1R5VB

Evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
185
structure length
185
Chain Sequence
APWFLEYSKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence that structural rearrangements and/or flexibility during TCR binding can contribute to T cell activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
total genus 40
structure length 185
sequence length 185
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r5vB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1r5vB01
1X5KA 5D1ZB 2NY5H 3T0XA 2FDBP 5D72H 3A67H 4FXKA 5KSBF 1AHWA 3HI1A 4JDZB 2Z35B 3VFPB 1E27B 4YHPB 3MRQA 1CXIA 2D7TH 4KAQH 1N6QL 3RIAK 3SOBL 3G08B 2XN9E 4G42B 4PB9H 3FQXA 1QSED 3QIBB 1R3JA 3G5VA 4B53A 4JZNA 4EEEA 5DUBA 4UB0H 4CVXB 3QFDA 2XQYK 2E3VA 4EUPH 3PQYE 1T0MB 4LMQI 4JN1H 1VB9A 2NY7H 3VJ6A 4L4TB 3VXQA 1F42A 4YDLB 1CTNA 4D0BB 2H3NB 1ZANL 3TT3H 1NQBA 4JFFB 5DD3L 3CVHL 3HE6D 2HMID 1UCBH 3D18B 2CRMA 2JCCF 4LRNH 4WFFE 4YDIL 4Y4KD 5JHDB 2HWZH 4FQXD 1AIFB 4F9LC 1IM3A 1LO3H 1A3LH 1GIGH 5FUOH 2VLME 3ARTA 5KZCB 1QVOA 1C5DB 1NCDH 3A6CH 3QUZD 2B4CL 3L3GA 4ODXB 3TYFA 1PD6A 4U6YA 5J1SC 4ODUA 4HT1H 2JK5B 1PG7X 3MRIB 4XPGL 4Q6IA 4HPOL 3N85L 1D5MB 4UIMA 5CLWA 2C7UA 1X7QA 2VDKH 1EEYB 5FK9A 3NZ8B 4HUXA 3O9WC 5T1LD 5IMMB 1KT2A 5BRZA 5EBGA 3IDMB 4JLRB 1AQKL 5HY9B 4KTDL 3BYYA 3ZTJG 2XN9D 3WNLA 1JYWA 2JF1A 1JZ3A 3BJ91 1QR1A 3MRRB 2Y07H 5HYJA 1FZJB 1TXKA 1L7IH 3R0NA 2CK0L 1NC4B 1F2XK 2OJZL 1VPOH 1A1NB 5CCKL 1R5WB 1AR2A 1OSPL 1EERB 3VCLB 3VU2A 4JR9H 2FSEA 5CD3B 4KJPD 3PDGA 5EU4A 4UOW0 4QHMA 3A6BL 4ELMF 2FEDC 1HKFA 1G9NC 4PJDB 1I3GH 3WUWA 3RL1B 2X9WA 2YMXH 4TSBL 2IBGA 3ULVL 3WFCL 3BIKB 4OZHB 1S5HB 4DQOH 5DC0A 3VD4A 4MXWH 3KPRA 1KJ2B 5IW1B 2ZPKL 5HI4C 5EN2A 5DK0A 1HDMB 4P2YA 5J1AB 4YZFE 3BPOB 1UWXH 1KUMA 3VFSA 3MOQA 2DWEB 4RCAA 1Q9KB 4PJFE 5FOBB 3WXVL 3SDAC 1ZGLA 2BJML 1NC4A 2FBJH 1MWAB 1OTUC 2GW5A 5T3XE 5T3XD 5I2IB 1QBML 3C8HA 5JTWA 3B9KC 1LO5A 4NP4H 3IETB 1X44A 2V5MA 3GI9L 3MCG1 3R1GH 1ND0A 32C2A 3BVNB 4ZXBD 2IMMA 3S3PA 4H5SB 4NQCA 2ORBH 5T5FL 1KNOB 5KN5B 3PGCA 1AP2B 3NIFF 5IV2B 5JQHC 3RWEA 2ZUUA 3VDAA 1FDLL 2J8UB 5CEZD 4F3FA 5HD8C 1F2QA 3RVUD 3KPLA 2ADFH 1DN2A 3ESVF 4NQCD 2UWEB 4APQD 5F6HI 1VFUA 3L95A 4KKCD 4UV4L 4HK3N 4IRSA 1TENA 5B4MD 5KSVA 3FQWA 3RDTA 5I9QB 1NLDH 2NLJB 4IDLA 4FFZH 3QPXH 5F8RC 4RGOL 1XAUA 4MAYA 3QG7H 5JXEA 4FQPA 2BOCB 3WIHL 2HT2D 3X13B 3MBXL 4HFUL 1X5FA 3NCCB 2VUYA 5I8EA 3W39B 4G6MH 5AUMB 2GJ6A 1RJYA 3WN5A 5AYQA 1EFXB 4Y2DA 5TQ2H 1U2CA 4UT9L 5FGBC 2PW1B 3ULUC 1TVDA 4G5ZL 2R2EA 4KAQL 5DF0A 4CNIA 1IEAA 4CJ1A 1XH3A 1MRDL 5DDHA 2QADC 3EKCA 4N0YH 3U7YH 5L88H 3RBGA 4OD1L 4ODWA 3LVEA 3CDFA 3HUJE 5IM7A 4IRJA 2W1NA 1KJVA 3TO4A 3N9GL 3ARDB 4HBCH 1KIPB 1S9VA 5E7FA 1CU4L 1WUNT 4G80A 4S1DD 3BGFB 2W9DL 4TRPH 1G9NH 2EXYC 4PJ8C 4I48B 2SEBA 4PRPD 5L2KA 1KCVL 4PJBE 5F1IA 3B4NA 2DQEL 1P7HL 3OF6D 5A2JH 2HWZL 4MB4A 1OW0C 5IHBA 5D7JC 1FFNB 3GBML 4NQED 4UUJB 2WIMA 1JPFA 4YBQC 1KCKA 4M9OA 3K0WA 4X6DE 4QTHA 2ILLA 3WFHB 2BVYA 2DQFA 4CVXA 3VFVA 1GZPB 2J8OA 4X7SH 4XP6L 1ZWIA 4FABL 4WWKB 4YHZL 1NEZG 3GBNH 4DN4L 5I6XC 1OAZL 2AJSH 4M3KB 1CGTA 2ZOKB 3FB8B 2Y9RT 3HRZB 1R5VB 5T33H 1YMMB 5EZLB 3IAGC 2P47B 1EAPA 3DUSB 5D72L 4QTIL 1AD9A 3ZKMC 4KK6D 2R1YB 4AMKL 4LHUG 3SGKA 1QSEB 3F7VA 5IQ7H 3SO5A 4BELD 4WFHD 1QFUH 2BRQA 25C8L 3DO3A 3QSKB 3U2SA 1FGVL 3QCVL 1I8KA 3TA3C 3EYFB 4ZUWB 3O41A 4YNYB 3G6JF 3K81A 5CJOL 4ZFOL 4NQSB 1KG0A 4PJFF 1ZA6A 3MRJB 5K9KA 4WUUD 2D7OA 2VXSL 3VGHA 2OTWB 4MQ7B 2EDQA 1U8PB 3C08H 2R1XA 5T1LB 1JHTB 1VCAA 2F19H 5MI0B 4HK0B 4XP1H 1DJSA 2BC4B 5BW7C 4OZIF 2VL4A 4LHUA 1G1CA 4U0QB 5D5MB 5D8JH 4YHLL 3WS3A 1FV1B 3VFWB 1SYSA 1GIGL 3GHBH 4OFIA 5C71A 1RK0A 2ZPKH 3FMGH 4JY4B 1HXMB 4JFEB 3RI5F 1U8OB 4LCCC 3SJVE 5I75C 3TO2B 3HI6L 4XX1G 3QXAB 1ROWA 1J8HB 1CDGA 5GGTL 2OQJA 4PJIB 4X80H 5ESVB 3TT1H 3DJ9A 4YAQB 1RAMA 4ZUWA 3EYFA 5E1AA 1RK1A 4XZUA 4OF5A 3VWJD 1CFQA 4DGYH 3QXUA 3O9WB 2UUDH 3H7BA 3OHXA 4Q2ZA 4UDTB 3VI3F 4PGEB 2XT1B 3QIUC 2EC9T 3TVMB 5DJCB 2AGJL 5CMAB 1MCKA 2GEEA 3I02A 4TQEH 4P2OA 4JAMB 3EYUH 2B2XL 4D3CL 3SQOL 3QDJE 4EUPG 4JFZH 1I4FB 1ZHBB 4POZD 4PRBA 2YD2A 1PW3A 4NO2A 3HAEB 3HAEA 3CXHK 1W2KT 2Y06H 1LEIA 4ZUSB 4RA0C 2MKWA 3GSQB 5L2JA 2YD9A 2X10A 3UTQB 5KOMC 2NY4B 2R0ZH 5L0QC 5DJCA 1U8LA 1MFCL 5E03A 4TPRL 4G7YH 5DEFB 3VRLF 5C08B 2YPVH 3O3BA 1UJTA 3DMMC 1QSFD 1Z9OA 4YDLC 4N9GB 4KJQD 5ESVA 3QWRA 2QR0A 4OM1L 2H2PC 3HNTH 2W65B 2VDLL 1QG3A 3MRKB 1JPST 1RZFH 2ZUXA 1JGUL 4ZS6C 5JNYB 3STBA 2RQ8A 5I66A 5C07A 4CAGA 5JW5B 4QWWD 2B1HL 1FFPB 3WJLA 4Y4HD 1HSBB 1NGZA 1KIPA 5C8JA 4WU7A 3RL2B 4LDEB 4PUBH 3MJ8A 1J9CT 2BHYA 4LHUB 3O4OB 2DYPD 3BMWA 3GMLB 3QCTL 5TE7H 5C0AE 1D9KD 4BFBD 4LPUA 2H45A 4NSKB 3Q1SL 4QRQB 1FG9C 3I6KA 2OJEA 4PRDA 1KBGH 3I3BA 1QACA 5IR1A 2H9GA 2G75A 4O4YH 4Z7UF 5IOPB 3GSWA 4KMLB 4I77H 3T2NH 3X13A 3WDJA 1JUFB 2HJLB 4DFIA 3V4PH 5I1LA 3PJSA 3ARXA 5EULV 3MBEA 4X7CC 1U91B 4W6WB 3MFFB 4ZPTA 5FM5M 3SDXB 3RHWK 2P48B 4XPGH 3ARGC 5CD5C 1NL0H 4OLEA 3U30C 1U6AH 4GAGL 4P49A 3NN8B 4H1LB 3B9EA 5FCUH 4PD4K 1TVHB 3O11B 2ZUWA 5FAAA 5HHOA 4G8FA 3QA3A 1OARH 5T5NG 