4KKBC

Structure of the e148a mutant of clc-ec1 deltanc construct in 20mm fluoride and 20mm bromide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
b'VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter ClcA
molecule tags Transport protein
source organism Escherichia coli
publication title Fluoride-dependent interruption of the transport cycle of a CLC Cl(-)/H(+) antiporter.
pubmed doi rcsb
total genus 40
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kkbC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kkbC01
3SY0A 3LN4A 4KKNA 3ARDC 3TJHC 2DB8A 1PKQA 3MV9D 3K1KC 4OGYH 1IC7L 3OKEA 5GS0L 1F13A 3S36L 1FNAA 2C4FU 4J8RB 2ATKA 1MHEA 1OP9A 4KQ4L 3QHFL 1MFBH 5C0CB 3TO2A 4KGJA 2ED8A 4OZ4A 1FZOB 5C0IB 3O2DA 1FVEB 3DRTA 1A9EB 2VLKE 3U83A 5EZOH 1P69B 4YPGA 4NO3A 3RRQA 4G6FD 2JIXA 1I1AA 3HA0A 4QHMA 4QRTB 3OWEA 3RP1A 1R5WA 2VL5B 3CFDB 4ELME 1NUNB 1W0WA 4OB5H 5GGRB 3IDJB 3MCKB 4MB4A 5IQ9A 3C09B 1DQQB 1HOCB 4NO0D 2R8SL 1KPUA 1D5BA 4M5YL 1T22B 4X6FB 2EDEA 1P2CB 1C5BL 4Y5VA 1NANH 3GO1H 5C07B 1CDHA 2Q3ZA 3B9DA 3QI9D 5GSVB 2FLBT 3VRIB 5KG9B 3HZKA 1R5IB 3I6KB 3L7FA 1Z0NA 3DUHA 1U3JA 4XX1E 3CD4A 2YUWA 5CCKL 1CWVA 2ZUYA 3HE6A 4JDTH 3IDNA 3HR6A 1PLGH 1ED3B 3VGGA 3FB5B 1UJ3B 4P3DB 3LD8C 1IKNA 4LEXH 3C9NB 3T04D 1JHKL 4FQQA 4M3JA 4BK5A 3P4OB 4LHUA 1A3RH 2G75A 3P9MA 5DWUH 5K33A 4NJ9L 4NN6C 1CGXA 4NUGL 3STBA 4W6WB 4B0MM 4F9PC 2X41A 4WW2B 2K3TA 4OFPA 1JNNL 2GTWB 2Q6WB 1F97A 4HJGB 4AG4L 1YY8B 3BP5B 1A6WL 4L9LB 5BZDA 1SBSH 3WL9B 2Q8AL 3DMMD 1R3HB 4GRWB 3FQWA 1GGCL 1ZHBB 3VXPB 3RBGA 4EOWH 1S7WB 4WHYH 4KDVA 3M1BA 3BAEH 5I8EA 5F9WC 2I5YH 4O51B 1T22A 4C83B 2MCG1 4DKEL 1NGWA 3TBVA 1OB1B 1CF8H 5H94A 4L3EE 1GGYA 1AP2B 4G8IA 4HS3A 1KT2A 4NQDA 4BZ1H 2F8OA 3D0LA 1RIVL 3ZKXC 5H35B 3DX8A 3ARED 2GFBA 4UUJB 4LCUB 5E8DH 5GS2D 3VRJA 3STZA 5DD6A 3U0WH 1MY5A 4EBQL 1J8HB 3KHOA 3MRQA 3W9EB 3HE7D 5JHDA 3Q6FB 2VDKL 3RWIA 5LXGH 1D5XB 2K7QA 1YYLH 5D93B 3PWPA 4NQVA 1UJ3A 1YEHL 5JIKA 1OM3H 2FZ3A 4HDIA 5D7LD 3ORJA 5GGVH 3NZ8A 4OZ4B 2Z31B 5CD5D 3N1MC 4U6TA 2FX8L 3KPSD 3DRQB 3RGVC 3B2UC 5DFTA 4PV9A 1E27A 3EJZC 3Q1SL 4Z78B 3LY6A 1G7MB 2ED7A 3HFMH 5LAXA 5DJXA 2P5ED 4JPIB 3ZZ1A 3O6ML 3OB0K 4XH2A 1DUZA 5JNYA 1JNHB 1DFBH 2BOCA 2FJHA 2FEEL 2D7OA 3I9GH 4O2FB 3U7YH 3G6JF 5AZ2L 4UILL 4X6DA 1DJSA 5DUBA 3VWJA 3QJHA 5F88A 4JFZH 3G6JE 2GJZB 4XWGH 1H0DA 3ARVA 5HDOA 4UU9A 3KLAA 3PABB 1EAJA 3MACH 4QXGH 4LFHD 1UT9A 4TTGA 4MSWB 1YZZA 4L4TD 5TQ2H 5I2IB 1Q0XH 2A9NH 2YD6A 4K3GA 1IT9L 1GHFH 2GJ6B 3NFSH 1XT5A 2NR6D 3NCYP 4WUUA 5JQHC 1CD8A 5DMIL 1HNGA 5FV2A 1BAFH 5CEXA 5HHXH 1G0YR 1QBAA 3INUL 3KJ4C 5CBEA 2ZUWA 5EPMB 1RUAL 3L3KB 5IVXF 1U91B 32C2A 4BYHA 4JO1H 3EYOB 4XPAH 3FONA 4D9RD 3UO1H 3JV6B 2AEQL 5TDOA 3RHWF 4PGJA 2CDGB 3TIEA 1N4XH 4ZOAA 5DK2A 43C9B 2AK4B 4CJ0A 4F58L 3UJTH 2JB6B 1CI5A 4RWHA 1S5HA 4G9DA 1KIQB 1QO3B 5CSZA 1WQVT 4NUJB 2X1PA 4MNHA 4HUVB 4U05A 4UU9B 4G8GD 1NEUA 3KYOB 3BIAX 4L3AA 4PJIF 4U1SA 4MQ7A 1VADB 4LVEA 2FR4A 4MX7A 3QQ4A 4OZGB 4U6VL 3RU8L 1GOHA 2XTJC 4KUZL 5AZEL 4NQCA 4UIMA 15C8L 3FQTB 3FB8A 2HT2D 3F58H 1DR9A 2BRRL 4O4YL 3SDCB 1I9IL 4PRAB 3ALWA 4HBCH 4NRXB 3O81A 5KN5B 4L4VE 3KPPB 3KPNB 4IHOB 4CU8A 1AI1L 3GKWL 3HR5A 3U0WL 1HH6A 3OAYK 5GS1A 4CDHA 2FHFA 3MGTA 3T09A 4IJ3B 4XPHH 2F19H 2X4QB 4ZOEA 4GG6E 3RDTA 1JNHA 4QRRE 3VGDA 4RISH 5IB4B 3L5JA 3RL2B 2HFEB 2FJGB 4YZFE 3F12A 2VQ1B 2DBJA 2I5YL 4Z7QF 1S9KC 1F3DJ 2ENSA 1Q38A 1CLZH 5C0NC 3LS4H 5ETUA 2E6JA 1CXKA 5IFJB 4HUNB 4PJBB 4HUVA 4E41E 3U9PH 2N56A 4RZCA 1CFVH 4XI5C 3IKCB 1A14L 1EGJH 3G04A 2AJZA 1RMFL 4JQVC 5E2VL 3T77B 4DCQB 4XHJC 5B8CC 1AR1C 4WO4A 4Y5YC 5DJYA 3R1GH 4JKPL 2X09A 4JY5H 2D03L 4LCYB 3KPRE 3CLEH 2YA2A 32C2B 3QCVH 4LBEA 4QHNB 1ZT4B 5AAWA 4OZFB 5A2JH 1FG2A 2YA1A 1N3NB 4OZHA 4IRJD 4W68A 5HYJE 4HMEA 3RVVC 3TNMB 2CPCA 2F74A 3OAYH 1KELL 5TF1L 1NDMA 3MOBL 4KXZH 2EDNA 1OTSD 4YC2B 2HG5B 4G6AD 3OKOB 5JXAH 5BV7L 1QLFA 2HMID 1VEMA 3HUJA 1E28B 1OM3L 3WDHA 3MO1B 3SGKA 1SEBA 1A0QL 3MGOB 5AUMA 4XHQA 4PG9B 3B9VA 3ZTNH 4F9LC 1I8LA 1RIVH 2OL3B 4YNYB 2BNUB 2QBWA 3UJJL 1D5MB 3ECBB 5HYJB 2LFGA 1S9YA 4ODUB 3DYPA 3BE1L 1LQSR 1HHJB 5CJQL 4KTDH 4XBPB 1TITA 2QHLA 2F8VA 3MRQB 2JELH 4TNVK 3VFOB 4MDIA 1ZWIA 3VD5A 5DJZB 4RFEB 5MEND 4LSSL 2NXZC 4ONGH 3WFHB 3OHXA 1BBDL 1DUYB 35C8H 3S35X 1YMHB 2CKNA 5IF0A 1KV3A 3H2WA 5HHOA 5LBSL 2C7UA 1QPXA 3MRCB 3JTSA 3D3VA 4O58H 4U6XB 4MVBC 1CYGA 5F89B 3O2WL 4GJTB 1FDLL 1SMAA 4XH2B 2CR3A 1K85A 3RWFB 4K23L 4OD3H 4M93C 4QKXB 1BBJB 1MWAB 4CRPA 3G6AA 1LO4L 3SDXF 4HQQH 3NCCB 3B4NA 3SGDI 2BHZA 4PD4J 5DJ8A 2EYSA 3STLA 4KFZC 4Q9BA 4GG6B 1UZ6E 1J05A 3VGAB 4IOIA 5FOBB 2QSQA 3RNQB 2BY2A 5EU5A 2QADD 2F53B 4YDVA 2CO6B 4LVHB 1I1CA 4ZYKB 4FQXB 4HFUL 4ISVB 1RUKL 4W6XB 1LO3L 3CFBA 5D70L 1WC7A 5DYOA 3T3MF 4JFZL 2QQNH 3PHQA 4PJ9C 1EDQA 4JHAL 2ZUTA 3HHRB 4OB5L 3SE3C 4QOKB 4QRQA 4H0IA 3QZWB 4I18A 2DIBA 4M6OH 5F7MC 5A16B 1FV1B 5FM5O 5I75B 1OCWL 3TCLA 1P4BL 3ET9F 5IK3B 4GW1A 4F9PA 4YPGB 2CH8A 4PGBB 4GAJH 1ZLUK 1GGUA 4UOJA 5JO5A 1NC2D 3KPQA 4JJ5A 4Y5XB 3QUYD 1P4LB 4HK0B 2VITB 4NQDD 2ICWI 3GJFK 2DKUA 1B4JH 1NFIA 1VFOA 3CFDA 4GQ9L 