1R5VB

Evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
185
structure length
185
Chain Sequence
APWFLEYSKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Evidence that structural rearrangements and/or flexibility during TCR binding can contribute to T cell activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 40
structure length 185
sequence length 185
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r5vB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1r5vB01
3QDGE 3IETB 3T65B 3BDYL 3MLWL 4PJBA 4P46C 3QAZC 4PGEA 2Z4QA 5E4EB 2V7NB 1DJSA 2GAZA 3T0EE 5F1KC 2WUCL 3D18A 4ZS7H 5ABDE 3MA7A 4HIEA 3JTSB 4ZTOH 1NGWA 1UA6H 3SKMB 4MNQA 2HT2C 3BP6B 4HBCH 1BQUA 4N0CD 1NL0L 2QEJA 3PUCA 2L7JA 5E4EC 5I2IB 4QRUA 1X5FA 5AYUL 1DN0B 5DVKA 4Y5YB 1EJOL 5HHPB 4NIKB 5GGTH 2V17H 2Y6SD 3SDCB 5ISZB 1YMME 1S7WA 2ICWB 3ECBA 4P9HH 3TIEA 1EBPA 1FVCB 3TZVA 4LPUA 3W5MA 1Z9MA 3OKMB 1P69B 3DSNA 4Y5YC 1U8KB 1K8IA 1LO2L 5DC4B 3ULUC 3MV7E 4JRYE 1HHJA 3NIFE 5F9OL 3FCTA 4OGZA 4WWKD 4JPWH 2DQFA 5FKPB 5TF1H 3D85B 4KVNH 3P4NA 4KUZL 1KLGA 2ZG3A 2O5XL 3LB6C 4KFZC 2LQRA 4PG9B 4B53A 1WZKA 3OR7A 5CGYC 3JWDL 2XWTB 1DCLA 3NCYP 3OR6B 4M3JA 5DK3A 2JB6A 1TCRA 2A6DB 4S1DD 1JI1A 3AMKA 3V6OC 3U0TB 1WFUA 1T1XA 1TCMA 2A1WH 1FZMB 1MRCL 3KYNB 4YDJA 1JVKA 1FN4B 3SE4A 2ARJQ 1MCOH 4M8QA 4WFFD 2QTEA 5FYKD 5C08A 3HAEB 4UINH 3ULSA 3ZKSD 1NBZB 4YHYB 2DBLL 5GS0C 3QEQB 2FSEB 4KTDH 4IDLA 5DHYB 5T1MA 5EZOH 5LCVL 4AIXA 5IGXH 2VB5A 5L2KE 3LN9A 4FXGB 4LSRH 4YFLI 5JO5A 5DD1H 2UVFA 4WFED 4M1CC 5E2UH 4MB3A 2OL3A 4N9GA 1ZLWK 1T7YA 3S35L 1Q9LB 5DGQA 3KPRD 1E4WL 3RDTC 1L0XA 4K8RL 4M9PA 4WRLA 1A6WH 5I8CA 4OZGF 5IVZA 2ENSA 3A6CH 3CFKB 4NJAL 1ACYL 4NGHL 1S7QA 3CFBB 2P8LA 1PZ5B 1NQBA 1T1WA 4P2RE 2VDML 3EFFA 3L3JA 3MUZ1 1SMAA 5C0BB 1HCFX 3O2VL 3ZE2E 1JGLL 5I1JH 4H0GA 1MPAL 2W0PA 4LSDA 2VAAB 2YPKA 2VLJD 1VB9A 4F58L 2W1NA 3FTGB 4HWUA 4XPHH 1W72L 2EKJA 1GOHA 3SKJL 5TH2A 5M94B 2X4PB 1MCWW 1VFBA 4OJFH 3MLTB 4YEEA 4ZFFA 2YZ8A 1UCBL 4EI6A 4EVNA 2CH8A 3LN4B 4LDOB 2DIAA 3QUYC 3WLBB 3CK0H 5HVHB 4FQXD 4YO0B 3ARTA 3EDKA 3JZ7A 4R96B 3IB4A 5AAWA 3U9UA 1S7XB 4PJ8D 3FB7B 1FSKC 5F89B 3W0WB 1INQB 3SDDB 2CLVB 2X9WA 1S3KH 3CSYA 2Y9RT 1ZHKA 4YBQD 5HHOD 2Q8AH 5FB8A 1RIHH 4HFWB 4D94A 1OGAA 1FNSL 1WISA 1LGVA 3GJEB 4HWEL 1EMTL 2ERJB 3C5ZA 4U0RC 3QI9A 5SX4I 4NBXB 3SDDC 3NTCH 1TTGA 5KSVA 1N2RB 4M48L 1IC4H 5F70A 2FJGA 1A1OB 2J8UE 4HT1H 4JQXC 1RJLA 1IQDB 2A6KA 2EDNA 4MA8L 4RGNE 3CLFH 3G6DH 2QQQA 4JO3H 3UC0L 1OGTA 3GSRA 1KIRB 4UNVA 3VFMB 3MLPA 3VFGL 3HC4H 4LKCA 3BJLA 3HMWH 5D5MB 3TBTA 4OZFA 4QHLA 4FQLL 2G75B 5F7LB 3RL1A 1ETZA 1YEFH 4N5UA 3LKNB 4OGYL 5F7NC 2NY7H 4OZIF 2YA2A 4GLRI 2YRZA 9CGTA 5BQ7B 5L9DH 4JZNB 2ICWJ 4UUJA 3KLHC 3CVIH 3I50H 3S8WA 4F7CA 4PYGA 1JNHB 1TVHB 1QO3A 3Q5YA 1DTUA 3ZMRA 2XICA 5DD3L 1KN4L 3BFOA 3STLA 1A6TA 1NAMH 2VZSA 1OT2A 1QEWA 3U4EB 1I8LA 2FEEL 5KSBF 2DTSA 2P5WB 2YXMA 4FQJL 3T1FA 3LN5A 3UYRL 1GC1H 3DECA 4IIQB 4XH2B 3HE7D 4QRRD 1UM5H 1EAJA 4L8SA 3O0RL 1LO3H 1EHAA 5CJOL 5CSGA 1NGPH 3OJMB 2YK1L 4KHXL 3VG0H 3RZCA 1BQHB 3T0WA 3Q6GL 2J5LB 1JNLL 4IIQC 4GXVH 4EKXA 5DA4A 1N4XH 4PLKD 4MDJB 4HD9A 5GGRA 2J88H 5BO1H 1Q0YH 2AXJA 2CKBB 1D3CA 1ZGLM 2EKSA 4QHMA 3SQOL 5TE7L 5F1OB 2FO1A 1PDKA 2J5LC 3L1OL 1HWGB 3QPQD 3UTSE 1J0YA 1RZ8A 1UB5B 1OTUD 2Y4SA 5KSBB 4DQOH 1WTGT 2P5ED 4J3OC 2XNAB 2XKUA 3D1MC 4TNWK 1CLOH 5CGMA 2F5BH 4FQ1H 4ZUWB 1F6LL 2G2RB 1MCKA 3MOQA 2YC1B 2FECI 3X13A 2CQVA 2VITB 3ZHLA 1TQCC 4MX7A 3RVVD 4OD3L 4JM4L 5L88H 4C56D 3EJZD 4XAKD 2AQ3A 3WIHH 1RZJH 3CFCL 3OL2A 4N0CC 4HGKC 1TVBA 1FDLH 3C6SB 3V8OA 3DVIA 5GGTA 1G9MC 4ONOA 3ARFD 4OLEA 3P4LA 3J7HA 1PSKL 2Y6SC 2VSDA 5TDPA 4OGXL 4WWKB 5E4IA 4Z77A 1U36A 3U0PB 2VLRE 1XGRB 3B9KD 2FWOB 3REWB 2WW8A 3CD4A 3BP7A 1LO5A 2ORBL 4BJLA 1NBVH 4F15B 2FD6L 4JO2H 4WWKC 4UMGA 4ZS7L 1NJ9B 5A2JH 4FQQA 4U2YA 4ZTOL 4R4BA 3NCYS 3MODL 1JYVA 4XAWH 1UCTA 1UENA 2GTZB 3NN8B 4M6NH 4P5MA 5DEFA 1T20A 3G6AB 3QDJA 1RJYA 3E0GA 1V3KA 2EYSA 1J8HE 1NCCH 2EH7H 1OAQL 1MI5A 3S96B 3ZDXF 1LE9B 1PKOA 4ACPA 3NAAH 4Y1AE 4P5TA 4HZLA 1NDGA 2V17L 3RKPA 5DZLA 3QIWA 1R3JB 4NQVA 5C6WH 4P2QA 1F8TL 4AIZB 3T3ME 2BNRD 4H0HB 1FFNB 3ETBF 4I4WB 1TETL 4NC1C 1JZ7A 1E0OB 2K7QA 4LAQL 4TN9A 5EBLA 4BUHA 3AC0A 2PXYB 3AUVA 1AXSA 1S9XB 4IMLB 4I2XB 2JE8A 3KPRB 3RWDB 1MCCA 4PJCF 3QNXA 3WSQL 3RWGB 3V5HB 3K81A 4G8FB 1H5BA 1QHOA 3ZZ1A 5L7XH 2KQMA 2PXYC 1IGTB 1A14H 4OZHE 5F7DA 3TVMD 5E8PB 5FO7A 5C0CA 3QQNA 1BZQK 1RJCA 3RWIB 4UINL 2YUZA 1A9EA 5DYOA 4LHQB 4MCZA 5E9DA 5D1ZA 1UKQA 4KTDL 3REVA 2VLJB 3B2VL 5DFVD 3GMQB 2ENYA 5IGXL 1XGYH 1E4KC 4GS7B 2PYFB 4YE4H 4PJAF 2BY2A 3EOAB 3BOVA 1FCGA 4NT6B 1JWSA 1HOCA 2JKXA 2J2ZA 5DD1L 1WIPA 1P1ZA 4LNVA 1T89A 3CH1B 3VXOB 1R3KA 3CVHB 5I9QB 2OSLA 4OIIH 5E2UL 3BZEA 4ZNEA 2V5TA 3L3KB 3I2CH 3GUTA 3GRWL 3ZLQC 4GS7C 4PJCB 3W5NA 2F54A 5I1KH 1A7NL 1U3HD 3WMSA 1XF2A 4FQXB 4DW2L 1PEWA 5I9QC 3RHWF 3AMLA 5HGAB 3A6CL 2KQNA 4OCNC 1CG9B 4WJ5B 1UC6A 3F7YB 1OCWL 4PJ8B 3WS6A 5HDBE 4JDVA 1MJJA 4G80B 3FHQA 5HHOB 5E5UB 1TFHA 5HYQB 4PRAB 2Z35A 3DARA 1AD0B 4PJAB 5I1JL 1QR1A 2F8XC 3UO1L 3QJHA 4GJTB 1IGJB 