 4JVUA 1UJ3B 3L3OB 4K3JH 4P99A 5EU6A 1F6AA 2R2EB 5KAQF 2OJEA 3HFMH 4XGZB 1MAML 5DVNA 3FFDB 1VFAB 4KVNL 3FQUB 3M1BB 3W0WA 4Q9QH 1NGYA 5EWIL 3F62A 3JWDC 4K7PX 5FYKL 4Y1AA 1CXIA 4PRDB 1FO0B 1BVKB 2JB6A 1FNSL 4U6VL 1PVHA 3ULVC 2IAMC 3JBG7 1O5DT 4LDEB 1V7MH 5DSCB 5E56A 5KVGH 3E6FB 4X6DF 1NLBL 1U6AH 1U8HB 2EE2A 2OL3B 4M7JL 5IJKA 4JO3H 5AUMA 1DBBH 3O11A 5GRZA 5CS7A 1FORL 3VXSD 4RA0C 2VDMH 3G9AB 1T89C 3FFDA 5K9KA 2IFFL 2WIIA 3FQUA 1YNLH 1T0MB 2IMMA 5FFLA 3FB7A 4D94A 5JR1H 1HKLL 4RRPA 5TDPB 1MJ8H 2FL5B 1IC7H 2X4NA 2P8LB 5SWSA 4YHIB 1YEHL 5C9JB 4DUXA 2P44B 1R5IA 2FLBT 4OCYL 1ZLWK 2Q8AL 3WEXB 1HH6B 5IVZA 5BO1H 4N8PA 3Q6FB 2ZUQB 1G0YR 1ZAGA 3GMNB 4XCEB 2FBOJ 2H32H 5IBUG 2D7TL 1UKSA 3GSOA 3ZE0F 5A43C 1MJUH 4WEUD 4FABL 4X7SH 1A6TB 4LKXA 5FAAA 3TIEA 1TIUA 4LF3A 1XCQA 2X44D 3G5YB 4AIZB 3RAJH 2FHFA 3MMEA 4GW1B 1UWXK 3TF7C 4X6EB 2W9LA 4OLWL 4I1NB 3V7AG 5FKAA 3TYFA 3PL6A 1MHHB 1HH6A 1VGKB 3MV8E 2NX5D 3N1PC 1SY6H 3IXAA 2FCBA 5DD5L 3RNKB 4AEFA 1I8LA 5J1SC 4CVUA 2E6JA 5AAMA 4PJHB 2IAMA 5DF0A 4NQCE 4KDVA 5MEQB 1IM3A 3O6KL 3L7EA 5EU3A 2D31B 1TCRA 1T1ZA 4CN1A 2CLRA 4JHWL 1RZJH 4PRBB 2ARJA 5T3ZH 2A74B 5SX5K 1V05A 2C4XA 2ZZUT 1QSFE 2X70A 4MJID 1NGWB 3IDIA 2RBLA 3ILQC 1T89A 4FTVE 4MJ2A 4C57C 2YMXH 3QUXD 5T3XE 4JG1L 2ZOKA 5HYIA 5C08D 4J4PD 3T1WA 3BRDA 3S97C 5I8CB 3B2UC 4XCYA 4FXGA 5BV7B 5L6YH 2I60H 3O0RH 1DBKH 4N0CC 3UBXB 4Q6IB 1G7JB 3FCTB 3P30H 3MREA 4K3GA 5E6ID 1LO2L 3V0VA 4X98A 3P3YA 2DKUA 4GKNB 1PG7X 3O2DH 4LLMB 5SV4A 1L6XA 3GGWB 5F6HJ 4CVWA 2ID5A 3BGFB 3GSRB 4EUPB 4ZUTA 4MXVF 3PQYD 3AMLA 3WIHH 2JCCE 4LOUC 3EOAB 4PJDA 5EIVA 1ZTXL 4OGZA 3KXFB 3ROLA 3U36A 3S98A 1FVCB 1HXYA 3PF2A 5DD6A 5BCAA 1SJEA 2W07A 4NO0B 4F7TA 3S4SG 3PP3K 1CZ8L 2O5XH 1QFWM 5DVLA 3NCMA 2EC9U 4MYWB 4R4FH 5KTEL 2ERJB 3LV3B 4P4KD 3BH8B 3HZVA 4OFYD 4PV8B 1SEBA 5D7LE 1U3HB 5FYKD 1DE4A 1IGIH 2H3NB 1CGXA 3GI9H 2CRYA 1ZKAA 1NC4B 3TM6A 3QEHB 3O6MH 3IFNH 3IDYB 4FFVD 4K7PH 1KFAH 4KMTL 2H32A 2F53A 3U9UA 1S7XA 4MD0A 5DUPL 4OZIF 4GQPH 3ARFC 5DK3A 3FFCE 1BD2D 4X6CE 4MD5B 2NYYD 4DKDC 3EFDL 3FO0L 3ET9F 1R3LB 5I1LA 3QRFM 3THML 2EIDA 4HMDA 4XNXL 3L1OL 2ICWJ 5E08L 1N7ML 4IIQB 4U0QB 2PYFA 4XPGH 1SJHA 1UWGH 3IDJA 1SY6A 5J8OA 2AI0H 4AT6B 1FDLL 3BAEL 5AG9A 4Y4HD 3QEHA 3KYMA 5EZIL 5K59E 4IOFC 3KDMB 2DQCH 3BJ91 3QEQE 2WWKT 4U33A 2XZQH 2YD4A 1IAKB 1KIPA 4TQEH 1KC5L 2O61B 3MLUH 3FQTB 3FB8B 1PKQB 3UYPA 1IGTA 5FF6A 1I8MA 2FR4B 1MREL 5HHOB 2D7QA 3AVEA 4AJ0A 1N0XL 4Y16A 4H5SB 4PJ7E 2DM3A 4YHYC 3MLPA 4AM0B 2X1QA 5IB2B 4PGJA 5A3IC 1K5NB 1QHPA 2WINA 3NZ8B 4G6MH 1BF8A 2Y4SA 1LD9A 1KB5L 1IAIH 1PKQA 3RL1A 1FZJB 5HD8D 4KTDL 1LO0H 4D9QD 