1R5VB

Evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
185
structure length
185
Chain Sequence
b'APWFLEYSKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
molecule tags Signaling protein
source organism Mus musculus
publication title Evidence that structural rearrangements and/or flexibility during TCR binding can contribute to T cell activation.
pubmed doi rcsb
total genus 40
structure length 185
sequence length 185
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r5vB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1r5vB01
4RFNC 4KRPC 3SDAD 3ARZA 1W0YT 2MTPA 1A7RL 1DANT 3QDJA 1ZXQA 3F5WA 1I8MB 5LG1A 1EIBA 4WUUD 3ARBA 1R5IB 5ACLA 1IM3A 1KOAA 3MRRB 1KN2H 2NXYB 3WBDA 4GXVL 4P9ML 1EHXA 4KMTL 4I8DA 5ITBH 4LHJB 1LEKA 5J12C 4H1LH 4PJ9C 4HK0A 2XTJB 2H1PH 2PW1A 2O5ZH 4XCYB 1QLRA 2FZ3B 4OD3H 3SDAC 4YLQT 2X9XA 2ARJB 2P24A 3BMWA 1AHWB 4OLXL 3IT8D 3BO8B 1RUKL 3H9HA 2X4PB 2ZCHH 4UINH 4HWBH 4LCUA 2E7LC 2XPGA 1GOHA 3FKUS 3H9SD 4Y2DD 5F6HJ 1RIVH 3CFBA 4LSPH 4WGVB 4ZSOE 3NFNA 4OUUB 5EPMB 4N1EA 1FNFA 3LQAC 4I48A 3ULUL 1TQCC 4Z0XB 2FATH 5D7LA 1HDMA 3MFFA 2QHLA 1GC1C 1AGBB 5J1AA 4B41A 1YYLL 4K8RD 1NCWH 4AEHH 2F19H 5D71L 5DUML 5FYLD 2QKIA 1B9ZA 4PJDF 4MAYC 1S7XA 1CI5A 5E9DA 3PUCA 3R4DA 3VFMB 3O6ML 3WUWB 2B4CH 3O41A 1OSZA 3RNQB 4NNYB 1GJIA 3D39D 3OR7A 3WJLA 4PJIE 5JHLH 3W0WA 4M93B 4FXKB 3UEZA 3FT2B 1YEFL 2F5AH 5KS9F 1PBYA 5B8CB 1U95A 1ZEAH 2BOBB 3O3EA 3TN0B 1WEJL 1TZGH 2YA0A 2ZJSH 1DUZA 2GTWA 5JQ6L 4FFVD 2VLKE 2MPAH 3BKJL 4OZIF 3HZYB 4RX4A 1CFNB 1R5VB 1T5WA 1TNNA 2GW5A 2PXYB 2BX5A 1V3JA 4PJHB 3RL2A 4WHTB 2CXKA 3HZKA 4KRLB 1YMMA 4O9HL 2XA8L 3U4EA 5FB8B 4NKIL 3H0TA 3B5GA 5JQHC 5F71A 3MUZ1 2VC2L 1YEHL 3QULB 3I84A 5BZWB 5D5MB 5HYIA 5AZEL 4OB5H 1G9NC 2XA8H 3JVGA 4LLYA 3UPAA 1CD1A 2MQCA 5EZLA 3ZSTA 1NEUA 4TUOB 1NCAH 1YPZB 3FB5A 3RWJA 5FOJA 2IBZX 5GGTL 2F9BT 1TPXC 4OZ4B 3TLRA 3DX8B 4WDIA 1CL7I 4GQ9L 3SKJL 5HVHB 1KEGL 1QG3A 2J5LB 2XFXB 4NRYA 1KCKA 1BWWA 4D9LL 2EZ0C 2UYLB 1T3FA 5JXAH 4MA8L 4R97B 2MQ0A 3MCG1 3LRGA 5SV4A 4G8EB 3BESR 2W9DL 3QIWB 1YEDB 4X98B 15C8H 3QIBA 3OF6A 2VDKL 4PBVC 5BS0B 3NCMA 4Y5XB 5DJXA 1ZHKA 4ETYA 1YPZA 2X05A 2A74A 4JO4L 2QHRH 5GGUA 1W0WB 1WIPA 1MRCL 2DAVA 1EK3A 3CFDA 4K8RH 4LVOC 4RGNB 2GJZB 3P77B 1A1NB 1G7IB 2CJUL 5SWQA 2AJ3B 2YSSB 3PDOB 3K1DA 1DLHB 3D87B 3Q6FA 5JW3L 2WIIA 3JWOL 1NMCB 5EZLB 4JDZB 3MLYL 3TVMD 1QRNB 3KPRA 4HWBL 3CFKB 1S7WB 5M94B 2XZAH 3OAUH 4NCC1 3IVKB 2C3VB 2NLJB 3QFJE 4WCYL 4LEXL 3ZYJA 3AAZA 2ZUTA 5HDQL 2O5XL 1CFNA 1R5VA 1T5WB 3K46A 4YPGA 5I2IA 5E7BA 3VGEA 3NCFB 4NNYA 4J6RL 4X9HA 1J0YA 3GSNH 5L88L 3O2VH 5C0AE 4HG4K 5BQ7B 2AJYL 4W68A 3DRTA 2CR3A 1YZZA 4PRBA 3WLWC 1CS6A 1TZIB 5D2NB 2D7OA 2VOTA 3LVEA 2G60L 1IRAY 3MREB 5E00B 2J8OA 4HC1H 2PCPA 3BIKB 5KBNC 4LGRB 5CJ5A 5SWSA 5CJXC 1I9EA 4P46B 4P2RB 5JXEC 1I1FB 4GBXC 5C71A 2A0LC 3T2PA 2HVKB 4P2YA 4Y2DB 1KJVB 4ODSL 3BH9B 2I26N 2OBGA 4P3CH 1C5DA 2JIXD 1OF2B 1PG7W 4GBXB 5EFIB 3F6IA 4TVPH 5FM5M 2RQ8A 5JW5B 3VXPA 3ZKQD 2RFXA 3DUUB 4HT1L 3BO8A 4D9LH 3AS0A 3GI8L 1HSBB 3WHE1 1J88A 4OM1L 3NCYP 5MEND 4PJ8C 5EO9A 4CRPA 2V5TA 4JFYB 4JQXA 1SBSL 4AT6B 1XGQB 3RTQB 2ITCA 4LPVA 4JREB 4EN3C 4NO5B 4XC1H 1ACYH 4UNTA 4PJGE 1GSMA 1RMFH 4U3CA 3ISWA 5E8OB 3DI2B 2VSDA 3Q5TA 4HT1H 1YY9C 3BI9X 4QOKD 5DHYA 1YEKL 1GH7A 4OTXH 4UDTB 2EDEA 1N59B 4LKCA 3MBED 1I1AC 3TIEA 1PZ5B 1UXSB 2X4TB 3Q6FB 4ZFGH 4BUHA 1CG9B 2J2ZA 1CVSC 3V6OE 1RZKL 3G08A 3QUMA 4M9PA 1AKJD 3GIVB 4AYFA 2JB6A 2VE6A 1PLGL 3C2AH 5E5MA 1NJ9A 3O2DH 3FN9A 3RY4A 1CF8L 2HYMA 3PP4H 2OK0L 5IEHB 2VO5A 2R2EB 3LQAL 3FT4A 3U0PB 1FZMB 1F8TL 4RA3A 1KNOA 5E6YA 4Z0BH 5DUBB 3FN0H 3B9DA 2GAZB 2PYEE 4UTBH 1MIMH 2MKLC 4YR6A 5ISZE 1NEZG 2IPKA 2V2WA 1G6VK 4C57C 2HP4A 3FFDB 1CICC 4JRXD 5FUZL 4OKVA 1ED3B 4U1IB 1IFHL 2NR6C 3CUPA 5C7XH 3VFVA 1KN4H 3MRBB 1QEWB 3O0RH 1E6JL 5I30L 1WFOA 3GNMH 4XPGL 1Z0MA 3HZYA 5DJDB 2AXFA 1JF6A 4YHPA 5HY9B 5HHPB 4ZYKA 1OSPL 4O02H 3LN5A 3W11C 1K6QL 2FJHB 4C56D 1D6EB 2OP4H 3U9UB 1YNKH 1I3GH 1WBYA 5I15L 3N9GH 5IMLB 1N6VA 1NC2A 1JRHI 1FYHB 1WC7B 1FN4B 2JLLA 4KGJA 5HGAA 1OB1B 4H20H 3FMGH 4Z7UA 5INCA 3O6FB 4GRMB 4OGAC 4P3CL 1U42A 4GUPA 1QA9B 3AU1B 4P99A 1ZLVK 4M43L 2BNUB 3SGEI 5HI4C 3D25B 4Y5VC 5DJCB 1YECH 2GTWB 1JZ3A 3FQRA 1NH6A 2X4NA 1WWBX 3UTTD 1GGBH 1XCTB 4CBPA 4Q58C 3QH3A 3ARVA 3SY0B 3TPKA 4XBEH 4Z7WF 4PJGB 4OB5L 1FZMA 5F1OB 4MDIB 3RL1A 4OZFG 5GZNC 4JZJA 1MPAL 3HC0B 4S1DC 1EPFA 4C83A 3MV8A 2VAAB 4YC2C 3QXDA 3QUMB 1B4JH 3S3SA 1UQSA 4V1DA 1P6FA 4UNUA 3TYGH 4F7CB 2ZOKB 1FE8L 4OZGB 1WSST 2GT9B 3T2QA 4ZSOB 4XCEB 3NN8A 4R9HA 4ZOBA 3QEGH 3MRIA 5ITFA 4GXUM 4DN4H 4LCCA 1N8ZA 4MD4A 3C5ZD 5IQ7H 4Y4HB 2VITB 2Y5EA 4UQ3A 1F4YH 1LEKB 4U6VL 5DO2D 1U8LB 3LPWA 3DUSA 1KB9J 4ZUUB 4DN3H 1L6ZA 4XVTH 3Q6GL 5FYLL 4CN1A 3KWWA 3Q5OA 3MRCA 4EOWH 1HYSC 2K9UA 1HH9B 5T1KD 3SDDD 3TT3L 1G84A 3PQYB 4ZOAA 4UIMA 1JZ5A 1I1AD 4H1LG 4NZRH 4KU1A 4YH6A 1E28B 1JBJA 1A1OB 1JV5B 4C59B 2XKNA 5BMFL 5INDA 5FUCC 3NFPB 1MH5B 3HCVB 4DGIH 1QQDB 5FK9B 4JCLA 3MGTA 5CCKL 2ADJB 1UH2A 4RNRA 3EO0B 5ILTH 5FFLA 5ICZB 1TITA 3KLAB 4YXHL 1JUFB 2NY4B 2C4FT 4XNQB 3A6CL 