1S7SA 3TNMA 1KCSH 2CMRH 4IRJD 4XPHL 4Y0GA 4YBQC 3ARED 3S7GA 1JGVL 2OQJA 1AGEB 5LGHH 1VA9A 4OJFL 5JDSA 4DTGL 3VJ6B 4AEIH 5E0QA 3RQ3A 4D8PA 3KXFE 3PWVA 1I7RB 4MNQB 3FB8B 1HINH 5JA9A 1QNZH 5GSVA 1AGDA 1PY9A 2IF7A 2LE9A 5GRYA 3T3PF 4WI8A 3BKML 1FGNH 1YN7A 3MNZB 1WAAF 4J7RA 5D2LA 3WJLA 1GGYA 4JKLA 3TO2B 4C59B 3WKNA 1N5YL 1U8QB 1F4XH 4KI1A 3ZL4H 5D1XD 3O3EB 1GRWA 3QDMA 1S3KL 5FYLE 2XACC 1CR9H 2E27H 5JR1L 5BZWA 3AS1A 2OCFD 1U8NA 1PVHA 3BP5B 3TN0A 3VFSB 3L95A 2AK4D 1MHHA 3SBWC 1N7ML 1PGRB 1WJ3A 4NOBA 4UDUA 5TDOA 3TZVC 4X4XB 1FVEB 4G42A 3NTCL 5EIVA 1LEIB 2EEAA 5H35A 5DJ2A 2EXWD 1KLGB 4I0CC 4ALAH 1H15A 1IC4L 4I8DA 5HTSA 5A40E 4MLSA 4PJ7F 1XH3A 3FO0H 3HE7B 1NAMA 1CFTA 1SBBA 3CLFL 1KEMH 3G6DL 1UZ8B 4JO3L 2D0FA 1QLEL 1B0GB 4I0KA 2A73A 2DN7A 2VXUH 4GQ9L 3MCKB 43C9A 4MJ2A 2N1KA 2JLLA 1YEFL 3WHE0 4GKSA 3WV0A 2NY7L 4MD0A 1WCQA 5T1MB 43CAA 2OTWA 3NZHL 4PV9B 4K71B 4PLKC 1BBJB 3CVIL 3I50L 3W9DA 1I9IL 4YWGH 4DN4L 2IANE 5KS9A 2P5EB 5DK0B 1E4XI 2F53E 4JFFA 4G6FD 1DBBH 1CQYA 4QHNA 4K71C 4Z95L 5KSUA 3K2UL 1PX4A 1GC1L 5FA3B 1OTUC 5FECA 3FKUS 4G7YH 5IHUL 4C56B 4ZG1A 5CEZD 1QRKA 3UTQA 1FO0B 5E8OB 1KIPB 3BYYA 4DZ8B 3EBAA 1N4XL 2HVJB 3NMEA 1H3PL 2J88L 3L3JB 5BO1L 4IOSD 3N9GH 4MHHI 4PRDA 3EJZC 1A6AA 5IKCB 3ARFB 2AV7A 3WIHA 3IU4H 2X4OB 4DGYL 1UH3A 4HHAB 1TZIA 2IPUG 3SOBL 4YHNB 3C5SB 1QD0A 5E8NA 3B9KB 2ZUYA 4JFEE 3C2AH 4NNPH 1UVQA 1HE7A 2FH6A 1T21A 2F5BL 4Q6YA 3TPUA 5DDHA 4PY7A 3EAKA 5I17B 3UJTH 4Y5VA 4XCEB 5EUOF 3B9KC 1V7NH 2ZSWB 4ODHL 2UWEE 1NDMB 2P4AB 1RI8A 5L88L 4ETQA 5GS1B 4ZODA 2C4FT 4EBQH 5L2JB 5DS8A 4JLRA 3RBGA 4NQCD 1BEYL 3WIHL 4Q2ZB 1RIVH 4WHTB 5J12B 5JIPA 1JZ6A 2BVTA 4MWFA 2BNRB 1LVEA 5FO9B 5I73B 5CP3H 3KPLA 3TWCL 1CICD 2FJHA 4GG8B 3P73A 1T7XA 1INDL 4LKXA 1A9BB 3DOSA 1CVSC 4QHKJ 5J12C 2IJ0C 5E08H 1YQVH 3AXLA 1M7IA 5EUOB 2C3VA 3C5ZC 3QI9C 4PRPD 4JO2L 3DXAA 3QUMB 4KV5F 3FFCE 4IJ3B 4DOHE 1KCUL 3UYPA 2YN5A 5C1MB 1QG3A 4LIQL 1ZHNB 2KPNA 3HZKA 1MHEA 4M6NL 3GGWB 1U8HB 3TVMB 2IMMA 1F6FB 2UUDH 3EYSH 2EH7L 3FQTB 3NAAL 1SYVB 1KB9K 2Q7NA 3CFEA 1CGVA 4IJ3C 4WDIB 4B7LA 2EE6A 3QNZA 4QHUB 3EGSB 3I75A 4Y19E 5FHAH 4PJDE 5EOCJ 2HN7B 2HG5A 4ODBD 1GOFA 3K0WA 3VXTB 5F3BB 2APXA 5ETUA 1A5FL 3UTTE 5B38G 2CLRB 3QO0A 4RQQA 4XXDA 4UTAH 3TESA 3IFOB 3NA4A 1U3HB 1JNJA 1KXTB 1T7ZA 1K3IA 3WIFB 3EO0B 4XCFH 1ROWA 1XGUB 2V9TA 4H0IA 3TJEH 1A14L 4ZFOB 4OCYH 1B2WH 1AP2B 4GUPA 4BSVB 3B9AA 4JDZA 4NQUA 4LNRA 1LD9A 1ZWIA 2YD1A 4OFVA 4CJ0A 2D03H 3ESVF 1O5DT 5MP6H 4YHZH 4JFXB 4X6CA 1MCBA 4IRJB 1EGJH 3AREB 1XGYL 3VXPA 4LASH 4EZMA 4UV7H 1IGYA 4YE4L 5HHNB 4JDTH 4G6MH 5DRNA 2PO6D 3W2DH 1F45A 5FM4A 3GSXB 4FXLA 1EIBA 4OIIL 3RP1A 4IRJC 2G9HA 3I2CL 3AREC 3X13B 5DJZB 4J3TA 2HLAB 4YUEH 1IM3A 1YEEH 4XCNA 4MD5A 4GRLA 4JKMA 1KACB 2ZUXA 3GJFH 3P9LB 2KZWA 1OL0A 3PDOA 4HF5H 5AAMA 1RVFL 2FGZA 5A3IC 2WP3O 3O3AB 4WHYG 3HG1D 3BWUC 4NUGL 4W4OA 3QG6B 4POUB 2I07B 3I3BA 4S1SL 1FC1A 3VGBA 2EDJA 2YD7A 3GBNH 4KQ3L 3BN3B 5K9QG 3RVXD 5D1XB 2O26U 5GGSY 4TULH 3U7YH 3S98A 1VERA 3PXHA 2ZUSA 2X9XA 2AK4B 5F96L 1OHQA 2VR4A 2YPVH 5EWIH 2IQ9H 2R29L 2PCPB 3G5YB 4OLZH 3KWWA 2WUBH 5GZNC 3O2DH 2CMRL 1KJVA 1P7HL 5EC1B 3OXSB 4G8GA 5E5MB 1DEDA 3V6FB 4QRPE 5LGHL 1NKRA 4J1UA 5MEQB 1KPRA 3F62A 4AEIL 2HFEB 1VPOH 2PNDA 3MACL 4M1DH 2QKIA 3HC0A 4NCC2 1QNZL 2XG5A 4M4PA 4QTIL 1FGNL 3KPOA 5F6IB 3CAFA 1A7QH 2EYSB 1K8DA 3M17B 3QIWB 4LEXH 1C5DB 1F4XL 1MHPL 5IEKB 5HPMA 1MAKA 3ZL4L 4BK5A 5F6IC 3DRTB 3L5WB 3FB6B 3QWRD 4Y16D 4Z7UF 1GGUA 5JIIA 3X3GH 1QLFA 4BQ6A 3R06A 1FFOB 4PJBE 1IILE 4HX1B 1NC2A 3QIWC 4G6FB 4C4KO 3I9GH 4XC1L 3VFOB 3QZWG 2UYLA 2Z91B 5KOVC 1O7SA 3H3BC 4R6UA 1HXMA 2W65A 3BH9B 4ALAL 2IQAA 3P11H 4AJ0A 3PABA 5I1CH 5M95B 1S8DB 2R0KL 4JHBA 4LF3B 3FO0L 4PRID 3S6CA 1KEML 1NFDA 1M7XA 3TNNB 2Q3ZA 4M7JH 3ROOB 2VXUL 4UAOB 3NCJL 1OWWA 3RPIB 3OG6B 1H5BC 1JTPA 4Z7UB 3C5JB 1OF2B 1R3LB 1MIMH 4PG2A 2HJKA 1MVUA 4UAOC 4OCXH 2GFBB 1EVUA 4RX4D 3L5JA 2AJSH 5C9JA 2DJ4A 4ZS6D 2H1PH 1YECL 1YYLL 3GJFK 4MAYA 4PY8J 5DJ0A 5C8JA 3CGTA 4RBPH 5L6YH 1IAII 3DO3A 3ESUF 1AR1D 1G7JA 1Z5LB 4J8RB 1CE6B 3KPSD 3UTZA 2X4SB 4I18B 2YXFA 5JZ7D 4XCCH 5K9OB 4ZSOA 5SWQB 1T89C 3IXTA 1HYSC 1E4JA 5CLTA 2B1HH 5IR1B 4NQCB 4NYLB 1DLFH 5C08E 5TPWH 4JQIH 5D6DA 4OUUB 1KPVA 1XF5A 3DROB 4I18C 5D96B 4GXUN 4AG4H 1JP5A 1CICB 1I7TA 3VG9B 3MRKB 4OIAA 3IU4L 2X4QB 5JXEA 3IDJA 2YRPA 2F5AH 4YBLB 3RIFK 4I5BB 1RQ5A 1G9EA 4S2SB 5IFHH 3MLVL 5CP3A 1JZ4A 5D96C 5FHBH 1R3IL 4TNVK 1CICC 5EU3B 3E6HA 4NNPL 1J9CT 1I1FB 1YQ2A 4PRPB 4YBLC 1BZ7A 3UAJD 4CJ1A 3QO1A 32C2A 2SEBB 4O02H 1DQMH 1JZ2A 5C09A 4NWUH 3HNTL 3GMLA 5BVJA 1I4FB 2ADFL 1TPXB 4IS6A 4UIMB 2DQUH 1U92A 2CDGA 2J12B 1HHGB 1DUZB 2BOCB 5B38B 3HB3C 3S4SG 2MWCA 4NRZB 2ZCHL 2DLGA 3FB5B 3IFNH 4XVUD 4LLVB 2AEQH 3UXFA 3VXRD 1TPXC 5IROC 3DUSB 3WNKA 1DQQA 2JJSC 1S9VB 1D5IH 5E1HB 3D39A 1T4KB 3KYOB 1K2DA 3I6LE 2HTLD 4G9DA 3D5OF 3VGDA 3EYFA 4H26B 1YNKH 4ODSH 1N6VA 2HT4D 5IBLC 3L9RA 2W38A 5ID1A 1I9RL 1FPTL 5HYEA 1RZIB 3EYSL 3VFPB 4O2CB 2R1XA 4X99B 3H0TB 4MDIB 1OAUH 1NEZG 4RIRB 1FZKA 4F2MA 2X4TA 2XWBA 1OGAE 1OARL 4OD1H 4YC2B 5GRZA 3KR3L 5I66A 3O3DA 5E94B 1K4CA 