1X44A 3DX9B 1MFEH 1Q9OA 1R6VA 1X7QB 3SE4C 1NC2B 5IR1B 3Q5YA 5C0AD 1CTNA 5J1TC 1NGQL 5BS0D 2ED8A 4LNRB 1U58B 4H5SA 1UJTA 3O2DA 3VA6A 4EQ2A 3TJHC 1AGBB 5GXBB 1AGEA 1CICA 3SDDC 2CXGA 4RFNB 1F58H 1E6OL 3RVTC 3VXMA 5EZLB 4RAVA 3WIHA 4URTB 4OD1L 2AQ2A 3IFPA 4H1LH 3MLVH 4JN1L 1C5CL 3VFOB 3S37H 1NCWL 4ENED 1CFTA 2CSPA 1N59B 1EJOH 3RWCB 3Q48A 4FFWC 5KS9F 3GHBL 4YXHL 7CGTA 1U58A 3RZCD 4KROD 3VWKB 2F58L 2VLKE 3E1F1 1DLHB 3MXVL 3TNMB 2E27L 5LQBH 4M6OL 5DHXB 4HUMB 3QDJE 4XNYL 1SMAA 3O3UN 4KFZC 4L8DA 3RWHA 1T20A 3LVEA 1QSEA 3B6SA 2F5AH 1IEBB 1EK3A 1PG7H 4PRHD 1H3VA 2OR8A 1C12A 2CR6A 3BUYA 3LSOB 4QRPE 5CIPH 1S5HA 3BPNB 4RRPG 1KELH 4DKAA 3MV8B 3RI5F 1FRGL 4NKOB 3CFKB 3SJVE 1FZOB 5JA9A 5HPOA 3OXRB 3CDYA 3WN5A 5GZOD 5TQ2H 5D1XB 4OLVL 5D1QB 3ZKQD 3U9PL 5JW3L 2NY5L 3QO0A 1FL5B 5IT2L 4I2XA 1PYWA 2NMSA 4Y2OA 1EBPA 4G6KH 4DEPB 5E99L 2W60A 1GPOL 3WO4C 2DAVA 3N1MC 3X12A 1T5XA 1F00I 3MRDB 5TE6H 4JQIH 4QOKE 4LPUA 3ARUA 4R90L 4WFEE 1YC8A 5D5ME 4FTVB 3U1SH 3AAZB 2NY2D 5E4EB 3WNPA 5J06A 5IIEB 4OT1L 1NUNB 1CDGA 4HBCL 5D7SL 1KOAA 4LCCB 5TF1L 4EDXB 3F7YB 4ZPVB 4H88L 1VADB 1PEWA 3D85B 5HDLA 1VFBB 2V2WB 4NM8L 3SDCD 3LQAC 1E4KA 2VL5A 3NABH 4JFDE 3MYJA 4A2MA 2BJMH 5IWLC 2KUTA 2H1PH 2AS5M 2ATPA 1T3FA 3MNWB 2Q3ZA 3O4LD 3ARQA 4I48A 3QHFL 3QJFA 5KVFL 3LKQA 2Y07L 2EEBA 4EN3A 5HHMD 4XNZB 3PABB 2NLJA 5D7JB 3ULUE 4JFOB 2D0FA 5SWZD 3MV9A 4JQVC 5IESL 2E9WA 3VD4A 2EXYC 3OKNA 2CK0H 4XNUH 5JA8B 4NT6A 4D3CL 3EJJX 4OSUH 1BJ8A 3I75A 5BMFH 4HWNA 2D3VA 4YZFE 3VFRA 3O8XB 1JZ8A 1XMWA 1ED3B 4H1LA 4TUKH 5DZNA 4G6JL 4OQTL 5DJ2A 1U95A 1EO7A 1A6WL 2A6JB 1M71A 1QRNB 3KLAB 5HDBE 5CD3A 3RIFK 5D7LB 1GIGL 3VDBA 5DI8A 4OCSH 3P9MB 3RGVD 3PABA 3MLTB 4NWTL 4QYOA 4XB8A 5HGDB 4H8WH 3EDEA 1FFRA 1WBYB 3T8XB 1WCQA 5KSAD 5K9QG 1S7WA 3SDAC 4ZFFA 4Q2ZB 4S1RL 1P84J 2FEDC 3DXAE 1DUYB 3B9KA 4P23C 4LCWE 1S9YA 3LD8C 1KTKE 4HBQA 2HVKB 4FFZH 3WLWD 3EIFA 3OGCA 4FMKA 5GRUL 2QV2A 4TVPH 2VKWA 5ACLA 5CIPA 1EAPB 1DQQB 3QUXC 4P3CH 3PWNB 5FHBH 3IRPX 5IWLA 5I74C 1RZFH 3GK8H 3VFVA 1S7TB 3K46A 4YEFA 5F9OH 1YJDH 4ETQA 4I13B 1MFBL 4QY8B 1DLFH 4WDIA 5DC0A 1R24B 4PG9A 2C9AA 4L8BB 4F2MA 1LILA 3GJEB 1T2QL 5E6IC 3DVNB 3JZ7A 2GI7A 2FGZA 5EA0H 1INDH 5JORA 2HVKA 2HKHL 5TDNA 4L8SB 5I1DA 1CDHA 4JQVA 1MQKL 3EYOA 2CRIA 5IFAH 4RBPH 1GC1L 5KZCD 2EE9A 3PWPB 1UZ6F 1UB5A 1TZHB 2EXWD 4LU5L 4XC3H 4BK5A 4PJ7B 3NH7H 4HC1H 1RVFH 4R4NC 1EGJA 4MAYD 1IGFH 4L4VA 3WS3B 5EO1B 4X6BA 1BBDH 5C09E 4HXAH 3DVNA 1CVRA 3VD7A 4PJ5A 1JYNA 3ECBA 1M6OB 1VCAA 4M93B 3HE6B 4PJIF 4TNVK 5HTSA 3WDHA 4Z5RB 1W72L 4NO2A 1AGDA 3SDAA 3PWPA 5JW4M 1GAFH 5B39G 1IEAB 1V5JA 4JFHD 2R69H 