1FL6A 3BYYA 7FABL 3OAZH 4MXVE 3L5HA 5I8OH 5ELIA 2EDHA 4NBXB 4I4WA 3B4NA 5D5ME 4XHQA 3IETA 3MNWB 4UT9L 5FGCB 4Y4HA 1X5AA 3CMOH 4PB9L 1GC1H 4ZFZA 2BY0A 5AG9A 4O2EB 1Y0LA 1T20B 3VXOA 3DLQR 1OM3L 4PLOB 1IAII 4JFFB 4ZDHB 5D2NA 2GY5A 3ZL4L 3BWUC 2GJ6E 2ITDB 1JNLH 1EMTH 1IC4L 4O58L 4MQXC 3U0WL 2B1HH 4HGWB 5EWIH 5JMOC 5GZOC 1P7QA 4FFWC 4P57B 4MJIB 1JWUA 3DX9A 1IGJB 5CD3A 4P48A 5EG6C 1UACL 1CICA 4NGHH 3FCTB 1ULVA 3SN6N 1IC5H 5ICXA 4IHOA 4KDTC 1PKQB 4YNYA 5HVGB 1V3LA 5CSGA 5C0AD 2VLLB 2ENYA 4PYHA 4XH2B 4MCZB 3U30B 2F5BH 3BW9A 4Q7DA 2NX5E 4X5XB 1U9KA 3RHWK 2B5IB 3I75A 1NMAL 5KJRL 4MXWH 2W0PA 1R0AL 1HKFA 5I1GH 1NBQA 4LLDB 4G9DB 1YYLH 3HNVL 3U48A 1FFQA 4ZUVB 4NN6C 1BBJA 1VPOH 3BPNC 4HS8H 1DBML 3CK0H 4TSCL 5DJZA 5D7IB 2R0KH 3KJ4C 1VKXA 3U7WL 1U8MB 3N85H 2BCKA 4JDTH 2EECA 5GJTL 4Z5RA 1FFRA 3LMJH 5DJDA 1KYOJ 2F54D 4OFDA 4D9QD 1A6TA 5CGYC 3R0NA 1QRKA 2XRAH 1RUAH 4UUJB 3SE4C 5JW4R 5F7YC 1ORQB 4KHXL 1UEYA 1XR8A 2GAZA 5BZDB 2R0ZH 3SE8L 4PG9A 2CQVA 4JRXE 4JRYD 3ZSSA 4YBLB 5KAQF 1WBZA 3MXVH 3VU2A 2VN4A 1U36A 1FH5H 2EDNA 1VFMA 4JRYA 4JFQB 1S3KL 1W0VA 3EO1A 4K3HA 3V0VA 3BUTA 3HUJF 5DJ2A 5BS0D 1Z5LA 3ULVD 5A43C 4P9HH 4L4JA 1ITBB 1SEBA 3V8OA 3DVFA 1KPRB 4U7KA 4YDVB 1DLFH 1M4KA 1YEKH 3DSFH 1RZGA 1G6RA 1A3RL 1P4BH 3HMWH 5CILL 3VFOA 4MLSA 2BVOA 1AH1A 1P7HL 2LVCA 1B0RA 2IPUG 2VR9A 3QDGB 4FQCL 2RCSL 1BBDL 2HH0L 3M17A 5CP3A 4X7SL 4EZMA 4KKNA 2OTUA 4CU8A 5TQ0H 3VFWB 4PG2C 5E9DB 4QYOB 5A40E 4YHIB 2IF7A 1NL0H 3LQAH 4TUJB 1JZ8A 3IDGB 4KK5C 3ECBB 4JM2A 4NN7B 2V7HB 4ISVA 3SKMA 5AG8A 5J1AB 1RHFA 4EN3A 5B21A 5I17B 1PLGH 3C2AL 3VWKA 1CU4L 2ZCKH 5FYKH 1J8HD 2ITCB 4OF3A 4FTVE 5T5FH 5SX4I 2LU7A 4YDKL 1K4DB 5ERWA 1BPVA 1KT2A 3D0VA 3GMPB 4TQEH 3WIIL 2NW3A 3ARUA 3IJSB 4MD0A 3LEVH 3PE9A 2CD0A 4X8XA 4F58H 4KTEH 2D0GA 4XPBL 2ZUVA 1N5AA 4QCIB 4U1GB 4LKXB 4H8WC 4CJ1A 5IMMB 1P1ZA 4QXUH 4LNRB 2R4SH 3GFUA 4OM0H 1QHPA 3PQYA 3BP5A 3QNYA 2VISA 3QRGH 3KGRA 5DUPL 5KS9E 3OKDB 5FKPB 1K8IA 2NQCA 1IL1B 4EDXB 4BFEA 1L0XA 3F58H 3T2OA 4U7MA 2H9GB 3U6RB 43C9A 1DQQB 1ADQA 2B0SL 2EYRB 3GUTB 4QOKE 2UWEA 4QHNA 4QHMA 1KTRL 4PY8I 5TDNA 2G5RA 3GHEL 4KK8C 3RDTC 4N8VG 2J6EA 4QRUA 2ZNWA 1FYTB 1JTPA 2V5RA 5GISL 5T5NG 2UUDH 1T2QL 1SJEB 3F65A 3ZE1F 1UXWB 2A6DA 1I7ZA 1V7ML 3HHRB 3MJ9L 5E2UL 5DMKA 4QRSA 1NLBL 3PDOA 2BRRL 1CDUA 2ED8A 1A1NA 3UTSA 4U2YA 5TH2A 1FCGA 1U8JB 1B0RB 3MRBA 3QDGA 4NQDE 4J12A 4NDMB 1ND0A 5DJXB 3WJJC 3JV4B 3P4NA 2Y07H 3C60A 1NDGA 1FNEA 3LDBC 3FRPA 2YD8A 4MSWB 1T1XA 1CDBA 3AXLB 3RTQC 2ICWB 1RVFL 1YUHA 1BHGA 4ZXBB 1QRNE 1CVRA 3MJ7B 1VGEL 5HGAB 2ATKA 5FIEA 4C56A 5IG7A 4NN6B 4I0CC 3PWUB 1BBJB 4AL8L 4M7JL 4F9LA 2NPLX 1QFOA 1MAMH 3QUZA 3SKOA 3WE6B 1F5WA 1KB9K 4S1QH 4EXKA 5T5FL 3X12B 4KK6D 1Z9MA 1FVEB 2B5IC 4LSQL 4ODWA 3I75B 3S8WA 4OLYH 3O4OB 1UCBL 3FJTA 4DW2L 3DXAE 5IHUL 3QXVA 4J3UA 2F53E 2R39A 2BY1A 4HZAA 3WXWH 1EFXD 3EO9L 4G6JH 3DECA 2EKSA 2FLRT 2BNRB 1VEMA 1R3LA 2GSIA 4O9HH 3S34L 5IBTH 3HAEG 4NQEA 1GXEA 3C8KA 3DARA 4YWGL 1KGCE 1PG7L 1INEL 1LO5B 5CINH 3P11L 4AT6A 5CEYA 1AGDB 4LAJH 1KYOK 4D0BB 4PLKC 1HYRC 4JFHD 4DUVA 2BOBA 2LU4A 5BXFB 1X5IA 2QSCH 3FQUB 2HLAB 4HBCH 4MJIA 3CXHJ 5EU3A 5C70A 2WLYA 4XNUL 5FKPA 3WNMA 5A1AA 5HYSA 4C4KO 3DURB 4HH9A 4PGBB 3RAJH 1NAML 1PZ5A 1UXSA 3GEWB 4F3FB 5E8NB 3PWPD 1ZOXA 5B4MD 4JHWH 2QL1A 5IFJA 1T21B 1IC4H 1L7TL 2BZDA 3SKNB 1BREA 4Q0XL 2CLZB 3D85D 1U95B 3GGWB 3KPLB 5MEOA 5J06A 1LDSA 2GEEA 1EAPB 4JY4A 3HR5A 4JY5H 1CFTB 4R7NB 1M05B 1VGKA 1AGCB 4UV4H 3WUWA 1LK2A 4UT9H 2ZNXA 3GSUB 1OAQH 4OCSL 1QQDA 4WFFD 5FK9A 3E3QC 3JBG7 3V7AE 5DYOA 4XHJD 5A16B 5GS1A 3E8UH 1A9BB 5F7WC 1NSNL 2X1XR 5C09E 1UVQB 2CDGB 2UY6A 3FQXB 1AO7D 1IKNC 1PSKH 3B6SB 1AIFA 4WGWB 3U0TB 3CIQA 1P53A 4BZ1H 1J8HE 5J6HA 4JDTL 3P4OA 3FAWA 3SOBH 4K3EL 4PJGF 2E7BA 4E9LA 3WN5B 1V05A 4U0RB 3S37X 2FD6H 5GPRA 4CDGC 5EZJA 3QDJD 1MVUA 4O5LL 4Z6AT 4R3SB 2FL5A 1CDJA 4KRNA 3NAAL 3IJYA 3SKNA 3WN5C 2JCCF 4AEHL 4C58B 1LQSR 6FABH 1QRNA 5H94A 4K7PL 1UM5H 2CDFB 3X11A 3L1OL 3WKMH 1LP9E 3GHEH 3M45A 2WUCH 4G9FD 1BF2A 3MREA 3ARWA 4LBEA 3CSYB 4YBQC 1ERNA 3ZE0E 5F7LB 4YC2B 2OTUB 2Q8BH 3FRUB 3C6LD 3LKSA 4X5LA 4WI9A 5CIPB 1JPSL 4YHLL 2W0KA 3EJJX 5D7JD 1F4XL 4XVJH 4WFGE 5BQ7A 1P7QD 1T89A 3QUMH 1LO2H 1P2CB 1KB5B 5T3XE 1N6UA 1RK1B 1K3IA 4AH2B 2W0FA 1DJSA 3L1OH 3U0WH 2HLFD 3MGAA 1K2DB 3C5ZB 4HDIB 2R56L 1T1ZA 4XXCC 5CGMA 1RUQL 2HA1A 4HS3B 2VYRE 4LSRL 5ID0B 3MRGA 5EO0B 4H1LA 3NN8B 3HS0B 1V7NL 3B9VA 5IGXH 3TJHD 1QA9A 4U1LA 4QTHB 4M6OH 5DRZB 1G9NH 4GRMA 2NMSA 3BKML 3IFLL 2YOCA 3PWJA 1BQUA 2VKWA 5JUEL 4NJ9L 1C5CH 3VFRB 4L8SA 1CT8B 5DQJB 4XBPA 1J9CT 3MJ8A 3JWOC 3CU7A 2W9LA 3AY4A 5KVFH 3L3IA 1DL7H 1GGCH 4FABH 3KYNA 5ESQB 3VRJA 5FYJU 3D2UB 3VXMA 1I3UA 4PJDB 1A47A 1YMMB 1NL0L 1T1XB 1U8OA 4LAQL 3K80A 4G6KH 5D1QB 3K8KA 2X44D 3LDBB 5IV2B 2ZKHH 3MBEB 4IRSC 3ZL4H 4Y4KA 1N6QH 4NUJA 2AV1B 4K94H 3KR3L 1YMMD 3SDXA 1FLRL 1HINH 4OZGE 2O61B 3QI9C 3MA9L 4YHZL 4HXAL 4JKPL 3GSVB 1U3JA 3F6LA 2ZP0T 4WHDA 5HHOE 2JB6B 5IKCB 2AQ3A 3OKMA 5HPMA 4PB0L 5F44A 1NGXA 3JUYA 3B2UD 1CE1L 1F8TH 1BQHB 3MXWL 3O6KL 1NC4B 1AO7B 2A73A 2DQDH 2QADB 4OT1H 5BZWA 25C8H 2IADA 1AGEA 