1R5VB

Evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
185
structure length
185
Chain Sequence
APWFLEYSKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Evidence that structural rearrangements and/or flexibility during TCR binding can contribute to T cell activation.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 185
sequence length 185
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r5vB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1r5vB01
1JGLL 4IIQC 3VFGL 2GTWB 4WY7L 2VIRA 5DJYA 1S7TB 2BNRA 3WFDL 4DCQB 1L7TH 4LGPB 5ADOH 1S9WA 3X11B 3BZEA 2H6PB 3DI2B 3OKLA 4L9LA 1HHIA 3PWPE 5EIIB 3WSQH 4PJ7F 4K9EH 3T77B 3QR2A 4TSCH 2JJTC 2ERJC 4MQTB 3WJJC 3FMGH 2FYYB 4XTRD 4K9EC 2R69H 4NUGH 3LVEA 4E41A 1JFQH 3RWFA 2ZCKL 4OCNC 2X4UA 5C71A 2FX7L 3KYNB 3WFBH 3RPIA 5IFJB 4NO0D 2E8YA 3ARFA 3DURA 2DQDH 4WU7B 1T2XA 2JJVA 3WIFB 5E2WH 5T1DH 5CD5C 4PS4H 3HNVL 2DQTH 4JPWH 5CD3A 3ALWA 3OXRB 4OZFB 2GY7B 3DUSB 5BQ7A 4XMPL 3D25A 3OWEA 5DR5H 4QNPE 2P24B 1NGQL 2AEPH 1LEKB 3LQZB 1U3HB 2HT2D 4HK0B 2P8PA 5TFSL 3WUWA 1XCTA 3EYVB 5FCUL 4JY4A 3MLSH 2DQGL 1TTUA 4Y1AD 3JV5A 3JUZA 4LRNH 3FO2B 4NUJA 4PG9A 4P3CL 2HJLA 3SDAA 5HY9A 5FXCH 1NGWB 35C8H 4M1GH 3LKOA 3IU3B 4OCRH 2UZXB 3NH7L 1IGFL 2A6JA 2JELH 1IC5L 1YPZF 3U9PL 5ESAA 4RAUB 4PGJA 5J11C 2FJHB 2FHCA 4TNWF 1YEGL 3NGBC 1JMZA 2BNRD 3O81A 3X12A 1AGEB 2EKSB 2Z31A 1JHTB 3SGEH 2YD7A 2UUDH 4KZEH 5J57B 2ZCHH 5IEKA 2BOBA 4E41D 1RZJL 2P45B 2HAZA 3O3DB 1DQTA 3SGDH 5E2VH 1NC4A 3VXMB 1P7KA 4WGWB 3P4OB 1QFUH 5GRUH 5INCB 5JHDB 5CEXA 4UIMA 4AJ0A 3GSNH 1YEJL 5F97E 5F21B 2PTTA 2DLFL 2VLRB 4PJEB 1HH9B 2E8ZA 4GH7B 2DM3A 4YPGA 1X5GA 3U36B 2YHGA 2RJMA 1NAMA 3EYUL 5JW5B 2DQCL 2AEQH 3SKOB 4M93B 1FZOB 3TIEA 3GKWL 3MLWH 1OY3B 3OAYH 2Y5EA 1A4JA 5HHXL 3UO1L 1XZ0A 1G0DA 4RWHA 1RD6A 3GNML 3HE6C 4NJ9L 2ITDA 5EO9B 3VFTB 1IM9A 4MNHB 3VXTB 4J23A 4N1EA 4AG4H 4HCRL 3SDAD 4PBVC 1HSBA 4U3XA 1A7NL 1NBYB 2UZIL 4NHCH 5BRZE 2O93L 1ZAGA 3KPQB 4MJ2A 4H8WH 3HR5A 3SDYH 4CN1A 3KPSB 5DK2B 4N8VA 3UPRB 4H8WC 4J6RH 5GGVH 1KPRB 1NMCC 2F5AH 5B39G 1E27A 3NFNA 2HTKD 2VLJA 1QRNA 2Z0BA 1FG9C 3LEXA 4UAOC 5BS0B 3EO0A 2Z31D 3D3VB 3HI6L 4MA3B 1W72B 3K1DA 3FQTA 4DOHE 4I18A 5IESH 1YMMB 5HYJB 4P5MB 3I02B 4HXBL 1QBBA 4ZNCD 1TZGH 5DD3H 1FIGH 1NC4D 4X0KB 1G9NC 4NO5A 5J12B 2XWJA 4K8RL 5IEHB 1I1FA 1FFNA 1KSRA 5TH2B 2PW1B 3LHPL 3TC9A 2J7LA 2BFVH 3ROLA 1AJ7L 4QEGA 4U1SB 4PGCA 2WQ8A 3QUKB 1A4KA 4M61A 2X89D 1GZQB 5F7FA 4I48B 4XTRC 3MRLB 3G6AA 1RZIA 3P0VH 1JHKL 3VD4A 3ECBB 1TNMA 4JHBA 3MCG1 2AJXH 4PRHD 3IETA 2KDGA 3P9MB 4O2CA 2P42B 4ZOCA 4LCCB 5IMLB 1KB9J 1WBXA 2LVEA 1IM9D 5I8OL 3MSPA 4PR5B 4PTUA 3LKRA 4BZ2H 2V9QA 3WSQL 5IKCB 4K9EL 3V0WL 1JWSB 3GHEL 3LKQA 2XWTA 3RHWF 1MWAB 2ADJB 1WFNA 3CXHJ 4WTXA 4KK5C 2HT2C 1T1WB 3BEWA 4XVUC 3TCXA 3ZO0A 3B8YA 4H25A 4QYOA 2H41A 4WU5B 5JXAH 2G9HB 5T1DL 4JFZH 2VLJD 1QRND 4PS4L 3UROR 3LKNB 2HT4C 3W39B 4HWBA 4WI2A 4R0LC 3NPZB 4X6CB 2X41A 4IS6A 4MJ6A 1G1YA 4NQEB 4KGJA 2P5WA 1S7RB 2FBOJ 4NCC2 2EDYA 2R2HB 3D85B 4HUKB 2YSSB 3L3HA 1VSCA 5KVGH 3CFBB 1EAPA 3HUJB 1A2YA 5C6WH 2Z4QB 4MWFA 1BD2A 5T5FH 5DJCA 3MV7B 4UIKH 3GEWB 1HE7A 1C16B 1D5XA 1UZ8A 5F93C 1WZ1H 2BSTB 3NCEB 2AJ3B 1U58B 5GRWA 1D6EB 4Y4KA 5EO0B 2DD8L 5DFWH 2NYYD 4HPOL 5EG6C 4KFZC 2P5WE 3OV6A 5F88B 5INDA 3EJYD 4LEXL 2MQ3A 5KZCD 4UTAL 2YUWA 4JFFE 1EGJA 4YR6B 1UKTA 3HNTL 4O51B 3U0TB 2QSCH 3T0VA 1NGZB 4HH9A 2P44B 5FO7A 5HYQA 4F33B 2Q8BH 3BMVA 5D71H 1OF2B 5BMFH 3LKSA 3GSRB 2OL3L 1A6TA 1HOCA 3QNXB 4D0BB 1WV7T 5BVJA 1V3MA 5H94B 1FVCB 4F7PA 4CGTA 5JXED 4HUUB 5E56A 1FAIL 5JDSB 1SYVA 4JM2F 3OGOE 4JJHA 1JE6A 3L3OB 5TDPA 5JMRA 1H0DA 2P5WD 1Y18B 2CDEB 1YN7B 5DUMH 2ZCLL 1ERNA 3CFEA 4XNZB 3R8BB 5I9QC 4LU5H 4XBEH 5ADPH 2XKNB 2Y6SD 1KIPB 2BSSA 3MRMA 1XF4A 5DHYB 3RGVA 1HXYB 2Z31C 1VDGA 4MGXA 3QXTA 1BD2D 3O9WA 4HFWB 4XCEB 5EOQH 5ITFB 3AS1A 4AG4L 2VZTA 1Q9LB 5IVOA 3V6OA 3BKYL 3R1GH 5DRNA 3IRPX 1PLGL 1NC2A 1WIPA 4H8WL 2YN5A 3DIFA 3VH8A 1NFDE 1Y6KR 4Y4KD 4RMWA 1MFNA 5I18L 4NM4L 4WNQA 4DZ8B 1RFDH 1UZ6F 3ISWA 5HGDB 5K33A 4CW1A 1A6PA 1F02I 3T8XA 2A6DB 5C09A 1NAMH 1AXIB 1HYRC 3AB0B 3HZYA 4Y4FC 1LO2L 2ICWB 2G75A 3V4UH 1G9NL 4FTVA 5C0JA 4PB9H 3GJEA 2H3NB 2NMSA 5IF0A 4FQXB 3C08L 1B4JH 1G7QB 3QQ9C 1PGRB 3VFRB 2HVKA 3GSUA 5BZDA 4OGXH 4JO2H 3SO5A 2VXQL 5KS9A 4MYWB 3ZDYE 2XA8L 3I6GB 4JFYA 1M7DB 1OSPH 3ZLQC 1E6OH 1T1ZA 3CLEL 1AIFB 3MRPA 1V7NH 2AJXL 4M1DH 2DLHA 5H37G 3DHJA 1J86A 3MNWB 4U1IA 2X1PA 4PD4J 5KVFL 2G60H 4OQ1A 2NNAB 1V05A 4ODXA 3RGVD 5DQDH 1QRKA 5BVPH 4LARL 5DMIH 3CK0H 3O9WD 2NY2D 3FRPA 3BKML 4HKXB 4WV1A 5AAWA 4WFGE 3V5KB 3L7EA 2IPUG 3HNSH 3LQMA 4GG6B 1NC2D 2VWEE 2CR3A 5DUBA 5JO5B 4H88L 5KTEH 4NWUL 4XXDA 1ZLUK 4TULH 1NJ9A 3UBXA 4KK6D 1FNHA 4OZ4A 4LASL 5TE4L 4OFKA 3X3FH 3V4PH 3X13B 3JV6A 4UI2A 1QKZH 5C09D 5ESQA 5JMOC 4PRBA 3I75A 5E5MA 5IB4A 1OB1B 4OCWH 3MV9A 1T2QH 1YN6A 4FTVD 5I76B 3MUY1 12E8L 4QRRA 1ZT7B 3EO1A 2E7LC 5IM7B 5E7FA 1QSZA 1YUHB 4WFGD 4N9GB 4X7TA 2XTLA 2Z91A 4HEME 3GIZH 4ODHL 5EULV 1K4DA 4XHJD 1RUQH 1A47A 1R24A 5DGQA 4UIKL 4L4TE 4EN3B 1OAXH 3SGKA 2HJFA 4YDLB 1QACA 5M94B 4P5TB 