3GSQA 4V1DD 4X5XB 2BNQD 4P4KC 2F8XC 1F4WL 4B7IA 1T0NA 1OVZA 1XF1A 4KI5D 4P23A 2Y5EA 5EPMB 1A21A 5C0BA 5I17A 1BOGA 3V7AE 2ESVD 3CC5A 2CLZA 3MOQA 1TVBB 4PB0H 5LAXB 4GQ9H 3A6BL 4NN5B 5EOCJ 4FFVC 1MUJB 4NN6B 1GXEA 4PP1C 1T03H 4P0DA 4O58H 3MACL 3ZTJH 3BYTA 4ODWB 4QXTA 3LIZH 3VFMB 2OTWA 4FNLH 4U6HB 5D1ZC 1KJVB 2VLKB 2X9XA 5DJ8B 2DM4A 4D0DB 3U4EB 3BP7B 2ICWB 1UM6H 3FT3A 1HDMA 1T6WA 3BIKB 3KS0J 2MJWA 4YHPA 4K2UH 1MHEA 2C4FU 3QDJB 4UDTB 2Y06L 4ZFOL 2V7NA 4HS3B 4P5KB 5DVOA 5DJDB 5KG9B 5DQDL 1K6QH 3X11B 4XAKE 2YSSA 4QHKJ 1WCBB 4LMQI 4ODWA 5ESAB 4UTAH 1D6VL 2DWDB 5E2WL 1TETL 2XZZA 5E5UB 4UU9A 3QPXH 3BW9B 1KTDB 1BWWA 4Z7OE 4RCAA 1CQYA 4R0LB 3SJVB 4AENA 4U3HA 4ELME 2K1MA 3GBNH 4JGMA 4CKVX 1CLYL 1WAAE 2NNAB 4MNHB 4P46B 4R2GB 1KJ3H 3HAEG 3D25A 3L3HA 3NIFF 2CLVA 1G7HB 1FAIL 2XKNA 4K94L 4M5YH 4Y5XB 4X7EC 5HGAB 1D7FA 1NLDL 4QO1A 5C0JA 2FX8H 1N5YH 5HD8C 5D5MB 5L8JB 1Q9WB 4R0LA 1FZMA 1U8IA 3MA9H 4KTYA 1LEGB 3RPKA 1SEQL 1ZHBB 2MHAB 3O4OB 3HCVB 3MLXH 4U1JA 1KGCE 4PJEF 5T5NG 3P4MA 2XTJD 1W0VB 3LKSB 4WI7A 1MIEL 3B83A 3QPQD 4JFQA 3GMOB 1JPSL 4ZOEA 3KPPB 2DQHL 3MJ8A 4PJAE 2XY1A 5D1ZA 5JXAL 1ZHKB 3OAUL 4HC1A 3TPUA 1LP9B 2HWZH 3NGBB 4PJFA 4HK3J 1SM3L 4KRPD 2VR9A 3KJ6L 1QO3B 4JFDB 1UEYA 1FC2D 2L7UA 4AEHL 5I71B 5J12B 1MFDL 3GIZL 4CADB 3ZDYF 3CK0L 3GEWB 1QVOB 3Q1SL 4QRSA 4Y4FD 3AU1B 2BC4B 3HCVA 3D39E 2IH3B 3MGOB 1PKOA 2ZSVA 4KROC 4GKOA 4NQEA 2NXYB 5CJOL 3FB6A 1F42A 5HDQH 1II4E 1CK0L 1IKFH 5GGSY 5FKPA 4NZTL 3QQ3A 4W70A 25C8H 1O7SA 3TNNA 2P42B 5GGRY 5IK3B 5DHYA 5IB5A 1FYTD 1FG2B 1R5VA 5IJVB 4NQXB 2AKRB 4YHLH 4CADA 3IDMA 5KSUA 4LQFL 3T2OA 3OKEA 3TJEL 4H20L 2AK4D 4PJCA 3JWOH 3U30C 2PXYB 1AY1L 2EKSB 4UT6L 3P0YH 5LXGL 3BZ4B 3K80A 3LQZB 3LS4H 4C4KO 3QFJA 4M43H 5GZOC 1CIUA 4P5TA 5H94A 4OJFL 5FV2A 3SKUD 4NQTA 5IK3A 5I16B 2PCPB 1AKJD 4HIEA 4CVZB 4F7EA 5KSVB 1BECA 3DXAB 1JK8B 5E2TL 5E9DD 3GKWL 2UWEF 1BHGA 1TJIL 3EAKA 3OAZK 1YMME 2ENSA 5C6WH 1RIUH 2P48B 4H1LG 4PGBA 5DWUH 1KPRB 1B90A 4N8VA 3C6LB 4GT7A 1FGNL 1UKTA 3ZDZE 4OD3L 2VN7A 4BSVA 2J5LC 1BFTA 2XACC 1ZS8A 1U8LB 1BEYL 3QT2A 4E41A 2IBGA 3B2VH 4TNWF 1JK8A 1MRCL 3SDCC 2EH7L 2I07B 4U31A 3D18B 2R0KL 5JTWA 3JWOC 3DV6A 5CEYA 1QBLL 2VL4A 3OQ3B 4Y5YB 4BKLB 4F9LC 1A7OH 1L0YA 1AXSB 4JANA 5DO2C 5D7IB 2W0LA 1I9JH 1IT9L 3HUJA 1JPFA 3CLEH 3MUHL 2GEEA 2NY3B 2KL6A 3WDIA 5EU6E 4DW2H 4HFUH 3LH2L 2VXUL 4I0CC 3GBMH 2C7UA 4HS8L 1MAJA 2QQLL 2G2RA 4GLRI 1U8LA 2ITCB 4HKBA 3W0WE 3MRIB 5C09B 3K2UH 1U8MB 1QFUH 5FO8B 3ABZA 4FQIH 4AG4L 2CUHA 3HI1A 4ZOAA 1I9RH 4GXUM 4MQXC 3G6JF 3G5VA 1JPGA 1XR9A 1OAZL 2P24A 2QEJA 1MLCB 4FQQB 4JPIB 1F4XL 4HHAA 1OP5K 4ZAKC 4H25B 