4KKBC

Structure of the e148a mutant of clc-ec1 deltanc construct in 20mm fluoride and 20mm bromide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords H(+)/Cl(-) exchange transporter ClcA
publication title Fluoride-dependent interruption of the transport cycle of a CLC Cl(-)/H(+) antiporter.
pubmed doi rcsb
source organism Escherichia coli
total genus 40
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kkbC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kkbC01
4ACPA 2H8PB 4K3JH 2HMID 1K4DB 3K4AA 1VA9A 4GFTB 3JWDC 2VLJE 2YN5A 3VGAC 3UO1H 1GZQA 4MXVF 3CFCL 4XNQA 4UBDD 2MQ0A 4G8EA 5E5MA 5EPMA 5I66B 3BJLA 3PXJA 1S7QB 2DBLH 2GUOA 3MV7D 3N9GH 5KS9A 4W70A 5DUML 4D3CL 1CGYA 1J10A 1N5AA 1Q9LB 3QDJB 1QFPA 3KHQA 1B3JA 1FHGA 4GUPB 5HDOA 2HFEB 2HFGH 5IROA 4OZFB 3BZFA 4L4TD 4FZ8H 4M6AA 1G7JB 1WT5C 1DSFL 1X3DA 4PR5A 1KENL 5JW4Q 3X14B 1JIBA 2WUBH 4XX1G 3UJJH 4HGWB 1KLUB 3ECBA 1N0XH 3QI9B 2WUCH 1OTTC 1OY3B 2NY7H 3D39A 3MJ6A 3V7MA 5MP6L 2R0ZH 4KC3B 1Y18B 4PGBB 4YHLL 4PJIA 1MCDA 4NQDE 4NN7B 3LB6D 5HYSG 1WZKA 3KJ6L 1SJHA 4QRPA 4EXPX 4PYHA 4U4BA 5HSFA 5HVHB 4PRPB 3K46A 3VXUE 2BSRA 2EYSA 4QOKD 5C3TA 15C8L 4JDZB 3CLFH 2BVOB 4MX7A 1KSRA 4NC0B 3X11B 1BQSA 2JIXA 5F7HA 5DJ8A 4PGCA 5A16B 2KKQA 4KDTC 3EYVA 4WCYL 4XGZA 4Z76B 1GGIL 1Q9OA 2NY1C 1S9WB 3RJDA 3VFPB 4EUPB 4JFYB 4PJGA 1SM3H 2P44B 2V2XB 3ZDZE 2EC8A 4JO3H 5GRXG 1T1ZA 1CICC 1ZA3B 4K2UL 4LCCB 4HC1H 2YSSA 3OKMA 4PJCB 4RDQF 3AB0C 1DLFL 1KCRL 2VN7A 3NFPB 5D2LF 4ZOBA 5MERA 3BO8A 3VGFA 4S0SD 5E2TL 1IGYA 5EC1B 1HDMA 2EDEA 2DM2A 3CXHK 4Y8DC 1V3KA 2M1KA 3R8QA 1MCIA 4M7ZB 3LPWA 1TCRA 3G5XB 5E2UH 5GS1B 2FIKA 4JO2L 4X6BA 2XWJB 2VISA 4XPHH 4YJZL 1A7PH 2B2XH 1BD2D 1OAYL 2FECL 4G3YL 4EDXA 3ULSB 5H37H 5FDWA 4ODSL 1EZVY 1DFBL 4EEEA 2PYEB 4WTZA 2AABH 3MRQB 1EAJA 1YYML 1CE1H 3CUPA 2IPKB 2ATPA 4U6HA 5DEGA 3Q3GA 1D5BB 1TJIL 3O3EB 2VL5A 4MA7L 3BXNB 4L29A 5E8OA 2WWKT 2DQHL 3OBAA 3DGCR 4JKPL 4BSWB 1IAIL 1NSNL 2H1PH 1ETZA 3HRPA 2MWCA 4KI1A 2LABA 3IF1B 5IEHA 3PGCB 1DEDA 2BNRE 2ESVA 3RIFK 2DWEA 4NDMB 4OCRL 4OLWL 5BXFA 4YWGH 4PTUB 4GKOA 1T5XB 1YN6A 1DVFD 1RIUL 1X4XA 1FLRL 1LE5A 2CLVA 4XWOC 1DBAH 1GIGH 1C12A 1JN6A 5HYJB 3E6FB 3EJYD 3HAEH 3CFJA 5BW7C 4NRYA 4N90D 3GRWH 3MR9B 1T1WA 1NGQL 4ZPTB 1HILA 1JWSB 1U36A 1U8QB 2BVPA 4LSPL 4OZ4B 3MJ8B 3QG6B 1NPUA 3QXDA 5GS0D 3HNVH 3QRGL 3BRGC 1UWXH 3WN5C 3MLVL 1S7XA 2FGWH 1YNKH 5E6IC 4XNMA 2KQMA 2WLZA 5CINH 1NLBH 3B2VH 3HPLB 2HMIC 4AZ8A 2ZOKA 3SO3B 4X4MA 2IH1A 2GJZB 3RVXC 1MAJA 2J8OA 3S9DB 1AR1D 2FX8H 1JPGA 4U1LA 3FO1A 1EUUA 5D6DA 3SGEI 2DMBA 5CSGA 3W9DA 1LO2L 1IBGH 3CPLB 1MFDH 4LARH 3VWJA 1WFUA 1IC7H 2MCG1 3HE7B 2CK0H 2WBJC 1UWGH 1QLEL 3LMJH 1T3FA 4OZIE 2VLKE 4JHAH 4TNWK 2X4PB 32C2B 5DJ2A 3C8KB 2VXUL 4Q6IA 4TN9A 3MFGB 2J8UE 1OB1A 1QRKA 2UWEA 1JBJA 4YBLC 2Q6WA 5C0FB 2ZCLL 5GGSA 3GJEA 2VDQL 2ICEA 1XR9B 2AKRB 4L9LA 3NCJH 3ARYA 4QRTB 4X8XA 2Y36H 3W39B 3V6FB 4D8PB 1RUKL 3WHXB 5F9OL 4ENEC 5IG7A 3MBEC 3MUGB 3SCMA 4PRNA 2NY4D 4OD1H 1L0XA 1BFSA 2HRPL 1WFOA 3SOBH 3EYUL 2LE9A 2NY6C 3BQUB 5C8JA 3VXUB 3KPLB 1EHAA 4HJJH 3T65A 2OK0H 4GKZB 1I8LC 4BUHA 4JY6B 4HT1H 1S9XA 4L1HA 3DVGB 2J5LC 1T7YA 1E4XH 2VE6A 5KS9E 4FQLL 4FFZL 1IGML 4ODTL 4R8WL 3UJIL 5F88A 3QUYB 1OF2A 5DC9B 3B9KA 4ZUSA 4GG6F 2J2ZA 4JR9L 1DBJH 3EO0B 4PJ7B 1QR1A 4KJPD 5CP7A 1EO7A 1MHPL 1MCRA 1VPOL 5D96C 5IFHH 3V8OA 3U4BH 2O61A 5C0GB 1MJUH 3ALWA 3QNZB 3P4NA 3D39E 1JPTL 4F9PC 1R3KA 1VFUA 3KLHC 1CWVA 3HE6B 4UDUB 2H3NA 4WHYG 2PW2A 2X4NA 3B8YA 3JWDL 3NBNA 3GI8L 3MXVL 3TN0D 4PJIE 5D7KE 2VLLB 3LRGA 1KACB 1IL1B 4YDVA 3OX8B 3PL6C 2YKLL 4PJ5B 4QRPE 1TLKA 1CTNA 4WTWA 1G1CA 4PRHA 2YHGA 4ZFOB 5HPMA 3NGBB 3ZE1E 1AQDB 3VXPB 3FQTB 5D6CB 3SDAD 1JMXA 4XNYL 1OM3H 3LKNA 2QHRL 1LHZA 2A0LD 4QHKI 1T22B 3IVKB 4GBXC 1QKZH 2AJZA 2DJUA 4ELKB 4LFHD 3PWNB 1Z3GH 2X7LB 2AJ3A 5B3JF 1OHQA 3EZJB 5HYSA 3HPJB 2DAVA 3SBWC 2PO6C 2AQ1A 8CGTA 5EA0H 2BHUA 5D1XD 5F7DA 4PJGE 5A3IC 43CAA 2E5EA 4U1KB 1G7IB 2DYPA 1I3UA 4ZAKC 1KTLA 3G5VB 3U7YL 4NQUA 1T1YB 1B90A 2P5WD 3F7PC 4LAJH 4JFPB 3N50A 3RZWA 2G60L 1JGDB 4XCFL 4I3RH 4XH2A 4NQED 3I6GA 3T77B 3H7BA 4LLVA 5ERWA 3D18B 5HI4D 2FJHB 2MOVA 4WUKL 3RGVB 3ARDD 3JSSA 2BNRB 1QHOA 3MLYL 3VGGA 2R4RL 3CFEA 4HG4J 3KLAA 3TVMD 1L9NA 3B5TA 4ALAH 2SEBB 4TTDC 1QFUL 4IMLB 3BE1H 4K3DL 5FGRA 5DVLA 1T21A 4CN6A 1NMAL 3IGAB 2EYTA 2GK2A 1DVFC 2R29H 1VERA 1RZGA 1J8KA 3ULVE 1I9IH 4LPWA 4OFDA 4OLZH 4HWBL 4NJAL 5CUSH 4ELMB 3X3GH 4GOSA 5DMIH 4DZBA 3SGKA 3EJYC 1TETL 2MHAB 5EH1A 1CD8A 3P0VH 1KCVL 4K23H 1D5IL 1RUQH 5KVFH 2F54A 4XBPA 4HCRA 3PDDA 3HC0A 4OUUA 5EOQL 2HT3C 4GKNB 2DJSA 5J13C 3VFNB 4PJ8C 2ZSVB 1SQ2N 2CLZA 3MJ9A 3V0VA 4PUBH 4WO4D 2ICWI 3VXMB 3AU1A 2YPVH 1FNSL 5DJZB 5C0AD 2F15A 3W0WB 2ZPKL 1FZOB 4NSKA 4OFPA 2A1WH 4GMTH 2ESVE 5DS8B 3OKNA 2RHEA 4S2SB 2QEJA 4JDTH 3WFBL 4HZLA 1YEGH 4OZIB 4CMHC 2VLKB 1CL7L 4X6FB 3ROOA 5FA3B 4CDGC 2ED7A 5T3XL 2ZCKH 1OT2A 1N2RA 1N6VA 3CVHL 3CFKA 5FHAH 3OF6A 1ZS8A 5INCB 1WZ1L 4WY7H 5DD0H 1A7NL 2KZ1B 2AERT 1FNEA 5CBAB 1RK1A 1I3GL 3NCCB 1J1OL 1AD0A 3QCUL 3DRQA 4A6YH 4ZS6D 1JZ2A 3EOBA 2EDXA 2FATH 4NT6B 1UENA 5J89A 