3ZT7A 3Q2CA 4XBGA 2GYSA 3IU4H 5GISL 4JO4L 2AV7B 3AY4C 1TTFA 1LP9B 4HWBH 4NQVA 1X5YA 3MV9E 5JXEC 1I9EA 1HHKA 5LGJB 4QRRE 3O6LL 1NCNA 3NTCL 2X4OB 3RWDA 2P48B 3FB8A 2QSCL 5FGCB 3KLDA 4IRJA 4YAQA 3HG1A 3R06B 3W0WB 3FRUB 4MMXC 2ZOKA 2Y6SC 3GSWB 2VXSL 2YEZA 3H42L 2E3VA 5EC1A 3G5XA 4Y7MA 1FNEA 4MNGE 4U2ZA 1JTPA 3PGFH 3MRKB 5IBLD 4HIJA 5IFHH 4P2OA 3TH4T 5I16B 2DI7A 1AY1H 3MCKA 3MV9D 1BMGA 4NDMA 4ZS7L 4PJDB 3R8QA 1I7ZB 4PRIA 4F37K 1T4KA 4QRRD 4ELKA 1U92A 2CRIA 1C12B 3BN9D 3S3SA 1CT8B 3OKOB 1FCCA 3ARGB 2J4WH 3STZB 1EGJH 4HC1L 5DQJB 1CBVL 2EDKA 3UJTL 4UOW0 1IEHA 1BM3H 1Z0NA 5BW7A 3NAAL 3R1GL 3QIUB 3MRCB 4OI8A 4W81A 4UU9B 4BFBD 4UQ2B 5FM4A 2H2SD 3ARQA 3OF6A 4OFIA 3CH1A 4P46A 3KDMA 4PGZA 3JWOH 2PCPA 5TDNA 1XF5A 3OG4B 3MLUH 4PRIE 4ZG1A 5ACZA 4ZSOA 3HZMA 4K7FA 3F65A 3B4NA 1EJOH 4XXCC 5D1ZA 4TUOB 4JY6B 1A6ZA 4IRJD 3QDJB 5HDQH 3HG1D 3RTQA 4PB9L 3EOAA 4OLZL 1J05B 1J0ZA 3GMOA 1I7RB 2NY3C 2HKHH 2VL5B 1KJ3L 1KGCE 1RHHB 5CKAA 2IAMA 4EUPG 2NY2C 4MA1C 4ZDHB 4RNRA 1AKJA 4JLRA 4OGXL 4JO2L 4P2OD 1RJZB 2VXVL 4U31A 4QY8B 1C7TA 1R5WA 3CFIC 4E0RA 4QTHA 4OI9A 3ARBC 1VACA 4PRID 3IJSA 1WK0A 4ZSOE 3S96A 3MRQA 1K85A 3OKNB 2YA1A 2UYLB 4KVNH 3GSQA 5BVPL 1AGBA 1Z5LA 4M8VA 1OHQA 3DMMB 3SCMA 1CN4A 5IHZA 3BQUB 3VG9B 5CHNB 4KXZI 1KGCD 5KW9L 4MJIA 3PWPB 3NIDF 5T1KA 1KYOJ 5KTEL 3OF6D 3D2UA 4P46D 5DDHA 4Q6IB 1I1RA 4QKXB 4XWGH 4EI5C 4NZRH 1FZKA 1A22B 2WBJA 4QHUB 3X3FL 1JK8A 4XHJC 5E6IB 4GG8B 1QKZL 2IG2L 3GMQA 1U8LA 1IL1B 3SBWC 1KC5H 1V7MH 3KPRA 4ZPTA 4XAKE 2NY0D 3PP4H 1XGQB 2CKBH 3RTQD 2GTZB 1DBJL 3A0OA 2VIRB 5DJYB 4JANA 1TQCC 5KANI 5AUMA 4NN5B 4LBEA 4U6XA 3ROOA 1LO0H 3IDIB 1S9WB 4M48H 2CRYA 2ADGA 4JGUA 4V1DA 3OKLB 1IAKB 4L9LB 4MJIE 3S37L 1ZE3C 2IAMD 3HRZA 1P53A 2DAVA 3KHQA 1RUQL 1AKJD 3AC0A 3TO2A 5C0RH 5JOFA 4W4NA 2PO6C 2ZSWB 1OAXL 2C3XA 1HDMA 2NXZB 5DURB 5IVZA 3ARFB 3DURB 3WIIL 4Z0BH 1QBMH 1UM5H 4N90D 4LCWE 5EBMA 5LBSL 5F7UA 3KPRE 4FQCH 4XAKD 1P84J 5GGUB 3ETBF 3KPNB 3D25B 3MQIA 4XCNB 1FV1A 3P0YH 4JZJA 4MJID 1A7PL 4V1DE 4XVTL 2P8PB 2Z92A 4JPVL 5T1KD 1XCTB 3VRIA 3BN9C 4OIAA 4GSDH 4GRLB 4KRLB 1YPZE 1VADA 1WFTA 3EHBD 3L1OH 5IMOA 1UYWH 3G04A 3TO4C 4PG9B 2ESVA 1SQ2N 5I1LA 3O2DL 1SEBB 1X5XA 3VGAC 3EZ8A 5EZOL 4R7DA 2A6JB 4GRWE 3SGKC 4D9RE 1U8MA 3RVTC 5DZLA 4FXGB 1BQHG 2QQLH 1JUFB 3AROA 1TCRA 3KPRD 3H3KA 3FT4A 1FAKT 1OAZL 5EO1A 2DQJL 4KHXH 5CGMA 3O11B 4ZPVA 1MIMH 3RBGA 3L5WA 1RY7B 3OB0H 1DUZB 1AP2A 5CWSA 5IJKA 2EDJA 4XP6L 3TBSB 2YD9A 2FO4A 3S98A 5IB2A 2X5PA 2H8PB 1T0NA 1CXIA 4X5WA 1DN0B 1Q0YH 3DROB 1ROWA 3CSYB 4G6FB 2ESVE 3T04D 5HVHC 1FPTL 1P7KB 1Q9KA 5BRZB 3QCVL 2UVFA 4ALAL 4UIMB 3VI4F 3JWOL 5DT1H 3T3PE 2KBGA 4UQ3A 3L5XH 3P4NA 1CL7L 3MLUL 2J5LC 4NRZB 1O0VA 4YPGB 1MJUL 4ODSL 1JNNL 3ARZA 1NAMB 4K7PL 2V2WB 3WLWD 2YZ8A 3LB6C 4LOUD 1K9TA 3ZDZF 1T66C 3TIEB 3CCHB 4M9PA 4G7YL 4HZLB 4L5FH 4UT6L 4KI5E 5GGQL 3QG6B 5MI0B 4QRUB 3UC0H 6FABL 4WO4A 4QGYA 1ORSA 4CVXB 2HKHL 2ESVD 1A5FL 4YHIA 4FFWC 1I8MB 2V17L 2V5RA 5E8EB 1MREL 3W5MA 3MFFB 1FNSH 4NGHL 3ZKMD 3U0PA 4RDQF 1CGYA 2W59A 4YE4L 4CN4A 1YEKH 5EPMA 2DYPB 5BZWA 2RQ8A 1DSFL 3NFNB 1KJMA 5KS9F 3LEXB 2IGFH 5MERA 3DYMA 3EO0B 5B8CC 2ICEB 4KUCF 2OZ4L 4LSTH 4KU1A 4KI5D 4RBPH 1WZKA 4QOKB 5HDBE 3RWHB 3S4SG 3VD7A 4LVHB 3QFJB 5ACLA 3RX7A 2WNGA 1JGUL 4PRNA 1SYSB 1G0XA 1RSFA 1U8PB 4OBRA 5GS3A 2OXGA 5T3ZL 1IGIL 3OKDA 3QCUL 3B9EA 2C1PB 4P2CG 1ZKAA 3EJZD 4ZD3L 1LD9A 3TBYB 4CVWA 1UCBL 4IDJL 5E2JA 4Z7WB 1W0VA 4E42B 5EUKB 1AQKH 4U0RB 4PGCB 3QI9A 2ARJA 4HD9A 4TVPD 5DD5L 1O7SA 1PKQB 3G6AB 3HN3A 4ODWB 1RZIB 1Q0XH 4Z5RA 5HI5C 2CJUH 1TVBB 3LPFA 4YHPB 2VDKH 1BBDH 4NKOB 3PP4L 5CLTA 2R29H 1QNZH 3DECA 4F7CA 1MJ8L 3O0RH 3G5ZA 3MYJA 4M43H 4ZFGL 4E5XA 5IFAH 3GMNA 3ZE0F 4WO4D 3V5DA 1WCBB 4LL9A 5KZCB 3I50L 1Q38A 4M48L 1G7LA 4DW2H 2XIDA 3IT8D 1PY4A 3ZYOA 4Y2DA 3QEUA 4LLYB 3IKCA 1FZMA 1H5BB 2WWMD 5ICYA 1JJUA 1JNJA 1X6LA 4OB5L 4JG0H 3HPLB 4YQXL 4KWUA 3RHWK 4H25B 1CF8H 1FORH 3OR7B 4Z0BL 4HKZA 3QULB 5C9JA 1UM5L 3SGDI 1P7QA 3RJQB 1T0MA 2HH0H 3BZ4A 5IW6B 3PL6A 1FL6A 1UKQA 3V8OA 5AZEH 3LAFA 4LLDA 4F57L 5IWLC 5CEZL 3BGFB 4MD5A 2HJKA 4Q97A 4JFFB 1NLDL 5A2JH 4PJIF 2GUOA 1A2YB 3DX9B 4RDQG 4ZUTA 4R4FL 5AZ2L 3U82B 3VWKA 1JF6A 3P11H 4Y16B 3FN9A 1VCAA 5LKNA 2AXFA 5I1GH 5JUEL 3QWOA 4DN4H 1UYWL 2DF3A 3QH3B 3S6CA 2HMIC 3RIFF 1UH3A 3QI9D 1R6VA 1NCCH 3MMEA 4EEEA 1XGYL 4HS3A 4X9GA 2UUDK 3EO9H 5JHLH 4ONHB 2DQHL 4PJHF 3PWLA 4GRWH 5DJ6A 4PRDB 1AGFB 3I6LE 4U1GB 4N68A 5ALBH 1RUKH 3U7AA 2R2EB 3G5VB 1RK1A 5INDB 3MRFB 1YEHL 3F7YB 1YEIH 1I1YA 3QCTL 1L9NA 3WLWC 4Y2DD 4WHTB 3QO0B 4HH9B 2OJZL 5JZ7D 5TF1L 1Q0YL 3QA3B 2ZWLT 3GSOB 1E28A 3LKSB 2R56L 1JP5A 2IMNA 4WW2C 2D4DA 5BVJB 3OAYK 4MZ3A 4F7PB 1CDJA 5ILTL 1P7QD 1ZS8A 5TDOB 2WP3O 4M6ML 1T3FB 1SYVB 3L5XL 1NFDB 1U41A 3BX7C 4LSSH 4C55A 3I6LD 1DLHA 2GEEA 4XPAH 3FT3A 1X44A 4UT9L 1WWAX 3PL6D 1AD0A 2P5EE 1NUGA 1H0DB 4YGVB 4DZBA 5CGTA 5FUOH 4LPXA 4S1SH 3BYYA 1F6AA 2EICA 1WISA 3RNKB 4FQJL 3DVNB 3EOTL 4MDJA 1J5OL 1BFTA 4KKCD 3CFDA 4Z8FH 4WUKL 4L5FL 1XR8A 2VDQH 5BOZG 1NCWH 4NJAH 5H2BB 5CP7B 1XF4B 3RGVB 3UC0L 5FF6A 1WWBX 3O9WB 3T0WA 5ICXB 4U1KA 4KAQL 