1KJMA 3W2DL 5I1EL 4KK9D 4JFEA 4K9EH 4QRRB 2R2HA 4NUJA 1BQLH 3DRTA 3WKMH 5HHQB 3UTQA 1JIBA 1U8JB 3MRIA 1BWMA 3U0WH 2NY0B 4DQOL 1NAMB 4M7ZC 3LEVH 3VJ6B 5ICXB 4ZTOH 3ARGB 5MENA 3OJVC 4YBLC 5FK9B 4H0IA 5I1CH 5ANMA 3NPSB 2HG5B 2WBJD 5CZVL 4TULL 3V5HB 4I3SL 2A1WL 5I6XB 3IXTB 2VDPH 4PYHA 4JDZA 4XC1L 4DUWA 5BVPH 2VTFA 4FHBD 5C2UB 3EYSL 4ZYKA 5EZJB 5E8DH 1CLZH 2QHLA 3FO2B 4F9LA 1C5DA 4DKEL 3TZVA 2EZ0D 2P4AB 3EYVB 1RY7B 2FBJL 5I1IH 5CSZA 3HG1D 2MKLC 5DJYA 4FZ8H 5FK9A 2AJSH 4OFIA 3KYNB 4PRPA 3VXRE 4JM2F 3P4LA 4HEPG 1OF2B 4WIQA 3MCKB 3VGEA 4Z7WE 1CS6A 1SHMA 1UH3A 3QCTL 4ODUB 4U1GC 4F8TA 4D9RD 4KZDH 1CDCA 4K9EC 2FWOA 4MWFB 3SHSA 3RA7H 4HWZA 4HUUA 3ULVE 4MZ2A 4PG2A 5DT1H 1RU9H 2RJMA 1N3NB 1YECL 2ZUXA 3DVGA 2UZIH 1XIWC 2V17H 3FB5B 3U7YH 1A0QH 4ZAKA 2IADA 4NNXA 2V9TA 4K71B 4MAYC 1FFQA 1C7TA 5J4MA 4OKVA 5KN5A 2YD7A 2YWYA 2R29H 1CF8H 2YBRB 1OF2A 3OKDA 1H0DB 1CG9A 2Z8RA 4M8QA 1D5IH 4HMEA 3FJTA 4ODUA 4Y88A 4YXLL 2NY5C 3TWCL 5E1AA 4YIQB 3ZDXE 5J6HB 3SDYH 1X5LA 1AC0A 1XFPA 3D0VB 1HE7A 4AYFA 1WVZA 4E9LA 4M1DH 1NCNA 3M8OH 3MBEA 3FB5A 43C9A 2X4TB 3K8KA 4KI5C 2NZIA 3U0TA 1N8ZA 2VH5H 1IBGH 3MRQA 1GGIH 4OGXL 4WY7H 5JNYA 3BE1H 3ZL4H 4WI8A 3F5WA 1KJ2L 4Z77B 3DHJA 4P2OB 4U7SA 4JCMA 1G7QA 5DMGD 1DVFB 4YIQA 2NY6B 4S0TD 4L3EB 4OCXL 1NFIB 5ESQB 3H3PL 1TMCB 1DQMH 1UM4L 3BKCH 3D0VA 3D39B 5HGBA 4F3FA 4MQSB 3P9LB 1QNZH 3MGTB 5GS0L 2F54D 4MJ5B 5SWQA 3B9AA 2JF1A 4OAWA 4RGMC 3FN3A 5IP4A 3T0DA 3OJDA 5I1HH 5FYLL 1AH1A 4JLRA 3HE7D 4PRIA 1WBXB 4LCUA 4NRZA 1T2XA 2VDQL 5D2LA 4PTTA 5C1MB 4WJ5B 4WFFE 2FDBP 4K8RL 5K9OB 4YNYA 2R1WB 4JY6B 1XIWA 3CD4A 2UUDH 4JFZH 4BFBD 4LHUB 4XWGH 3MZGB 3V6ZB 2GCYB 1S5IH 2VDKH 1JZ7A 3DPBA 5SX4H 3T0AA 2DQJL 4HUXB 5GZND 3RQ3A 3VW3L 1M7IB 5I1GL 5DMIH 3QEGL 4JY5H 2F53E 5KJRH 5EFIA 3I50H 4OLYL 2W9DL 4PR5B 1IM9B 5JMOC 3UJJL 3GMPB 5CILL 4RGND 3AY4A 3OGOE 5I8EB 2WZPD 1P84K 3O2VL 2IPTL 1MH5B 4LLYB 2R1WA 4JY6A 1ROWA 4YO0B 1LE9B 4ZUWB 5I2IB 5D72L 5DQJB 3F7VB 1YMMB 5AD0A 5HVHB 3U0PB 4MGXA 3NZHL 1OAQH 1WLHA 3N85H 1D5ZA 2X6MA 3KPQA 1FE8H 3V9FA 3BDYH 2VR4A 3AUVA 3SKMB 3ZTJG 2IGFL 5EOQH 4YC2C 4UUJB 1YY8B 4G5ZL 4PY8I 3LMJH 4I5BA 2XTJC 1MI5A 3QPQC 2YA0A 5DR5L 5C0CB 3O6LH 2CKBH 5EIIB 3UBXI 3QHTC 3MA7B 5ID1A 4JO4L 2PYEE 2HMIC 1ITBB 4PV9A 5C70A 4NHUB 4PJGE 4S0SD 3T3PE 5T1KB 1MHCA 2LU7A 2J12B 2AJVL 3LPWA 4WU7A 4MHHG 5LGKA 1EMTL 4GAJL 3EHBD 1F4YL 3QUYB 1VERA 3OR7B 1JNLL 3MJ9L 3F58H 4N8VG 5DEGB 4JVPA 3MOAL 1T21A 5FUCC 4ZO7A 2DIJA 2FJGB 2FIKA 1U3YA 4IOSD 3VXNA 2R8SL 1J0KA 1NH6A 5DUMH 2JK5B 2H6PB 1CFSA 4F33A 1CU4H 5JOFB 3QB7C 2JIXD 2NPLX 1L6ZA 4GRLC 3UZVB 1GZQA 2VLJE 1LDPL 2HT4D 3MC0A 