4CN4A 1R5WA 3OHXA 3MNZA 3VXTB 4ONGH 3H9ZA 4UU9A 4HFWB 1UM6L 1WWAX 3ESUF 1WICA 4XTRD 5C0RH 4IMKA 2VLRE 1QKZL 4XPTL 4YFLI 5D96C 3W9DA 1KIQB 2B1AL 5J1TC 5EWIL 5FYJE 4KHXH 4DQOH 2VR5A 3I02A 5GRUH 3TH3T 1NGQH 4M48H 3MRDA 1SMAA 4TUKL 5JORB 3C08L 2VLKB 1NBVH 2NY1B 5DT1H 1P84K 5KS9B 4BZ2L 4KDWA 5DD6A 4XP1L 4Y2OA 3S6CA 4I2XA 4P4RB 4OZIB 4GKOA 4PJHF 4QOKB 4JHAH 1T20A 5DEGA 4ZMAT 3VXSB 2DWDA 1TETL 2BXYA 4WO4B 4OLZL 5C08A 4LLUB 4OGAD 3TBSB 5ICYA 4HPYH 1B0GB 5ETUB 2XXCB 2BJMH 3THMH 3CFBB 5AYUH 1YEEL 3JV6B 4L4VE 5H8DA 4JAMA 4F7MB 2APXA 4HIEA 2OJEB 4HWEH 2Q7YA 1CFSA 2GSGA 2VZVA 5EC1A 1YYMH 2JCCA 2MHAA 5CBEA 3O4LD 4RDQF 2OSLB 2GKIA 2IFGA 3SE3A 2IH1A 3ELAT 4ZFFB 3MV7E 4I9WE 3GHBL 5DVOA 4XP5L 4P4RA 2BJML 4LVHC 2H26B 4Y19E 3PIQA 5IW1B 3TFKD 3MRDB 1ZANL 4FHBD 3AROA 4OLZH 1J11A 1JL8A 4HK0B 4Z7QE 4U05A 5BRZE 5AWNH 3FB7A 4ZPTA 1TJHL 5EZJB 2NY5H 4TNVK 2Q3ZA 1BZ9A 1MCBA 5D7LD 5I16B 1EMTL 1AO7E 4XXCA 1M6OB 3W81A 1CTOA 1VFOA 3I6GA 4C4KT 5D9SA 1OF2A 4HXAH 2B8OT 2Y4SA 5J6HB 3PL6D 2FGWH 3MC0A 4YPGB 1O7SA 5MEOB 4UOW0 1EEYB 1MY7A 4Y5VA 2LTQC 2OP4L 2A38A 2I5YL 5TFSL 1IM9B 3CCHA 5L88H 2VERN 1A7BA 2MJWA 4Q9RH 1XF4A 1A6PA 5IB3A 2ZCLH 4X0KB 3SCMC 1BQHA 2I5YH 3O45B 1IEBB 2AV7A 4DEPB 5DJ6B 4CADA 3OHXB 2J4WL 3O3AB 2PYED 3MLPA 3ZE2E 3UC0L 1HSAB 3H7BB 4PLKD 5JO5B 4S1SL 3L5IA 2YBRA 1UM6H 3JTSB 5C0RL 3TWCL 4XGZB 4HC1A 4MQXD 2PYEA 5E08L 3ORJA 4MXQC 1BQLL 3QH3B 2X2YA 1MFNA 4Y5XC 2PO6C 4IRSA 4XPBH 1MJ7L 4UUJA 3GIZH 4JRXB 3BVNA 3TBTA 4K8RL 1A9EA 5CJBA 3VWJA 5IB5B 5IHLB 1YEFH 3PHOA 5HHOA 4NKQB 2GSIB 5CP7A 3INUL 2MMXA 4U1JA 3RJDA 1NMBH 4K55A 3L3OB 1OT1A 1T04A 5DDHB 4NZUL 2VZOA 3WS3A 3H3PL 2WINB 4U2ZA 2ZCKL 3QBTB 5BJTA 4P2OB 5FYJL 7CGTA 3FT4B 3GRWA 3CX5K 4MMZC 4NQVA 3UTSD 3G6DL 4U6YB 5M7QA 3KYNB 3HC4L 1Q9LB 1G7IA 1MFDL 3CFDB 2Z35B 3KYAA 4X6CE 3IDMB 5K9QG 2WAHA 2CXGA 5DJ0B 3QFDB 4OKVB 4MAUL 4PGCA 4MD5A 1F00I 1CXLA 1T0NB 3Q3GA 1PKOA 4NUGL 3QDMA 4YNYB 1RY7B 1FL5B 5E95B 1CWVA 1OARL 1OP9A 2C7UB 2R2EA 5DC9B 5T1DH 4ELKB 3V52H 2ARJQ 1AY1H 2CK2A 4M6OL 5D7SL 4FTVB 4OCXH 5T3ZH 2YD9A 5IG7B 1K85A 3S35X 5A2FA 1G7PB 1OAKH 2BVQB 5C09B 3PGCB 2P5WB 1U8IA 3RVVD 3WSQH 1OWRM 4KRMB 5B39A 3AREA 2DBLL 2AK4D 1T4KB 3LZFH 4ZO7A 4UIKL 4UAOB 2JE8A 4ZTOH 5I76B 2DQIH 3WYRA 3U30C 2NZ9D 5CJOH 1T66D 4JZNA 4TVSa 4QRUB 5DD3H 3HRZB 1EO8H 2CKBA 3EGSB 3LY6A 3P9LA 4LDEB 3UPCA 4NKMB 1QO3B 4HX1A 5CS7A 5CUSH 2D7TL 4EVNB 5IB5A 3WN5A 2ARWA 4R0LA 1E27B 8FABA 3ARGB 4FS0A 5IVZA 3SGDH 4IS6A 3NFNB 5D7IF 2IAMC 1DQQA 4FQXD 1BZ7A 3HRPA 3MUGB 1A4JB 3HNTL 1Q0XH 1JWMB 1OW0C 1I8KB 3U0TA 5DVLA 2PYEB 3DBXA 2X4RA 3TBVA 3NH7L 3HMWL 1P4BL 4A6YA 1EXUB 3QUYD 3NZHL 2PCPB 4BK5A 1LEGB 4KPHH 3RBGA 4EBQH 3CNKA 3TGXA 2DYPA 4JFEE 5KSBB 1P5VA 5JORA 1UWEL 4JZOA 1KLGB 1FGNL 4P59L 3PV7A 3DVNB 2KZ1B 5LXGH 1TQCB 1MQKL 5F6IB 3HNSL 5IFAH 2HVKA 1I1AB 5CWSB 5KVFL 3OWEA 3VXPB 1N0XL 2X1OA 4EI6A 5IFAL 5E6ZA 4D9RE 3CZFA 4N68A 3MLZH 2M1KA 3A6BH 1E0OB 3T65B 1N26A 3SCMA 2P5EB 4PJ7A 4XCEA 5CHNA 5DTFB 1AXSA 4NKMA 4N0FA 4PRIE 3BDXA 1A0QH 2EDBA 4GW4A 4JY5L 1A6ZA 1RJLB 3U7YL 2OZ4H 3SE4A 1KBGL 4NHCH 1WWWX 4XI5C 4CVXB 5DF0A 1OCWH 2DQUL 5GS2H 4KI5E 3RZCD 2BC4B 4WEBL 2DMBA 2WBWB 1NCNA 4Y19D 1X4XA 1VACB 1RZFL 4BQ9A 1WJ3A 5F3HB 4DGYH 3GGWA 4LEXH 3D48R 3OJDB 3BFOA 4ZD3L 4HX1B 3VXQB 4LAQH 4U0QB 1VGEH 1E6OH 5IHZA 2C5DC 3BEWB 2HTLC 2IALA 1S7UA 2DKSA 5E2VH 3WO3B 1CXEA 4QHKI 1TJIH 1LVEA 4TUJA 4R26L 4HEPG 4XI5D 5GRJH 5FYJH 1OQXA 3IXTA 3Q1SL 5GGRB 5I76A 5JXEA 2Y9RT 5ISZB 2FLBT 4G6AC 2XG5A 2P8PB 2EIZA 1UM5L 4MQ7A 3R8QA 1DBJL 3VCLA 4M61A 3HMXA 5EB9A 3MLWH 5E56A 1QSEB 43CAB 1SEQH 3G04B 3KJ6H 2VDNL 4J4PA 4XCNA 5GGUB 4LCYA 3UAJD 1O5DT 5JQ6H 5EC2B 3I3BA 4IRJA 4S0TD 2XNAB 4K23H 1ZEAL 4ZPVB 4TUOA 5F3BB 2EDWA 3GBLA 3A67L 5AAMA 2DD8L 1J1XL 3ARPA 1EBPA 4R4BA 4XHJC 1O7VA 4JQXC 2D0HA 3QEUB 3MBXH 3WFDH 4QHUB 5BCAA 5E03A 5D93C 4OJFH 4JJHA 1QR1B 1J18A 1CFVH 5F88A 5E0QA 1DZBA 4FXLA 4ORGB 5DUMH 1KJ3L 1YMHB 4QRSB 1FORL 4OUOA 3EOTL 4FQXC 5D7IA 1N64L 4HQQH 3KYOA 3HE7A 4PG9B 5LQBH 3U1SH 3EFDL 4Q0XH 4HKJB 5B4MC 4HKBA 3QCVH 4RGNC 2EDQA 4H0IA 2ATPA 4AIZA 3GSVA 4LLMB 4Z7VE 2EH8H 1FAIH 1X5YA 5GRVL 2NY5L 1YY8B 1FNEB 1XIWA 4I3SH 1SJEA 5D1QD 2AEQH 5CEZE 2E7MA 4IOSD 4K9EH 3C5ZC 5EOQL 4I18B 1A0QL 5HHXL 5T1KB 5C0DB 5ECJE 4JPVL 4Q9CA 2IFFL 4R3SA 2NY0C 1OTTC 1TVHA 4MJIE 3W0WB 2Z8SA 3L5JA 1ORSA 2QQNL 1KTLA 4LLVB 4I0PC 4Y4HD 5I16A 5M95B 4L9LC 4ZO8A 5GIRB 4L8CB 1CU4H 4HUUA 4LHUB 4NQSB 1DUYA 1J7VR 3RKDC 4YAQB 3QWQB 3MA7B 4IMLB 3PIQB 5IW1A 5F9WB 3UYOD 1FZKA 3JUZA 5D2NC 3SKJH 1LNUA 4G7YH 3RVWC 3V95A 5C0JA 2VWEE 1OLLA 4Q6IB 1IBGL 3MOBL 2R0WH 1EUTA 1DBAH 4Y4FB 5L7XH 5IFHH 1RIVL 5I8EB 1HI6A 1G6RH 1G7LB 1MCHA 3GNML 1CLCA 5EU4A 5BV7H 5TGBB 1KBGH 4NHCL 4J3WA 4Q9QL 4KTEL 4APQA 4M6ML 6CGTA 1IQDA 3D85B 3MGTB 1IAIL 4QYOA 3UDWC 2DD8H 3DHMA 1EEUA 4RX4D 2YZ8A 3NFPA 4PRDA 3KYKL 4EIGB 2H1PL 4NJAL 1JK8A 2EDTA 3K1KC 1NBZA 2BP3A 1CDIA 3EYFA 1KXVC 2NZ9C 2ZG3A 5DRNA 4G8GB 2ZUQC 4M7LL 2UWEE 4HMCA 2YD1A 4NWUH 3ARBB 4X6CF 2VJXA 1TETH 2DLEA 3OB0H 1VB9A 4JE4B 3HCVA 1T0MA 1S7SB 3TF7C 3C09B 2IQ9H 3V52L 5C3TA 1C7SA 4JM2B 1G6RB 5KOVC 3UYPA 