3VGGA 5E8NB 4DZ8A 1HI6B 4IHOA 5IEKA 4HQQL 3TV3L 2XFXA 3PF2A 4PTTB 1P5UA 1KJMA 3CX5K 1F4XH 3B9AA 4UIKH 4LKCB 2C3HA 3WSQL 3QNZA 2OR9L 2AJVL 1LP9F 2AEPH 4WFED 4M93B 3ZYZA 3LEXA 3CMGA 4OLWH 1MJJB 4R2GC 4DVBA 2OSLA 1CLOL 4PRAA 4MLIA 1PAMA 3DXAD 2MMXA 4OKVA 5I17B 2NY6C 1I7RB 3ME0A 2IJ0C 1WBZA 5L88L 1BZ9A 2B7DT 1X5AA 1J1OL 2J5LB 4XMLH 1VDGA 4ZQKB 2FECL 4OZGA 1EFQA 2X4PA 5C0CA 2Q76A 3NCMA 3HE7A 3B43A 1QNZH 3PXHA 5KSUA 1SJVA 4UBDC 5D5MF 2OP4H 1YQVL 3B2VH 3STLA 4K2UH 4X6CB 4B5EA 2W9DH 5I8CA 1QRNA 3QUXD 4IMKC 1KJ2L 2YR3A 1P6AB 4U2YA 2J1KA 3DVGA 4OCWL 4WHYH 1NEUA 2ENSA 3OR6B 1MFBL 4PR5B 3WIIL 2W59A 4OJFH 4EVNB 1CLYL 3O3AB 4PJHE 4WVRA 1RU9L 4FMKA 4QHLB 5DK2A 1Q0YL 5T3XL 1MHPL 2R2EB 3IB4A 3INUL 2CIKB 2DL2A 1BJ8A 4L8DB 4Y1AA 4AQ1B 2P8MB 1YEKL 4DZ8B 3MZGB 1FN4A 3DLQR 4G8GE 2WK2A 1ZHNB 5CEZL 2VQUA 2JIXA 3HAEG 1UJ3A 4M7LL 3CXDL 1RSFA 5GGTH 4WWKD 5BRZE 1C5BL 1VACB 4RIRB 4R7DA 5E08H 4TUJB 2YUVA 3CFJB 1QLEL 4P9HL 1QR1B 4WTXA 4BSWB 5KOVC 2VZOA 1S7WA 4KMQA 4MGXA 3V6ZB 2ICES 2EH8L 4DN3L 4NNXB 5LQBL 1FNAA 1IARB 3T77B 4K3DL 1AFVL 2X4SA 1U8KB 5SWZD 4WTZG 4NHCH 5KG9B 3D25A 2L7JA 1T0NB 2JJWA 4ZFOB 4NZDA 4R26H 4Q6IB 4PJ8A 2E9WA 1NMBL 3EOAA 1Q9WB 2VDQH 5CJOH 5HSFA 2P1YA 2HT4D 3BPCB 4X6CA 3KVQA 4HG4J 4JO2L 2CLRA 2W0KA 5BZWA 1T03H 1OW0A 1C5DA 1C7SA 2IAND 3Q5OA 5JOPD 4MXQC 3CK0L 4ZSOA 2F53E 5EO1B 4PP2A 5HYJE 4XPFL 5IFJB 1T1WB 3V5KA 4GKZB 3S34H 2C1PB 3U9PL 3HPJB 1RVFH 3NIDE 4H88L 2FO4B 2FHCA 1G7JB 4Z8FL 1VEMA 4JRXB 3DHMA 4WIQA 2M8XA 3I6LD 4NRZA 3O2VH 4G3YH 3EFFA 3TT1L 1QSFA 4YQXH 1TZIB 1J05A 1PDKA 3I9GH 4KZDL 3HLAB 4X6FB 3VE0B 5JORA 4YHKL 5F9WC 2AAVA 1CTOA 3KPOA 2BSSA 1HHHB 1Z5LB 3ZDYE 1WWBX 4HHAB 5SX4H 4G8FB 3MYJB 5L6YH 3GGWB 1AHWB 4J3TA 2BRRL 5DT1H 4DVRL 3UTPE 1FNEA 1IVLA 4GAFB 3IDXH 3V4UH 3TNNA 5IQ9B 5GGVY 3RWGB 5I16A 1BHGA 2VXTH 2WWKO 1BGXH 3D0LB 2RBLA 4BQ6A 3BKCL 1PG7W 3LN5A 3TNMA 1OLZA 4EUPB 2H9GB 2H8PB 5IOPA 3C8DA 4RFNC 3QYCA 4TVPE 1KT2B 5BRZB 3REWB 4JG0L 1IQWH 4JM4L 1IC5L 3PNWA 4HKXA 4Z0XB 1KN4H 3GJFK 3O4LB 4MJ6A 3TIEB 3O9WD 1EEYA 2ICWA 4GSDL 5KSBE 2Z91B 5F9JA 1WWCA 5DYOA 3MROA 4LCCA 4XH2A 1XGRB 4JJHA 4GRWB 4JPVL 4RAVB 4XX1E 1MJUH 5I1DA 1FO0L 3DO7A 1QFWM 2UVEA 3HZVB 5I71C 2J3SA 1WZLA 5DQJA 5FDYA 4WI3A 1XGRA 1UZ8B 2CDGA 4MAUL 2KL6A 5CJQH 1N7ML 3JTTB 3NCJL 3QI9A 2OM5A 1HK6A 5CSZA 4TSAH 5KVGL 2F54E 4NKOB 3RVVD 4Z7WF 1EVTC 4G7VL 4HFWA 3UC0L 5F97E 1IZJA 1UADC 3HRPA 4W4OA 5HDBE 1DQJA 2H8PA 4EUPA 4KHTL 4PGBB 4U1SA 5D7IB 1JYNA 1HEZA 4OZHF 4E0RA 4LQFL 5C08A 5I16B 3GI8L 4R96A 1JNNL 1CE1L 3RY6C 1JTPA 2IAMA 1N2RB 4TUKH 3G5YB 3H6JA 2G5BB 1RUMH 4RMQA 1FL6A 4F15C 5ILTL 2R9HD 4DUWA 3CC5B 4X7TB 1EO8H 4WEMB 3DV6A 4OIIL 2PTUA 1F3JB 3KNBA 1K4CB 3AUVA 4XPHH 4FZ8L 1M7IA 4LCUB 5D2LE 2VLRE 1BBJA 2V7NA 5T3XH 4N8CL 1XIWA 1NJ9A 5TF1L 3QP3A 3J8F7 5B21A 3IDIA 4ZTPH 5J0BA 1FZKB 4MSWB 2BY0A 3VXMB 2JE8A 2EXWC 3BQUC 2PKDA 1RQ5A 4ELKB 1X3DA 5DD6B 4JQIH 4NKMB 1IZKA 2AJXH 4GH7B 2R4RL 5FO7B 1P7QB 1N5AB 2H26B 1IGJB 3QDJA 2LAAA 2NX5A 1DCLA 1UB6B 1FE8H 4NCDA 3K4DA 1T89A 1CT8A 1ACYH 2EO9A 2HFEA 3BE1L 3ARDA 1NGPL 3BOVA 3RZWA 4KK8D 3MLWH 3IAQA 4Y2DC 4ZDHA 1Q9WA 3QISA 3BGMB 1G7PA 4UQ2A 1OB1A 4YHMH 1UA6H 1EMTL 3AREC 1I9JL 1VFAB 4ZFOA 1J11A 2VISA 1TVBA 1N64L 4CNIB 4N8VB 3ZKSD 3MNVB 4YHYC 5BO1L 4PJ9D 1QUNA 1KELL 3IF1B 1V05A 5HYSB 3MRJA 5K9KB 5MP6H 1GHFH 3SJVA 1QHOA 1QRKA 3EO0A 3IKKA 2R0LH 3MRLB 5SWZB 3TN0C 1MRFL 4F7TB 2B5IB 2J8UF 2KZWA 4YEEA 2DLIA 1I85C 2AJ3B 2QSQA 3IFNH 3JZ7A 1YZZA 3MLYL 3HPLB 1QSEA 3FOLB 4LHQB 4NN6C 4QWWC 3U9PH 3C9NA 3C6LC 5BVJA 3MUGA 4OUOA 2V2WA 4OF3A 5HGHA 3HC4L 2ZG1A 2AI0H 5KSVB 5I1AB 4G9FB 1JFQL 1P4IH 3PDOA 3O2VL 4OCSH 1OAQH 5BMFL 2YMXL 4PBXA 4TSBH 1BFOB 4P4KA 1A7NL 1A47A 4QHKJ 3U36A 1M4KA 1U92B 5E08L 1NMAH 4L4VE 1WEJL 3K2UL 4NPYA 4PJEE 4YPGA 5DUPL 3VFVB 4KKAD 3RWEB 3F58L 3QAZC 5EOTA 4MJ4A 3MJ9H 4XVUC 2DB8A 4RWHA 3EYVB 1CFSB 3E1F1 3GHEL 3FN9A 3OTTA 4L9DA 4G8GB 4RZCA 3MRFA 3QWQB 3KPRE 3GEWB 3PL6D 3PGDB 4YHIB 1J18A 2HA1A 1LWRA 1HNFA 3T1FB 1X9QA 3V8CA 4YZFF 5H94B 4POZC 3ULSA 3BT2L 4U1IA 1SEBB 1U8IB 1I9RH 4FQJH 2WBKA 5E2VL 2EO1A 1TJHH 4KRPD 3ARED 4AZ8A 2EE2A 1MCSA 3ZKMD 1CD9B 5J12B 5E2WL 5F88A 1KC5H 4CMMB 3MGOB 1HE7A 3DV4A 5K59E 2DKSA 2A6IA 5DTFA 3DBXA 5JOFA 4MA8H 1JZ7A 1VGKA 4JRXD 3WDIA 1XF4A 4OTXL 3SEPA 2DJSA 2QADD 4NNXA 3NA9H 4ZUTA 2PYFB 1XF3A 3MLZH 3LDBB 5C7XL 2Q7YB 4KXZI 4UQ3A 3U4EA 4HH8A 4U1KB 1GZQA 2OTUB 1JNJA 5HTSA 4HCRH 4OZGE 3QO1B 4O02H 3GDBA 4L1HA 1RU9H 4UOW1 2MQ0A 2G75B 1T6WA 1G7HB 1I8MB 3DTXB 4YHNB 3U4BL 4Y1AB 4L8DA 2HRLA 5H35A 3V5HB 1FIGH 2AK4B 1OP3K 1KXTB 5FK9B 4FTVB 2B4CH 2VN7A 4MX7B 1A5FL 4QHLA 4ZO9A 3M45A 2V7HA 5JXED 3WHE0 4UTBL 1Y6NR 4CMMA 4P5TC 4L1DA 1MFAH 4RFOL 4LSQL 3T8XA 1TQBC 3V5HA 1Q72H 3O6MH 1MCLA 4JM4H 2O5ZL 1N59A 5FUZL 1HHJA 5K9OB 3DMMB 3VXOA 4S1SL 2NW2A 1A2YB 2MTPA 3IFOA 3C2SA 5D1XA 3NAAH 1FBIL 3BP7B 3GJFH 2YZ1A 3NMEA 4ORZC 2RR3A 3D6GA 4PS4H 2NY4C 1T20A 2Y6SC 2WUCL 1Z2KA 2EKSB 3TZVB 2L0DA 4Y7MA 3IDNA 3PGDA 1T22A 4Y19D 5GJTH 1XF3B 4P2QD 4L4TA 5EOCH 4L9LB 1JPTH 1AY1L 3RAJL 4R9HA 4EXPX 3LEXB 3BIKA 2VOTA 4N8VG 3C5ZD 1I7UB 1KFAH 2AJZB 1A6WL 4X8JB 