2R0LH 4HKJB 5C6PB 3NABH 3QXTA 2FZ3A 5IBUG 2PO6B 1MFBH 4JQVA 1IGMH 1ZTXL 5DLMH 3HRZB 3W39B 1G7QB 1BOGB 2PR4L 1EGJA 4KK9C 4YC2C 4OZ4A 4Z7WB 3BZFA 4NCDA 3QXUA 3EYOB 4WV1A 2WIIB 5EULV 3WUZA 5CHNA 1TTFA 5B3NA 2PO6C 5E99H 5MERA 2XKNB 4WFGE 3WFEH 4X8JB 2G5RA 3HG1B 4XCFL 3TJEL 5J6GB 2VDNH 1JE6A 1U91A 1NAKH 1B2WL 2IGFL 4Y4FD 4MMZC 4Z9KB 4ZYKB 4XHQA 4W70A 5FO8A 3KPTA 3S37L 5BCAA 2A9NH 2X44D 5L8KB 3NCCB 4MXWH 5BV7L 1WIOA 4S1RH 1VEOA 4PS4H 2DQTH 5D1QD 5DK2B 3RVXC 3SDXF 4S10A 2DIJA 1EGJL 4IHOA 5C0IA 4JG0L 4LASL 2VLKD 4HJ0D 4M6OH 1QFPA 1BM3H 1WBXA 1RZJC 4G6ML 4LMQE 4XMLH 2ZCLH 3H3PH 5ACZB 3EIFA 3O2DA 3V5KA 3CX5J 2W60A 2V9RA 4XZUA 4Y4KA 3Q0HA 2VIRB 3RY5A 4YUEL 1CFVH 2BC4A 3MRLA 4W68A 4HF5L 3BEVB 4K2UH 4N5ED 1RHHB 1TJGL 5E2WH 5IFJB 1I7UB 4M4RA 2NY2D 3QZWB 5HGDB 2WQ8A 4LLMA 3KNBA 1ZSDA 4Y16B 4JR9H 3U7AA 1GCFA 2Z8RA 2O61B 1HIML 1G6RA 3SDXB 4OD2B 2OZ4H 1RUKH 5EWIL 2IQ9L 5LVEA 2WUBL 3NACL 3VI3E 4X6FA 2FB4L 4HPOL 1VESA 3JSSA 3MXWH 3G08B 4QRTA 3RRQA 4PRIB 4LDLB 4LOUD 4OCWL 4YXHH 5I8KL 3IKKA 4UQ2A 4Y4HA 1VPOL 4PGBA 4M1DL 3TFKD 2WLYA 4Q6IB 4ONHA 1MUJB 4P9MH 4OLYL 3EDJA 5IV2A 1A7QL 1ZKAA 3MV01 4LARH 5ICXB 4PFEA 2AABH 1AIFA 2D31A 4GRMA 4UZGA 3LQAH 4HKBA 1BD2A 2EDYA 2WLZA 4NWTH 2BMKA 1D5BA 3CH8A 1J0ZA 3QNZB 4MVBC 4Q6IC 2JCCA 4JREB 4HLZH 2FJFB 5TJWK 3VD9A 1T2QH 5K9JH 2ED8A 2RR3A 3BUYA 3GMPB 4BKLA 3C8DA 3LMJL 2OXGA 4OB5H 3X3GL 3SY0A 2JJWA 1FV1A 3I02A 3VXMA 3SDAA 1UWEH 1CI5A 4JREC 4XXDB 3WXVL 1SJHA 5GGUA 3MRPA 1SEBB 2R8SH 3GZKA 3KPSB 4ZS6C 5FF6B 5I1CL 3V6ZB 4NZDA 3MTRA 1NEUA 3VD4A 3QDJE 1MAJA 4JFYB 4C83A 3MFFB 5ICYA 1MI5E 4PV8A 4PJXB 1AR1C 3RTQA 1XF3B 1WZ1H 2VDKH 5JZ7C 2FR4B 4FZ8L 2V2WA 5C2UB 4KAQH 5LBSH 3IFLL 1T0MB 1DANU 4P2QE 4NNYB 3PGCA 1WK0A 4D9LH 5CZVH 4TUOA 4RDQF 3L3IA 4AYFA 1FFPB 1MIML 4FXKA 2YUVA 2I27N 1OB1A 1ORSB 4OCXL 4ZPVA 2CO7B 3WKMH 2AJSL 4YGVB 1BLNA 4J4PD 5T5FH 5E5RB 4A6YB 2H1PL 3TLRA 1DVFD 3UTPE 1E4XL 3RAJH 2J4WL 2VZOA 4PB9L 3IJHA 1F2QA 3JV4A 5F9WB 5F3HB 4K07A 5L6YL 3MREA 1TNMA 1L6XA 3LQMA 4JO4L 3S4SB 2XN9A 1F11B 3WDHA 3MRBA 1XR8A 4XCCL 3C08H 1J86A 2DOCA 3FOLB 3TYFB 5C0CE 1E28A 1BIHA 1UH4A 4XPAH 3OXRB 1IAOA 5TPWL 3UCRA 2FX7L 2EYRB 2DL2A 3U36A 4GRLC 5TGBA 3AB0B 2NYYD 4RGOH 5E9DE 3D25B 5J6HA 5MHSD 4AG4L 3JWOH 4JRXA 3VXRB 2UVEA 2VC2H 2XY2A 3HI1B 3GIZL 1H3XA 3VFWA 4AL8L 2ZZUT 1XAUA 1MWAL 4QXUH 5EOTA 3C09B 1A1NA 1GGTA 3UMTA 3AB0C 1MJ7H 3BZDA 3P30L 1CD8A 3BEWB 3RIAF 3UBXA 1IVLA 5FHBL 5CBEA 5DJXB 4RWYL 4ZNEE 3D9AH 3LKRB 3BD3A 1DEEA 1EVTC 3B5TA 1BBDH 2F54E 2VMFA 1N5AA 5DI8A 5CWSA 1A21A 1NEZB 3C09C 1V7MH 3TBSA 2DI9A 1HKLL 4QCIA 3S5LA 1ZT1B 2MQ0A 4P57A 1HK6A 1BOYA 2EH8L 4CAGA 4O02L 1ZT4A 4N0FB 3LQZA 1OAZH 4CGTA 5JDJA 3MFGB 2CSPA 2Z0BA 5IBUB 2DQUL 4L3CB 4HQQH 1YYML 1I8KA 4G9FA 3FN0L 1DDHB 1P7QD 1NCBH 4K8RD 1MCFA 1GYAA 5DSCA 4HK0B 1QSED 3DGGB 5J11B 3RNQB 2ICCA 4XBGB 5KG9B 3IFNL 2CGRH 3V4VH 2AEQL 3DRQB 1DBAH 2EC8A 2Y7QA 3GSVB 4MAUH 5GGVH 1GZQB 5D70H 3BXNB 4O5LL 5SWSD 5FUOH 1D5IL 5J11C 4HIIB 2C1PB 1KYOK 1JMZA 2B4CL 3JV6A 5I76A 4ODSL 4PTUA 4U1NA 2HJLB 5D2LE 1X4XA 3GB7B 1YUHB 2ARJB 3QIUD 1E27A 3RVTC 5GISH 1OM3L 3ZTNH 4Y4FB 4KDTC 5IB4A 1IC7L 4YXLH 2B7DT 5I8OH 4QEGA 4J6RH 1T0PB 3QP3A 5JOFB 3L3HB 3UZEA 4PBVC 3QDME 3MX0A 1RURH 3DV6A 1JGDB 1UXSA 5FGBA 4XB8A 4Y4FC 5D1QB 2YPLD 3MUHL 3K7UA 4M03A 2VAJA 4QF1B 1K4DA 3ILQD 4D0BB 2VLKB 3NH7H 4NQXA 2R0LL 3BKYL 4P48A 4QRSB 5D6CA 3ZKQD 4NSKB 5BRZA 1AQDA 4FTVD 3Q1SH 2JK5A 5CJQH 1IGML 1CU4L 2AXHA 4LSPH 4P5KA 2AQ1A 1XGPB 3T8XA 2AS5M 1YY8B 1NCTA 5DMKA 5H2BA 3UTZB 2BHUA 4OKVA 2H26A 1C7SA 1H8SA 1J05A 3FQUB 4OQTH 3K1KC 4MAYC 5E99L 5D7IF 5EU4B 2IMNA 3WFEL 1IE5A 1U3YA 4Q9BA 3HLAA 3MJGX 5CMAB 2NW3B 2QSCL 3G5XB 2NY2B 2WBJA 5IM7B 4CW1A 1KPVB 1NAKL 2ARWA 3QUKB 5KSAA 1CK0L 2K7PA 4AEEA 1I7TB 1WBYB 5E8EB 5BS0A 1KSRA 1U41A 4ZUVB 1W0YT 2OLDA 4MXWL 2NY2C 3M8OH 1U58B 5KS9E 4U6VH 1NCUA 5HGGS 5DJ6A 1YNTB 4JFFE 1OD7A 1RFDH 4K7PX 4RGMB 3V7AE 2APVA 1ZEAL 4M6OL 2ZSVA 1U8PB 5EU6A 2OZ4A 3QNYB 1JPSL 5JXEC 1Q9OA 4QYOB 2A74A 2QADC 4PJGF 1KENL 2C5DC 2ZCLL 3H3PL 3MOBH 4PJ9D 2AGJH 3V6BR 3VI4F 4A2MA 2CK0H 2X05A 1F90H 4JG1H 5D93C 3FO9A 5D7IB 5T3XH 4RGMC 2X70A 3H6JA 1MFEH 3DX7A 1CFVL 1B88A 1CLCA 1ZE3C 4LOUC 4ZMAT 4K2UL 3E3QE 2X7LB 4QXTB 5E2WL 4GG6B 5GS2H 4NO3A 4WU5A 1X5ZA 2PTVA 3CSPA 1IEBB 2LAGB 4ISVB 2VDPH 3QCUH 3MRMA 3KJ4C 1QBLL 4RMVA 4YLQT 1FBIH 3OMZA 2DQDL 2OZ4L 5J7CC 4H1LG 3RHWK 1MCEA 1YZZA 5ALCH 3MRFB 3BGMA 3FQNA 3G6JF 5CIPA 5IW3A 4PJGB 1MCHA 5FGRA 1AGBA 3MXWL 3MLRH 1HHKA 4YXHL 3K2MC 1HEZB 4V2CB 1SYSB 1RULH 4ZQKB 2CLZA 1BFTA 3PWJA 4P9ML 2VUYA 1QYGH 5JORA 2G5BA 3I6KB 1ND0A 4UDTA 4LARL 2JJTA 3VXUA 1MREL 1JPFB 4LLWA 3LQAL 1SJXA 3U46B 1B4RA 3QHTC 4NM4H 4DKEH 4KRLB 4PJ5A 4LSUH 3P0YL 3B3IB 5CEYA 5EIIA 1UWXH 3G6JB 1DVFB 1UWEL 1FZJA 4GO6B 3C6LA 3F8UB 4UB0H 3VFRA 7FABL 1X44A 3GIVA 3IFPA 5DFTA 5TF0A 1JF5A 4RFEB 1GGCL 3DXAE 4ZPTA 5SX5K 4NUJA 4J4PC 2QV2A 1JBJA 1DVFC 1WCBA 3EOBA 5F6HJ 3DETC 1OSZA 1OSPL 5TFSH 1KJ3H 3TIDA 3QQ3B 2GCYB 5F7KC 4Q9CA 5DUBA 3BO8A 1KPUA 1MCJA 1JZ3A 3VRLE 4KAQL 2P48B 4D9LL 2X89A 3CC5A 4NZUH 4AK1A 2P44B 5AZ2L 1NANH 5IIEB 4OTXH 