3TIDB 3KPPB 5GGSB 5H35B 5SV3A 3WIHA 1NMAH 2ITCA 3G08B 3BVNB 4JRXA 4U6VL 2HLAA 3KLAA 1N6VA 4U0QB 2X42A 2HP4A 4CW1B 4TVPH 5IOPB 4JPIA 4RRPA 1IRAY 3T8XB 2A77L 4LSTL 4Z7NE 1H8SA 4HG4K 1OM3L 2BVPA 2DL9A 4YC2B 1OW0C 5FOJA 3QDGA 1MFBH 5JR1L 5CUSH 3IGAB 1KB5L 1SHMA 2IPKA 4ZTPH 1KCRL 4JFXA 4HUXB 3MRRA 4F9LC 3EAKA 3BAEL 3ULVE 3OB8A 2HVKB 5GJSH 4WHYH 3E2HB 3HMXL 3SY0A 2EDDA 5JW3L 1CVRA 1VFMA 5D70L 2DB8A 5I6XB 3N1FC 1REIA 3AREA 5HHVL 5D7JA 4IBLT 2EXWD 4MQXD 1E4KA 2CKBB 2R29L 3O0RL 4CL7A 1JV5A 1MQ8A 4ODXB 3QDGE 3MGTB 3ZDXF 4OZIA 4LFHD 15C8L 5C0IA 4ZS6D 3AU1A 3UX9B 4DGVL 4ZO6A 4XB8A 4GS7B 4OV6F 3DX8A 3ULVD 1HHJA 2EYSB 1KT2A 1UM4L 1A3LL 4J1UB 4JRXD 1FE8H 3HFMH 4IJ3C 4X6BB 1TFHA 4L4TB 4XXDB 3ARPA 4LHJB 1D5MA 1ZANL 2JTDA 3DI3B 4EUPA 1CF8L 4JN2B 1CGVA 1G7MA 4NBXB 1IGYA 1X5ZA 4P4KC 2OSLA 2CUIA 5K59F 4MAUL 3MNVB 3JTSA 1JF5A 1VEMA 3CNKA 1HEZB 1NBZA 5F7KC 4YHML 4LF3B 3IDUA 4BUGA 3BN3B 2ATKB 3I9GH 2XNAB 3KS0J 3WO4C 2CK2A 3D69A 3MV9B 4H26A 5AZEL 3EFDL 1KB9K 3X14A 5L6YL 1YN6B 2DIJA 3IFNH 1GHFH 1J0HA 4OZIE 4D8PA 1XCQA 3EO1B 3GBNH 2Z91B 1S7QB 1X5LA 3CXHK 1OAQH 1NUFA 2VZ3A 2C4FU 4LLUA 1Y0LB 1R24B 4RISH 5D6DC 1JGEB 4PP1D 4U1LB 3SE3A 1UJTA 2HJFB 2BXZA 4FQPA 4WW2F 4MNGB 4F8QA 5J6GB 3LH2H 1W8NA 5JHLL 4XBGB 5IGXH 2CUHA 2EXYD 5HHPA 1Q9OB 1CCZA 3ARED 3INUL 3N9GH 1MIEH 1EEQA 5D7JD 2RIKA 2K9UA 4JRYB 4POZC 4HUVA 1A6AB 1TVHB 3RZCA 1ZV5A 5EU5B 4G8EA 1I3GH 1WT5A 3LS5H 1JN6A 3RWDB 3FB8B 3QZWA 2CIKA 1FL5B 4GAJL 2F54A 3VD5A 3QQNA 4IRJB 5HVWA 1AD9A 5GRVL 1FBIL 4KKCC 3KS0H 3AMLA 4GQ9L 1KCKA 2ZOKB 1XH3A 1MJ7L 4M4RA 5AWNH 3TYFA 5KJRL 1NFKA 3GI8H 1ETZB 4BA8A 2UWEE 5EC1B 1T04A 4OM0H 1U3YA 3RWGA 1FNEB 5I1DA 1KFAL 4ZFFB 1KENH 3DYOA 4P2OB 2WLZA 3MOBL 1I9JH 3TZVA 3T1FB 4NDMB 4WWKA 4S1SL 1QBLH 2FEDD 4GW4A 3LQAC 3UEZA 3DARA 4O9HH 3WHXA 1A7RL 5DJ8A 5KOVC 4Z8FL 2VDQL 4RA0C 3BUTA 3M8OH 4K2UL 2F54E 3BGAA 3WS6A 3CLFH 1VHPA 5DS8A 4YDKH 4LDOB 1P5VA 2MFNA 2X4SB 1N5AA 3BKJH 4N9OB 3E3QC 3V6FA 4KKBD 4S11A 3C6LB 4I4WA 2ENSA 1F4AA 1NDMA 4N0RA 3RDTB 2MPAL 3T65B 3LSOA 3WXWL 1SVCP 5EC2B 1CFVL 1DE4A 4FG6D 3KDMB 2F53B 4IM8A 5TDNB 5HGGS 2VLLB 4TVPL 1GCFA 2QQKH 2V5YA 1TQBC 4PJCA 3RZCD 1BQHA 2G5BB 4HWEH 5GSVB 4MVBD 1IZJA 1GGYA 3KPMA 1LK2B 5E70A 2F54D 5D1ZB 1UG9A 2NY0B 2BVEA 1RK0B 2XFXA 2GJ6A 5CUSL 3GMPA 1HNGA 4MNQB 2MTPA 4HJ0C 3U2SA 1MY5A 2NPLX 4UILH 3J7HA 4HDIB 5D6CA 1SEQH 4Y5VC 4FFYH 2VNCA 2IAMB 5L88L 5L9DL 3ULVH 1MFEL 3WIHH 4JLRB 4QTIL 5MENB 4KGLA 4JZOA 3K7UA 1ZA6A 3TZVD 3QUMB 2D7NA 2WUCH 1I7TB 1U8HA 2VR9A 1OGAA 1QR1A 2AK1L 5F8QC 3S96B 1QG3A 2OBGA 5E8DH 4XHQA 1A9EB 5GZOD 5SWSD 3QHFH 4JZNA 1NCUA 3CUPA 3GSQB 2NY6C 4LHUG 2I60L 1Z5LB 2GJ6E 3Q5TA 3SCMB 3CDYA 1IAMA 1ZGLB 3M07A 2W9EH 1MHHA 2XKUA 3T0EA 4EQ3A 1FE8L 5IROC 2VDOH 3D2UB 3HFML 5DDHB 3CX2A 4RZCB 4L8DB 1GGBL 2J8UA 3T3MF 2WBJB 2E5EA 4PJ8A 4Y5XC 5CJOL 4PLOB 2CIIB 2XTJE 1G9EA 3RY6A 4LCWB 1U8LB 4PD4K 5I1IH 1CE1H 3KPRB 1CTOA 1QLRB 3IFPA 5HHME 5ACMA 5B39B 2CDGB 2VDPL 2EXYC 2GJ6D 3IFNL 1RVFL 4U3CA 3BH9A 3AREC 4JANB 3OJ2C 3SDDA 4HT1H 5AUMB 4LBEB 3UYRL 5CBEA 2CR6A 4YEFA 2ADGB 2EDFA 3I3BA 4V1DB 3I84A 5IR1A 3T0EE 3CPLB 3HRZB 1HQRA 3L3GA 1T03L 4UMGA 2R1YA 3TO2B 3LN9A 1YPZB 3RU8H 2J8HA 4Y4HC 5IQ9A 1CU4H 1RUAH 4PBXA 4PP2A 1MVUA 4KMTH 4EUPH 5IGXL 1F4XL 3C2AL 2XTJD 1OGAD 4MCZA 3MJ8B 4GRWB 2CXGA 3AVEA 2WINB 2GK0B 1HH6A 1SJEB 5JIHA 5D2LF 1B0RB 1NAKH 2XPGB 5ANMA 3RX8A 1FV1B 3IS0X 1MI5E 1LDSA 2QEJA 5HGBB 2DQFA 1FFOA 1FL3A 3T0ED 1IC4L 4QRPA 2Z92B 1KOAA 4Z7OF 2WM0A 2R8SL 5AWNL 4AL8L 3GI8L 1A64A 1JYWA 2C1OA 1EO8L 4MHHI 2E6JA 5IMOB 1WZMA 4J3TA 1SJHA 4OM0L 1JI2A 4PUBH 3G04B 4PJ8D 1EFQA 4PLJD 5I1LB 4KKBC 1TJIH 1KF9B 3C87A 4P23A 4TTDD 3B83A 3HAEA 1I4FA 3CSGA 5F9JA 1QFWH 1U8MB 1P5UA 3LQAL 4I13B 3V4VL 2NX5E 1N26A 5F70A 1ZSDA 1ZHNB 4HIHB 2XXMB 3MR9B 4LAQH 3SOBL 4FG6C 5HDLA 5ANME 3SDDD 3L5WB 4IOSD 3QEGL 3E6FA 1MFAH 1KELL 3LDBC 3Q3GA 5ELIA 3REWA 3CLFL 3RJDA 4YDKL 4QRPE 2V2TB 5IT2L 3RP1A 4FZEL 4JRWA 5I8KL 5IB2B 3WJLC 4EIZC 1T22A 3C5JA 4JJ5B 4X5WB 5J9PA 2J1KA 1UWEL 1JWUA 3H6JA 1AQDB 4RMRA 2XZCH 2I07B 4ZAKA 1Q9KB 3P77A 1Z6JT 3ABZA 3FO9A 3KWWA 4Q9QL 5EOCH 1J0YA 1UH4A 3O2VL 2JB5H 3L95A 4UQ3B 2BZDA 1U8NA 4XWOD 2NY4B 2WP3T 1KXQE 4IIQB 4Z7QE 1EFXB 4G43A 3MBEC 3BRFA 4HW6A 2P7TB 4XVSH 3H3PH 2WIIB 4R97C 4I3RL 3EOBA 2Y06L 4QRPD 1E4JA 1RHFA 2F9BT 2GITA 3CDGA 4UDTA 4YXKL 3WV0A 5DFVD 3U6RB 2WZPD 1ORSB 2BVOA 1KNOA 2EDNA 2A0LD 4YHIB 5HI3D 4JDZB 4U1MA 4P23D 1HILB 4KRPC 4FXLA 3W9EB 4YK4C 5C0AB 3P30L 4M7ZB 3F7VB 4MA7L 5FEBA 3OKEB 1VFAA 5JPNB 5D7KE 1LO5A 3UBXI 1J10A 5MERB 4JM4H 1ZVYA 1DLFH 5GIRB 3QHFL 4HV8A 5BCAA 4JFQA 4NQSA 1VA9A 1DDHB 4CDGC 3LMJH 2Q20A 3EYSH 4CU7A 1BAFH 3GMLA 4LCIH 2IFFH 5F6HJ 1XR9A 2X9YA 2V5SA 4PRNB 2EH7H 5I71B 3SE8H 1KTLA 1IGCL 4LQFH 3OKDB 5EUOF 4FQQA 4ZAKD 1C8PA 2VQUA 2X4PB 3V0VA 4OCSL 1U8OA 4S1QH 1W0VB 3QISA 5J1SC 2ARJB 2B20A 5J11B 4FHBD 1WF5A 4JKKA 5E2UH 1UGNA 1DVFA 4WJ5B 4NQUA 1FNLA 5J13B 3VFVB 4ZFZA 3WLBA 4F7CB 2W07A 4KHTH 4YDVB 4X6DA 4E5XB 4HT1L 3GMNB 3N1QC 2FB4L 5I15H 32C2A 2N4IA 2IH1A 4G7VL 4C54A 5IIEB 1HKLL 1CWVA 1TNNA 1JTOA 4LSVH 3U9UB 4WI7A 1O7VA 3PGCB 