1G1YA 4CW1A 4NDMB 4HWBA 5LXGL 2XNAB 3MNZB 1PD6A 3GK8H 5GS0H 3MJ8B 1KLUB 4KXZI 1SQ2N 4W4OA 3P4NA 4R4NC 3NPSC 5C9JB 4CNIB 2CRYA 2ZKHL 1G7QA 5DK3A 2I9LB 3ES6B 3WHXB 3MUHL 3P11H 4ODSL 4QTHB 4LLYB 4WWKB 3FJTA 2BOCB 1U3HC 5HDQL 1V7NL 4X0KA 5J9PB 3QISA 5IMLA 2XA3A 1QFWM 3HLAB 3O3DA 3OJ2C 3QAZB 4LSQL 2W9DL 5DZNA 3R0MA 4BH7B 3CSPA 1JHTA 1G7HA 2H26B 2D7TL 2WWKO 1VESA 3MRKB 3QG7H 1ACYH 3NA4A 1P2CA 2WV3A 4OAWA 3MRJB 1CL7I 3AROA 2CK2A 2IQAB 3T3PF 2HYMA 4CVWA 4PJHB 1OAXL 3QDGB 2E9IA 5E2WH 5HD8C 1AGBA 1T21B 1AGDA 1OAYH 3MODL 2OLDA 3OBAA 1RIHH 1LP9A 2FEDD 4KRMB 2OXHA 4HWEH 3EFFB 3P0YH 1Z3GH 2RCSL 4S2SB 3ARQA 5CD3B 3UTTB 3PP3H 1B4JL 2CXKA 3PGFL 4TOYH 4L4TA 3AAZB 4TUJA 2HH0L 5EUKA 1MCQA 4P2QE 1A5FH 1JGEA 4TVPH 3VWJC 5DUMH 4X6EA 4GXUN 4HV8B 3SO3C 5L2KA 1BVLA 3PP4H 3DURA 1IL1B 2VDNH 3MV7E 1RZ7L 2JLLA 5EBMB 4QHKI 3C8KA 3IU4H 1QLEL 1U8NB 1ZANH 1XH3A 5EOCL 4YDVB 1FGNL 4PY7A 1MAMH 3L6FB 4RZCB 1UC6A 5EUOB 5HPMB 4UDUB 1T7XA 1RSFA 4TULH 1CGSL 1CXHA 3PHQB 2BNRB 1DDHB 3B9AA 1XIWD 1B9ZA 2VABA 4UT7L 3MUY1 3CZFB 5DJYB 2NY5C 3RWGB 3UJIL 1QLEH 1ZANL 3L5WB 2C4FT 1KB5B 4XPBH 2YA0A 3BGFC 3LB6D 3I02B 4MS8C 2NXZB 3DRQA 2CK0L 2GQHA 4YHML 4I5BA 5HHNA 5IVNA 4E0RB 3OKLB 3I6LE 3E8UL 4G8GA 1T0NA 3RPIB 1UACL 3V8CA 2ESVE 2VXUH 3WFBL 4S11A 3G9AB 4LARL 2X9WA 1JNLL 2X7LA 4ACPA 1FE8L 3AMKA 5C08D 1NGZA 3MBXL 1UWGL 1KLUA 1ZLVK 4X5WA 4NQCD 2XKNA 3GRWL 2IAMC 3REVA 4BSJA 4LSUL 5DJDA 5FGCE 1BQHA 3CDYA 3IJHB 4EKXA 3P4MA 5I9QB 5LGHL 1S9WA 4U1GB 4LPWA 4NNPL 5DRNA 1MJ7L 3O9WB 3PUCA 4HHAA 12E8L 2MOVA 3L6FA 2VAJA 1T1WB 4OGAC 1QBBA 1UZ6F 3P73A 4NNXB 5E6IC 2VNCA 1G84A 5IMKA 1J10A 1KJ2A 3ETBF 4JFFE 4YR6B 3GSXB 1MCCA 4OLYL 4YH6A 3SDXE 1JPST 2AJUL 2YN5A 4PRNA 5M95B 3BQUC 1GZQB 2GFBB 4NKDA 1N6UA 1QRNA 5FM4A 4P2RE 4M8QA 2RFXA 5KANG 3WUWA 2R1WA 2CKBH 1W8NA 4GRMA 1JGVH 3WIIH 2EDWA 1F42A 4OZHF 2B39A 2IH3B 4F3FB 2Z31A 5JR1L 4RFNC 1F6AA 3FKUS 4PGDA 1B4RA 4PJ5D 2JB6A 2HKFH 1VFBA 1ZA6A 4D0DA 1YECH 2EDJA 4EI5B 1FNGA 4MNHB 4X98B 3TCXA 2DF3A 4UV4L 2O5ZH 1J05B 4DUVA 2A0LC 3SN6N 4Z7VA 4XVTH 4Y88A 3SDXA 4AQOA 1GGIL 1K2DA 4YHKH 4BQ9A 3QEQE 4FG6C 2FJHB 5IHUL 4HAFA 1T03H 3O0RH 3RIAK 4Y4HA 1JYWA 4UNUA 1D9KB 5FO9B 5E2VH 5CWSA 1W0WB 4D9QD 5C0BD 3VD4A 4UT6H 3VD9A 3EOTL 1PX3A 1G6VK 2P8PB 4OLXL 1ZLUH 1L9NA 4KRPD 3RUGB 4NSKB 2FDBP 4AQ1B 1BLNB 5J1TC 2NNAB 4BJLA 1Z0MA 1DLHB 4Z7WB 3GMPB 4YLQT 3FRUA 1VPOL 1BX2A 1R5IA 2BVEA 1ZA3A 1GGBH 4P49A 4KV5F 1S7RB 2HT3D 5DJCB 3KR3L 1LEIB 1WAAF 1CDCA 3HB3C 1EERB 4NM4L 3HN3A 5BRZE 3NIGE 2X70B 3FT2B 4Y4KC 3MXWH 1T83C 2P45B 2OJZH 1JJUA 4AM0A 1EZVY 5C2UB 1J11A 3TZVB 3QUZC 4KK8C 4OV5A 1MFEH 4JFFB 3NIFF 2BERA 5CZXD 2Y06H 3WKNA 1G9EA 1IGCL 3HPLB 2MHAB 4XPFL 2H3NA 5HYEA 1YEIL 2BC4A 3FB7A 3DVNB 5B21A 1HINH 1I8MA 3QNZA 3CH1B 3HLAA 1G0DA 3D3VD 5L6YH 4FFZL 1HI6A 3QNXB 3CC5B 4G9DB 1U8KB 4N1EA 1X5ZA 5I1AB 3ZE2E 1BF2A 4HC1H 4OM1L 3VU2A 4Z0BH 4TRPL 5E8NB 2EZ0D 2A73A 4YZFF 3PGDA 5LGJA 1P84K 2VRAA 2H6PB 3DVFA 5GZOC 3BWAA 3M17A 1ZT4A 1F58L 2JK5B 5IV2B 3ARFC 1UCBL 3T0AA 1HXYA 1XF4A 2J8UF 1CL7H 4BFEA 3HE6B 1YA5A 1J1PH 4QRRA 4NT6A 5D1ZD 3VGBA 4XPBL 4PJBE 3DTXB 2XOTA 1Y6KR 1WZMA 4U1MA 5EU6D 2VZUA 3H7BB 1HYSD 3ARSA 1S7XA 4G7VH 1IC4H 1F6FB 3DNKA 1ZA6B 4PYGA 3MUGB 3D39B 3QJFA 3VXTA 3V6FB 4PG9A 3R06A 3BWUC 1NH6A 4WNQA 3RVTC 3EDEA 2DLIA 4MZ3A 4Y2OA 3KJ6H 5IB4A 4X6CF 5E99H 2MKWA 3FFDA 3U0TA 2HRLA 2AQ3A 3ARTA 2RAMA 3KLHD 4ZTOH 5DUML 4PP1C 4TN9A 3VFSB 1ZV5A 2LU4A 3PWVA 3VW3H 2V2TA 1L0XA 3UYPA 1NC2A 3O4LB 4RQQA 5F88B 4O2EA 4EEEA 2I07A 4QCIB 5AUMB 5JW3L 5KSAB 5ISZB 2VWEC 1S7SB 3C5ZA 3CSYB 2BHYA 1CFTA 2VDQL 4KGLA 4Y4FD 4NQSA 1N59A 5F1NB 3UTSD 2BRQA 5BJTA 3AXLA 2VYRE 1JGDA 3KPRD 3HAEH 2Y07L 4AMKL 3BQUB 3QWOA 4IOSD 4M6MH 3GKZA 5JW4R 4QTIL 1YUHB 1S78C 5E56A 5DT1L 3TN0D 1DFBL 1L7IH 1XGTB 4RISL 3QG7L 4PB0H 4P3WA 4WDIB 2EO9A 4P46C 4M5ZL 1C1EL 1YPZB 4K3JL 1YEKL 1A6ZB 1KB9K 3MRIB 2R1YB 2AQ1A 4PY8J 5J1AA 4O02H 3DXAD 3ARBA 1PG7W 1K6QL 5IW6B 3PWJB 3QXWA 2DAVA 2JJSA 3T0WA 2UWEE 1YEHH 3OKDA 3DV6B 4K94L 1NAML 1IAIL 2C3GA 3CH1A 5CJXA 2XRAH 3ZT6A 4APQA 5KSVA 1T2XA 1FVCA 1YNKH 2AK4A 3AU1A 5JOPD 5IMKB 5ADOH 3CPLA 3S88H 3P0VL 3ESUF 4NFDA 2B1AH 2GJ6E 3SKMB 5C0ND 1UGNA 2OL3A 4MAYB 1MFDL 1AXSB 3BDYH 4GS7B 4UV4H 4C56E 5BVJA 2FX7L 3NTCL 2X1WL 3J7HA 1QBLH 4PJAE 5DR5H 4WFEE 3PIQA 3DTXA 4RAVB 4WV1B 5E5MA 2I26N 5T5FH 3TPUA 4N0YH 1DBJH 3JSSA 4L29A 1JYVA 3GIVB 4LPXA 1HILA 3FOLA 2MJWA 4LSDA 3O45A 4DGYL 4K7FB 3CFEA 5HGGS 4KPHH 2QLVB 3KPLB 4RFNB 2DM4A 4YGVB 2IAMD 3WLBB 4J3SA 1CBVH 1NAMA 1D6EA 1P53A 2DMCA 2VDMH 3EO9L 4L4JA 4XNMB 1N6QH 4MNQB 3BKYL 3IFOA 2CLRA 5SWSD 2CLVA 5DRXB 2ESVD 1KPVA 3CLFL 4Z5RB 2I9LA 3VI4F 5FGRA 1WZLA 1KLGA 3D85A 1LEGA 5E9DD 4JZNB 5E1AB 4P5TA 1AQKH 4X5XB 1RJYB 1KJMA 4P9ML 3MRFA 1OW0A 1IAKA 4XB8A 3P2TA 5CMAA 3O4OC 2QL1A 5IJVB 3ARDD 3TJHD 1BVKA 2HMIC 2R39A 2XTJD 1FZKA 4LNVA 4HJ0D 3X14B 4F9LA 2ORBL 4V2CB 4HIIA 3LV3A 4F33A 2JF1A 1RURL 4YDIL 3BMWA 3D25B 4CNIA 5IFJA 3L5IA 3K8KA 2NNAA 2KQMA 5GGUA 1RK1B 5BQ7A 1S7QB 5HHVH 1FVDB 3V0WH 1D6VL 5GJTL 5B8CB 3IS1X 1PEWA 4KKBC 1DQDL 4LU5L 1QA9A 1MREH 4L5FL 2F58H 5E5MB 1EEYA 3GM0A 4EUPA 