1RURL 3OKKB 2D2OA 4P5TD 4H25B 4YHYB 3RIFK 3K2MC 2VXUL 3GRWL 2YMXL 3CDGB 4BZYA 1UA6H 3BH8A 3G5XB 2AJ3A 1KTKE 5JPMA 1BEYL 1NGYB 3QWRD 4ODXA 5EO1B 4R90H 1NGXB 3MRKA 1NFDE 3VGGA 4Z8FH 1OHQA 4D0CA 3O4LE 1MAJA 3UJTH 4EEEA 4PJFA 4MD4B 4R7DB 1ORSB 3DETC 5TJWK 3NPZB 2P8PA 3MNZB 2EEBA 1FFOA 1VENA 32C2B 4AEIL 3IXTB 1XF3B 1IGCL 4Y8DC 3TC9A 1XCTA 5B8CC 2E8ZA 1NCDL 2R1WA 3IFLH 4PP1D 1XT5A 4YDLC 1HXMB 4ZFGL 1DN0A 2ZUXA 3IU4H 4RDQG 3X14B 3V5DB 3IDMA 1U8NB 1YNTB 3BEVA 3D39A 3V6OA 3HZMB 5FHBL 1HQ4A 5C2BH 4MDIA 4S1DD 2UV3A 2XZQL 3FQWA 3RL1B 4I3SL 3VH8A 1XIWC 2A6IA 5D72L 2BSSA 4QLRA 3VFGL 5E2TH 3G5XA 4ENEC 5BOZG 4GRWB 1IILE 2YR3A 2DL2A 3MCLH 4GW1B 4XTRC 4HUKB 3EJZD 5IB1B 4WWKC 3GSNB 2AJYH 2PXYA 1TXKA 3VDBA 2UWEB 3MODL 3EUUA 1NEZB 3VFUB 4LDOB 3TV3H 4NNPH 1R3HB 1WIUA 2PXYD 5CZVH 5B8CA 5KVDL 3S3JA 3JWDL 2R1XB 3WFBH 1SQ2N 3H3PH 4DVBB 1E4JA 4CUCA 1C5CL 3BHBA 4LCIH 1U41A 5TDPA 3BH8B 2W91A 4PJAA 2NXZB 4F58L 4ZUSA 4LLDA 1MI5D 4O51B 4LCYB 4XNUH 3H6JA 4UT6H 3VFTB 1IC5L 3EDEA 3VXRD 4OIIH 5EBWA 3O9WA 3KPSA 3M1BA 3PV6A 1ZHBB 3NVQA 1XF4B 3CXHK 2G75B 1MI5A 1QNZH 5C0BB 2CJUH 3MV01 3ZDXE 1MUJA 4UZGA 4XAKD 2E6PA 4RFOL 4F57L 5ICXB 3MQIA 1IAOA 1P6AB 2WV3A 4Y5YC 5FYKU 4TTGA 1MCJA 2HFGH 3BUYB 4EOWL 1MFCH 3JV4A 5ICZA 4S1SH 3RFZC 4R96B 3BT2H 4P57A 3RWHB 3ULSB 1HN1A 1TTFA 4LCUB 1VACA 2LAGB 4HJ0D 1Q8MA 3M07A 4KXZH 5C6PB 1JPGA 5IOPA 3MRFB 1FVDB 3U4BL 4G5ZL 4ZUTB 5C0NC 4V1DE 1KG0A 1A1MB 2HN7B 5ESVA 3FB8A 1QLRB 5I1IH 3LKNA 4ODUB 4ENED 1RVFH 4NQSA 5MENA 2XY1A 4BH8A 4KUZL 4FFZH 1GOFA 1HHIB 1S9XA 3VFTA 3LKRA 5IB4A 5DT1L 3RI5F 3QEQE 3Q2CA 5I8EA 3X13B 1C1EL 5SX5H 4E0RA 2VXTL 1K8DA 2Y6SC 4QGYA 1IM3B 3MRRA 2P5WD 3CPLA 4ELKA 4K3JL 3HNVH 1CFTA 1IT9L 4FQHB 5CJQH 1MEXH 3WXVL 4HUVA 2M26A 3OZ9L 2AQ2A 3SCMD 3GKWL 5DQDH 1T7YA 4WFGD 1JGDA 3VG0H 1JPFB 3O3BA 4MD5B 4PP1C 1HIMH 4P23A 4OQ1A 2NR6D 1BOGA 4DVRL 3BDYL 3QAZC 1A6VL 5BVPL 4O51A 3NCJH 4GS7C 3HZVB 3FO9B 4MS8D 5DFWH 5F7EH 1VDGA 3ARFD 1ZVYA 1ZTXH 1UACH 5J12B 4NT6B 4QO1A 1AO7A 2A73B 4CNIA 4P59H 1F3DH 3TYFA 3GMNA 1FP5A 3UC0H 1B6UA 4JHAL 1U91A 1ZT4B 4OKDA 1MWAA 1UCBH 3ZDYE 1BOYA 1ZK9A 1KENL 4Z7VF 5L7XL 2EH8L 4FQLH 2OCFD 3SDCC 3GSQA 3EYUL 4U1NB 4MQTB 4OCYH 1KUMA 4M7JH 3VXTA 4LRNL 5GSVA 5E00A 3WIFB 4I0KA 1X7QA 3KPMA 3MRJA 4H8WL 2GJJA 5FUZH 3MJ9A 1U58A 4XP9L 1Z9OA 1A6AA 4F7CA 1GHFH 5HD8C 3GSOB 4X7DC 5CEXA 3V0WL 1YN6A 4C83B 2AI0H 2N7BA 4K7PX 3QDGD 4OF8A 5B39B 3A6BL 1BFOA 4RMUA 3C5JA 5DQ9A 3OXSB 4HKJA 5F7HA 2YEZA 4G8FB 1H3UA 3GB7A 1OAZH 3G04A 3WIIH 5EOCJ 1GGUA 5DHVB 4QHLB 4M8QA 3QA3B 5FECB 1QBLL 2R1WB 2B4CL 1ETZA 1XAUA 4MJ5A 5F88B 1KPRA 1OTUC 4MWFA 5KSAB 5JPNA 5C9JA 2YD4A 4XVSH 3T0DA 4DKFH 3VE0A 1J05B 1DLHA 1T83C 3MO1A 3BRDA 4JY6B 3S36X 4WHYH 2V2WB 1RULL 1BZ9B 1QFWM 1KB5H 5DMGD 4G43A 3O0RL 5FUOL 4WY7L 3BRFA 5C7XL 1DSFL 2BDNL 2FB4L 3ZTNL 2VNCA 3UYRL 1NGYA 2VLRD 3OKOB 2BERA 4POYA 5CIPH 2YA1A 4PJ8D 3DNKA 5HGBA 4LLYB 3MV9D 2QEJA 1KJMA 4G6ML 3MZGB 5L8LB 2JCCB 2MHAB 2Q8BL 1P4IH 3VDAA 2Z8WC 1U8HB 4HWUA 4OM0L 5F1IA 5GGSY 3WIFA 4AH2A 4PFEA 5TDNB 1OCWL 4P3DB 5C0CA 1HHHB 1XMWA 1I85C 5JIHA 5EORH 4LVEA 3ES6A 1QKZH 1E4XI 3BPOC 4OLEA 5IEHA 2WNGA 5D6CA 1NLBH 3SGDI 4OIAA 1CGUA 1UB5A 4QRPB 3WUZA 1MNUL 5LGJB 2AEIT 3MGOA 4Y1AE 5D1XB 5FHAL 1MWAB 1NLDL 1UM4L 3MRHB 4MX7B 4NWTL 2ESVB 1EH9A 3GMLB 3PWPE 4DKDC 2EE2A 2HFEA 3GSWA 4HIIB 4FQ1L 4FZ8H 1KCUH 2FEEL 4KKBC 2HTLD 1T7ZA 3PG2A 2R56H 3C6LA 2KH2B 2BC4A 1T03L 4G8GE 2X7LA 1OQOA 2VDQH 4GRLC 5EFIA 5F6HI 3LPGA 2NXZC 1UENA 2XACC 1JYNA 1DUYB 1EVUA 4WW2C 1KACB 4X6DA 2NY6C 4QF1A 5GRWA 1MFBL 2A9MH 4U6TA 1GGYA 1YJDH 3QO0B 1N6QL 1OTTD 2VITA 4M6AA 2VDPH 1N8ZB 1AE6L 3TIDA 3H9SB 4JHZA 1MFBH 4JFYA 4I0PD 1CICD 5GS0L 1R5WB 3BZFB 5E8DH 3CVIH 1EDQA 3FQXA 4XCCL 2XZQH 3T8XB 5K9OA 3E0GA 2X4PA 1HHKA 1HNGA 1XH3A 3EZJB 4OCRL 1C5BL 1RUPH 3SHSA 2FR4B 2NY6D 4NZJA 3G6JA 4NPYB 4GKNA 4HJJH 3T4YB 2C3XA 2PW1B 4PRBB 2W38A 1VFUA 5TPWH 2YPLA 5CD5C 4WO4D 3V0AC 3IXAB 2P44B 1JWMA 2CLZA 4KVNH 1FGVL 3RY5A 3F8UB 3TH2T 5EIQA 2J7LA 1QFWH 3IFNH 5ID1A 4CVZB 3OKOA 1JNLL 4KPHL 4EBQL 1MRDH 1Z3GL 3EO9H 3NIGF 4CAGA 4OLUL 3HUJE 2FH8A 2YD5A 4Z7OF 4FG6C 2V9RA 5C3LD 3MRQA 4GRLD 4X8JA 4Y5XA 5CEYB 5HVFB 4XCFL 3TT1L 2C7UA 5JZ7D 2XTJC 5JIIA 5KVMC 4S2SB 5C0GB 4MZ2A 3QDJB 4JO3H 1DBMH 1JI2A 3HS0A 1JPTH 4Y2DC 4P9HL 4X99B 3ILPB 1T83A 4UNVA 1RULH 3N1FC 1JNHB 3BKYL 2HT2C 1I8LC 4FZ8L 1JWSB 1PGRB 2DS4A 1MCCA 2B2XL 4PRPE 12E8H 4YR6B 2DM3A 4XB8A 5DI8A 3QPQC 4Z7VB 2HWZL 1RK1A 1CR9H 2WIIB 2FJFA 3V6OC 5EOTB 1P84J 2Y07L 3QHTC 3S4SG 3W0WE 1ZGLM 1PG7X 1CD8A 3QSKB 4HZLA 5DHVA 5F21B 3F7VB 4JHBA 3TO4D 3QIBD 1W0WA 1H3WM 4L4VB 1MLBA 2B2XH 4UILH 4ESKA 5C0BE 1H5BA 1ES0A 1P4IL 4EDWH 3GSOA 4G6JL 4U6YA 2YK1H 4GQPH 2YPVL 3RWGB 4Q9QH 1PYWA 3QDGE 4PP2A 1F42A 2YN5A 5C6WH 4DN3L 4D8PA 2DJSA 1WZKA 2W60A 1J86A 1EO5A 5LGKA 4AQ1B 4ELMA 3WS3B 2I07A 1EFQA 4S1QL 3U9PH 4U3HA 4FQ1H 3NACL 4RAUB 3QEGL 1U8OB 2E7HA 4O2CB 1R3KB 5C0GA 4NT6A 4TPRH 3WFCL 5IEKA 5GHWL 3NFSL 3T0ED 3CH8A 5DJ6A 4CADB 2O5YL 2WWKO 5F7KC 4G3YL 4I5BA 2P8MA 3G6JE 2YBRB 1U8QA 4C54A 1MSPA 3QNYB 4KRPD 1NCCH 4P5TC 4ZODA 2VIRB 3QNZB 1TFHA 3RGVC 3DROA 