2NY4C 4NZRL 4RGOL 1B88A 4YK4C 3SDXA 1JMZA 1GZQB 4XNQB 5E5MB 4QKXB 5EPMB 4G8EB 5F3BA 4X4ME 4K8RH 4TUOB 2GUOB 3OB8A 5I73B 1N5AB 4HDIA 4LVNC 3T0ED 4JG0H 3BZFB 5I16A 1YJDC 3L7FA 4NKIL 3NFNA 5E56A 4PR5B 5DC4B 4PJBA 4ODXB 3ECBB 4WI2A 4WFFE 3BP4A 3Q1SL 3UPCA 1T89C 5K9KA 5D7JD 2PF6A 4DGIL 3D39B 1U3HB 5KSAB 3T4AA 2UWEE 1YMHB 3EO1A 4U6YA 4L3CB 2D2OA 3CSPA 3TJEH 1J1PH 4PJIB 4UNUA 1MWAH 4TULL 5DMKB 5DVMA 4TNWF 2EIEA 3GHBH 4NUJA 4LSQL 4J6RL 3TN0C 2OZ4H 1SJHB 2ZUVA 3IFNL 2X44D 3S98A 5CD3B 25C8H 2OL3L 1KXVC 1T0PB 4ZYKA 4DTGL 4UIMA 3SKOA 2EYSB 3MCLL 3VXTB 1IGCH 4KXZH 4WWKD 2BRQA 1V7MH 3KYAA 4MWFA 4MX7B 2JIXB 5KG9A 1UADC 2A0LC 4F7CA 5A2FA 1F58H 2O5XH 4LPCA 4PGCB 4G6KH 4JFDA 4ODVL 1PSKH 1Z9OA 4FNLL 3EYVB 2GSIA 5IB3A 2QQNH 4PJGB 4R97B 3MRNB 1SJXA 3VW3L 5D1XC 3VRJA 1T1ZB 3P4OA 3VFWA 1EJOL 1EGJA 1MCWW 3NPSB 4H88H 1IQWH 5IQ7L 2YSSB 5E9DD 3JV5A 3VDBA 3CZJA 5MEOA 2DLTA 2E27L 2YMXH 4P23D 2Y72A 2DTMH 4NKMB 4KMTL 3BO8B 5MERB 1T1XA 2VRAA 1IGYB 3MOAH 3V4PL 1HDMB 4UDTA 3TA3A 1GGUA 2R39A 4XX1E 4YDKL 4E41D 1PKQA 1TCRB 4PRHE 2J6EA 1CR9H 1BEYH 3O3AB 4EVNA 2FIKB 3R1GL 4P3CL 4X6BB 1E4WH 3U6RA 1AHWC 3D0VA 2AS5M 2VISB 2IJ0C 4JREC 4EDXB 4KTYA 5FDWB 3LEVL 4CU8A 3CSGA 2I26N 3HFMH 1MAKA 3OB0H 1JPFB 3NAAH 4APQA 1UKTA 4FQIL 4I48B 5JW3L 3BPNB 3CUPB 4U6HB 5DEGB 3Q3GB 3T04D 5J3HC 1TVBB 1KFAL 2IPTL 2VL5B 1IZJA 4Y4FD 2DTSA 5E24E 4L29B 1XFPA 3OV6A 2YBRA 3BEVA 3STZA 4N0UA 3D6GA 2R0KH 1DL7L 1CXEA 1NGXB 3BSZH 3WFEL 3MRDA 5FF6A 1EHLH 4D9QD 4J2XA 4OCSL 5IEHB 1JK8A 2ESVB 2FECI 2WQRA 4WTXA 3KPNB 3V0WL 5FO8A 1EMTL 3LKOA 4Z7WA 3O4OB 1KBGL 5TE7L 5FUCE 4JY5H 3ZKND 5I1IL 5F9WB 3BKYL 4ODUA 1LE5B 2CLVB 2JB6B 1F3RB 1EXUB 1C12B 1JN6B 3BP5A 3CFJB 3HMXA 2N4IA 2VQ1A 3E2HC 4NRYB 1PLGH 1T1WB 3EZ8A 4LVEA 1WTLA 4PG9B 1HILB 2BVPB 1CIUA 1OCWH 1T83A 1IAII 3EJJX 2ICCA 5IFAH 3LEXA 3QXDB 2F54E 5CEZD 2BRRL 3UYRH 1FO0A 1H8OA 5DD1L 4JM2A 3RTQB 2R1XA 5JXAH 1S7XB 3QXWA 2J4WL 4XNMB 4ZS6C 4YHZH 3IETA 3K2MC 4ZD3H 2BSED 4WW2C 2FJFA 3TIEA 5GS3A 2ZOKB 4HIEA 1A7OH 3J7HA 4JPVH 4YIQA 5D5MF 1NCUA 4XAWH 3DTXA 3H3PL 1P4LA 2XXCB 3DO7A 1JPGB 1P9MA 1A3LH 3KDMA 3FO1B 3W9DB 4Y19D 2VZVA 3BN9D 3SDDD 1AGFA 3IJSB 4HPOH 3VWJB 3ZDZF 2Y07L 1HHJA 2X70A 1T03H 2BFVL 1UG9A 3C8HA 1T3FB 2P49B 3ARGD 4XPBL 2EDTA 4FFYL 1FZMA 3GSNH 1FN4A 5DJ2B 4C56A 4Q6IB 5J6HA 3QUMH 3LKSA 4Q0XH 2XWBA 1E4KC 2ADIB 2Q6WB 3U46A 3T1FA 5GGSB 2NY0D 3GJEB 5C2BL 1J1XH 4L9LB 5E6YA 5EOTA 1FGVH 1ONQA 5IG7B 3SCMB 1YECH 4PRNB 2EDYA 2EH7L 3WXWL 1U8KA 3HNTH 1FORL 4X5XA 1JWUA 1ACYH 5C8JB 2V17H 5EU4A 3SGJA 3QCTL 3T65B 2NY2D 3SDXE 2MNUA 4EQ3A 2HT2D 4FXGA 4TSBL 5CBEA 4O5LH 2VE6B 4WWKC 1YC8A 3FB7A 4OM1H 3FT3A 2GK0A 1G7HA 2XXMB 2ZUYA 4KHXL 3WLBA 5F88B 5DURB 1OF2B 5DHVA 1FPTL 2NXYD 2OP4L 3B9KB 1RU9L 1HINL 1JNJA 4NNYA 2AJUH 5I1EL 1QR1B 1I1AC 4KPHH 4B53A 2YD6A 5CP7B 3TBTA 4PJBE 2DIAA 1JHTB 2MQ3A 3ZL4H 4JHWH 4NZJA 1ZLSH 2O61B 1NMCB 3P4NB 4N0YH 5B3NA 2E8YA 5EN2A 3DGGA 2F53A 4LLDA 3SDCA 3SE8H 2H3NB 4C4KO 4EN3D 4HUUA 2PW2B 4UINH 3TFKD 3OAYH 4JFEA 4F57H 1MFCL 3MLTB 4L4JA 4P23C 3WXVH 5JO5A 4OV5A 4YDVB 1HHGA 3VMPA 1BBJA 3FMGL 5B39G 2AJXL 1NMBH 4PRHB 3RI5K 1Q72H 4UNVA 2CIIA 1YJDL 1FNLA 5H8DA 3SE9L 3KNBA 3HMWL 2XZAL 5CJXC 2AJZB 3UX9B 4JGUA 3VWKD 3ZHDA 3WO3B 1JWMB 2AJ3B 3HLAA 3PHSA 2VL4A 3UC0L 1CF8L 4X6DA 5HYSB 4JFDE 2E6JA 4XXCC 3TNNA 4YC2B 4Y7MA 5F7DB 2BOCA 4GW4A 1WITA 5FOBA 4PJFA 43CAB 2GAZA 3GSOA 3V0AC 2DYPB 5IMLA 1KTLB 1D5MB 4JFZH 2A6KA 4PIRF 5IP4A 5GIRA 5FYLD 2VAAA 3I6GB 1KC5L 3H7BB 1DDHA 2Z0BA 4LLVB 5ERWB 2E9BA 2NW3B 4MJIA 5DK3A 4HV8A 1NGZA 5FYKL 4JB9L 5TFSH 5ICXB 4OGZA 4JFQA 1FFPA 1BZQK 1XGQA 1ZHKB 3CFEB 3B9DA 3KLAB 3QNYA 4ZTPH 1IAIM 2GJ6D 4OZIF 3FCTB 1NEUA 1TPXC 1PKQE 3MNWB 5FIEA 2J8UF 4ZUVB 2EYTB 3ESUF 4UB0H 3QAZB 1RZGB 4N8CL 3GBMH 3ARFD 3SDYH 4WV1A 2UUDK 2IBGA 4DZBB 2CMRH 4M7LT 2Q7YA 2ZUTA 2VERN 3HNSL 1E28A 1S7UA 1QSED 1Z0NA 1YZZA 1KIUA 2F54B 2YZ1A 4XBPB 2NXZC 2R0WL 3HC0B 2XACC 4OUUB 3WCYA 4XT1C 4L5FH 1T2XA 1BIIA 2D7OA 2VC2H 4RGMC 1KPUB 1E6JL 5JOFA 2DQFA 3DETC 5DGQA 2NY5H 1JV5A 1KIPA 4PRAA 2CLZB 3V0VB 5KS9F 1CZ8H 4PYGA 4N0UE 5EZOL 2FD6L 3PQYD 4QHMA 3L3GA 5IHZA 3HUJF 4PJ9A 1D9KA 1JZ4A 2Q76B 2XZCH 1RVFH 5I15H 3O2VH 3OKNB 2X1WL 3QEQD 3U7WH 4HZLB 4Z7WE 1LDPL 3SDDC 4NUGL 4M5ZH 2NZ9C 5ECJE 2K1MA 2CRIA 5CZVH 4GAGL 1NC4A 2H6PA 3IU4L 1NANI 4DJMA 3KPPB 2F5AH 3DNKA 4P2YA 5IB5A 2V2TA 4LVHB 5DD5H 3CFKB 4I9WD 4L8CA 2W9EH 1ZS8B 5BS0A 1DBBL 1A6WH 3RWIA 4G6FD 1FNEB 1K5NA 1RK1B 1XF3A 3A6CL 4F33A 4LOUC 1AD0B 4OIIL 1OP5H 1JI2A 4YXLH 3ABZA 3DRQB 2WQ8A 4QF1A 2W9DH 1KG0A 3GK8L 3EOBB 4BQ6A 3CU7A 3S96B 3ZE1F 2YPLD 4QXUH 2VUOA 4FQQA 3SDXB 5JDSA 5AAMA 1X5HA 5F3BB 1AKJD 4BFBD 1ZE3C 4K3JL 5KSVA 2NY2C 1LP9A 3RX7A 1BVZA 4M1DH 4V1DD 5E8EA 4HDIB 5CIPH 4K3EL 3UO1L 2V6HA 3GSVA 1FC2D 1DQLH 2DBLL 3N9GL 1FZKA 5I16B 3L7FB 4KTEL 4PJBB 1QRNA 2F5BL 4O2CA 5D71H 5TPWH 3SGDH 2D4DA 5K9KB 2H41A 4C56E 5KTEH 1WBZA 2HA1A 4P4KA 2WUBL 3T4AB 1P69B 3DVNB 3UJJL 4AQ1B 2VXSH 1N0XL 3O6LH 3EO1B 4U6YB 1YEFH 3QUXA 2CUHA 1AI1H 1J0JA 1JNNH 3QDJD 1URLA 4NUJB 5A2LH 3P73A 3CLEL 1GVIA 2EIDA 4HJ0C 5ESQA 4MB5A 1FE8H 5GZOC 2VDOL 3O6FC 