1JGVH 3IKCB 5DEFB 1FZMB 1GAFL 4MAYA 5D1XA 3RU8L 2ZOLB 1CU4L 1PKOA 2VAAA 2EE9A 4ETQB 5L2KA 4HKZB 5DRXB 5C9JB 1P7QB 1HHGA 3FZUC 4EI6B 3C60C 4OT1H 3NZHH 4YLQT 4PLJC 1BX2B 1QP1A 5E1AA 5I2IB 1F4WH 4W68A 2N7AA 4P9HC 1NAKL 4LLDB 3TBWB 4S1DC 2JJWA 4MD5B 3TT1L 1ZT4A 4AQOA 5FDWA 4OKVA 1XGTA 1N4XH 1M71A 3VWKB 2R1XB 1N2RA 1CLYL 3FB6A 3OB0K 2OJEA 5IB3B 4PJBA 2JKXA 5L2KE 1B2WH 4KROD 3FOLA 1QFWL 4UAOB 1DVFD 2DM4A 5DJ6B 5DF0A 1ZK9A 2GJJA 3Q1SH 4I77H 4KTYA 4M5ZL 2KUTA 3FFDB 1K6QH 3N85H 5HHQB 2P5EB 4LAQL 1EPFA 3LKPB 4YHNB 2D31B 4Q9BA 4UNUA 2MNUA 1MFAL 3MOAL 2OI9B 3F7PC 3I3EA 4RA3A 4IMLA 4UINL 5D1XD 2OXHA 4ZTOH 5HTSA 1FLTX 1DQLH 4TQEL 2X4NB 1E28B 3UYOD 2XZCL 1XFPA 5LGHH 4KUZL 5DFVC 5I8CA 5L2KD 2AK4A 4V2BA 1ZS8B 2BSED 3V9FA 2VXTH 3I85A 5HI3C 1DLHB 1IBGH 4GXVL 2HYMA 3U30B 2W9LA 3NCMA 4OIBA 4RFEA 4YDIH 3QPXH 1AD0B 3KXFE 4G8FA 3WDHA 4BUHA 4DZBB 2NW3B 1MNUH 4LPUA 1N59B 3LN4A 4RMTA 1JYVA 5CEYA 4MDJB 1M05B 4LCUB 2O61B 4PY7A 4FQHB 3B9KA 3V5HA 4JB9H 3DX7B 4PJCF 1GGCH 4PRPB 2M26A 4XZUA 4QHKJ 3B9VA 5JIIA 1SBBA 5E94A 4POYA 5KSAA 4I0PB 1MHCB 3O3BA 4WDIB 3KLHD 1KACB 4PJGF 1J8HB 3O3EB 1C08B 4RBPK 4JFEB 3ILQD 2HLAB 3KLAB 1OAYH 4XPBH 3WFCL 3FJTA 4Y5YA 4JG1H 3IDXH 1JPFA 2GK2A 5F9OH 3TN0C 4NN6C 4FZ8L 3MXWH 2HFGL 3NIGE 4JPIB 1JRHH 4PJFA 4XNYH 4DKFH 5LXGL 3O3AA 1X4YA 1DEDA 1DLFL 3ESUF 4JQXC 2I9LA 3P4MB 3TWCL 4KRNA 2AGJL 3C5ZC 2CO6B 2QSQA 2BVPB 5GXBB 4LSPL 4FXKA 1MOEA 1BAFL 4L8SC 3QDGB 4JY5L 5IG7B 2X4RA 4JVWA 3ARDC 3GKZA 4G80A 2IQ9H 2RGSA 1U3JA 4JFXB 1DEEB 5EU4A 3MRRB 5ISZA 5IK3A 1OP9A 2AK4D 5DJ0B 3CSBA 1FNGB 2EYTA 3PV6B 4PJ9C 5CZVH 5C3LD 3NABH 4M7KL 5IVXA 5DGRA 3BDYH 3NCCB 4I9WE 4NP4H 3GJFA 5E8NA 1WBZA 3VWJA 1AR1D 1T5XB 2JIXA 4X83A 1WTGT 5F44A 5TPWH 2B1AH 3JTTB 2IBZY 1OD9A 5E4IA 1A1MB 2B1HL 2BDNH 5KSAD 4QXWA 4DVRH 1C5DA 5FKAA 1FVEA 3V2AR 1OOAA 1U42A 2ICES 3AU1B 4XBPB 3FOMA 5DEGA 5C7XH 2R2BA 4XX1G 5ALCH 3PP3K 4KKNA 1QSFE 2BJMH 4D0CA 4LSUL 4YPJA 1YNLH 5IVXE 1BEYH 1GIGH 5L7XH 5KSUA 2NY5H 4EUPB 4I9WD 5J6HB 2VH5H 1G7MB 2IH3B 3BIKA 2C4FT 1RZFH 1IMHC 2OSLB 1CZ8L 4UDUB 4OT1L 2D7PA 3JTSB 1ACYH 4P9HL 3IDJA 4MQ7B 1NBZB 1XF2A 4G9FA 2HG5A 5JLZA 2KPNA 4NT6A 4UB0H 3VFNA 1A9BA 1YYML 4X9HA 1DVFC 1U95B 1XCQB 2IWGA 3BUYA 4QF1A 1EJ6A 5C0DB 2BMKB 3UTOA 3IKKA 4LK4A 2FJGA 3H0TA 5IHBA 5ISZD 1AFVH 1E0OB 4OZHE 5LWYH 4F7TA 3IXAB 4ZUWA 2UWEB 1ADQL 4HFUL 5J3HD 1DUYA 1EMTL 3CZFA 3AXLB 1NPUA 4QWWD 5D1XC 3S35L 3VWJD 2O5XL 3MRNB 5HHPB 4UV4H 4G9FE 2PN5A 4I77L 3CVHL 2VZ1A 4HIIA 4Y4FB 5HHOE 4OGZA 4P4RB 3S34L 3STBA 4R2GD 1P2CB 2QTEA 1H3PH 1CLOL 1BBJB 1TETH 3MRGA 2CIKB 4IRSA 2FJFA 2F54B 1K5NB 3D0VA 3VRJA 2VQ1A 2BVQA 1I85C 1A7OH 5JQ6L 1F5WA 2B5IC 3RVWD 2VITA 1XH3B 4W4OC 1IEAB 1NL0L 2QADC 5LGHL 2E9WA 1F4YL 2P43B 3EW3B 1R3IH 4OUUA 4XMLL 3WCYA 1LK3L 4X5XA 3T09A 4G9FD 3BPNC 2YOCA 1CDYA 1QO3A 5FYKL 3TZVB 4OAWA 4YDIL 4YH6A 2GKIA 2HFFA 4WWKB 3BPOC 3WHXB 2Q7YA 4QXGH 4N8CH 3KGRA 1OTTD 5D96C 4JB9L 1MVFA 2X4QB 5T33H 2ZUVA 4OCXH 3C8KB 3IFLH 4PTTA 1XGUB 5DS8B 2NY1D 1FJ1A 3HZVB 4KKAC 3SDCC 4RFNC 5ESVB 4I4WB 3RKPA 3VXRA 4C83A 1DQML 3MNZB 1S9YA 2D03L 2JJSA 4MLSA 3GM0A 3WFHA 5DD6A 5KSBF 3LSOB 1QFWM 3N1PC 3DYPA 4BQ6A 1KN2H 5DC0A 1VFBB 5EU7C 4FFZL 2OTWA 2A9NL 1T5WB 4ELME 2DQIL 3IDXL 1CG9A 4BSJA 3MXWL 4K3DL 4XNYL 5L8KB 3NA4A 1BQHB 1RIHL 4M5YH 2IEPA 4ETYA 2VKWA 1J0KA 4IRSD 1GRWA 3Q6GL 1AR1C 2DI9A 3CC5B 2XFXB 3A6BH 5HPMA 1NBVH 3QUXA 3O6ML 1D5BA 1BQLL 1F3JA 2V7HA 1U8QB 1IGMH 1UM6H 2VL4A 4KC3B 1UFUA 2VDNL 3VXRE 4P59H 5KSAC 1NCTA 4JFOB 3ET9F 2MHAA 5CZVL 2DJUA 3RUGA 3V95A 3EKCA 3S36X 5IV2B 1ND0A 4PJ5E 5HYSG 3ZE1E 1KJVB 1AE6L 3LS4L 2BXYA 1U8HB 3UTTE 1V5JA 2XTJB 5HHNA 2AS5M 3P73A 2A74B 4KMQA 4AEIH 1QR1B 4ORZC 1JNHB 4AT6B 5TPWL 2B1AL 4MXVE 5JA9A 3CFCH 4ZO9A 1BZ7A 1G6RA 3ARTA 4HLZH 4JQVC 5HHMB 4YFLF 4OLUH 4FMKA 4OD2B 4KKLD 1G7PA 5I1EH 4CUCA 3WNOA 4XPGH 3QNZB 2X1OA 4UT7L 4PG2A 3VXRD 3BH8A 4XNQA 1S7VB 1K8IB 5ALCL 5D1QA 3T0EB 4X6DF 4HBCH 1LE9A 2AKRB 3RUGE 3TCLB 5E24E 3GZKA 1YNLL 1MY7A 3AM8C 2GTWA 1D5IH 2YD6A 5L7XL 4LRIA 4YO0B 2X05A 5GGTA 4JFHE 2VH5L 1MAJA 5KBNC 4PJ8B 1RZFL 4XB7A 1UXSA 2QQQA 2EIDA 5EIIA 2Z8VC 3GJFH 3VGEA 3T77A 4YWGL 5JOPE 5J3HC 2FYYA 4D94A 3IFPB 2MSPA 4DVBB 1E4WL 3QUXD 4KZDH 3KYNA 3H3BC 2JJUA 2LU7A 5IFJA 1FGNL 4OD1L 4WU7A 1MI5B 3MLYH 3VXUA 1U0QA 3S4SB 3K2UL 5D72L 1L4IA 3OXRA 4OZFA 2A38A 3MV01 4XCFL 5FUCC 4NRYA 3B3IA 5DD1L 4R2GC 5K9JL 5IBTH 1CI5A 3L3GB 1B0GA 1IAIL 2P24A 4JFHD 4GKZB 2VR4A 4NNYB 4M7JH 1LEKA 3LQZA 5I75C 5FOBA 1MVUB 4P2RE 4JFDB 1U3HA 1VGEH 3OQ3B 4ERSL 1PSKL 4MCZB 2EKJA 4S0TD 5JOPD 2WWKT 3N1GC 5DHXB 2YPVH 5IW3A 1Z3GL 3G6JA 1BFVH 2NX5B 4FQLL 4DUXA 4PJBF 2AXJA 1CK0H 4BZYA 5IW1A 3FO2A 2C3VB 1S9VB 3E3QE 4NNPL 4TUKH 5DJ2A 5ANMB 4R8WL 3BKCH 3VXUE 3IU3A 3O45B 1XT5A 2NY3B 5LJYH 5D1QD 3OAZH 3K2MC 1I8IA 4ACPA 1SJXA 1I1AA 4RGOH 3FT2A 2FJHA 1FGVL 2ZUQB 1IAOB 3LPWA 1DANU 2APXA 1AGEA 2EKSA 1JHTA 1UH2A 3NCYS 3ARBB 3LCYA 2LTQC 3HMWL 1PEWA 1N3NB 2R0WL 3E8UH 1E4XH 3CU7A 1I4FB 3GGWB 5F9JB 2BOCB 3NIFE 3W82A 3MRBB 3G6JE 3UZQA 4RAVB 5JNYB 2QR0A 3O3DA 1ZSDB 2FX9L 3UTZB 3VXMA 5F9WB 4QXGL 1R0AH 3P4OA 4N8CL 3UTSB 3VXUD 