3EYVA 2H9GA 4LRIA 3WKML 4ZO7A 2X6MA 3RAJL 3T0AA 1JNNL 4HULB 5KTEH 2OP4L 1NGZA 1ZHLB 2W07A 4XBPB 2WWKO 4X6EB 5FOBA 4DAGH 3PNWA 4XGZA 5C07D 4M9OA 1T6VN 1WF5A 5HHVH 3BWAB 4XMPH 1P7QB 2D7QA 3T4YB 3ARYA 1YC7A 3B6SB 1BQLH 1GZPA 4U1SA 1UM4H 1S9WA 4O2EB 2X4RB 4RAVA 1QSEB 4YPGB 4F57L 4RGOL 1G7IA 1FZOA 5I16A 1G6RB 1SY6L 2NPLX 4L4TD 4X6CE 1NFIB 1MNUL 1B0RB 4Z7OE 2VC2L 5SV3A 2LU3A 4JZJA 5J06A 4QXUL 1J0IA 4HMCA 5SWSB 4S0TD 5TDNA 3KPMA 1MJ7L 3B9EA 1N8ZA 4BSWA 3RGVD 4L29A 2I9TB 1H8OA 5C2BL 3D9AL 4X5WB 1F6AA 3U79A 2DM2A 2X10A 3MYJB 2NW2A 1W72B 1BBDL 2WM0A 3U6RB 4PGBB 5DR5H 5D9SA 2YHGA 2R0WL 4WEMB 3QIUB 3ARBA 3KG5A 4R0LB 3WHE1 3L5XH 4F9PC 1OAZL 1AC6A 4CU6A 4Y4HC 1FYTA 2ZOKA 2I5YL 1WTLA 2VYRE 3MROA 4NO0D 1RUMH 1NCBL 4IOIB 2NMSA 4R0LC 4V2BA 1CD1A 2YPLB 3EYUL 1KTLA 5JXAL 4OLUH 4RNRA 1H9VA 4YHMH 3DVGA 2CGRL 3OJ2C 1D5XB 3V4VL 2JJVA 1DBAL 3HE6D 3N85H 4OFPA 5E56A 2Q6WB 4BH7A 4FTVB 4G8GE 1T03H 5D70L 3PP3H 2XZCH 1JFQH 5FUOL 5I19H 1DANT 3ILQC 4LLYB 3LHPH 3SDAC 3ORJA 2V2XA 1T5WB 4JN1H 4U1JA 5GPRA 5IQ9A 4HIJA 2C26A 4DGIL 5DGRA 4LHJB 4GT7A 5JLZB 3D2UA 1BX2B 1Q72H 1H0DA 5JPNB 3VDBA 3D0LB 4OQTA 3E8UH 5I8OL 5AUMA 1XZ0B 2QSTA 2XTLA 2Z9TA 4XTRD 3ULVC 3GSOB 5IB1A 3D3VD 2KKQA 1MFNA 5CFHA 4FG6D 1TJIH 4C54A 4FXKB 1P53A 3HUJA 1YN6B 4S0SD 4F7TB 5I1GH 2RFXA 2H32B 2ICES 2MHAA 2A6JB 2BNQD 1J0HA 2XOTA 3LCYA 1ORQB 1OAKL 2NY0C 5LWYH 3Q1SL 5BW7A 5T1DH 2DDQL 2FATH 3MRHA 4PJ9B 2FBJL 1PZUB 1IL1A 1QKZH 3QIBA 2W9LA 4K9EH 4QWWD 2IPKB 1UEYA 4ODVH 1NFDE 4EDWL 2X4UB 2Q7YB 4GAYB 4OQTL 4AEHH 3JTTA 1CXKA 4PR5A 4EN3D 4U6TA 1R5VB 2BSSB 2H8PB 4PJ9C 3QUXA 1IKFH 4ZTPH 1FHGA 4H1LB 1AHWA 2A38A 1RUAH 3VWJD 1IC1A 4X80L 1CXFA 2ITDA 2Q86A 3DO7A 3KLAB 3CXHK 4O00A 4CMMA 1FE8H 1QSFA 1P2CA 1UKSA 4U31A 5ESAA 4FFZL 4C55A 3WD5H 1ZT7A 4XVJL 4MQ7A 1N6QH 2UY7A 4YQXH 5CBEB 3MCLH 1R6VA 3MO1A 5SWZD 3BIBX 3MR9A 1N5AB 3JV5A 5INCA 3MRIB 3MOBL 3ARDD 4XPFL 2AGJL 4G43A 3VXSD 4MJIA 3VI3F 3FQWA 2CK0L 4ZSOE 2GTWA 4JG1L 25C8H 4ODWB 3PIQB 4X98B 2NY5C 4Z78B 1K5NA 4IRSA 2GEEA 1A2YA 4PREB 4UQ3A 3HZMB 3KPNA 2YEZB 5JUEH 1BPVA 2QLVB 3BAEH 4KQ4H 4G9FB 5JHLL 1U8IB 1KB5H 2E7CA 1IM9D 4XWGH 3IVKB 1BF8A 4OSUL 3H9HB 1NSNH 2XPGB 3LRSB 1IGCH 3IS0X 4DGVH 4Z5RA 5I1LA 2VDPL 4H25A 3QCTH 1E6JL 3DJ9A 5FIEA 3ROLB 3QUZD 3NFNA 5T1KA 1FBIL 4HWZA 5JW5A 5IB3A 4JZOB 2VLME 3CPLB 5ALCL 5J56B 1UYWH 4N9OB 2VDLH 2XZQH 5IVXA 3BVNB 4RZCB 3AS0A 3MLRL 3F6IA 4WTZG 4XB7A 2NY1D 4OCMC 5C09E 4XP6H 3HC3L 5I1AA 1RULL 2CRYA 1FVDA 1QPXA 5F7EL 3O6KH 5FYJU 1ZA6A 5ANMA 2P42B 3KGRA 4RAUA 5IF0B 3ALPA 4YHKH 1ZHBB 2IFFH 3OGOE 1WWCA 2EDHA 5IUSA 1JPGA 3IT8D 3VE0B 4UBDD 2OJEA 4YIQB 5MENA 4WUUA 4WTWA 1MLCB 1YNLH 5F9AC 5IW1A 1K85A 4NM4L 5KVDL 3QHZH 4DWHA 4H20H 1YDPB 4DVRL 1J5OL 3D39E 4HDIA 4GSDH 1JHTB 2E7BA 3VDAA 4Z7NE 1A3RH 3IJYB 4TUJB 1KCVH 4UB0L 3LH2H 5HGBA 3HZYB 1URLA 3ZTJH 2FYYA 3CIQA 4U05A 2QHRH 4UOW1 2NZ9D 1EXUA 5C07B 1OP3K 4P23A 4WCYL 1C16A 1NMAH 4MGXA 4RMSA 2QBWA 1JGUH 1CXIA 4G8IA 4E41D 1ODAA 3VGHA 1YEJL 3BDBA 4MXQD 1DE4A 4L4TB 3TCXA 2OTUA 4XCYB 3LKOB 4NJ9L 5F9JA 4RA0C 3FN9A 4N1CA 3W81A 2QQKL 2XQBL 4NN5B 2W9DH 4NZUL 1EK3A 2IH3A 1AJ7H 5KSAC 4XNMA 3DUUB 3EJYC 5HHME 3SHSA 3RGVB 3H7BA 4TQEH 3AU1A 1P4LB 4OTXL 2KH2B 3NPSB 3EFDL 4PJEA 3MA9H 4UU9A 4GKZB 2VABB 3ARSA 4K3HA 4NN5C 3BHBA 4MD4A 1R3HA 1X7QA 3QT2A 4QOKD 5KTEL 1DZBA 1VHPA 2XWJB 4NHUA 4KWUA 4KZEL 3RGVC 1D5MA 4U1HB 5HJ3B 4J3VA 3B4NA 2WQRA 3A67H 3QXAA 2Y72A 4NHCL 2C1OA 4DAGL 3HMXA 1L7IH 3RA7H 5DRWA 3RU8H 1T83A 4O4YH 1C5BH 1T2XA 3MLXL 4KMLB 5HHVL 2OX5A 1C08B 3MPCA 4NO0B 5GRVL 3ULUH 3O11A 1NLDL 1BQLL 4HUNB 3HPLB 5DJAB 3M1BA 5IEHB 3VWKD 3G04B 4OLXH 4MNGA 1CFSA 5CD5C 5L8JB 4LSVH 3X14B 4ODTH 1QLRB 3OKDB 3O2WH 5LGJB 4HS6A 5DJ8B 2Z8WC 5F21B 3UJJL 1JYWA 1NGYA 3QFJA 4LPWA 1MVFA 3BX7C 4XVTH 4BK4A 4JN2A 1FAIH 2GJ6A 1KXVC 5JHDA 2ZOLA 4EQ2A 3PWJB 5GS0H 2PYED 3TH2T 5JORB 2EIBA 3L5XL 1RJZB 3DX9A 4KGJA 3DVNB 4D9QD 3D3VB 8FABA 15C8L 3NBNA 2W91A 3OB8A 2XZZA 3HAEH 1UACH 4LLQA 3VCLB 1C12B 1W0WB 3DV4B 2IFGA 4WW1A 1I3VA 1SQ2N 2BNQB 2VDOH 1EUTA 2CK2A 5K93A 4PJIA 4XTRC 5HGHA 4E9LA 5A2FA 1TXKA 5E6ZA 3OAUL 4JO1H 4FG6C 3AFLA 2OYPA 3VFUA 2XZCL 3IFPB 3R1GH 4WW2B 1JI2A 1EEZB 5I19L 4MNHA 1M71A 4NBZB 1FLRH 4DZBA 2D2OA 4LSSH 3PP4H 3F7PC 1GXEA 2F19L 4ZFZB 4JKWA 3G5ZA 3QH3B 3C6LC 4L8BA 4EN3B 4NKMA 2O5YH 1OSZB 1EPFA 1FG9C 4G5ZH 5CJ5A 4WW2C 1QRND 3TIDB 4RWHA 1MELA 4QWWC 4R7NB 5FYKU 3HTLX 4HGWB 1HNGA 3EYQD 2E7LC 4CVZB 3VWJB 1NUDA 1BD2E 3AAZB 1PFCA 3E8UL 5HYIA 2IADB 3HNSH 1NLBH 5E8DH 2JCCE 4ZUUB 5CEXA 4L4VA 3GM0A 2W92A 3MUJA 5DD5L 2HMID 3CU1A 1P4BH 1QFUH 5CKGA 3VXME 1D6EB 4RMRA 1RU9L 3VWJC 1RZ7L 3WFBH 2J8HA 1CE1H 5I1GL 3EYVB 4PGDB 5F1IA 4M7ZB 5SWZB 1YMHA 1U3ZA 4XXCC 2NX5D 2E8YA 3N1PC 3P9MB 4KKCC 3F5WA 3CX2A 1VEMA 5KS9F 3ARDB 3QEHA 2FATL 2HFGL 2APBA 3VXSB 1QKZL 3JWOC 3FAXA 4K7FA 2Z31D 5C0RH 3SEPA 4MJ6A 4K9EL 1FL6A 4M7ZC 4U6HB 4A2LA 4ODVL 4LRIC 3ULVE 3GHEL 1G9NC 4MXVF 5CBAA 4HS8L 4NFCA 3RWHA 4AEHL 4EI5D 4HUKB 4NKOA 5IMMB 3U30B 4P3DB 4PPTA 1AO7D 1QBML 3BKJH 1IKFL 3DMMA 3IRPX 4FQPA 4ZTPL 3X11B 4Q9QH 5FYJH 4MA7H 1DBMH 1IM9B 4NQDA 4PTTB 1GPOL 4PRHA 