3ZYIA 4JG1H 1T03H 5GRZA 2YUVA 3UAJC 3BZ4B 4K7PY 4KKCD 4OZFH 2BOCA 1IKNA 3IKCB 2DQDL 4OT1L 4WWKD 1G7MB 2H9GA 3S5LA 4EQ3A 4RGOL 4YDLB 3R06B 5FHAH 2AXGA 1T2JA 4OCRH 5A2KH 1FV1A 1S78D 3GMNB 2DQFB 1U8PA 3L7FA 1DE4A 2PYFB 3SJVE 2HN7A 3EFDH 1FAKT 1KV3A 2WWMD 3KPNB 3NIDE 1IARB 5IB4B 1EGJA 3NZ8A 3L5XL 5SWZD 2XI9A 3ZDXF 1MLCB 2FSEB 1FBIL 5EDXA 4OGXL 4RMVA 1K5NB 2X4OB 5D1XC 1DFBH 1JJUA 2R4RH 1XGRA 4XP6H 4YJZL 3MRHA 4HWNA 4MX7A 4LPTA 4MAYA 5I30H 2X4TA 4DGYL 2OLDA 4Z7UF 1N59A 3CLEH 2EC9T 4UV7H 3TBYB 4HUVB 4GKZA 3OAUL 2DI9A 4YE4L 3BUYA 4JM4L 4H26B 3KXFA 4K2UL 2IC2A 5C0CB 2EC8A 4W4OC 5CBAB 4Y19B 1S9XB 3TCLB 4RQQA 1YNLL 3P9LB 5DMJB 3HRZA 1KFAH 2YK1L 4LARH 3JWNC 1DQMH 3I9GL 3O2DL 4MHHG 2NY6B 3FN3A 4DKFL 1A1OA 1PX3A 4FP8H 4YHIA 4XAKE 5EO9B 2J8UE 2ADFH 3OPZH 3WHE0 4NOBA 2W65B 3I2CH 5C0BA 2X70B 4J8RA 3AY4C 4ODHL 1NC4A 4LSDA 5GS1B 1J8HA 3EAKA 5ENWB 2FECL 4MXQD 4L5FL 3L3KB 4KUZH 3QQ3B 5JR1H 4ELME 4PJAB 1XGUA 5F7EL 1ZVSA 5MEPA 3I50H 4YQXH 5DJ8B 5E6ID 4MJ5B 2H32A 2APTA 4R4FL 4QT5A 1JHLH 1GGIH 5C0DA 5JW4Q 3DOSA 3OGCA 2G75A 5F7MC 3IFOA 2H41A 3VFSA 2H32H 4E5XB 2R2BB 3D18B 5E8NA 3MMEA 4YHOL 3ARFA 1X5HA 5IB1A 3LMJL 2YRLA 3B9KD 1GRWA 1I3RB 1NKOA 1MEXL 4JRXA 4WIQA 1HYSD 5GGVY 1MCSA 1FSKC 5CJXA 2HFGL 4YDIH 3H9YA 1FN4A 1I7ZB 3LD8B 4PBXA 4PJGA 2EE6A 4OBSA 4YQXL 1J1PL 4PLJD 1D9KA 4OD2B 4OQTH 4RMTA 3VFNA 2R8SL 1WBXB 2HT3D 2E6JA 3H7BA 2SEBB 2DQCH 5KSUB 2GUOA 1U3HC 3DYOA 1YQVL 4OD1H 3FO0L 5KSBE 4GG6B 1NUDA 5I66A 5JUEH 4G8IB 4TN9A 4NBZB 4KTDH 3OF6D 4DK3A 5FF6A 4IRSB 5EORL 1CLOH 4X6CB 3T4AA 1MCDA 4FQXA 4HHAB 5C07E 4PB0H 3QP3A 1OAQL 3NCYS 4OCSH 3ZE1E 1ZA6A 4OFPA 1BFOB 5EZOL 5SX4H 4PJ7E 5DRZA 1YN7B 4Z8FL 3TM6A 1SYVA 4XCCH 1HK6A 3QUYA 2DJ4A 1HINL 1UWXH 5MP6H 5GS0H 5E5RB 1CT8A 5DQJA 3S7GA 2IAMB 3CAFA 1MCKA 2B39A 2D7PA 5HI3D 4JHWL 3KXFE 3O81A 3MYJA 1XF3A 4LSPL 5J0BA 3ETBF 1OM3H 3BD5A 3LKPB 5FO9B 1BM3H 3UJJH 4X6EA 1XCQA 4PV9A 1C08A 4R6UA 4HH8A 5ID0A 2Z0BA 4FQQB 4F9LC 4LGSB 4M4RA 1GPOH 3BJLA 1FO0B 1Z9SA 1SYSB 3PABA 3VH8G 4NN5C 2ERJB 1M1SA 5EU7C 5I1JL 3ARQA 3P11H 1CCZA 1IGIL 3H3KA 4U1KB 3L95B 3EO0A 3BPNB 5BVJB 5FOBB 5KAQG 1MHEB 1UXWA 2A6DB 3EOBB 4OF6A 4O5LH 1ZT7A 4HS6A 4JO4H 5DMIL 3UBXG 2OS7A 4IOFD 1PEZA 4RAVA 4HSQA 3IETB 1U6AL 1DDHA 3ARYA 3Q48A 8CGTA 5KS9A 5J57B 3V4VH 1F4WL 2Z4QB 1FL6B 2PYFA 5HHQA 5I18L 1KLUA 3C8DA 1NUNB 3KLAA 2AJUL 4LQ1A 1CN4A 1G7JA 4EJ1C 4HLZH 2WQRA 2Z92A 4QOKA 3VXSD 5HHMB 1G0XA 2I9LA 2VDOL 3TJHC 5GJTH 1MCOL 4WENB 5E4EB 4KROC 1LE9A 4QEGA 3MRMA 4IIQB 4LIQH 4NM8L 4U33A 3BZEB 4BFGA 3CFEA 1WQVT 4QY8B 1N5AB 1QFUH 4QCIA 2YC1B 1FE8H 1NMBL 4KROB 2D03H 4W6XB 3OTTA 3TBVB 2C1OB 1A9BA 3BX7C 4TNWK 3QXDB 1HDMB 3A67H 2AAVA 1LILA 4NCC2 3CC5B 2ZUUA 2WMPA 4PJEF 3U83A 3GBML 3BAEL 3JZ7A 4R7NA 2DRUA 3HR5B 2CRMA 4P5KB 1S7TA 3QZWG 4JN1L 4NN7C 4XP5H 2OTWB 2EH7H 4QNPF 3IU4L 5GRVK 3DURA 3BDBA 4HH9B 4PGBA 3VG9B 1F11B 4GW5A 1GOGA 1MUJB 4MA3B 1QPPA 1S5IH 3CFKA 2H3NA 3Q6GH 5FYLH 4G3YH 2I9TA 4P2QE 3TN0D 2YD7A 4FFWD 2NW2B 4DEPC 3UTPD 1IMHC 4FFYH 4ZUVA 1AKJA 5LJYH 3GSNL 3IYLW 2BVPA 5GS3A 3MLXH 1OB1A 2E27H 2D7NA 5HYJA 4DN4L 4U1GC 2WQ8A 2E7LA 4M7KL 5CD5D 2X09A 4S11A 4MA1C 1QSFE 5L9DL 2XZAL 5DFTA 1HILB 2OL3B 2AABH 4JY6A 4XH2A 4KQ3H 1FG2A 1OP3H 5IQ9A 3IF1B 4P4KD 4P3DA 2F58H 1MIEL 3QIUB 1REIA 2P7TA 2NY0B 5GJSH 5JW3H 5C1MB 3QUKB 4UINL 1HHGB 3G5YB 4HS3A 1YY9D 2DICA 4WU5A 1JNHA 4YGVB 5D7JA 1TNMA 4KK9D 5CP3H 1W8OA 2IPUK 5HGBB 1QFWL 5DUBA 3CMGA 5TH2B 4YO0B 4KAQH 1MCWW 1IC7H 1I3RA 4LSSL 5TQ2L 3QIBB 5AZ2L 4P2OA 1MCFA 5I6XC 2XICA 4QRPE 4OI9A 5F89A 3HFMH 2Q87A 2HFFA 4YUEL 5CIPA 1YUHB 5IHZB 5FB8A 4Z7UE 1CFBA 1T0MB 2ZSWB 5KVDH 1U8JA 3DXAD 1OPGL 2EYSB 4LLQB 1VFAB 3V2AR 4XCFH 5LAXB 4YHML 5D70H 4BSWA 1NPUA 1IC7L 5IK3A 2EEDA 2VL5A 2J12B 5F1SA 3VXSE 4JR9H 4G7VL 1Y18A 1XF2B 1SVCP 2FO1A 4GG6F 3KR3H 4G5ZH 5DURD 1RFDH 5AAWA 2YHGA 4XNMB 3KPTA 3SDAB 4HFUL 3BAEH 4LMQE 3B9AA 1OVZA 3U4EB 4M62H 1F4WH 5ADOH 2BVEA 1MAKA 5SWZB 2MPAL 3BKJH 3TVMC 3KPPB 5I19H 4OSUL 5E7FA 2HKFH 2WM0A 1G1YA 2VXSH 3BPLC 2VDQL 4XPFL 1IAKB 3PL6C 2BMKA 5HHVH 4YFLF 3HC3H 4DZBB 3TBWB 1TLKA 2H2PD 4QXUL 5T3ZE 5JHLL 5E5UB 4OZGF 4JY4B 3BKCH 3O6MH 5J6GB 2J8UB 5E8EA 1OAKL 3KPQB 3SDYH 5E6IC 1GIGH 2RGSA 1LNUB 4RGMB 5CJ8A 3EYOB 1N3NB 4TRPH 1AFVL 3WJLC 2CLRB 1QHOA 4E41E 1U91B 1ZT4A 3ARBC 4M1GL 1K8IB 4LSRH 5LXGL 4LSUL 5I19L 1RMFL 1CTNA 4LIQE 4KJYB 1FL3B 1MIEH 2ERJC 1BVKB 4B50A 1QYGH 4Z0XA 4OCWL 3OAYK 1WF5A 3L7EB 3SDAA 1NAKH 1AC6A 3TCXA 1SBSH 3VFPB 5EU4B 4OCWH 1UCTA 2I9LB 2NCMA 4F8TA 4XX1E 2X5PA 4R0LC 2VDNH 4KVCL 5L2JA 3ARBD 5LCVH 5SWSB 3PL6A 3RIFF 5EU7E 1X5FA 4R0LB 4DKEH 3GSXB 4G6AD 2ARJA 2P24B 2RCSH 1H3TA 4XAWL 3CU1A 1LE9B 1NQBA 1U8HA 5IP4A 2DM2A 3EYVA 5SX5K 4WNQA 1SM3L 2DQTH 5I73C 5LCVL 5EBWB 3IKKA 2IBGA 5JHDD 2IQAA 1KJ2A 2VH5H 4FTVA 1W2KT 1UB5B 4QRPA 3KXFD 4Y7MA 3HLAA 3FT3B 1YMHA 2CH8A 3VI4E 3I2CL 4BJLA 1EERB 4PRID 1WTLA 3PABB 1I7RA 2CLVA 3GO1L 1U8LA 2IBBA 4QRPD 4X7EC 1PSKL 1RK0A 4H5SA 1M7IA 2HMID 2VL5B 1MI5E 2E9WA 2RB8A 2E9IA 4N5UA 1WITA 4OLVH 3JXAA 2XQYK 3P4MB 3MRIB 3EO1B 5C6TH 4M7LT 1NGWB 5HDLA 2F58L 3QNXA 3KAAA 2FECI 3U0PA 4JQIH 5TQ0L 3QR2A 4K2UH 