4X4MA 3OAUL 2GUOB 3VMPA 3WS6A 5HVWA 4DKFL 4PP2B 3DX9B 3RX7A 1X5FA 1IM3B 4KHTL 1LE5A 3MBEC 4X7SL 5T1LD 3V7AG 5GGSA 4YHMH 5DVMA 3O3UN 1LP9B 2DDQH 4NNYA 1FH5L 1LILA 4X9IA 1EEUA 1MH5A 5IMOA 1EO5A 1PYWA 5GGVL 3GJFH 2X4NA 2BMKB 3GBNH 4X80L 4YUEL 3C6SA 3C87A 2PN5A 3MLYH 2WSKA 4XAWL 5KVEL 3PJSA 3OKOA 3TF7C 3AY4A 3H9ZA 4JY4A 1ORSA 5BVPH 5L8LB 1JHLL 1RI8A 3K4DA 5ICZB 4JFXB 1H8SA 5HI3D 1T7YA 1MAML 3G5ZA 4RCAA 1BD2E 5DMIH 3R4DA 4NO5A 1A1OB 1AC0A 4H8WC 3BWAB 2YSSB 5IV2A 1ORQB 5GXBB 1XGRA 1JI1A 2Q8AH 1I9JL 2H26A 4WU5B 4DUXA 3TPKA 4HEPG 5FECA 3B9EA 4G8EB 1PDKA 1A5FL 5GSRA 3CVIL 3LKRA 4FQLL 5B38G 3WCYA 2NZIA 1A4JA 1IGTB 1UM5L 1D7FA 3V6ZB 4NYLB 1VFAB 3RWEB 2XIDA 5C0BA 1MY7A 1OVZA 5EPMA 3T4AB 2A9MH 4J2XA 4KTEH 5JIHA 5GGSB 5HPOA 4YXKL 2IBZX 4PJIE 3CVIH 1CD0A 1T1XA 4R0LB 3GMRB 4LNRA 4MJ6B 1J1OL 5EIVA 4CUCA 3B8SA 2BJMH 2NXYC 4WW2F 4XCCL 3V5KA 1ETZA 3K8MA 1J0YA 4YGAB 1A6AB 4LSQH 1ZKAA 3WN5A 5DS8A 5FGSA 4YNYA 3RIAF 4DVRL 4ZAKD 3QIWC 4NQED 1S7QA 2JCCE 5LJYH 5E2UH 3H0TA 4EIGB 5HVHC 3CDGA 5HHMB 3A0OA 1BVZA 3DOSA 2AABH 1QUNA 4KC3B 5C6WH 1U3ZA 1HE7A 4HKZA 3CFBB 4H88H 2WZPD 2V5TA 2QKIA 2IADA 4HPOL 4J3OC 5DSCB 3WO3B 3UTZB 4JRXA 1NGQL 4IJ3C 3DBXB 4QOKA 5LGJB 5JOFA 5EZOL 4YHYC 2O26U 1UCTA 4XCEB 4ERSL 4XWOC 1U41A 5DA4A 4LVNC 4POZC 4NRZB 2APXA 4OBSA 2ICEA 5BS0E 3TFKC 4JRYB 5F97E 1OD9A 3EOBA 4HKBB 1EH9A 3C6LD 4L4VA 1YY8A 3BP5A 2HT2C 1YDPA 2W60A 4LQFH 5F7FA 1TIUA 2CIKB 3O3EB 5EO9A 4BSWA 3JXAA 4HXBH 4NGHH 2R4SL 3BH8A 4NUGH 5DJ8B 5SWZA 5H37G 5IB2A 2XTLA 1JZ5A 5EOCJ 1ZOXA 3TA3B 1AY1H 3UYRL 2Z8VC 3WYRA 2EXYD 4JFED 2QQKH 5EBWA 4XPAL 3UYOD 3MREA 1MAJA 4ZYKA 2Q20A 4FQJH 1H3UA 4QOKE 1JWUB 3O2DL 4PLNC 4U7MA 1BF8A 5D1XC 4JDTL 1X4YA 3PIQB 1V8HA 4LIQL 1H3GA 1I75A 1S7RA 4FFWC 4MJ5A 4OM0L 4RAVA 2BVPB 4DJMA 1LEIA 3O2DH 1QR1B 1CGWA 4WCYH 5HYQB 4QCIA 3T4YB 3NN8B 4JB9H 2C9AA 3K1DA 4S1RL 3ZYIA 3FT2A 1F8TL 3WNNA 4EUPH 4KVNL 4AIZA 1TQBC 1F6LL 2HLFC 4AENB 5JW5B 4H0HB 3VXUE 4GAGH 3C5ZD 3GBML 5LAXB 1OSPL 2ICWA 5I1DA 5EU4A 4LQFL 3QDJB 1I7RB 2AGJH 4IS6B 2IC2A 5GJSH 5EIIB 2J8UB 4ALAL 2ZUVA 4LKXB 1AD9A 1G6RL 2VB5A 4QRPE 1C5DB 5C92A 3KPRA 3AAZA 4TUJB 2PTTA 3DGCR 1FH5H 3BPOC 1UEYA 3VE0A 2D0HA 1I7TB 5C9JA 4EI5A 2P8LB 1H0DB 5INCB 4HIEA 2EH7L 3RTQB 3CIQA 1FL6B 5I1GL 4TRPH 1FORL 1EZVX 4MCZB 2IBBA 1QFHA 2OI9C 4NC2B 2ARJA 4H88L 4XXDB 3DVIA 3U46A 1MRCH 5EH1A 3QQ9D 1KC5H 4ZUWA 2NXYB 3FB7B 4JQIL 4XCYA 3BD4A 4GAYA 4GBXC 3B6SB 4U1MB 4LSPL 4PTTB 1HEZB 2VLMD 5E2UL 4MDIB 3SKMA 3CZFA 1JP5A 4PJDA 1ZVSB 2IQ9H 1KIRB 1TCMA 4PJFB 4LOUC 4TSBH 5IR1A 5BVJB 2FSEA 4RRPG 4XPTH 5CINL 1RUPL 5FXCH 4FRWA 4LLAA 4CBPA 3GSWA 1Y0LA 2OL3H 2E6PA 3UZVB 4CN1A 3RKPA 3WXVL 4YQXL 4YXKH 5FYJE 3LD8B 3P40A 3LEXB 2ENYA 3ULUL 1A47A 1OTTC 1N6QL 3V6OA 5BS0D 1ZT7B 2CSPA 1JN6B 1MHHB 2ZUXA 4D94A 2P49B 3PQYA 1ZLWH 4Y1AD 4JZNA 2J12B 2ZCKL 1IEAB 3UCRA 2V7NA 2EIZB 4ODTL 1X5YA 4DEPC 4Y19B 1NSNH 1PKOA 3MLRL 4FMKA 4Y5VB 3MNWA 2EECA 2H32A 1MI5B 1IAMA 4YHIB 4H25B 1T03L 1U8KA 2QQLH 4LSVL 1RZJL 2AEIT 1XZ0A 5H8DA 3MMEB 3REWB 4G6AC 5GSRB 5C0JB 5MI0C 4HAGA 3ZO0A 4OZIE 2EDQA 2I07B 5J56B 1AH1A 1G7JB 1OGAD 2ILLA 3S9DB 1KN4L 3TBTA 2Q8BH 2WIIB 3MRIA 1VB9A 4NCC2 3MBEA 3FB5A 4FNLH 4MWFB 3MRRB 5EA0H 1CN4A 1GOFA 3SE4A 3AB0B 4XXCA 4I77H 1EMTL 4XAWH 2IQ9L 1QPPA 3HRZB 1I3UA 5IB5B 5ENWA 3N1QC 3NPZB 1YQVH 5IVOA 1P7QD 1CK0L 4D3CL 4RGMC 4R2GB 4ZPVB 3V79C 2ZSWA 5TPWL 3DPBA 3QJFB 4PGDB 3DROB 5I0ZA 5AG9A 4R2GC 1A6AA 2DWDB 2Q6WA 1QBMH 4UNVA 1EFXA 5TFSH 4U1HA 4WW2A 1ROWA 3GGWA 4CJ1A 1MUJB 4JG0H 1R5WB 2VL5A 3QP3A 3OKDB 2EC8A 3H9HB 4XP4H 2YK1L 4L9LA 2NCMA 1MCJA 3FO1B 1TJGH 4RIRA 3X13B 4XC3H 12E8H 3OXRB 2R69L 5HHOE 5J4MA 5J11B 3RIFF 5IW1A 4JAMA 1IKNC 4PJFA 3WNMA 3AMLA 1RURH 4OAWB 4PJ5E 5E24E 1WITA 5KZCD 3CVHL 4NO0A 1TVHB 4Z9KB 1N7MH 5AYQA 3L7FB 3P9WB 3TBTB 2J3SA 2Z93A 5IBTL 1JRHI 1MIEL 1MCIA 2D3VA 1JFQL 3A67H 2FHBA 2UWEA 1BFTA 2FWOA 1QFWL 4HUUA 2R0LH 3E3QE 3ARGA 4X7CC 3W9DA 3LSOA 1SJEB 3O11A 4I3RL 1MVFA 2E7MA 2XWBB 1U8HB 1S7TA 1FIEA 3EDDA 1XGUB 2EDOA 4U31A 1U36A 2OCFD 4ODVH 1H5BC 1INEL 2AXFB 2P44B 4U6HA 4JFPA 3T4AA 2MMXA 2A83B 4M1DL 3VXMD 3TT1L 4MNGE 1CFBA 4R7NA 4BELD 5FYLL 1NC4B 3RZCB 3HG1B 4JFHE 1Q9OB 1TVBB 3QIWA 1X7QA 3DYMA 2DYPA 3EZJB 1ZT1A 2B7DT 4HXBL 4FZEH 3K0WA 1A9BA 1FGNH 5DS8B 4QY8B 3K4AA 2KZ1B 1FHGA 1NFDA 1NUGA 1MJUL 4KZEL 5IOPB 4NZRH 4PJ7F 5HYIA 5FUZH 5IWLA 1BD2A 4XAKD 3QDJE 4G3YH 4PFEA 4L3EA 4LLQB 2EXWC 1TQCC 2MPAH 2DTSA 3CCHB 4NQEA 1ZLSH 1P7KA 1WFNA 1DL7H 1IAII 1S9XA 1HHHA 1ORSB 4YJZL 2X89A 4CAGA 2HT3C 4JFYA 2DQDL 4POYA 1KULA 3MV8D 5F7EH 5EBGA 2EYSB 3PWPD 4XI5D 1YEKH 3MR9A 2BX5A 5A2KH 3MXWL 1R5VA 1DN0A 4HKXA 4LL9A 1VFMA 1ZHKB 4S1DC 5EU5B 1HDMA 4PJCE 3T1FB 1CE1H 2B2XH 3DSNA 1NLBL 4JG1L 4PJXF 4HMCA 3OL2A 1YEEH 2P5EA 3CC5A 4B53A 3OGCA 1BVKB 2NY4B 3FQUB 4EOWL 5DUPL 1EVTC 1HOCA 3B3IB 4TUOB 5IW1B 2HN7A 3Q5YA 1REIA 5H2BB 2YRZA 2XXCB 3ARWA 3DIFA 3ZDXE 1NDGB 1GZQA 4L4TE 5J6GB 4JE4B 2A9ML 3VW3L 4ZUUB 1EHLH 3NABL 1A6TA 4WV1A 3WE6A 4HSQA 2HKHH 1FFPA 3ILPA 1OLZA 2VDRH 5GS1C 1CD9B 1DL7L 3TLRA 3O6FD 2GITB 3VJ6B 4J3VA 4X4ZA 2VLKD 1FFNA 1UM4L 4OUOA 4WJ5A 1A7PL 3FN0L 3IAQA 4KRNA 