1RUAL 1CBVH 4HXAH 3WL9B 3U30C 4K3DH 4IRZL 2BVQA 2HA1A 1KB5A 3QUZB 2JELH 1KNOA 4TVPE 5T1LA 3KPMB 1G84A 3CFIC 3DIFB 1FL3B 3BZ4A 5D7JD 1KV3A 1BZ9B 2YKLH 2NY1B 3K4AA 3QUZC 4PJHF 2AJZB 2FX9H 2XN9E 1IBGH 4KJPC 3KPQA 3IGAB 4PP1D 2EDOA 4DUWA 5DT1L 25C8L 2BY0A 3VFNA 5ESVA 4P49A 4LVOB 1KCLA 2NY1C 2X4NB 4K7PH 1MCSA 1S5IL 5HSFA 4HUVB 1BWMA 5F7HA 4LFHG 4U6XA 3BAEL 4KQ4L 5EBMB 4GKOA 4HSQA 3E6FB 4JRXE 2NQCA 4X7DC 4D3CL 4HGMA 3SGDH 3BQUD 4OV6F 1CD1B 4XWGL 4LVOC 1IEAB 1KJ2L 3V2AR 1IGCL 1KOAA 4HH9B 2AEPH 2FBOJ 1U8LA 4UBDC 4KDVA 4WY7H 3CUPA 4YR6B 4P4RB 4F3FA 2R15A 1S7TB 2NY4D 4L8DB 2X2YA 4PJHB 4U1IA 1V3MA 4LU5H 4HUWB 5FUZH 3BPOB 2XZQL 5C0GA 1MEXL 3FAWA 2J6EH 3TO4D 5KVFH 3WNMA 5HPOA 4OI9A 2Z93A 4F33A 1DBKL 2XTJD 4WO4A 3O8XD 5B3JE 5GGQH 2HKHL 4K3GA 4E41B 3BPOC 3O6KL 2YD4A 4KHTL 2EEDA 2NZ9C 4Z18A 5JNYB 1TZGL 1JK8A 2GIYA 3WFHB 4G7VH 2CKBH 1A4KB 1LP9F 4X7CC 4ZXBA 3H9ZA 4J12A 5ELIA 2EECA 1F3DJ 2D4DA 4UOJA 3CMOH 2IH1B 5IB2B 5HYSG 4WI6A 4D9RE 1T7WA 3OHXB 1DR9A 3BE1L 3K80A 1CLZL 4CNIA 3GMOA 4GSDL 2GQHA 4R3SA 2BXYA 4XNXH 1J10A 4QOKB 1KCVL 2LTQB 4HS3A 3SE9H 3SGKA 3IETA 1C5CH 1MF2H 3T65A 3CDGB 4FQCH 2AJVL 1A7OL 2V7NA 2FEDD 2QHRL 2H2SC 4QY8B 4RRPA 2CR6A 4XRCB 4YFLF 3IDIB 1LE5B 2LTQC 3MLYH 2FX8L 3JTSA 1MCDA 1ZOXA 1I1AD 3SKMA 1G9MH 1JGUL 4NN6B 3BP6A 2ZNXA 5I2IA 1LP9B 3VWKB 2OTPA 2HFTA 1DN0A 4NFBA 4Y5YA 1QVOB 3ZDYF 2GSIA 5HHPA 4CKVX 4NNXB 4OFYA 4I77H 3OF6D 3V52L 1SJEA 2BSED 1AHWC 2W9DL 4NN6C 4XI5D 5I74B 5ISZA 3SDCA 2BOBB 2QHLA 2ZPKH 1B3JA 1AJ7L 2ICWA 5BRZE 1FVCA 5DVOA 5GHWL 3MO1B 3OKMA 4X6CF 1PD6A 4ELMF 2CDEB 3MA9L 3UX9B 3MUGB 1KN2H 3UPRB 5I74C 1AH1A 2B1AH 5FKPA 3D85A 5DEZA 1RZKC 5TQ2L 2PYEB 2K9UA 2UZIL 3V6OA 3ALXA 3ARPA 3A67L 3ZDZE 2ZUVA 4NPYB 4HK3J 1FGVL 1FL5B 4O4YL 1E6OH 1C5BL 1QSZA 5FYKH 3RUGB 2XWTA 2D7MA 2RQ8A 3OR6A 2V9QA 2A6DA 4FA8A 5BS0E 4NKDB 3U0TA 5J13B 1FZMA 3KYNA 4P2OD 1FN4A 2B20A 2BVPB 4UILL 4OLXL 3HAEA 3OKYA 2VZ3A 3GMMB 4LSVL 1NBZA 1EZVY 4ODTL 4ELMB 3QEQA 1J12A 4FP8H 1AD9B 1LK2B 2FSEA 5DHYA 3BGAA 5EU6E 5J13C 1Y0LB 1SHMA 3LIZH 3PQYE 4RSVA 4ERSL 3MNWB 5IBTH 3NFSH 3IDNB 5MI0B 4FXGA 3BRGC 1R5IB 4BZ2L 3LPGA 3MXVL 4XVTL 4EUPG 1IAKB 5I1AB 1FAIL 4FQ2H 5F97E 1QRNB 5IHBA 1FVDB 1NUFA 4I48B 1Q9LA 5GS0L 1IGIL 3RFZC 2F9BT 5EPMB 5T33H 2YMXL 1T3FB 2ESVD 3OJVC 1OAXH 2DMKA 3HI6H 4ONGH 3DX8B 1HDMB 4MYWB 3CFKA 1PYWB 4PIRF 3MV8D 1QFWH 3EYQC 3CFBA 3WJJC 1T80A 1PZ5A 4H5SB 4KRPD 4WI7A 3FHAA 2VDOL 1KIQB 1VENA 1JL8A 1YY9D 2NX5B 5T3ZE 4JO1L 5DJDB 5C0BA 5TE4H 3W11D 5ITFB 2VAAA 3FRUB 4UIKL 2Z31B 3FTGA 3CVHH 3CNKA 1FLRL 3A6BH 3INUH 4LSSL 4PUBH 3PP4L 2X4PA 4L5FH 3O9WD 4P23B 4EI5B 4NKIL 1ED3B 3MLTA 4JGUA 3FT2B 5D4QA 1AO7B 1P84K 1JZ8A 2Z31C 3O41B 3LN4A 3PWPD 5JW4Q 3ZT6A 3VXUE 4UT6H 3D6GA 3QXDB 3WLBA 3O6MH 3SKOB 3MLZH 3GNMH 1GGIL 4P23C 4KI5D 4YO0A 3NCFB 4EI5C 5A16B 1EAPA 4LCYB 2AP2A 4PJ5E 4R96A 3LKPB 4JFHE 3QXWA 4LCCB 4U6YB 1I85C 1T22A 4L8CB 1P4BL 1S7XA 4LEOB 3HHRB 1G0DA 1MJUH 3ZYIA 3FB7A 1EEQA 2XZAH 5F89A 3H7BB 3W0WA 3WFBL 4X7TA 1INQA 3DVFA 3SDDA 2CLVA 4GW4B 5D7JB 4PJEB 3LV3B 4HFWA 4X9GA 3WFCL 3MUY1 4LCCC 3GJEA 4HFUH 1X5YA 4F7PB 1G7MB 3SJVD 2P45B 2VXVH 2MKLC 5FEBA 4I13B 2WANA 5C0RL 1YEHH 4M7LL 5D7JC 1N2RA 4CUCA 1I1CA 5DD6B 1A8JH 3J8F7 1A1OA 1P5VA 1L9MA 1OP9A 1IQDA 3TCLB 3BKJL 4PP1C 1LO0H 1KIRA 3VFMA 4RFNB 3I3EA 5FYJL 3BQUB 1DBML 5D5MA 4JFZH 1CBVL 5K59F 2G75A 5EOCH 1YEDB 3MGOB 2P8MB 1PG7X 1EO8L 3LKNA 4K3DL 3P4OB 5DVNA 4F7MB 1UM6H 1EEYB 3BQUC 4YHOH 5BQ7A 2NY4B 4JZNA 2ZKHH 1A7PH 3VFTB 1GOGA 1JNHA 1TVHA 1X5HA 3HN3A 3QFJB 4WFHE 5KW9H 4X5LA 2CUHA 3GI9H 3TO4B 3TYGH 1IBGL 1MIEH 2XTJB 2NY4C 3O8XB 3U4EA 5FA4B 1MRFH 2J6EA 1SJVA 5HYSB 4IIQA 3TO4C 4POZD 4XH2A 5EO0B 4K7PL 1WITA 1AGFB 5EZJB 5D7LE 8FABB 5DQ9B 1NGXB 2GSGB 1BQHA 2R69H 2DJUA 3KS0J 3HNVH 5E24E 4MDJA 1HH6B 5H94B 2HWZH 1VADB 3L3DB 2AXFB 1DFBH 2AEPL 1F4YH 1MHCB 4XP1L 4ONFH 4GAJH 2OL3H 2OK0H 4LU5L 1YJDH 5FUZL 1UWGL 1GVIA 1UXWB 2GK0B 1UB5A 1ZANH 3QWQB 1F3JB 5KSBA 4Z7NF 2D3VA 1S5HB 4U1KB 2XNAA 3TT3L 4JPKH 4ZUWA 3SPVB 4JCMA 4MHHG 2G2RA 1I1AB 5GGQL 1FYTE 2YC1A 5E2VH 1FO0H 2GW5A 3U1SL 4HUUB 2FEDC 1G7LB 3D69B 1LO4H 2VITA 1LDSA 3K8LA 5FCSH 3OGCB 5F88A 1L0QA 2CKBL 4LDEB 1HHIB 1KTDB 2PTUA 4DKFL 4B5EA 3EZ8A 1CL7H 2MCPH 3FOMB 2FIKB 3CMOL 4L3ED 4MCYB 3V8CA 5F1IB 4X4YB 3U9PH 3C6SA 1X5LA 1QBBA 4KK5D 4KVCL 2BP3A 4FFWD 5C7XH 3QXVA 2UV3A 4XNXL 1BVLB 2DLEA 4XI5C 4E42B 4WWKA 4KKLD 2F74B 3SCMD 3U0PA 3MRCB 1FL6B 1C5CL 1MF2L 1J8KA 4DCQB 1XGRA 2VDRH 4FQCL 2FWOA 3N06B 2B0SH 2FNBA 3REWA 3NGBC 2Q76B 3PDDA 3OAZK 3V7MA 4OLWL 3MLYL 1NJ9A 4J3SA 4RISH 1ZVSA 4K3JL 1MFCH 5IMLB 2GTZA 3NN8A 2EZ0D 3G6AA 2Y06H 1VFOA 4P2OB 3L5IA 4CN6A 5F7FA 4KMTL 3HUJE 3S96A 1KCRL 4Y5XB 1LE9A 3PGFH 3H42H 1CXHA 3P2TA 3WNOA 3O4LE 4EUPB 3OX8A 5DMGD 2ZUWA 1R3JA 5CS7A 2ZPKL 3EUUA 4U33A 2VKWA 2DYPD 5BV7B 4KZDL 2FL5B 4AIZA 5C0DB 2D7NA 1I75A 4W81A 3WFDH 1FFNA 4I4WA 4K3EH 2AXGB 4HUXB 3QUMH 1KB9J 1YEIL 2L7UA 4Y2DD 5BV7C 1S9XA 4IMLA 4I2XA 1U93B 5C0AD 5T3XE 3KPRA 3NA9H 5L0QB 4ELKB 2ESVB 3RIFF 3FT4B 1E6OL 2RJMA 5FYKL 3RWGA 3V5HA 5I18H 4G8FA 3WXWH 4KI5F 1IGTA 5IQ7L 3GJFB 3SKUD 4YHIB 1KF9B 