2EYTB 1GSMA 4F58H 4D8PA 3VRLE 3NFSH 3VXOA 2VIRB 3UTSA 4Z7NF 2XWJB 4WEBL 5AZEL 1M7DA 4L9LC 4I0KA 3SQOH 3NVQA 4NHCL 2YS4A 2EDXA 1HINL 2BNRA 2H6PA 2HFTA 3KVQA 3EOTH 1LK3H 5DDHA 3R0NA 2VDLL 3VH8B 1BIHA 3AGVA 1ZT4A 1A3LL 1BJ1J 2FECL 2W9EH 3E8UH 3V52H 3WFEL 4PS4H 2DQIH 1F3DJ 1A2YA 4UIKL 5J7CC 1QQDA 2V5TA 4Y2DC 1IC4L 1B4RA 1ZHNB 3LCYA 3W5NA 4MS8C 5FUOL 3IAPA 5GS0D 1MFCH 3L5WB 3OKYA 4NZDA 4WEMB 2XN9B 3VXRB 5FYLD 4XP4L 3BZDA 2XWTA 4Z7WB 4XWOD 2BVYA 4HG4J 1TVHB 4L4JA 4FQ1H 4MMXC 5MI0B 1U91A 1I7ZA 3SQBA 2GITB 1B4JH 1KLUA 1QFWL 3GB7A 1RUPH 2C1PB 4K8RD 4LLWB 5I76A 3TO2A 2AXJA 3WFCL 2CMRH 2EKJA 2BSRA 2IFGA 1Z5LB 3L3KB 2EDYA 2IAND 4I2XE 3RU8L 4G8EB 2VXVH 3VGHA 4GRLA 2Y36H 4DVRH 1ACYH 1K8IA 2X4RA 4QF1A 1V7NH 4HT1H 4NQDA 3M45A 4YDIL 2HLFC 2AV7B 4J23A 4LSTL 4KUCF 2R1XA 4YDKH 1B3JA 2MWCA 4AEIL 5K9JL 2A9MH 5I75C 4NQUA 1T6VN 2D0HA 2YPLB 2CKBA 4X6FB 2CK2A 4L9LA 1X6LA 1YEGL 5MP6L 4LVNB 2MPAL 3CSYB 3KPSA 4YDJA 4WW2C 4G8EA 3Q6GL 3JXAA 3VGBA 3B3IB 2V9RA 4NKMB 2DDQH 5IG7A 3CDCA 1OCWL 3MRMA 3VD3A 2E5EA 2NW3B 1RUAL 3IVKA 1BIIA 4UINL 4Y2DA 4NM4H 3VI4E 5TH2A 4R6UA 4NPYB 3O2WH 2YD2A 2YXFA 3MLYH 1A1MA 2DTML 1CN4A 2EECA 2FGWH 4RZCB 3LN5A 5JW4N 3PHSA 3SCMB 1HOCA 1XF5B 3BMVA 3U4BL 2HFFA 3D48R 4L1DA 4NGHL 4JFFB 5ETUA 1DBJL 5BZWA 4CAGA 4C56D 4OF7A 1AXTH 4MNGB 3PV6B 3EGSA 4RIRB 5E5RB 1T1YB 2AJXH 2EZ0C 4KHXH 4WHDA 3FO9B 1IGJB 1A6VH 4N90E 4WUUE 3QJHB 4M61B 2SEBB 4NPYA 4UQ3B 4PTUB 1I1AD 2VRAA 1YMHB 1L9NA 1K2DA 1Y6KR 3GO1H 5JIKA 4HWEH 1EDQA 4G8IB 1A1OA 4D9LH 4PJXA 4GMSL 1QBML 4XXCC 4JG0H 1NFDE 2N1KA 4F7PB 1HH9A 4KKCD 3OMZA 4X0KA 2WP3T 1YNTA 4PRAB 3STLA 4RIRA 4KZEL 3ARED 3WXWL 4BUHA 4HJJH 1JTPA 1RHHB 5DHVB 1D9KC 2P5ED 3W82A 4TUJA 3RP1A 2C1OB 4Q7DA 5AYUH 4WW2A 4FFYL 4R96A 3VXSE 4U2ZA 3RX5A 1QSZA 1T22B 4BFEA 1AQDA 1H8NA 2Y7QB 4J3WA 4EIZC 3QNZA 4JQXC 4R8WH 2VLMD 3ZO0A 1L0XA 2EH8H 1P9MC 4I0PD 4XVSH 1BX2B 5DJZB 3GZKA 2YPKB 4GW5A 1D5BA 1ZGLP 3UYRL 1RHHA 5TJWK 4M9PA 1HZHL 3WL9B 3PWLB 1JZ3A 4J6RL 1T1XA 2BMKB 5B39B 2B4CH 3KWWA 2YZ8A 4YHKL 4PJBF 3OWEA 4XH2A 4N0UA 5IM7A 4PJGB 3IDGB 4LLQA 5DMGC 5FM5O 1OP3K 1YQ2A 3GHEL 5A1AA 1FNEB 4KPHL 2DOCA 4WGWB 2YPKA 1M7XA 4OB5H 4DAGH 3CVIH 4YFDB 1P6FA 1QZ1A 3CFDA 5DRWA 2K7QA 1LNUB 1DL7H 4X6DA 2AXFB 2BY1A 2ZG2A 2NX5E 4OZGB 4X99A 1HWGB 2GW5A 3G6AA 4PJ5E 5C7XH 1FL6A 5EUOE 4GG6E 4XXCA 1F2XK 3T0EC 4XBPA 4RGOH 3CH1A 4YDVB 5K93A 4JPWH 3QUKA 5I1AB 4XVJH 1LK2B 5JQHC 5FGBC 1I7TB 2ZUWA 4HCRH 2BCKB 1NCDL 3ARFB 4WO4D 4ONHA 2VLJB 2LAGB 3PHQA 4WWKA 1D9KA 4NO5A 5DRZA 5J1AA 4K7FB 3IU4L 5C0BE 1AO7B 6FABL 5FB8B 5GGTL 1I3GH 4S1QL 3CPLA 3NN8A 5E2JA 1B6UA 5FUZL 3BESR 1I9IL 5ADOL 