3CXDH 5JHDA 3WKMH 1MAMH 3K1KC 2VZVA 3F6IA 5I66A 1NANH 2B8OT 5B3JF 1G9MH 3E6FB 3RA7H 3Q3GB 1JPSL 3REWB 3MO1B 3FL7A 4K07A 3WL9B 2VLRA 1HH9A 5HGAB 2FD6L 5J9PB 4IRSC 5J0BA 1RUPH 1A14H 4NM8L 2ATPB 5D7SL 3VDBA 1JWUB 5H8DA 4EI5B 5JW5A 3SKOA 1MCQA 2LABA 3OAUH 2K3TA 1U3HD 3CFKB 4I8DA 5FHAH 2IALB 3IDMB 3P77B 1RZKH 2EEAA 3FO9B 2M2DA 1KN2L 5DMGD 5EO9A 3L95B 1JZ3A 1CGUA 3VFTA 1JMXA 1QSEE 4MNHA 3VXTA 4UOJA 2CGRL 4K23H 5A2KH 4G43B 3PHOB 1NBYA 1ORQB 5JHDE 5I1HH 4OQTL 4O02L 5CIPH 3MRHB 1EZVY 3EOBB 3KPSA 4TUJB 3UDWA 1NBVL 4RGNC 1MRFH 3UPRA 4UDTB 4HK3J 4AYFA 4PBWD 5J1AA 3IB4A 1KPRA 1JGDB 4OGYL 3D87B 3RPKA 5BS0A 5HGHA 1AXSB 2EDWA 4G6KL 4MA3A 4KKLC 1LO3H 3PUCA 4NZTL 1YMMA 2YWYA 4P5MA 5HYJA 3I02A 2JJSC 4HWNA 4KJWD 5DLML 5CMAB 4UZGA 3S36L 3OJDB 1NLBH 4X0KA 3VXMD 3DETD 2N56A 5IEHA 5JHDD 1J11A 3FQXA 5TH2A 3M17B 1YEDB 2XZZA 3MREA 2HA1A 1Q72L 5FYLL 2VLRD 1N0XH 1YEFH 4U1SA 4NQSB 2IF7A 3QUKA 4LLMA 4I48A 1FVDB 3MRLA 1KTLB 5FGSA 3BEVB 3TO4B 3WD5H 1P4LB 2DQEL 5K9QI 4I3GA 4J4PC 3VGAB 2A1WL 1JZ6A 1E6JH 2I5YL 4MJ4A 4F8TA 1GGUA 1YMME 5HYJE 4J3VA 3TPUB 5DYOB 3FO0H 3BJLA 4LCCA 3QB7C 1GOHA 2PR4L 4YHYC 4PR5A 4AMKH 3WN5A 1BGXH 1X4ZA 4D9LH 5IKCA 1SY6A 2QSVA 1FP5A 1JWSA 4KROB 3V7MA 2CMRH 3HI1A 2ADJA 3SKJH 1EHLH 3VA2C 1G6RH 3KPSD 3EFFB 3K8KA 4YZFE 4XNXL 5JW4R 1QFWI 4OF8A 2ORBL 2DM7A 4F9PC 3QJHA 1T1XB 4LMQE 2DTMH 2G9HA 1PG7W 3WBDA 2Y36L 3LKNA 3KVQA 5BS0D 3HE7A 2BSRB 3QIWC 3ORJA 3W39A 3V7AE 3D3VD 2HTLC 4OSUL 5HVHB 5ID0B 5E8PB 1PBYA 1YMMD 2BNUA 5HYJD 3OGCA 4NQEA 4MAYB 3MGAA 5TE6L 1FO0L 5KVEL 2E27H 1A7QL 2R2HA 2CKNA 5CJQH 4NKIH 3BPCA 5GGTH 3VW3H 4NZJA 2O5YL 1R3KB 5L2KB 3HUJA 2EEDA 4JPKH 1VENA 5E2TH 5F71A 5TGBA 2ZKHL 3VCLB 4GAFB 1BFVL 4GOSA 1Q9WB 4F2MB 4YHKH 5KVDL 2Z4QA 1UWXH 3MV7A 1R3LA 3HC4H 4MXQD 4P2YA 3SGJA 5E1HB 3U46B 3H9HB 2ZUWA 43C9B 4KK8D 3CZJA 3PHQA 2VDRL 2AJ3A 1MCOH 1AI1H 5T1MA 1U58A 4N1CA 3O3UN 1D6EA 1YC7A 2V6HA 1T7WA 4RGOL 4OZFH 5EO0A 3V0AC 2EC9U 5E03A 5JIKA 4N5UA 2E7CA 4KV5F 1IKFH 3O6FC 5HPOA 3DVIA 5F88A 4PREB 5D8JH 1FDLL 2WUBH 4F80A 5E5UB 5TQ0L 3EOYG 5GS0C 2Y25A 3TA3C 2Q6WB 3U0TA 5C07E 2NTFA 2D2OA 1KTDB 1OAKL 3FOLB 4HKJB 4DKDC 5B8CB 2RFXA 1U3HC 1OF2A 3RVVD 1MCIA 3GSRA 4HK3N 4K3JH 4D3CL 2PXYC 3QNXA 1NFIB 3KXFB 1A0QH 4DK3A 5H94A 1FVCA 5DMGC 3VRLE 5MHSE 5JDSA 4HQQH 1IZKA 3QUZA 3B2VH 4MD4B 5D5MF 3L3OA 4IMLB 2VTFA 3GRWA 1KB5B 4NQED 4WW1B 1RUPL 4HSQA 2CDEA 1FRGH 3D85D 2XKNA 4KJQD 1F45A 4GXUM 1B3JA 3WEXA 4KQ3H 3D6GA 4WEUD 4LIQL 2XRAH 4HFWA 4XCEA 5ITFA 2IADA 3MV7D 3BT2L 4EQ2A 1BVLB 5GHWL 4G8FB 5D7IF 1T89C 3MRJA 1LO4L 1CR9L 3EDKA 3LN4B 1IC1A 5I1HL 4WUUA 1SBSL 3VFWB 4PY7B 4OIIL 3TVMA 4UV7L 3B9KB 1BQUA 3FONB 3N0PB 4H20H 3U7YL 4HUWB 3T4YB 4DKEH 4DZ8A 5HGDA 5HXMA 1WWWX 3GI9L 2A6DA 3QNYA 1ZHLB 3OG6B 3ZTJG 5F7NC 3NFSH 4KJPC 4M1CC 1P9MC 4OLWL 2ICWA 3PJSA 2F8VA 1K8DB 4M93C 2GSIA 4PY8J 2QQNH 2H3NA 4HH8A 4FQXA 4MB4A 3X3GL 1JPFB 3TJHD 1G7QA 4O4YH 4KDWA 3EYQD 3VFRA 2Y7QA 4WUUE 5A40E 2ZZUT 3QUZD 5DI8A 4N0UA 4EDWH 3BO8B 1XGPB 3O41B 2QBWA 1YECH 1M7DA 3HC3L 4JN1H 3EUUA 2CD0A 2ILLA 4G80B 1AIFA 1U8IA 4Q0XH 1J1PH 5IK3B 1RUMH 1E6JL 3MNWA 1QSFB 1OLZA 4M8QB 4AK1A 1X5FA 2NNAA 4FQIL 1DQJB 3FO0L 2FBJH 2Z93B 4F15B 5IVXB 1J1OL 1YQVH 3CIQA 4HKXA 4GBXA 1MCDA 2R0LL 2AABH 3V5KA 1QA9B 4K3EH 3CAFA 2CRZA 1WBZB 1KBGL 2ZUTA 4WUUD 2MJWA 2JIXB 4CBPA 3D0LB 3P9LB 3E0GA 4JCLA 3TVMD 1Z0MA 2ZPKH 3IAPA 2AI0L 5J12C 2IC2A 3B9AA 4N0UE 3ZKNC 2BNQB 1CS6A 1S3KH 2VXUL 1C5DB 3X13A 3VI3F 1CXLA 1F3DH 4BK4A 1WSST 4EVNB 4JHAH 1AGDB 2WBWB 4H5SB 4HAFA 4MXQC 1XMWA 4LLWB 2Q8AL 3SE9H 1OB1A 4EXPX 3F58H 4OZHB 4KK8C 5T3XD 4AEHH 5CJQL 4NKIL 1X4XA 2WQRA 4FQXD 4N9GA 4EBQH 4ZUVB 1WTLA 4JPKL 1BIIA 1SY6H 4X98B 5A3ID 4LLQA 2HG5B 1ZLWK 2UY7A 5HHOB 1INDH 3GB7A 4X4XB 5DJZB 3D48R 3C8HA 1U6AH 4LLVB 2OR9L 2EZ0C 3VE0B 3TNNB 3DHMA 8CGTA 3UJIL 2FJGB 1KEML 4LHUB 1MCPL 2AV7A 3F5WA 4OD3H 1LP9A 4LQ1A 1JHLL 3S5LG 1IKFL 4C56A 2YMXL 5B4MC 1CDIA 1I9IH 3TV3L 5GS0L 4QHMA 1GL4B 5LGJA 1NCDL 3U4EB 1NMBH 1MCJA 2X4OA 4KDTA 3HA0A 2BY3A 3CZFB 4XI5D 1OPGH 1CE6A 2FX8H 3EZJB 2YK1H 4ZODA 3W0WA 3FRUA 3BMWA 4KJQC 3BJ91 4KPHH 3A67H 3GSWA 4IMKC 4HIIB 5ETUB 2NLJB 1A0QL 1WVZA 4P3WA 5I74C 1ONQA 4M6NL 3KPOB 4OJFH 4F37F 1OT1A 5I16A 2D0GA 3D0VB 3VGBA 2Y1VA 3VRJB 1KCUL 5C0CA 4AIZB 5A16B 1I7ZA 4C56E 1J9CT 4R26H 2VITB 3U0WH 4OLXL 2XQBH 4MS8D 1CT8A 3OKOA 3MLZH 4PJEF 3ARGA 3STZA 4QT5B 1JYNA 4KQ3L 3BZFA 4LP5A 4JDTL 3FO1A 4U2YA 4XC3L 5DQJA 3DSFL 2NZ9D 3W0WE 4X5XB 4JHWH 5DQ9B 7FABH 5FGRA 4Z18A 1QO3B 4EN3D 3DBXA 4ELMB 3W9DB 2HFFB 1HQ4B 4P5TD 4UU9A 1RJCA 5BV7C 5JPMB 3TF7C 4UQ2A 5CIPB 1R3HB 5AD0A 2ZJSH 5SX5K 5FDYA 1MEXH 1I8KB 1HWGB 1S8DA 4Z7VE 1NCBL 5C0CE 4C56D 1MCWM 1UWGH 3GRWH 3G5YB 4DQOH 4BSVA 3QEQB 5C6TL 4P9MH 4NQDE 3NFSL 2R4SL 4LHQB 5I1KL 1SM3L 4P4KB 1S7WB 4JY6A 3QDJA 4QHNA 2HKFH 2OCFD 3MA7B 1DQDH 3W0WD 5E08H 3HC0A 4PJ5B 4R90H 5K9KB 3DXAE 1UEMA 1PAMA 1J05A 1N64H 1NKOA 1VESA 1F58H 3MLVH 2VL5A 4QCIB 3UTTB 1T83A 3QUYC 1WAAA 4ZDHA 1RJZA 3ZL4H 4RFOH 2VYRE 3UAJD 2Z8WC 4ZOAA 5TQ2H 3G6DH 4YFLI 1MJJB 3QUXB 3MZGB 5I19H 5T1LB 1EEYB 2V7HB 2ZUUA 4U1JA 2GI7A 2X4TB 4Q0XL 3ZE2E 1RMFH 