3IDJA 1UWEL 1AGBB 4LKCA 5GRVL 5FV1L 1NFDB 2XPGA 4AEHH 1P4LA 2A6IB 3FFDB 4P9ML 5CUSL 5DTFB 4EDWH 4JZNB 5IJKC 4P0DA 1I3GL 2AEQH 1YPZF 1CDJA 4XC3L 4TULL 5IBTL 5FYJU 1C12A 1AGDA 2PTTA 3BEWA 5DVNA 3MV9B 4YHOL 4WWID 4FXKB 2GJ6D 4PY8I 5CGMA 5HGDB 3QIWA 5B38B 4YHYB 4NBXB 1U8NA 3AS3A 3UYOD 2GTWB 5C0CE 2HJLA 4WUUB 4RQQA 4OGXL 2HKHH 2VXVL 4M8QA 4OV5B 2PO6A 3I6KB 4L4VD 5EDXA 1FVCB 2QHLA 4BSVA 1OD9A 1AJ7H 1D6EA 3BWUC 5BS0B 1KLGA 5CP7B 1JFQH 2F53D 4IOIB 5EC2B 3QEQA 1AO7A 2NMSA 2YBRB 5HYQA 3H9SE 2YD5A 2VL5A 4A6YB 1NGWA 5DVKA 3MRIA 4PJFB 4OGAC 5SWSE 2RCSH 4Y1AE 1BFOA 5I1KL 1GH7A 4QHNA 4GRMA 4NNPH 1ZE3C 1T1YA 2DQDL 1J8HE 1JHTA 3GSRB 4X80L 4Q6YA 3T0EA 1OAXH 4YWGH 2ADGB 3QUKA 5EO0A 2DLFL 3RQ3A 4D2NA 4M4PA 4Y4FA 5J12C 3VXME 3MX0A 3RHWF 2W07A 5M94B 1FLRL 3RWHB 1I9RL 2A9NH 1SM3H 4FQJL 3LPFA 2I25N 5I6XB 5E2VH 1NGXB 4ORGB 4G43A 4Z76B 1NDGB 3F62A 5D7LE 3U83A 2KDGA 5IUSA 2EIDA 1LEIB 4P2QB 3KXFB 1NUFA 4BZ1H 5GSRA 4PV9B 3QB7C 5EB9A 4AENA 5E24E 2IALA 3D3VA 2H6PB 4NHUB 5HYSG 5ICZB 1JV5A 2V5TA 1S5IL 3BPNC 5IB1B 5D1ZA 2EIZA 3IKCB 3S98A 2VC2H 1GVIA 3BGFC 4P5MA 2MJWA 4U1SB 1WEJH 3TP4A 5E1AB 1RZFL 2Z8WC 3ARDC 2HH0H 5GGUA 1I1RA 3CMOL 3K1KC 3KYNB 4HIIB 4LSPH 4U1GC 4RGNE 4C83B 4ZAKA 2BNQB 3F6LA 4NN6B 4Y4HB 1I1YA 2I27N 2QADB 2GI7A 1DN0A 1DBBL 5IB1A 4I3SL 3U4BH 4J1UA 2VLJB 2W9EH 3IJHB 3QULA 4CUCA 4L4VB 3TPUB 3F6IA 3MREB 4LCUA 4PV9A 1KJVB 1RJLB 4JVWA 1FVEB 1ZVYA 5ID0A 3GMQA 3SDYL 4Y2OA 5HHOE 1B0RB 5GQBA 1J10A 1F58H 3QUZC 3AREB 2P45B 4QOKE 1U8PA 3NCFB 1NCCL 4XPBL 4O9HL 4S1SH 5HPOA 3FB5B 2R4RH 2HT3C 1KG0B 5ALCH 4RMVA 3ULVC 2AK4D 1BIIB 2FB4H 2WLZA 4N1HB 1EAJA 3EDJA 2I24N 1J8HD 4PJ5B 1PSKH 3H7LA 4C4KO 4RMWA 3R8QA 4JY5L 2MHAB 3MLWL 4Y88A 1ED3B 2W0FA 2D0HA 5BQ7B 3GMNB 4L8BB 4UT6H 1ZHKA 3BP5B 3RVXD 1BVLA 4KRMB 2B8OT 4JM2A 4S0SD 3HI5L 4UOJA 2VZUA 2PETA 1VSCA 1GJIA 3ZKQD 3JV5A 4LIQE 2C5DC 2P5ED 3SE9L 5T3ZD 2BSSB 5F44A 5I1EH 4ZS6D 2DRUA 2X41A 1T21B 2GTZB 4O2CA 4U6HA 5JIHA 3MOBH 1UM5L 1YYMH 5IMLB 4GMTH 5DGQA 4P2RE 2V5SA 3PGCB 1NGQL 1QRNE 1MIEL 1ORQA 2DWDA 5DO2C 5EH1A 2AXJA 3MGAA 5FXCH 3QUYB 4ZAKB 3TFKC 5D71H 4DAGL 2PYEE 3WE6B 2BZDA 1Y6KR 1EGJL 7FABL 5TPWH 2UZYB 3RJDA 2ICWJ 3PIQB 3OJDA 5GS2H 3MV8A 3DRQB 2NY5C 1XGUA 1K2DB 5LCVL 1A7BA 2FJFB 5FGBA 4WFEE 3QH3B 1OLLA 5EU6E 1CDUA 1CFTA 3QXVA 4LCWB 2YD6A 5IK3B 3H9SA 4LVOB 5CZVL 1I1AA 3PWJB 2WNGA 2DJ4A 1CE6A 1GOFA 2IG2H 5IGXH 4XP5H 3ZE2E 1K4DB 3SQOH 1WWWX 2BNQE 5JORB 4OZHA 3OAUL 4PJGF 5TFSL 1JGDA 4A2MA 2P4AB 4PJ8B 5I0DA 1G0YR 2J2ZA 3NABH 5IBUB 1QBLL 1XH3B 2X70A 4JDVA 4LHUD 4TSCL 2EDXA 3FT4A 1C8PA 4OZIA 5I71B 1U93A 4ZMAT 3FCTA 3MUY1 1UEMA 1OGTA 4KZEH 3EOTL 4XMPL 1OAXL 1P1ZA 4G6KL 1AI1L 4PRIB 4P23D 1UWEH 1Z9MA 3LN9A 1KPRA 1KC5L 4ZO8A 1R3LB 4JE4B 4P2RD 2R1WA 1BD2E 1BD2D 1WBYA 4FQIH 4NN7C 3VH8B 1CGXA 5LQBH 4XPTL 1T83C 4XGZB 2GCYA 4K7PX 1FFOA 3CAFA 1YEJH 5EO9B 1VFBA 4PB0H 1R3HB 4H1LH 1IAII 3BPCA 4N0CD 4I4WB 4KJQC 3BD5A 3QIUA 3X14A 1RIUH 5EOQH 1NFDE 3GJEA 4Q7DA 2DM7A 2ZCLL 1MEXL 1T03L 5INCA 4HEPG 5CP7A 4CN1A 4FG6C 2JJUA 5F9WB 3A67L 1G9EA 5F3BB 2Y7QB 3EYSH 4GRWH 4HS8H 2LABA 2IQ9L 1OM3H 2AV1A 2RAMA 1YEIH 4PGZA 2VQTA 4ZQKA 1WBYB 5BZDA 1FLTX 1TZHA 5L8JB 1A6AB 4TUJA 1DLFH 5D70H 1IC4L 4JRXE 2KUTA 3FTGB 1TPXC 4JFFA 4Y5YA 1AGDB 2PTTB 1GCFA 1S7VB 4GG6B 1F6AB 5HXMA 3HR5B 2A73A 5IW3A 4IRZL 1F3DH 2APVA 2FATL 1GYAA 1VGKB 5DK2B 2C4FU 4NNYA 4YDIH 4LEXH 1X6NA 3BEVB 3PABA 2IANA 2GAZB 3QIWC 3L5WA 5D93B 1FHGA 2XQBL 3OX8A 4XNQB 2ITCB 5ACMA 4CDGC 4OCRL 1AXSA 4YX2H 1A3LL 3DVNA 1ZKAA 3MLXL 4WO4C 4PLJC 3FFCE 1V7ML 4P3WA 4GJTB 1E6OH 1BPVA 1CE6B 1A1OA 3ZDXE 3KPPA 4I2XE 2ZUQB 3TH2T 4Q9QL 2Y5TB 4XBEH 1EEZA 5I1GH 4LCWA 3MFFA 1GGCH 4ZPTB 1J8KA 1BZ9B 2R8SH 4MB3A 2DLHA 4YJZL 5ESQB 1MRCL 1NFKA 4HKZA 1U3HD 2VDKL 4XMKH 4JFQB 4MNHB 3PWNA 1KB5H 3L1OH 5BVPH 5CBAB 5F3BA 5MEPB 4F7EA 4CN4A 3DSNA 4B7IA 1T6VN 4GRWE 1I3RB 4P4RB 4K8RC 5JDJA 3OKDB 3MV8D 3MRPA 4LIQL 3SO3B 3TN0D 4HS6A 2R69H 1H3PH 1I75A 3T3PF 4J6RH 1T04B 5AZ2H 3LIZH 3WIIH 3IT8D 5FEBA 1CGWA 4B41A 1NSNL 3EFDL 1FFRA 3DETC 3INUH 5FO8B 1PY9A 3MBED 2YUZA 5D7KE 1DBBH 5D71L 1WZMA 1WK0A 5JR1H 3OG6B 2B4CC 3QDMA 2GUOA 2Y72A 4PPTA 2OZ4A 3AMLA 2AV7A 2AW2A 3C60C 1QFWH 4YXLH 3LOWA 3CFBA 3O3EB 3JV4B 1K9TA 4JKLA 4V2CB 5C0GA 3VGEA 3VXRA 1IBGH 5EIIA 4UQ3B 3ULUH 3GIZH 4PJ7B 4JANB 3TZVC 1QLEH 4PRHB 3RWDB 1BQUA 2XZQL 3PE9A 4LPCA 3CZJA 1OGAB 4XVSH 4N5ED 4WFGD 4OCNC 1OY3B 3NFNA 5HI3D 1D9KA 3UJJH 2XWJB 3N85H 3FONA 4XP9H 2V6HA 2E9IA 3P0VL 4M7KH 3MC0A 4QGYA 2ZJSH 3S4SG 1V3MA 5I18L 4UT7H 3R1GL 2R56H 1EZVX 3ARSA 1S78D 3HMXH 3MRNB 4DGIH 1DN0B 4Z7UE 5CMAA 4PTUA 1CDYA 5KSAA 5I75B 1URLA 3PGFH 4WI4A 3VFTB 3GSXA 1T1ZB 4BH8A 3ULSB 2AJSL 1JWUB 4V1DA 1RULL 1YJDC 2RIKA 4GMTL 5KS9F 2NR6C 4OCXH 3QUYA 1T1ZA 1INEL 3GBLA 4XVJL 1G7LB 1Q8MA 4MQSB 3ZT5A 1QYGH 4X9FA 3NCEB 1VKXB 3WDHA 4KUCD 1SYSB 2HT4C 5JA8B 4AK1A 2WINB 5BJTA 1IE5A 1RIUL 1A6UL 5IMOA 1SMOA 1U92A 5D7JA 3S96A 2B0SH 2W60A 1RFDH 4PRBB 4OZ4B 4P2RB 4OLZL 1ZVSA 4JO4H 2XI9A 4GW4B 4R7NB 3T4AB 4IJ3C 3CPLA 2F74B 3SDDC 1MRFH 1ZLWK 1WTLA 1KLFA 2X7LB 4P57A 1RUKL 4U05A 1BQHA 1XCTA 5C0BE 1J1PL 2X4NA 2MHAA 