3F7RA 4LLDA 1INDL 4MXVF 3HC0A 4N5ED 5JTWA 4M6OL 1IFHL 1FNEA 1WBXB 4DAGH 2UY7A 2BMKA 2FCBA 4KI5E 5DRZA 1TVBA 3QIWB 4YDLC 1BWWA 3GBMH 5E8EA 5ACZB 3HMXA 3DV6A 4PRHB 2X4RA 4Y16C 3LIZL 5TE4L 1P1ZA 4OCYH 1UWXH 2N4IA 3X12A 5DMJB 5FYLH 5D9SA 3B3IA 4NUJA 1Q94B 3MMEA 3DX8B 2CXGA 5LVEA 4KDTC 3GSRB 3GSQA 1OLLA 1IC1A 2X1XR 1T04A 5MHSD 5FDWA 5EU7E 4F7EB 5TE7H 4OLYH 1LO2H 5DHVH 4NC1C 2L4OA 5DHVA 4R90H 3X3FH 1GH7A 2PW2A 3EYFA 3MRDA 5DD6B 2EDTA 1FAKT 5I1EH 4NZDA 3GIVA 2A2QT 3V4UH 1PZ5A 3O2WH 2WK2A 1PW3A 4OSUL 5KSBE 1IGYA 1I4FA 4C4KT 3KXFA 2OYPA 2BCKA 5E9DE 4ODWA 4GBXB 4FMFA 1OAXH 3EO0B 3IRPX 1IGIH 1G7MA 5DI8A 1DN0B 2E8YA 1X5LA 1M7DA 4PLKC 1ADQL 1ONQB 4IDJH 5C0AB 1JNLH 4YDIH 1I8LC 1AHWA 3WFBH 2PETA 4IMKC 5F6IC 3IDMA 3KS0H 1OAKH 2YK1H 2E8ZA 1I9RH 4JFEE 2W92A 2AAVA 4LAQH 2CK0H 4GT7A 3T0BA 3ZKSD 4R97B 5E7FA 1YEJH 2EDBA 5EORL 3FN9A 1H3PL 2VZSA 1FJ1A 1I1YB 4KQ3L 1U93A 4KKAD 4XMLH 2LVCA 3D25A 4MYWB 1OP3K 1BPVA 5F6HJ 2XFXB 5FUOH 2HJKA 1WEJL 1J5OL 2Q1EA 5FK9B 4OCYL 4CKVX 4MVBD 1SM3H 5BS0A 5J8OA 2SEBB 2VDML 3EO9H 3NACL 2CGRH 3N0PB 5FKPA 5C09A 1UKQA 2FWOB 3MUJA 4JRXB 3H7BA 5CZVL 1NAKH 4LFHG 4DAGL 1UEMA 1MCNA 3QDMD 4RA0C 5DXWA 4LBEB 5EU7C 4JFQB 3FB6A 1IJ9A 2YPKB 4E5XB 1CE6A 1DE4A 1OPGL 2X4UA 3CMOH 4WNQB 1OTUD 4HJ0C 1MFDH 1CIUA 4JN1H 1RJYA 2QQLL 4NBXB 5HI5C 4HGWA 1IILE 4JO2H 1UH3A 3MLRH 3S88L 2HLAA 4UTAL 5E1HB 1KEGH 1GGTA 1T20B 3LMJL 1MHCA 5DJAA 4HWBH 4FFYH 4X83A 5JHDD 1Q94A 3U79A 5C0FB 5DTFB 5HDBF 3TA3A 1KJVA 5ISZA 5KSAA 1XMWA 4L9DA 4HIEB 1QHPA 3VD3A 3VXSA 4M4RA 1I1YA 1KIRA 5KAQG 1JGLH 4MQXC 4ZFGH 3LPWA 3SE3A 3FAWA 5T3ZL 3MJ7A 4LHJB 3LS4L 1JWUA 1RVFH 2PW2B 3EYFB 3P77B 4L3EB 4NJAH 4NRXA 4PJHF 3U48A 4QRQB 1OTUC 2B2XL 4JREB 43CAB 4P23B 1UM6H 4B7LA 3O9WD 1UADC 4J3XA 4KUCD 2GSIB 4K23H 1DVFD 4D9QE 3ME0A 4PJ7A 3SEPA 4OT1H 2AEWA 4OI9A 4KAQH 1P6AB 3U7WL 1HEZA 2C26A 1DEDA 3LKPB 4ONHA 4XNXL 1HCVA 3BISA 5CAYB 2DQDH 2HT4D 4RRPA 5SWQA 1RU9H 1WWWX 3QIBA 1IQWH 4JO3H 5I19H 3SQOL 4G6JH 5IP4A 2VE6A 1IGML 25C8H 3M07A 3V7AE 4GW5A 3ZE2F 5AAMA 2DQCH 1OP3H 1JUFA 5D1ZC 4ZPTA 1I7TA 1PEZA 4N5EC 4U7KA 4YAQB 4TUOA 1YN7B 4S0SD 4N0FB 5ALBL 2AJZB 2NPLX 1I8KA 1VGKB 1RK0B 4HX1B 3B9KC 3CX5K 4PRPB 4WTZG 2VXTL 3TJEH 2GK0A 3WKML 1MREL 4QTHA 2P43B 1I3RB 4XPGL 4D8PA 1IEAA 1KIUA 1XR8B 1A6TB 3HAEG 3VRJB 4A6YA 3K2MC 2A6IB 2KL6A 4QEGA 5ACMA 5JXAL 4K9EC 5DURD 1HILB 3FOLB 3TIDB 4R7DA 1BFVH 3QA3A 1U8PB 3SPVA 1JGUL 4M1DH 3GEWB 3MRGA 7FABH 5T1KB 2YMXH 4G7YL 3TZVC 4GW1B 4N8PA 2ZUQC 1QLFB 1J7VR 3B5HA 5HGBA 4Y4FC 3OX8B 4PRHE 3OJDB 2G60H 4HC1L 1BVLB 4HF5L 4DUWA 2NY1B 1V7ML 1MHCB 1A14H 1YYML 5FB8A 1Q0XL 2YD2A 3D2UA 4A6YL 1MNUH 5F3BB 1K8DA 1N2RA 1IL1A 1BBDH 1JTOA 35C8L 5C0DB 5JLZA 4PLKD 1KTDA 8FABA 4YDJA 3BEVA 4N0YL 1XAUA 1EFXB 2OTPA 2X89D 5T5FL 3ULUH 3FRPA 2VXSH 4LLWA 5MP6H 2O61B 5IWLC 2M1KA 2DM3A 3F7VB 2W07A 1W72H 1QP1A 2H32B 1XF4B 1EAPB 2EDXA 2P5EB 3QPXL 2AI0H 5L9DL 3SDDA 2P7TB 1UWEH 5MEQB 3ZE1E 1Z9OA 2ITCA 4NCDA 3MV01 4AH2A 3QH3B 4K3DL 4X8XA 3GSOB 4J3TA 4P59H 3DYOA 4OCNC 3LEYH 1BMGA 2PXYC 1SJXA 1MPAH 2Z91A 2WUBH 1AGBB 1QBML 3QCUH 4KJYB 2DQIH 3VFTB 1VERA 1QSZA 3MRLB 4HWZB 5IB1B 4XVSH 1BGXL 2CRZA 5DDHA 4U6YA 3G6AB 3WSQH 3QDJA 1VHPA 2XN9D 3HG1A 3H3BC 4M7ZC 1A7NH 4JHWL 4UBDD 1DQMH 3D5OF 3U4AA 5KVGL 4Q9QL 5FCUH 3P9LB 1NGZB 3QUKB 4LP4A 5D1XD 3WEXB 2GJ6D 2FGWL 2EO1A 4HHAB 4JKLA 2C1PB 4MAUH 5ICZA 1BQHB 4PY7B 4KDTA 2KDGA 1KTDB 5F9JA 3V5DA 1D5IL 4PJAF 3I75A 4F58H 3GSNA 2R9HC 4ZQKB 2Z92B 5F7LB 2NTFB 3LEVH 3WHE0 1CFVL 5MERA 5IBUB 3FRPG 1EJ6A 2A38A 2XA8L 4JO1L 1W8OA 3W0WA 3V0VA 1S7VB 1S9VB 5T1DL 5LQBL 5A16A 1V7MH 5D7LE 2G60L 1SYVA 3BVNB 4PIRF 4S1RH 4J4PA 3ZYJA 1HHIA 4XC1H 4XXCC 2PF6A 5DDHB 2V5RA 3G6DH 4MD5B 1F4XL 4LKXA 3H3PL 3LSOB 4QO1A 5I6XC 1T89A 4EJ1C 3HE7C 2PKDA 1HHHB 1FNGB 2FYYB 5IT2H 4R96A 4U6HB 2YXMA 2R2HA 3SE8L 2QQKL 4D0DB 4NHCH 3LPFA 1KJVB 2UY6A 4DTGH 5HJ3A 1ZT7A 4NKMB 5D8JH 1C5BH 3RVTD 3VXSB 3BPLC 5DLMH 1XF5A 1BZ7B 3JV5A 2D31B 2R4SH 2R1XA 5SX5K 3FT4A 4UZGA 1CR9H 2DLGA 2MKLC 1JRHL 3O3AA 4MA8L 1QACA 1DP0A 2QR0B 4OCMC 3MRJA 3GSNB 3PWLB 2WQ8A 4GW4B 4GKZB 3BYYA 3QO0B 2X42A 3QDME 3BXNA 4LARH 1EA9C 4H1LG 5B38B 5MERB 4YHZL 5F7KC 3EFFA 5CEYA 4QHLB 4NN7B 4AEEA 4C4KO 2DQTH 3X17A 1U2HA 3Q6FA 3BDXA 4MA8H 5E2TL 2MCPL 1A2YB 4U1IA 2NW3A 3RI5K 4L8SC 3SGJC 3TP4A 4KY1H 4R26L 2LAGB 2EICA 4JO3L 5I19L 3OAUH 4P2OD 3QFJB 3UTTA 1YYLL 3I6GB 1M05A 2LU3A 2VOTA 3O8XC 1EMTH 5C1MB 5DD0L 4KTYA 5KS9E 4FXGB 3VJ6A 4K7PX 1H5BB 1PY9A 1FYTA 4JN2A 3O2VH 5E70A 5ALCL 5HHVL 2HP4A 4JDVA 4OCSL 1A4KA 1IEBA 1KENH 4F57L 5SV4A 4DVBA 2VLRB 3QDMA 3D39E 5C7XH 1RZ8A 4PRDB 3NH7L 1C7TA 3F7QA 1I3RA 2XZQL 1D9KA 1L7TH 1GHFL 2J5LB 4HK3N 5IFHH 3IVKA 2N1KA 4Z7VE 3JTTA 5DEZA 4KK6D 1A6WH 3EYSL 4I1NB 2XI9A 1G1CA 2K9UA 2ZCKH 3GZKA 5IIEA 4RIRB 5TQ2L 1OHQA 2AXGA 1KNOB 2O5XL 1FNFA 4HWBL 3WFHA 3SY0B 1UB5A 1NGXA 1BREA 2FX9L 3TWCH 5FDWB 4NO0B 2ZSVA 2HVKA 5JXEC 2F54D 3PGCB 5BO1L 3BGAA 1CXEA 5EU4B 2CIIA 1RHHB 5C0IA 2UUDK 3OX8A 4ZNCD 3I6GA 3KPTA 4MHHI 3KLHC 2Q76A 2XZQH 2PTTB 1PZUB 3H42L 3E0GA 3O9WA 4DFIA 3FO9B 1AGFA 2D9QB 4P4KB 2FX8H 1CFQA 5IVXA 5DJDB 4MMZC 3IJHA 2B1AL 