1A6UL 2IBZX 1J1PL 2R23A 1PYWB 3ARGD 1W72L 5FYJE 2CRMA 2DDQH 5FM5M 4ZOBA 1IE5A 3QDJE 1A1OB 3HB3D 1RI8A 3DMMA 1OTSC 3BQUA 1KCLA 4RX4A 5T3XH 3T2QA 4K3EL 1RIUL 5CHNA 5LAXB 2IBBA 3PWPA 3P73B 1WAAE 2V7NB 3A6CH 4IOFD 1UB6A 3V79C 4EOWH 3IF1B 4MXWL 4QHUA 4HEPG 4XC1H 1T0PB 2FATL 3VA6A 2YKLL 4YDJA 5IHLB 1IL1A 5FYJD 1P4IH 1A1NB 4YHLH 3QDJD 3L9RB 1WC7B 3ZKXB 4FMFA 4FABH 4RWYL 4DGYH 5DVKA 4GMSL 4X6CF 4PGEB 3IDIA 4P2RB 1C5BL 5D2LB 1UXSB 2VC2L 1IAKA 4QHLA 5I8EB 4HS8H 2A9ML 1MWAL 1ZT1A 1FHGA 1K4CA 2ZSWA 1HXMA 4FQ2L 4UTBH 2BY1A 3WMSA 5IHUH 3BE1H 5CJXC 5BO1H 1U6AL 2F8OA 3MLRL 2R9HD 1TJGL 3QXUA 1QQDB 2AV1A 4LPVA 3R0MA 3VXUB 4QXTB 5FHBL 5A1AA 4NRYB 3B3IB 3WDJA 5GGUA 3KPNA 4J3XA 4Q74A 4XCNA 1B0GB 3QDAA 3DMMD 1NMBL 3BQUD 3S88H 4RX4D 4OKDA 2YPKB 3DGGB 3VFSB 3FB5B 5FOBB 2FX8L 2R0KH 3PWPD 4DGIH 5C2BH 2D7TH 4EDXB 3OBAA 1HHHA 2O5ZH 1U93B 1DANT 4GRLA 3A67L 1RIVH 5FB8B 1TJHH 3G6JB 3BP5B 4OV5B 2DICA 4TSBH 2MMXA 4KY1H 5IW1B 1NSNL 1RJYA 2XZQL 4CADA 5F1NB 2BRRH 5E6ID 4X80H 1SEBA 5DJ2B 3TLRA 1KPVB 1HYSD 4EN3C 3PV7A 5DUPL 1P4BH 3QXDB 4P5TC 4FXGA 4Y5VB 4BQ8A 1JUFA 3QQ3B 1I8IB 4NZUL 3FN0H 1CD0A 1I1AB 5SWQB 1INEH 3FT2B 4R26L 2J6EA 3C6SA 4POUB 2XQBL 2W9DH 3O11A 1FQ9C 4C4KO 3QDME 4OTXL 3W2DH 1DUZA 1ITBB 3VG0H 2D3VA 4WTZG 3TBSA 5DHVA 4X4YA 3TP4A 1KJ2B 4P5KB 4M62L 3QIBC 5EZJA 5LQBL 1NCAL 3CU1A 2H8PA 5EZIH 1MFCL 1DN0A 1KIRB 4XNUH 4F7EB 3KLSA 5BV7L 1QSEB 3DROA 2QR0B 4ZOEA 4ONGH 4F7MB 2NXZD 5DURD 2NY6B 3CSYA 3DVGA 3F62A 4R3SB 1YJDH 3ARFD 3K81A 5BRZA 5I66B 4LEOB 4XP5L 1ZHKB 2EC8A 3FB7B 3AGVA 1L6ZA 1YNKL 4PJXE 4NRZA 4ZO8A 3GRWL 3I2CH 2V2WA 3UZEA 5E8OB 3ZKSD 4X4MA 1L0QA 3CCHA 5B38G 4HZLA 1TZHB 3K8LA 2ICCA 2OP4H 2FGWL 5I1CH 3QG6A 4QRUA 1D3CA 4R90L 4GRLD 1KCVH 3T2NL 3ARGC 3GBMH 3P9WB 5FYJU 1FFQA 4ZFOL 2H1PH 4CVXA 3MLVL 1OT2A 4X7CC 3RAJH 3HB3C 5F3HB 1I8MA 5E8EA 5FYLE 1OCWH 5E00A 1LNUB 4GAGL 3TH2T 3QIUC 1KPUB 4JM2C 3MFFA 5KANG 3VXNB 3NZ8B 5DJAA 5EUOB 3QWRA 4PB0H 3VFMB 3BSZH 3B43A 4G9DB 4XPTL 1ULVA 3SQOL 5J1AB 2DYPA 5EU6A 4Y4HB 1RMFL 1VERA 3OR6B 1N5YL 5HGHB 2ICEA 1MRDH 1IC7H 2DDQL 4NKQB 4X4ME 2IFGA 4YXHL 4QOKA 3RWHA 5FYJH 1H3UA 3QFJA 4NFCA 5D2NC 5T3XL 1SYSA 1U8PA 2CK0L 2R1WA 4HJGB 4G6FD 1W0WA 1ZWIB 1OSZB 2C1PA 1IFHL 3GHBL 2A6IB 5BRZD 2C26A 3FQXB 3TBYA 1FFRA 1C1EL 3MREB 3U7WH 4PLNC 4Z7WA 5FUCE 4E42A 5EUKA 4GG6F 2KQMA 2PYEE 4JE4B 2VZSA 4LLMB 1JZ2A 3GJFK 3UXFA 1PKQA 5EU6E 3MXVH 4ODWA 2RCSL 1DBBH 1TVBA 4YHPA 2EE2A 4NKOA 2R9HC 2X9WA 2HWZL 4QOKE 4X8JB 3MACH 4HWUA 1BOGB 3QFJE 4ISVA 4Q6YA 2CPCA 4H0HB 4ZQKB 3FAWA 3SN6N 1WCBA 4X99B 1L7TL 4KTDH 5ADOL 3WN5B 4LSRH 4D0DB 4MD0B 1QFHA 5F7EH 4P49A 3BQUC 4TSCL 4YBQD 4LLYA 1T7XA 3FMGL 3HI1B 1H5BA 3VG9C 2R69L 4NUGL 4IDLA 4UTBL 3TNMB 1JFQL 2I26N 4Z7WE 5BO1L 5SWZA 3QWRD 3HPLA 3WFBL 4LVNC 3RRQA 3QJHB 2DQDL 3OR7A 2DYPD 3QULA 4WRLA 5E2WL 4Q6IC 5EU6D 1PKQE 2DQTL 2YD8A 4JPWL 3HE7B 4M7LH 5E6IC 5IW6A 3L3DB 2DMBA 1NANI 4YUEH 4QOKD 1MCLA 1IT9H 1VEOA 5DR5L 2BNUB 3QFJD 3OGCB 4OZGF 2XY2A 3LEYH 2AEPL 3HPJB 1WCQA 1DFBH 4JFFA 3BPCB 2EC9T 2R0KL 4WIQA 4G42A 3DX9A 5C07B 3BRDA 4PV8B 3MBEB 3JVGA 5TGBB 2O5ZL 5A2LH 3MLSL 5I73C 4Y16A 4TSBL 4YJZL 4LRNL 4L9LC 3ZTNH 3QH3A 3VGDA 5SWZE 2GAZA 4GLRH 2BRRL 4DEPB 1R3LB 35C8L 4M1GL 5DA0B 1LQSR 5E5RB 2D7MA 2LU3A 1HZHH 4OCRL 2JELL 4ONHA 4GQPH 3SDXA 5M7QA 3PHQB 1OP5H 4N0YH 5T1MB 4PRDA 1AGFA 3ARFC 1I3RA 4M3JA 2R2EA 5CSBA 2BERA 3G5VA 4KRPB 1NDGA 3ILPB 3MRFA 1RURH 4DTGH 3W2DL 3F7YA 4HKBB 1BQSA 3BFOA 3DSNA 4PJDF 3WO3B 4M3KB 4KZEL 3GK8H 2ZCHL 5GS1B 1ZVSB 5EZIL 2NTFB 2VUYA 4WHTA 1D6VH 3QO0A 2ZUYA 5EFIA 1U8JA 2RFXB 3QA3A 5F9DC 1INQA 3GSOA 4KDVA 3E1F1 3GIVB 5E2VL 3DUUB 3FFCE 4GXUN 3F12B 1QFUL 3QDHA 5GRUL 3V52H 5TDOA 3GSNL 1JZ7A 3SDXE 1T3FA 1NFDA 3QUZB 3SDAC 1UVQB 4GAYB 3KR3H 1LHZA 4YGVA 2J6EH 2HFEB 1CLCA 3RNKA 2GIYA 3B2UD 2AEQL 3DVNA 1KLUB 3S5LA 1JTTA 4JFFD 3MLWL 4K94H 1AHWA 3EYFB 2I9TB 3MJ7B 3NVQA 4IOIB 2ZSVA 3WEXB 2HTKC 5H2BA 1JF1B 5CP7A 5DHVH 4Y16D 3JZ7A 4RAHA 3OKKB 5DZNA 1MQKH 2IADB 3JV4A 5ICXA 8FABB 1QLFB 3TIDA 5DC4B 3KPPA 5GGSA 4GW5A 5DD0H 3MRJB 4Z7UF 5H35A 4NHCL 4KK9D 3PGDA 1EDQA 1JVKA 3G08A 4WUUB 3BVNA 4W6XB 3SDYL 2XI9A 4XCYB 3TVMB 1U3ZA 3KYOB 3KYMB 2DJ4A 4J6RL 1M7IB 2WW8A 3BDXA 3TFKD 5GGVL 2F5AL 3GO1H 1A6WH 5IOPA 2CO7B 5EB9A 3TYGH 3QNYB 2P8MA 4TSAH 1JZ8A 3ZHKA 3MODH 5AYUH 4HAGA 5IESL 2AW2A 3EGSB 1XEDA 1Z2KA 3HS0A 3C60B 1ED3B 4RMSA 1CDHA 3MLXH 3PJSB 3IGAA 2GSIB 2XN9A 1TZGL 5DD3L 1FIGL 1AXTH 2JCCF 4HUXA 1BLNB 5I1AB 1HK6A 1OQOA 3FQNB 1YDPB 3PWJA 1B88A 3PABB 2Y7QB 2W91A 1IQWH 1YMHB 2BFVL 5DI8B 2DLTA 2Q76A 2ZG1A 4N0UB 2EDTA 1CDCA 4UNVA 1XGRA 2DIAA 3P0VL 1UACH 5C0EA 1DBBL 1U8IB 1G6VK 5D7LB 2CKBA 3MACL 4BSWB 1N0LA 1T6VN 2FECL 1SVZA 1NGPH 3MGTA 2R4RH 3HCVB 4KTDL 2XN9E 1CGWA 4I18C 2FRGP 2KZ1B 3QRGH 3O8XB 4GBXB 4BZ2L 3DV6A 4LVHC 4QNPF 2EYSA 4J1UA 5DWUH 3VI3E 4K71C 2WSKA 3CX5J 4X6BA 4L4TA 2ZG2A 3K3QA 4JN2A 5JXAL 1GPOH 3H7LA 4FA8A 3OKMB 4JFZL 5BOPA 3AS3A 3MNVA 1JPTH 2VABB 4M7LL 1HEZA 3KG5A 3HI5H 4LF3A 1UWXK 1WBYA 2ATKA 4ZXBA 2XNAA 4ONFH 1J0IA 3IAQA 2YD5A 3SJVB 4P99A 2BCKB 5KVGL 2NYYC 1S7QA 5HYSB 1BIIB 1XAUA 3EJYC 4A2MA 1Y0LA 