4KKBC

Structure of the e148a mutant of clc-ec1 deltanc construct in 20mm fluoride and 20mm bromide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fluoride-dependent interruption of the transport cycle of a CLC Cl(-)/H(+) antiporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords H(+)/Cl(-) exchange transporter ClcA
total genus 40
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kkbC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kkbC01
2HLAA 1T89A 4FQPA 3ULVD 4OV5B 1F6AA 4XHQA 1OP5K 1JN6B 4YHIB 3EIFA 3QCTL 2IANA 3HC3H 4Z5RB 3RVTD 1YMME 1HHKA 3RZCB 1J87A 3MV8D 3BUYA 3QFDB 2X1PA 1J8HE 2PW1A 3MV7A 4LSVL 3QIWA 1RZJH 1U6AL 2GFBB 1QR1B 4Z7UE 3HNTL 2FZ3B 3RKDC 5GPRA 5C08A 5DHVB 1XIWC 4FQHB 3TV3H 2AXGA 1R3KB 4XPHL 1KIQB 3SGKC 3IDXL 4AL8H 4N0YH 3TN0D 4BK4A 1X5ZA 4TOYL 4HIHB 4OI7A 1CL7I 5D6CA 2IQAA 3C5ZC 3GDBA 4M6OH 2ARJB 4A6YH 5HYJA 4DVRH 5BS0A 2EXYC 3W39B 2EDEA 1MAKA 2H3NB 1VFBA 5KSBF 1HE7A 4RWHA 3CIQA 3E6FB 5F97E 3GSVA 1I85A 3CH1A 3OG6B 1PSKH 1GGUA 1HINL 3V4PL 25C8L 2ZPKL 4I3GA 4N1EA 5F44A 2L7UA 2ITDA 5C0GB 1AY1L 4XCYB 3G5VA 3W5NA 4EOWH 3AROA 4HFWA 2L0DA 3IFLH 5E0QA 4Y4FD 5ID0B 1BREA 4JLRB 1TJHL 1FZKB 1M7IB 4P3DA 4Y5YB 4PTUB 3MROA 1KJ2B 5L9DL 1A47A 1IFHH 4OCNC 3VGAB 2W1NA 3H42L 5EBWB 3I6LD 4UZGA 4UTBH 4HIEB 4JQXC 1U58A 1YMMB 4P4KA 2IBZX 3BPLB 3D85A 4KQ4H 1DL7L 3BZEA 1H0DB 2PUQT 4PJFE 3DECA 4NNYB 4X5WA 2LAAA 1ULVA 1VKXA 1I7TA 4NJ9H 2FJFB 5F1NB 5BZDB 5JIIA 1JGLH 3K74B 5C0BB 1CTNA 5FA3B 4U49A 3VW3L 2XN9A 3RDTA 3FHAA 2EDWA 3NFPA 4I0PD 4X6BA 4WGWB 5A43C 3BEVA 4X6CA 4WDIB 4NC0B 2LV4A 3HG1B 4LCWD 4TULL 2OBGA 2AV1B 3TJEL 3MR9A 4K3DL 2BCKB 4I1NB 3HAEB 3W9DB 4PGDA 2HLFD 4D9RE 3G08A 5F7UA 5JO5B 2C1PB 4MSWA 4ODSL 4HSQA 3TIEA 5F1OB 2NY5H 5GGRA 4NN6B 1NDGA 5H35B 4XVJH 4NRXB 3RVXD 3ARXA 1ZGLA 2JIXB 2NR6C 3N9GH 1NCAL 2DB8A 2X1XR 3D6GA 2IPUG 1QZ1A 5CINH 3ZKND 4GSDH 5IVXF 5C0RH 5CEZH 1BFTA 4YGVB 2CMRL 5FB8A 4GH7B 1D5IH 1FFOA 2AS5M 3H7BA 3STZA 1NFDE 1D6EA 5D7LE 5GS2H 3IFOB 3LRGA 4NKMA 3P30H 2PO6D 4RGMC 4QHUB 3SO3C 3CK0L 1IAIL 2HJKA 4PJXE 2CKBA 4S11A 1JGUH 4R26L 4FOMA 3LS5H 3FFDB 4XNQB 4WUUB 2MSPA 2HWZH 3OF6D 3ABZA 4ZYKB 3WDJA 3O3BB 1CE6A 3MRJA 3JV6B 2RCSH 3I3EA 1NMBL 1QRNA 3KPNA 1A6WL 1JHTA 3NPSC 3X12A 3HUJB 4OKVB 3TBSB 3T0BA 5HGGS 2VN7A 4Z7WB 1BVKA 3VFPB 1MH5B 4YXKL 1FG9C 3ZT5A 2O5ZL 4PJFB 1IE5A 5KS9A 1U2CA 4HWBH 5BMFH 5J8OA 5ABDE 3SKUD 5IHBA 5KVDH 5DHYB 4NHUA 4XP6L 1P4BH 4PR5B 2I5YH 5EN2B 1N2RA 2X41A 3PF2A 3QWOA 3VXOA 5FYKL 2Z9TA 1FFPB 4F7MA 3EYSH 1NGPL 4RIRA 4XGZA 4J3VA 2F74A 2EYRA 2R29H 1OF2A 1A7PH 1TCRA 2NY1D 3SKMA 4JCLA 3FB7A 4JFDB 5DDHB 5FYLL 1AGCA 4KK6C 3SN6N 3QUMA 4H1LA 1MCBA 3WUWB 4Z78A 2A6IB 1OAQL 4F57L 3VWJA 4KTDH 5HVHB 2ZNXA 4IDLA 5H2BA 5I15L 3HRZB 3OXSB 3DBXB 4U1IB 5ACZA 1BZQK 5CZVH 3C60B 4XPGL 2V9RA 4I18C 3BP6B 3MREA 3T0EA 1WGOA 4JDTH 5INCB 3ILQC 2Q8AL 5KVGL 1SBSH 4QXGL 2WWKT 4GMSH 3VWKD 3I2CH 1T7XA 4PJDB 1S9YB 1FO0A 4K8RC 2EDDA 2FIRT 4OM1L 4IRSC 4R9HA 3S5LG 2VKWA 3EZJB 2VR4A 1R6VA 1YNLH 3QO0B 4M4RA 3VFNB 3VMOA 5FUZL 5ISZD 4JFYB 1JUFA 3RY6C 4OLWH 2ZOKB 4X4MA 3GSWA 4YK4C 1EO7A 4Z7UB 1N7ML 3LHPH 3LHPL 4L4JA 4I5BB 4OI8A 5C0DB 5DZNA 3D18B 4X0KB 5JPNA 5DUPL 3D9AL 4WI5A 3M8OH 4XVSH 3BN9C 1ED3A 1KJVA 1IQWL 1LEKB 2CR6A 4PJ8C 3S96A 4L5FL 3BGFB 1CXIA 2DWEB 3KJ6L 4G80B 5FF6B 4M7ZC 3LIZH 1EJOH 3BKYH 2GSIA 3QG6B 4TVPD 2R8SL 4RDQF 1XGUB 1VENA 1JZ7A 3BE1L 3BP4B 3QI9B 4KROC 5A2FA 3HAEG 4KRNA 4K7FA 3RGVC 1R5VB 4NIKB 2DIJA 1F4WH 2P5WA 4G6MH 2FO1A 3KPSA 1Y0LB 2D7QA 4XP5L 1A7OH 4G8EA 2AGJL 5SWSB 1CDCA 3RX7A 1LEGB 4Y19A 2NNAA 4NKDA 3GMQA 1T6WA 5EC2B 4RMVA 1ZANL 5HYJE 4X7TB 1I9IH 5DA4A 5IVZA 1FIEA 1LE9B 3TFKD 4HK0A 4M1GL 5CEZE 3C6LA 1V3LA 1I8KB 5EZJB 4MAYB 1DN0B 5EO0B 1PKQB 1AQDA 4LKCB 3PV7A 5D71L 4HKJA 5I19H 1FCCA 1LE9A 3H2WA 3IKCB 3F5WA 3BDYL 1DVFD 3KWWB 1NEZB 4NO0D 3THML 2O5XH 2Z93A 4G8EB 1EXUA 1S7UA 1AGDA 1E4WL 3ARYA 4L4TD 5E8EA 2VC2H 3S34H 3V5HB 4LSSL 4H26B 4AIZA 5E2VH 3EGSA 3WIIH 3T2PA 1XGUA 5DTFA 4L29A 3VFUA 4NN7B 3LPWA 2FATL 1DDHB 1T66C 3FB5A 5DHVH 2DWEA 2MKWA 1BPVA 4GLRH 3RWCB 1C5CH 1HHHB 1G7JA 4TUKL 3A67L 5ITBH 4HDIB 5I1DB 1GZQA 4HZAA 4DVBB 4LF3A 2F9BT 5I30L 2HKHL 4PUBH 5DD0L 5EU4A 2V5SA 4M48H 1OVZA 3BKCH 4XP4H 4Y89A 2FX9L 3DARA 3OGOE 3HNVH 3FQRA 4NRZB 5C0CA 1DEEB 3DUUA 3MJ9A 1LO4H 5D7SH 1JUFB 2RFXA 4J6RL 4Q9QL 1E27A 2R2BB 1JNHA 4P2RE 3CSBA 1A1NA 1Q94B 5FHAH 4WVRA 1GCFA 3T2NH 2NY0C 2R9HD 1S9YA 1JIBA 2UUDK 4OT1H 1IC7L 3T4AA 3IDMB 3NTCH 5DMKA 3TESA 1BQSA 1OSPL 4QF1B 3DNKA 3UJIH 2ZP0T 3DRQA 3E0GA 5ERWA 4HJ0C 2E6QA 5H8DA 5ETUB 4O2EB 3I50H 1OAYH 3WN5B 2WLZA 5ACZB 3DBXA 5HI5C 2FNBA 1CLOH 5J6GA 5I6XB 2VIRA 3F6IA 1KJ3H 2W9EH 1G7IA 4V2BA 3IJSB 1EFQA 5EUOF 5EU5A 1KLGB 2DLIA 3IVKA 3GIVA 1QSFE 3DROB 4LCCA 3L7EB 1LDPH 5C0JB 1NCBH 2PXYB 1LP9B 3SKJH 3OZ9H 5IW1A 4ODXA 4R2GD 4KJYA 4MHHG 1OM3L 4D94A 1YQVL 4KKBC 5KSAD 3X3GH 4Z7NE 1FFPA 3BZ4A 1JRHH 5DI8B 5I8KL 4DN4H 5SWQB 4JPWL 4FZ8L 4Z76A 4HJGA 4M7ZB 3MTRA 1A6VL 4P23C 4LARH 4IOSD 2MQ0A 3KAAA 1I1CA 5LAXA 1NGWA 4PRHE 5FDWB 3MRHB 1MPAL 3DHMA 1AI1H 3WFCL 4PJ8B 4KI5D 4PTTB 4RSVA 4PRNB 