4BZ2L 4YDVB 1CLZH 5HHQA 5IB2B 3RGVB 1FGNL 5D1XD 4PBWD 3N0PB 3Q2CA 1G9MH 3CFBB 5C09E 2XWBA 2QSTA 2X4NB 4O2FA 3SDAD 5KVEH 3D85A 3MCLH 3QDMB 1CU4H 4YDKL 2FL5A 2XZCH 3KDMB 5IVXE 3SCMA 5EZLA 1PFCA 3ZE2F 1LO0L 1NCCH 1UXSA 3ARYA 2DYPB 4PJ7E 3HZYB 3WS3B 3GMQB 2E7LC 4QRPE 5DRWB 3JSSA 3O8XC 3OPZH 4FQHA 4PJ9A 4CMHC 1FDLH 2I07A 3RUGB 2BC4A 4JPVH 5L0QB 5CKAA 2VYRE 1W0VA 3EYUL 4KJWD 1UB6A 4XPTH 4QTHB 1OWRM 3GBMH 3L3HA 3WNMA 1EDQA 4NKMA 4MNQE 4HX1B 1E6OL 1OPGL 1LEGA 4JZJC 3ARFA 3H2WA 1EEQA 5IEHB 4UZGA 3QDJD 5E9DD 3C2AL 5JW3L 4CU6A 3O6FA 4WV1C 5IP4A 4GW5A 4ISVB 4KUZL 3U0TB 5DRZA 4P5MB 8FABB 1KENL 3C6LB 1A1MA 2PN5A 1U8QA 5DQ9B 1EEZB 4KRPB 4XCFL 4X6DB 3K2MC 5FYKL 2DQUH 3V9FA 5JPMB 2LU3A 5A2FA 4AENB 3BEWB 2Q3AA 5DHVB 4BQ9A 1HHHA 2ZOKA 2BNUB 2G2RA 2E7CA 4NJ9H 1IMHC 3ROOA 5CJXA 2HN7A 4LP4A 3T65B 1ZWIB 1F6LL 2V17L 3CCHA 4J6RL 5AZ2L 5INDB 1NFIA 1JIBA 4NN7B 5H8DA 1T66C 2DDQH 2B1HH 4F9LA 3QUXC 4ODHL 4KK9D 5FA3A 6FABL 2HFTA 2D7MA 3BI9X 2EE6A 5TF1H 1TJGL 4JANA 4XXDA 5EUKA 4FNLL 2BNRE 4R8WL 5CEYB 5E70A 2IG2L 4BKLA 4PLKC 4Z77A 1T4KB 3UAJD 4JFPB 1T20B 4YXKL 5ACZA 3UXFA 3UZEA 1E0OB 2SEBB 5L2KB 4XPAL 3KYMA 5DSCA 1PKOA 4R90L 3RNQA 3VMOA 2HLAB 5DJ6A 2Z4QB 4LSUL 3KPNA 1I1FA 2Z31B 1DEEA 1RZJL 4RMRA 2E7HA 4S1RH 1M7DA 5IG7B 3EAKA 4IRJB 1ZT4A 4UAOB 4KY1L 1FSKB 2EE3A 3RP1A 4A6YL 4L4JA 4GG8A 3KLAB 4KROD 5T33L 3ZDYF 2PW1A 2AABL 4YHML 1VADA 1J7VR 4JHAL 1JF6A 1FBIH 5GJSL 2Q7NA 3I85A 1AXIB 3PGFL 4FQLH 4M5ZL 4ALAL 1LO5B 1XIWC 4Z18A 3P4LA 3MUHL 2DI8A 2HTKD 4PYGA 1HQ4A 5HVGB 4NKQB 4MS8D 3OG4B 2NTFB 2BSTB 1A6VH 3H3PL 4PRIA 1F4WL 1YNLH 1FSKC 4FQ2L 4NWTH 2BVPB 2YWYA 1RMFL 4MDIB 1NAML 3RFZC 1J1OH 4CDHA 4K7PH 1ZLSL 2J6EL 4TOYH 4E5XB 4X98B 4M61B 4WHTB 5D8JL 1A7NH 5E6IB 5JDSA 4MJ5A 2BVQB 4D0DB 5DLML 3VW3H 1A21A 4ODSH 4YXHL 3U7WL 4C58B 1EPFA 1AO7E 3QNXA 3FZUC 2DQJH 2FO4A 5FYJE 2FSEB 5CD3A 4OLUL 5DMKB 1KLUB 3HI6H 2F8VA 3O2DA 3S37H 4PY7B 3PWJA 3OKEA 3V5KB 2GITB 4O5LL 2BSTA 2IAMC 2HMIC 3V4VL 1L6XA 1Z9SA 3MRRA 5HYJB 3NGBC 4U6VH 3M17A 2HJKA 3MO1A 3OKMA 3IJSB 4K23H 4KKAC 1K3IA 3RZCB 3ILPB 2BHZA 2IFGA 2MSPA 3V0VB 2YPKB 1YJDH 2YK1L 4C56E 3KG5A 4L8SA 2NCMA 1W72L 4GBXA 5GS0H 4JVUA 1JZ4A 3RL1A 4OM0H 1FPTH 5CGTA 5L9DL 1A22B 2GK0B 4FTVD 1JZ6A 2X4SB 4JJ5B 1BZQK 3WLWC 5AD0B 2XFXB 4Z95H 5LAXA 2WWMC 4MA1B 1IGIH 4X6EB 5E8OB 4GBXD 1TVHA 1ETZA 4OTXH 4K7FB 4Z78B 4XGZA 3JWNC 1YEGL 4GBXC 4HWEL 2AXHA 4RSVA 5CINL 3IXTB 4LARL 1GZQB 4EOWH 1VACA 5JHDE 5I15H 3LKPA 3RBSA 1P1ZB 5MEQA 3LS5H 4O00A 3L9RA 3GMPB 4OLWL 3MRLA 3VXQB 4JO4L 5EC1B 1E28A 1KF9B 4XPFH 3FZUD 4CKVX 2HG5A 2X4RA 2MQCA 5E4IA 3BPOC 4U6XA 5LGKA 1HXYB 3SKMB 2D4FA 4EI6A 1MCQA 1S5IH 5MENE 2DKMA 3C6LD 2Q6WA 5KVEL 1QNZL 1KN2H 3TYFB 4S11A 4EN3C 2QJDA 1CL7H 1F3DJ 3UCRA 1PKQB 5D6DC 4I0PC 1A8JH 3RNQB 2MCG1 3I9GL 3GRWA 3VG9B 4HIXH 4P5TD 3E3QC 4I2XA 2CIIA 4IRJC 2FX9H 2VDPH 4BK5A 4FTVE 5ETUA 5EPMA 1JE6A 1IGFH 4N9GA 4OCLC 5CEYA 3W82A 4HW6A 4PBVC 4MCZA 1JVKA 1FJ1A 1QLRB 2Z9TA 2LU7A 2ZJSL 3IKCA 1LQSR 2VLJE 1S9XB 2LV4A 4U3HA 3WLWD 3BDBA 5KAQF 4IRSD 1C16A 4HSQA 4BFIA 2Q8AH 4FQHB 4MXVF 5C0NC 4CW1B 2QSVA 4A6YH 1T7VA 1P9MA 3KXFA 5DRXB 3FOMB 1UXSB 1A9EA 5JPNB 4R0LB 5F7EH 1D5BB 1GC1C 4M48L 4LLMA 3DNKA 2FX7H 5D2LF 1DBAL 1FQ9C 1WSST 3BH8B 1U91A 1MCEA 2KKQA 5DJDB 3OKLB 2G9HA 1MH5B 5CS7A 1QEWA 1JWSA 5DRZB 4XXCA 3J7HA 3MLSH 3PP4L 4ELMB 1KIQA 3FQNA 4ZFZB 2OJZH 2EDFA 3VXRE 4Y4FB 1Y6MR 3ARBA 5ANMB 4NQCE 4MMXC 1TCRA 4FQ2H 1QLFA 4ODHH 5KVDL 4XVTL 1X5LA 1B3JA 4QRTA 4R4ND 1RK0B 1U36A 1NBYA 1AJ7L 2Q87A 2E7MA 1OB1B 4QHNB 1G7PB 2IH3B 2D9QB 4KH2A 5GIRA 2W60B 4LDOB 4Y16D 3MLRL 1UG9A 5EBWA 2GIYA 1KEMH 3MREA 2ZCKL 1II4E 5JLZB 3WFCH 4RAVA 2Z8SA 1CDCA 4OZFB 1EGJH 1IQDB 4DKEL 1DVFA 5B8CC 2NXYD 5D1QC 3IDYB 5CEZH 5TDNA 3D85B 4DCQA 1ZLUH 5FGCE 2CO6B 5C9JA 1JZ2A 4ZFZA 4R0LC 1BQHG 1FZKA 4L8CB 4N8CH 5C09A 4KZDH 3KWWA 3U2SB 4DKAA 3HNVH 3VG0H 4P2CG 2W0LA 3Q0HA 5SWSB 3WCYA 4MD0B 4P5TB 4Y5VA 2WIIA 5EUOF 1TJIL 3CGTA 1INQB 4DWHA 4ZD3H 5J6HA 5I74C 3TCXA 4RBPH 2P24A 4FP8H 4R0LA 4LSDA 1EO5A 3WKNA 4WY7L 3CUPB 2ESVE 4QRPA 2D4DA 3RU8L 4EBQL 3CNKA 1EV2E 2XWJA 5DI8A 2VLJD 1NLBL 4KUZH 3HAEH 5DUMH 2ADFL 3GK8H 4QRPD 3PL6B 1CN4A 4XCFH 4F9PA 1MPAL 1S9WA 2ZUQC 1NLDL 4Z7WE 1F90H 4HWEH 1AGEB 2X4OB 3KWWB 3CU1A 4Y5YC 1H15A 1BD2B 4WFFD 1WLHA 4LARH 3Q48A 4WI2A 5DR5L 5FGRA 2WBJC 3UTSD 1MHCA 4UV7L 4PRPE 5A2KH 1Q1JH 3V6FB 5EZIH 1W8NA 2BY3A 2W91A 5JOEA 1DLHB 3S88L 4RX4A 2EYTA 1Y18A 2XYCA 1NCNA 4NN5B 4JN1L 4RDQG 5ADOH 4Z7NF 3CH1B 1AGFA 2YN3A 3TYGL 3I6GA 1JBJA 5JW4N 2ATPB 4Y8DC 4QRTB 1YPZE 3MFGB 3IFPA 3O4LA 4MJ6B 4MQ7A 1U8KA 3TIEA 4EI5C 2R0WL 2OK0L 3V95A 1QA9A 5E8EB 1TQCB 5ERWA 3RWDA 1HCVA 1I8MA 1RUPH 4YNYA 4JZOB 4RISH 1XR8A 3K2UH 3MRBB 1BFSA 2G60H 3NA4A 1DLFL 5D70L 1FZOA 3LKPB 4WUUA 5EIIB 4WGWB 3SDXF 2IH1A 1KGCE 5KW9H 2CDFA 5A3IC 3IXTA 2VUOA 1OAKH 4PYHA 3W5MA 1AD9B 3KYKH 4OI8A 3UZQA 4Z78A 4KPHL 3JV0A 3JTSB 9CGTA 5FO8A 2FATH 2KPNA 1FN4B 3QEUA 4FQCH 2ZSWB 4C56D 4HZLB 1QQDA 4NC0B 4NGHL 3RZCC 1H3UA 1I85A 5F70A 4ZFGL 3RZCD 1F5WA 3SE9H 4ZYKA 4YX2L 2O26U 5A2LH 1QSFB 5DVOA 1HYSC 3WNKA 1YDPB 3LS5L 5GPRA 4U7MA 1KB9K 3IVKA 