5IJKC 1NCTA 1TZIB 4K7PX 4ZYKB 4J3SA 1M7XA 3RY6C 3SKOB 3AGVA 3ULVF 5GSRB 1U91A 3QI9D 2ORBH 4OLYH 1U8NB 4OTXH 5GRJH 4MWFB 1MVFA 1QFWI 2UZXB 5KG9B 4NQCB 3WHE1 4F7CB 2IAMB 2XNAA 4U0RB 1RAMA 4YQXH 5L2KB 3O81A 4JFDB 4R7DA 2D03H 5GGQH 3EYQD 4EI5A 4MQTB 3VRJB 4GSDH 2C3WA 3P4OB 3UTOA 3VFWB 4PRPD 2R0LL 5JLZA 4NBYB 5GGVY 1S5IH 5MEPB 3S3PA 1GC1C 2F53E 4ERSH 5MEOB 4BFGA 3T1WA 1WAAA 2NY3B 4M5YH 2VXVL 1XEDA 4JFEE 3RWJA 4RMSA 4JFFA 3DPBA 4UDTB 3TA3B 2PXYA 1PKQB 4EVNB 3PP4H 3N1GC 4HS6A 4NJ9H 3C60B 3X13A 1MCOH 3D0VB 3D3VA 3FZUC 5A2JH 2R4SL 4CVXA 4Z95H 3IFLL 2IQAA 1JUFA 1OAQL 1A6UH 5E2UL 3T2NH 3WO4C 5C0NC 1CN4A 5IFJA 2E3VA 1OQOA 4X6DE 4XPHL 1A7PL 4APQB 2B2XL 2VDMH 4LL9A 1H8NA 4UV7L 1G9MC 4PJFE 5B39A 1KJ2H 2AABL 3E1F1 1WT5A 2QL1A 4UAOB 2JTDA 4MNHA 2EDQA 2C7UA 2YBRB 3OKKA 1IKFH 3BEVB 3STZB 5IHUH 3QRFM 2RIKA 3KYNB 3MRDB 5FF6B 1REIA 4MJIE 5TDNA 4P9HC 2VDNH 4Z7QF 1JK8B 5HHOB 2PYED 4TQEL 2H1PL 4J23A 1KGCD 3CZFB 1Y6KR 5FO8B 3LKOB 4IRJC 4Z7WB 5BJTA 1M1SA 4MNGA 4W4OC 5D8JH 4XP6H 1RQ5A 1EFXB 2UWEF 5I1KL 4YWGL 3WIHA 4K8RC 3V6BR 3BP5B 1HIMH 2VQ1B 3FKUS 3STLA 4UU9A 1IARB 5CD5C 1DBAL 1GIGL 1R5WA 1VEPA 4QXTA 2QADB 3DECA 3LEXB 1U8JB 3GRWL 5HY9A 3TH4T 4S1QL 4LHQB 5HGBA 2ICWB 3QIUA 1DBMH 1FO0B 4KDTA 4O58L 3UJTH 1WUNT 2R1XB 3MRIB 4OM0H 4QHNA 2EDHA 4XPTH 3O4LB 3HNVL 5BVPL 3IETB 5I6XB 1S3KH 4HWBA 3RGHA 2X1QA 2FJFB 3WDHA 1CXHA 1TNNA 5DR5H 1ZSDB 4YIQB 5HYJD 3KXFA 5JQ6H 3WNMA 4JZJC 1J9CT 1P4LB 4M03A 2IANA 5CINL 1NLBL 5AWNH 3FL7A 3LN5A 4ONHA 4ORZC 1YN7A 4MSWA 1NAML 3A6OA 5IV2B 1RJZA 1AGFB 5IQ9B 1HHJB 4CN1A 1F4HA 2AEQL 4YX2L 4WEBL 5J1AA 1ZGLM 1MFDL 1NCWH 3M17A 1FZMB 1PD6A 4LARL 3MGTA 4C56B 1FAIH 1KUMA 1YQVH 1UXWA 2CK0L 2BJML 3LKSB 4YEEA 3AAZA 1UWGL 2XWBB 3LMJL 3U46B 3T1FB 4JHAL 4AEFA 5BS0E 5H94A 5EOTB 1J0ZA 2KPNA 2EDOA 2IQ9H 1QFWM 1ONQB 3SE4A 2BHZA 1FL5A 2OTPA 2DM4A 3BKML 1U8KB 2IBZX 4X5XB 3HE7D 1JWUB 2FSEA 5I76B 5GRUH 3A0OA 4J8RA 4MNQA 4HIHA 3TP4A 5EU4B 2HLAB 3RL2A 5TH2A 3CVHA 4OD1L 4MDIA 3MRHA 1MI5A 3NA9H 3UTQA 4FXGB 2WBWB 4JHZA 2CK2A 5CBEB 2NR6C 1LP9E 4X7SH 3FB7B 3FT3B 2GK0B 1G7HB 1HQ4A 3WLBB 5IR1A 1I1FB 1R6VA 5HHME 1E4XL 2Q8BH 4GAYA 4LK4A 4NNYB 2LU7A 3UP1A 3TBTB 4NN7C 1G0XA 1LO0H 1QRNE 3BQUD 1CLZL 2YRZA 4RBPK 4N9GA 4UUJA 3VXUD 3WSQH 1AE6H 4GRLC 1ZT7A 1FYHB 5EN2B 3F12A 12E8H 3B9EA 3DGGB 2F53B 4LLDB 2OMBA 4XXDB 3U4BL 4NC2B 1MJUL 1IC5H 4DUWA 5F9AC 4JFEB 4ZTOH 1L7TL 1IAKA 1LNUB 3IJYA 5CILH 3QUYD 5JO5B 1WICA 3QISA 3BESR 3Q6GH 2PTVA 4FFWD 4YHIA 5CEYA 3W9EA 1DQJA 1HHGB 2O5YH 4OIAA 1BBJB 4LLMA 4MVBD 1YEJH 4PGEA 1AJ7L 4NQSA 2CIIB 2WK2A 1INEH 4RRPG 1R5VA 4E0RA 3KNBB 3IDYB 3NTCL 1CFVL 1FIGH 2UUDH 2Z9TA 3HE6D 4PG2C 2VABA 4X6DB 3GMOA 2LTQC 1QKZL 3VFTB 5BVJA 2BOCB 4GW4B 5FOBB 2B4CC 2X89A 3WJJC 4PJ5D 3QIWC 1I8MA 3QXTA 3GSOB 4KVNH 5IMLB 1I9JH 5EA0L 4EBQL 1PEZA 1CE6B 2A6KB 4I8DA 4OLVH 5IOPA 3S4SG 1F97A 3DBXA 3WDJA 5HYEA 2VAAB 5GS1C 4XCYA 1C1EL 1WAAE 4MJIB 4CN4A 5ENWA 1NGZB 1EK3A 4TSAH 4JFQB 1FFPB 3QUKA 2X5PA 3UMTA 1XGQB 4I3RL 4HX1A 4JFFE 3BW9A 3MBEA 2W0PA 1EEUA 3P9LA 4MXQC 5JPNA 3L5WA 2BNUA 5BQ7A 1ROWA 3VGEA 3QH3A 4XCCH 2A9NH 2ID5A 3ULUE 5JR1H 2D0FA 4LCYA 4ZXBC 3VFOB 3D3VE 3RIAK 3PV7A 3BE1L 4WV1B 3AFLA 3VH8G 3F6LA 3OR6B 2ZKHL 4HLZH 1N3NA 3WIFB 5DRWA 2Q7YB 2XN9A 2R29L 4N68A 4QLRA 1E28B 1S7UB 5E2WH 3ILQD 5DD3L 5CUSL 3TO4C 4P4RA 3RGVD 1FFNA 3T0XA 2BNRD 3G9VA 3ME0A 3X3GL 3CFDA 3T0BA 1R0AH 1GC1L 1X6LA 3F7VA 4RX4D 5ICYA 4HHAA 4J4PC 4ORGA 4U49A 4NBXB 4X7CC 1CQYA 3P0VL 2B5IB 1BIIB 3VJ6B 5KVFL 2DQFB 3U30B 1JV5B 4ZQKB 4RMWA 5F97E 1KIPB 3S6CA 3V4UH 3DV6B 2VQTA 4NFDA 4QHMB 3L3GB 3T08A 1CDUA 4F9PA 4Z0BH 4I2XA 4PJ9B 1D9KB 2K9UA 4PUBL 3GJFA 1UZ8A 1S5HA 3GNMH 2YPVL 3H9YA 2JJSA 8FABA 3WNPA 2A1WL 2RFXA 4GMTL 3PL6A 4MNGE 4GMSH 5HTSA 5KOMC 3UZVB 1NGYA 4KI5D 3C5ZA 1NC4B 1G9ML 1RJYA 2V2TB 5IB5B 3WEXA 1A7RH 5FYJL 1F90H 2V5YA 1YEGL 2CR6A 2FHFA 5I8OL 4L8CB 3ZO0A 3VXMD 4BSJA 4GBXA 1L0QA 4DCQA 1XF3B 4FQ1L 3W0WD 4F33B 4F7TB 4HEME 3C08H 4QF1B 1HH9A 4WY7L 3EBAA 5DD0L 1X9QA 1RJLA 2DQUL 2PO6A 4I18A 4P9HL 1FNHA 1GGYA 2VLKD 5JDSB 1MCPL 4Y1AA 4KTDH 5KSVB 4XP5L 3ARRA 3KXFE 1LP9B 5TF0A 3REWA 5L7XL 2IANE 3HI6L 4OCXH 4PGZA 3GSVB 5I0ZA 1UM6H 4K8RL 5HHMB 3FQXB 5I8CA 3FOMA 4M93B 2ICES 2LAAA 5DZOA 3V5HB 3O8XA 5E8PA 3OAUL 1HNGA 4IMKA 4JG0L 1QRNB 1L7IL 4PJEF 1WBZB 1NAKH 3BQUC 1U41A 3QDAA 3IAPA 3QUXB 5E8NA 5A43C 3H42H 4KVCL 4U2ZA 3P73B 2UYLA 1J1PL 3ARBB 1U2HA 4ODWA 1KULA 3GHBL 1NC2A 4MNQE 5FYLH 5T3XE 4YHYB 2OZ4L 5JA9A 1U91B 1QPPA 4GT7A 1MI5E 2BVEA 3REVA 1B0RA 4MA1B 3U0TA 3UTZA 1CGUA 4PJ8A 2PCPB 1QEWA 3D39D 1NGWB 25C8L 1DQTA 1J18A 1U3HD 2R56L 4JZOA 5KSAD 2PKDA 4S11A 3DX9A 2XNAB 3LEYH 4AG4H 1A6ZA 1V7ML 4LVOB 1JI1A 2B39A 5D7KD 4R7DB 4N0CD 5EIVA 1K4CA 4G6KL 4EI5B 1PSKL 4Y2DA 5I1LA 3VRLE 1ZWIA 5LWYL 4ETQA 5GJSH 2HKHH 2QQNL 5JLZB 5GRZA 4BJLA 1CLYH 3QEGH 2P24B 3NGBC 4FG6D 2EE6A 3S35X 4QXWA 2JIXD 3V79C 4H88L 1IJ9A 1IQWL 4U2YA 2YWZA 5IB2A 1UA6H 3W2DH 4XP9L 3RWJB 4Z7WF 4JFFB 3ET9F 2D31B 4XI5D 1DUYB 4G7VH 2YMXL 5K59F 1W0WA 2DTML 1A4KA 2NY5C 3SO5A 4H0HB 4HS6B 1VGKA 3RL1A 3MRFB 3X13B 5IK3B 3IYLW 3D3VB 2G75A 3VGAB 4CVXB 1OD7A 2IQAB 