1J18A 4JQXA 1JF1B 1P9MA 1I8IA 2QADD 4ZSOA 2VITA 5CUSH 2PW1A 1EIBA 2AQ1A 2R2BA 1JFQH 4OCWL 3LKRB 1WTGT 1BFOB 1CE1L 4RGNC 3DWTA 4UQ2B 1A5FH 1ZLVK 3LEYL 5IMMB 3WFDH 4RA3A 3HNVL 3HAEB 3WUZA 1VGEL 4GKSB 5DD3L 2HN7A 5T1LA 1FBIH 2HRPH 4O4YL 4EBQH 3H9SB 4LSQH 4ODVL 5FXCH 4JZNA 5B38B 1WC7A 4OIBA 3VG0H 4ZNCD 3ESUF 5JOPE 3LHPL 2FLRT 3BSZL 2ZCKL 3L3DB 1FNFA 3PQYE 3X17A 3UC0H 3H3BC 1R3JB 1A3QA 2HTKD 2V7HB 3NAAH 5IMMA 2OJZH 4HXBH 1WIUA 4ZFZA 3DX6B 2IEPA 1AP2B 3T0EA 4K3HA 5CZXC 1IARB 4PRNB 4TUOA 4TVPE 1IGYB 1KLGB 5FGCE 3SDXF 2WWKO 5FYJH 3SE8H 5GHWH 5FGBA 4YJZL 4I18B 3TGXA 4WW1A 3CVHL 4JRXA 3EHBC 3ROOA 1U41A 4QRUA 3FL7A 1XGRA 3T2PA 4N8CL 4NKDB 5FA4B 3IAQA 5E6YA 3SDDB 4JO1L 1BAFL 1YEDA 3WIFA 3PWJA 3GMMB 4MNQA 2GJJA 3WLBB 1AJ7H 5DGRA 3NCJL 2GSGA 4U1SA 1FNGA 3UTTB 2DM2A 5JQ6L 2FHCA 2CDGB 5AZ2L 4CJ1A 3X13A 2YK1L 3K4ZA 5GS3A 5DJ0B 3RWJB 4FQXD 2HT4C 5HYJD 3RVWC 5GQBA 1YEIL 3QBTB 5D8JL 2XICA 4K3DL 5EC2B 3MV7D 1X6NA 3HNSL 5T3XL 1C16A 1H3UA 1TZGL 3CSPA 2DICA 1JZ2A 1V3LA 4M7LT 4BZ2H 1C1EL 3I3BA 3QULB 4HS6B 5JO5A 3VGAC 1TITA 4HPOH 2GTZB 1QLRB 3QQ4B 4YBQC 1WWWX 3BKMH 2ZCLH 4Z7UE 4XHJD 2G75A 3LB6D 3PG2A 4GXUN 1JRHI 5E7FA 5T1DH 1T1WA 5DYOB 3D0LB 4EI5D 1N5AB 2L0DA 4Z95L 5GGVH 5BZDA 5LGJB 2DJ4A 4JFYA 5ALCL 4HCRA 3O3AA 4ZTPL 5LWYL 1RULL 3MRJB 4Y19D 3C08H 5GRVL 3TFKC 1Z3GH 4HZLB 4DGIH 1AI1L 2ZG1A 3W39B 2GTZA 1QLRA 3LN9A 3SGDH 5GS0C 4GKZB 4EVNA 4LLDB 5GS1A 1LE5A 5F1SA 1OTUD 1JYWA 2BY2A 3ULSA 3PNWA 4KUZH 3EKCA 2GUOA 4EOWL 4OZIA 3MRCB 4LK4A 1GGBL 2W91A 3WO4B 4OD2A 4J3VA 1U3ZA 2R4RH 2HT3C 3MRJA 5EU5B 1NFDB 4K8RC 4D9QE 4QNPE 4HZLA 3VXQB 3RKPA 3KLDA 5C0AE 3X3GH 4O2CA 3WS6A 3RY4A 2C3GA 3CFCH 4JGJA 4QT5B 3DETC 3VXSB 3CMOL 5J6GB 5F1OB 4JZJB 1KCVH 2A2QT 4AEEA 2BHYA 3LRSB 4LCYB 5D2NB 3T2QA 3ARBC 2DIBA 5ABDE 1AHWA 4EXKA 2QR0B 4M3JA 1OPGL 3ORJA 1WT5C 1PSKL 3UCRA 4P49A 4X83A 2A9NH 2EEAA 5TGBB 3DMMD 3CDGB 3VE0B 3LS5H 2QKIB 1UQSA 1NAKH 1S7RA 2WV3A 4HH9A 3WE6B 3ZTNL 4MQ7A 4UAOC 2EDTA 3HUJE 3HB3C 1IAIM 3DSFH 2I27N 4PRHE 1KCRH 2F5BH 1WV7T 4H0HB 3TEUA 1L0QA 4N9GB 4PJHF 5L2KA 3QXAA 2B0SH 2NX5B 1AC6A 2IPKB 3VE0A 2O5YL 2WQRA 3T2NL 1HSAA 2CUIA 3NA4A 3B4NA 1F13A 5EUOB 5C0RH 4GG6B 4GRWB 3V6BR 2XIDA 1E27A 3UX9B 2DBLL 1MF2H 3FMGL 3G08B 3QCVH 1I1AC 5JW4Q 1NEZA 5KAQG 3QZWB 3RTQD 4KVCH 2YD8A 4NN7C 5ID0B 4S2SA 4G7VH 3BWAB 4NQCD 4YR6B 1PZ5B 5KS9A 4MHHI 4MJIB 3SOBL 3B9VA 2C3VB 3GSNB 4OIIL 3QUXB 4DTGH 3ARBA 4P2RA 5C08B 4LLUB 3MJGX 3V6OC 5I74B 5MENE 4HSQA 5ANME 5F96H 1WT5A 5CCKL 4P9HH 2D7TH 5T3XD 2Q8BL 4U6TA 1E4XL 1G1CA 2YUVA 3ZKXC 3RPIA 4QEGA 3QDMD 5D7KD 5E6IB 4ODXA 2OS7A 3E2HB 4X9GA 5I30H 3BWAA 2M2DA 