1U93B 1PQZA 4K2UH 3V95A 4HPOH 2AJ3B 3A6CH 4KV5E 5EOQL 3VFSA 1MLCA 4TNWF 2VDKH 4YHLH 4BQBA 1UZ8A 1XGRB 3QIBD 3RVXD 3MXVH 3P4LA 1FG9C 4OIAA 4HPYL 4N90E 5BOPA 4HZAA 5HDBE 1ZGLP 3HMWL 4FN0A 4ZODA 2IMNA 2QADC 3U30B 2MCPH 4HX1A 1CF8L 5C0AE 2DM7A 3PDGA 5IEKB 2R29H 3OF6A 3LRHA 1QYGL 4XNYH 5DEFB 4NFCA 1LK3H 3QFJA 2JJWA 1JE6A 3QDAA 1EEQA 1YPZA 4PJ8A 4M93B 1R24B 2VN7A 2XWBA 1MQ8A 1EBAA 4PJXB 2AS5M 2W9EH 4GXVH 5D1ZA 4MHHG 1NBYA 3EIFA 4Q9RL 4F7TB 1J8HD 3WV0A 5EU6A 1BQUA 1TLKA 2OZ4L 3FTGA 4OZHE 3INUH 5IVZB 2VDQH 3DARA 5BMFH 3LKSA 1RHFA 3GJFA 1BFOB 1OP5K 5KS9B 3KPSB 2JB5L 1LO0L 3T1FA 1LO2L 2A6DA 3GI9H 1LWRA 2Q86B 2BVOA 3PXJA 2X4TA 4P9MH 3BKML 5KJRH 2QHRL 4YX2L 4HQQL 4K07A 4Z8FH 2HLAB 1CGUA 1YMME 2WQRA 2R23B 5D5MA 5CZXC 1ZTXL 1MJJB 3MQIA 5BMFL 5INDB 3ZDYE 3TYGH 5ESVA 3V52H 1O0VA 3HNTL 4JVWA 5LQBH 3KDMB 1AGDB 1KSRA 4NIKB 2DD8L 3BHBA 4G7VL 4Y4FA 4AL8L 3TJEL 4NQEB 4B41A 1YUHA 3LEVL 3SO5A 5JPMA 4KHXL 1CXLA 3GJEA 3MLYL 1DBJL 4WFGE 1RZ7H 4G43B 4Z78A 4N9GA 1Q9LB 1QSVA 4DW2L 1NCTA 2IPTH 4HH9B 4GFTB 1A6ZA 2VWEE 1C08B 1KJ2L 2BY1A 5L0QC 1ZSDA 1D5IH 3L5XH 3VFTA 2YEZA 2H9GA 3QUZB 3S3JA 2EE6A 2A77H 4Z0BL 5BW7C 5F7UA 3DVNA 3PWJA 1VKXA 3MRFB 3QHFH 3QIUA 5DHYA 1ZHKA 2XZAH 3BIBX 1KBGL 1NMBL 2QQQA 1JZ6A 4PJGA 3DUSA 3KYMB 1KLGB 3D85B 1RU9L 4QF1B 4P23C 3ARBD 1NAMH 3GSVB 3TH2T 1A7NL 1UXWB 4GH7B 4LPYA 4RMSA 5F96H 1DDHA 1IGCH 3PHSA 5F7DB 1IZJA 5D8JL 5J6HA 3PWUB 3L5WA 4QXUL 5INDA 2ORBH 3EGSB 5TDNB 4NKOB 2AK4D 4GG6F 5GIRA 3GSNH 1IEHA 3QUMH 5D71H 3OJVC 3LQZA 2GJ6A 2HRPL 4XP5L 5TQ0L 5GRZA 1MCWM 5DVLA 3AM8A 3TPUB 5AWNH 4KKAC 1PBYA 1KN2L 1U8JB 4HWNA 1FZJB 4G8GB 3RPIA 1FVEA 1BIHA 4U3HA 2DOCA 3QPXH 4RAUB 2G75B 3P9MB 1RUQH 4AMKH 1IGJA 1OAZL 1MJ8L 2JIXB 5I8KH 2Y4SA 3BZEA 3JWOC 4PR5A 4QXWA 3S98A 5IFAL 5IJKA 2FX9H 1NLDL 4YE4L 1A9EA 4PB9H 1T7VA 1BFOA 3G9VA 2XWTB 4HG4K 4N0UE 2NYYD 4DGYH 1GZPA 4X6CB 1TJHH 4NZUL 3VXOB 5B3JE 4M7KH 1IAKB 3QQNA 2XKUA 4MA3A 4NZRL 5SWSA 3P73B 4OZIA 2H1PL 4XCYB 2CD0A 2F15A 2CRIA 2ITCB 2P48B 1UVQB 4O9HL 1HSAB 3IETB 1KT2B 2IMMA 1K9TA 3U1SH 4ZUTB 3ILQD 2FEEI 5KSBB 3KDMA 5KSUA 2Q3AA 1W72A 2F19L 4Z7WF 4HLZG 4NN5B 2WP3T 3IDXH 3HAEA 3QFDA 4TQEL 3CFKA 1NCWL 5D7JB 2MQ0A 1DTUA 3DVGB 3QWOB 1CDJA 2A1WH 2Z35B 4LCWE 3LKOB 4UDTA 3FAXA 2V2WB 3VXQA 4EN3B 3SCMC 4YUEH 4JREC 1INEH 2X4OA 1TDQA 2NXYD 1ODAA 3DLQR 5E8PB 1FC1A 1I85C 5CEYB 1M71B 3RWHA 2WAHA 4FTVD 5JDSB 2X4QA 2D0GA 1BOGB 2UVEA 2G5RA 1RY7B 1ERNA 2ZCHL 1GOGA 5CIPB 3MFFA 1TNNA 5JHDE 5E08L 3Q3GA 3DV4A 1FYHB 4YHYB 1SJVA 4LRIA 4OM1H 2YKLH 3LN5A 4ORZC 4OCRH 4PB0L 4PJGB 5FA4B 1ITCA 1ETZB 3AU1B 4U6YB 3TBYA 2EXWD 1UWEL 4MD0A 3UBXG 4ZMAT 1D9KC 3MNWB 1JZ8A 4LRNL 4QRRD 3WJJA 2BSRA 5MP6L 3HNVL 3K80A 3P9LA 5GJTH 4HLZH 2HLFD 4TNVF 1XR9A 8CGTA 2XV6B 4LKCA 3HNVH 3TNNB 4DTGL 3VXUB 3S37H 1HN1A 3OXSB 3QWQB 4A6YH 1B0WA 3DSFH 4JM2F 4OFYD 4DZBA 5KSUB 4XP4L 5BS0B 3MBXH 3MRRA 3MOAH 5FKAA 4JHBA 1FNHA 1TETL 4ZUUA 5TE6H 4M7LL 5I73B 4P9HC 1EBPA 3V5HA 4Y0GA 4AEFA 4RDQG 4PY8I 4Q58C 3T0XA 2FIRT 5ILTH 2OQJB 4NJAL 2IADB 2DI7A 1D9KD 4JZOA 3ZYZA 1MI5D 4O2CB 4NO3B 3TZVA 4XNMA 5JORB 3PWPE 5IKCB 3MRMA 5DGRA 4GKOA 4PGEB 5DJ6A 3UTSA 5FYKL 4UT6L 2PO6B 4OZIB 2A6KB 3H9SD 3RNKB 2J2ZA 2F54A 1AKJD 3QCVL 4X9GA 2EDKA 3GMNB 1DEEA 2DICA 2ZOLB 2GCYA 4RMVA 5MI0B 2EKSA 4LOUD 1U9KA 1SBBA 3LCYA 2O5ZL 4ODUA 3BN9D 5EUOA 1LEKA 5HPMA 5B38A 1GAFH 1QA9B 1CDIA 1DVFC 3TBWA 2VJXA 1CDGA 1VGEL 4IRJC 4YXHH 2R2CA 2FGWH 1A02N 4ZFZB 5BQ7B 5D7JA 2NLJA 2LE9A 5IUSA 3G5YB 2AK1L 2D7QA 4D0CA 1WLHA 1B6DA 5E6IA 4OKDA 1FZOA 1R3IH 1UKTA 4MQXD 1VEOA 1DCLA 2QADB 5IFAH 5LG1A 3VWKA 2Z31C 2C7UB 5F3HA 4APQD 2YUXA 2ICWB 5I1DB 2I60L 4XP9H 4ODWB 3NZHL 2Z8RA 1YNTB 3G6JB 4ZXBA 1K3IA 5F70A 4QOKD 4FP8L 1KN2H 4JKKA 5C0CA 2Z4QA 1MLBB 2PR4H 2ZCLH 1ONQA 4XCFL 4PRDA 5EIIA 4X4XA 5FDYA 4MJIA 3DSFL 1QSFE 2R56H 4ZPTB 4LDOB 4M7ZB 3KYAA 5DK2B 5GZOD 3GB7B 1ZGLA 3SGEH 4RDQF 5HGAB 4U1GC 5F8RC 2WBKA 3TBSB 4NBYB 2ARJB 1M4KA 4NQDB 1KB5L 5CIPH 5EG6C 2CKBA 2DLTA 4MCZA 1R3LB 2BXYA 4FFYL 1JPGA 5EO0B 5SWZD 1Q9KB 1J8HA 1TCRA 5GRYA 1S5IH 2WW8A 4WWKC 4ZTOL 3MYJB 4MD4A 5CBAA 4WY7L 1DANT 1UACH 1XCTA 2OM5A 4P5TD 4C56D 1E6JH 4YPJA 1ZLWK 1KNOA 3MRGB 1KJ2H 4ORGA 2OTUA 4WI8A 1YECL 3RDTB 3Q5TA 5MENE 5D72H 1RZGA 1WT5C 3WL9A 3O41A 2B5IC 2V7HA 3UTSB 2MQ3A 2NX5E 3UX9B 3U6RA 2VSCA 1QEWB 1WGOA 3TO4C 3RVVD 1LDSA 1JGVL 2WWMD 4CVUA 3QJHB 2W1NA 3GMRA 1H15A 2FO4A 4PGCB 4IRSD 1DEEB 2CDEA 3G5XA 2NY7L 2H2SD 5CZKA 1F58H 3ES6A 3U1SL 3WHXA 3S5LG 1UVQA 1HWHB 3LQAH 3TBSA 1WFTA 1YEFL 3HI1A 3VFUA 4Q97A 2YRLA 4YHPB 5E94B 4CVXA 1QHOA 5HI4D 5T1LA 1MIEH 3QUXA 1S7UA 4NN5C 3NA9H 4HFWA 5GZND 4N90D 1WK0A 4NSKA 3QIUD 2X1OA 3VRLE 3IS0X 1JV5A 2VLJE 4FOMA 4R3SB 5JOFB 1DLHA 4I9WD 4Z7WA 3GSOA 1DUYA 4FQ2H 5B3NA 5HGHA 4P5MA 5GGRY 3RJQB 3KVQA 3PL6A 4K7FA 4HJJL 4Z76A 3SOBH 1CLCA 1NBZA 1MFEL 3B43A 5CILL 5DJ0B 3S4SA 4EVNA 3EYOA 3I9GL 3HMXH 3ARXA 3IFOB 1KCUL 3WUWG 3NCMA 1WBXA 5BCAA 3VI3E 4LSSH 1U8JA 4OLZL 4YBLB 1GPOL 4RGMB 4PS4H 1Y0LB 2XZZA 5DUPH 3A6BH 3BH8B 2IH1A 4HUWA 3RGVB 1BQSA 4KKCC 5C07E 5IB5A 2W0LA 1QLRB 4W4NA 1BHGA 3S7GA 4ZNEA 4QXUH 1V7NH 3O8XD 5TPWH 3VH8B 3MGOA 4ZSOA 