4U6VH 4F7EB 1D6VH 3VD5A 4RQQB 4C4KO 4X9FA 1FZOA 3F12A 3WO4C 3G6AA 2H26B 4QRQA 1GC1H 1IGIL 1BMGA 3MJ8B 2CDFA 5C7XL 2BXZA 5DJ8B 5D93C 4F15B 2ZUWA 4XNQA 5IHUL 1MCRA 1UM6H 4Q2ZA 1GIGL 2YA2A 2H6PA 1T1YB 3DX6B 4M8QB 5C08D 4HXBL 3NFSL 4HIIA 4KJPC 1U2HA 4G6KL 4H20L 5JPMB 2NY0B 1D7FA 5HHOE 2FSEB 4L4TE 4NN5B 3V4VL 4BFGA 1BZ9B 4NNPH 5HD8D 4DGVH 3VGDA 3GRWA 3NVQA 3WHE0 2BVQB 5EWIH 4O2FA 1ZLVK 4X83A 5T33H 5AUMA 4ZUUB 1ZT4A 5DWUL 4OF7A 4LIQE 4ZPTA 4PJHB 1KB5A 3VFVB 1ETZA 3O3UN 2FR4A 2GSGB 1W0VA 1K4DB 1R3JA 2PW2B 4RFNC 5JOPE 5I9QC 3S97C 1HSAA 5I1IL 1LQSR 1P9MA 4WCYH 4KGLA 3HMWH 4WI6A 3VXQB 3DVNA 3E8UL 3PQYD 1NC4A 5EBGA 3X14A 2R8SH 1SM3L 2VDPL 1CFTA 1CDJA 4LMQE 4LRNH 3MJGX 2YKLL 1KOAA 1K8DA 3QZWA 2GW5A 3O8XC 3VRJA 3EYVB 1WWWX 2CDFB 3OKMB 1MFDL 3T3MF 1KYOK 1IGJA 3ESVF 2VXQL 2DL9A 4E41B 5KG9B 4RQQA 4MA8H 3OX8A 3QSKB 3VG9B 1FGNH 1MFBH 1X4XA 4YXKH 4QNPE 1XH3A 2AJYH 1HHIA 3CDYA 5AZEH 2GJZB 4PJ9B 3GSQB 4FXGB 4TYUA 3BN9D 1IC1A 1TTFA 2J6EH 1K3ZA 2Q8BH 1NBQA 1ORQA 2AEQL 3HE7B 3HMXH 4I3RH 5A2JH 3G6DL 4I0PA 2WAHA 3QP3A 2DQUH 4FHBD 5ALBL 3CFIC 3SGJC 5ALBH 3LCYA 5BV7C 1EO8H 3VXUE 1V7ML 4K23L 3VI3E 4QY8A 1UB5A 1ZVSA 3MX0A 3CLFH 1CFTB 1LO0L 4L4TA 4MCZB 1U8MA 2Y6SD 2BRQA 4X7EC 4FRWA 3D2UD 3WLBB 3O2WH 2P45B 1SQ2N 4CN6A 3MZGB 3VXQA 5L2KD 5DK3A 2VIRB 2NY7H 4N0UB 4KH2A 4GW1B 1K9TA 1MJ8L 5FO8B 1GGIL 4MNGB 1B0RB 2X89A 2AAVA 2QQNL 1RHHA 4XP9L 3ULSA 4XP9H 1J8KA 3BH8B 4PJCA 2YPKB 2ZOLA 2H3NA 1J10A 1JTPA 2B0SH 4P99A 3HC3L 1A3QA 5AUMB 2V17H 2HLFC 3QXDA 4BZ1H 4HG4J 4XC1H 2NTFB 3BISA 3V5DA 4DEPB 5JXAL 1GJIA 2V5RA 4QRPE 4L3CB 1G6RA 4P2QA 4YXHH 1FLTX 5C0CD 5L2JB 3RUGB 3GGWA 3DUUB 5DK0B 3VXSB 4FTVD 1KIQA 3PP3K 4K7PH 4E5XB 5IB5A 3QNYB 3LEXA 1QR1A 3HPLA 3KHOA 2NW3A 2ERJB 4Z7OE 3TZVD 4NOFA 5HHMB 3AU1A 2VABB 4LVEA 3O6LL 3GHEH 3WE6A 2KDGA 1F3JA 4NQSB 4YHIA 5IF0A 1U95B 1WBXA 2AEPL 2MCG1 1K8IB 3RX8A 4PRNA 3VCLB 4UT9L 4J1UB 5BZWA 1KTDB 1U36A 4G6JL 4MA3A 4CNIB 5DXWA 5EUOA 3LIZL 3TA3B 1QSZA 4YNYA 3GM0A 4KZDL 4K3JL 1IGTB 5C09D 1I1AB 2QV2A 4G8GD 4BQ8A 3ZMRA 1RJLA 5HDOA 1KGCD 2DYPA 1O7VA 2ATPA 3OZ9L 2W60B 2DI8A 3KWWA 3W5MA 4QTIH 4ELME 1VEOA 2EDHA 4U6HA 5FK9A 1X5LA 1T22B 3H3BC 3I6GB 2E9JA 2WINA 4JZNB 3G6JE 4Q0XH 4L9LB 3RIAK 4NWUL 4UUJA 4K94H 1DN0A 5EO0A 5IB2B 1YEGH 1UKTA 4ZUWB 1J8HA 4JZOB 4M9PA 2XZCH 5MENE 5EZLA 5EC2A 3GMQB 5TGBA 3BHBB 1CBVL 1ZHLA 1K85A 4BQCA 5IFJA 1X5FA 3MRNB 4NFCA 4BQ9A 5FO9A 2XKNA 4KKLD 3WXVL 1V8HA 3D3VA 1CD0A 3DX9A 3HRPA 4LL9A 2FIKB 4WFFE 1HNGA 3EDEA 4F37K 5F70A 5EORH 3VFOA 2P1YA 1MHPL 2VDOH 4KPHL 1CG9A 4APQB 3MRGA 1VADB 4GG6A 2Q7NA 4WHTB 2DRUA 1OAQH 1INDL 1U3HD 4TSCH 4F57H 1JNJA 3L5XH 3E6HA 4U1NA 2FH6A 5C07D 4U1MB 1JF1A 4U0QB 3D18A 1BFSA 4X0KA 5KBNC 1MRFH 2MCPH 2Y4SA 5I16A 1FL6A 2VLKB 1E4JA 2A6JB 2XZAL 4CADB 1OTSD 2LAGB 1SMOA 3QIWC 1WZLA 3TJHC 2BSRB 2KL6A 4U1HB 1T1WB 4MAUH 2J8UA 2APTA 4PJ5E 5IMOA 3UBXG 4N5UA 1D5BB 1MQ8A 4OM1H 3V6FA 2R1XA 1OP3K 5IQ9A 5HYSA 3MXVH 5FO9B 7FABL 7FABH 1AGDB 2PR4L 1IAMA 2JCCF 3FO9B 1ZHLB 5F9OH 3VGGA 2XT1B 3FCTA 1WFOA 2RCSL 3BP6A 3B3IB 3FN9A 1NSNL 3E3QE 4RFOL 4M5ZL 1A14H 4XCNA 1T3FB 5CMAB 3OXSA 3MOBL 5DHXB 4UNTA 5EU6D 3HRZA 5F9JA 1H3PH 1I9RL 1YN7B 4MNQB 4PJBE 1FCGA 2O5YL 5DMIH 4UUJB 2DQCL 5DC4B 3V8OA 4G5ZH 1LO2H 4Z78B 3JWDC 5M94B 1SYVA 4OSUL 1T22A 2OL3B 4OZHF 4NKDB 2NNAB 3SKMB 4N0FB 1TCRB 1NCBL 3VXMA 4PJ9C 4WW2A 2DYPB 4LIQH 3GJFK 2HTLD 1HIML 1WFUA 1YY8A 3KPSB 5JQ6H 3WMSA 8CGTA 3QWOB 4OJFL 3VXOB 4F7TB 2AJZB 1EO8L 2B2XL 3BQUD 2CK0L 1KJMA 1LP9F 3K1DA 4RMTA 4NQEB 4JY5H 4PJFF 4CU7A 4JFEE 3CZFA 1I8LC 3MRKA 5DHYA 3TBYA 1NMCB 3D2UA 2CUIA 4PJIE 1ZSDA 5EUOB 1GPOL 5KS9B 1EVTC 1DLFH 2XZZA 1JI1A 5KVFL 4AM0A 4Q6YA 2EICA 1KYOJ 2FJHB 2XNAA 3TBSA 2BSED 4ZD3H 3N0PB 3T0DA 2A6KA 4LQ1A 1RZGA 1ED3B 3MRJB 3S98A 1BWWA 1CE6B 1FDLH 3L5WA 1M71A 4LDEB 4UV7H 5GS1C 3ZTNL 1WWBX 5I1HH 3TNMA 2X4PB 1I4FB 5C0AB 2NY0D 2XFXB 1AJ7H 3L3GB 5JR1L 1RUKL 1JJUA 1F6LL 2FX7L 3GSWB 2FO4A 1J0IA 1A1OB 3IGAB 1E4WH 3VFNA 1CLZL 5J13B 1AKJA 2EIEA 3S34L 1FFOB 2BNRB 4Q7DA 4FFVD 1Z9LA 4ZAKB 4G7VL 2NMSA 3NH7L 2EKSA 5CBAA 3ULUL 1W8NA 1T4KA 2DQJH 1Y6KR 2ADJA 2UZYB 2VXUL 2FATH 4GKZB 4EUPH 3VXSD 3BO8A 2QR0B 4D0BA 4FG6C 1XIWB 4S1RL 1YPZF 4NYLB 1RY7B 3Q5TA 4UDTA 3I75B 5E94B 2ADFL 2BVTA 2VLRB 5E1AB 1MLBA 3RY5A 3S4SA 1FSKB 1XGYH 2BY0A 2R9HC 3SGDH 1KXVC 2BMKA 2KZ1B 4PGDB 35C8L 3W9DA 3FONB 1YECL 2BK8A 3Q5OA 1FFNB 2APBA 2EDOA 4AT6B 2X70B 2C1OB 3WO4B 5MERB 3IDIB 4N8CH 1X5IA 2VDKH 4Y8AA 5E8PA 3S5LB 5HPOA 5C09A 3HNVL 2AJ3B 2DQHL 2F74B 1J0JA 4IDJL 4YHOH 1JYVA 4BUHA 1AC0A 4PBXA 5FKAB 5L7XL 2V2TB 3ARFD 1CFVH 3W81A 1CFVL 1KIUA 2X4RB 2BRRL 1KPVA 4JJ5A 3LDBB 3I9GL 4A2MA 2JB6B 4X5WB 2HT3C 1MFBL 3F7VA 4JFDD 3BESR 3GI9H 1MCWW 4WUUD 2GJZA 5ICZA 4D9LL 5DGQA 4TNWK 1XH3B 2Z31A 2J6EL 5DYOA 4PYGA 3PV6B 2M1KA 3U36B 2OR7A 5CEXA 4GXVH 4TUOB 2UZXB 2HJFA 5KVEH 3RL2A 1RIHH 5IB4B 1CWVA 1K8DB 1J05B 1JWSB 3GSOB 3TWCL 3QIBB 4ZYKA 1IAOB 3RNKB 5GSVA 5HBBA 3MROB 5D1ZB 1TZIB 2WQ8A 3QIBC 5HD8C 4QRRD 2MTPA 2HJKB 3VFMA 4YFEA 5ISZA 4Q74A 2FL5B 2HRPH 3TVMD 4MNGE 5F9AC 1IGFL 3WIIL 4HKXA 4H1LH 4NKQB 4PJCF 3RTQA 4L4VB 3LN4A 2GSGA 