1XGRA 3P0YL 5IFJB 3X17A 5H37G 3BEWA 1YA5A 5FCSH 4JM2F 4X6CA 1UYWH 3ILQC 3VFMA 4UTAH 4M3JA 3RGVC 5B39B 4AEEA 1VFOA 2I24N 4MA3A 4X83A 2XQBH 4O4YL 4CVZA 4DWHA 2C7UB 3OKKB 2AXHA 1T4KA 5FUOH 3I50H 4Y4HA 3QB7C 4LNVA 5TDNB 5BV7H 4RZCA 4MAYA 3RU8H 2R0KL 3D87B 1PQZA 3EJZD 2Z92A 2YA0A 4KAQH 1FRGL 1EHLL 4ONFL 5BJTB 2YC1A 4RIRA 1EAPB 1JFQH 4F58H 4MNGB 2NCMA 1XGYL 2J88H 2P5EA 1J12A 1TJHH 4OCNC 2PYFA 3S4SA 2B4CL 4MS8C 5AYUH 4HSQA 2RR3A 3STLB 1N7MH 4UU9B 4PRIB 2D9QB 4WHCA 1R5WB 3HI5H 2XN9E 1GH7A 2P42B 4QXTB 1UT9A 3MXWL 1OLLA 2ESVD 1QUNA 5HGBB 3DLQR 3QIUB 4WEUD 4W6WB 3WMSA 5EZLB 1GGBL 4LAQH 1E6OH 1UJTA 3G6DH 3IKCA 1RFDH 3Q48A 4JM4H 4QHNB 1KJ3H 5IFAL 2C1OB 4XRCB 2F9BT 3UYRL 2FYYA 1C16A 5AZ2H 5JXAL 1CICB 3VH8A 3KXFB 3MODH 2MQCA 3OXRA 3BUTA 3C6LA 4OZFH 4YHZL 2IANB 3LVEA 3NH7H 4I2XE 3VI4E 1NCDH 3LN5B 2V7NA 1A7OL 4ONHB 1YN7B 4JPVL 4MSWB 1RJZB 3KAAA 4XAWL 1SMOA 1KTKE 1R3LA 4P5KA 3RVUD 4U1JA 5EZJA 1A3LL 5DT1H 2OS7A 3GMRB 5DO2D 1M7DA 5J1AB 3RTQD 2I60L 3M17B 2VB5A 4DOHB 4HPOL 4RDQG 2HN7A 2GCYA 3RPIA 3RVTD 1T03L 4AY0A 5CWSA 4R3SA 3AAZB 2O5ZL 1MIML 3GSNL 1AHWA 1S7TA 4MD5A 3QUML 4Q0XL 3IT8D 3PV6B 1MFBH 2QJDA 2FCBA 2DLIA 4ZO9A 1J1XL 1FV1A 2A74A 1FL5B 5CJQH 4ZS7H 3VWJD 5CHNA 4FS0A 5D70H 3G6AA 2C3VB 2FSEB 5IROC 3MRRA 4J8RB 1FGVL 1K85A 4MNQB 4HIHB 1GCFA 2B0SL 1QNZH 3MLUH 2A6DB 3RL2B 5TH2B 1YECL 3CVHB 4WFFD 5HI5C 1JYVA 4MDIB 3MRHB 1MI5B 4NM4H 3UTQB 3BWUC 3HNTL 4Y1AE 3GSQA 4XMPH 2V17L 2BSSA 3RNKA 1IC1A 2HJFA 1HQ4B 5JIKA 2Y6SD 1MFAL 2EECA 5IR1B 3O6MH 2Y9RT 2JK5A 4O5LL 4PJFF 2YD2A 1EERB 4OGAD 5F7WC 4GAYB 4OM1L 4BFIA 3SCMD 2YXMA 3WIIL 1TFHA 4LMQI 1ITBB 3R0NA 4LKCA 1PAMA 3I2CH 1H3UA 2BVTA 4IDLA 4N9GB 5MEQA 2AJUL 1ZT7B 1RPQA 1H3VA 1KPVB 3NCYS 3TH2T 3CD4A 3F12B 5TF1L 1PJ9A 4P48A 1BAFL 1QBLH 3MJGX 1MRDL 2GIYA 1ZLSL 4PLOB 1WIUA 4AEIH 2JCCA 4FG6C 5CZXD 4N0YL 5LQBH 1IAKB 5DURD 5KZCB 3SE8L 3W9EB 4YHIB 5CEYB 5SV4A 4ZNEA 3P9WB 3B9KD 1DQJB 4UINL 5HGDA 2EXWD 4LLMB 3RBGA 1NDGA 1WWAX 5I18H 4PGEB 2ED8A 1T66D 3WXVL 1L0YA 5IESH 4NM8H 1R5VB 4E0RB 5GS2H 4PLJD 2IGFH 4WW2A 4KKCD 1IEHA 4YHMH 2VABB 2VDPH 5FCUL 5IVZA 3VD4A 1Z6JT 2OQJA 2DQCH 3BRFA 4Q9QH 1X5LA 3GMOB 4MHHG 1UEMA 4BZ2H 2HAZA 5BVJB 1FNGA 3ZT7A 5KW9L 4HGKC 4K07A 4L3EB 5F89A 1SEQH 3PWPA 3LKPA 4PRHD 2WBJB 5LVEA 3NPZB 3DBXB 3ZSSA 5IB1A 4XCYB 4DEPB 4OLXH 2JJVA 3LQMA 4YBLB 1E4KA 4Q9RH 5E0QA 3OQ3B 3ULVC 5JMOC 1G6VK 3P30H 4N5UA 3QUKB 4M6OH 2A6IA 4IS6A 3H3BC 1OAZL 1UB6A 2NZIA 3BW9B 4HX1B 3RWGA 2FNBA 1FGNL 3PE9A 2AEPH 3MBEB 3QHFH 5TFSL 3P9LB 5JPNB 1OWRM 1LILA 3L5WB 2BNUB 1DZBA 2V5SA 4MHHI 1FZJB 4Y5VC 4H8WH 4F2MB 2DYPD 2NY6B 4ZTPL 4LRIA 4LCYB 4K7PL 3UAJC 5CSBA 4DK6A 3OAZK 4HC1A 1N3NB 5DWUH 1Q1JL 5DRWB 1W72L 3WNNA 4YLQT 3QPQD 1G6RH 2XN9B 5D7IA 4KV5F 5ISZA 3QR2A 5JOEA 3SDYL 4P4RB 5F71A 1FFNB 1LEGB 3CFDB 1IGTA 3F7VB 5ICYB 4X6CE 5C9JA 1XIWA 4ORGB 4QNPF 4KRPC 2W91A 1LK3H 1FNAA 3IDUA 4G7YL 3CSBA 1T80A 2YK1H 1I1AA 4WI6A 3CDCA 1NLDH 3OGOE 3FN0L 4PB0L 4Y5XC 1LP9F 2AW2A 2LU3A 2I25N 2VC2L 4O00A 4GW1B 4KZDH 4K55A 3BPLC 5HHPA 1IQDB 2NY5L 5C7XH 1ITCA 4B41A 4I2XB 1CGVA 5JOPE 4JKLA 4JDVA 4PY8J 3GJFB 4M1CC 1CZ8L 4YDJA 3TBSA 4BH7A 1PVHA 5DHYB 2EDBA 5IW3A 5IT2L 1BVLA 3AREA 2F54D 3IRZA 5I30H 1NCCH 1BBDH 2CKBL 8FABB 2RFXB 3PL6B 1RVFL 2P5EE 3P2TA 2H2PC 1NGYB 3C5ZB 4HK3N 3CSYB 4F9LA 1RJYB 4IM8A 2XG4A 3WEXB 2Q86A 5GGRB 1K6QL 4WWID 5CZVL 2VTFA 1CU4L 3QO0B 1YNTA 4GBXB 5CJXA 3CH1A 4DCQB 3WE6A 5DD5L 2W9EL 2XZZA 1ZTXH 2MMXA 1RJLB 4BQCA 3P11H 4JAMA 3BKJH 5I1GL 2PO6B 4I18B 1X5JA 3H6JA 2Q20A 3CDGB 4HIIA 1BQHG 3VWJC 4YXLL 2W9DL 3BPCA 2X4OA 4QCIA 4Y1AB 1N64L 1XCQA 4ZAKB 3U9PL 4QXUL 3RQ3A 3HAEA 4HG4K 3OF6D 3REWB 1CFTA 4Q6IC 3GRWA 1ED3A 5FKAA 4NBZB 5HI3C 2C1PA 1XAUA 1E4JA 4X80L 3FOMB 4M1DL 5E8PB 1F2XK 4XC3L 2GT9A 2X42A 5F93C 4R96A 4WDIA 2RB8A 1ZA6A 4PLKC 2CDFA 4I4WA 2WWMC 4P46A 3S37H 5TPWL 3JWNC 1TTGA 3NCBB 2W38A 3EGSA 1BLNA 5E8NB 5KTEL 1HSBA 3O2DL 2UYLB 4WNQA 3O6LL 5CZXC 1WC7B 2ZG2A 1AI1L 1JNNL 3V6OA 5CCKH 3MBXL 1CCZA 5GZNC 1NC2B 3ULUF 5J13B 2EXWC 1KB5L 1TDQA 4X9IA 2DQEH 5D2LA 1AIFA 4OIBA 3REVB 5JIIA 1B0RB 3U0TB 3UTZB 3VI3E 4BFEA 4PJ8B 4D0BB 1QEWB 4JZOB 1FYTA 5FM5M 3VA6A 1EZVX 3QQ9D 3DX9B 1OTUD 3NCYP 2ORBL 4OLYL 1X6NA 4KKCC 5GRJL 2PUQT 3KPMA 2X2YA 3GMMA 1WK0A 4KROC 4RQQA 5EWIH 1HNFA 3MRJA 1AGEA 2VZOA 4Y2DB 5I1LB 1ZWIB 2D03L 4ETQB 1N59A 4CMHB 4OZGA 4G80B 4OJFH 4YFEA 4GSDL 2P8LB 4Z7NE 2A73A 4NQCD 3W11D 2IAMD 2JCCE 5GISH 5SWSB 2VDKH 4P3DA 1S5IL 5IB2B 5L2KD 4JFDD 4I5BA 4OKVA 4ZNEE 5DEFB 4KXZI 3NIGE 1W0WB 3HR5A 1AC6A 2BDNH 3LDBC 1PG7X 1V3LA 3LIZL 1LMKA 5I74C 1OD9A 4CBPA 1RZKC 1VGKB 2FO1A 1RULH 1UH4A 3ZHLA 3RRQA 2Y7QB 1NCNA 3DSNA 4NJ9L 2NY3D 2DLFL 4NRZA 3OWEA 3LSOA 5JIPA 3BEWB 1FG2A 4X6CB 3N1QC 1UACL 4RFOH 2P7TA 5GRVL 3T2NL 3VFMB 4ZNCD 4HKBA 4LDEB 3TA3D 4MA3B 3ZT5A 5B21A 1A21A 1KPRA 2R9HC 3PWPE 4C54A 4QRQA 1MCKA 1FJ1A 1X5YA 1X5GA 4MXWL 4RISH 5T1MA 1KJ2L 3C60D 4FQJH 4RZCB 4MAYB 2VMFA 1Z9LA 1H3PL 1OP3K 3BIKA 5IHUL 4K9EH 4YXKH 1PQZB 1FLTX 1P7KB 4Q74A 4APQD 2Z92B 2HTKD 5EO9A 2YC1B 3GBNL 3ZYZA 3NFSL 2VDNL 2P5EB 3MRLA 2YN3A 1INQA 4KKAD 4FRWA 3WS3B 3O6FA 5C0CA 1WISA 