1IGIH 1JZ7A 2HKHL 4Q9RL 5SWQB 1VKXB 4MB5A 3QO1B 2BVQA 4ZD3H 5DVMA 1G9MC 1G1CA 5KW9H 1BZQK 1CG9A 4Z7QF 5JNYA 3HC4H 5FV2A 3MBXL 3WFDL 1QSED 2GK0A 3O8XC 1RJCA 1AKJB 5BS0A 3U7WH 2Y7QB 5JR1L 1IAIM 2DTSA 4EKXA 1I9RL 3TP4A 2XIDA 4B7LA 1HCFX 4TVPL 1CBVL 3WJJA 5JOPE 5HGDB 1T3FB 4ODHH 3WL9A 1A6AB 3IU3B 4ODSH 1H3GA 3DETD 1ZLVH 1MCWM 1ZHNB 5F8QC 4L4TB 4ZUWB 5K33A 3BVNB 3TBTB 3VWJB 2HRLA 3OXSA 5D7SH 3LPFA 1S9WA 3FB5B 1Q9KB 1OWWA 4WI2A 3AS3A 5DD0L 4KZEL 4N0YH 2XKUA 1D9KD 2E6QA 2YXMA 5BJTB 1KSRA 3QIBC 3IDXH 4U6VH 5EU6A 3B8SA 3IDIB 3MLVH 43CAA 5CEXB 1A14L 3S35L 1A4KB 5JXAL 4OZHF 2BHUA 4U1SA 1IM9A 3CCHB 3E6FA 1BIIB 3DUHA 3RX8A 5GSRA 4Q6YA 5IMMA 1L0YA 4U1IA 2R23B 4I0PB 3IFOB 2ENSA 3GSQB 3BH9A 2P5ED 5CSZA 5F1KC 1CFVL 2VZ3A 1FBIH 4G8GD 1J1PH 1P7KA 4M6NL 4YEEA 4JPKH 1SVZA 2VZTA 5IMOB 2Z92B 2R2HA 2XWTB 1KCVH 3MNVA 5HTSA 1GC1L 4LF3A 1HH6B 4FRWA 1A14H 3S35H 1MIML 4MNQB 2V2TA 3S36L 5TDOB 3V5KB 2F53A 7FABH 3VWKB 4DVRH 5D6DC 3EFFB 5HI5D 2PR4H 2W65A 5DD1L 2QQLH 4M7KH 2F5AL 5GGVH 2GYSA 1LO4L 1A21A 1J0HA 5J13C 4X4YA 5IW6B 3GSRB 5E8OA 3U7AA 1HHJA 3CPLB 3KHQA 3HG1E 3O6KH 3MXWH 15C8L 1C1EH 1CK0H 4DAGH 1U92A 5A2JH 4EIZC 2L4OA 1J8HB 3NZHH 2HMIC 4K7FA 5ETUA 5GRYA 4HXBH 2EXWD 2JK5A 2ED9A 1AHWA 3U1SL 1JYWA 1MHEA 5IESH 3HNTH 4J1UB 1TTGA 4AJ0A 1HH9A 5EBMB 1NDMA 1QRND 2J8UF 4RAVB 5DLML 4PJEA 1T66C 5IJVB 2Z31B 3EIFA 4GXUN 3RZCA 1JV5A 1HXYB 1BQLH 1FVCB 1GZQB 3V5KA 3SQBA 5D2NE 3SPVA 3BIAX 3ULVE 5I1DB 3HA0A 4KMQA 1QSEE 4UBDC 1X5XA 3PQYE 5DUPH 2DQFA 1KJVA 3S4SB 3KWWB 1YEDA 1TVHB 4X98A 1OAYH 4YDVA 3P9MA 4IDJH 1P7KB 5DC0A 5TE4L 1I1YB 3QDHA 1YQ2A 2IEPA 3MUY1 5BV7C 2PW2A 4U1MA 2DWEA 4U31A 2UZXB 3BZ4A 1XGPB 4UT6L 3FHAA 5FO9A 5T3ZL 4NQXB 3QG6A 4GXVH 5ADPL 2HFTA 3MACL 3S96A 5T1DL 1RJZA 1JHTB 3AFLA 3DX6B 4PY8J 3QUZD 5AD0A 1IEAA 1BFSA 2ZOLB 4MNGB 3SDXB 4AEIH 1FZOA 4PY7A 3B2VL 3HE6C 2AV1A 3MX0A 4R26H 5C07B 1VFBB 2FJHA 3TT1H 1OTSC 5FCSH 4PPTA 1BQSA 1SJHB 3GK8L 4ZYKB 3DO3A 5CSBA 5I2IB 1LP9A 1KIRB 3N1QC 3K8LA 1HQRB 3FL7A 1A9EB 4PJXA 3HKFA 5IBLD 3KNBA 2EKSB 3FQNB 1AE6H 4PS4L 3AM8A 2VDPL 2XKSA 3PWVB 2PXYC 2DOCA 5GRUL 4LRIC 4WEMB 1UH4A 1MFAH 3I3EA 5IROC 1PKQA 4ODWB 3AU1A 1MCLA 4XGZA 4IIQC 3EDFA 1IC1A 3NPSB 4KI5F 4LSUH 3RPIB 1N7ML 2BVPB 3LN5B 3DSFL 1VFBA 3UTZA 3WD5H 1AQKL 1NC2B 2PF6A 3FN0L 4CVUA 1S7XB 3JWOH 5F7FA 1BLNB 3MLTB 4X0KA 5TPWL 4JFDD 4JN2B 5ABDE 5J3HC 4C55A 3U9PL 3TNMB 5HGDA 2IPKB 4FN0A 5JXED 5K9KA 2GIYA 1D5IH 2FHCA 3QIWA 2P4AB 3ALXA 4IHOB 2DQGH 5HI4D 5L0QC 3O2WL 4P4KC 2VKXA 3NIFF 4XPFH 3C08H 3CUPB 3GBNL 4NNXA 4POUB 4NO2A 3UTTA 5KZCD 1MQKH 4MA7H 4NHUB 1YYML 3P4LA 1EJOH 2VZ1A 4J4PD 1DANU 2C3WA 2J4WH 3PXJA 2R9HD 4WTZA 4BSVA 3K4DA 5F3HA 4RRPA 3RZCB 4WW1A 5EO1A 2WP3O 1LEIA 4IRJB 2YUXA 4P2OD 1KJ2H 3H42L 5I1DA 4QHKJ 3TPUB 3MRMB 4IIQA 3HMXH 2HT4D 2OYPA 5ANME 4JFFD 3C5SB 4NKOA 4ONOA 1F97A 1Q0YH 4U1MB 4JB9L 2C26A 4RQQB 2K7QA 2AEPH 3K8MA 5DMYA 4ZAKD 5F7DA 1B2WH 2ZUSA 3QRFM 4U7SA 1X9QA 1CIUA 3OXRB 1JZ6A 3DO7A 4ODTH 2AEPL 2DM4A 4XZUA 1MHCB 3TNNB 3TA3C 3RNKA 2V17L 2YRZA 3P0YH 4OFKA 4ZAKA 2YWZA 1LHZA 3WNKA 1RZ8A 4E41D 3F7RA 4ZG1A 4O00A 1MRFH 1Q9OA 2CR6A 1EGJL 2VDMH 3MLRL 4W6YB 5LBSL 1LMKA 1CD9B 1TZHB 2Y06L 3MV8D 5DGQA 4YWGH 2W9EH 3K2UL 1ONQA 1K4CA 1TIUA 3MFGB 4JKLA 5DRXB 1OAYL 4ZS6C 4IMLA 1HHKB 3SQOL 3DV6B 1NSNH 1F6AB 3HAEA 1S9KC 1DQDH 1YEGH 3VWKC 2CUIA 3R06A 5T33L 3MV11 2WP3T 1EV2E 2GTZA 5K9QI 4GBXA 4PRNB 1MREH 4Y16B 4EI6B 1LWRA 4GAGL 3DROB 3V6ZA 4WY7H 1AQKH 1FFNB 1A2YB 5J13B 2E27L 4YBQD 1A6UL 3L3HA 3L3GA 4I18A 1JTOA 1RD6A 1S9VA 4LARL 5T1KA 3CSPA 2A77H 5GQBA 4JRYE 3O9WB 5SWZA 4X4XA 1KIPA 4PJ9B 1YEGL 1MCNA 4WI3A 3CXDH 5C08E 4GUPB 3LCYA 1NBYB 4FTVD 4ZS7L 4YK4C 1I3VA 4M03A 3KDMB 3MLVL 3WO4B 3IS1X 4PTTA 4JGUA 1JGEB 5ACMA 1WBYB 2EH7L 1F4XH 2HLAA 5KANG 3V4UL 3T4AB 4N0YL 1PKQE 2NLJA 4N0CD 1C16A 2IG2H 4RMSA 5MI0B 1O0VA 2ED7A 4KJQD 3RZWA 3UXFA 2WIMA 3MJ9H 1V7MH 1T80A 2AQ1A 5MI0C 3R1GL 1JZ2A 4HLZG 4AZ8A 1UJ3C 2NNAB 4CVWA 5F89B 2W9DH 1B2WL 3UMTA 3RGVD 2ZOLA 4HZLB 3VD5A 1JF1B 5IKCA 1D6EA 4P49A 4I13B 1W8NA 3WFEH 5D6CB 1A5FL 5HSFA 4RZCA 3CLFH 1F2QA 2JJWA 2X9YA 4ZUWA 4GAYA 1E4KC 4MDJB 4YHLH 5D5MA 5FKAA 4P5TA 1Q9WA 5DR5H 4HUXA 4MQ7B 1I1YA 2E9BA 1AC0A 1OY3B 4DOHE 1G0DA 3C60B 1WFUA 1DUZB 3KYMA 1XGUB 1ETZB 4NFCA 4GMTH 4NKDA 5H37H 1EHLH 5ANMA 1T6VN 3D2UA 4K8RC 5CINL 1FGVH 5EC2A 4WVRA 4KVNL 4PUBH 5E5MB 4JDVB 2OJZL 4FQPA 5DJAA 4YBLC 5B22A 4HKZA 5HVHC 3QUZC 1XGQA 1NBYA 4W4NA 2VDLH 3ULVL 4UB0H 3OL2A 1RSFA 1WEJH 2KBGA 4K9EC 1BJ1J 2EIZB 2D3VA 1VCAA 3B3IB 1FIEA 4KY1H 1F90L 3X11B 3DHJA 4G9FB 2XZCH 5KG9A 4XMKH 5D2LE 2COQA 2NTSP 5E2VL 1FHGA 1K2DA 4Y5VB 4KHTH 5KW9L 4JFOA 1CQYA 2NX5A 2V7NB 3IAPA 1MJUL 3MJGX 1Z2KA 2X4UA 3BE1L 4ZS7H 1NCWL 2AK1L 3RIAF 4FQ2H 2AI0L 12E8L 5JDJA 1H8SA 1MPAH 3L6FB 4GT7A 4X9FA 5I1AA 4M48L 1AD9A 3UTSE 1I1RA 1NGQL 3PJSA 1I8IB 3FO9A 4N0UB 4PV8A 3NZ8B 3B5TA 2X89D 1X7QB 1LO0L 1OTUD 4MNQA 2V2TB 3KVQA 4HJ0C 2OTWA 2AV7B 4WFED 4ETQA 5ACZB 2BVTA 1C12B 3CFJB 1IZKA 5EN2A 2GK2A 2ZJSL 1KCUL 4FQIL 4ALAL 2VQ1B 3MACH 2X89A 1FV1B 2XYCA 4M1CD 4YHKH 4BSJA 3FO0H 4PJCE 1F13A 1OGAD 1HI6B 1MNUH 4LASH 3CFCH 1ROWA 