5CEXB 4I4WA 2X4PA 1CGSH 1UA6L 2NTFA 1JWSB 2PN5A 3WUWA 1NMAL 1HCVA 1ZA6A 1O0VA 2R0LL 5F7LB 5HI4D 4FZEL 1EH9A 2NR6C 4PRPE 3P73B 3VFUB 4YDLB 2A83A 1QKZL 3PQYB 2GK2A 3QIBA 5HHME 1BQUA 4NOBA 3IF1B 2VISB 3VWJD 2Z0BA 2WM0A 4M7LL 3I3DA 5GJTL 3DO7A 1X5XA 5SWZE 4HG4K 4M1CD 1FVEB 2OR9L 1QLEH 4CNIB 1YDPB 2CJUH 4PREA 1N2RB 1XGUA 1Z0MA 1BQHB 5FGCB 1GGUA 1Q94A 2BOBA 4QRTA 2FD6H 2XQBH 5DXWA 1CXFA 4JO2L 5BW7A 3MFGB 5EORH 1Y0LA 3ARDA 2ITDA 4UILH 1KF9B 3R0MA 1KCUL 5DRNA 5MEPB 2P8MB 1FIGH 1LO4H 3GM8A 5EUKB 4G8GA 3V5DA 2FJHA 1CLOL 1WFNA 2RFXB 4G6AD 2EO1A 5MEOA 3K74B 4ZUUA 4IRJA 5F1IB 4MD4A 1D5MB 1TQCC 1BFVL 4MJ6A 5C0EA 3W9EB 5DLMH 1XF4B 4WO4C 1BD2B 4YXKL 3MRHA 4OV5B 3HR5A 4M1GH 3UAJD 1JN6A 1A3RL 3FFCD 1S7UB 4OF3A 1CVSC 5DD0H 3VRIA 2VE6A 2XPGA 2VR5A 5EUKA 1MY7A 2R15A 2DTSA 5DJCB 4Y4HB 2Z31D 4KI1A 4Z7UB 4EXPX 4NQVB 1YZZA 4LAQH 1ZTXH 4HF5H 4MDJB 1S7QB 2ZNWA 2EDRA 4OV5A 1JUFA 4BZ1L 1YNKH 1H5BA 3CLFL 4MA7H 1IGML 3VXUD 4HGWB 3IJYA 3QEQD 3TP4A 3QP3A 4PRIE 1ZE3C 3INUH 1J5OH 5E2UL 3OX8A 3PXJA 1WZLA 4POZD 2RCSL 5D93B 4G7YH 1FSKC 2GSIA 3RWDA 5L0QC 2WLYA 4HKZB 2HAZA 1IAOA 2QQKL 1R3HB 1A7PL 5IROA 2HFGL 2EDEA 4JRYD 3DSNA 4J12A 3BHBB 1R3IH 2C26A 3ULUL 2AAVA 3HHRB 1OARL 3JTSB 4KWUA 3QIWD 2VC2H 2E7CA 5EBLA 3L3GA 1KEGL 1QRKA 2FATH 4GW4B 5I8OH 1FNHA 3OF6D 4HZAA 3DLQR 3JUYA 5C0AB 1JGVL 2BVPB 4HKZA 1NCBH 4KHTH 5BS0B 1ZSDA 1L4IA 1OQOA 1N7MH 5AWNH 2ARWA 3SGKC 4L29A 3MXWL 1QFOA 4KI5E 1YPZE 2MFNA 4X4MA 1JV5A 1K4CA 4KY1H 3MRLA 3IDNA 2DD8L 4FXLA 3QAZB 5HYSA 3SKNA 3FRPA 3G5XB 2F19L 3MGAA 4YFLI 2GHWB 1MEXH 4QGYA 5INDB 4X4XB 2VLLA 5JMRA 2D0GA 2J88L 5GRXG 1BM3L 1MREH 5C0IA 5FHAH 3QRGH 4J3XA 3RZCB 4GBXC 4KROB 4AIOA 1G0DA 3NIGE 3O3DB 4J7RA 4FG6C 3TIDA 2GT9A 5C2BL 1Z9OA 4UNVA 4M3KB 4DVBA 3ARVA 1KYOK 4GUPB 3RWEB 1YUHB 3EO1B 4NNPH 4P5MA 1J8HA 1NUFA 1D5XB 3H9YA 4PRHB 1LEKA 1HYSD 4PJIA 1P2CB 2X89D 4NBYB 4ALAH 4P2QA 4EI5C 2VZTA 1Y6MR 4GJTB 3DHMA 3FT2B 2B39A 4K23H 1AFVL 4HPYH 4MA8L 3O3DA 5A2FA 4QRPD 3VXPB 4TNVF 2GQHA 2OLDA 4DN4H 4E42B 2DBJA 2OK0H 5IB3B 3HPLB 3J7HA 3O6FC 3VRJA 2G60H 3AMKA 5L8LB 3WJJA 3A6OA 1NBVL 4S10A 3CJJA 1Q9KB 4HV8B 3EO9H 4QHKI 4S11A 5IMLA 3WD5L 3SGKA 4JN1H 3MLSH 3TBSA 1OTTD 4RNRB 5E2VH 1A22B 4OQ1A 2NY2B 4ODSL 5T1MA 1SYSA 1XH3A 4RAUB 3PJSA 4DGVL 4YK4C 2HJLA 1IL1B 3HZMB 4QOKD 2XTJE 5FOBB 4KJPD 2COQA 5C3LD 2J5LB 1KCSH 1OAKL 5CGTA 4R97B 2YD9A 4OI9A 3TA3C 5J57B 4GBXA 1UXSA 1Q0YL 1TZIB 3SDCB 4YX2L 4OTXL 2J6EL 4KTEH 3L9RA 1NEZG 1IQDB 3DO3A 5HBBA 3OBAA 1WF5A 1F6LL 3BZFA 2XY2A 3O4LB 4O5LH 1F90L 4UDUA 3D87B 1RIHH 4ODHH 2O5ZL 1JL8A 1A7QH 1J87A 5FOBA 5DRXB 1HHJA 2GTWA 4UT9L 4U05A 5HHMB 4C59B 