2PYFB 2VKXA 2X6MA 4KK8D 3S4SB 1Q9WA 3RY6A 4P5MA 4IOIA 1RIHH 2B1AH 4PP1C 1Z0MA 4D9RE 5LBSH 3LV3A 4QWWC 5DDHA 1S7WA 4W4NA 1OP9A 5D7IE 5E03A 2XZQH 1W2KT 5ISZE 3EYFA 1HIML 2GSGB 5HHOD 3BZ4A 4EI6A 3BD3A 3IKCB 3ULVL 4HS3A 3CX2A 3ARZA 4KY1H 5L8KB 5J7CC 1EFXD 2FYYB 1C16B 1H3TA 3UJTL 5L9DH 1KNOA 3VH8B 4XPTL 1U2CA 4UZGA 4FABH 2VIRA 1S3KL 2EEBA 1NCAL 5KSBA 2V7NB 3BHBA 4ZDHB 2QADD 2IADA 5I8KH 4P5KB 4KJQD 5AWNL 4MXVE 1XGTA 5EZJB 5DA0B 3EHBC 4NOBA 1C5CH 4MGXA 1M7DB 3OGCA 3O4LD 2HN7B 3RPIB 5F9JA 5CWSB 3UTTA 2HH0H 4JFHE 4LRNH 3ZE0F 4GG6A 4UT7H 3TV3H 1NCWL 1AHWB 1JGUH 2FBJH 4DGVH 1S7TB 1YQVL 5DQDH 4JREB 2EH8L 1YNLL 1FV1B 2A74B 4U1HA 5CHNB 2CRYA 1IC4H 3CK0H 2IQ9L 2B20A 2X41A 3F6IA 2ZUQC 2APFA 2RCSL 1Q9KA 3EDKA 3RWEB 4C56D 1BJ1H 3K1DA 3GSQB 1NEZG 2BSSB 2VDRH 3RNKB 3P4MA 2HJFB 3NA9L 1J0HA 1FC1A 4QHLA 4FZEH 3QQ9C 3P4LA 2JK5B 3PWVA 1SJEA 4X7SL 4BFIB 1R3JA 2V9QA 4GH7B 3IDGB 4A6YA 1A22B 2X4QB 4UTBL 4LKCB 1BQHA 4IRJA 3B8SA 2Q8BL 2EKSB 2MFNA 5MEQB 5TQ0L 5TGBA 4Z7VA 4KFZC 3ETBF 4HKJA 4YH6A 4DVBB 5IGXL 5JHDA 4KDVA 3DMMC 5C2UB 1AE6L 2JCCB 2EIZA 1DEEA 3RWDA 1I4FA 4RNRA 4NHCH 4U6VH 1TMCB 1IC5L 3E3QC 1G7PA 1NDGB 3F8UB 3V6OE 4ZTOL 5J12B 2DM3A 3KPRB 4S1DD 5CILL 2O26U 5IWLA 5J1SC 1QHPA 1BGXH 3JVGC 4LU5L 2O5YL 5D2LE 4LQFH 1MPAH 3MV01 1TIUA 2R1WA 4KRMB 4WW2B 3MRKA 1FYTE 4P2QA 2F53D 2OR7A 5BV7C 5DVNA 1JF1A 5IVZB 2YOCA 4ZFFA 1K2DA 4JZJA 2OQJB 4JFED 5ESAB 1FIGL 3S97C 3K7UA 1MWAA 2NY3C 1FNGB 1YEDB 1IFHH 2OZ4A 2IWGA 1EHNA 5F89B 4YDIL 3PWPB 3LKPB 1KT2A 3IS0X 4P9ML 5LAXA 5DJ0A 4JQXC 1M71A 3TA3C 4OZGE 3GGWA 4L8SC 4XAKE 2D3VA 5DJYA 3IS1X 3D25A 4E9LA 3VI4F 5IB1B 5C08A 4UT9H 1T2JA 1B4JL 4OLVL 2IC2A 3PGFH 4A2MA 2A6IB 4IS6B 1BVKA 1UB6B 1V8HA 5HGAA 3RWGB 4WW1A 4X4XA 1FDLH 4TSAL 3GO1H 4E42A 1T7ZA 3OTTA 5AG8A 2DRUA 4P2RB 2VUYA 3KVQA 1LEIB 4WFED 4KK8C 5LXGH 5DJDB 5JR1L 1G7LB 4MJID 5D7IB 1CBVH 3ARVA 5ISZB 4OGYL 2XICA 1I8KA 2ZJSL 1IGTB 4YNYA 1XIWB 5BRZB 5KBNC 3HKFA 2K7QA 3KWWA 4NO2A 5E2WL 2QHLA 1ADQH 3L5XH 3RKDD 3BWAA 1I1AB 1R0AL 1FL3A 2MKLC 5D1QA 2I07A 3B2UD 1SYVA 3TLRA 1QLRA 3FAXA 5HHPB 3MGOA 5IJVA 1ZOXA 3FFCA 1F45A 3HC3H 1RZKL 4JDVB 3QHZH 3TBSB 4BH7B 2YUXA 3S35L 3WLWD 1A5FL 4LSUH 1BVLB 1HH6B 4AENA 3AREB 4AH2A 1HXMA 5EBMA 1T83C 4Z0BL 1QSZA 3PJSB 1F4XH 4KJQC 4MZ3A 4CNIA 6FABH 1OAXH 4JM2C 5C0CE 4F7MA 5K9JH 4Z8FH 3PP3H 1LO3L 2Q86B 2WZPD 5I6XC 2IH3A 1YNTB 3G6JF 4HJGA 3CH1B 5J56B 1A3RH 1IEAA 3WE6B 4PJ9D 1D9KD 1A7RL 1QOKA 5FK9B 4OB5L 3MLWH 1P9MC 2ITDA 2VR4A 3DYPA 5CKGA 4JAMB 3FRUA 1MHEA 4G9FA 4M00A 3GEWB 2D4FA 1MY7A 3OL2A 3TBWA 3EFFB 4OQTH 4UQ2A 4HIIB 3WJJA 1F4YH 1FH5L 1T20B 2EEAA 2X4OB 3MV7A 1A7BA 2XA3A 1XCQB 1NC4D 1U93A 1AO7A 2AVGA 1RZJH 4HCRL 5LCVH 1F5WA 1CFTB 4KRNA 4I0PC 5CGMA 4L4TA 5FKAB 5KSBE 1QLFB 4KTDL 5GHWH 2ZCHH 2C1PB 5DFWH 2FEDD 3SKUD 4GAJL 3LS4H 5E2VH 3KYOB 2D0HA 3IXTA 5HYQA 2OJZH 5CLTA 1CK0H 4R96B 1FSKB 5F1OB 5HDBE 2EDNA 2HP4A 1H0DA 1ZA6B 4O51A 2CDFB 3HZVA 4I4WB 4NZUH 5KSUA 1F8TH 3UTTE 2Z31C 3MA9H 1OLZA 3SGJC 4GG6E 3IDXL 1FVCB 1NAMB 4ZXBA 5DMGD 3EGSB 4WHDA 1NAKL 5E7FA 1HSBB 1AQKL 5IEKA 4WNQB 5HHMD 1PX4A 2I5YH 2NLJA 4NN5C 2JJWA 2NXZB 3VXNA 1S9YA 4J4PA 5FGBC 1QRND 4RGMB 4NNXA 5FYJE 5D72L 5D2LB 1AIFB 2CUIA 1Q0XH 3GSNA 2L0DA 2AJVH 1T7VA 2A9ML 5K9QI 3QUMA 3RPKA 4MYWB 3BPOC 1MJ7H 4O2EA 4DVRL 1UCBL 4V2BA 3QUXD 3SY0A 3SGDI 3KPMB 4QXGH 3SDCC 3GMMB 2CXKA 2WSKA 3WBDA 3EW3B 1H5BC 1H8SA 4XHQA 1N0LA 2GQHA 4Y4KA 1KN2H 4RQQB 4P3WA 1AGEB 1P7QA 3ARBD 4I3SH 2KDGA 4H8WC 1G9NC 2FX7L 4Z7VE 2BY1A 4BZ1H 5CMAA 5JHDE 1I1CA 2MPAL 3QG7H 3TIDA 3U0WH 2AXFA 5F6HJ 5GJSL 2HKHL 5CEXB 2R8SH 4FQXC 3ZKMC 3LHPH 1CLYL 4K71C 4P3DB 3QEGL 4DKEH 3Q5OA 4I5BB 1NFIA 1C8PA 4OKVB 2XOTA 1JGEA 5EZIH 2IFFH 1NCBH 3HR5B 1F3JA 1PG7W 4NWTH 3W2DL 3MFFA 4HAFA 4GXVL 4NO3A 4EI5D 2VNCA 1TXKA 2A38A 1DQDH 2RGSA 3CVIL 3EDJA 4P2QE 1JZ3A 5DFVC 1FP5A 5IIEA 4YE4H 3R4DA 3LSOB 2FL5B 3C87A 3LKRA 3PHOB 1TTUA 4JFFD 1UCTA 2AEIT 5DTFB 4OD3H 1P1ZA 1UQSA 4HKBB 1KPRB 3U48A 5KAQF 4FXKA 3RVVC 4QRQB 1F2QA 3MNVA 1F6LL 4Q9BA 2WINA 3NCMA 1UYWL 5EOCL 4FQCL 1HKFA 1UEYA 3LD8C 1UWXK 5FOJA 5T1MB 4PS4H 2XQBL 3B2UC 3D3VD 5C08E 4PY8I 3DX7A 2C9AA 5DLMH 3UPRA 3O0RH 2WIIA 3BIKB 1R5IA 4U3CA 4XBGA 5FUOL 3I50L 2OMNA 4M7LL 1DQMH 5EO9B 5BV7L 1I7TA 3UCRA 5D5MA 4CW1A 3FQNA 4HUWA 4XC1L 5IF0A 3OXSA 3T3MF 4KAQL 3O6FB 5C0CB 1Q9WB 1VEMA 4P5MB 4IOIB 5I1CH 1OTTD 4RFEB 1NBZA 1TJHL 4KK9C 3LV3B 5DDHB 1S7WB 4NKOA 1GSMA 3P77A 4YO0B 4D94A 4YDLC 4LBEB 5AYUL 1KTDA 3V5KB 1I9RH 1C5DA 4KGJA 3JBG7 5E94A 3C5SB 3BZ4B 4PJ9C 4EI6B 1BM3H 1VADA 3HI5L 4XPFH 3MPCA 3WUWG 5EBWA 4HWZA 5IBLC 2BVUA 3O41A 3VI3F 2DD8H 3QZWG 4QTIH 1VFBA 3TZVC 4LAQL 1E6OL 3G6DL 1RFDL 2DJ4A 1KJ3L 2UY7A 1AD9A 4C57C 5TQ2H 4HIJA 2VIRB 3JWOH 3FFCE 1M05A 3QUZA 5ALBH 2X9WA 4PRID 5KSBB 1ZEAH 2GEEA 4OCWH 3BHBB 3E8UL 3V52L 3NMEA 4EQ2A 4JE4B 3MODL 3C2AL 4PV8A 5I71B 2IADB 2D7MA 2F19L 3NH7L 1NCDL 2E9JA 3QIUD 3QULA 2FEDC 1MAMH 1HE7A 4CGTA 1U8HA 2JELL 5T33L 2R2CA 2IG2L 2XG5A 3N1PC 1MCLA 5F9JB 2JKXA 5DT1L 3B9AA 3UTTB 4AEHH 3VFGL 4Z7NF 3T4YA 3BGMA 4LLQA 1AY1H 1YEEH 4GG6B 1CICD 3KXFD 2PR4H 5ANMB 2IAND 5F1NA 3NIGF 3WO4B 4XP1L 