1T2QL 2C1PA 1RZIA 1JGLL 4UQ3B 5HHQA 4D3CH 1QFUH 4XMKH 5IB2B 5CUSL 1MJJA 3UP1A 3F6IA 5EOTA 1YJDC 2FD6L 2FEDC 1NCWH 3PV6A 3BFOA 5CSBA 5E8DL 2ARJQ 5DHVB 3A6CL 5EOQH 1AXTL 1J8KA 1XR8A 4JKMA 3O0RL 1AJ7H 4G6FB 4M43L 1TQBB 1BECA 4M7JH 4OKVA 1VEPA 2AK4E 5EOCH 4O9HH 4GAJL 3H42H 4JZOB 3UAJC 1OPGH 3BJ91 4HS8L 4FXLA 1A7BA 3DMMA 1CFSA 3ARDB 1S3KL 3ZL4H 5IJKC 2XTJB 3DUUA 3EYQC 1II4E 2PW1A 4HS8H 3O41B 3SKOB 4AG4H 4ZNEE 4TVPL 3BD5A 4W6YB 3MJ9L 4Q2ZB 4GKSB 5K9QI 5F89A 5C07D 4ZAKA 2DKMA 2X5PA 1T1ZB 3LZFL 4DFHA 3HC3H 3WIFB 2DD8H 1H15B 4XTRC 2VDRL 1W0YT 1HYRC 2NTSP 4G43A 3ESVF 4M03A 2B0SH 3ZMRA 1JHKH 1A7QH 1IAOA 4BSVB 4LLUB 3FTGB 4QXTB 4FQPA 4F37F 3IKCA 1H3PH 3IKKA 4J7RA 2PTUA 1FBIL 1VKXB 4U0QB 4JQXC 5T1LB 3TVMA 4GBXD 1DQQA 3TBYB 1DBMH 4PJ5B 2XFXA 1Q8MA 4IRZH 5DRWA 4MXQC 4N0UA 3MRPB 1EV2E 1BM3H 3W2DH 1IM9D 3QUML 4QY8A 1CE1L 3DI3B 5HGDA 4ZFOB 4APQC 4YK4C 5I8OL 3HR5B 2ZOKA 3EZ8A 5J12C 4G8EA 4YC2C 1GPOH 2IGFH 2RBLA 2FR4B 3BZ4A 2EIEA 1LO5A 4XPHL 1BD2B 1NCDL 5IM7B 2DWEB 5L0QB 3S3PA 3O2VL 4YFEA 5JIIA 3ZE0E 2DI8A 1C7SA 2W9EL 3VWJD 4JQIH 5DQJA 3FCTA 4OJFL 2G5BB 4IIQA 3TCLB 2ZSVB 2HG5A 3LQZB 3WLWC 4ONGL 2BNQD 2IAND 2IPUG 1TNMA 4OSUH 4OV6F 3ZYOA 1VFBB 1PSKL 3RA7H 5I1GH 4KK5D 3QRGL 3VXOA 2H2PD 1XGUA 4P4KC 3DURB 3WJJC 4TTDD 1URLA 5J89A 2IPTL 3ARGD 4X7TA 1AGFB 4WI4A 3T08A 2P46B 3E2HB 5BZDB 4JPWL 3UJIH 4DCQA 2EEAA 2ICES 4ZS6C 3DO7A 4JHAH 2NY2D 4S1SH 3W11C 3LHPH 3SQBA 4X6CA 2PXYB 1KCVL 3TZVD 2OSLB 4NPYB 4DKAA 3NAAL 5D7JC 3VXMA 4PV8B 2X1QA 4K7PY 4ZQKA 5D6CA 4UTBL 5IF0B 4MWFA 1ADQA 4Z77B 4OFDA 3UTZA 2JCCB 1NGXB 4NKOA 1RPQA 5I71C 4JANA 5DJCA 3PE9A 4JFDE 7CGTA 3MA7A 3ZKXB 4Y5YB 4HDIB 5C8JA 1F4YH 4KROB 4BH8B 2D4FA 5T33H 1QFWH 1RJCA 2BVYA 4U1JA 1T0MB 1R24A 3VXQB 2Q76B 3G08A 4PLJD 3BKYH 4L3ED 1FIGL 4MXWH 1EGJL 2V5SA 2YWZA 3OV6A 1F3RB 4GKNB 5D1ZB 3T0EA 3C60B 3MLSL 5I66B 4IOIB 3U4EB 1CFQB 1S9WB 2GI7A 4M02A 2EE9A 5C0BE 5ITBL 4GSDH 3HUJB 4P2QA 5FYKD 1M1SA 5D1QC 1ACYL 5EO1A 2C3VA 3NTCH 3X12B 1MQKH 4R8WL 4WFHD 3HCVB 3RY6C 5L7XL 1Y18B 4LCWA 4YEFA 3RIFK 4ODHH 2A74B 3GMOA 4JM4H 3H9YA 2HN7B 3U36B 5I1LB 3C6LB 3VGAC 1J1XH 3NN8A 3ZKNC 3JTSB 1RIUL 4YBLC 4ZO9A 3I6KA 2UWEB 3MXVL 5EBLA 4HGMA 4LQ1A 1DQML 4PRID 2R1WB 3FFCA 1DBKH 1EGJA 2Y5TA 4PJIB 5HI5D 4PJGF 1WIOA 5HGBB 4P3DA 5CBAB 4Y4FB 2GY5A 3DX9A 3OR6B 5CJ8A 3THMH 3PQYD 4KMQA 2EIBA 5F9OH 4Y1AA 3RZWA 4EBQH 5GISL 2MPAL 5GRXG 4BZ2L 4AK1A 1VA9A 2DQUH 5TGBA 4G3YL 2WUBL 1H3WM 3RUGE 3O6FA 3KNBB 2I9TB 4OCXL 3JVGA 4TSCL 3RWFA 3Q3GB 1T1WA 2AEPH 4DVBB 3FZUD 2X9XA 3SDCD 3VG9C 2IWGA 5KOVC 3IB4A 1FN4B 1ZS8B 1OGAA 4NO2B 2XYCA 2Y7QA 2DLFH 5I74B 1RZJH 5T1KD 5KS9A 1QKZH 5ACLA 3FO0H 2Y07H 4O2EB 4X4ME 1X7QB 4QWWD 3DXAB 5I8EB 5DLML 2UV3A 1FJ1B 3LVEA 3IF1A 5FYKH 1K5NB 5DJ2A 4LKCB 4QRPB 4NWTL 3LDBC 3X11B 5JXEA 2VH5H 3OKKB 1S7UB 3QQ3B 4KI5C 3WXVH 1T83A 3RWIB 2BXZA 5CKAA 1QVOA 5HTSA 5EFIB 3WUWB 1EFXD 3WJLA 5D7IB 4YHNB 4FQCL 3UC0L 2YMXL 5LCVH 5CCKH 3FO2A 1OGAE 4RAUA 5T1DH 3VWKB 1IKFL 2X4UB 4LF3B 2VISA 4KUCF 4XBEH 3UTPD 4G8FB 4YFLF 5EZIH 4D9RE 4JFDB 5C2BH 5I1IH 5D7SH 2W9LA 2AKRA 4S10A 1X6LA 3MACL 4QXGL 2W0FB 3QB7C 5MENA 5FYLD 3MLWH 3UPCA 4ZS7H 1MFAL 2AXJA 3RAJH 4M62H 3SGEI 3KXFD 1BZQK 1R5VB 3GBNL 5C0GA 3NAAH 5KVDL 2XNAA 1T4KB 5E7BA 4HUWB 2DDQL 5E00A 3L5HA 5D2LB 1F90L 5KANI 3WKMH 1B90A 1UJTA 3QXUA 1I3GL 3UDWA 1WCBA 1RZIB 3LB6C 1F45A 3BGMB 4MS8D 5D2LE 1XCTB 3G5VB 1FORH 3F6LA 4K3HA 3UEZA 1UA6L 3CAFA 5D7KE 3QRGH 1JRHH 4B5EA 5F9OL 4S1QL 4JHWH 5DQJB 5JHLH 1CR9L 1CICD 1CQKA 1IGMH 1T0PB 1Q9KA 1TCRB 2GT9A 4Z0XA 4M61B 1FFPB 5K9QG 3CGTA 4ZS7L 4Y1AB 2AEQH 4PJHA 4PJ8B 4RGNE 3OMZA 2DQHH 3VXTB 1PGRB 2J7LA 2DYPD 4FFWD 4Z7WE 1LGVA 5DC4B 3L1OL 4D0BA 4NP4L 3IDXL 1RIUH 4GAGL 2FYYA 2R0KL 4AY0A 3X3GL 5TF0A 4P59L 1K4CB 1RUAH 1RJLA 1A6PA 3FONB 4MDJA 1CG9A 3DXAE 5IROA 2R2EB 3S5LA 3WD5L 4DKEH 1P7HL 1E28A 4GKSA 1GZPB 4GRLB 2BDNH 2HA1A 2Z4QB 4LSRL 4Y8AA 2V9QA 5A40E 3KPSE 1Q9WB 5EIQA 2CR6A 4LSVH 2DJSA 4CVXB 1K8IA 2FRGP 4OM0H 4J6RH 5DFVD 2AV1B 1RMFH 4NWTH 2ZJSL 5JPNB 5CSZB 1IAOB 5C07A 2BSRB 2AP2A 3VDAA 1N8ZB 2X4PB 1YN7A 4JAMB 4KJWC 1HHJA 4N8CH 5E95B 3DJ9A 1K4DB 3MLUL 4QHLA 5CEZE 4NJ9H 3LQMA 4I0PC 5CP7A 2NY0C 4OTXL 5ISZE 3LZFH 3FO0L 3EYUL 3MV8A 2ATKB 4K55A 2IG2H 2HFFB 2QEJA 3HRPA 1NL0L 2V2WA 3VXSD 1F4YL 4JGUA 4XBGA 2IFFH 5T5NG 4GBXA 4WGVB 3KPNA 2VAAB 3W9DB 1I9JH 5J1SC 3OAZH 3RBSA 3LS5H 5AWNL 5IM7A 3P4MB 5ADOL 3EDFA 5D1QD 3QA3B 3SPVB 1HCFX 1JTPA 1YNKL 5DJ0A 3JV6A 3V6FA 1JL8A 3QBTB 2F5BH 3SDXB 3EBAA 5CGMA 1EEZB 3EO0A 2A83A 2AJXH 3WIIL 3RDTC 5KZCB 4OQTL 4Z6AT 1FVCB 1O7VA 4WU7A 1QFWI 3D2UB 5E6YA 4EXPX 3REVB 2P5WD 2BNQA 3BSZL 3ZDYF 4P48A 3T2QA 4P2OB 2VZVA 3RU8H 3W5NA 2V9TA 1MPAL 4TUKH 1QFUL 4XMKL 2A6JA 2AJUH 4A2MA 1WIUA 3N1GC 1G9NC 3KG5A 1WIPA 2MSPA 1ORQA 2RFXB 1WZ1L 1MF2H 1G9MH 4E42B 2GK0B 2VIRA 1A22B 1OAKL 2KQNA 4LPTA 1KFAH 4X7SH 3EOAA 1ED3A 2ID5A 4X7EC 3IYLW 5L2KD 1KPUB 5E03A 1UB6B 1MFBL 4V2BA 1L0YA 1YEDA 2VXSL 2FBOJ 1U2CA 3CFJA 5CP3H 4DW2H 4WO4B 1NC4D 1D5ZB 2EYTB 2OQJA 1MSPA 3HMXL 3KPLA 1JVKA 4NC0B 5GSVA 4WWKD 1RD6A 4Z76B 1DQDH 3FOMA 2PYEB 5F3HB 5CLTA 4ZSOE 5I74C 2C1OB 1MCFA 4KAQL 