3QQNA 3O45A 1YEEH 3ALWA 2BOBB 3AREB 5GGSY 3P4NB 1E6OL 2J3SA 3GSXB 1JNLL 4M5YL 3VI4E 1JNLH 1CFSB 5D2LE 2V17L 5DD5H 1LK2A 4YEEA 1ORSB 5B38G 4NWTH 2JIXA 2D7TH 1ZGLB 4O58L 1KENH 4G9DA 4EVNA 1A3RH 4Y16A 3ALPA 3SHSA 1GC1L 4D0CB 4IMKC 1R3IL 2C1PA 5LG1A 3UX9B 4UOW0 3O8XD 2X4NB 3BP5B 1FP5A 2PYED 4HS3B 4IRSA 2BCKA 1DBKH 2QSCH 1EBPA 4ZFGL 4J6RH 4Q9QH 4MAUL 2QSTA 5C0AD 4Y19E 2VB5A 3T77A 4ZO8A 4PLOB 4RDQG 4HUVB 3BEVB 5EA0H 4LCYB 4QRSA 2R69H 4ZUVA 2GFBA 4XPTL 5GS2D 1AH1A 1PZ5A 2HG5A 3I6KB 2ATKB 3GB7A 1NJ9B 5DC9B 4CL7A 4QO1A 1MCFA 2XKUA 3UYPA 4DTGH 3NGBC 1BD2E 1KF9B 3ZHLA 1XF5B 4KVCH 4KVCL 1ZT7B 2HKFH 1NDMB 4PJ8A 1I8IA 3HZYB 4P59L 4DZBA 4NNYA 4XPFL 1QPPA 4P3WA 1II4E 1AO7B 2BSTB 4AMKH 3TEUA 4XVTH 2FWOA 3UEZA 2IANE 3D85B 1MFEH 3TYFA 4ZO9A 5IKCA 1KPUA 3GRWL 5SWQA 1RJZA 4ONFH 1I1YA 2E27L 1U8NA 5L0QC 1FZKA 1M7IA 1P84J 4Y5YA 1HIMH 4K8RD 4ZUSB 5C0FA 4OJFH 4DJMA 1SM3H 1U42A 1JGDA 1ZK9A 5KANG 3OMZA 1H5BB 3BIAX 1J86A 1FVCA 4ZOCA 4LHUD 1W0WA 2CK2A 5F93C 2H2PD 3KPSD 1KACB 4TNVK 5IWLC 4Z77B 2GI7A 4O51A 5H94B 3WFCH 2WQRA 3ARFB 5ESVB 5K9OB 2E6PA 1B0GB 5A16A 1H8NA 1JZ8A 3E6FA 2BVPA 2F19H 3IDMA 3PHQB 4J4PC 5ITFA 2W0LA 4JHAL 5T1KA 2J4WH 1RK0A 3QQ4A 1MCNA 5D9SB 4X9BA 1R0AH 4NQXB 5A1AA 4I9WD 4AZ8A 5HYJD 3CAFA 3W2DH 1QFUL 3L1OL 4JZJB 3FFCD 1SEBB 4JQIH 1JNHB 3MGTA 4KKAC 1CLYH 1DVFA 2HTKC 1V7MH 3DMMD 5D1ZD 3QG7L 1M7DA 2KBGA 5DHVA 4LVNB 1KBGH 1JNNH 4IRJA 4GBXD 1KBGL 5EU4B 2X10A 3BOVA 3T08A 2PW1B 1UYWH 2PYEE 5I74C 5T1MB 4CVUA 4ZFFA 5EZOH 5EBLA 3MLTB 4Y5VB 4ZUTA 4M7LL 4G6AD 1LD9A 3O41A 1YPZA 3QDGB 1UJ3A 5T5FH 1C7TA 2XWBB 4MJIB 4XNMB 4JFPA 5EOCJ 5EFIB 1YDPB 5BW7C 2ADFH 4R4BB 3ZSSA 1N4XL 1ZHKA 4O2CA 3JSSA 3NAAH 2OR8A 3ES6A 4PJ7B 4Y5XA 2Y07H 5JMOC 4TTGA 3ULVH 4N8CL 1ITCA 5SX4I 1T2QH 3C08L 1S7UB 3P2TA 4I77L 4R4BA 3TGXA 4XMLL 2YK1H 1J9CT 3QQ3A 1I3GH 4YHOL 5I1CL 1ZAGA 2I24N 3RPIA 4CVWA 5TDOA 4R2GB 3EJZD 3T0XA 5HHNA 2X4OB 1MI5B 4LGPB 3R06B 5EBLB 15C8H 4APQC 3O3AB 3LRSA 1GHFL 4F9LC 1NUFA 2E7CA 4HS8L 3C6LB 5DFVC 4B41A 4NBZB 4Z95L 3HCVA 1EH9A 3VFSA 2VQ1B 5AG9A 5GGUB 2HFEB 5SWSA 1CD1B 3LOWA 3QUMH 2IADA 4X5XA 4XCEA 4G6JH 4LCIH 3AFLA 2E7HA 2ICES 4RGNE 4JJHA 1N59B 2B39A 1U8LB 4HS6B 1AXTH 2VDRL 1T80A 2JELH 2OP4L 2OTWB 2IQ9L 4U3XA 1Q8MA 2YN5A 4ZDHA 3D3VD 5ITFB 2P8MB 5I76B 4WHYG 1QSED 4PGEB 3VFRB 1U92B 1MI5E 1RJYB 4BM7A 4H8WH 5DEGB 5E99L 3KPRB 4R2GC 1VPOL 1A6AB 5E9DD 1EEUA 1DBJL 1CVSC 3JUYA 3UROR 4Z7NF 4JRYD 2MKLC 5IVNA 3WFBL 3O6MH 2WWMD 3L3HA 4GRWE 5BS0E 1HKLH 3BXNA 5DQDH 2ICWJ 3G5XB 1QBLH 1HWHB 1I7ZB 3GIZH 1Y18A 1G7PA 5DJ0A 3HA0A 2D9CA 5TH2B 5IK3A 1WVZA 4ZQKA 5GRUL 5MHSE 3GM8A 1WT5C 1SY6A 3CFDA 4I0CC 2NLJB 4XP1L 3RUGF 1A6PA 1MJUL 1XIWD 2B7DT 2FWOB 5DRZB 3RY4A 2OTUB 5CEYA 4XAKD 3INUH 2VLRD 4M62L 5D7JC 3DTXA 4KKBD 1NC2B 4YPGB 1MFAH 3FRPA 3DX7B 1JHLL 4HHAB 2WBWB 1OGTB 3ILPB 4P4RB 3FQUA 1P4IH 3CFBB 3QIUA 3U7WH 5IBTL 3O4LD 4JFFA 3RWJB 4R3SB 3WNNA 4ELKA 1RZKH 3M45A 5DDHA 1T5XA 2CIKA 4OZFH 2P7TB 2EC9U 4DEPC 1QRKA 4YBHA 3O9WB 1VFMA 4QKXB 4PBWD 3QPXH 4JM2A 4JFED 1EHLL 4QNPF 4OCXH 3MYJA 1NC4D 3FO2B 1G6RH 4KRPD 3KYKH 1NUNB 1PAMA 1CDGA 1A2YB 2GK2A 3SJVE 3U6RA 4JDVB 3M1BA 5M7QA 5GRXG 3FOLB 3Q3GB 3CXDH 3PWPA 2R2EB 2IF7A 3V4UH 3MLUH 4CUCA 4GXVL 4QYOB 1LO3L 5CGYD 1FYHB 1H5BC 1FIGH 4F58L 2OZ4L 3X11B 2OZ4H 3ZKQD 4MXWH 3QUZA 3AGVA 3MMEB 2UWEE 5IR1B 1YYLL 2VE6A 1QFWH 3QH3A 2ITCA 1NFDF 1K4CA 2WP3T 1GGBH 2BY2A 2IH1B 2UZIL 4OIAA 2Q1EA 5LGHL 2NY1B 4P4KC 4PB9H 1P4BL 2XQYG 3GMMA 2J5LC 1FRGH 3L1OH 4PGZA 2OI9B 2Y5TA 4NRYA 5IVXE 3STZB 3BZDA 2AJUH 3QAZC 3O4OB 5FM4A 2W07A 1PEWA 3B9EA 1UENA 2R29L 4WEUD 2P5WE 2HT4C 3QDJA 1BD2B 3BPOC 1F4HA 4MA7H 4OIIL 3IXTA 1H9VA 3DV6B 3IB4A 3Q6FA 2X4QB 4YC2B 2AXHA 3O8XB 4IRJC 5M95B 1JFQH 2Y7QA 3GKZA 2ZJSL 1E28A 3G08B 3V0WL 1YYMH 3MXWH 5FKAA 1QVOB 1ES0B 2CQVA 1DQQB 2V2XA 5I1KH 5DS8B 2UUDH 1X3DA 2P7TA 3MR9B 4G8GA 3RHWK 4IRZH 3O2VL 4Z7WE 3MLVH 1IBGH 5DLMH 3QA3B 1KCSL 1FFNA 1W8OA 3EOTL 1RIVL 3MODH 2C3VA 2MHAA 2WIMA 3CFEA 5DS8A 3G5YB 3QEQD 3CFBA 3CMGA 3UJTH 1GOGA 5F89A 3C08H 5INDA 3UBXA 4CKVX 4KWUA 3K8KA 1EHNA 2W0KA 4OLWL 3UYRL 3FB6A 3DPBA 3OAUH 4P48A 5CD5C 4OIBA 3O6FB 5KSVA 4EDWL 4QHKI 3UJJH 2HKFL 1C7SA 1EZVX 1C08B 3GKWL 4NN5C 1BQHG 1QLFB 1JGEB 5D7LB 1KT2B 4EN3B 2XWTA 1GGCH 3HS0A 3MLYH 5GGTH 4K9EC 3TV3L 4PJAA 2XQBL 5B21A 3QCUL 1CDUA 4TPRH 3RRQA 3TZVC 4LEOA 2WUCL 1MF2H 1HH6A 2Y72A 3N1MC 3DWTA 1YN6A 5FO7B 3GMMB 1WCBB 3L5IA 3IJHB 4JLRA 1EJOL 1L7TH 5JMRA 3NIDF 1P2CB 3SE8H 5I1JH 2YSSA 1AXTL 2WZPD 4U0RC 5EZIL 5D7IB 5F3HB 5D6DA 2DQGH 1VGKB 4KHXL 3QUZB 3NZ8A 3ZTJG 4PJEF 3WD5L 1ZOXA 4YDKL 2A6KB 1HINH 3V4PH 2ZPKH 4FQXC 3D1MC 4FFYH 3WHXA 2OM5A 2EH8H 4UB0H 3VG0H 4NQVA 5C0IB 2OXGA 5C2BL 4APQD 3E3QC 2I60H 2F54A 3RJQB 3HPJB 3MYJB 4HUNB 4GS7B 1ZTXH 5I1HL 4QXUH 2DQDL 4DKAA 3MV9D 2ESVE 1HKLL 2UY7A 2NXZC 2VTFA 1CLYL 4P2OC 1FL3A 1K3IA 1WZ1L 5EOQL 1A0QH 4U3CA 2CIKB 2AERT 4R97B 1FAKT 3D3VE 3REWB 5DZLA 4R3SA 4JREC 2DQIH 5FA4A 1UYWL 1EMTH 3BUYB 3KPQA 5GS0L 4Z7VA 4P4RA 3DO7B 3SDCC 2OXHA 1YEEL 1EEYB 3T4YA 3BMWA 1P1ZB 4XNZB 1MNUH 1WC7B 2EDRA 1UQSB 4JDZA 1MNUL 4RWYH 1ODAA 1C5CL 1C12B 4ORZC 1RZ8B 