1QSFE 2NY3D 3AY4A 4KRPB 4PLJC 5IFAH 5E8PA 5L0QC 4QRQB 1E4KA 2EDFA 2HYMA 1CXEA 5KANI 3RWIA 1R0AL 1GSMA 1FIGH 3U0WH 5C0EB 3T2QA 2JB5L 4FP8L 1CT8B 3QJFB 2AJYH 2VLJA 1T04B 2EXYC 3GMQA 4LCWD 4KJWC 2PYFA 4MJIE 1XMWA 1YY9C 4UNUA 2XQYK 1ZS8B 3O9WB 5IBTL 1WEJL 3EOAA 4ZO9A 1JRHH 4NT6A 4R7DB 4CDHA 5KVMC 2C9AA 3MJ9H 4WNQB 5CKAA 3CH1A 1R24B 5KZCD 3VXOA 4I0PD 1PQZB 5I1HL 3PWPB 1AKJD 3L3KA 3BUTA 4PJCA 4QT5B 4ENEC 3JXAA 4FQXA 2D0GA 3HI6L 1NFKA 3C9NB 5HGAA 1GIGH 4WJ5A 5DHVB 3QYCA 3C8KB 3F7YA 1QFWL 2VTFA 4PJ8A 4KKAC 3FO2B 1V3JA 5D2NB 5AG8A 4AT6B 5KVEH 4G80A 2JCCF 5HHOA 4TSCL 3W82A 5FGCB 4O51B 5HYQA 4J3WA 4PRAA 4ZXBC 2VLLB 4HC1L 5TE4L 3SGEH 3KYMA 1EERB 1AD0A 1NBYB 4PJAA 3KJ6H 4TUKH 1BQHG 5IVXE 3SJVB 1IGJA 3F58H 5D2NC 3CVHL 3A6BL 1TZHB 1FNHA 3INUL 4OLVL 1XCTB 1AGEA 4PUBL 3IU3B 3QWOB 3PQYD 3CLEH 3K4DA 3IS1X 3VJ6A 2VWEC 5ANME 4I3RH 3SGKC 4JB9H 2BHZA 1I7RA 3WE6B 3FB8A 3VXQB 3H3KA 1L4IA 2BRRL 4UT6L 2OR7A 4HJJH 4OCRL 3MNZA 3O6ML 3HPJB 3H8NA 3KDMB 1KLUB 5MENE 2GSIB 4WUUE 35C8H 5HYJD 2EDTA 1FIEA 1SJEB 4X5XB 2OM5A 3TO2A 3SBWA 1U8QA 1KJMB 3EO1B 1MJUL 2GJZB 1MLBB 5JOPD 1VSCA 2DQCL 3O3EA 2RGSA 5ID0A 3MGAA 2HT3D 2E9BA 3BP5A 2DM7A 3VFSA 1J18A 2PW2A 3SDCC 5B4MD 3FO1B 4N0YH 4G3YH 3HFMH 4HIHB 3MLUL 1TVDA 4JM2D 2VXVL 5E6ID 3RL2B 3PWUB 4X4XA 1FVEA 1YEHL 1LEIA 4N90D 4RCAA 5GRJH 1RPQA 4FQIL 3HE7A 4QRRA 2AI0L 1RUQL 3L3OB 1INEH 1UZ8A 1UJTA 1A3LH 3T08A 3TP4A 1VACB 5D7KD 1B0GA 5E00B 3TC9A 4JFZL 2IEPA 4POZC 1KEGH 3MCKA 6FABH 3VH8G 3ZE0E 4OI8A 5CD3B 1RK1B 4JE4B 2H45A 4HEME 3MRQB 4PJEE 1MFAH 1UM6L 4PV9A 4YHOL 3OKOB 2ZKHL 1BBJA 1A7PL 4ODXB 4HPYH 1MWAB 3HRPA 5CLWA 5KW9L 3GI9L 5FUCE 4YHYC 1UFUA 1WFOA 2P5EA 4O2FB 4PRBB 5DK0A 1G7HA 4ZDHB 3RWCA 5HHXL 4PJ7A 3WEXB 1VCAA 5CEZH 3MRDB 3I85A 5BVPH 3DTXB 5FA3A 4UI2A 2VXQL 3L7FB 5INDA 5GJTH 4C56A 5IP4A 1IFHH 5B3JF 4MNGE 1FO0A 3GMRB 3VFVB 1CDYA 4KH2A 5E8OA 2R69L 4L3EB 4YXKH 1ZLUK 5DO2D 1KIPA 4DZ8A 3HNVL 2IALB 2HVJA 1Z0NA 2A6IB 4NQED 4BZ1H 4OM0H 3S35X 5IKCA 3ARFA 1BMGA 4M6AA 1DFBL 1LQSR 2X4OA 2LABA 4HHAA 4XMKL 5LQBH 5DZNA 1F4YL 3QFJE 4QLRA 3SCMB 1KT2B 1ITCA 5IOPB 4ONFL 5ALBL 4GAJL 2OL3L 1DQTA 2DKSA 5IJVA 1HSAA 4YHNA 3C5SA 3B9KA 2GJ6E 3UPCA 4XNUH 4V1DE 4KK5C 5JHDE 1ZANL 4FFWC 4FABL 3GMNB 1FFQA 3SCMC 5DA0B 4JPKL 1BHGA 1REIA 3UEZA 2HTKC 2E8ZA 5I17A 3OAYH 4XCEA 4OZGB 4HG4K 1JCKA 1Z9OA 1VFAB 1FO0L 2ZSWA 3FZUD 2R4SL 1EAPB 2ZP0T 1NDMA 4QXWA 5EU7E 3VMPA 5GS1A 4Z76B 4K23H 2D7TH 5L2JA 4Z7VF 4PJIE 1T22B 4GKNB 1HQRB 5D7LD 5ESQB 5AWNH 4Q2ZA 1CL7L 2MCPL 4WHTA 4X7TB 5CJBA 2EZ0C 5HVHC 2DYPB 2AKRA 3LEXB 1I7ZB 2BNRA 4JFDD 5FO9A 4GG8A 5I6XB 1LDPL 4TRPH 1D5ZB 3GSWB 4EXPX 5DJCB 5DMGC 4R8WH 2OXHA 4DEPB 1A9BA 2B2XH 4M1GL 3PHQB 4Y2DB 2C4FU 5FK9B 5C0AB 1KFAH 1PLGH 2B0SL 2E6PA 4ZD3L 5I6XC 5IVNA 4JPVH 2Q87A 2R1WB 2R23A 5EUOA 2ERJC 4DEPC 4Y88A 5C86A 3QUMA 5CZXD 3T0EA 1IAIM 4Y2DC 1U8JB 1ZHNA 4M62H 1X6LA 1ONQB 4L4VE 2NY3B 3BKCH 3GGWA 1U8HA 4Z7VB 3TVMA 1J11A 4X7SH 2VRAA 2WWMC 3FQTA 1CGTA 1SYVA 1S78C 2I26N 5DRXB 4WDIA 1QFWM 2NCMA 1HI6B 4QHUA 3EGSA 4Q9RH 1S7UB 5LXGH 1MQKH 1J1XH 4LCWB 3FJTA 4P4KD 5DVMA 1KG0B 2HN7A 4WVRA 2BX5A 4YX2L 3WFDL 5C70A 5J1SC 1MRDH 3VXTA 5F3BA 1M05B 3H9SD 4Z6AT 4KY1H 4TSBH 4I0PB 3RY6A 5T5NF 1AKJB 1FP5A 1Q94B 2CLRA 3BSZL 5MEPA 3QUML 3IFOA 2EDLA 3DLQR 1VGEH 1U3HA 2ZG2A 1ZA3B 4R4FH 1OQOA 3MJ9A 3BIKB 4NQDE 3WIFA 2VXTH 3O6LH 4PRHE 3EO0A 1XGUA 3AS2A 5DD0H 1L7TL 3WXWL 3FN3A 2H3NB 4ZFOA 3OSKA 1AP2A 2ATPB 1GHFH 4BSVA 3OKNB 4OZIB 2CJUL 5EORH 1FIGL 1W0VB 3QEGH 1B4JL 5DUML 3S3JA 4GMSH 4GW1B 4PJFE 5EH1A 4JFXA 2AJYL 1F42A 3O4LD 4WHYH 4IRJA 5IG7B 3AREA 4KKNA 5HHNA 3PL6D 4JM2F 3U83A 1B6DA 3D0VB 1IC5L 1JRHL 3GSXA 3AM8C 4G6JL 4KTEH 1EFQA 3VRJB 5DJZA 1SEQH 4F37F 1U95B 2Y5TB 2HLAA 4JFPB 4KK6D 5I0ZA 4ZFOL 2Y07H 3I6GB 3P9LA 5HYJB 5F88B 3MV9D 2DLFH 2GUOB 1EJ6A 3O3AA 3QG6A 5DC0A 2I07A 4FQHB 1ZLSL 3GK8H 2FHBA 3MJ8B 5D1XA 4PP2B 4U3XA 5JPMB 4U7MA 2BDNH 1WBZB 4XX1E 2DLHA 1HZHH 2ZUTA 5CAYB 4GBXD 2AK4A 4LQFH 4XPGH 4JM2B 3VXNB 2PCPA 1FQ9C 1CFNB 3F58L 4U3CA 3G5YA 5E6IB 2HJFB 5CZKA 5EC1A 3OXSA 3GKWH 2GT9B 4PGCB 5E5MA 3V6FA 5LKNA 4YHLH 1BJ1J 3VH8B 4OF0A 3CLEL 5MEQA 5B4MC 2HFEA 2IC2A 4I3RL 1EEUA 3ZE1E 1UA6L 4NQSB 1ZVSB 5CILH 4HBCL 1S7RB 4CADB 4HJJL 4ZUTB 4L9LA 4F15C 3HA0A 3BP4B 4XT1C 1ES0A 3M17A 5GGTL 3L5HA 4S1DC 3OX8B 1PKQB 2FIRT 4YK4B 1C5DA 5IMOB 4P9HL 3CCHB 2D7OA 5IEKA 4MS8D 3DRTA 3L5WA 5E2TH 2VWEE 3TA3D 3FB6A 5HD8D 2O93L 2J8OA 4I9WE 1FFOA 4CU8A 3EOYG 4YK4C 4HX1A 4G3YL 4JPWL 3KVQA 5TF1L 3VFOA 2VJXA 2Z91A 4KVNL 2CRIA 5A1AA 2EIZB 3QDGD 1AC0A 2COQA 3BH9A 5GRJL 2DTMH 1S8DA 4LF3A 4U2ZA 1K3ZA 1N64H 4YDLB 4R97B 3T0ED 2FDBP 1KGCE 5C71A 1G7PB 2BVOB 3TNNA 2A1WL 4M5YH 3ULUE 4OCSH 3ROOA 5E1AB 5ISZE 6FABL 1MCOL 1JHKH 4Q58C 4NQEB 2RCSH 2WINB 4R97C 3RPIA 4B41A 4Z7UA 2ICEB 3C5JA 3ZT7A 1FAKT 1MFAL 3LDBB 5EZOL 3SGJA 1OF2A 1R3LA 1TITA 2WV3A 3AY4C 4GW5B 1YMMD 1I8MB 2GFBA 1NKOA 4HPYL 4LSRL 2EE2A 5HHQB 3V6OE 4J3UA 1P6AB 3LDBC 3RKDD 4BZYA 2F8OA 3MV7D 4JRYD 5CEZL 3P4MB 3SDYH 1QA9B 5BVPL 1Z5LA 4JY4B 3MBXH 4J8RA 1CE6A 1MH5B 4N8VB 4LHUD 4F7EA 2X4SA 4I18A 5K9OA 3RZWA 5SWQA 1LK3H 1A6WL 1IFHL 