4U1HB 4G9FE 3RY4A 3O2WL 3EYSH 3LH2H 2GY5A 1DANT 1CFQA 1HI6A 3MOBL 5CJQL 3MV7E 4ZS7L 1Q9KB 5D70L 5C0BA 1AO7E 5ESVB 4JPKL 3P4MB 4IRSA 5DYOA 4NM4L 4L4TE 4P4KC 4WU7A 1GJIA 4QHLB 3TJHC 2AGJH 1LE9A 3PWVB 1A4JA 1SJEB 3C6SB 4TUKH 3V8CA 1R3JB 1TJGH 4Z7OF 4KKBD 3PWJB 4N0RA 4A6YB 1BQHB 4IRJB 1W8OA 3NIDE 4MNQD 1OAUH 3K3QA 3QQ3A 5T3XD 5TGBB 1MI5D 1TVDA 3AS1A 2HG5B 3RX5A 3I2CL 5DJXA 5FAAA 4E5XA 3L5HA 5JHDB 4LEOA 3MRPA 5CGYC 4S1SH 4LCUA 2EIZB 3LN9A 5CIPA 1ZVSB 3RWDB 4LIQH 4RNRB 1U92A 1QBLL 2QKIA 4UILH 4AEIL 4KUCD 3SDAA 5LQBL 4ODHH 3DSFH 4KQ4H 5BMFH 3CMOL 3FOLA 4ISVA 4RAVA 5EORL 5I18L 2R1WB 4PV9A 3TYFA 3GB7A 2NNAA 3MRKB 4JN2A 4P2QB 5F21B 4OSUL 4FQPA 4OCMC 5IESL 4NM8L 1JF1B 1FFOA 4ZFFB 4JZJB 5C0JA 1YMMB 2IGFL 3TESA 3LZFL 1J0KA 3D9AH 3DUSB 5EU5B 5KZCD 4JPWH 2VDPL 4HS8H 2DQCL 2OTUA 4Q9QL 1I3VA 1QBAA 1MREL 2AJYL 5MHSE 4DGYH 1KT2B 3IJHB 5LAXB 4BZ2L 5CJ8A 4UMGA 5DJ0B 5GGVH 2AJSL 1U58A 4NQEA 2HKFL 2PXYC 3MROA 2FZ3A 4MZ2A 5DJYB 4JRYA 4M9OA 1SEQL 2KQNA 1JPSH 4W68A 3NOIA 5C08B 3CGTA 1JHKH 2BERA 3ULUC 3SQOH 4UIKH 5JTWA 3VXRA 4J12A 3RVXD 4URTB 3VMNA 1BVKB 1CXLA 3CXDH 4OLXL 2DQJH 2AV7B 4WW1B 3UROR 5D1ZC 4Q9RL 2X89D 3P30L 4E42B 1RZ8A 2ZUXA 4KUZH 4L3ED 3QDMA 3HUJA 2AEPL 2J12B 2WBJD 3HZMA 1WJ3A 2ENSA 2AV1B 5INDA 5JW4M 4XMKH 4H8WL 5JUEH 1LO5B 3CJJA 4KJWC 2H32B 1G9NL 4HLZG 1KIQA 5JXEA 4YNYB 3CFIC 3T0AA 3K4DA 1G6RL 1KJVA 1EEYA 3KWWB 4ENED 2W0LA 1MUJA 3MBED 4PLNC 3BWAB 5DK2A 3JUZA 1FL3B 1T7WA 5IB4A 5FXCH 1SYVB 2NY6D 3VFSA 4BM7A 2H9GA 1QLRB 3X3FH 2HJKB 2VN4A 4GRLB 4F7PA 4JQVC 3FFCB 5J06A 2B8OT 3GMLA 1VHPA 2XN9D 1B0WA 5SWQA 4UOW0 4KZDL 4WI7A 5T3ZH 5HGHA 1N6QH 3HZKB 4AH2B 5C7XL 2ZOLA 1HXMB 4XZUB 3AROA 3QP3A 5MENA 4OI9A 1A9BA 5D5ME 1BOGB 2R15A 1KJ2A 3QIUC 5I30L 1BBDL 3TT3H 2VKWA 3NZ8B 4F7MB 1PG7L 2QTEA 1G84A 2ZWLT 1KXQE 4EXKA 1F6AA 4L8BA 3S88H 1JZ5A 2HRLA 4ZPVA 4HJGB 1IEAB 3KLHD 4NPYA 1RZ7H 5FKPA 4MQXC 2ITDB 5MI0B 5LGHH 4P49A 2P8MB 2LTQB 3FRUB 4G9FB 1XCTA 3MYZA 4PJDF 3TBWB 1A7QH 3I3EA 4UQ2B 5HVWA 2LVCA 3PL6D 2VZ1A 5J57B 1ZTXL 3QIWB 5DRXB 3P11L 2ZNXA 1I1YA 3BKJL 2VZTA 3C5ZD 1MQ8A 1U93B 4JPIA 1JNLH 1AO7B 5FUZH 5D7SH 4PTTB 2B7DT 2R2EB 1KEMH 4DZ8A 4GBXD 1HOCB 3DARA 3SKNB 3CFCH 1OOAA 3NABH 5I17B 1MSPA 2Z35A 3WUWA 3SE4C 3S36X 2PO6D 5HYQB 4UV4H 3QZWA 4OZGF 4KKBC 4R90H 1CYGA 5EIIB 5A3ID 1H0DB 2BP3A 4O51B 3HZVB 5KSUB 3ARXA 4Y1AD 4Y5VA 4YFLF 3VD9A 3BUYA 4IIQA 4ZAKD 1DSFH 4KKLC 1DBKL 3AS2A 1A14L 4ZXBB 4HXBH 5CLWA 1UJ3C 2DI9A 3M8OH 2Z8SA 3SJVA 3S34H 3EYOA 2NLJB 3H9ZA 4O9HH 3TO4B 3I6LE 4LPYA 1UFUA 3VXNB 3VE0A 1S9YB 3RBSA 1ZMYA 4I77L 4NNXB 4TTDD 3GSNB 3T2PA 5CCKL 5C0BE 5J0BA 1JF6A 2HLFC 3KJ6H 3QNXA 3QUMB 3A6BH 4Y5XA 3RJQB 4HFUH 2J3SA 4TTGA 4O2EB 4X7DC 2DQEL 4JANA 1TZGL 2YUWA 3WFCH 3R06A 3AM8A 4WU5B 15C8H 5CS7A 4Y4KB 5JDJA 2QR0A 1YEKH 3SKJL 1P7QB 4GXUM 3OB0K 4N8VG 1NC2D 2HT3D 3KLSA 3V7AG 5EWIL 4U33A 1NEZB 2MJWA 1F11A 4Q2ZB 1XF5A 1GGIH 3EOAA 4BA8A 4C4KT 3MLRH 3ZE2F 4XB8A 4PJ8D 2W65A 5CMAB 4WI4A 2AXFB 5TE6L 5C86A 3PDGA 4GQ9H 2VLJB 3LCYA 4OJFL 1S7SA 1AP2A 4Z77A 4IOFD 1JGEB 4YGAB 2HJLA 2VDKL 1F3JB 1NH6A 4TVPL 3MFFB 1BJ1J 1HEZA 4KQ3L 2VJXA 1DLFH 1Z9SA 4NO3B 3RKPA 4Y2DD 1R3IH 3DRTA 1GPOH 5E2TH 2VAJA 4NN6C 4YPGA 4YXHL 5IIEB 3GM8A 5SWSD 1FIEA 3LKRB 4DEPC 4CKVX 2EZ0C 1P2CA 1B0GB 1OAYH 1P1ZB 3INUL 3HZYA 5F70A 2VXTL 4OUOA 5IVXA 4FXKB 3MV8A 4LSTH 5DC0A 4NQDB 3MNVB 1EIBA 1BFVL 2WINB 4RFOL 4TYUA 4NQEE 1I7ZA 4QRSB 1XR8B 1YYMH 1KXTB 4JRYE 1U9KA 5KSBF 5EFIA 1H9VA 3DX7B 4MA7H 2P46B 3RWCA 2FDBP 2DQTH 2Q3AA 2WIIB 3VXRE 4RISL 4NO0B 5BOPA 4DKFL 1ND0A 4XBGB 3I3DA 2G2RA 1IAIH 5F1KC 3NZHL 1NSNH 1I7TB 5D5MB 5HDBF 3FQNB 4HUWB 1DQQA 5IF0B 3BMVA 5C07A 3OXSB 3QDME 2W0KA 3HUJE 4H26A 3G04B 4Z78A 2KL6A 4OLWH 1NBZB 3EOYG 3MO1A 1K3ZA 1F6FB 1FLRH 3P77B 5JOPD 4MAYD 1RIHL 5IKCA 1KTDB 3JV4A 1K8DA 2VR9A 1C5DB 3DX6A 5LBSL 4QRRA 3ULUL 1IT9L 4DW2H 1FFQA 5EBWB 4HWZB 2BSTB 3O41B 4UT6L 2P5ED 4LSPH 5HPOA 1IM9A 1Z5LA 2JJSC 4XPGL 1W72B 3IB4A 1SY6H 1AD9B 1T6VN 2APBA 1KCLA 4HIJB 4Y19A 1KLGB 5GQBA 4WVRA 5FYKD 3C5ZC 3QUZB 3QXAB 5L9DL 4D0DA 5CAYB 3KPOA 4PV8B 2EO1A 1QFOA 5L8LB 2ZG3A 2ADGB 3ARGA 5MENE 3VXSA 1EO8L 3L3OA 1U8HB 4JLRA 4Z7VF 2CIKA 5I8KL 1N5YL 2BX5A 2K7PA 3QA3A 3DVIA 1LO2H 1I85A 4I18C 5F8QC 1JP5A 4HK3J 1T2QH 2QLVB 4LLQB 3T4YB 1BFTA 1RZIA 3FB8B 1IE5A 2KBGA 5EO1A 5HVFB 1VFMA 1NL0H 3CC5B 1GL4B 3W82A 1X5KA 2HH0L 2QQQA 2HT4C 3TH3T 2CKBB 4LRNL 2VXUH 3GM0A 1JGUL 4L4VA 1RZFL 4Y0GA 3WIHL 3Q2CA 1CT8A 3RWFB 5EC2A 3OAYK 5ID1A 2GHWB 3O8XC 3QJHA 1CFQB 1GOHA 4IMKC 4NCDA 5C0BB 1HXYA 1IC4L 1B4RA 1HSAA 3OMZA 3GSWA 5ADOH 3L3KA 2HRPH 1U3ZA 2RAMA 4IRSB 3EYUH 2GITA 4OGXH 1MEXL 1A0QL 4WU7B 5A2IH 4BQBA 4LSRH 3TM6A 1HHHA 1LE9B 1BF2A 1AGDA 5K9OA 5AEAA 5C6TH 1RI8A 2DBJA 1AR2A 5JHLL 3I3BA 1MHCA 4ODTH 4YHNA 1L4IA 3UJIH 4H5SA 5J3HD 3QQ3B 1EFQA 1WBXA 2EDFA 4GW5A 5DJXB 4E5XB 3QPXH 4OZHA 3MRPB 2V2WB 1MHPH 5AAWA 1RHFA 1OGTA 4LCUB 1I3RA 1M7IA 3DJ9A 1U92B 3SJVE 3W81A 1YDPA 2QKIB 3Q6FA 2DI7A 4Y5YC 4NIKB 3L9RB 4IOFC 4IJ3C 3JWDH 3MXVH 3WFZA 3FOLB 4G8IB 4ISVB 4RAVB 4LCWA 4PV9B 5F3HA 3TYFB 4Y2DC 3GB7B 2NNAB 4JN2B 2YKLH 4U1GC 5DZLA 1ZHBA 1BGXL 5C92A 