1OAZH 4KV5F 1U3HB 3LMJL 1UH4A 3GZKA 1FV1A 4JY6B 2BP3A 5C07A 3SE3C 3K8LA 1A3RL 3RJDA 3PP3H 5DF0A 3AY4A 1LWRA 5TF1L 2GITB 5IMKB 4PRPE 4M48L 1LK3H 4PRHA 1MI5D 2NY5L 4JFPB 4X98A 3DURB 4G9FE 4LSRH 1JYXA 1KIRA 3ME0A 4GG6E 3JVGA 3P4LA 5GGRY 3MRDB 4F9PC 5F6IB 2A74B 3R1GL 1J88A 5HY9A 1N0XL 1QQDB 2LVCA 2NXYB 3ECBB 3AM8C 3VXUD 4O5LH 3O9WD 1LEIB 2J8HA 1A7RH 3HC0B 1J0KA 2I07B 3GI9L 2NX5D 5TDNA 2EDBA 4LSPL 4HWEH 1U8IB 4P5TA 3MRGB 1NMCC 3SDXE 4JO2L 3VFRA 5CJBA 1QP1A 2HYMA 3MLXH 5HYQA 3C2AH 1Q9LB 4ZTPH 4WI2A 1WBYA 5F7WC 5E4IA 3C60D 2DWDA 3D3VB 1MFEL 2ICEA 4MS8C 5CSZB 3BX7C 4WI3A 1RK0B 4OLYH 4GAYB 1WAAF 2XN9D 1QYGH 3LKRA 1Q9LA 2HRPL 1HDMB 5HJ3A 3OKKB 3VXMD 1JHKL 1MELA 1YY9C 1PLGH 4PGCB 2NY4D 5ENWA 1MCQA 3PGCA 4JZOA 4ZUWA 3QJHB 3NCJH 3QPQD 3TBVB 2WBJC 5I1EH 5HY9B 2GAZA 1DUYB 2QQLH 3MQIA 2QQLL 2R0KL 3N1QC 4GRWH 5JHDE 1YQ2A 2FRGP 1I9JL 4LSQL 2CIIA 3GMNB 1R3IH 1O0VA 3FRUA 3FAWA 4LVOC 1DJSA 3FTGB 5IFHH 4YUEL 5DVKA 2VLKE 1BX2A 4G6AC 3ZL4L 3KPMA 3MLVL 4U1SA 3UO1L 5LGJA 5E4EC 4TUJA 4OLXH 5CJ5A 4MJIA 4XNMA 1ZT7A 2VZSA 1P1ZA 3WO3B 5E6ZA 2Q8AH 1VFUA 4N5ED 4GBXA 4JKMA 3STBA 1CFNA 2VH5L 4WNQB 3QZWG 3RGHA 5DO2D 1GGYA 1U93A 4JB9H 5IEKA 3PWUB 1L6ZA 3BH9A 4X6FA 3HNTH 3CCHA 4G42A 4LPTA 1FE8H 1GL4B 3O0RL 4KUCF 1B0WA 3CMOH 1J0HA 1S7QA 3ZKNC 1T6VN 4NKOB 4TOYH 4KRPB 2O93L 2DTSA 2ZG3A 5GJTH 4Y16B 4EVNB 3LKOB 3NAAL 5CZXC 5JW3L 3QUYA 3F8UB 2F54B 3KYKL 4MXVE 1A6UH 1CT8A 1U91A 4YPJA 3TPKA 1IC5L 1MQKH 2PYFA 3BKMH 3MV01 4HF5L 3UAJC 1IC5H 2ADIA 1MQKL 4HT1L 3FQTB 3UC0L 1CQKA 1ZV5A 4U31A 3ULSB 4JFXA 1ADQH 3TF7C 2NY6D 2FECI 1BQUA 1MCWM 3ARFA 3U9UA 3HKFA 4NC2B 4XRCB 5LQBL 3GMPA 3IETB 3D87B 1IZKA 5D7IA 5CGTA 3UZVB 3PGDA 1U8HA 2FL5A 3TNNA 4D8PA 1WITA 4Z95H 3WLBA 5D72L 3ARWA 2J4WL 4B7LA 1QLEL 2P8PB 4LLUA 1TZIA 3NZHL 5DRNB 5A2IH 4QY8B 1ZTXL 4PRDA 2DQUL 3BRDA 4YDIL 4FQQB 4YDIH 2AI0H 1ZANH 4ODBD 3BW9A 4C56B 1T5WA 2BERA 3HC4H 5JOEA 4QGYA 2PO6C 4OI9A 3TYFB 5MP6L 5CEXB 2F8VA 3U36A 3HE7A 1EDQA 4QRRB 1QLFA 4P2RD 5D7LA 4MJ4A 3VXME 5TQ2H 4P2OA 1HHIB 1V3KA 2M2DA 1ZLSL 3GO1L 1IGCH 5DJCB 5IROA 4NCC1 1JFQL 5DK2B 3WFHA 2FGWL 4FQXD 4WW1A 1XR8B 2Y25A 3ZKXC 4PJBA 4KC3B 3SO3B 2D2OA 2EIZB 2J88H 3VE0A 1U3ZA 1A9EB 1Z5LA 4QRPB 4H0HB 2A9ML 2J2ZA 2D7MA 2FBJL 3OJDB 4LK4A 3FONA 1DLHB 3TN0B 3GSUA 4PB0H 2BZDA 5E8DL 4CN4A 1ES0A 3P77B 1OTTD 2Y7QB 4IRSD 1A4KB 2KKQA 4G9DB 4LDOB 2EDYA 4RA0C 5DJ6A 1XIWA 1JK8A 2HKHH 4PUBL 4WEBH 3O6KH 1BQLL 4N0UE 1T4KB 3U4BH 2J1KA 5BOPA 1RHFA 2W38A 1UWXH 4O5LL 3JVGC 3BEWA 2R23A 3PDDA 2BOBA 3AREA 3C5ZA 4NQCE 3HE6C 1BIHA 1EAPB 4LQFH 4FMKA 1RVFL 3W9EB 2YPLB 3TT1L 3RQ3A 3LV3A 4RAUA 4WEMB 3VXUB 3IGAA 3B9VA 1BVLA 3DI3B 4NT6B 5C3TA 2XIDA 2PO6B 3DX8B 3IDUA 3QBTB 3MLXL 4HKBA 2JJSA 3QUZD 2XFXA 4PJEA 4KZDH 5J4MA 1T0MB 5D1ZA 5GS0D 3OKLA 5T1LD 4KXZI 5J6HB 4HWZB 3QPXL 3WD5H 5HI4D 1TMCB 5DUML 2H26A 4R90H 4R90L 2HFTA 1CLOL 4MQ7B 1Y6NR 2MQ3A 5DYOB 1ND0A 4OTXL 4MQXC 5E99H 5CSBA 1C1EL 3SE9L 4DKFH 3BKJL 1BJ1J 3SGJA 3U48A 2Y1VA 3J7HA 4OV6F 3KPRE 4LHUA 4X7FC 4X8JB 1EUTA 3DRTB 3A0OA 3P4OA 1UWEL 3WJJA 2AJZA 1INQB 2AJVL 5EO1B 3QR2A 3QWQB 2QQQA 4OFVA 1RUPL 1OAXL 4U1LA 4HMDA 1UXSA 3V5KB 4LBEB 4V1DE 3EO9L 5BVJA 5F3BB 1FYTB 3L3DB 1E6JH 2W91A 4CBPA 1T5XB 1RULH 1CZ8H 3RVXC 5C71A 1CZ8L 5LGHH 4LPUA 4PG2A 4YUEH 4NM4H 2DQIL 2MWCA 3ZL4H 1YN7A 1KTLB 3FFCB 5GS0H 2NY3D 1OGTA 5CZVL 4M6MH 3WFDL 1TTGA 3VGHA 4LPCA 3G04A 4KPHH 3OXRB 2QR0A 4D0BB 3BO8B 1JHLH 5IJKC 2AVGA 4F33A 1R3HB 5DR5L 2OTUA 5CBAB 2P5ED 2EKSB 3V6FB 2B8OT 4HQQL 1TZGL 4GBXC 2DAVA 4IMLA 3L6FB 4HC1L 1CGXA 4JO3H 2WM0A 2G75B 2GJ6E 1AKJB 2YZ1A 1JZ3A 4DZ8A 4Z7QF 1WZKA 1OWWA 2K7QA 4ODUB 5DJ0B 3JTSA 2FO4B 4M00A 4ZTOH 3U1SL 2YN3A 4KJWD 5A40E 3U1SH 4ZTOL 5J3HD 1N8ZB 5ANMA 4PG9A 2JTDA 2WUBL 5JW3H 2GHWB 1OGAE 2WUBH 2EE3A 3QEQE 3VD9A 2IFGA 3T2OA 4MJIE 2IBZY 4XNYH 5AYQA 3SE4C 4BZ2L 5DEGA 3T3PF 4PJ5D 4NGHL 2J8UF 4EDXA 4APQA 2BC4B 4X4ZA 4IEFB 4BH7B 2VL5B 2F54D 3MOQA 5ESAB 4TRPH 3VWJD 3BKYL 3LPFA 1RAMA 3CK0H 4OAWA 3VFUB 4LVNC 4GOSA 3TBYB 3VXRB 3UYOD 4PREA 1KB9K 2QBWA 4JANB 2YPLD 4TPRL 3QXWA 3P0VL 1MF2L 5GJSL 3UTSB 5GJSH 4GAJH 2VWEC 2XA8H 5SWSD 3TBWB 2XA8L 3S36H 1BZ7A 2VXQH 3E2HB 3Q6GH 4LDLB 4J8RA 3VFSB 1OCWH 3MRLA 3VFWA 1T1XB 5DD6B 5D2NC 3HMXL 4FQIL 3TLRA 1D3CA 5AEAA 1CN4A 1J0ZA 3UAJD 2J8OA 3WCYA 4HLJA 4HK0B 4OZIE 1BM3L 4J12A 4UB0L 4HJ0D 4U6HB 3L95A 5FK9B 1LEGA 3IFPB 3WKNA 4ZFOA 3P9LB 4FABL 4NNXB 3QDHA 4QLRA 4KK5C 2HJLA 1WF5A 4PLKC 4YH6A 3ES6B 1XCQB 4U6YB 4P9MH 1YA5A 3BP4A 1TVHA 4KRMB 3QO1B 4X6DF 5JQHC 1T1WA 3GSRA 4QRTA 1P7QB 3R4DA 2IAMD 5J56B 4CRPA 3AS1A 3HLAA 3FQWB 1UGNA 3BYTA 1ACZA 5E00B 3JV5A 3G5ZA 5F9WB 1KGCE 1LGVA 4Y5VA 4ZUTB 5ITBL 4K07A 1BAFH 1T89C 5C6WH 1KCVL 1UZ8A 1ZVHA 2Q7YA 3PG2A 1P4LB 4KFZC 1KNOB 1Z3GL 2GK0B 1K6QL 2DKMA 4XH2A 1PG7X 1CR9H 4I5BA 4K8RL 3KDMB 3WIFB 1B88A 2YC1B 3WIHA 43CAA 4PJEE 3W0WA 1YJDC 5D5MA 1LO4L 4N9GA 4LAQH 3TM6A 3JBG7 4YHZH 4OB5H 1KC5L 1MFCH 4ODUA 4N68A 3DETD 4RZCB 1CGVA 1HXYA 3ARDD 4R7DB 4MMZC 2GUOB 3PWNB 3KYAA 4OGAC 2WBKA 3L6FA 5FYJE 4ZXBB 5BRZE 1HHGA 1N3NB 3GBNH 4L8CA 5DUPH 4U6XB 4YHKL 2NY2C 3FO0H 4NOBA 4E42A 1IKNC 1MUJA 