1QFHA 1LK2A 1SJEB 4YO0B 4Q9QH 3RZCA 5HHVH 2B5IC 1MCWW 3PWNB 5HJ3A 5CBAA 3ILQD 4QXUL 3OGOE 4M3JA 43C9A 1PZ5A 3T2QA 3UC0H 1NAMB 25C8H 5FECB 1XGQB 3D39D 1HH9B 3MLSL 4LAQH 1TETH 4Z7WB 3W9EA 2LVEA 3TESA 2DWEA 3NVQA 4F7MB 1U3ZA 4LFHG 4NO0B 4NRYA 2OSLB 3WD5L 1RUML 5F96L 2F19L 1FYTE 3VI3E 2FZ3A 4N9OB 1CFSA 5EWIL 3MNWA 3VG9C 3VFRA 1CXLA 2X4RB 2V7HB 1ZLUK 4P2OD 2O61B 1HHGB 5HHMB 2AK4A 3MV9D 5JXEC 4P4KB 4W4NA 5DD1L 1LNUB 1QD0A 4LCWE 2ZSWA 2UVFA 1OQOA 3QPQC 4LP5A 1KYOK 3ARGD 5ESAA 5EU7C 1L7TL 3LKNB 3ZZ1A 2ZUVA 4J12A 1OP3H 3BW9A 4FABH 3LKOA 4XTRC 1CL7I 1RHHB 1RHHA 4LSQH 4M8VA 5LJYH 4N1CA 5FKPA 1DE4A 2CJUL 4FFYH 1N6UA 2XZQH 5C0DA 3L3IB 4N68A 4JQIL 3MRBA 3LB6C 3X3GL 4GXUM 1IKFL 3TO4C 4XBPA 2OBGA 5DRNA 3SGEH 4LAJH 4OZIB 1P69B 4NZRL 1S78C 5IQ7L 3VDBA 2WUCH 4U31A 3LZFH 2WQ8A 4UIMB 2LVCA 1G84A 4LLUA 4LRIC 1QO3B 3OKNA 5C0IA 1UA6L 5C07D 5DMGC 5KS9A 1HIML 2CR3A 4KDWA 4X5WB 2EDTA 2ED7A 1NGZB 1HSBA 3QI9D 3ROLA 2CO7B 2DQCH 1KCRL 3MO1B 2NR6D 3C08L 3QXDA 3QQ9C 1LEKA 5JNYA 4NJAL 1M6OA 1ZEAL 5DSCB 3V5DB 2RFXB 3CLFL 3QUXB 3ECBB 3MSPA 3BKJL 4U3XA 3C8KB 4OAWA 1KACB 3RRQA 2PCPB 4RAHA 1J0HA 3C5JB 35C8H 4OD3L 5BV7C 1AGEA 2X4OA 5DZLA 5DEGA 5IHZB 4X8XA 4U6TA 3BXNB 2WBJD 4HD9A 4NQEA 1SJEA 1Q9OA 1VA9A 1T0MA 1HHIA 2VDMH 3DXAB 3P0GB 3T0WA 1FG2A 5IIEB 3SBWA 2G5RA 3UTQA 5EU3A 4TRPL 1ERNA 4WHTA 4JGJA 4G6FB 1RZ8B 1IKNC 3LKQB 1UXWA 5J13C 1KJMB 5D1QD 4HCRL 4JZJA 3D9AH 3CLEL 4G42A 4O02L 1BJMA 4MA3A 5JO5A 1T3FB 1SEQH 2N4IA 4RFNB 3CC5A 4X7TA 2P24B 2VZVA 3B5GA 3GHEH 3MRQB 3KPQB 4L29B 5FIEA 5JPMA 3EW3B 5HDQL 1F13A 5BQ7A 1OF2A 4HPYH 3H3KA 3LD8C 5FYJH 5HHPA 3OGCB 5FGCB 3HPLA 1G9ML 3MBEB 4HJJH 3RU8H 2Q1EA 4YBLC 2AJYL 2XIDA 2HVKB 2Y06L 3H9SD 4AEIH 1A7OL 2ICCA 4QF1B 4WW2B 2CRYA 4ESKA 3VXUE 3KYKL 1IM9A 4JFEE 4LLDB 4PJXA 3GK8L 5C0EB 4NN5C 3QXAA 3NZ8A 3F5WA 3RVWD 1XT5A 4NUJA 1LDPH 2JB6A 2GFBB 4OQTL 1UM4H 4PGDB 3AAZB 2PTVA 3GNML 5B8CA 2YRPA 2HJFA 5C0AD 1FV1A 3VFWA 5I73C 3PWUB 4NQDB 4QO1A 4E41B 4ZDHB 3QUMA 3EDEA 3S8WA 3UTSB 3DSFH 2CUHA 4ODUB 5JIKA 4OM1H 3WHXA 3HZYA 2BVOA 1DLHA 2YC1A 3P9MA 1S7QA 4HLJA 2Z4QA 1C5CL 1IGJA 3QDJB 2QEJA 2A6JA 2PF6A 3SJVD 4I18C 2OTWA 1AR1C 1R3KA 4QXUH 3TFKD 1TCRB 1IFHH 1WFTA 2BNQA 3SKOA 5GSVB 1UKSA 2J12B 3O3DA 3MLTB 4JFFD 3TA3D 4KMTH 1BOYA 3VWKC 1T4KA 3FQNB 4WU5B 1UWXK 3OKKA 4RRPA 1W0WB 2KH2B 1FYTD 3ZTNL 1Q0XL 5DJZB 5I1IH 3D0LA 3TLRA 5DGRA 3IDIB 4FG6D 4UI2A 2CUMA 2VO5A 4GAYB 3Q1SH 5C08E 3T4AA 3VI4F 1FZMA 2VDNL 5L2JB 1YMMA 1MJ7H 1R5VA 2NY0D 3QRGH 4OCWH 5HGBB 2HN7B 3T65A 1J5OL 2C3WA 1VEOA 3G6AA 3QFJE 2JCCB 2BCKB 3KR3H 2VABB 3AY4C 3DXAE 4JG1H 2X42A 1ACZA 4DGYL 1VFOA 4ZAKD 1VGEL 4GAGH 2D3VA 3BQUA 3UEZA 3TVMA 2BNRB 3UDWA 4GQ9H 2ATKA 4MD0A 4RWYH 4Z6AT 4UUJA 1NGXA 1XCQA 2VITA 4JFDA 4OT1H 2IQAA 3CXDH 3HMXL 4DGIL 2Y1VA 2D0FA 2WUBH 3V0WH 5DJZA 4IRSC 4OF8A 4FP8L 2IC2A 2J6EA 3MR9B 2XV6B 1HQRB 4P23C 4GW5B 4IMLA 4R90H 4DGVL 1DQJB 3BRGC 3QWRD 1YYLL 3U82B 2XN9B 1KCSL 4OCMC 1PEWA 4PP2B 4N1EA 1U3HC 2NQCA 5ALCL 1JPTL 5I19L 3UBXG 4K3DH 1CGSH 3SDCD 2DICA 2YWZA 4LLWB 3GMMA 2ED9A 2I07B 4CN6A 4KK6C 1KTLB 3WN5C 3LMJL 4JY5H 5CHNB 7CGTA 5I1DB 2ID5A 3EO1A 3HKFA 1BJ1H 4AL8H 2AEQL 2VDQL 2DM4A 5LBSH 1EUUA 1WFOA 2EZ0D 1U8MA 4M5YH 2FL5B 3GSOA 3HNTL 4FQLL 1RJZB 4N90E 1IGCL 2NY6B 3B9KA 1RJCA 4JKMA 1BJ1J 3DYMA 2DTMH 5IKCB 4PV8A 1F4YL 1JWMB 5B39A 2VIRB 1MIEH 3RWGA 2WBWB 4XNZC 4U33A 4FZEH 3WMSA 5SX4I 1FNEB 3EYQC 1ZSDA 3LEVH 3RDTB 5TE7L 3TN0A 5E8OA 1NAKH 4DOHE 1DDHB 4GOSA 4XCYA 4GKSA 1AXTL 2E8ZA 3DPBA 4XC1L 3FB8A 2R0WH 3ESUF 1G7QB 2OK0H 5B39G 5AD0A 3VXSD 3VE0A 5CILL 3KAAA 1K6QH 3ALPA 5F7HA 4O4YL 1CDBA 3G5ZA 4GLRI 4ZXBB 2ZZUT 1NBZB 4ERSL 3CMOH 1ITCA 1S7TA 4HS6B 4LSPL 3BN3B 1AO7B 2YBRA 5IIEA 1SJXA 4X5XB 5K9JL 4NQCB 5D2LA 3TJHD 1FFNA 4I0PB 3LH2L 4BZYA 2YXMA 1B0GB 4B50A 4DFHA 2IGFH 3OKMB 5L8KB 1LMKA 2C1PA 4HLZH 2PCPA 3HE7B 1S9KC 3TJEL 4KJWC 3I50H 3NPZB 2K7QA 4NM8L 2BOBA 3ECBA 4GFTB 1CICA 4QYOA 3UBXA 4OF6A 3GB7A 3KPPB 1S7UB 4WNQA 1LEKB 4Z9KB 2BERA 2VAJA 1IC5H 2NNAA 3U48A 1BF8A 3LHPH 5FV2A 3AU1B 1LK2B 1SVCP 5IW1A 2FYYB 5FA4A 3CLFH 1YC8A 2BX5A 1MFDH 2BY2A 1YY8B 2HG5B 2EE9A 1U2HA 3QEGH 4M61A 1YNTB 1T0NA 3UTPD 1ZLVH 4PB0L 1RIHL 2AS5M 1Z0NA 3V6OC 3WN5B 2UYLA 1T5XB 2YD4A 3FTGA 2OP4L 3B2VL 3ARDD 3O6KH 4IEFB 4K2UL 5MENA 4P3CH 1BMGA 1YECH 5T3ZH 3SGJC 2NY3C 4I9WD 3FQRA 4QXGH 3O6FD 4XNMA 4EI5D 2A83B 5IVXF 3WIFA 2AV1B 2JIXB 3V6OA 2DM3A 3TVMD 5JMRA 1XR8B 3AMKA 3KPLB 3RWFB 2WMPA 1MWAH 1YNTA 2MWCA 4HEME 5GZOD 1DBKL 1JP5A 2ZCHL 5IV2A 2C4XA 3JWOC 4TVPH 4DOHB 1HSAB 3QZWB 1B88A 3QIUB 3X14B 3RWIB 1EHAA 8CGTA 1PYWB 1PKQE 4JRWA 2YS4A 2EDYA 4KQ3L 1TLKA 4NWUL 4PIRF 3ZL4H 4X4XA 4HKBB 3L5XL 3STLB 4PG9B 1ZTXH 1ND0B 32C2B 5TF0A 5I8CB 5DHVH 3D48R 1QVOB 4G9FD 5IBLD 1S7UA 2DI7A 2GCYB 5A1AA 4LLYB 1IKFH 2FNBA 3IYLW 3HB3D 3Q6GL 3QO1A 1YMMD 4K3JL 3ZO0A 4XNUL 3X11B 2A0LD 4NZRH 5IHUL 4R4BA 4ALAH 3QEHB 4F9PC 5FOBA 2IPKA 3WFBL 4Z77B 4WCYH 2Q7YA 3STZB 1MI5E 2UYLB 1K8DB 5DVLA 4XCEB 1ZVHA 3QQ4A 5DFTA 5TE4L 4XBEL 5IB3A 1KJ2A 1DP0A 2VKWA 2LTQB 3PL6A 4D0DA 2A9ML 1IFHL 5CFHA 4XRCB 1NGYA 4K8RL 3CVHA 1S7TB 5MI0C 4ZS7H 4WI8A 4MB5A 5JOFB 