2GTZB 2ITDB 4FQ2L 1FPTH 2VUYA 5EZLA 5KW9H 2WBJD 5DO2C 1QD0A 1NJ9A 2H3NB 4U4BA 2BNRE 4X5XA 3VFWA 4RGND 1VCAA 4FABH 4P2OC 3FHQA 4IRZL 2C4XA 3UTQA 3V8OA 5T3ZH 3MRPA 3V4VH 3SKJL 4U0RB 3E2HC 3FRUB 3LV3B 2IPKA 3VFMB 5HHQB 5CFHA 2VL4A 2B4CL 1E4XH 4G42B 1RAMA 4Y19A 2B0SL 2JK5A 1KEGL 4Y16B 3GMLA 3ZSTA 1J1PL 3U4BH 3T0ED 3MV8B 1V3JA 3HCVA 5JW4N 4PJ7B 3HAEB 1EJOH 3QFDB 4UILH 1YEDB 3ROOA 4JFEB 1T1YA 2D7MA 3U2SA 1JI2A 2CLRB 4Q74A 2CLZB 5C0RH 2YPLE 3QIBB 4AJ0A 2HJLB 1WBYB 1NDMB 1M6OA 2VLJB 3ILQC 5IGXH 1AO7D 2OJEB 3PHOA 5FO8B 1B2WL 3DGGB 5HXMA 1RZGB 1KCSL 2FECL 4HUXB 3P0VH 4Y4KB 5EU3B 1ZXQA 3MRHB 3QNXA 3CSBA 3ZKQD 3BEWA 4HPYH 4QWWC 3Q6GL 2LABA 1ZVHA 1J0IA 1P9MC 4FFVC 4UIKL 5E8NA 3T2NH 1ZHNA 4I8DA 1ZMYA 3CU1A 4OIIL 1CU4L 3QDJD 5I1JL 1CTOA 1DQTA 4WEBH 4G5ZL 5A2IH 1H3XA 3EUUA 5I8OH 3QNZB 4XBPA 2IPUK 3J8F7 3TVMB 2EDHA 1S8DA 4OF7A 1UXSB 1G9NH 5F8QC 2W91A 3HUJF 4M5ZH 3TIDA 4I2XB 2OP4L 3C2AL 4JY6B 3RTQD 1FBIH 4EZMA 4K3EL 2R4RL 1FL5A 1KCUH 3PGDB 1U0QA 1NMAL 5T1KA 2GUOA 3W39B 4DQOH 4OLXH 3BIKB 2BVTA 3RWEA 5JMOC 5EWIL 2VC2L 2GTZA 2ITDA 1H8OA 4B7IA 1I8IA 4JO2L 4MNGB 1DZBA 5BXFA 3FQRA 1KCSH 3U4EA 3BO8A 1JZ7A 3D9AL 5FO8A 2NY1C 5IHUH 3VFWB 3W0WE 4U1IB 2PCPA 2ZG1A 4LLVA 3VXNA 4BH8A 4Z7VF 1DLFL 4DN3L 1CLYH 4IM8A 1T0MA 2ATPB 3D69A 4G8FA 2IPKB 3VFMA 4R4BB 4R7NB 2JJUA 2R2HB 1G7QB 3KYKH 3FHAA 1F4HA 3ALXA 5D4QA 4J3UA 4ZUWB 5C0DA 4XMPL 4KZDL 4UUJA 5DQ9B 3BRGC 1SM3L 4RMRA 4RGOH 4M5YH 4WDIA 1FAIH 4S1SL 1ZEAL 5DD0H 5E6IB 4HKJA 2OZ4A 1CT8B 1YJDH 1JYNA 3P30H 3B83A 4M9OA 4KKLC 1FL5B 4Y5VC 3CFCH 4OGXL 1OQOA 4JLRB 4QHNA 2HWZH 1FFQA 1Y6NR 2PNDA 4GRWH 2CIIB 5ILTL 3U7AA 5BZWB 2VITA 3NVQA 1ND0B 4JRYA 5ICYB 4V1DA 1KIPB 3PGCA 1JTTA 2CDFA 4NHUA 4IBLT 1FN4A 4LASL 2CJUH 4Q2ZA 3QUKA 1QRNE 4JRXE 4F8TA 2VLRE 5GRWA 2D7NA 5LBSH 3WN5B 4NN6B 5HY9B 2VDPH 3UTTE 5MEPA 1GIGH 3V0WL 2P24A 4OLWH 4JO4H 4KJWD 3WEXA 5DTFA 4X0KB 5J9PA 1RZFH 2EDRA 2R0ZH 4Y89A 5I2IA 4HCRL 4P2QB 1FYTD 1QNZL 1Z2KA 4JZJC 2VIRB 4WHTA 3X3FL 1I7ZA 3JBG7 4E41D 3OKEB 1Y18A 4YBHA 1JWSB 5ETUB 5H2BA 3FN3A 1U92A 1W0VB 3SE9H 5B39B 1QVOB 1E4KA 4RFEA 1YEFH 3V0VB 4HKZB 4HXAH 4HC1A 3C08L 3NZHH 4XCEA 1MFCH 4EN3A 5DMYA 4XP9L 4OD1H 3L3KA 5J6GA 3MCLL 1BP3B 3F7YA 4XT1C 1VPOH 4F8QA 3GRWA 3W9EA 6FABH 5E1AA 2XQBL 5IROC 3WFZA 3VG9B 5B4MD 2XA8H 4G6MH 4IIQB 3LH2L 5IHZA 4QRSA 1X5GA 1OD7A 2F5AL 3PJSB 1T1ZA 1C5DA 2LAAA 1TTUA 4LVOB 4AIXA 4K7PL 5EA0L 3JWNC 2BSTA 3W81A 1NKRA 3TV3H 1S3KH 3MC0A 4GOSA 5I8CB 3SDDD 3KYOA 3BT2L 4HBQA 5CD5C 3TN0A 4F7TA 1A1NB 5ACZA 1VADA 1A1OA 4U33A 3CJJA 1Q1JH 3O3AB 1U8QA 3RUGF 2A6DB 4ODXB 1WF5A 5FUCC 4HZLA 3MO1A 1XF5B 1Z3GL 2RCSH 5HYQA 3NABH 3VDCA 1WC7B 4CGTA 3QUXB 3BPNB 4G8GE 3BW9B 5C9KA 2EYRA 3MRNB 5E2WL 2FB4H 4G6ML 2HTKC 4P4RA 3IRZA 3KPPA 3WSQL 2YR3A 4PJ8C 1F11B 6FABL 2XN9A 1NBVH 3HG1D 1R0AH 2HJFA 5TDPB 5J11C 2NY0B 2H41A 4QRRB 1UQSA 4YQXH 3VFNA 2J88H 2YD7A 3S4SB 1KG0A 3O4LD 3BMVA 3WD5H 4FXGA 4GG8B 4WW1B 4JKWA 3QULA 3BKJH 4FP8H 3RVWC 3FT3B 3QG6B 1OWWA 5CEXB 3A67L 1BQLL 2VKWA 5FYKE 4LEOB 5SX4H 3GUTA 2R0WH 4QTIH 2IH1B 2B20A 2NY2C 1GGBL 2VISB 2DQHL 1QTYT 4HCRH 3PV7A 1OB1A 4XZUB 3C60A 4OIBA 3DUSB 5CGYC 2Y72A 2R69H 5INCA 2BRRH 3LKSB 4LCCB 1BBJA 4POZD 3TH4T 4R0LC 4WHTB 2VDLL 5AZEH 3GNMH 1T4KA 2ADIA 4PRBB 1KCLA 1J9CT 1T5WB 4Z95L 1A9BB 4YHIA 4PD4K 5E4EB 3C6LC 4X6FA 5FUZL 1KIQA 4JG0L 2BVOB 2R2BA 1AFVH 1LE9B 1J88A 2XZAL 3PWPB 4NQVB 2EC9T 3E1F1 1TZGH 4J4PD 3VFGL 1Q1JL 5E9DA 2IQAA 4MNQE 2OBGA 3MFGB 2NY1D 5IK3A 4UINL 1E27B 3IDUA 3T65A 3D0LB 1AGCB 4H1LH 4WFFE 5EZJB 2HKFL 2NY4D 2CO7B 3BHBB 4K71C 1KLFA 4S2SA 5CGYD 4K7PH 3LKQB 1MFAH 3RAJL 4LPCA 3WBDA 2HFGH 1N5AB 2Y23A 1CXIA 4TQEH 2CIKA 4XBGB 1N0XH 1BJ1H 4HH9A 2WANA 4NRYA 1WBYA 4Y2DA 1A21A 1X5XA 2H45A 4JPVH 4FQHB 3W5MA 2DM2A 3QUZA 4OUUA 3D3VE 3SJVB 1RJZB 2H8PB 2VLKB 4OD3L 3BKMH 5KJRL 1DSFL 4WY7H 5GGTA 2D7PA 4E42A 3N9GL 1ZHBA 3VXPA 5MHSE 3MA9L 5IB3A 3QDGE 4OLUL 2Y7QB 1EXUA 3BOVA 3KPMA 4U1LA 3ZKMD 1IBGL 3V4PL 4F15C 1U58B 2ZWLT 3CNKA 4QYOA 4OF3A 1A6UL 4QRPA 4WHCA 5EWIH 1RUQL 5EN2B 1J18A 5I75C 3QXDA 1NFKA 1JHTB 1G7HB 5EZJA 2EC9U 1AC6A 5D2NA 3SCMB 2OX5A 2PR4L 4JY6A 4OT1L 4D2NA 5DEFA 3MSPA 4WJ5B 5EC1B 3AGVA 4PRPE 4ZD3L 5JDSA 1YN6A 4X6EB 1UM6L 1NMCC 4M1GH 1P84J 3UBXI 4C58B 3CUPB 3DX7B 2X2YA 4WEBL 2CRMA 1BJ8A 3P11L 1YQVL 3HI5L 1R3KB 4P2RB 3BO8B 3EJYC 3JZ7A 4LCCA 2VUOA 3RVUD 2O93L 2EEDA 4YHOH 1C8PA 1QSEE 2GAZB 2AABL 4X6DB 2AK1H 2BVUA 1PG7X 2D31A 3FQTA 4DEPB 1V3KA 3NCJH 4FNLL 3EYQD 1WVZA 4JGJA 2OSLA 1MIMH 4N0FA 2L0DA 4UV7L 3CLEL 3OXSA 4RX4D 2D03H 1OL0A 2HAZA 1INQB 1HQ4B 1CCZA 5HI3C 3BT2H 4ELMA 4XP6H 2JJVA 4R8WH 2LQRA 3ARGC 3OKYA 4G42A 2ADFH 3RWDB 2FL5A 3OKKA 4I0PA 3SDAD 3O4LE 1H9VA 4HUUB 1DLFH 4KWUA 1P4LA 4HK0A 4N9GB 1BZ9A 1JNNH 2HH0H 3H8NA 3TO2B 5M94B 1EJOL 4YHNA 3MLSH 3VE0B 3ULSB 1KB5A 5JMRA 1M05B 4PJGE 1KXVC 3JWDC 5CJXC 1KGCD 3PQYE 5T3XE 1GC1H 3JWOH 3G08B 4NZTH 4KVNH 3ARPA 3MRCA 1BOGA 1MJ8H 1U3HA 2E9JA 2X4NB 3ULVL 1LP9E 3I3BA 5BZWA 4U1NB 3RWJA 4UQ3A 3S37X 4I0CC 1A1NA 2CDGA 4Z8FL 4JRXD 3IDYC 3SE9L 2WUCH 3PG2A 1MRFH 1L7TL 2IFGA 1TETH 4LDLB 5DF0A 3L3JB 2DQFB 5F7DA 4H5SA 3JUZA 3SBWC 3GKWH 