5I2IA 3GHEL 4HT1H 4BELD 4FTVE 3BQUC 1IGYA 3B9KC 3NBNA 5J12C 1JWMB 4MS8D 1IL1B 4XPAL 3RGVA 2A9NH 1JPGB 1V05A 3RVWD 5T3XD 4NZRL 2AJXL 2X6MA 2Z4QA 4HULB 1DUZB 1H5BA 2NZ9C 4MVBC 2ZUXA 3BPCB 4L9LA 1A9BB 4M7LT 4NQCB 1CICD 1EGJH 2DTML 5FYKU 2IPKA 2OL3L 1RUML 5CD3B 2I9TB 4JVPA 1XZ0B 4MD5B 4HG4K 1I8LA 3VFTA 4HMEA 1RJZB 1S5IL 1S3KH 2AI0L 1S3KL 3KLSA 2JKXA 4PR5A 5HGHA 3DSNA 3MCKA 4L4VD 4RA3A 3SGDI 1QR4A 2O61A 3TCLB 1XF3B 4YZFE 5JUEH 4ODVH 3LKSB 4RISH 3JWDL 4N1CA 2XRAH 4PGBB 4LLQA 4Z7WA 2DMBA 1GXEA 5CZKA 1CBVH 4NQSA 4QRPD 3OKMA 1NEUA 3EW3B 5ESQA 4X7SH 4JN1H 1WWCA 4HWZA 1I3UA 3FN0L 4FQ2L 3D0LB 4QHNB 1X44A 4YWGL 4LCYA 4XB8A 1UM6L 1XCTA 2WWKO 2EC9T 5C9JB 2RAMA 4QHUA 1F45A 4HS3A 4IRSB 4OD1H 1YNKL 5DK0A 1MCKA 3RUGA 4MNQD 4H20H 1A1MB 1D6EB 4FXLA 2YD6A 2LU4A 5B8CB 4X4XA 3P11H 4YHNA 3A67H 1C16A 4PJHA 4F2MA 4ZPTB 3W11C 1UADC 4D9QD 4HH8A 2V6HA 5FB8B 4C56E 4XWOC 4F7CB 1JZ6A 4FQ1L 4MLIA 2ZUQB 4GXUM 3LS4H 4DN3L 1NAKH 3JXAA 1KLUA 1NAKL 3GSXA 2CRIA 4Y4KC 1DCLA 1RQ5A 5HVHC 3O45B 4MDJA 5FM5M 5CZXD 4K2UH 1OP5H 2HMID 4XNUH 5JO5A 1BIIA 3OKEB 1MCIA 3NIGE 5ADOH 1DE4B 4FN0A 5BQ7B 2VDMH 3DMMA 3PQYB 1MWAA 3MPCA 2X44D 5JA9A 4M6AA 4U7SA 5J13C 1U8MB 2JK5A 4MCZA 3HZKA 1F58H 4TVPL 2DF3A 3U0WL 3VD4A 5SWZA 2BHUA 1NSNH 4W6XB 1N6QL 3KXFA 3P9WB 5FA3A 1TIUA 2CKBL 2FJFA 5C08E 4P3CL 3PDGA 2R4SL 2FGZA 2LQRA 2Z31B 1AXSB 1CK0H 3TO4A 2BY1A 3ULUD 1FFQA 1A7BA 5TQ0H 3HE7D 4PRIA 1NBYA 7CGTA 5KG9A 4XP6H 1D9KD 3FT3B 3WNKA 1YMMA 3DOSA 1T5WB 5DZOA 3R8BB 4WHCA 2E7MA 3X3GL 2Z35B 5HYSG 2J7LA 1LE5B 5F7EH 1I9JH 5EUOE 1NFDB 2CKNA 2EEBA 4PJIB 2AK4A 2HVJA 3IFLL 3K81A 3VH8A 1MY7A 3ARBB 4LCCB 5DD3L 5C0JA 5D72H 3QFJB 2X70A 2LABA 3ZTJH 4KJQC 2IG2H 1DUZA 3KPSE 3LQAC 4JQVC 2OTPA 2IG2L 3N1GC 5KZCB 1HSAB 2K3TA 3REVA 3FT2B 4I3SH 4KKLC 3UZQA 3WN5A 1S7VB 3NABH 1IILE 1RFDL 3H9YA 5TFSL 3U9UB 2D9QB 2IH3B 1RK1B 5F72S 4QT5B 4QF1A 3RI5K 1NGQH 3UPRB 1NGQL 4YQXL 2W9LA 2DD8H 3FAXA 1G0YR 4KJPD 5IW6A 2VH5H 1MJ7L 2MOVA 5AWNL 4GAGH 3KXFE 4HQQH 1C5DB 3HG1E 4KK6D 5JXAH 2GQHA 3WV0A 3PWNA 4JHWL 2VZ3A 1QKZL 4V1DA 5JIPA 4LLMB 2YBRA 1NUGA 3G6JF 2RFXB 3CMOL 5I73C 1BECA 1P5VA 1S7QB 4LAQL 5E5UB 2FZ3A 3CVIL 4JKWA 3FOMB 3KDMA 2CD0A 3D39E 4YE4H 3WIFA 1PEZA 5T33L 5A3ID 2VN4A 1Z9OA 5IEKB 3TJHD 1X5GA 1RZGB 2E8ZA 2DQTH 3ARDB 4IM8A 5ICXB 1FVDA 5DSCA 3MJ8A 3TIDB 4K3GA 1I3GL 5I1CH 2NY5C 2VQTA 1NCAH 3BPLC 4KAQH 3AMLA 25C8H 1PG7L 4HK3N 5LQBH 5EIIA 5FYJU 1XF3A 5C0RL 5CEZL 4NZRH 2O61B 3VGAC 1T21A 3BE1H 4X80H 3ARED 4LRNL 4FQCL 2ZCLH 3V5HA 4I13B 2GT9B 3H9SE 4S1SH 4LLYA 1YY8B 2DMKA 4KJYB 4RGOH 4XP5H 1NANH 2I9TA 1KSRA 4UILL 1TJIH 1TZHB 1FGNL 1CICB 4NQCA 1QO3B 3MRBB 4HLZG 4LP5A 5FYJH 4KKAD 3DIFB 4Z7WF 1T3FA 5CMAA 3QJHA 5I19L 2XZCL 4X4ME 3C6LC 2B1HH 5C0NC 4NJ9L 3SEPA 2AABL 2BFVL 4HAGA 1KFAH 1JGLL 5IBUB 1CGSL 1BBDH 2K1MA 3QEUB 2EIDA 3KYNB 1VPOH 2GCYA 3S7GA 2XPGB 1KB9J 1A64A 3O2DH 1Q94A 5JA8B 3HG1D 3QNXA 2C9AA 5FEBA 4GMTH 3BRFA 1DANU 1SEQH 2BSRA 1MHPH 2WBJD 3VMNA 1DEEA 1UH2A 4G80A 5FF6A 3QRGL 1QNZL 3NCYP 5F1KC 5HXMA 3U9PH 3QUYD 3D85D 1EEQA 1L0QA 3KPPB 3TA3C 1T04B 4UINH 3P11L 4M5YH 3WL9B 4QXTB 4MQTB 5DMJB 5IVXA 1KCVH 5EOTA 1KXTB 1HEZA 4DVBA 1R5IB 3NN8A 2Q7YB 2VOTA 3LD8B 1Q0YL 4FFVC 4WHTA 3EJZC 4P5MB 1B3JA 2BX5A 4PJ7F 3IYLW 5TE4H 4Z0BL 3IDXH 4JFYA 1P7QA 4ZS6C 1WK0A 2P47B 1Q1JL 3C2SA 3QNXB 3DLQR 3EOYG 3C09C 1RMFH 4JO3L 3CU1A 2PETA 2VLME 4DVRL 1DQLH 4HJJL 2R15A 3VXSE 1D5XA 2HJLB 4XHJC 3O6LH 5D7IE 4HK3J 4JCMA 1RZ8A 5DRWA 3EYOA 1NEZA 2Z8RA 4AEEA 4LMQI 1I3RB 3L95B 1G9MC 3ZDXE 4CVXA 3L5HA 5IESL 5CSGA 4OLZL 3D25B 4LHJB 4X6EB 4JG1L 4U1IA 4NQUA 3O11A 2YD9A 3KLAB 4OZHA 1SJHA 1NGXA 3ZE2F 3ARFC 4M4PA 4KQ3H 4QTHB 2ZKHH 3REWA 3I6GA 5HI3D 1TZHA 2Y9RT 3CXDL 3L3DA 1FYTA 3SKJL 3TO4C 5J1SC 2AJVH 1YMHB 3BJLA 2QADB 4CN1A 1E4KA 4HV8A 3ARBC 2DM2A 5F7EL 2R2HB 4K7FB 4PREB 1A6VH 3DVGB 5J12B 2GSIB 5E2UL 5EIIB 4KDTC 5CJXA 5IBLD 1JPSH 1A3LL 2BC4A 2W92A 3OF6A 5IV2B 1RZ7H 1R24B 1FVDB 1LEKA 3DI2B 4M93B 3RTQC 3OKLB 4EUPG 5IROC 5KVGH 3EKCA 4LLAA 4GRLC 4OGAD 3U4EB 1NCNA 2UY6A 1MJ7H 1QLRA 1U41A 3HB3D 3RA7H 4XBEL 4NKMB 1IM9A 3LY6A 3PJSA 2B4CH 4WU7B 1HH9A 4CMMB 2YPVH 2D0FA 4N8PA 5F9WC 5F6IC 1HYRC 3NH7H 2YA1A 4YGVA 4FFZL 1CLCA 4Q9CA 3CNKA 4LHQB 1E4XL 1FL5B 4ZFZA 1MVUB 1DFBH 4ODHH 4YO0A 2EEAA 2VDNH 3DV4B 2VDNL 4DK6A 2BSSB 5D1QB 4IS6A 4PJHE 3MRMA 3C8DA 5H35A 4K7PY 3OJMB 5J1AB 3K1KC 4QOKE 1KTLA 5ADOL 4NUJA 4GKSA 3MRCA 4I2XE 4YAQA 2MPAL 4L4TB 3CU7A 4G3YL 5IGXH 1MIML 1ZT1B 4JM2C 5FIEA 4KI1A 5BVJB 5F3BA 2FD6H 2EIZA 4OB5L 3B8SA 1MFCL 3U7YL 2YKLH 2Z35A 4M5ZH 3P4OB 3N85L 2NZ9D 4MVBD 5DK2A 2FHBA 4D9RD 3Q6GL 1G9NH 4L3EE 1VKXB 2XTLA 5I0ZA 3P4MA 3HZVA 4PJ9A 4BJLA 4XAWH 3ZHDA 1AXSA 4WFFD 4NZDA 4LSUH 4X6DE 1IGJB 1EUUA 1OAYL 1G9ML 3LVEA 3BW9B 4C56A 1J1PH 1M1SA 3X17A 4AENB 1PJ9A 1VESA 4WW2F 5HI4C 3WJJC 2JK5B 5IT2L 3QEHB 3ZE0E 3OHXB 4D8PB 5JW5B 1K4CB 4J4PD 3PQYA 3V6OC 4YBLC 3VXUA 1HZHH 3BIKA 3IETA 1LP9E 1F13A 5CJOH 1K4DA 4MDJB 4PG2C 2NYYC 5C6PB 5ID1B 4MD0A 3PWPB 2EE2A 5I6XC 1ZLUK 4BUGA 2B20A 1CGYA 4WIQA 3ZTNH 1UFUA 5SWZE 3IXAB 2BHZA 3N06B 4LP4A 3CX5K 3RDTC 1UACL 5BS0B 5I8OL 3QUYB 1MCSA 2D31B 