1FFOB 2G9HA 4LQFL 1MPAL 1AGBA 2J8UB 1KCSL 2QHRH 2IBZY 1MVUA 5I1JH 1UKQA 1F13A 3N85L 1KB5B 4HXAH 2J8HA 3VXQA 1QO3A 3K8LA 2OTUB 4XP4H 2OTWA 3KPRD 3BH9A 2OSLA 4KK6C 2XFXB 4B7IA 4P2OC 1IFHL 3SEPA 1F00I 1KOAA 2FZ3B 4JRYB 5TE4H 3K4ZA 3LQZA 4YHKL 1J5OH 2M2DA 3MV11 1RY7B 1N4XL 1K9TA 3TBVA 2IPUG 4U6TA 3VXRB 4WGVB 4UT9L 2Y4SA 3ZHKA 1OAKH 2G60H 4POUB 5KS9B 1JZ8A 3NVQA 4BUGA 5DJ6A 1RZ8B 4N8VA 1AFVL 3QDMB 3PWPD 1VKXA 3ARFA 3HUJB 2XPGA 1A1MA 1II4E 1MCNA 2RQ8A 1MHHA 3MLYH 3HZMB 4HWUA 4Z7QE 1D6EA 2R4RH 3B6SA 3O11A 1S9VA 4Z6AT 3JWOC 5E8DH 2XY2A 1HHIA 1NFDF 4JQIH 4K3DH 5KVGL 4PRDA 3WNOA 5IW1A 1KIQB 2YD8A 1CLOH 4Y4HC 5F7MC 5LXGL 4MAYC 4ZSOA 1KJVB 1EEYB 3CCHA 4NP4L 1X4YA 3FT2A 1NQBA 1CBVL 3RUGA 4JVUA 5DK2B 5IVXE 3MV8E 4FP8H 4AMKL 1A1OA 1OP5K 4AM0A 1INDL 4G6AC 2H9GB 4H20L 4P2RD 4NHUA 4QRPB 1ADQL 3L5XL 2Z91A 4F7PB 2Q3ZA 1CVSC 3ZDXF 4LP5A 1NANH 3OZ9H 2BSRB 5T5FH 5KJRL 5C71A 3DMMA 5SWQB 3TF7C 4R4BA 5ISZD 5HGHB 3V5DA 3HC3L 3ARPA 3FQRA 4JN1H 5MENB 1XIWD 3NIDF 1A9BB 5BRZD 6CGTA 4J3XA 4YHPA 1FNSH 4GG8A 4LSUL 5DJ8B 5C07E 1ZLUH 2WW8A 1KJ2B 2ZPKH 1I1AD 3B4NA 4DQOH 4XGZB 2PTTA 1Q9OB 2F74A 1XZ0A 1F4XL 3JVGA 5JZ7D 3WFBH 4L8BB 4ZPVB 6FABL 3G08A 1OAXL 5K9JL 4NPYB 1CDGA 5EBGA 2EE3A 4R6UA 3VFVA 3C6LC 3BGAA 2XKNA 5HD8C 4PJEA 3OKMB 4QRRE 3ARED 4GJTB 2Z93A 4Z7UF 1QACA 3QDGA 1A3RL 1XCTB 2AK4A 5FM4A 1WZ1H 2GJJA 3PNWA 3MMEA 3FO2A 2CO6B 3MLWL 1I3GH 1J1OH 1I1YB 4MD4A 1PBYA 5DUBA 5FYKU 1MCCA 4JPIB 4JQXA 4OQTL 4JFHD 3MGAA 3IDIA 1LGVA 1F4YL 4Y19E 4L8SA 4N5EC 1U8IA 4DZ8B 4TSCL 4RGOH 5M7QA 4NKQB 4P59L 2YEZA 5LCVL 2FLBT 4NNPH 1CFSA 1CFNA 2Z35B 3WUWB 3RHWF 1C7SA 1A6AA 3VXSE 2ZCHL 1ERNA 2OI9C 3QZWB 5SX5H 4HPYH 2APTA 3LS4L 2ATPB 4IHOA 5E2VL 3QIBA 2WANA 4Y5VB 4R2GC 4RCAA 1HHKA 4IIQB 1CK0L 1MF2H 2HFEA 4XWGH 5E8OB 5HVGB 4OZFA 3PWLA 2PTUA 2LAGB 1UXSA 1QFWH 3MA9L 3T0WA 1WWBX 3SJVB 1UKSA 3EYOB 4L4VE 4G6MH 4UQ3A 5HXMA 1ETZB 4LLAA 2QBWA 4HGWA 3D69A 5LJYH 3VE0B 3QI9A 3IDJA 4GQPH 4KRPB 1OPGL 4GLRI 2I5YL 4TULH 5DZNA 4XCNA 1P4BH 5F7EH 1Y18A 1ZT4A 2DWEB 4PGBA 1FBIL 4J6RH 5BXFB 1KJMA 3RWHA 3LS5L 3QNXB 4Y5XB 3OR7A 1YN6B 4YZFE 1NDMA 1Q0XL 2OL3H 3BPLB 2Q87A 3EOTL 4MA8L 3KS0H 4P5TC 2YD5A 4DTGH 3R06B 3OJMB 5GGSY 3OKOA 1MJ7L 1T0MA 3FN3A 2QR0B 4PRPA 5GRVK 2NXZD 5F7LB 5FV1L 2ZP0T 3B43A 3PG2A 4FTVA 4JDZA 2QQLH 5J12C 1GZPA 1IRAY 1KF9B 2BVOA 1F11B 1MIEL 4FNLH 1XF5B 3EOAB 4Z0XA 3X11A 3DETD 4QHUA 1ZLVH 2W65B 3ARSA 3QHTC 4I3SL 4XHJC 4OZHE 2VYRE 4POZD 1S7SB 1EJOH 4XVJH 2R1YA 3VFPA 5ITBH 5F7NC 4BZ1L 2JLLA 4Z77B 3QG7L 2V2XA 2IH1B 2R8SL 5AYQA 2HJLB 4U1LB 1CDJA 2UVEA 2E27H 4DKEL 5DMJB 2I9LA 4YBQC 1ZA3A 4U6XA 4WFGE 4B50A 2VH5H 5EZIL 2IFFL 1NCBL 3KHOA 3DRTB 2XA8H 4LCWE 3P3YA 2NZ9D 4WUUA 3V4PH 4XAKD 4YPGB 3NFPA 4I0KA 4YDKH 4BZYA 4OBSA 2X09A 3VCLA 1DQDL 4LDLB 4I0PA 3R1GH 3ARUA 2R2BA 4AT6A 1OB1B 2UWEB 4GRMA 1P2CB 1HKLL 4YE4L 4X98A 2ICEB 4LOUD 3GSUA 4MJ6A 3MV8B 2XWJA 4IBLT 4MDJA 5FYLE 1I7ZB 4FQIH 4OD3L 3ALPA 3QFJA 1NUDA 3ULSA 4U31A 1LWRA 4JKWA 3MV9A 2IPTH 5JIHA 2Z31A 2FLRT 4HLJA 4LRIC 3MRQA 1YEIL 3F62A 4AJ0A 1A6PA 4PS4L 2IPKA 1P5VA 1ND0B 3O3EA 1S9XB 1OVZA 2G2RB 1VGEL 1ZVYA 3BXNA 5DLML 5CSZA 3O0RL 3ZTNH 5BO1H 1DQQB 5C07B 3U1SL 4OCSH 1XIWC 4H26B 3V7AE 1DQML 1MQKL 3GDBA 4ZUSB 5FGBA 4Z78B 5C6WH 1GXEA 3V0WH 1LO4H 1EMTH 1KBGH 5TE7H 4PD4J 5JZ7C 3BKYH 1J0YA 3RFZC 1OT1A 4ZUWA 1N8ZA 4MJ2A 5IKCB 4NDMA 4HKXA 3JV4B 1K8DB 1OW0A 3DX6B 2JE8A 3MLXL 4PTUA 1R3KB 4QRRB 3O3UN 4ZSOE 3S3SA 1YPZF 1H5BA 2X4NB 4GS7C 3RUGE 1IILE 4KROB 4NCC2 4QRUA 3AREC 4J3OC 4XB7A 5HYJA 4HJ0D 1IM9B 1Z5LB 5GZOD 4ZFGH 3O6FD 5C0CD 3R0MA 5DD1H 4QTIL 5HPMB 4F9LC 3MJ8A 2J4WH 3E0GA 3KPOB 3LKNB 1G6RA 4GO6B 5TQ2L 4FQXA 3RNQA 7FABH 3JWOL 3TO2A 5ALBL 1OL0A 4KHTL 4ONGH 2ZUWA 3VXSB 1VDGA 2D7PA 3E3QE 1IM3A 2CIKB 1QP1A 1QPXA 3LDBB 4I9WE 3QA3B 2OM5A 5I74B 4MAUH 1ZANH 2ICWJ 2Y07H 1MAML 3QO1A 4NZTL 2HWZH 5EO1B 3ARWA 2NPLX 4XVUC 3WKMH 4AEHL 4M48H 4XPBH 5JW5A 1A64A 4NCC1 2PR4L 4L4VB 4PJEE 4XH2B 5GS0H 3QDGE 2AK4E 3K2UH 3BZEA 5EC2B 4BSVA 1HXYB 1IAMA 1HSAB 4X9FA 3UTTD 2AKRA 3DOSA 3L3KB 4QRTA 3EYSL 1V7NL 1FSKC 3LH2L 1FORH 3W39A 2GITB 3V6FA 3WHXA 3FZUD 1T21B 4P46C 3LRSA 1HHHB 4LLYA 1AGDB 5K9OB 4TSBH 4FFVC 1MJ8H 5C0ND 3AY4C 4D2NA 3TYGL 4OF0A 3KPLA 1MHCB 1JZ7A 2AGJL 3U9UA 4H5SB 4KHXH 3F58H 4JY6A 5LGJA 3V6OC 2EIBA 5FYJD 1WBXB 3MUZ1 2OP4H 4RWYL 1VCAA 1RU9H 3BDYH 4GW5B 4DAGL 5I1EH 4QGYA 1OAUL 4QGTA 1OGTB 1I3RB 5JQHC 3OPZH 2CH8A 1C5BH 2D7TL 4ESKA 3EO0A 4M43L 4PJ7A 1IGJA 4POZC 3QBTB 4XBEH 2CR3A 3AU1B 4J3TA 3VXOA 4HQQL 4LIQL 4NSKB 4IRJD 4UILL 1MFCH 4G6JH 2UZIL 4LCWB 4ODHL 5F3HB 1MLBA 3DSFL 3TZVA 3KR3H 5K59E 5BMFL 1DR9A 1TENA 4MD0A 2AJXH 5JHDD 4K8RD 5ALCL 2G9HB 4RAUA 3ROOB 1YJDH 3OX8A 4PJ5A 1AGBB 5CD5D 3BMWA 1MVUB 3HMWH 1N2RB 2DIJA 2E8ZA 4XPAH 2J1KA 4PRPE 4ZFOA 1QO3B 2OTWB 4Y16C 3BH9B 3GKWL 5T5NF 2OSLB 4FTVE 4JPWL 1CF8H 5HHVH 3VGBA 5HHNA 3S36L 1X4ZA 4HS8L 4ELKA 3LQZB 1NBVH 2X9YA 5C9KA 2X7LA 2BZDA 2VLME 4DGYL 5GGVL 4P2QD 3PUCA 5IVNA 3HPJA 3TBVB 1OARH 1JPSL 1YMMD 3PIQA 1JHKL 3D0LA 1HN1A 1CL7I 1TQBC 4UIKL 4EIZC 4U1KA 1KC5H 5DJ6B 1P53A 1PFCA 1EVTC 3CXDL 5FYKH 2DQJL 2W07A 4JB9H 2XPGB 1MHHB 