4LLQB 1TPXC 5T5FL 3S3JA 1JGEA 4U1LA 5C0BE 3GB7B 1P6AB 2F74B 1QYGH 2W0PA 3VMNA 5D9SB 4MNGA 1WZ1L 3ES6A 5J6GA 3RIAF 1KIQA 4YXLH 1Q9OA 3OPZH 1URLA 3F5WB 1X3DA 2WAHA 5E99H 4LSDA 4JRYA 3AS2A 1A6AA 4JVPA 3W11D 4C56B 3WUZA 4GMTH 1TVHA 2YWZA 3B9DA 4GUPB 5EU5A 4QHMB 1NUDA 4JGJA 3RNQB 1MCRA 1FL5A 3C8DA 4JAMA 3GK8L 1QFOA 1CE6B 3BGFC 3B2UC 3B6SA 3BD3A 2Q8BL 5ITBH 5D71L 3PWVB 3PDOB 2YBRB 3NOIA 5BMFL 4L4TD 3W5NA 1ETZA 4NC1E 3C5ZB 2EO9A 1I3VA 4L8SB 3OX8B 4HS6B 1ONQB 3SQBA 4U7MA 4EKXA 3CMOH 4ZFFA 3ARDB 2F15A 4G6JH 4JVUA 2X1XR 4Z7VB 3T1FA 4JRYE 5C0CB 5DUML 1JZ5A 4PJAE 1QUNA 3VGFA 4DAGH 4LU5L 4XBEL 5ADPL 2P47B 2MQCA 4Y4KC 5FA3A 2Q7NA 4NQDB 5EIQA 5A2IH 1MSPA 1ZLVH 5DC9B 5C08E 4UNTA 1DQQB 3BZFB 4G8GA 3FO1B 2X4SA 3WKNA 3VXPB 5EOQL 3DXAB 3CDFA 1PQZA 2ZNXA 3DBXB 5DK0A 3C6LA 5GRXG 3T0BA 4HXAH 3RVUD 3MA9H 3RDTA 3IDGB 3RFZC 3TEUA 2EIZB 4Y19B 4OLVH 3T65A 2PW2B 1AR2A 1CFTB 5AD0B 3RKDD 5EC2A 2F53A 4JRYD 2GFBB 1S8DB 5HD8D 1RFDL 2COQA 2FR4A 2VLLA 3JWOC 2V2XB 1A21A 2G5BA 1NAML 4WFHE 4TSAL 4OLEA 5GSVA 4BSVB 1UA6H 3QG7H 3KYAA 1P1ZB 1Q1JH 5AYUL 3WNLA 1LK2A 3QEHA 2VISB 5JW4N 3GBLA 5F96H 3WUWG 4QHNB 1RK0A 4HIXH 1Y6MR 4G8GE 3V4UL 4MNQA 1MF2H 2HN7B 3HC0B 4U1HB 1F00I 2DM2A 4HDIA 4OGAD 4DWHA 5DO2D 1DBKH 3QYCA 1B4JL 2L7UA 3RGVC 5C0FB 1YA5A 4N5ED 3O9WC 3LEVH 2CLZA 3V6OC 5MENA 3ULUE 5EZLB 4OM1H 2F53E 3CVIH 1JWMB 2FEEL 3QUMA 5IP4A 1I7TA 5F7DB 1OSPL 4U1JB 1KG0B 3RWEA 4LKXA 1E6OL 1UACL 2AJVH 1J18A 5CLWA 1BFSA 4XPFH 3IFOA 1CDUA 1V7NL 4M1DL 4KK6C 1A9EA 1B9ZA 5IB5B 2R23B 1PJ9A 3IJHA 2G60L 2HLFD 1EHAA 4PJ7A 5I30H 3EYOA 4FNLH 5DQDL 4MNQE 5DMIL 3CK0L 1S7UB 1AH1A 3C6LD 4YC2C 1CICA 2JB6B 1ZGLA 3HNSL 3RDTD 5F1OB 1B4RA 1N7MH 1KEGH 1UB6B 1AO7A 1EX0A 1UCTA 4IEFB 4Z78B 5IQ7H 4TULL 4FP8H 5MENE 4RZCA 4L8DA 2F53D 2R2CA 3OJMB 2VWEC 3E2HC 3V4PL 2WMPA 1QHPA 3MRDB 2YRPA 2CIIA 1JPTL 4HPYH 2AP2A 2QADB 4LCWA 4TOYH 3KPTA 4YDJB 2Y07H 4NC0B 4ODVH 5D1ZD 4OCWL 3SKNB 1HIMH 1QLRA 1T2QL 5B39A 2CDGA 4GRMB 4PJ7E 1L7IH 4LDEB 4MNQD 4LVOB 3OTTA 1G7JB 3GIZL 3BPOB 1F42A 4QHLB 3CPLA 4P3DB 4WV1C 1K2DA 3WE6A 3H9ZA 1ZT1B 2W0FB 5MEND 1AO7E 1YPZA 4GS7C 5EBWB 1K4CB 1HXMB 4B5EA 4N8VG 3OZ9H 1MCWW 1YYLH 3G9VA 5DA4A 3UJJH 4YXLL 2AV1B 3IU4L 3SDCB 4RFNB 3UTPE 3MJ8A 4BH7A 1FZJA 2WINA 3IJYB 3NA9H 4HWBL 2GK0A 3DPBA 4DFIA 2CUMA 3F8UB 1SJEA 4GMTL 5IBLC 1B0RA 1R3JA 2XPGA 3SCMD 5GRJH 5E4EB 4WI6A 4JEGB 3QDMB 4WEBH 5HYEA 5E95B 5HGBA 4KQ4H 2DQUH 4U1NB 4YGAB 2YUXA 4MJ5B 1C5CH 2GW5A 4JKPH 1HHHB 4FOMA 3CFJB 3D2UD 1DZBA 1ZEAH 3KYKH 3TJEH 2F58H 5IUSA 3MBXH 2AJZB 2DJSA 4Z76B 1RJYB 4CADB 2WBJD 4R4ND 1S5HB 1FH5H 3PGFL 1QD0A 1G7HB 4S0SD 5IFHL 4LCWD 3DLQR 4AEEA 1HCFX 1AY1L 4P0DA 4R7NB 5C0ND 4PGDB 4PJXB 2H2SC 1OD7A 1ZHNA 3C6SB 4HIHA 3RKDC 3MR9A 3BD5A 1NFDF 4RMVA 2AJYH 3M1BB 1UJ3B 4RGMB 2IBGA 3JWDH 2J4WL 4NBZB 1F2XK 1EGJL 4V1DD 5DHVB 4X4YB 3IRZA 2V2TA 2N7BA 4K7PY 5CSZA 5EZJB 4JJ5A 1B6UA 1ZLSH 1BM3L 1N6UA 1KLGB 2H32B 4JO1H 4IRJC 2ICWI 4ENED 3HR6A 1AQDA 3DVGB 1OTUD 2I07A 1J88A 4ZUSB 4D9RD 4I1NB 3WXVH 2VDLH 4N5EC 1CGTA 4P2OC 4IIQA 3T08A 1EFXA 3GUTB 4JHZA 3ALPA 3VXOB 2P7TA 3RWJB 3ZDYF 1EJOL 2WIIA 5HYFA 4QXUH 5HDQL 4WCYH 1KN4H 2JJTA 3U6RA 3WJJA 3V8CA 3PXJA 3RBSA 1ZA3B 1CD1B 2E9IA 1H9VA 2X1QA 4JQIH 4MDIB 5F8RC 3MFGB 2YS4A 3LIZH 4JDZA 3BP6B 3C6LC 1HSAA 2YRLA 1HILA 4TN9A 5E00B 5BW7C 2R0ZH 5HYIA 3W9EA 2RAMA 5DJAB 4LPTA 5C0AA 3ULUH 2PYEB 3D39A 3F7VA 1IEBB 2EYRB 3BWAB 4P46C 1IQDA 2APVA 3OKEA 5JPNA 4L4VE 3D9AH 5EU6B 3GSVA 2EDLA 2XQYK 4BZ1H 2D7OA 1I3UA 5I75B 5GIRA 3UMTA 4M6OH 4KVNL 1FO0B 1JGLH 3VFGH 4WY7H 1DDHA 4NC2B 3WFDH 5D1ZC 4GKSB 1IILE 2R1WB 4K8RD 3DNKA 5DSCB 2NY0C 1YQ2A 1W0WB 4WI9A 3RTQC 4M7LT 5HI4D 1N7ML 2A83B 1TXKA 5F6IB 5IQ7L 2X4PA 4XWGL 2ZCKH 4Y89A 4NZRL 2FX7H 2IAMC 2H2PD 5C0AE 2NY4D 2I27N 5ID1A 3D39E 1EFXD 3QUMH 2ARJQ 1HKFA 3MUZ1 1U91B 2GHWB 2Y07L 4KTEH 4TTGA 1KC5L 4WJ5A 1V7ML 3DX6A 4ODUB 3KJ4B 4S2SB 4XMPH 1A8JH 2IMMA 3BXNB 2CKBL 4MHHG 1L7IL 3VFVA 4KXZH 2LFGA 1CVSC 1J0JA 4ISVB 1NGQH 4YDVA 1PW3A 4LLAA 5IIEA 1LO0L 3LN5B 5TFSH 3ALXA 4YBLC 3L3JB 1UQSB 3U9UA 3SCMC 5FCUH 3PGCA 2AERT 2DQGH 3SGEI 2KL6A 5DEFA 2OL3A 5F1IB 5C0RL 5CD5D 3I6KB 1IARB 3VH8G 2I25N 4P3CH 4APQB 2ZOLA 3OZ9L 5SWZB 3WFEH 5C0AD 4ETQA 3T2OA 3D39D 4OZGE 3NH7H 1IGFH 1QBML 5DRXA 3EHBC 1IC5H 3WS3A 4EI6A 2KKQA 2WBJC 4ODBD 5IMKB 1BX2A 4FQCL 5I2IA 1YEGH 2QKIB 4O2FB 1TIUA 1U2CA 2LAGB 4WEBL 3TBWA 2L4OA 3P0YL 5C0NC 2DQUL 1TZIB 4G42B 4GFTB 3Q5YA 1PG7X 4L3EA 4GSDL 3O4LB 2R1XA 3DVFA 3ZSTA 1I9RH 3L1OL 1W0YT 4U05A 4A6YB 5D5MB 4WI5A 2GAZB 3FFCB 4RGNB 5IB3A 1J1XH 2L7JA 2VR5A 1PG7H 3BIAX 3D5OF 1YEJH 2FH8A 3SDXB 2QQLL 3JWNC 1OTUC 3QWQB 3HHRB 4D9QE 3ZYJA 1I3RB 3FFDA 5HHQA 2P5EA 4KHXL 1F13A 3H2WA 4TYUA 1MIML 1NDGB 2DQCH 3LKPA 3N06B 4YHNA 2D31A 3GKWH 4S10A 2HRPH 3LD8C 4J3SA 5GGRY 4L8BA 2YD1A 3GNMH 3OKYA 4NJ9H 5GJTH 4L3EE 4LOUC 3N1MC 5EFIB 1U8JB 4JZJC 1INQB 2B0SH 2D0HA 2X4NA 3UBXG 3RY4A 2CLVB 4OFYA 1F11A 2E6QA 1A7NH 3MJGX 2UZIH 4H1LG 5DT1L 3T0AA 5D4QA 4PGBA 3RWCB 5F1KC 4FN0A 4NO0A 1YY8B 3VJ6B 2P4AB 2NW3A 1N59A 5D2NE 3ZKMC 1M05A 4LCUA 3S5LB 2QHRH 2O61A 4L29B 4FQHA 1AHWB 3DX7A 4PRPA 4WCYL 2ZSVB 