4LKXA 3QXVA 5DD0H 3KVQA 1VEPA 4X4XB 5B8CA 2IQAB 5IVOA 43C9B 5CGMA 5GGQH 2RQ8A 3SKNA 4Z7UF 4RWYL 4Z7QE 3HAEA 1JCKA 4UIMA 1R3KA 3EFFB 4AIOA 1N6VA 1FG2B 3DGCR 3WDIA 3O6FC 1XCTB 5KSAB 3BAEL 3I3DA 1GAFH 4UAOC 5KN5B 4X6BB 3D0LA 4QHNA 5CBEB 2G9HA 3OR6A 1LNUA 1IC7H 2YUWA 2QKIB 2LFGA 4YX2H 5HTSA 3PXJA 4CW1B 3G9VA 4UIKH 5E6IC 2AEPH 4M93C 3OKYA 3K80A 5J0BA 3JWOL 1YECH 1DBAL 1ROWA 4GSDL 5LGJB 5HHVL 1H0DA 2AJXH 3BZEB 1KJ3L 3QWRA 2IWGA 2VDQL 4BH8A 2C7UB 3RVVD 1UXWB 4Z76B 5LGKA 4POUB 4DAGH 2GJ6D 3STLA 2E27H 4DAGL 1Q72L 1WIUA 1CI5A 4ODXB 5E2JA 1BJ8A 1Y18B 5CD3A 4P3DB 4LLUB 2WW8A 4Q9RH 1KLGA 2W65B 3BYYA 5FFLA 5DJAB 1BJ1H 4M8VA 4LSTH 1EIBA 5AG8A 5CJQH 2G5BA 1NMBH 5L2KE 3MLUL 3VA2C 4XRCA 1EERB 1A6WH 2NY1C 4O2EA 5D2NA 3IF1B 2C3HA 5GGVH 4PGCA 1MCDA 2N56A 3SDAB 1QFWL 5DMKB 4YDVA 4ZSOB 1ZA6A 1OY3B 3NOIA 2KH2B 4LEXH 4PV9A 5C7XH 1TETH 3PWLB 4PRAA 3FN0H 5D7KD 3SDDA 2AEQH 3E2HC 1R0AL 1P5UA 3U30B 3W0WD 1MREH 3MV8E 2ARJA 5HYJB 2VAAB 1FZMA 1QFUH 2CDGB 2YEZB 5HHQA 5EPMA 1N59A 2V5YA 2YZ8A 4RZCA 3PP4L 2PYEB 3FQRB 4KDWA 2AW2A 2ID5A 1U8IA 1HOCB 4NC1C 1C5BL 4TSBL 2GK0A 3QIWB 1KNOA 4FQJL 4MX7A 3PE9A 1ZLVH 5GHWL 5T1DL 2BHYA 1BFOA 3UP1A 4M7LH 3OKNB 1E4XH 2QQNH 2OJEB 4AJ0A 3RGVD 5BRZA 5HHNB 1ZS8A 4HAFA 3RWCA 4DW2L 1JN6A 3FQWA 4JDTL 4DKEL 1S7WA 5I1KL 3CSPA 3OBAA 5JIKA 4POYA 1FO0L 2GTZA 3BDBA 3GSRB 5HPMA 1A02N 2VLMD 1Q1JH 4CU6A 4JN2A 5FECA 2R2CA 1RZIB 3KYMB 1UM4H 4AIZB 5BO1L 1MCJA 2Y07L 1U6AH 4PRBB 3SO5A 3HAEH 4AQ1B 4KKNA 1H3XA 1L9MA 5HPMB 4MD4A 1BGXH 4NQCD 3L7FA 4IBLT 4OCYL 1NCUA 2ZCKH 4AL8L 3IKCA 1S78C 1T0NA 5EB9A 1MCLA 1NPUA 3LKQB 3UJJL 3GNMH 1FVEB 1EEYA 3FL7A 3T4YB 1OGAA 1F02I 3MLTA 5D8JL 4P5TC 2ARWA 1NGYA 3TBVA 1G9NL 4J3OC 3B9KA 3T0VA 2FECL 4P5KA 4X99A 1FBIL 1XF1A 2H8PA 4QHLB 5IFAL 4QRUB 1BZ7B 3KJ6H 4L9LC 3GJFH 1BVZA 1Q9KA 3CDGA 5DJ2A 2PNDA 1AY1H 5JW4Q 4PJXF 3MUY1 1X4YA 1NBZB 2A6DA 2PTTB 2CLZA 3RVWC 3MYZA 4RX4D 4XB7A 4PJGF 3Q48A 2OCFD 1B90A 5HDLA 1SYSB 3T1FB 1EO5A 1T0PB 1LVEA 4YHPB 5TF0A 1MJ8H 2CRMA 1N0LA 2C3XA 4MJ2A 4Q0XL 4OUUB 3GHBH 1PYWA 1IGIH 2YD7A 1FDLL 4RMRA 4B53A 1XAUA 2HTKD 1HILB 1SHMA 5DJAA 5LWYH 2W65A 2X09A 1IC4L 2WANA 2ZSVA 3HUJE 3TA3D 3N50A 4Z7UA 4V2CB 3TYGL 3RIFK 5D2LB 4XBEH 3RWHA 2ERJC 3JTSB 3PIQB 4X98B 2RIKA 3GMOA 3QUXA 3H9SD 5BV7L 2G75A 3FQNB 4JM4H 4MGXA 1XR9B 1XGTB 4Y4FC 5E2VL 3GUTA 3Q1SL 2NQCA 3PDOA 4Y1AE 1KPRA 5SWZD 4G7VH 3ZE1E 5F7MC 2CR3A 3HR6A 5CCKL 4FFZH 5C0EB 2DQEH 2E9BA 3INUL 1TCMA 2HN7B 3K2MC 1FFRA 1I8IB 1WQVT 3HZYA 4KGJA 4DZBB 5E4EB 5B38A 2YMXL 3O6FA 5DJDB 4ETQB 2X42A 3S36X 4GUPA 1F90L 2A77L 4GKOA 1TPXB 2QKIA 1BFVL 1A4JA 3UTTA 4PY8I 2HFGL 1XGYL 1KG0B 4UT9H 2JB5H 3FQXB 1VFAA 1PG7H 3GEWB 4JPVH 4QRSB 4TQEH 4ZUVB 4Y4HC 4NM8L 1FORH 1ACYL 5MI0C 3MJ6A 1S7SB 2H2SC 2VDPH 4AQOA 2WLYA 4G8GB 1G7LA 4JO1H 2EXWC 1Q9OA 4M1DH 1JPFB 1SJEA 3VRIA 2X5PA 1D5IL 4JFZL 3MLSH 1QVOA 4S1SL 1CXFA 4U1GB 3RP1A 1CD8A 4D0CA 1Q72H 4GT7A 4RGOL 4MAYD 1ZKAA 3LN5A 2W0FA 3MNVB 3TZVA 5HI3C 3FRPG 1LDSA 4P2QD 3IXAA 5CS7A 4CDHA 1OTUD 1WTGT 4UMGA 3RWFA 3DSFH 2X4QA 2ED8A 4CDGC 5F9OL 4JPIB 3VFPA 8FABB 4NO0B 5C0BE 2CJUL 3OGCA 2R0ZH 3WHXB 3MFGB 4BKLA 5HVWA 3G6DH 3L5JA 4L3AA 5F6HJ 1OT2A 2Z31C 1BWMA 1HHJA 2Y5TB 4A2LA 1U8KA 2JJVA 5KS9F 2ZKHL 3CLFL 4NQDA 2CKBB 3VFMB 1TQBB 3ARQA 5F8QC 1TVDA 3RWGB 1FYTD 4IHOA 2VE6B 5L88H 4HEME 2P43B 4H88H 5D7JD 3QIBA 4RAUB 1X5HA 3X11A 3QISA 1AGFB 2HJFB 1MEXL 2AK4D 5HHOA 5EDXA 1R3LA 3Q3GA 3ULUE 4JPIA 3S37X 5I1EL 1CXEA 1AI1L 4EI5A 5KW9L 2OJZH 2BNUA 4U6VL 3KHQA 1NC2D 5DQDL 1WT5A 1UACH 5KZCD 2JF1A 3FB6B 4JEGB 5AYUL 3GIZL 2XN9E 3MRIB 4JFEA 4XC3L 1OOAA 3RBGA 1J1OH 3AB0C 3G5YA 3O9WA 4IOIB 3UTPE 4KU1A 4GXUN 5IUSA 1ZHBA 1OP3H 3FO1A 3MV8A 4LLDB 3RNQB 4HH9A 2EO1A 4LLWA 1WBZB 2EYTB 4HH9B 1N64L 4KRPC 1KCSH 4WDIA 4Y7MA 2C1OA 5MERA 2BDNL 1VB9A 4M62H 5BO1H 5KS9E 3MA9H 5ICYB 3MXVL 3TVMA 1P6AB 2UYLA 4JFEB 5T3ZE 4NQEE 4UAOB 1KCRH 2XTJB 5HHPB 1JF5A 4IS6B 2YRPA 4N8VA 4IJ3C 1N5YH 2D4DA 5CJ8A 2GY5A 2YRZA 1CU4H 1DBAH 3Q6FB 3IXTB 5GGTL 4C56D 4WGVB 2DI7A 2DOCA 1R3LB 3PDOB 3O0RH 4FFWC 3LQMA 5D2LF 4G5ZL 1LO2L 3WFEL 3B9DA 1IJ9A 2VXTL 4PRPD 4OSUH 4FQQA 4UDUA 2QHRH 1G7QA 4IHOB 1ZE3C 3SBWA 5BVPL 3LEVH 5ACMA 1QLRB 2HFFA 2UVFA 4FQXB 1IZJA 5IGXL 1IEAB 5I71B 5CGYC 1NLBL 1FGVL 3F7YA 3U0TA 4LSTL 3KLHC 5CJQL 3H6JA 1A6AA 2RJMA 4YDLC 1QA9B 3O3EA 2IBGA 4ENED 3CH1B 3GSVB 5EU6A 4FTVB 2A38A 2P8MA 5I76A 1OCWL 4I0PC 4URTB 3U2SA 2W9DH 3W39A 1G84A 4LLVB 5EUKA 4C54A 4FQIH 3TZVB 2DLHA 3A6CH 4FNLH 3W2DL 3MFFB 3WKML 4P9HL 5DVNA 3WKMH 2ADGB 3WUZA 2HT2C 1JGVH 4ELMA 3BDYH 1JGVL 2O5XL 3MGOB 2HFEA 4U1KA 2B4CL 5DEZA 4QRUA 1RPQA 4OUOA 2H8PB 2H1PL 2IPUK 4IRJD 4ELKB 4JM4L 1OPGL 4HGWA 2M8XA 1X7QB 3FT4B 4OCSL 3GO1H 4Z18A 4Z5RA 2EDKA 1V3MA 4X6EA 3D25A 3LAFA 1MRFL 2MCPL 3HFML 3O6FD 5DJDA 2YOCA 5T5FL 2VXVH 4OV5A 4F7PA 4TUKH 4E0RB 2HN7A 1OW0C 3MRPA 3MJ9H 5DRZA 4WUKL 3VGEA 4ONGH 3UTQA 1KENL 4DQOH 3GUTB 4I48A 4OCWL 1PVHA 1RZIA 5FECB 1K6QH 3FRUB 4NN7C 4PJCE 1SY6L 5D1QC 5IK3B 3PHOB 3UMTA 3WS3A 1MIMH 5E2WH 5IB3B 3L3JA 4P46A 5E2WL 2CIIB 3GMNA 1S9KC 4M1DL 4HPOL 3G6JB 3G5XA 3U7YH 1UJ3B 1U8JB 4JKPL 1ZS8B 2YXFA 1GAFL 