4G6FD 1S9VB 3BDBA 2A73A 5FUCE 3B43A 5SWZB 3H42H 1G6RL 4J3OC 5IHZB 1FYTE 4N0FB 3S88L 3ULUD 4OI8A 3O6FA 1JHTA 1YEJL 2VLRD 1AE6H 5H2BA 1WGOA 1NKOA 2JELL 5C0DB 4PD4J 4NQDE 3QNYA 3WUWG 4PJEA 1KB5B 3NFNB 3C5ZD 1W0YT 4OT1H 2V5RA 3PP4L 3RL2B 4X6CF 3RGVB 3JTTA 2VZOA 4NWUH 1LWRA 5FGRA 2EIEA 5TF1H 4H88H 2FH6A 1L7TH 1KN4L 3PWVA 5GGRB 5KSAB 1J11A 5IOPA 4X80H 3V6FA 4PP2B 3F7PC 3T0VA 3RKDC 3KPSE 4E5XA 4WWID 3W9DA 3RTQC 2DQEH 2HT2C 4Z7QE 4OM0H 4L8CB 5E9DE 4KQ4L 5K59F 3REWB 4Z7VE 1RSFA 3TA3A 3QDGA 3GSVB 1TXKA 4F15B 4V2CB 3RL2A 2BY0A 5GGSA 4LCWD 1CR9L 5I66B 5SX4I 5GJSL 4Y4KB 5GGRA 2IBZY 1HK6A 4WFHD 3PGDB 3MRPA 3KPNB 3RJQB 5K33A 3EZ8A 4PJ7F 1UXWA 2FSEB 3Q3GB 2PTTA 4Z78A 3A6CH 2BHUA 3TN0C 4XVTH 2OYPA 1SYVB 3C2AH 2Z91B 4MXWL 5H35B 4U1GB 4G43B 4LNVA 1B0GA 3BIAX 2KQMA 2VDNL 5CJ5A 5FYJU 1X5ZA 4KGJA 1A6WH 4KJWD 5HI4C 3ILPA 3TBWA 1U93B 4GAGL 5F9JA 3BQUD 4Y4KA 5C6TL 4YGVB 5DK2B 5DC4B 2YD6A 5J11B 3GSXB 5ITFB 3DARA 3T0XA 3X14A 4MAYB 4HMCA 1UZ8A 2DJUA 1KIRB 5I15L 1X5IA 2UWEA 4HJGB 5IBTH 5CD5D 2C4FT 4LBEB 1N64H 2QQNH 1OGAA 1BLNB 3HPJA 4XPAH 2VDOH 4R7NA 4M6MH 1NL0L 1OAUH 4RISL 4OCNC 5D9SB 1U93A 2P7TA 3QIUA 3TYGH 5DJXB 4V1DB 2BNQB 2DQTH 4FQJL 1HHGB 1F8TH 3G5ZA 5GISH 3C8KA 4KH2A 4OGAD 4C55A 1YPZB 4G80A 5ITFA 1JGUL 1N4XH 2ESVB 5E5MA 4OF6A 1MFBH 1T7WA 4IMLA 1ZWIA 5M95B 3I84A 2E6QA 3KGRA 3PWUB 4ZODA 3QCUL 4XPBL 2LAAA 3T1FA 2B1AL 2ENYA 2GK0B 3VFSA 3R1GH 5IHUL 1MCSA 1A1NB 5CJQL 1NGXB 4UV7H 1DJSA 5IGXL 4JM2C 3TN0A 2MSPA 2B1HH 4RGMB 5C0NC 2IJ0C 4HIJA 1EFXA 1UWEH 1FH5L 2VERN 2WUBH 2CDEB 2DLFL 4PGEB 3HA0A 1P1ZB 5IFHH 2VQ1B 3PWUA 2Z31C 1OB1A 3BGMB 4UV4L 3CFEB 4DOHB 3O9WD 3I2CL 3P2TA 4NRYA 4O51A 3HG1E 3TBYA 3G6JA 3MOBL 2FEEI 2GK0A 4R26H 1YQVL 2AJYL 3CFBA 5HYSG 5JHDA 1W8OA 3QXUA 1KPVB 4P4RB 3PIQA 3IDXL 5F7WC 3KNBA 4PJ8A 4XAKD 2CIKA 5KSBB 4D9RE 5E95B 3EDFA 4GSDH 4XPHH 5I8KL 2BDNH 3DURA 2R0ZL 3GMQB 4MLIA 3MBXL 5D5MF 4U1HA 3BUTA 4PJ9D 1U8NB 2ZP0T 4KJQC 1J1PL 1IFHH 2ADIB 1A14H 4WV1B 5IMKB 5IQ7H 1J10A 2PR4H 5ICYB 4P4RA 3FQXA 3OKKB 4YBHA 1BFSA 4Y7MA 5DJAB 1X5AA 4EDWH 4LEOB 5CJBA 4ZSOE 3F12B 3SE3A 2AXHA 3WDJA 1DFBH 1LP9F 3QWOB 5BRZA 1TCMA 3ZE2E 4QHLB 4YC2B 3S35L 4IRSD 4A6YH 5LKNA 2XTJB 2J2ZA 2ZUUA 1AGFB 3HRZA 5IW6B 1S8DA 2EYSA 2VNCA 1MJ7H 4F9PC 5EBGA 1KGCD 4LSRH 3CNKA 4RMUA 3QG7H 4JM2A 2J4WL 4R7DB 4ACPA 2WLZA 3SO5A 2P1YA 3I9GL 4Z0XA 3KLSA 4OLZL 4KRPB 4LIQE 5JW5B 1B2WL 4L5FH 4XI5C 3CXDL 4HIHB 3EJYC 3BXNA 3LQMA 1ZANL 1MCCA 3OKLB 4Q0XH 3D3VA 3IFLL 1XGPA 4Y4FB 5F8QC 3BMWA 2LU3A 3HI5H 3OKMB 3VFNA 1BBJB 5BVJA 3ZYIA 3D9AH 1J0JA 3NBNA 1MJJA 4HIXL 3VG9C 4DFIA 3IAGC 2BK8A 3T0EE 5HDBF 4MB4A 1G7MA 5ICZA