1MJJA 2ZUQB 3NFNB 2HTLC 3B6SB 3FO0H 4WUUE 1S9KC 3O11B 4JFOA 2HFGL 2FJHA 4OLEA 4H1LH 5C08D 1HHIB 3BAEH 3BP4B 4FZ8L 4PRDB 5FA4A 5L6YH 3QXVA 2XYCA 2NYYC 4XMKL 5CGTA 2SEBA 5JUEL 2YRLA 4ZSOB 1MCSA 2WUCL 1EEQA 3FT2B 3RUGB 4AIOA 2NY7L 4U3XA 3IGAA 2YRPA 2A6JA 4EDWH 3HNSH 2R0ZL 1A1OB 3BZDA 4ELMA 3JXAA 4X0KA 3QFJE 4FQ2H 4NHUB 2Z91B 4JFXA 5HJ3A 4HZAA 3MV9E 4BYHA 5EU6A 1E6JH 4UIMB 2YD3A 4X5WA 2NR6D 3DMMB 2Y06H 3X3FL 3I6KA 4AIZA 4R4BB 5DJCA 4GKNA 4LGRB 3V5DB 1ZHNA 2X40A 3FQRB 3VG0H 2FD6H 2H45A 3C2SA 5ABDE 4LLUA 4YHPB 1EEZA 2GTZA 4GG8B 1YYLH 2ZSVA 5EU7C 5T3ZL 3OHXA 3CLFL 4FMFA 4PGDA 2CKNA 2GSIB 1BIHA 1ZGLP 3VXMA 5IB3B 4QY8A 2F74B 1XZ0B 2HYMA 5DJZA 2HFFA 3W0WA 1LDPH 3G08B 4GRLD 3FFCD 3TT3L 5FFLA 5BV7B 1SM3L 4GAGH 2XKNB 4PJEB 4JO3L 3IU4H 2Z93B 2EEDA 3QDGB 2AK4B 4WI3A 4CJ1A 1BFOA 5I71C 4ODBD 3PNWB 1AXTH 3MMEB 1X44A 4HC1L 3FO2B 5FA3A 5HYJE 1T1XB 5LGHL 3MNZA 2EXYC 4MD4B 5DUBB 1PZ5A 1SYSA 5INCA 4G9DA 5TDPA 1A7QL 3GK8H 3IDIB 4L8SB 1RMFH 1ZT1A 1U8IB 4M6MH 5GSVA 4NWUH 3BKCH 1JNLL 1QVOA 3ZT6A 5FUZL 3U6RB 2J7LA 5D7SL 4NT6A 1CFSB 1KEML 1CFNB 1A6AB 4G9FD 5D1ZA 4K3EH 1QG3A 3NABL 2ADFH 3QIWD 4TUOA 4IHOB 1F02I 3QIBB 1HHKB 3RVWD 4UV4L 4R90L 1AO7D 4XTRD 4KTEH 2F5BH 1CE1L 4WFHE 3PWLB 2V9TA 1UXSB 4ZMAT 5AD0A 3QQ4A 3HB3C 4N0UB 4UQ3B 4ODXA 3HA0A 4HXBL 3D69B 4NQXA 3IDJB 1TVHA 3M8OL 3PABA 1P6AB 3S34L 1U3HA 5KSAA 4XCNB 4JHBA 4O9HL 4HBQA 3K8KA 1YMHA 4MXQD 1ZT4B 1KJMB 3RWHB 3CLEH 4L3AA 4L3CA 3OR7B 3NCFB 2VDOH 3TT1H 1NDMB 1YEHH 3Q0HA 4R26H 2WP3T 5DMKA 4ODUB 3MUY1 4ZXBD 3IU3A 4JQVA 4ZOAA 1MRFH 5BZDA 4LSVH 3UZQA 3A6BL 5B4MD 4HFUL 3OKOB 4B5EA 3DHJA 1T0MB 5CD3A 5IVXF 5C0EA 3TO4D 4AYFA 4OF5A 3WFCL 5FYJU 3VXTA 1O7SA 1RD6A 4J4PD 4FTVB 1GZPB 1YEKL 4Z0XB 3WL9A 2Z8WC 2DDQH 2UVFA 4QHUB 5IWLC 1WZMA 4JM2B 3L7EA 5KVEH 2DL9A 2IMNA 3IRPX 3TIEB 1FQ9C 3MLRL 3DI2B 4HIEB 2R1YB 2R0LH 2X1PA 4PJ7E 2FGWL 1YNKL 3MRNA 4JVWA 5I0DA 5ILTH 3LPGA 4DUVA 3DTXB 4GQ9L 4Y4KD 3D48R 3B2VL 3DO7B 3KDMB 3MRBA 2E7MA 5MHSD 1P7QD 2I9LB 2VXVH 4I1NB 1TQCC 2WLYA 1E0OB 4U6XB 3BRDA 1UWEH 3UTPE 2X70B 5E00A 4WUUB 2FX8L 4HGMA 1R3IL 3TEUA 1IBGL 4NKMA 3RX8A 1MOEA 4PJXF 5EUKA 1GPOL 1FN4B 1IC7L 3VCLB 3PDOA 5J6HB 4I0PB 2VLJD 2R2BB 4PJ5E 2R2HA 5SWZA 4AT6B 1O7VA 5I1HH 4GRMB 3L3IA 5GJTH 1UM4H 4MJ4A 4X98B 2R4SH 3O3AA 3GSUB 3IFLH 4MJ6B 1OAQH 2N7BA 1NKRA 1X5XA 4A2LA 4PBVC 4MDJB 4KV5E 4OI7A 4K94H 3QFJB 3NCJL 2FX9H 2Y36L 4UV7H 3L6FA 4LSTL 3MV9B 4QNPE 2Z31B 1PYWA 3U4AA 1JPFA 4KDWA 4I48A 5FV2A 3D1MC 3GI9H 1TVBA 3SOBL 1UJ3A 5L8JB 2DQTL 5CSZB 2DM7A 4HJJL 2OK0L 4CRPA 4HT1L 4NN5B 3VA2C 4OAWA 5DHVB 1Y6MR 4NQDD 1ZLWH 4TQEH 3MUJA 1NGXA 1JHLH 1EHXA 2Q1EA 2BXZA 3QWRA 5ETUA 5D1QC 4Y2OA 2FHCA 2EDJA 4X9GA 3KYKH 3BPOB 4ZUWB 1DBJL 3KPNA 2BOBA 1N8ZB 4HKXB 5I1KH 4NO0D 4TVPE 3GHEH 5F1IA 3HCVA 3SDCB 2AK1H 5IFHL 1D6VH 4HUUB 5FM5O 1H5BB 4EJ1C 5AZEH 5FECA 2JB6A 1EXUA 1S78C 4KMLB 4QRUB 3PWUA 3UPAA 1SEBA 2PN5A 5DSCA 4OV5B 2LVEA 4ELME 4DW2L 4YZFF 4S1QH 4NZDA 2D9CA 1YY9C 4PG9A 5DGRA 4O58H 4OFYA 5EU6E 5BVPH 3BDBA 1G6RB 1SY6L 3VG9C 2PETA 3GSXA 4FQXB 5GPRA 3RNQB 3F65A 4K71B 4RGNC 3TO2B 4MQSB 3RTQA 3GBLA 2XI9A 4KI5E 5F1SA 1OM3L 3HLAB 3KJ4C 1IM3B 5MI0C 4U7KA 1ADQA 4F7EA 1NAMH 3VD3A 3TNNB 3VXME 1Z3GL 1A1NA 3EKCA 4OZHF 4UBDC 3DIFA 4PJFB 4X99A 3QO1B 2AEQH 2GAZB 3W0WE 4YX2H 1HWHB 4WEBH 3RVWC 3QUZD 2FO4A 3DO3A 5JW5B 1T2QL 3IJSA 4W6XB 3NACH 4XTRC 1DANU 4G5ZH 2YR3A 5T1DH 2BJMH 4DFIA 5GIRB 1U8PA 5B22A 1NL0L 3MYJA 1DDHB 5CEZH 4MMZC 2CLRA 1MRCH 3BZEB 4HV8B 4S1RH 4BSVB 2ADIA 2W92A 4KRLB 4GRWF 3QNYB 2VR5A 2I27N 3FQWA 3BKMH 4HKZA 3LD8B 2MTPA 3LRSB 3VGDA 4LLYB 5ADOL 5KAQG 4ALAL 3LB6C 3MZTA 2APVA 4JRXA 3BT2H 4OGXL 1VENA 3CU1A 5B4MC 4LSRL 4TOYH 3I6LD 4J3VA 5EDXA 3U9UB 1DN0A 5DXWA 4OKDA 2DQIH 5C6TL 1I9IL 4OLZL 2FR4A 2VXQH 4OQTA 5LGJB 5DMIL 2QSQA 3DX8A 4QO1A 5C0BD 4F15C 1VFAA 4K23L 1RUQL 3WFDH 5JOFB 5IW6A 4UNTA 5F44A 3F7RA 3KLDA 4IRSD 4D0CA 1TCMA 4HK0A 1CLZH 4PRAB 2XQYG 4CVWA 4Y89A 3QPXL 1UM5H 1IGJB 3GFUA 3PF2A 1XMWA 2IPUK 4F37K 4YDLB 3F7YA 4PBWD 1JHTA 3VXOB 5IHZB 3DV4A 3T2OA 4Y4KC 1L7TH 3I9GH 3OG4B 4OCLC 1MLBB 5SX4I 3FTGA 3TZVB 4MD0B 1FCGA 3UYOD 3LPFA 1ZVHA 3MLTA 1AJ7H 1EVUA 4MS8D 4RAUB 4JDTL 2H6PB 2ED9A 3NTCH 3RUGF 5KVMC 5BS0B 1CFVH 3RWIB 4G8FA 2L7UA 4F8TA 1K5NB 3TC9A 2E7HA 2ZCKL 5I1JL 1MFEH 5FHAL 1G0YR 1KCUH 5HHNB 4HXAL 1KG0B 4XP4L 4C55A 1JWMA 2P1YA 1DUZA 3L3DA 3L95A 3T09A 4CL7A 4FQQB 4A6YL 1CLCA 1RURH 5TE4L 1J5OL 3PIQB 2FATL 4EBQH 3D0LB 4HIXH 4TVSa 3K1KC 5E8EB 5F8RC 4IRZH 1C1EH 3TGXA 1D5MA 1MCBA 1HYSD 1AGCA 1OAKL 2CDGA 4CU7A 1FZKB 4B7LA 1MJJB 2V5RA 4PREA 4F3FA 2NW3A 3KS0J 4JRYD 4JFOB 1RUAH 4OFKA 4O2CB 3HG1A 5ICXA 4CAGA 1PZUB 2X4TA 1OSZA 1ZHKA 4O2FA 5FA4B 3VXRD 4P4KB 5SWZE 2Q7NA 4GRWH 3FCTA 2ERJC 3MCKA 5E8DL 4JQIL 3MNWA 3PXHA 2ZKHH 4M3KB 4ZUVA 1LEKA 1CLOL 1KYOJ 2A6JB 5D2NC 4ZUUA 3F5WA 3G6JA 3JTTA 3QDMD 5DD3H 4G43A 3L3HA 4X0KB 4X7EC 1GC1H 4YR6A 5ESQB 3TJEL 4JFXB 5HJ3B 5HI5D 4FP8L 1MWAL 3CIQA 4U3HA 3ZMRA 5EU6B 2G5RA 2JB5H 3IDMA 4X5WB 3I6KB 4AIZB 5DJCB 3G9AB 5JXED 5GS0C 3PHQA 1KPUA 1Q38A 1ZHNB 3OZ9L 5T5FL 4X7FC 1IGCL 1OQXA 4LLUB 2F8VA 1EEZB 2GTZB 4Y5YA 3OHXB 4PGDB