1I9EA 3TIDB 1JGDB 1Q0XH 3AB0C 5TE6H 4LQFH 3U7AA 4NO2B 5C0AB 1I9JH 1F6AA 1JNNH 4JO1H 1AQDB 4G8IB 3BIBX 4AMKH 2HTLD 4LIQH 3RNKA 2NNAB 5J6HB 1P7KA 5MP6L 3G6JE 1N0XL 3DETD 1PGRB 1UVQA 3PP4H 4P46B 4IS6B 4F7PA 1MJ8L 2ADIB 4OIIH 4P2OC 3PJSB 3O9WA 4Y4FD 2X4TB 4FZ8H 4BK4A 4ISVA 3PIQA 4WW2C 5SX5H 3MLPA 4PJIA 3D9AL 3QRFM 1DQML 3ZKNC 5DD5H 1SEQL 3MBEC 4WWKC 2D0GA 4BH7B 3MOAL 4HS8L 1D5ZB 2J88L 1JPGB 4X0KB 4HPYL 3ULUL 3K8MA 3GHBL 2GTZA 4O2CB 3RL2A 5D5MA 2VLLA 4QRUA 4BUHA 5K9JH 1KCSH 5JW5A 3V6FA 3D3VD 5JXAH 3BZ4B 4XMPH 2VZSA 4DJMA 4LSTH 1BREA 3KXFE 2VWEC 4R6UA 3K8LA 5DURB 3VXSB 5EA0H 2KQNA 4PGJA 4IMLB 1ZT1B 3D18A 1JGLH 2H32B 2XQBH 3NOIA 3R8BB 1YNKH 2VLKD 4FQIL 4OIAA 4YR6B 3P4NA 4LSRL 3BX7C 3FT3A 1CCZA 1JN6A 3BKMH 4LLMB 3V52H 3ULUF 4MMZC 5IVZA 2R0LL 3A6OA 3GSQA 3UDWC 3D0VB 3BGMA 4UQ2B 3QG6B 3MRDA 5DHYB 2A74B 1F3JA 3LPGA 4U1JA 2MQ3A 4QRPB 4XWGL 5GISL 4N0YL 2FD6H 2QQKH 2WINA 4TPRH 1WWAX 5BVPL 4Y19E 4L4TD 1DR9A 3HZKA 3CFDA 5E9DB 2XWTB 5C2BH 3NA9L 2C3XA 1J0IA 2PO6D 5F7WC 2PNDA 1P4IL 3QDGB 3GIVA 1CL7L 4HWUA 3BN9D 3LV3A 3DRQA 4P3CL 4HMEA 1CFQB 1XEDA 1N4XH 2WLYA 1VESA 3F7YB 3MRCB 5I1JH 3T4YA 4ZUUB 3S36X 1BLNB 4XPHL 2DKUA 3AXLB 4I0PD 5KSAC 5I0ZA 5DZOA 2CGRL 3FO2B 4K3GA 3CFDB 4OZFA 5E9DA 4EXKA 1GAFH 2IGFL 4WDIB 5JLZA 2V7NB 1FH5L 2GT9B 4N0UE 1ADQA 2BCKA 4OT1L 4EI6B 1CYGA 4H26B 4ZAKC 1NKOA 1A6ZB 4GKOA 4UTBH 1OHQA 4NM4H 4YE4L 5C09D 4WHCA 1INDH 5F7FA 4LNRB 1TDQA 1SY6H 1CG9B 4J3XA 3G5YA 1ZTXL 2F53B 4K9EH 2IPTL 4C55A 3MV9E 4U1LB 5F1OB 5F7EL 5CJ5A 5FKAA 1IM9B 1JF5A 2UWEF 4LVEA 1RJYB 2EH7L 4NZJA 2DQGL 2O5YH 3GMPA 3GMOB 1KXVC 4EN3A 4H0GA 2BOCA 3D3VE 5GGRB 1ZT1A 4JDTL 2X6MA 2IPUG 3RGVA 2XA3A 1D7FA 5CP3A 1TTFA 2RGSA 3PWPD 2P42B 4WUUE 1WBXA 3OGCA 2BSRA 4KKLC 4UT7L 2XTJC 3IDGB 4BQ8A 3X17A 3S35X 4NGHH 1V3LA 2EC8A 1OTSD 3CH8A 4ZFGH 1FC1A 1MHHB 2BVOB 2YC1B 4YK4B 1F4XL 4UIKL 4MA3B 1KFAL 5ITFB 2K7PA 3HZVA 2I5YH 5FHAL 1KTRL 1B2WH 5AZEH 2F8OA 3U1SH 5EZOL 4L4VA 3TPUA 2HKFH 1XMWA 1RZ8A 1S7XA 2NY5L 5I8KH 3FRUA 1INEH 5EC2A 1IKNA 2GY5A 3F5WB 3HG1E 5ANME 4ZOEA 3HUJA 2NY0C 1BLNA 2E7LA 4KGLA 2BXYA 4BSVB 1M7XA 3BVNA 2HJKB 2IMNA 4H20H 4POUB 4U1HA 2DQTH 3PWPA 4HS3B 2CD0A 5ENWB 1G6VK 3RTQD 4YXLL 5EUOB 3KHQA 4Y4HC 3UPRA 3TCLA 5DUPH 1ZGLB 3G5XB 4NWUH 3OKEB 3BSZH 2O5ZH 4G80B 1XGPB 1LE9A 4FNLH 3GUTB 1HKLL 2R9HC 3VXMD 1RUKH 4DW2H 4XCNA 5C6TL 4U1JB 3Q6GH 1CLZL 5IM7B 1BFTA 3KPRB 4LLQB 4JZJB 1CXEA 3UTTD 1KCUL 1H3TA 3LB6D 1QO3A 2EXWD 3OKNB 2JJTC 2A6KA 3C60B 5F1NB 2P44B 1HZHL 4PJ5D 1BEYL 3FQTB 1IGMH 4HJ0C 5EC1A 3LEYL 4QT5A 1T83A 4Z7UA 5CSGA 4D9RD 3DX6A 1GGUA 5KJRL 3P4NB 3HPJA 3EUUA 3BP6B 4CVZB 1REIA 3C5JA 4K8RH 3OR7A 1YN7A 2EKSA 2JJTA 1A1NA 1OTTD 4JCLA 5I30L 2NTFA 4J3WA 4DK6A 1XIWD 2EH8H 2YEZB 4M93C 3BP7A 4KQ4L 2VZTA 4PJCB 4GAJL 3LY6A 1BQLL 4HXBL 1A2YA 5E5MB 4AIZB 1A9BA 1S9YB 4RMSA 5BZWB 4YHOH 1OPGH 5B3NA 1MQKH 1UM6L 3UROR 1JRHI 1Q1JL 1X7QB 4OFYD 3S88H 1LK3H 1CR9H 3SDDB 1B9ZA 1PQZB 3DUUA 1PQZA 3DUUB 4BZ1L 4JRYE 2E9JA 4JO2H 2DQCL 3OKDA 4IOIA 3OF6A 4OLZH 4BH7A 1X5YA 3A6BH 1DQMH 2CR6A 3D1MC 4MCYB 4QOKB 2WV3A 3BYTA 1VFBB 1ZLWH 4JQVC 2EIEA 5E7BA 2BDNL 2FIRT 2R2CA 2EXYD 4WEBH 5DJ6B 5ESQA 2F5BH 2FIKB 3NH7L 3S34L 2XY2A 4DQOL 2XTLA 3OL2A 3S4SB 3QIWB 3KPSA 3NZHH 1FNFA 2VSDA 1A0QL 1U41A 2BY1A 2Q3ZA 2VDML 5ESAB 4PLNC 5HI5C 3DHJA 2ADJB 4D9RE 4G3YL 3O4OC 4LLVB 4TNWK 5J1AA 5I1CL 4OFYA 3C6SB 4NRXB 4KQ3H 1LNUA 2YHGA 2O5XL 1A6TA 3FB7A 5M7QA 3E2HB 2R2HA 3MXVH 5D1QB 3UO1L 1H9VA 1JRHL 1YY8A 4PR5A 3BD3A 4GKNB 4GS7B 4PS4L 4HGMA 3G6DH 3CFKB 1KPUA 3QQ4B 1TTUA 2DOCA 1QRNB 5FYLL 4KVCH 1J1XH 2E6JA 2YK1H 1D3CA 3O11A 4TYUA 4KVNH 3N1PC 1LE9B 3BKML 4WNQB 3RPIA 1OT2A 3W9EB 4QNPF 3H9SB 3C2AH 4AEIL 5JW3H 3DVFA 3SKJH 3UPRB 2VDOH 1WTGT 3HE6A 2BOBB 2YPLE 5D2NE 1V5JA 3BUTA 1R0AH 4L9LC 5C0CD 5J8OA 1UH4A 4KI1A 1OTSC 4HF5H 2XZZA 5SWQA 3U0PB 3REVB 4QRQA 2JLLA 5IMMA 2P7TB 1ZHLB 4LAQL 1F11B 5B4MC 1KTDA 4JFXA 3WIHA 3T8XB 4NQDE 1KB9J 3CU7A 2C7UB 4M7JL 3QZWA 4PJCE 3QG7L 3QEQE 4JPIB 3Q5TA 5E99H 3HG1D 1W0VB 1DL7H 4MXVE 1FYHB 3I6GB 2IFFH 2CK0H 5ISZA 2CXGA 3SN6N 4OJFL 4WU7B 5HVWA 1CLYH 4OQTA 2DIJA 1EJOH 1FAIH 4R2GB 4XB8A 4LCYA 4U1MA 2B1AL 5DWUH 4P23A 3BDXA 5C07B 3SDDD 3CZFB 6FABH 2CKBL 3WIFB 3UAJC 2VXQL 3L5HA 2WBJA 3VH8A 5DD5L 2W0FB 1MREH 1N6VA 1WBXB 3JWOH 3ZT7A 4PJ5A 3GJFB 5IROC 3ZHLA 4F7TA 2QTEA 3MGTB 2PUQT 4JREB 3VFMA 1PEZA 4ODSL 4AH2B 4RGNC 3DX6B 3PV6B 5FKAB 5HYSA 1FIEA 1HILA 4HIXL 4PJXF 3BKYH 4MLSA 4QXTA 3VD5A 4F8TA 1DTUA 1TVBB 3QDHA 4JFFE 3QHFL 2EH7H 5IB5B 3CCHB 1ZVSB 4YWGL 3S5LG 3DV4B 1HCFX 3G5VB 4F7CB 1A6ZA 4FHBD 5A43C 4NZTH 5H37G 4LPYA 3LSOA 3GKWL 4PJHA 2NY4D 2R0KH 3ES6A 4XBGB 2QL1A 5K33A 4HBQA 5AEAA 1F3RB 1FFPA 1HH6B 1FCCA 5ICXB 4Q58C 1D5XA 3PXJA 2WUBL 4JKPL 1QSEE 1N5AA 5E56A 4X6DA 1L0QA 3MA9L 2Q8AL 1EFXD 5C0JB 5EUOA 1OAZH 4X5LA 2AQ2A 2I5YL 3MV8B 4PJGA 5DJXB 3ZDZE 5IFAL 5I76A 5FOJA 2GK2A 1D6VL 3QXWA 5GISH 5C0BB 5D2LB 2X4UB 15C8L 4LKXA 1R24A 4QRRB 1L9MA 5FO9A 2PXYA 2YA1A 3VXNA 3NIDF 1FP5A 4NPYB 3GO1H 4PGCA 4XBGA 3ES6B 5C1MB 1M7IB 4FFVD 2FJGB 3B3IA 5LCVH 3QDMD 3G6AB 2VLMD 3QDME 1D9KB 4NQDD 1RZIB 1QHPA 4HLZG 5BO1H 3D0VA 