2Q86B 2FO4A 2BOCB 2HJLB 1NUGA 5EBGA 2V5MA 2GFBB 4KV5F 2HVJB 1UWEH 3BN3B 1CL7L 3OXRA 1A7PH 5EBLA 4MA1B 5KSBA 2ZWLT 3ULUD 5I8KH 1JRHH 2XPGB 2XT1B 2IAND 2VLKD 3HAEB 1E4WH 4OGZA 2V2XB 3ZO0A 3T3PE 1TJGH 4LFHG 5EZIH 5GGQH 2P8MB 4F9PC 1JCKA 1G9MH 5DYOB 1F3DJ 2LU3A 3WNNA 5F93C 5IVNA 1KN4L 2VLKA 4LSQH 2XTLA 5IK3B 3QQ9D 2FBJH 3RQ3A 1IVLA 1XF5B 4Z77B 4XNMA 1HHHA 1CLZH 2WUCL 4G43B 3LH2L 5K93A 3W9DB 4HCRL 4Z0BL 4F37K 3EJYC 2YD3A 1AD0A 3QXTA 4JDVA 3RTQD 2CIKA 4ZAKB 1IKFH 1BD2E 3MRLB 1GAFH 1ZWIB 3T0AA 3LKQA 2K3TA 4LLUA 3T1WA 4JFPA 3WKNA 4F7PB 4M1GH 2EYSA 3T09A 1H0DA 1KG0B 1PX4A 1CK0L 2W60B 2ZSVA 3LEYL 3QDMB 1MFAL 1HCVA 1CLZL 3TV3L 5DHXB 4DTGL 3T0VA 1WBZB 4ZTPL 2O5ZL 1JI1A 2ADIA 1EA9C 4YDJB 1PJ9A 4NO0D 5GGSB 2W07A 3WLBB 5DJYA 1S3KH 5E1AA 4NBYB 4JFED 3F7VA 3S34H 1EJOL 3F12B 5HXMA 3MJ7A 3MCLL 2J88L 2QR0B 5EUKA 2AJZB 3QCTH 3B83A 2DQEL 1AJ7L 1QFWI 5LGHH 5IVXF 1D5IL 4JFXB 5IF0B 5DD5H 5C0FB 1X5LA 3P4NB 4PGJA 4LLWA 4NDMA 4UV7L 2EC9U 4X99A 5E99L 1KIRA 4LRNH 5L6YL 4NFBA 2YWYA 1BIIA 4OZ4A 3VA2C 3N1PC 1WBXA 3K81A 5D70L 1RIUL 1QZ1A 2AW2A 3BD3A 5CMAA 1KXTB 3OV6A 2A2QT 5HDQH 5CEZL 3PWUA 1CD1B 1NAMH 5FGRA 1D5XA 1LD9A 1U8KB 4MNQE 3LN4B 3FQWB 1AXTH 1DN2A 3V79C 4Z95H 1U3YA 4HWZA 5JO5A 3X3FH 3NAAH 4F57H 5GSVB 4R90L 3HPJA 2P47B 4H88L 1DN0B 3FRPG 4DFHA 4RWYL 1EEQA 5IWLA 4NJAH 4F8QA 3AB0B 4KDTA 4FOMA 1DSFH 2BDNH 2FB4H 3MROB 4JG0H 5IV2A 5F6IC 3BMVA 1H3XA 4G7VH 3CH1A 3QDAA 3VXNB 1KNOB 4X4ME 4X9BA 1KB5A 5FXCH 2FX8H 5CJQL 4PD4K 5EU6E 1JYXA 4G80A 2OMNA 3HB3D 2FR4A 1ZT1A 2J1KA 3X14A 1YDPB 4KKLD 5IFHL 1XR9A 4ZXBD 4PJEB 5HDBF 3H9HB 3WFCH 2GI7A 3QIWD 4NRZA 4QTHA 1DVFC 3ROLB 3KHOA 3DIFA 3WS6C 4KI1A 2JK5B 4WI6A 4JJ5A 4O4YH 4RA0C 1JUFA 4EUPA 5EH1A 3GUTA 2GTZB 3GKZA 4DZBA 1WT5C 3NIGE 3D1MC 4EDXA 1X5JA 4C56E 3FO1B 5KANI 1UB6B 1MHCA 1RUAL 3O6FC 5DRNB 1AGFA 4RCAA 1B3JA 1EEZB 2JCCE 3ZKSD 1QTYT 4UTAL 1A5FH 4LMQI 3ZKMC 5EOQH 4R2GC 1Q9OB 3EYQD 4O4YL 4X9GA 3ULVF 1YECL 3RVUC 1BFVH 2YS4A 4ZUUA 4LVOB 4Y19A 1OGAE 4AM0A 3NCCB 5FOBA 2CDFA 2VL4A 4AENA 3PF2A 1UJTA 2NXYD 4APQB 2ADGA 2A6KB 1J5OL 4XPHL 4PV9B 3I02B 2YPKA 4H20L 1D6VL 4LLQA 4QGTA 5D93B 4IEFB 5J7CC 5IMOA 1KEGH 4P5MA 4BSVB 1KIQA 5GGVL 5L2JB 1T0PB 2CKNA 4P4KA 4OGYL 1ZGLB 2BNQB 1A3LL 3HPLA 3RX7A 2VQ1A 5INDB 4I77L 1RZIA 3ULUF 1K6QH 2PO6B 1X6LA 1WISA 4NC1C 4UTAH 1UQSB 5KOMC 3UO1L 2N56A 4QTIH 3BQUD 5C6TL 2XQBH 3QUYB 3SO3B 2AK4E 4LQFH 4NC2B 3B6SA 3D3VE 4J3SA 2A83B 2WBKA 1RZFH 1T4KA 3RA7H 2ZOKA 5A2IH 2D31B 1UB6A 3MRCB 3MNVB 4GG8A 1CBVH 5DD5L 2XWBA 4RFOH 1QBMH 2DLFL 3EYOA 4HHAA 4FQXB 1VSCA 2PTUA 2DQUH 3P30L 2WSKA 3SDCA 4UDUB 3TO4A 1RHHB 3GMRB 3X3FL 1A7NL 3HI5L 3MV7B 1RU9L 4P2OC 5IEKB 4G80B 4NCDA 4I0PA 4M4PA 4JANB 4MXWL 1R0AH 3L3JA 1NMAH 1ADQH 4Q6IA 3QHZL 1DCLA 1Z9LA 4P2QD 2GUOB 3IF1A 1NFDB 2WBJB 3C9NB 2NY4C 4HUWB 5I1KH 3FOMB 2BSSB 1BLNA 4G9FA 5KG9B 1F6LL 1MOEA 5BRZD 3UBXI 5GS0C 4OFYA 1DBKL 3O11A 3PWLA 1MCRA 3HE7D 1VESA 4YHNA 1NAMB 4KK5D 1S5IL 3O6FA 2E7CA 1A7NH 3HI5H 2JELL 4JEGB 4NZTL 5I18H 5JHDA 3FMGL 4YFDB 3ARFB 2JJVA 3MV9E 2F54E 2O61A 4BQ8A 3LD8C 1UH3A 3N06B 5FF6B 5DDHA 5ANMB 2X4NB 1JNNH 4NQDD 1BX2B 4ODBD 5ESAB 2AEQL 4WEUD 1A6TB 3QZWB 3PXHA 2Z91B 2VAJA 4Z7NF 4AQOA 1S7TB 5DVKA 1VADB 3U4AA 5CFHA 3W39B 3PWNA 3V5HA 5JTWA 4Y4KD 4PJCF 1H3PL 4QRTA 1NANH 5FKAB 4Z7UB 3HPLB 1FDLL 5INCB 4HKBB 3SDCB 1LO3L 2CDEA 1RK0B 1OPGH 3CFIC 1D5XB 5HDOA 4PTUB 5I8KL 3VGAC 1I9IH 32C2A 4JVUA 4MNGA 5KVEH 3SDYL 4HQQL 3UTSB 2OZ4A 4N0UE 4X6BB 2ADGB 4KTDL 2VDRL 3B43A 4X8JB 5EOTA 3RWEB 2RHEA 3RRQA 5B3NA 4YHPB 2ZUYA 5CCKH 4KMTH 1HKLL 1X3DA 1OP5H 3OAYH 1KCRH 4N9GA 3QUXD 4MS8C 5CZKA 4I3RH 2YD2A 3T2NL 1MWAL 4NM4H 1NFIB 4PRDB 4G42A 1ZGLA 2ICWA 1M7IB 4LOUD 1CLYL 1T5XB 1EZVY 3IDYB 4WO4C 2QSTA 1G9ML 2PTTA 5B3JE 2NX5D 1FNHA 3OKKA 1JGVL 5FHBH 5MERB 4M93C 3RA7L 4O02L 4LCWD 1OP5K 2YMXH 1G7HB 4NO5A 4HULB 5KTEL 1Q0XL 1OLZA 3SE9H 3SGKA 3BKCL 3O2VL 1FFPB 3D3VA 4JO2H 1YPZE 4YHMH 3FRUA 4MMXC 4RFEB 1T22B 3MLZL 5GS2D 3DSNA 2R0KL 4XRCB 4A2MA 3MOBH 5ESVB 2X4QA 4V2BA 5JLZB 4ZNEE 5I8OL 5I1HL 4LVHB 3QHZH 2NY5C 1ADQL 5DK2B 1KB5L 2MQ3A 5EOCL 4FQJH 3ARDC 4IDLA 1IM9D 3FOLB 3QXAA 1OD9A 5TGBA 5I1GL 5FDWA 2BSTB 1ZT1B 5I1CL 4KY1L 3KPRE 2FH6A 4M7ZC 2HJLA 1S5HA 3IDJA 5BS0E 5C08B 3X3GH 1C08B 4Y2DA 3G6JB 1K9TA 4LQFL 3SGJA 4QF1B 2MCG1 1GVIA 4XPGH 4PYGA 4OI7A 4AIOA 1ZS8B 4JPVH 5SWSE 1UVQA 4KKBD 5C0AA 1T21A 2QADD 3RVUD 2F53D 3BP5B 5IROA 3QWRA 5I0DA 4M43H 1ZKAA 2VIRA 3Q1SH 3QNZA 4LLMA 3E6FB 1LEGA 4H0HB 1EXUA 3T65A 1Y6NR 5TF0A 4HJGA 3E6HA 1M7XA 3GMLA 3S3PA 3SJVB 3KYOB 1LGVA 3MUGA 1KLFA 5CWSA 1R3HA 1AGDA 5GGTH 3W0WD 4FQIH 5LAXA 3X17A 3OPZL 1NGPL 4CMHB 5TE4H 3CK0L 4GRWH 1LO0H 5JHDE 1PVHA 3UPRB 2Q76B 3KPOB 4XVUD 1OW0A 3S37L 2VUYA 2X1PA 2VR4A 3O8XB 3UDWA 3IVKA 2DQJL 5T1LA 1FNGB 1ZA3A 3IJHB 1KFAL 4ODVH 5C92A 1WLHA 4OZHB 4MAYD 5HYSB 1KF9B 4R2GB 4YHOH 1TQBB 3ZTJH 2KQNA 3SDDB 4BELD 3OKMB 1T1WB 1U93B 2KZWA 2P5EE 2G5BB 1BZ7B 3CSGA 1WZLA 3P9WB 4CJ0A 4ZFOL 4UILL 1MRCH 2FIKB 5T3XL 5DQDL 1Y18B 5GGSA 3WLBA 5C0EA 1XF2A 3OR6A 3QEQD 1PEWA 4QWWC 4XMPH 5T3XD 1AQDB 2WUBH 2BK8A 5BRZB 1KCSL 1CXFA 4OF0A 1TJGL 4M61B 2E5EA 1KULA 