4RAHA 3GKWH 1E0OB 5T3ZH 4WO4B 4OZIB 1CXLA 1JF1B 3C8KB 1HEZB 2H9GA 2XG5A 4BSJA 4JVWA 2AKRB 2IFFL 3CVHL 12E8H 2CUHA 5I1AA 2E6JA 2DL2A 4YLQT 5ENWB 5GRVL 2VJXA 2DJUA 3KPPA 3QUYC 4UIKL 4ZMAT 4JO2H 4YHPA 3X13B 4JREB 5HJ3B 3EJJX 4X8XA 3AS3A 4NO5B 1RIHL 2PKDA 4GG8A 1O5DT 3DX9B 4OD2A 2VDQH 2W9EL 2VDRH 4Y4HD 3S8WA 5EZIH 1NCDL 5D9SA 1P6FA 3QQ4B 4OLYL 4JG0L 1WBYB 2GCYB 5J9PA 4OZGE 1VACB 5MEPA 3PHQA 5IFJB 4M43L 1IGFH 4Q6IC 1AQKH 3QI9C 4KROB 4XX1G 2X4UB 4LFHD 3BVNB 4RFEA 1S5IH 1DN2A 3RZCD 1FZJA 1PX3A 3RAJH 2I07A 1FNFA 2AKRA 1S7XB 2A83A 1OAKH 1E6OH 3BGFC 1YEGL 2ORBL 4HWUA 3U79A 4UTAH 4BFIB 1MI5A 4QXWA 1S9VA 4WO4A 2DQDH 1OGAB 1FVEA 1T1ZA 3WFBH 1GGTA 4JZNA 2WINB 1YC7A 2V9QA 4PJBF 4O58H 5L8KB 1B4JL 3QQ3B 1ZLWK 5JNYB 2FX7H 4AG4H 4EI5C 2IPTH 4LEXL 3V6BR 4HC1A 4JO4L 4PRBA 1GZPA 2I9LB 3KXFD 3RWDB 4D0DA 3GFUA 3HHRB 4JFQB 4MZ3A 3PL6B 5D2NE 2NZIA 3EDFA 4YNYB 1CF8H 3NMEA 1WTLA 5J7CC 5EORL 3NA9H 4XPTH 3TO4D 1NDMA 4C58B 3VCLA 4WHDA 4PRID 1MLCB 3MUGA 2UV3A 5I8EA 1YPZB 4G6KH 4MB5A 3EYQC 3WIHL 5I1LA 4ISVA 3C09B 2NY2D 4FQJH 5DSCB 5ICXA 1MY5A 5ACLA 2PN5A 2ATKA 3GB7B 4GFTB 3I6KA 4WU5B 3U7WL 3KLDA 3C60C 3HR5B 3RL1A 3TO2B 5CINL 2R56H 4OFYD 3B43A 1U8OA 3T77B 4XVTL 2Q76B 1QACA 1FG2A 5B4MC 1FL3B 3ALXA 1CQYA 3T2QA 1FO0H 2PYEA 2VXTH 3AM8A 3CVHB 2DI9A 4P2QB 4LLMA 4V1DB 3MLSL 2EZ0D 4DKDC 3ARGD 5KVMC 1RUQL 3Q0HA 5HHQB 3CDCA 2YEZA 1QBML 3HMWL 3TBTA 3OR7A 3ULVL 3I9GH 1IAIH 3RZWA 3ULVE 3PWLA 4XCFH 1T2QL 4I77H 2LU7A 2XWJA 4HUXB 4KMTH 4M9OA 4HIJB 1VDGA 4KMTL 4NGHH 3SCMC 1ZMYA 2K9UA 1SVCP 3C9NB 4U33A 1JZ2A 4P2YA 4RFOH 1ZWIB 4BQBA 15C8L 3LRHA 5FO8A 1W0WB 4MXWL 3CSYA 1FVCB 2APFA 4HKXB 5F7YC 4XPBH 4OD3H 5AZEL 1L0XA 2B5IC 5TE7H 4YBQC 4OQTA 2J5LB 5DRXB 3OB0H 3IJHA 4JFFD 2AK4B 1A6ZB 2BOCA 5BS0D 4NP4L 1J05A 1JWSA 3GSOA 3QFJD 4S1DD 3SDYH 1B2WH 1AD9B 5DQJA 4EBQL 1KXQE 3PP4H 3OB0K 4RGMB 4ELMF 1QEWA 1UXWA 3F7QA 2C7UA 3ET9F 4HCRL 1IKFH 2IQ9H 4NSKB 4U1GC 2QADC 1YPZE 2BSTA 4OZFG 2CXGA 2VLLA 3KLHD 2NW2B 1PBYA 1BLNB 3PGFH 5KVFH 4LCWA 1QRNE 4N8VB 1WEJH 4WFED 3QXAB 5AYUH 3RX5A 1HWGB 1KCLA 2FJGA 4J3TA 5C0CE 3B2UC 2BNQD 2AQ1A 3PWPD 3QZWB 4NJAH 4NO2A 4M61B 3JWOC 4UV7L 5KANI 1PZ5B 1YEDB 2NXYD 4HW6A 1NANI 3M07A 2NYYD 1WCQA 4LLDA 3FO1B 3RNQA 5KSUB 5AWNH 4FA8A 4PJGE 4OBSA 4K3EL 1EJ6A 2PF6A 2W59A 3AVEA 3LZFL 3BP5A 1PKOA 1B6UA 5BV7H 3TH2T 2PW2A 1KEMH 1R3JB 1BGXL 3VXRE 4LKXB 3Q1SH 3ROLA 4NYLA 3V6ZA 2BSSA 5D1QA 3F7RA 1TVBA 4WFEE 2DQJL 1AE6L 1QRND 1RZJL 1EHXA 4X7CC 4G6FB 2ADJB 2JJWA 4ZUUA 5J3HC 3ZKSD 4OLUH 5E6IA 2H41A 3RWIA 5IG7B 1TXKA 2DJ4A 3P4NA 3FZUD 4JZJC 4MD0B 5CUSH 2XQBH 3S37H 1F5WA 3S37L 4HIIB 5HGAA 3PJSB 4WU7A 4HEPG 4HUKB 1FPTL 4EJ1C 1UVQB 4DGIH 4ERSH 5EG6C 5HDBF 1A6UL 5C9JA 1HQ4B 2NY6C 5HYEA 4HF5H 4X80L 1RIUH 4YHLL 4FP8L 1L4IA 4R7NB 2GJ6B 3UTPD 1IQDA 5ANME 5IV2A 5FHBL 5FYLD 5GRJL 3OWEA 5FHBH 2FLBT 5CWSB 3BSZH 4WFGE 4JDVA 2FEDD 3GHBL 1A2YA 5ICZB 1UKSA 3RWFB 1JRHI 5BRZD 2W9DL 5FYJD 3EBAA 4ORGB 5LAXB 2I60L 3FO2A 3MCKB 1X5AA 4WWID 2X4RA 4JJ5B 1L6XA 4YFLF 1KJMB 5D1XB 2R2HA 1IFHL 4HV8B 4TVSa 2XA3A 3FFCE 3WJLA 2A1WL 2CLVB 1ZEAL 4QGTA 2B5IB 2QQKL 5JOPD 1YYLH 4GQ9H 4KVNH 3SDAD 4N9OB 5C09B 1FNEA 1RULL 3D0VA 2OL3A 5FDYA 2AJSL 1A21A 1FYTE 4XCCL 1A9BA 3RWJA 3BPCA 4JFFB 4KZEL 3MRCB 1WSST 5EIVA 2P48B 1SJHB 4KK8C 2NY3B 3CGTA 5FUOL 3ILPA 4LOUC 5FUOH 3ZDYE 1A4JB 4LPWA 3MJ7B 2YD1A 3VW3H 5HHOD 1QNZH 4KUZL 2ZSWA 1WUNT 4XNXH 3DV4A 3NCEB 2XOTA 5DRWB 4Y2DB 5D70L 3CLEH 3LB6C 4JRYA 2PTUA 3V79C 3GMLA 5IQ9B 1T83C 1MRDH 3QCVH 4M7KL 3NFNB 1YNKH 4JRXA 1XR9A 2BVOA 1F8TH 4P2QE 5E9DA 1W72L 1J1OL 3MGAA 2IAND 4PRPA 4XVJL 2ZUQC 1WICA 4FQ1H 1CYGA 3AREC 5K59F 5JHDB 3HE6A 1EHLH 3MODL 3BGMB 1ZGLM 1Z2KA 5FHAL 1N0XH 1YNTB 1M71B 4U1MA 5F1IB 3F6LA 3QHFL 4HDIA 5I1DA 3QHFH 4LQFL 3KPRA 2BVUA 2IAMC 4OUUA 1RJCA 1OQXA 3P73A 3K2UL 3IU3A 3QUML 5D1ZC 1DDHA 3FB5B 4ZPVB 5HSFA 4OFPA 4AEHL 4C83B 1CDBA 3ARUA 1L0YA 5D93B 3GJFA 2A6DB 1KB5H 2VLKD 4S1QL 3MLRL 3UPCA 3EGSB 4U6YA 2EE9A 3IFNL 4OM0L 2HVKA 1XCQA 3T0WA 3CDGB 5JDSB 2WUCH 1CL7H 3BWAA 3RIAF 4GAJL 1RV6X 3O4LA 4NNXA 4X5XB 4XCEB 5DUMH 5E8OA 5FGCB 1IM3A 1FHGA 5CAYB 3BHBA 4LIQL 2EZ0C 3LDBC 2X05A 5FCSH 4PLNC 2XTJE 1EAJA 4H8WL 4WI4A 1I7UB 1UA6L 1V5JA 2YUZA 5K9KB 4MNQA 5F9JB 5GGVY 4OZHB 3KLAA 1I8KA 5EZJA 5KW9H 1T1XA 3VFWB 2OJZL 1CVRA 3LKQA 4PV8A 1J5OH 3TPUA 1TQCB 1MHEB 4NZUL 3EO9H 4MZ2A 1Y0LA 3BPNC 1YYML 3MXWL 4G9FB 5FYLH 1ZVYA 3S35X 5B3JE 5JDSA 4Z8FL 5L0QB 5DEFB 3A6CL 5IFHL 2AQ2A 5DMGD 5IHUH 3GJFB 1D5BA 3TA3A 5SX4H 1J18A 4YIQA 1YJDH 3SKOB 5B39B 4WJ5B 1A0QL 2LTQB 4H5SB 4EDXB 3LEYH 4ZAKC 1BAFL 2OJEA 1BFOB 1EX0A 3AU1B 5D1QD 4XHJD 1UJ3C 4U1NB 4MJ5A 2XI9A 3EHBD 1YZZA 2OQJB 3NGBB 2AK1H 2C4FT 3V9FA 5BW7A 2FB4L 4PG9B 4PJAF 2ZCHH 5DWUH 1INEH 1DBMH 2CDEB 3CC5B 3VI3F 1DVFB 1P7KB 4OFKA 1G6RB 4NQDD 4L3CA 5FGRA 5SX5K 4R97C 3MV9B 3QO0A 1WLHA 4HZLA 2QHRL 4JZJA 4WUKH 5GJTL 2XXMB 3GBNL 35C8H 1FPTH 2VAAA 2NTFA 3FO0L 3M8OL 4XVSL 5F88B 4R4FH 5E03A 4PV9B 1UG9A 4JRYB 5C86A 1QSEE 4OCRH 2WNGA 1CD9B 3E1F1 4HPOH 4WUUE 3C5JB 3IF1A 3SJVA 3UC0H 2ZSWB 1LMKA 2F53D 2IH3A 2DDQL 2Z92A 4KAQL 4XPAH 4O51B 4N90E 4TNVF 4N90D 2NR6D 