5F9AC 3KLHC 2H1PL 4P59L 3SCMB 1E4KC 3B9DA 4QXTB 1NCBH 1F02I 2VB5A 1I8IB 4IM8A 4DW2L 2CLZB 4HAFA 4PJDE 2CGRH 5C6TH 4LSVL 3PV6A 3RIFF 5KVMC 4P9HC 4ZTOL 2BJMH 2NXYC 2HFFB 3U7YL 3O45A 3C60D 1U3JA 4G8GD 4MA7H 1MH5A 1JF1B 1RZKC 5JZ7D 2FECI 4WW2F 4GXVH 3MRMA 3S35L 3QCUH 1KIUA 1U8OA 2OL3B 3PHOB 4HH9B 4JM2D 1G9NL 1T1YB 3DX8B 5AAWA 1EXUB 1MAML 3P11H 3KGRA 1UT9A 2VR9A 5MEOA 4KC3B 12E8L 1KTLA 3UTSA 4JO3L 1CFVH 5GIRB 3IJHA 2M26A 1NGWB 2VL5B 1P4BH 4X6BB 3UMTA 4LCCB 3GM0A 1VKXA 3PP3K 1MCJA 2X4UA 1ORSA 5HDBF 1SBBA 2A6DA 2E7BA 3HE7D 3QDAA 4C83A 3BPNB 1AHWC 5F7NC 5EU5B 1HINH 3E8UH 1WIUA 5GS2D 5KVGH 4R97B 4YHZH 4G9FE 2OCFD 2GTWA 2BK8A 1JHKL 5GRJL 2IQAB 3RY4A 3HZMA 3G04B 1ODAA 3BH8A 3MOBL 1MFCH 4QOKD 4W68A 4GRLD 3LHPL 3BQUB 2DLEA 3GI8H 3P40A 4JFOA 3ZT6A 5ICXA 4MJIE 1CIDA 4W6YB 1XIWB 4HKJA 1TTGA 3V2AR 3IGAB 2DM2A 4GT7A 5JO5B 3P2TA 5DHYA 4U6XB 4X6FA 4NT6B 1IAOB 4WWKA 4BFIB 3L5WB 2Z92A 1M71A 5D1XC 1QSFE 3H42L 3MLZL 1KJ3L 3F7RA 5F6HJ 1NCWL 1N2RA 3OXSA 4OZGF 3LRHA 4EDXB 3I2CL 3VFMB 2CKNA 1H5BA 1ES0A 1DANT 4JB9H 4EQ3A 2MOVA 1UH3A 4KFZC 3VXSA 3S4SA 2F5AL 3KS0J 3QEHA 4R4BB 5IFJA 5KS9E 1MCIA 1QRND 2RFXA 3CSGA 3QUXA 4PREA 1KCUH 2JCCE 4M1CD 4AT6A 1KIRA 1JYVA 4LSSH 2A6JB 4LPTA 4Y19B 5FYLH 1WC7B 3FMGL 4MVBC 3AVEA 3L95B 4NOBA 1DBKH 2XNAA 4X4XB 1ZT7A 1EH9A 1JNHB 4G9DA 5I19H 4KTEH 1FORL 1GGCL 2CKBB 3QIUD 1MUJB 4E41A 3K1DA 5J56B 5DC9B 1Q72L 4J3UA 1NCUA 5HYQB 3C5ZB 3PDDA 3QJHB 5I18H 4WEUD 4M03A 1KLGB 3PNWB 2Z8VC 3ILPA 1UB5A 1WQVT 5GS0C 4KWUA 4NZUL 2GJ6B 3VRJA 5AG8A 5EBMA 3LN5B 3V6ZA 3R06A 1P84K 1QFUL 2X2YA 2YEZA 2VR4A 4KRPC 1MF2H 5HHPB 5J89A 4O2EA 1ZA3B 3RPIB 4NC1C 1KULA 1D6VH 1ZAGA 1ZHNA 4X6EA 1IGYB 5BS0D 4ZUTB 1HDMA 2P8MA 4AEHL 1EZVY 3FT4B 3WV0A 1TZIA 3ARRA 4LPXA 1AXTH 4XC1H 2X1PA 4GUPB 3PWLA 3PWLB 3IDJB 5DMJB 3CVHB 3EFFB 3KJ6H 3TWCH 1DFBL 5DJ0B 5DFVC 4HWBA 4IOFD 4W4OC 2MPAH 4JPWL 4L9LA 4XHJD 1A0QH 5CSBA 1IAKA 3E6HB 2GKIA 4XAKE 4BZ2H 2LFGA 4N90D 3OSKA 4GMSL 1KSRA 4P48A 1XF5A 4CADB 3VFOB 2CUIA 1FNHA 2BFVL 2EDJA 4J8RB 4L5FH 5ICYB 3NIGF 1DQQA 3MCLL 4MD5A 2R56L 1JYXA 4NCC2 1L7TH 2FJHB 4ZD3L 3RGVC 3MLXH 2JJSA 5MERB 4Y89A 5KS9B 4MZ3A 4PJIE 3IVKB 5INCB 2QV2A 4YBHA 2DQIL 4KVNL 1A14H 1MAMH 3P11L 1UYWH 5K93A 4RMTA 5E2WH 5I1KH 4LU5L 4E5XA 1JL8A 4MNGB 1M7DB 5IG7A 4PRHE 3RWJA 3ABZA 1QQDB 4YHNA 4MS8C 4K07A 4ZNCD 3BUYB 2DLFH 2P5WB 1IL1B 1FFOB 4JM2B 2PYEB 2WW8A 2CPCA 2VSCA 3MUZ1 2A83A 2V2WB 2A77L 4JKKA 3TBWA 4E42A 5FKPB 4PREB 1CBVH 3DRTA 3MACH 4UILH 3CSYB 3AS1A 3LKNA 5I1LB 2VR5A 1RFDL 2DMCA 4HXAH 5DC4B 4UNUA 3OB0H 2D7PA 2H3NA 5EBMB 5HYIA 2IFFL 5IR1B 4S10A 3RGHA 3CSBA 4NIKB 5ERWB 3RVVC 4Z7UB 2GSGB 4AEEA 3PQYB 3AGVA 4HUUA 3AREA 2CKBH 5D6DA 3JWDH 1RZKH 3SOBH 1NCAL 3WXWH 4YFLF 1QR4A 3LCYA 4H25A 3T3ME 3WFDL 4CU7A 4R3SA 5FA4B 4H26A 1OAYH 2HLFC 2UY6A 2PW2A 2ZCHH 1QFWL 5LVEA 1IBGL 3OMZA 1XR9B 4F7MA 1A4KA 4GO6B 1TNMA 2Q76B 1YEDA 1KIRB 2PR4L 5D2NC 2I9TA 1IRAY 3VXRD 4IIQB 4PRID 2NXZD 3HZMB 4PRIE 4XVSL 4JHBA 1LP9B 4ZPVB 4JM2C 2V2TB 1D5IH 2PXYC 4JRYB 3RWCB 5KW9L 3OJDB 5D7SH 1FNGA 5KANG 3KLSA 4YPJA 4NZTL 4XP9L 2VXUL 4I9WE 1L6ZA 2R0KL 3WLBA 4LSUH 5D7JD 3ARBD 1MJJA 3HN3A 2EYSB 3P4OB 4UNTA 4U0RB 3OV6A 3CD4A 2EDRA 3TV3H 2AJYH 1NJ9B 4KTEL 2Z92B 5AYUH 1UFUA 3RUGA 1N5YH 4I3RL 2X9YA 1KENH 4HZLA 2AJVH 3BZEB 3O2WH 1TQBB 3PDOB 2AKRA 4HKJB 3TN0B 5IVZB 5IVXB 4JM2F 1INQA 1BVLB 5HHVL 2X5PA 1H3GA 5GJSH 4D0CA 5CIPH 2V9TA 2OR7A 1BOGB 1N6QH 3DSFL 2E8YA 1FO0H 3QIBC 4GW1A 3QHTC 1HEZB 2VN4A 3RIFK 1G6RA 1W0WA 3T1WA 3W9DA 4K3EL 3GO1L 4NFCA 5SWZA 3EO0B 3FB6A 1G7MB 3MLTA 1F4WH 3H42H 1XCTB 5DJYA 4Z7QE 2WANA 1KCRH 3BPLB 2VLKB 2H2SC 2N7BA 5CSZB 4UU9A 1TITA 4NBZB 2V2XA 3CFEB 4FFWD 4X6BA 1MVFA 5DQJB 1MFBH 4K7PL 1ZLSH 3TA3A 2ENYA 3WHXB 4XI5C 2APXA 4Z7VA 4Z7VB 4PJ8D 4HGWA 5BJTB 1JHLH 2VLJA 4TUKL 3BH9B 2V2XB 3CFEA 4D94A 5DD1H 5E00B 2MPAL 4JPWH 4JY6A 5CAYB 3A0OA 2R1XB 2VDNH 5T1LA 1S7SB 5IESH 3SGJA 3F65A 2DQTL 5BS0A 1W8OA 3D69B 2XN9A 4X7FC 5F9OL 4HIHB 4S1RL 1YEEL 2PO6B 4O5LH 2P46B 1U8HA 5E94B 1HQRA 3TNMB 5HYEA 2L7UA 3HB3C 1TPXB 3BO8A 3BWAB 4Q9RL 4M62H 4GW1B 1WITA 2ADIA 1XCQB 4JFDB 4HC1A 2NXZB 5EBLA 3B2UC 4WUKH 3L7EB 4HC1L 4D0CB 5C9KA 5GRUH 4F15B 1HOCA 3B9KD 2CLVB 3V0WL 3DUSA 4NZUH 3GSNH 4OI7A 4FQ1H 4Y4KB 5JHDD 4M6NH 4FQXB 1RZIA 4YGVB 1GC1H 1F00I 1AO7D 1A7PL 5D7JB 3S96B 3HG1A 4RAUA 4PGCB 4X9GA 3TIDA 1J05B 3NFNB 1A6VL 5IB5A 1NDGA 2ZWLT 1YNLL 3QAZB 3MV7A 5DJ2B 4J3VA 2FD6L 3L7EA 1S9XA 5BOPA 2AXGB 1OOAA 5IBUG 2QSCL 4XCEA 3OHXB 3EO9L 4JRXA 4UDTA 5FYKH 1EK3A 4LASL 1UCTA 5H2BB 4PJ7A 3BDYH 3BWAA 2H32A 1KB5A 4FFZL 4QRSA 4PJGB 4RGOH 4X99B 2FEEI 5J3HD 2F54D 1DUYB 1CDIA 2CRIA 1NANH 2FWOB 2ICEA 2CIIB 1JWUA 5C0JA 3IFLH 2E27L 4YXHH 3T0EB 5D1XB 4Z8FH 5I1JL 3U9UB 3WBDA 1A02N 2ARJA 4LCYB 4U1MB 1CR9L 2PYED 3VI4E 2EDOA 1T7WA 3FKUS 5D96C 2IADA 4DUVA 1NCAH 2QKIB 3TF7C 5IF0A 1ZANH 3EOAB 4J23A 4TN9A 1XF2A 1Y0LB 3WEXA 2AK1H 1I7TA 3QXTA 5AWNH 3WJLC 5SWSD 5BMFH 1F11A 3D39E 2HRPL 3B8SA 5FM4A 3B9VA 4QRRE 5AUMA 5TGBA 5FYJL 3L9RB 4L4TE 4JGMA 3MLUH 4U49A 1IC4H 1W72H 4BSWA 1LILA 3CIQA 4MHHG 1UYWL 4M6MH 5LWYH 4WO4D 4LVOC 1IGFL 3MRHB 3MNZB 1UVQB 4R7DB 