1G0YR 5GIRA 5IR1A 4NQCA 4NYLA 4OUUA 2X1PA 2V7HB 3FZUC 4FQXC 4YXKL 4WTXA 3DROA 2I24N 3QEQE 5TQ0H 4JFDB 1CICA 2DQHH 4X6DF 5DURD 3MRKA 3KYMB 1KTKE 4MQSB 2X4QA 4A6YH 4PJ8C 3AS3A 1NCAH 4GAGH 5LQBL 4R4ND 2Y5EA 4I5BA 4S2SA 2CIKB 3LKSB 3U2SB 3PJSB 3MMEB 3S88H 2Y25A 3MJ7B 2O5ZH 2E9WA 2I60H 2VXSH 5L2KD 5EU3A 1JIBA 5IT2H 1I1FA 4PRPA 1RZFH 2MSPA 4YDKH 4CBPA 5GRUH 2XYCA 3EHBD 2SEBA 3T04D 1YC8A 2ED7A 3CK0L 3P40A 1BAFH 1IMHC 3RX8A 1ZMYA 1I4FA 1FNGA 5CZXC 4UIMA 4K23L 2D7TL 2BCKB 3OKEB 3ARGD 5IROA 4GRWF 3T2OA 4X6DB 5AWNL 1HHGA 1DUZA 2BOCA 5C0BE 5B38A 2JJSA 5ID0B 4NRZA 2Q8AL 4P4KB 5C3TA 1OTSD 1RIHL 3FB5A 2DQIH 3L3GB 2RAMA 4LLVA 3KYKH 4P2RD 2PW2B 3DYPA 3BW9B 3H9SB 3GSUA 3DUSA 4R8WL 3MRJB 3MRNB 1S9VA 2B2XL 5EN2B 5F44A 5IMKB 3EDDA 1T4KA 3KYOA 1N6UA 3N1MC 4QRRB 4H26A 4HT1L 4JPVL 5ITBH 2CRZA 4JY5H 1JWUA 2I9LB 4V1DD 1YPZF 5DMYA 5DWUH 1Q9WB 3HC4L 1DUYB 5HI4D 3HMWL 4M62L 5FYJE 5FDYA 4XBEH 1RZIA 3HE7C 1QOKA 3LY6A 4GRWB 4P59H 4FMFA 4H88H 3VFPA 4O2CA 4QNPE 4X99A 3W0WE 2NLJB 1KYOJ 2ADGB 3H0TA 4MDIA 1NCWH 4HK3N 4RIRA 2A0LD 2KL6A 2BJMH 5FV1L 1CYGA 1DSFH 5L9DL 4Q9RL 5EG6C 4XC3H 1XGTB 2DJSA 5LXGL 1MQKL 4FS0A 4BFIB 5E94A 1C1EH 3PL6B 4M43H 4HKJA 4XNQB 4NRXB 3B83A 1G7HB 2PO6A 3RWCB 1CGUA 3HRZA 1NAML 4KY1L 4TSBL 4PJ7B 3QPQC 1G7QA 1BOGA 4QO1A 3W39A 4F8TA 4XP4H 4AQ1B 1BIIB 3IDGB 3ZYOA 4Z7WA 1VGEL 3EYOA 5ILTH 2WIIA 3PL6C 3EJJX 1YPZB 4LLUB 4R4FL 5INDB 1UM5L 4DN3H 3MV9B 1RUPH 3O6LL 2XKNA 1LO3L 5D5ME 1OP5H 4X8JA 1NGPL 3HG1A 3VA2C 1YJDC 1CQKA 2ADIB 3QISA 5DD0L 3VG0L 5J6GA 4RGND 3FRPG 5I1EH 4GXVL 4C58B 4LP4A 3RVVC 4ZYKA 2E6JA 1OVZA 3R0NA 1Q0YL 2V5YA 5EORL 5A2LH 3QEGL 4GBXB 4APQD 2VKXA 3NZ8B 4IBLT 1KBGH 5IHZB 4WI3A 5DK2A 3RVUD 5IJVB 1HSAB 2L4OA 2HLFD 1KTRL 5FOJA 3ARFC 4NO2A 4DQOL 1GGBH 2P5WE 4GBXC 3NIGE 5J8OA 1FRGH 5DEGB 1CLOL 4JPIB 5ACZA 4FQ1L 4Y7MA 2NNAB 1ZLVH 4D0CB 2BSTB 4KTEL 3G5VB 4EIGB 1SEQL 2VIRA 5F1NB 3QDAA 4KRNA 1Z9SA 1X4ZA 2Y07L 1JHLH 3MBED 4BUGA 3BEVA 1RHHA 1D9KD 2DLFL 2P46B 3T0DA 3WHXB 1A1MA 1FCCA 4AM0B 5I1IH 5IFJA 1I7UA 1RZJL 1A6VH 3QZWA 5HGDA 3MGTB 5J9PB 5K9KB 3AROA 2AKRB 3TA3B 1FDLL 3OTTA 3QWRA 4Y16A 3UBXI 2O61A 5GS1C 3SDXA 3IDUA 1HZHL 3PV7A 2V5SA 4QGYA 4OD2A 5EU5B 4P3CH 4LQFL 5EA0H 5I15H 2MQ3A 5EO1B 5KSBE 2NY6D 4MS8C 5D72H 5EBWB 2HRPH 3TA3C 4CN4A 4MLIA 5HD8C 5I73C 3QDGB 4O9HH 1KC5H 3GKWL 1VFMA 1DLHB 4LVNB 4WU7B 3G08A 3NIFF 2R23B 3UTSD 4PRIA 1NBVL 2NXYD 3T0EB 5FDWB 1Z0MA 2P8PB 5CILL 4XAWL 5AZEH 4Q6IA 4QKXB 4N8CH 1MUJA 3RPKA 4LVNC 4EXKA 1NCCL 5ICXA 3G9AB 1U8MB 3T0EC 3WDJA 1UB6B 2VN4A 4NC2B 3IDMB 3TVMC 2HFFA 2FJFA 4X9HA 1H3VA 5DRZB 1HH9B 1YMMB 5E2TL 4QGTA 3GMPA 2OBGA 4RX4A 1JYXA 3V5DB 2B5IB 3VGAB 3BDYH 3MV7B 4JRYB 3QG7H 5DFVC 5MEPB 2BNUB 4R2GD 3F7VB 1SEBA 1KIUA 2WUCH 1CCZA 2JIXD 2VLRD 3KPSA 4LHUB 3V4UH 2IAMD 2DTML 2B5IC 5FF6A 3V6ZA 4YHPB 3RY6C 1N64L 5J1AB 4JFYA 3Q2CA 4OGAD 5L7XL 3MFFA 1NL0H 5FYKE 4PJXA 4NRYB 5A2KH 2PTTB 1U3HC 4X6BB 5AYUH 4OCSL 4NC1E 1XF3A 1I3UA 1EJOH 4X4MA 4YAQB 1JHKL 2FR4A 3IRZA 1R5WB 5DURB 1T0MA 1J8HD 2ZCKH 4NNYA 4Y1AD 1JGEB 1FFPA 1P5UA 3UTOA 4WFEE 2VL5B 4P46D 1LO2H 1ORSA 4JJ5B 2VZUA 2XRAH 1A6PA 4NP4H 1VGKB 4YGVA 5L2KB 3ZE2F 4A6YA 1A0QH 4I2XE 1BECA 4LVHB 3KPRE 4R4NC 1N59B 4D0DB 5F3HA 2AK1H 4WI2A 3SDYL 5I1KL 2O5XH 3S4SA 1F11A 3MBXL 3ZDXE 3JWDH 4AQOA 3IKCB 4X0KB 3FOLA 3N1QC 2RHEA 3ARGB 3TYFA 4JAMB 1WICA 2WBKA 3FONB 3QFDB 3EHBC 3OXRA 1TMCB 1ADQH 1MRCH 2EEBA 2EYRA 4NZRH 1EFXD 1U8OA 1N26A 2GITB 2K1MA 1U2CA 3D25A 2DRUA 5IW6B 1WQVT 2VLJE 1XGQB 1CTOA 4MA3B 3VXRA 2DQHL 2H6PB 4P2RB 3HI1A 3ARGC 1RY7B 1S7VB 4A6YL 2XFXB 3LEVH 1NCAL 5D1XC 1BF2A 1KCSL 2VE6B 4ZUSB 3BEWA 3EO9H 1U42A 4WGWB 3S88L 1HWHB 5FKAB 3KPPB 3FFDB 5DJXA 3LB6D 1LNUB 2O5ZL 5BMFH 2I60L 2VXSL 3LKRA 4N68A 3TBYB 2UUDK 4PJCE 5CGYD 4OBRA 3PWNA 1NEZA 3WYRA 1QQDB 5CP7B 1HINL 4YDKL 4ZOBA 1ZT1A 5GRUL 2EXWC 1E4WH 4KUCD 4N0FA 1BAFL 3ZO0A 4K8RH 2J8UF 4L9LB 1ES0B 1F5WA 4NJAH 1ACYH 1G6RH 2B39A 4U1MB 4WEUD 5GS0D 4L3CA 3ELAT 1QPPA 2JF1A 5HHOE 1DDHA 5HI4C 1K6QH 4HK0A 4PJAE 1OLLA 3DGGA 3LSOB 4L9LC 1JN6B 3RNQA 1CR9L 2E27L 4XBGA 5KG9A 3O2VH 3IDYB 3DRQA 3GSVA 5ERWB 3KYKL 1MPAH 4F58H 2A0LC 4BSJA 4HWNA 1GZQA 3BXNA 1W72H 1RZGB 1XCQB 2J3SA 4BQ8A 2DF3A 4BYHA 4Z0XB 4OV5B 3C60D 4HIIA 2C1PA 3RDTD 1A6ZB 4MNQE 3IDYC 4KDTA 4HXBH 5ITBL 2HJLA 2J8UB 3QQ4B 3GEWB 3GB7A 4RGNB 1YUHA 3KXFD 5HY9B 2ARJA 3IXAB 5HDOA 4E5XB 4Y4FA 5BXFB 3MNVB 1F58H 2CUMA 2Z92B 4P59L 3CFDB 5GGSB 5JOFA 3L3HA 3MRRB 4APQB 1NCWL 2XI9A 1Q0XH 4FN0A 4RGNC 1JGDA 5B39G 2CDFB 5D1QA 5BJTB 1A7RH 3WFZA 5IB5B 3MV11 4QF1A 2BVYA 4YWGL 4D0BA 4DUVA 2VLKA 1H3UA 1C1EL 4HWEH 4QRSA 4OAWB 4APQC 4NSKA 5FYLD 3SGJC 4YNYB 4PJFF 1PAMA 1HILB 1DBBL 4M48H 4XP4L 4QRRE 3ULVH 3T3PE 3QUYD 2CIIB 3ME0A 3GSNB 1XGPA 1YY8A 3WUWG 4F7EB 4G7YL 4NO5B 3MBEB 3FQUA 4DN3L 2AJ3B 4UV4H 1RUPL 1D9KB 5GIRB 5EU4A 3VFGH 2DM3A 5CMAA 2NW3A 4JY6B 3G5XA 4JCLA 5IM7A 4FQLH 5I1EL 3QUKA 4OGYH 2YA0A 4HKZB 1J1PH 2FHCA 3N9GL 2H32H 1D9KC 1A3QA 1WBYA 2X1QA 4QTHB 5E8EA 1CFQB 1F13A 1KJ2B 3BDXA 4TVPH 5F71A 4ZUVA 7CGTA 1FG2B 1U58A 1KBGL 2NY6B 2APTA 1TLKA 2P5EE 4B7IA 1YNTA 3VG9C 5DD3H 1KN4H 4JFQB 3UTSB 1GGBL 