3ZHKA 1NGYB 3CU7A 3QFJD 1M7XA 1NFDB 3ZTJG 4LCYA 1A1MB 1DBBL 2RIKA 4JO4L 2FH8A 1KXQE 1OARH 4I3SH 2YPLA 5BVPL 1GIGL 2ZKHH 5F96L 4CN4A 3O8XB 1SYSB 1FSKB 2AJSL 5E8OB 3GK8L 1UWGH 3UTPE 4U6VH 4PRAA 2WWMC 5DMKA 4LASH 3RWCB 3H9SE 1YN6B 3SKUD 3VD7A 4AYFA 3MUZ1 2D2OA 1EUTA 4ZAKB 4WENB 4MXVE 4OFYA 1F4WL 4KJYA 1KFAL 4YDKL 4PJ9D 1YNTA 2DQTL 3NFNB 2YD8A 3QHZH 3HC0B 4XHJD 1IRAY 3KJ4B 3BJLA 5DGQA 1Q0YH 4F7MA 3UJJH 1JZ4A 4WFFD 4GMTH 3TFKD 1DVFB 3F12B 4HUKB 2KBGA 1TPXC 3S34L 5EU3A 4F3FA 1MI5A 1T3FA 4LPVA 4Y1AE 3BH9A 1I8MB 4RNRB 4ZUVB 3IXTB 4RGOL 3U4BL 3NGBB 3L3JA 3E3QC 3L9RB 3RUGA 4JM2D 3V52L 2Z0BA 1RV6X 5DJZA 4Y8DC 5ERWA 2YPVL 1F8TH 3K46A 1T04B 1QSED 3H9SA 2VZOA 4WTZA 1BJMA 5ICXB 2VTFA 4QNPF 4Y4HB 4L8CA 4X8JA 1DBML 43CAA 4M9PA 4MB3A 1JF1B 4M1CC 2OR7A 2P8MB 1F4XH 3PWNB 4OLVL 5DSCA 1OAUH 3G6DL 5FYKU 1UYWL 1LHZA 3DBXA 3FMGH 4JPKL 1E4JA 3QCTL 4HKJB 1BX2B 2AV7A 4YFLI 1JCKA 3DRTB 4QT5A 2VLME 1FNEB 5IMMA 3STLB 4HWEL 2PYEA 4TYUA 3LN5B 1DUZB 5JNYB 3MV9E 3C09C 1U95B 4FQLH 4L8DA 1IARB 1QSFB 5D93C 3S96B 1IQDA 1FNLA 5TDOB 3VFVA 3VWJB 2DL9A 3BH9B 2D7TH 1KCRH 4E9LA 2Q7YB 1KJ2B 2BNQB 2YD1A 5KOMC 1XFPA 1S5HB 3BDYL 3KLAB 3BESR 5JW4Q 1LNUA 4KH2A 1S7SA 3C5ZB 4M43H 5C0CD 3HKFA 5GGUB 5C70A 5FIEA 2FH6A 2H6PA 3HMWH 4ZFFA 4ODSH 3RHWK 4F57H 1UJ3C 5E5UB 3H9HA 1AGEA 5KBNC 1QRNB 2GJJA 3QEQA 3EYVA 2J5LC 2DLHA 3I2CL 2SEBA 3ARGB 5C09B 3B9KD 5AD0B 4YHLL 5K9KB 2FO1A 3KPQB 4JJ5B 4Y5XA 5HYSB 2PYEE 1MOEA 2DQGL 1EVUA 1FC2D 2IBZY 4H8WH 2AJXL 3OHXB 3V7MA 2R15A 1BGXH 1B2WH 1YMHA 4AZ8A 4DZ8A 1NBZB 3L3DA 3OG6B 4QHUB 5ITFA 3VMNA 3B2VL 3F65A 4PUBL 5F1IB 5HHPB 2NW3B 2R9HD 3A6BL 5IMMB 2LU7A 5KVFL 5IQ7H 1GGCH 1C08A 1HSBA 2QSVA 2OMNA 4V1DB 1X5AA 2BZDA 3FQNB 2E27H 1T1XB 3T2PA 1F00I 3DGGA 1W72L 4QRSB 1BFSA 1V3MA 3TYFB 4LU5H 1R3HA 2ZP0T 5GRUL 3KYMA 3MBED 3CPLB 3HNTH 1K8DB 4GG6A 4U1SB 4BFGA 4K8RL 2RHEA 1VENA 4RGNC 3EDKA 1LK2A 1HHGB 3HB3D 1ZTXH 1AXSA 1UYWH 4OLEA 2Q7NA 1WFUA 4EI6A 3IU3B 4ETQB 3ELAT 3F7VA 1R6VA 4HIHB 5I1CH 4LCIL 4IRSA 3CK0H 3O6KL 4YHPA 3HPJB 3EGSA 4WU5A 1P5UA 4FTVA 3BI9X 1JWSA 1UKSA 3T77A 2JB5H 5CP7B 3QUZD 1BAFL 5TH2B 4KK5C 2C5DC 1UWXK 2H2PC 5EULV 1U8IA 5GGSY 2JCCF 3VFPA 4JFYB 2YPVH 4Z7UF 4MQSB 5KW9L 5L88L 2YRPA 1B0GA 5CLWA 4LCIH 1DN2A 5D5ME 4PGBA 5GRVL 2VLJA 4KKLD 2R8SH 4KPHL 3MV8E 3SGDH 5C71A 5FAAA 4U1KB 4OZFG 5BXFB 1Z6JT 2VE6B 1MCPH 3AREB 3GHBH 3PL6D 5E8EB 4LCCC 1C16B 3I85A 4NC1E 4ONOA 1I9IH 1RUMH 4XWGL 1YPZE 1DQJB 1Q0YL 2E9BA 5IG7A 1QYGH 1QKZL 3AS1A 3P4NB 2DTMH 4KTDL 3MLVH 4JQXA 4YDKH 4X9HA 2E27L 2YC1A 1MF2L 3BE1H 5J3HC 3RWGA 3IDIB 4DKFH 5L2JA 1L0QA 1EUUA 4JDZB 5EOTB 4OD2A 4N0UB 2J4WH 4XVJL 1S8DB 1IC7H 1MCSA 5KSBA 1YMMD 5KVGH 5I17A 5C6TH 1HINL 2J1KA 3FQUA 2OR9H 5AYUH 2V9RA 4N1CA 5E0QA 4Y4HC 3EOAB 3QRFM 1KB5H 1N64H 3DX6A 5DEGB 5TH2A 2VXQH 4YGVA 1MHPL 2XPGB 1RZJC 4MAYC 3HS0B 1INQA 3SDYH 4K9EL 3UO1L 2EYTA 1G6RA 3F62A 4JQVA 3MOBH 4OZFA 5HVGB 4QNPE 5DMGD 3R06B 5DFVC 1IKFH 1KJ3H 4OCWL 3GSUB 3LEYL 1QFOA 4OF5A 3SKOA 3EW3B 2D0FA 3CVHB 4JKPH 4LLVB 4KJPD 3KR3H 1P1ZB 3ARUA 1NL0H 1C12A 1NCBH 5BO1H 5A2LH 1FZMA 4DWHA 5CHNB 2VR4A 1YNLH 1FZKB 2I25N 3HC4L 5D7JD 4OV5B 5EBMA 4ONFH 4ETYA 4ODTH 1N0LA 4MCYA 4RMTA 1G7LA 4LHUG 3NBNA 4RMWA 3RNQA 4L8BB 4ESKA 1NUFA 3VWKD 3HPJA 4RWYL 1IC5H 4ONFL 4Q7DA 3S35L 4F7PA 4J6RL 1U3HD 1MRDL 4P46A 4BQ6A 1VFUA 2DLFL 5C7XL 1I4FB 1U8PA 1GSMA 3VXMB 5LWYH 3VXRD 2BFVL 2VLRD 5I16A 1MIML 1TZIB 1EHAA 1KENL 4IOFD 3NOIA 1L6ZA 4IDLA 5D5MF 5ALCH 3L3OB 4X4YA 2HJLA 1PKQB 3R0NA 2EE3A 4TVPE 2LVEA 2CMRH 1NUDA 4K94H 2YPLD 4UQ2A 3HI5H 1CL7L 3D0VB 3VFVB 3I50H 1DBKL 3V0AC 1A8JH 4FQQB 2AXFA 4DK3A 3UPRB 2IANA 3B5TA 1AQDB 5IEHA 1UA6H 4WUUD 1LNUB 1PVHA 1I1AB 1KTLB 1QQDA 1LP9F 3SGKC 4DK6A 2VLKA 4LLYA 1N8ZA 1L7IL 3MOAL 2DBLH 3QXAA 1K2DB 3BPNC 3HG1E 4JM4L 4KVCL 2EH7H 4PJ9A 4QF1A 2ZUUA 3CDGB 3EFDH 3DO7B 1KF9B 3ARFD 2DTML 4YDJB 4TVSa 4F7PB 4XPFH 4BH7A 3QH3A 2C3VB 2R0ZL 4KQ4H 5DO2D 3BW9A 2B8OT 4GRLD 4OLWL 1SVZA 3MRNA 3L3IA 3BN9C 2P7TA 3NZ8B 5F1NA 1FV1A 3HI6L 1F2XK 4LP5A 5GJSL 2ZUQB 4LK4A 5F72S 5H94B 1IBGH 3V4PH 1NAMB 3PF2A 4XBEL 1FIGH 4MXWL 3BP7A 2JKXA 2YKLL 1DBAH 3O4OB 1P7KB 3STZB 4TSAH 5F44A 5I1EL 5CJOH 1QSEA 2FBJH 3ULUC 3E8UH 3HRZA 4IMLB 1CD1B 2YUVA 1VFAA 1JGEB 5C0FA 1SEBB 2OS7A 4LPUA 2COQA 4GUPB 5LKNA 2WUCL 1J0ZA 4FQJL 2Y9RT 5IW6A 2FNBA 2A9NL 3V5DB 5F9JB 1XGPB 2E6QA 2WWKT 1OP5H 4HJGA 2APWA 2UZYB 2C3XA 3FT4B 4APQB 4IRJB 4HIHA 4D8PB 5CWSB 4UTAH 1E6OH 1U8OA 5D6DA 3F7PC 3QEGH 4NT6B 2NW2A 5I30H 5DJAB 1PKQE 4HUMB 1HI6B 4L9LC 1S78D 2GY7B 3MJ9H 1ZE3C 4KMLB 4PJCA 4OZIF 1CGTA 1HQ4A 3VFGH 5ALBH 1J0KA 2H1PH 1W72B 4G9FA 3WLWD 4WFGD 4WRLA 1CDYA 3RFZC 2J6EH 4NRZA 1RFDH 4LCWD 1A7PH 1TTFA 2IALB 4XP6L 2DQUL 2DQCL 5B3JF 4Q9QH 3AY4C 1UENA 4G6JL 3QG6A 4YE4H 4HIXL 1ZVYA 2DQGH 1SY6A 3WIHH 2FJFB 5EFIA 3QEQD 3S36H 1RIHL 1G9MC 4NQXB 4DQOL 4EDWH 4JDVB 3QEUA 4PGCA 4WO4D 3CSYA 4KQ3H 4WI6A 2KH2B 3IDJA 4PBVC 8FABB 1KEMH 3UDWC 1A3LL 1OAQL 3ZT5A 4PJBF 1WAAA 4JEGB 2A6IA 4PRBA 3PWLA 3O3EA 1CZ8H 4NNXA 5EO9B 5JIPA 5ECJE 4HGKC 4IRSC 1JF1A 1MQKL 4RNRA 4U1LB 2F54E 3NMEA 2E7LC 4NNPH 1NQBA 3GSXA 3SDCA 4GS7C 5I1JH 5DVOA 4PV8A 4MJIE