3R0MA 1K3ZA 3RNKB 3U79A 3GGWA 1EAPB 3CZFA 1KYOJ 2JB5H 5JPNA 4OSUH 1C12B 5GZNC 4GRWF 1WCQA 1IAIH 1NH6A 4TTDC 3QUYC 4F3FB 1CBVL 1CD1A 4ZNEE 1EHLH 3MACL 1IJ9A 1AC0A 5EU3B 4I3RH 3SDAA 4LPVA 4WI6A 4B0MM 2YD8A 2AJZA 3DVGB 5C0FB 4OFVA 4P2QE 5IJVA 1G1YA 1NBVH 1QLRA 4NRXA 4DTGH 2LAGB 5IHLB 3MMEA 3CVIH 4KKNA 2FJHA 3RA7L 4F7EB 5MEPA 5DEGB 1WAAF 2OXHA 3VRIB 3S7GA 3RWCA 1RMFH 4Q0XL 4KMTL 4CL7A 3QUZA 1NAMH 4JEGB 1U58A 1WAAE 2OXGA 5I2IA 1CFNB 1MCPL 1PY4A 3QCVH 4AL8L 1N0LA 1LE5A 3KS0H 3F7QA 1CF8H 1Q9KA 5F7KC 1H8SA 1IAKB 3E6HA 4X83A 5KVDH 2F54B 5KVFH 5KTEH 1YPZA 4JVPA 4LLAA 2Q6WB 3QNXB 4LGSB 4HIEA 3K4AA 4U1NA 4PJHF 5ILTH 1PYWA 3DVNB 2PR4H 3P9LB 4Y4KC 1GPOH 5C0RL 1J5OH 3T0EE 2GAZA 5DDHB 5LKNA 1FFQA 4ZYKB 4OLXL 4FTVA 4M43L 4MX7A 5ADPL 3OAUH 1E4XI 4GMSH 1KPVA 1MCFA 4IRJD 2VXUH 3HC4H 4P3DA 4HIJA 1FIGL 1BEYH 4F37F 1NAKL 1FCGA 2IBZX 3ZKXB 1TZGH 3VCLA 4BFEA 1CGVA 1MCOL 1ZA3A 3KPSB 3SDXA 4C56B 2CDFB 4JGUA 4U1KA 3VGBA 5MENB 3HNVL 1O0VA 2VIRA 5F72S 2C3VA 4K94C 5F3HA 4K7FA 1FZOB 5I30H 1FPTL 2APTA 2P5WA 4YC2B 5GRZA 4RNRA 4QOKA 4GAJH 4N8PA 5E8EA 3FCTB 2YPLA 5B3JF 1CGSL 2ZG3A 4D9QE 1VADB 1BQLH 5FYLE 1YUHA 3DVIA 2J8UA 3UJJL 3BE1H 4Z7NE 2OR8A 3WEXB 3HR6A 4M7KL 1CI5A 4EBQH 3OKOA 3WL9B 3V7AG 1CK0L 2VZ1A 5KN5A 5T1DL 1H8OA 5BV7H 2DF3A 5LBSL 3SE3A 3W2DH 4K94H 1AY1H 1WJ3A 3NBNA 2VXSH 1YPZB 3RY5A 3ZYIA 1N64H 3O81A 3BZDA 5EO9A 4ZO7A 4QKXB 3QJFA 2VDRL 4M7ZB 4LASH 3V79C 1RULH 5T1KA 3VFOA 3TCLB 5TQ2L 4UT9H 1EVUA 1HH9A 5TE6L 2FJFA 2BDNH 1FYTA 1U58B 2ICEB 4JFPA 3CFCH 4MZ2A 5DO2D 5DJ8A 4K8RD 5GGVH 3AM8A 1NC4D 5ISZD 1QYGL 1RIHH 1OAYL 4PG2A 1TCMA 2VITB 4ODVH 3N9GH 3IXAA 1V3JA 4Z0BH 4G6JL 3RIAF 4XHJC 4HULB 4L3CB 3SDAB 5I1CH 2BVQA 5EOTB 5CILH 3O3UN 4U0RC 2P8PA 4KDTA 2HKHL 2VXVH 4FXGA 4K71C 2VABA 1R3JB 1KCVH 1T21A 2H1PH 3QIBA 1WAAA 4P59H 4U6HB 5DFVD 3KJ4B 2G2RB 4LEXL 1U0QA 3DV6B 5IEKB 1QOKA 4U4BA 5B38G 4XCNB 5HGBA 5EU4B 3IJYB 5IVNA 5T1KD 1WICA 3G6DL 4Q6IC 2GSIA 1SBSH 4GAYA 2C3GA 2DIBA 3GSNL 3NFSL 5E9DE 4JFYB 3C5SA 1QZ1A 2HT3D 4APQA 5F1SA 4Q2ZB 3S3SA 3H7BB 2QHRH 3CX5J 1VFMA 3KYAA 4PJEB 2UZXB 5FB8B 1AGCA 3S36L 3BO8B 4TVPL 4PGBA 1RK1B 4XZUB 5F6IB 4OB5L 4HS3A 4FXLA 5C9JB 5GRVK 4L3EA 2XZCL 4QNPE 5IWLA 1FL5B 3R4DA 2FEEL 1J8HA 5FCUL 1J86A 3QJHA 1MPAH 4FQCL 4KRNA 2QSCH 3QI9B 3EO9H 3QI9C 1AC6A 3NAAL 3E6FB 1YNKL 5IMLA 5HGGS 2P43B 4MJIA 5F6IC 1Y18B 3L3GB 4Y0GA 4FN0A 1R3IH 1JGUH 4I5BB 2NX5B 5GJTL 3ZHKA 4KV5F 3LIZL 2D7QA 3FQUB 5I8OH 1OQXA 5JUEH 4HMCA 2UZIH 3U0WL 3AXLA 1ED3A 3IRPX 5GGUB 4XWGH 1IEBB 2X89D 4X99A 3W9DB 4KRLB 4LCWD 2GHWB 2HVKA 2C9AA 4XMLL 5F7DA 5GRXG 4YEFA 3V6OE 3BMVA 3GSVA 2CLZA 5ITBL 1PLGL 3P0YH 1UEYA 2J5LC 2V9RA 5KVFL 3SY0A 5HVHC 3QFDB 3MLVH 1T2QL 4OZIE 5IESL 3TVMC 2XA8L 3LS4H 4I77L 3VA2C 5HPMB 4QCIB 3BZEA 2R39A 2EC9U 2JCCA 3KPOB 2EDBA 1NCTA 5E8DL 1EEUA 2X1OA 5IMOB 4OLXH 2CMRH 5ADPH 3O2DH 1NCWH 1E27A 4YHPA 5E2UH 3WFHA 3SDCB 4L8SC 1GAFL 2FHFA 3VG0L 2DTSA 2YXFA 4JAMA 1I1YB 3DXAA 3GFUA 1FJ1B 3FT3B 4R96B 3DIFA 5IHZA 2Z0BA 4K3HA 3LPWA 4JRYA 4WTZA 4YAQA 5C70A 4I2XB 2EDKA 3FT2A 3P30L 5D1ZC 4IIQA 4NNPL 3QDGA 1DVFB 4KI5F 3X3GH 3P77B 2CDGB 5IFHL 2DS4A 3BJLA 5IROA 1J88A 3EHBC 2VLLB 2LE9A 3V7MA 4OLVL 4EIZC 5BOZG 1U3YA 5EOCJ 2KZ1B 1JPSL 3H8NA 3VH8G 5CGYC 1K5NA 5C2UB 4P9MH 3TA3B 4IIQC 1I1AD 4K71B 1X4YA 4EDWL 4X0KA 1FLRH 4H25B 1EXUA 4ONGH 2AEWA 2HJFB 4XC3H 5D7LD 5CBEA 1NPUA 3DX7B 4UU9B 3KDMA 1J0KA 5DMGD 3Q3GA 5I1EL 2J4WL 2EDDA 4O2FB 5FHAH 2WM0A 2VDRH 2ESVD 4D9LL 1NCBL 4YR6A 1UM5H 3L3IA 4OUUA 2F8XC 5F3HB 3BKJH 4E41D 3JV4A 2NY3D 1R6VA 2NY0B 2G9HB 5ADOL 1G7IB 5TQ0L 3WJJA 4C56A 4JR9L 1MHPH 2XRAH 1OCWH 1S3KL 4XNYL 4OZFH 2Z93A 2GSIB 1YEKH 2XKNB 5C2BL 1P5VA 1IL1A 4R4NC 2QQLL 3N1FC 1LHZA 2DI9A 4YDKH 3FOMA 1C7TA 2BNRD 2CIKA 1KBGL 5D7LA 4W6XB 4RISL 1BAFL 1HHGA 1P4LB 3FFDA 2XPGB 4I1NB 5FO9B 5CZVH 4YHKH 4UMGA 1D5ZA 2XTJB 4A2LA 5J57B 1G0DA 1I3RA 2UY7A 5BS0E 3D39A 2DQDH 4KI5C 4WW1B 4G6AC 3KJ4C 3NCBB 1I3UA 3TJHC 5EFIB 5CWSB 4OFKA 4KXZH 1EIBA 1V8HA 3NABL 1MCWM 4PLOB 3LN4B 2N56A 2VXTL 1HZHH 4MJID 1NMBH 3UTTA 4TSCH 2F58H 2ICWI 5T1DH 3VFTA 1HIMH 2Y5TA 1M6OB 4RBPK 3W2DL 3QJFB 1AE6H 1PZ5B 2OR9H 2NW2B 4OF0A 2NPLX 4NQVA 4K9EL 5DK0B 1TFHA 1U8JB 3WO4C 2PW2B 5MHSE 4FQQA 3OB0K 5C0IB 1YDPA 4MJ5B 1I1AC 2WP3T 5D2NA 4XRCA 3RX7A 1CD1B 1T5WB 4L3ED 5FUCE 5EU6A 1HILB 3SGDI 3W11D 4Y2DB 1EFXA 1PJ9A 1ZS8A 4RNRB 1IILE 4PRHA 4FS0A 5EOQL 1OSZB 5EIVA 3RDTD 2EDWA 1CZ8L 1FNLA 4NC2B 2X4QA 1JNLL 3EOBA 4FFVC 3VGAB 1UGNA 3NFPA 4HUNB 1YYML 1KV3A 4PRHD 4OGYL 2ZNXA 3LKRB 3ISWA 4LRIA 4O51A 2MNUA 2H2SD 3O6FC 5ITBH 2YD7A 4M43H 2PYFA 3HTLX 1QTYT 2UWEA 4LSSL 4ODTH 4PJAE 1T04A 2M2DA 1XF4B 3QWOB 5ISZB 1TZGL 1EO8L 4YLQT 2CH8A 4PJGE 3DBXB 1N3NB 1N3NA 3S36H 1NMCB 3EZ8A 5D6CA 1BECA 4YUEL 4JG1L 4OB5H 3ZKXC 3RVTC 1AGFB 1A7QL 1WISA 2JK5A 2ZOLB 3M8OL 4WI5A 2DBLL 4YFEA 2IADB 5MERA 1F58L 3W0WA 1T1XA 3BSZL 3T3MF 3DTXA 3KPTA 5LGHH 3ALWA 4N5EC 4MD5B 3S6CA 1DEEB 2IPTH 1LDPL 5KSUB 1C08A 1WZ1L 1X5IA 3L3DB 3ARBC 1MHCB 4CADA 1GGIH 1U8IA 3KYMB 3L6FB 2OZ4L 5TFSH 2R1WB 3B83A 1XGQA 2XKUA 4M7LT 2GITA 5EIQA 1RZ7L 4NKIH 4OKVB 5IJKA 3K8KA 4CVZA 3BP6A 3V6BR