4BFEA 3MNZB 4KK5D 1XGRB 4GW1A 3S3JA 1JZ4A 4ZNEE 5HGBA 4PS4L 4HS8H 4ZG1A 1AP2A 2IFFH 3CVHH 1OAUL 3MUJA 1RURH 4BK5A 1IEHA 1YUHB 4OD3L 5MEOB 3MRBA 1H8OA 1VGEH 3K7UA 3QDME 1F4WL 1VGEL 1WWAX 3OPZH 1E4KC 3S88H 1OTUC 1UB5B 1ZVSB 4FNLL 2J12B 2CLVA 1A7NH 2AJUL 4DK3A 4M1GH 3BMVA 3H9HB 4NQDE 1CDYA 1Z0NA 3ELAT 4KDTA 5CJXC 4BH8B 4U7MA 1T21B 4L8BB 3U0PB 3GSNH 4BFBD 2IAMB 2P8LB 4XBGA 4PJFA 3GBML 4XMPL 4LHUG 1NGZA 4CW1A 4EN3C 1U95A 3V52H 3KYOB 5DUBA 3DHJA 4BSWB 1JHTB 3KPNB 3X12B 2HH0H 2ZJSH 1Q0XL 4JQVA 3HFMH 4S2SB 1LNUB 2GJ6A 1TJGH 3OR6B 4R4NC 1OAKL 2RB8A 1F97A 4LSSH 2EYSA 3RVUD 5JHLL 3LEXB 4X9IA 2C5DC 2Q86B 4GMTL 3NCMA 1RZKC 3QB7C 3ARTA 4ONGL 2EXYD 1B4JH 2H45A 4OCWH 4K3EH 3HI6H 2X1QA 5CILH 2X1WL 1GC1C 4XX1E 5IQ7L 4DUWA 2ICWB 1YEFH 1T7YA 3UYRH 5E24E 4HXAH 1JZ5A 1WIPA 4YFLI 3TCXA 1ZT4B 1YEJH 2NY4B 4EI6B 3X3FL 3X3FH 3UPRA 4O2FB 2VDLL 5T3XL 4F7CA 5I1GH 4YBQD 3MACH 4Z0BH 5D5MF 4GRLB 4HWEL 4MSWB 3IS1X 1JPTH 4L4VA 3RTQB 2HTLC 4L8SB 2XTJD 1JPTL 3QYCA 3CSGA 2H6PB 3GSNA 4XVUC 1URLA 3OJDA 1DTUA 4U3HA 3KNBA 5K9QI 2LTQC 1DQLL 5KSUA 3QFJA 2CXKA 3BD4A 4I18B 5DJYA 5I1JL 4S1QH 4X6CB 4TVPH 1XF2B 4QRPA 1YEDA 3IFNH 3KG5A 3IRZA 1BJMA 2JJSC 2XN9B 4J3UA 3RL2B 2FJGB 5JXEA 1N5AB 4M43H 5GS1B 4PJIF 1AR1D 3MA7A 1CICC 4QTIL 2EH8L 4G8FA 2CGRL 3BPNB 4X7DC 5C0BD 5TPWL 1GOHA 4MDIB 4RRPA 1CFQB 3F7VB 3S9DB 3U0PA 4ZFOL 3OX8B 2P5WD 3RKPA 1HYSD 4HBCH 3R0MA 1HXMA 5DJZA 1QEWB 1BBJB 2CUMA 4WV1C 3HI1B 1JRHL 4JY4A 2E7LA 3AS0A 4JPWH 4XI5C 4OLVL 5L6YL 4LSQH 1HK6A 1NEZG 2DICA 1S8DB 2P8PA 2FH8A 1L9NA 2ILLA 5GGSB 4YAQB 2GKIA 4MQXD 5DT1L 5HGBB 2ITDB 5C07E 2N7BA 3I75A 4CMHB 5J1AA 1GOFA 4M6ML 2VLJD 5ERWB 5K9QG 3C5JA 3FQTA 2KUTA 2XXCB 3MBXL 4J23A 4ZFZB 2HA1A 4WFGD 5IHLB 4YZFF 5KJRH 3OR7B 1IGCL 2JE8A 4K3DH 1OD9A 5IJKA 1HHGB 1N3NA 4B50A 4L8CB 1RI8A 2X89D 2BNRA 3LH2L 4HZLB 1HH9B 1QUNA 1I7RA 4G8GE 5L2KA 3CC5A 1X5YA 4UU9A 5FCUL 4ZSOE 3B5TA 3N9GL 4NUGH 4YE4L 5EWIL 4Y4KA 3FZUC 4G42B 2C4XA 1I4FA 5CLWA 1LILA 1RU9H 3CCHB 3TNMB 3U4EA 4PJDF 3MBEA 4N0RA 1TPXC 1UM4L 5MEND 5E8DH 3L5WB 1AHWC 1Y6MR 5DJ8A 4R4FL 4NFDA 3QHZH 3WLWD 1HHKB 3RZCA 4GBXB 1FZOB 3F12B 3I6LE 5I1IH 4LLQB 3HNSH 2X7LA 5DJXB 4PGBA 1ADQL 3EDJA 3SKOA 5B39A 4HMCA 3O6KL 4WO4D 3MRHA 4AEHH 4Y1AB 3MRKB 4L9DA 3DJ9A 3DVGA 2JCCA 2ZCLL 3U0WH 4H26A 1UM5L 4WHYH 2FD6L 2DM3A 1N6UA 1MWAH 4G43B 3P9LA 4RGNB 5D4QA 4N0FA 1XEDA 1JMZA 1DQJA 3S36L 3L7EA 3NACL 3OKDA 2AEWA 1DUYA 1CK0L 4BFIA 1G7IB 2BNQE 5ADPH 1UA6H 4LKCA 3DUSB 5K9KA 3SCMB 5EBMB 2L7JA 5EIQA 5JDJA 2R0WH 4U6TA 2CO7B 2D03H 1GPOH 1IL1A 3B3IA 3OAYK 4FFYL 1C8PA 1ZLSH 5TE6H 5KOVC 5GS3A 32C2A 2JJUA 1B4RA 1ERNA 5E8OB 1HDMA 3BKJH 1D5XB 2OR9L 3A6BL 2P5WB 2OR9H 4X9HA 4N0CC 5DFVD 5E70A 5KSBE 4PJ7E 3DVFA 5FM5O 2J8UB 4NO5A 4L1DA 1RUKH 4XPGH 1X9QA 2RHEA 3IU3B 3WYRA 5T1LB 1KEML 3PWPE 1AFVL 4MWFB 4Y16C 2C3WA 3QDGE 4OGYH 2UWEB 2N7AA 4LF3B 3NPZB 4GAGL 1QQDA 5FAAA 2DM7A 1GVIA 1QKZH 3QI9D 3IDNA 1I9EA 4H25B 4PGJA 4XNXL 3G6JA 1T2XA 4AEIH 2ZOKA 1DBML 1F90H 2A77H 4RMWA 4K7PL 1QBAA 2FIKA 2XV6B 1BF8A 5T3ZD 3EYQD 4IMLB 3SQBA 1CFBA 2XPGA 3UTQB 1XT5A 3W0WE 4X6DB 2EDFA 5D7KE 4E9LA 3MRNA 1U3HA 4EI5D 1EV2E 2CLRB 1RIUL 4YHLH 4JO1L 3NCBB 3IFPA 1MHEA 3ESUF 3OXRA 5IM7B 3VXTB 3V0VA 1UQSA 4JDZB 2VZ1A 5EZLB 2AEIT 4L3EB 4M02A 4NO3B 3ARGA 4PLJC 2R0LH 5IB2A 5EU3B 1AQDB 2R0LL 1PKQA 3Q5YA 3BQUA 4OTXH 5JXEC 1OB1B 5E8NA 2PXYC 5DMGC 1CICA 4J8RB 3OKDB 4YHML 2CJUH 1A7OL 2AGJH 1LO3H 3TBWA 3C2AL 1GH7A 4KKCC 3O4LB 1ZEAH 2GT9A 1S7RB 2YHGA 5L6YH 4ZAKD 1CIUA 3DRTA 4QOKA 4UQ2B 1IGTA 1GGBL 6FABL 4LLVA 5EUKB 2F5BL 3T3ME 4OAWB 3JUZA 1IGML 3VJ6B 4J1UA 5BZWB 4KZEH 1AO7E 1JHKH 1I75A 3IDJA 5I18H 4NM4L 1L7IL 1BVKB 1PY4A 2X7LB 5DJXA 4KI5E 5IF0B 3V52L 3WE6B 1FNLA 5KSBB 1RZ7L 3S96B 1M7XA 3O3EB 1MVFA 3TIDA 4BYHA 1E4XI 1IAIM 1MEXH 4RBPK 4UI2A 2EDJA 4DGYH 2KZWA 5HVGB 5JPNB 4KMLB 1HNFA 4PRIE 3MBEB 5D70H 1TNNA 3QNYA 2YSSB 5F7HA 2A9MH 5DFWH 3RA7L 2JJTA 1N8ZA 3VU2A 2FHCA 1CE1H 1G7MA 3GGWB 3VXSA 1WCBA 1NCTA 2KQNA 5L2JA 1I7RB 1W72H 1A7QH 3RU8L 2CRZA 4LEOB 1INDH 4TSCL 1RSFA 5GRZA 1DBKL 5B8CC 3UBXI 2R23B 1MCCA 4ODTH 2H2SD 5IG7A 2XWTB 5E6IB 3UO1H 5IW6B 4RFNB 4AK1A 4O00A 3RBSA 1KJ2L 4Y2DA 4MJ6A 4DCQA 5I66A 2YPKA 4LGSB 4W4OC 5INCA 3G04B 3UJTL 1PZUB 3AAZA 1W2KT 4MNGA 3FT2A 2F5AL 1KN2L 5GRYA 5KSAC 5TDPB 3VWJB 3IAQA 4G6FD 3T2NL 3LSOB 3S35L 3S3PA 1NLDH 2MPAH 3ZSTA 4AMKL 4P57A 1GGCL 2PR4H 3MLYL 4JFDA 4XWOD 3FB7B 3VH8B 3MLZL 2VAJA 2YS4A 3CX2A 3BZFA 1Z5LB 1MAML 2ZCKL 4N0YL 3MLWH 4NHCH 5E7FA 4IOIA 4CJ0A 3V8CA 4UT6L 4Y1AD 2X9YA 1BBJA 3SDDD 4ONFL 1MWAL 4LGRB 1N6QH 1A14L 3PL6C 4YR6A 4WW1B 5C70A 4EQ2A 4I0PB 3FT3A 4A6YL 4U1JA 3K4AA 5BVPH 5KTEH 4ORGA 4LCWB 5FGBA 5TPWH 3GSQA 2BNUB 1JBJA 4EI5B 3ZZ1A 3QUKB 4YDLB 2I25N 4G7YL 1UZ6E 2IC2A 5CLTA 4QRRA 1LDPL 5LVEA 4YBLB 4J3WA 5F9DC 2D0GA 2WWMC 1T20A 4GS7C 1MHCA 1KCUL 1S9XA 3EYVA 3JV6A 4PP1D 2JIXD 1Z9MA 5IBUG 5FXCH 2ZZUT 4WUUA 4UNVA 3LKNA 2DS4A 1AXIB 4Z8FH 3S88L 2EDLA 2OL3H 3GSNB 4WTZA 4NT6A 1D6VL 3PGDB 5GISL 4QXUL 5HGAB 3OJ2C 1TDQA 3V95A 4UV4L 4GRLA 3HE6D 4LASL 2YPLA 1G7HB 2Z0BA 4LASH 5CFHA 4QYOA 1ZWIA 3VDBA 2VLRE 4ZOAA 1CDIA 4LPXA 2XTJC