4Z7UE 4HXBH 4NQCA 3VWKD 2AQ2A 5C86A 4I0PA 1MHCA 5IJKC 2NCMA 4WDIA 3PHSA 3JV4B 4KI5C 2FECI 4AM0A 1JNLH 1J8HA 4K8RH 3LIZL 3O3EA 1C08A 4GW5B 1UZ6E 3PGDB 4G6MH 3MV11 1T6WA 3GMMB 5FFLA 4JFEA 3LHPH 2DLEA 5FKPB 2E9JA 4LNRA 3LRGA 3QIWB 1FNSL 1AJ7H 4WFEE 4R0LA 5HI4C 3SKMB 4RIRA 3EJZC 1MCCA 1YEKL 2V5MA 2P5ED 3OJVC 4RMUA 5DVMA 3ZT6A 1BVKB 3L3IB 2IGFL 1XF3B 1JHKH 4DN3H 2P8MB 4OFVA 4U33A 1D9KB 3P4MA 2JCCE 1OGTB 2FLBT 4PRPE 2FLRT 1S7XB 3HS0B 4NQCE 5IG7A 2DL2A 5CBAA 5I8OH 1M4KA 2XN9B 4NYLA 1XIWB 3P3YA 4JCMA 3V0WH 1DEEA 4OFYD 1J8HE 3GHEH 5DJ0A 4WO4C 3PWJB 1FNGA 3PV6A 4Y1AE 4JFEE 3L7FB 4HX1B 1F8TH 4WFED 2Q76B 4BJLA 1JL8A 1AQKL 2OQJB 3DRQA 4I2XA 3OSKA 2WWMC 3QUML 3O6FB 5KN5B 1XGRB 4GLRI 4KTEL 1T5XA 1Q0XL 1F4HA 2CJUL 5E6ZA 5C0EB 5IB1A 4O2EB 4M7ZC 3B5GA 2VDKL 1BBDL 1I7UA 3JTTA 4PRPD 1QNZL 3TA3B 1A1MA 4NQCD 5IFAL 4M43L 2BNRE 4I0PD 4HGWA 1TVDA 4KK5D 4XVUD 4XBPA 4DW2L 2PXYB 1QLEH 2GSGB 3DV6B 1J8HD 9CGTA 3PDDA 3U1SH 4NNXB 4JFED 5I71C 4E41E 3D18B 2HT4D 4JG0L 5C0BB 3WFEL 1CGSH 2JE8A 1NEZG 4I2XE 1FORL 5J6HA 4QRSB 2IH3A 4DUVA 2DMKA 4UDUA 2MOVA 4PV9B 2HH0L 5C92A 3L6FA 3QI9C 4MQ7A 3Q6FB 1WBYB 2DD8H 3S7GA 4ZXBB 4HPOH 4GRWF 2YC1B 3QDGD 4LEXH 4UTAH 1U95A 2PUQT 3VFOB 5C0DA 2BMKA 4HC1A 1KIUA 3HNTH 5J13C 1OP5K 3UTQB 3T4AB 1EO5A 3O4OB 3P11L 5CKGA 4QLRA 3P2TA 1I9RL 5I1GL 2EE3A 4DN4L 3IXAA 2OL3H 1EERB 3QFDB 1HWHB 1J1XL 2UWEA 1PG7L 4Y2DC 1NCCL 1X5JA 3FHQA 5JZ7C 3AXLA 3ES6B 3AAZA 3EO9L 1KIQB 1FAIH 3FCTA 3NCJH 3MRNA 4CMMB 5CILH 2P1YA 2X89A 3KAAA 3K4ZA 4Y4FA 3RIAK 5ALBL 1RUKL 1D5ZB 1H3GA 1U8KA 2ZCLH 4KI1A 4PJAB 4P4RA 4M00A 3T3PF 1P2CA 4PRHA 1YEIL 2HRPL 4MMZC 2PYFA 1BBJA 1H3XA 5H37H 3PL6C 4HG4J 4JAMB 1K5NA 2VDMH 5C08B 5GJTL 3B6SB 4X9FA 2B0SL 1BWWA 1IEAA 2BC4A 2FIRT 3BKYH 1OWWA 4KI5F 4PFEA 1MCEA 1P69B 2AQ1A 3VWKC 1PLGH 1S7SA 2VKXA 5HVGB 1EBAA 5F7YC 1AC6A 4XVJH 4LSSL 4XPAL 5I18H 5E7BA 3LV3B 4NM4H 4ZO7A 5FUOL 2B39A 5IJVB 2QHRL 4NN7B 3MGOB 1Z9OA 4PRHE 2FEEI 1LO2H 1W2KT 5FA3B 2X4QA 4DJMA 1WQVT 3C8KA 1NCWL 4NJAL 4QO1A 1XGUA 1G9NH 4G8GB 3HZVA 2OI9C 1NQBA 3K80A 3PIQA 5ESVA 3MUGA 1PQZB 5HDBF 3C08H 5DK0B 1JNLL 3KHOA 3JV0A 2NR6D 3BGMA 3MNZA 4G6ML 1NMAL 4ZMAT 2UZYB 3BI9X 4CMHB 2SEBA 1MCFA 2VXQH 1VFBA 5CJ8A 4BFGA 5DRWA 2XA8H 4Y4FD 2Y5TB 4AY0A 3S8WA 1T5WA 2VLJE 1QRNE 2FR4B 2DS4A 3CLEH 3WNKA 4DN3L 3U30C 2D7QA 2E7LA 4LSQH 4Q9RH 5F1SA 1MELA 3QEHB 5KVFH 5BJTA 3QQ9D 1MFBL 3CC5A 4LARH 3REVB 1MLCB 1ZXQA 3BKMH 1U8QA 2EXWC 4MQXC 3T0DA 3BPLB 2YPLB 4X7SH 4KVCH 4ZTPL 4NHUB 4I0PC 4JFOA 5GJSL 1WITA 4LGRB 4H88H 1U9KA 3STLA 4NWUH 4ZS6C 5EWIH 2VZOA 1F8TL 2CLZB 4Z9KB 4HMCA 2X40A 5IV2A 3AY4A 4LASH 1KJVA 3ULVC 5TE4H 1DTUA 3Q0HA 3PNWA 4WWKD 5JXEA 3EDEA 1M6OB 5DZOA 3RWEB 4LKXB 2A74A 1A7BA 3IFOB 1JNHA 4AT6A 3QAZB 4ZYKB 3IJHB 4LCYA 3NIDE 4PJ7B 3EYOB 1L0XA 1S78D 12E8H 4OD2A 5J4MA 3VGHA 5B38B 3QNZA 1QLEL 1CICB 1S7VA 1K8IA 5F7WC 4HHAB 5I74B 4ODHH 4RQQA 1FG2B 3U1SL 5DFTA 2VSCA 2AKRA 3TCLA 3IVKA 1CD9B 3K8MA 5E9DB 1S9KC 1AO7B 3L5HA 3O2DA 1CGSL 4YO0A 3NCFB 1Z9MA 4G5ZH 2GT9A 3MJ9A 4HWZB 4NSKB 5GISH 4JO4H 4PP1C 2QJDA 3I9GL 1DCLA 4AENA 2VSDA 4NO2B 4DVBA 1GHFL 2NXYB 3O6LH 2Q3AA 3EIFA 3NTCH 3MROA 5D7JC 1EVUA 1MI5A 1E4KC 3GBNL 3S4SA 2DMCA 3L3KA 1H15B 1OAQL 1F3RB 4WHYG 3CX5K 5D93C 1DP0A 5BV7B 1BD2E 1K2DB 3DRTB 3H42H 2VXSH 4RISL 3WE6B 2DIBA 4BKLA 4GKZA 4NNYA 3LH2L 4JFDA 2Z9TA 3F7RA 3KNBB 3NCJL 5CILL 4BH7B 3WNNA 1JBJA 3N9GL 1MIEL 1FZJB 2NX5A 5KVMC 4ZS7H 4XXCA 3H7BB 5HHMD 1JPGB 2MQ0A 1VKXB 5GSRB 3FHAA 2QV2A 3BZDA 2C3VA 4G8IB 1R3JB 1S9VA 1I3GL 3LS5L 2ADIB 1DR9A 4HLJA 5FUZH 2A73B 3O45A 3KPLA 5DK3A 2VDML 1ZGLM 4HC1H 5FA4B 5ENWB 2FEDC 4FQ1H 1CBVH 3QUYB 4BFIB 4ZFOB 3UJTH 1QHOA 5DMKB 1IAOA 4YHZH 3NAAH 3DGCR 1ZLVK 3RX5A 2B7DT 3ARBA 4JFDE 5GS2D 1KENL 1N3NA 1IGJB 4L9DA 3SE3C 4XVJL 1S9XA 3GGWA 2BOCA 5FV1L 5FO9A 5JORB 2NR6C 3MRBA 1I9JL 5JQHC 4RAVA 5JNYA 4CU8A 1QBLL 3PXHA 3Q5OA 4O9HL 3UTZA 3NPSC 2OZ4A 2X7LB 3CMGA 3UTSA 2APFA 3P0GB 1MI5D 4Z77B 5A43C 2X70A 3M8OL 3MO1A 3RZCC 1CFNA 3WL9A 3DO7B 2NY7H 5CSZB 3BKJL 1WT5C 5HGAA 1B90A 4MVBC 4OLZH 4Z7NF 1GZPB 3D1MC 3VI4E 4PRAB 3V6OE 2ATPA 4XPHH 1GH7A 4EI5A 3ZHLA 1KJ3H 3MX0A 4W6YB 4JFDD 3CFKA 2DWEB 5MEOA 2IALA 1LWRA 3IDMA 3S9DB 2VXVH 1T7YA 3ZDZE 2NX5D 3NCBB 3SBWA 3ULVF 1JI1A 2VN4A 2QQKL 5C09E 4HWEL 3PHOA 4L4VB 4Q9RL 4LSQL 3UTSE 3TZVC 1ORQA 4ZUUB 4WWKC 2NY3D 3MRHA 1ZHBA 4TUJA 4FTVE 2ERJB 4UILL 5C0GB 1JGDA 5T3ZE 5GZOC 1UEYA 4X7SL 2PO6A 4KVCL 1WEJH 4U3HA 1SEQL 3WS6C 5KW9H 1S78C 1H3WM 3H9SB 3IAGC 1AXSA 4FFYL 4XAWH 3ARBD 3K4DA 3ULVL 5EWIL 3WIHL 1HSAB 2AXGB 5KS9E 1GC1H 2ED9A 4H1LA 5CMAA 2X9XA 1WGOA 1GC1C 3LPGA 2NW2B 4BFEA 2WUCL 1MAKA 4X9BA 3OJDA 2IG2H 4QRQA 3D39B 5FECB 2EE6A 1IQDB 4JDVB 3UTSD 5E8DL 3GSVB 5KSVA 4L8CA 3M17A 1YEDA 1PZ5B 2LV4A 3BP4B 3AMKA 2XWBB 3S37X 1DBJH 5ECJE 5T3ZD 1V3KA 1FVDA 1T21B 4AEFA 2CSPA 4EI5D 2W9EL 1HI6A 4IHOB 3BEVA 4J8RB 3S37H 3TO4A 1P4LA 1T80A 4OZIF 3PE9A 2VDOL 1EEUA 2BX5A 2CDFB 3SKUD 2FSEB 1CFSB 3THMH 3TPUA 5DYOA 4KUCD 1HNFA 1UENA 4BQBA 4G5ZL 1LEGA 4MX7B 3WIIH 2DKSA 5ID1B 4OZGB 3ZE0E 5D7KD 3ULSB 3NGBB 5LBSH 1EXUB 4F3FA 5EU3B 5EIVA 5I1IL 2VE6A 1CE1L 3DX6B 3MLPA