1U8PA 3C2AL 1NUNB 3QNYA 2NXYB 1IGFH 4WEBH 2IAND 4QYOA 3RWJB 3RX7A 3T4AB 1FRGL 2NY6C 1BVKB 2NTFB 3CXHJ 2F53D 4Y8DC 3UJTL 4C56E 5D7IA 1V7NL 1UH2A 1EA9C 4H1LH 4XAKE 4LQ1A 1FNGB 3ARZA 3PHOB 2YK1H 4KHXH 2X7LA 4QXTA 4EBQL 12E8H 2DD8H 5I0DA 5I1IL 4GG6A 1RIVL 3FQRA 1A6VL 3KLHD 2CRMA 2FLRT 4I3GA 1IEBA 4HCRH 2X09A 3STZB 4ISVA 2NY5H 5TE7H 3PE9A 4R90H 3GSUB 4EOWH 4P3CL 5EA0L 5I15L 3OJDB 4R2GB 5D72L 3MRFA 2HRPL 3T3MF 4PJGA 1M4KA 4RDQG 4JANB 2LVCA 3RJDA 5AG9A 3H2WA 5E08L 2F8VA 3L7EB 1YQVL 2JIXB 2VLRB 2H2PD 2IAMB 2BY1A 1JWUB 1HEZA 4JFED 5AYQA 1SYSA 4ZOEA 4R2GC 4DJMA 1HHHB 4ZQKA 2EICA 2ZUQB 4N8CL 2MTPA 1ACZA 2IAMC 3I6KA 4FRWA 2VSCA 1CDCA 2VUOA 1ZLWH 4PB0H 3EW3B 4OGAC 1J8HB 3CFCH 1JPFA 4OZHF 4ZAKD 2BNRE 2FRGP 4Y1AB 3U46A 2ZUQC 5FHAL 2IBGA 4P46B 1CGXA 4RBPK 3B3IA 3Q3GB 1PSKH 3DX6B 4J4PA 4OGXH 3G6JA 1DVFA 3NVQA 1N3NB 4M61A 2D9CA 1XF4B 3RX5A 5KN5B 3QG7L 1UQSB 4UTAL 5EUOE 4U1LB 4RFEA 4KK8D 1HSBB 2QR0B 3X12B 3K8MA 2ORBH 5EO9B 3QEUB 5C0FB 2Z8SA 2EO9A 2FD6H 3V4UL 5JW4R 1JF1B 4KUCF 3MODH 1JMXA 1XR9B 1MCQA 3SKNB 2OMBA 5IK3B 3QQ3A 3DBXB 1I1YB 4OCYL 3FFCD 5DJYA 2GCYA 1EFXB 1OAQH 4OZHB 3Q48A 2YBRB 4WI5A 1RD6A 2QQNH 1LEGB 2R2BB 4KJYA 2D03L 5EC2B 2ZCKL 1ADQA 1Q1JH 4LCUB 5MP6L 2ADJB 4YHZL 3F12B 5HDBF 1F8TH 4TVSa 1RSFA 3BD4A 2W0LA 3GDBA 1X5GA 2YD3A 4MB4A 5IIEA 4UV7L 5I1DB 2XRAL 4Y19D 1TETH 4NO2B 4NP4L 4LAQH 5F7MC 4JDTL 3HR6A 1Q38A 1A0QL 3W2DL 2R39A 5FM5M 4KV5E 5EZLB 2DWDB 3TEUA 1I1RA 3CDCA 1ZHLA 4XBPA 3UTTD 3ZHKA 3S37X 2AK1L 4X6EA 1YEEL 5LJYH 3WSQH 4H8WC 1Y18B 2M1KA 1A1MB 4X8XA 5AD0B 3T1WA 4ORGB 3BWAA 1LEKB 3GBNL 1P7QA 3T4YA 1ADQL 5JQHC 3B6SA 5H37G 4HKXB 4Z0BH 4NZRL 2X4RA 4O2EA 1QSEA 4TULL 4G6KH 4M6MH 4YPGA 3U7YL 3O6FD 1NFIA 5K33A 1B0RA 1HKFA 2YPVL 2PW1B 3HCVB 3B2VH 2IWGA 3LEVL 4OLZL 2WSKA 5SWSA 2YD5A 3O2DL 4Y16C 1FJ1B 2DB8A 3C60B 3EO9L 4NZTH 3RDTB 5KAQG 3UDWA 2I9TA 3LRGA 3O3BB 4X5WA 5BMFL 4F9PA 3MYJA 3U6RA 1W72A 1W8OA 3C2SA 3GRWH 2PXYD 1A7NH 3KXFB 1X5AA 1K9TA 3C60C 3QIUA 5B39B 4DW2H 3IF1B 4Y2OA 4R0LA 3Q6FB 3I3DA 5IJKC 1T0NB 5DMJB 3O45B 4EJ1C 5KJRH 4OBSA 3QSKB 4K7PY 2EYTB 1G6RL 1OCWH 4Q0XH 2RB8A 4LEXL 5B21A 4IOIA 1K6QL 2HFFB 2AK4E 3VRIB 2YPLA 2R2EB 5T3ZH 5CIPH 3FT3B 4QNPF 3WUWB 5CINH 1D5XA 2J7LA 3FQXB 3UO1H 2Q6WA 3BPCB 4FTVA 5C0JB 1T1YA 3I9GL 3QQ9D 1NC4D 1JGVH 3BN9D 4Z7QE 1J1OH 3QUYB 4NBYB 5F7WC 1EBAA 4LLYA 3RVWD 4DTGH 4OFDA 4ZOCA 3I84A 3X17A 3P11L 5DQJB 1T5WA 4HXBL 4QRPD 3LS4H 4AENB 5JLZA 1HQ4B 3TBVB 1BX2A 3BH8B 2DWEB 1FSKB 3BKMH 3EZJB 4M7JL 3PF2A 5JPNA 1F3DH 3GO1H 3D0LA 3WCYA 1KXQE 1JV5B 1F58L 1RK0B 1XZ0A 5D5MF 5DFWH 4UNTA 4AH2B 4JHWH 3PHSA 3GSOA 5CGTA 1Q8MA 1N5YH 4U0RB 1Q0XL 1NANI 4F7TA 1YN6A 3V0VA 5JR1H 1A7RL 1BJ8A 4OT1H 2H32A 1M6OB 2VQ1B 2A6JA 2R2HB 5EUKB 2KZ1B 1N7MH 1ORQA 1GL4B 3GSQB 1QSVA 2IANB 4OI7A 5IHLB 4PJ9A 2F53B 3ULVL 2BRQA 1QHPA 2IPKA 4PD4K 3S97C 5CEZE 4X9BA 2X4UA 3SQBA 2WBWB 2Q7YA 4GAYA 4GFTB 3NIGF 1WWBX 3UAJC 4UV4L 1R5VA 2BSSA 4MMXC 2H8PA 4MNQD 1QLEH 3DURB 5F9WC 5FGSA 2B1HL 2JTDA 1DLFL 4K94C 4JQIL 4LRNH 4H1LA 4GQ9H 1IKNC 2UWEF 1U8OB 3OKKB 4Z7UE 5MEOB 4G8EB 3MZGB 1J1PL 2NXZD 3WNNA 3KLAA 2LV4A 3NZHH 1KLFA 4TVPL 4NN7B 1G9NH 4J23A 2AEIT 3TZVD 2F5AL 1OW0C 4HEPG 4O58H 5IFHL 1I9IH 4B50A 4KXZI 3KHOA 1O0VA 4DN4H 4HV8A 4HCRA 4Y89A 4XVUC 1TNNA 3ES6B 1YEKH 4NN7C 2FO4B 2QJDA 4WEBL 1IGFL 3PWNB 3QRGH 4Z95H 1TIUA 3MRIA 4JFEB 3K2UH 3RWFB 1YEGH 2VISB 4LCIH 5FAAA 4ODWA 5DXWA 3PIQA 1DQML 4X98A 2HTLC 5IHUH 4Z78A 4NWUL 2C7UB 2H2PC 1CDHA 4NQCE 2G60H 4R9HA 5ICZB 4PREA 3RNKB 2BSRB 2UWEB 2X1OA 3HZMA 4NDMB 2YEZA 3TBWB 4ZAKB 12E8L 2HT4C 2DD8L 5GSRB 1V3LA 1U8IA 2UZXB 3IVKA 1H3PH 5C08D 1JUFB 3H9HA 2XPGA 3LRSA 4F37K 1I8IB 4HCRL 3TPKA 4DGYH 2NY5L 2APWA 4ZAKC 1VKXB 4R90L 3ROLA 4EOWL 5J1TC 1LMKA 2MJWA 4ETYA 5D71H 3SOBH 3WN5B 3L6FB 4JZOA 3CPLA 4PJDF 1MCRA 5AEAA 4PRPE 3MRGA 3R8BB 4F9LC 5B22A 1TQCB 4DVBB 3BVNA 1YNKL 4RZCA 3VGGA 1OY3B 3WN5C 2DI7A 4LBEB 2J1KA 4ODHH 4KK8C 3FFCB 4DOHB 4HIXH 2P1YA 4M7KH 4PB0L 1DQJB 3CZFB 5IF0A 3BYTA 1ZHBA 1KCKA 1CS6A 1OAUL 1BEYH 1D7FA 4N1HB 1GAFH 5CSZB 3VE0A 5KAQF 4YIQA 3PGDB 4OD1L 1JWMB 1MLCA 5H8DA 2QSVA 3TWCH 2W9EH 4Y19B 3OQ3B 3K46A 4PJDB 1YDPA 3NABL 2XQYG 1INDH 2X41A 1MFBL 1JHTA 5DLML 3IJYA 1Y6MR 4TUJA 2HKFH 4M8VA 5D1QC 3RWEB 3UTTB 2R1YB 1AE6H 3HZYA 4E0RB 4HJ0C 3VD7A 5A43C 3MLSH 2DMCA 2XIDA 4MZ2A 5ENWB 5C07A 3I6LD 4FOMA 1KCUH 2W0FB 4MSWB 4LIQH 4R26H 4LK4A 3ZYJA 2VDNL 4F8QA 3ALWA 5E6YA 3O6FB 4N5EC 4L4TA 3LKQB 2QQNL 2IG2H 3AVEA 3PWLA 1M7DB 3LKOA 4XCYA 2FGWH 2Y1VA 1NCDH 3QBTB 2A9NL 1KUMA 2P7TB 1Q1JL 2R56H 3EDEA 1BFOB 4S1RL 4PS4L 2DQTL 2IBZY 3DUUA 3RGVA 3O6FC 1OGAD 5DTFB 1P4LA 4MJ5B 2IBBA 1FLTX 1BM3L 3VD3A 4GKZA 4EQ3A 1WVZA 2VABA 3C5ZD 4Z7WE 1A5FH 3T77B 3QI9D 4XMLL 1J7VR 5I8EB 2XWJA 5JMOC 2YSSB 5E7BA 5C92A 3F7QA 2LVEA 4U1HA 5HJ3A 3HG1E 4L4JA 4J3XA 1QBAA 3GRWA 3ILPB 3TFKC 3FQRB 4WFGD 2AJUH 1C08A 2HRLA 4NO0A 2P47B 3IJSB 3PV6B 4Z0BL 3HPLA 5DJAA 4G6KL 4JR9L 4M6ML 5IEHA 3G04A 1RZKH 3HE6A 4TTGA 3HS0B 4BH8B 4M02A 3X14A 1RUKL 1QLRA 4OZFG 3OKDA 3O4OB 1NC4B 5LGJA 3HR5B 5DJ8A 4NZTL 1MAMH 3LPFA 4PJBF 4QRPB 3P0VH 3QQ9C 4ODUB 1F00I 3O4OC 3BN9C 1S9YB