5L8JB 1WUNT 2VXTH 3VE0B 2DMCA 2VZUA 2OXHA 4DW2H 5FYJD 5DO2C 5DI8B 3PP3H 3LZFL 4HUNB 1FG2B 1F4YL 2C3GA 4Y89A 2GK0B 1GAFL 3REWB 4DUWA 3BP4A 3E1F1 3RVTD 5E2WH 5JNYB 1MQ8A 4L1HA 1NGZB 2CRIA 4HCRH 2ZZUT 5DJYB 2IFFH 2R0LL 3B5HA 5D7JB 4XWOD 1CD0A 1FIGL 3GIZL 4NQVB 3VMPA 2IG2L 1CGSH 3RWCB 5H2BA 4NP4H 4CVZA 3WNPA 2DLTA 4MSWA 5JPNB 5CUSL 1DQLH 1AJ7H 3TO2B 5JA8B 5E2JA 2OK0H 2ICWJ 1T0NA 2VLLA 1E4WL 1S7SA 5LQBL 2BNQD 5ISZA 3VRIB 3BSZL 2HTKD 3SJVD 1JVKA 1WZ1L 4U1NA 2AGJH 2CIIA 1XF5A 3VA6A 2VDML 3NABL 1C16B 2APWA 2GITB 4NO3A 1JF1A 1J0ZA 3L5XH 3SJVA 3BN9C 5E99H 2BFVH 3OG6B 4HJGB 4OTXL 2BY2A 4PLJC 3OR7B 3TYFB 4K3GA 3RWIB 1JHTA 3UBXA 1IKFL 4GG6E 5IVXB 1E6OL 5EU5B 1MCPL 4L3ED 3QHFL 1S7RB 3UJIL 4GO6B 4FG6D 4XP4H 3IDXL 1T89C 4YXKL 2X9WA 2NY3D 4WUKL 3NTCH 5DHYB 2OTPA 2VDLL 5IM7B 2X4RB 4EDWL 3L3GB 3P40A 1XEDA 3TA3A 3RVXC 1N3NA 5EA0H 5L2KD 2NY7L 3K2UH 4D3CL 2FATL 5KSVA 3BGAA 3UP1A 2OJZH 5ERWB 4PUBL 5FO7A 1TCMA 1X5GA 3QWOA 4TSBL 5IVZB 1LE5A 3HG1B 1E27A 8FABB 4OV5A 3I6GB 1J0IA 4Z18A 4DFIA 1IJ9A 4NPYA 4P23D 2EXYC 2WWKT 4X5WB 5DSCA 5C0ND 1I9RH 2BHZA 3RDTD 4LKXA 3JVGC 2CDGA 4HPOL 3C6LC 4HUMB 3DUUA 4XMKL 2H26A 3DGGA 3TO4C 2KDGA 4LSTH 1AGFB 2NW3B 5BVJA 1UWXK 1N4XL 3FB6B 5CZXC 3LS5H 1R5IA 1T22A 1VGKB 3TNNA 3VD4A 1KTDB 1RIHL 2R69L 1G9NL 1V8HA 4LOUC 1IGTB 2Q7YB 5T33H 1H8NA 3W5NA 1UM4H 1NBVL 2BSTA 4JFHE 3WD5L 4EI5A 5BW7A 1G7JB 3L9RB 1NKRA 4ODUA 5C86A 1EFXB 4NKIH 2R15A 1P9MC 2R0ZL 4MB3A 3SE8H 1EZVX 3MYJB 4KKAC 3RWCA 4JO1H 5I74C 4L9LA 1NFIA 3MV9B 4LU5H 3ZYZA 5TF1H 3QFDA 4OD1L 1SYSA 5ALCH 4ELMF 2Z35A 3THML 5GRXG 2JB5H 4RMQA 4JZJB 2EICA 2Z8VC 5DFVC 1RUKH 4PGEB 3KYMB 4NKDB 2FJFB 1BD2A 5D1ZB 5HPOA 2Q6WB 3LKPA 4IBLT 5FYKE 4DKEL 3ABZA 4NJ9H 3QIWC 2HT3C 3O3DA 3W9EA 4PGCB 3QEHB 4BQCA 2L0DA 5E24E 3PWNB 2JB5L 3V5HB 4XNYL 1UKQA 5ITFB 3SE9L 3CVIL 5FA4A 3MOAH 3QDJE 5ALCL 1X5KA 2YEZB 2DMKA 1RUML 2ICWI 1UGNA 5EZIL 5GGQL 2F5BL 3BD4A 3ZHLA 3JV5A 1YNLH 3FONA 5EU6B 5HPMB 3QQ4B 4PTTB 4CL7A 4L3CB 4KTYA 4MJ6B 4PJ8A 3T77B 4JKMA 3VJ6B 3TWCH 2GJ6A 4NO0B 1P69B 4JM4H 4POZD 4KXZI 4MAUH 3T2NH 2AJVL 3E8UL 4PJEE 1VADA 4WHTA 3RZCC 5IIEA 4KK8D 2EYTB 3NABH 3OKEA 1DFBL 1UZ8A 4UV4L 25C8L 3VGBA 3UCRA 1FRGH 5F7NC 3TN0A 1A2YA 3ZTNH 1CE1H 2VLME 1JGEA 5F72S 3GB7B 1BVLB 1VPOL 2P46B 4OCYL 1I9JL 4HBQA 4NZUH 4KKLC 4PJDA 1YEHH 3OMZA 2GJ6B 3NMEA 3HZVA 1A22B 1U93A 4JFZH 2AVGA 4DAGL 3RAJL 4RIRB 2PN5A 4XPTH 3VFSB 4E5XA 1FPTH 2H3NB 4NQUA 4UT7L 1WAAA 4MA3A 4MGXA 3CDGA 4JLRA 4N5ED 5HDBE 2Q76A 1EEYA 3CSBA 1XZ0B 4N8CH 4N8VA 4JKKA 4H1LB 1MFDH 2LABA 1CFQA 1A7QL 4BFBD 1TVDA 2JELH 5BMFH 3PHQA 3IDNB 4LU5L 5ESQA 1QSFD 4HG4J 3JV6A 4F7MA 3F7YA 4GSDL 4AMKL 1FVCA 1GZQA 3FB7B 4HGMA 4ZPTB 4PJBA 4XBPB 1BIHA 1M71B 1OGAB 3RNKB 3FOLA 4U6HA 4K3JH 4NFDA 4AENB 4S1RH 1JFQL 4J1UA 1WCBA 2Z8RA 4Q2ZB 1NLDH 3ZDZF 4L3EB 1AHWC 1UWGL 4IJ3B 2GHWB 5IQ7L 3D3VB 1NDMB 2NXYC 2RFXB 2ZKHL 1L7IL 2VZSA 2JIXB 3ME0A 3MOQA 3U2SA 4FMKA 1RZ8B 5L2KE 1QLFB 1ZLWH 3L7FB 4PJHE 2YXFA 1DL7L 1XFPA 5C9KA 1CFSB 1J1XH 3QJFA 2FJGA 1QPXA 2IMMA 5CBAA 3UX9B 3MR9B 2QSCL 5CGYD 5J9PA 1MFEH 5TF1L 5DA0B 5IJVA 5DLMH 3IKCA 1TZGL 1Q94A 3WO4C 1BJ1H 2X1WL 3BIKA 1FLTX 4ETQB 4OGYH 2X4SA 4KWUA 4HK3J 4TOYL 5C0JB 4UOW1 1EAJA 3I3DA 4MLIA 1UJ3A 4DOHB 2QHRL 5IOPB 4NRZB 4XCYA 5CKAA 4GRLA 2R29H 4HJJL 3D9AH 1M71A 4WUKH 3IJYB 4WW2A 1F4AA 3TEUA 2H2PC 3NGBB 1C8PA 1N7MH 5D7KD 4LCCC 2F74B 3PHQB 3P4OB 1CFQB 5FCUL 2LV4A 2AKRB 4LCIL 4W4OA 2R2HB 3V4UH 3VXMD 3NCJL 5KSVB 3E3QE 3QPXL 4GQ9H 4TOYH 4X6DB 3AS2A 5CZVL 1I1FA 1SY6L 2P8LA 1SY6A 5C8JA 2XG4A 2UZIL 3G6AB 1VERA 2ZG2A 4XNZC 5DVNA 1N5YL 2I07B 5T3ZD 2EXYD 5DEZA 4RIRA 3MODH 3TO2A 4G6KL 3IFNL 1H8OA 2OZ4L 2DDQL 2VLJD 4LSVH 1Y6MR 1AXTL 3ZE2F 3DVGB 1GGCL 2DQJH 4L4TE 1BMGA 3GM8A 3IDIA 1JN6A 4RRPG 4H8WH 5I74B 4OBRA 5E1HB 3VWJD 2FD6L 2R1YB 2W92A 4R2GD 2HT2D 4JO2L 4UI2A 2MCPL 1FG9C 1F2XK 3NA9L 5ADPH 2Q7NA 2EDOA 3K74B 4NQEB 1U2CA 3S97C 1MCPH 2DF3A 1ED3A 3ZKXC 4QHUA 4BFIA 3HN3A 2C3VA 4GW1A 4HXBL 3W11D 4Z7NE 4PREB 1VHPA 3VD3A 2UVEA 1ZMYA 5BO1H 2X6MA 4X80H 4N9OB 4PJFB 2QQKL 1T6WA 4NO0A 2JJUA 3GZKA 1QLEL 4U1LB 5DZLA 1U0QA 4JM2F 4YO0A 3QEQA 4LPUA 3O2WH 3QDMD 1AR1D 2XOTA 2Q20A 3S88L 3OZ9H 4P9HC 5E9DE 1WAAF 2HTKC 4YDJA 2A74B 4AG4L 1RIHH 2YN3A 2OR8A 3C60D 1S7QA 1T1ZB 5I75B 1HHGA 3G5YA 4JQVA 3MRNA 4R97C 5IHUH 3UPRA 3WKML 4P5MB 4Y5YB 2AERT 5IR1A 5GISH 2A6KA 5I75C 1HEZB 1I7UA 1N2RB 5DD3L 1XGYH 4KJPD 3S5LG 5C08D 3GMRA 2XN9E 4PGDB 4KUCF 2DQIL 3GMMB 5EOCH 3EHBD 1AFVH 3CJJA 3AS1A 4WW2B 3T0EE 2AJSL 4PGEA 2CSPA 4ZQKB 2PETA 4WU7B 3GJFK 3MRQB 3VXRA 1KJ2B 1W72B 5HVWA 4PD4J 3IGAB 1HOCA 4P9MH 1KPUA 1EFXA 2QQLL 2PR4L 4U4BA 5FYLE 3U36A 3H0TB 4M1CC 2OXGA 5D72H 3LB6D 5SWSD 4QXTB 4BYHA 4EXPX 4QRRE 1MVFA 1IGTA 2YD6A 1BP3B 5EUOB 3RGHA 3SDXF 5HJ3A 1PQZB 1FIGH 5LKNA 3D39E 2BSRB 4MJID 2W59A 4U3XA 5JOPD 2CGRH 2Q8AH 2GCYB 4N0RA 2A9NL 4NQEE 5CKGA 5E94A 1IL1A 1RZ7H 4I2XB 4ZNEA 3E6HB 5I71C 1FSKB 4Y8AA 3LQMA 1SM3H 4RFNB 4K3DH 1IQWL 1EHAA 2VXQH 4L3EA 4FQLL 3LQZA 5FA3A 1I75A 4KK9C 1BAFL 4PJCB 3FB6A 1NC4D 2CLRA 4JZOB 1U3HA 2Z93B 3QI9B 3BWAA 5FYKL 1WVZA 4IDJL 1FYTE 4KJYA 5GSRB 1P1ZB 2CMRH 4MNHA 5B38A