4WFED

Human traak k+ channel in a k+ bound conductive conformation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
211
structure length
211
Chain Sequence
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSNSPPTFGAGAKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfeD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfeD01
3I6KB 1YEFH 1J1XL 5L2JB 1RJZA 2VERN 3BAEL 4A2LA 3IVKB 2H26B 4OF8A 1UA6L 3WFZA 1G7IB 1YDPA 2YPLD 3SDAA 3MGOA 3X3GH 5ADPH 4FZ8L 4Q74A 1VGEH 4U2YA 5D2NC 2W0PA 1K5NB 4X6DE 3U7YL 3RTQD 1XR9A 1V3JA 1BQHA 1AXSA 3FB6A 2HJLB 1OWWA 2PUQT 4XPBH 2Q1EA 1Z5LB 5DLMH 5IQ9A 4QRRA 5TQ2L 3TWCL 4NNPH 1E4KA 2KBGA 4LCUB 3TC9A 4N8VB 2QHRL 3FCTB 1CGSL 4NO3A 3WNPA 5HD8C 3D39A 1PAMA 4K3HA 4BZ2H 3WN5A 1EK3A 2VZUA 3HUJB 5J1AA 4OCWH 2CXKA 3ULUL 4BSVA 4KMTH 3GSUB 4R3SB 5SWZD 1ORQA 1WZLA 3KR3H 1MFNA 1FBIL 2F53E 3FFCD 3PWJA 2GK2A 3VXRD 3ZTJG 3H9SB 2FB4L 1QR1A 1AQKH 1G7HB 2DJ4A 1ZLSL 4X9BA 1BBJA 3EOAB 1FAIL 3FONB 4LLMB 2WANA 4MCZB 4YDVA 2BOCB 4HXAH 4PJAE 4JR9H 3KPOA 1YUHB 5DHYA 3SKMB 5FM5M 1JL8A 3WD5L 5E9DE 4ZFZB 3N85L 3OKOB 5TDNB 3D25B 3DETD 3BQUB 5DRZA 3W5MA 1X6NA 2IH3B 5D7JD 3BH8B 35C8L 5MENA 2BY1A 3ES6B 1X44A 5D1ZA 5C0CA 4HUUA 4HWZB 5IB5A 4HSQA 4UT7L 1PZUB 4RISH 1KENH 3U82B 2FCBA 2XIDA 5LXGL 2CUHA 3BYTA 3ETBF 3PL6D 4XHJC 4Y8AA 4R7NB 3VCLA 1CE1L 4V2CB 3O3BB 4U4BA 1XMWA 4Q7DA 4QRUA 4I48A 3JZ7A 2JJSA 2NX5E 4QHUA 1ZA3B 1KPVB 1U95A 5JOPE 4QOKB 3KVQA 3STBA 2DMCA 1CF8H 2R29H 3MUGB 4AEHL 3QIWC 5E94B 4KHXH 3DRTA 3FO9A 3OSKA 1IC1A 3W5NA 1CZ8L 5DUMH 4U7MA 5HHVL 5SX4H 3G6DL 3KNBB 5KJRH 5DMKB 4IRJC 4R90L 1BVKB 4KZDL 4RMRA 5DJZA 1FAKT 1UZ6F 1BF2A 3RGHA 3HA0A 5C07D 3L3HA 5KVFL 1ORSA 2GCYB 1F3JB 2O5ZL 1FH5L 2HN7A 4OGYH 1ZGLP 2QQQA 2XY2A 4Y2DA 1LEGB 5ICYA 4HKBA 2WIIA 5I19H 4FQHA 1BZ7B 3INUL 3OKEA 4HXBH 4S1SH 1TJGH 4I5BA 3AS3A 4ORZC 3HAEG 5TE6L 5FKPA 3RDTD 1Q9KB 5D7SH 3V95A 4U6XB 4NO0B 1UA6H 5D9SA 5J13B 4LEOA 1IC5L 4MJID 2Y5TA 1T21B 4FXKB 4CN1A 2RBLA 1PEZA 3U7YH 3LN4B 2F8OA 1S7QA 43CAA 4OD1L 3IDIA 1E4KC 4KAQH 3P77A 5TQ2H 1U93B 1ZS8A 3TWCH 5BOZG 1ACYL 1MNUH 4JY5H 3WN5C 1XH3B 2Q6WB 2LVCA 2X41A 3CLFH 1CU4L 4POZC 5GPRA 2GSGA 4O58H 5ELIA 3ZT7A 3QRFM 4PB9L 4BJLA 2XN9A 5E8PB 3S37L 1J9CT 1KTDB 3GSRB 1QSEE 3QUKB 1M6OB 1DBJL 2W9DL 1DVFA 3FB5B 1A1NA 4I3SL 4I2XB 4HUVB 4GRLA 4PP2A 4OFKA 2YRLA 1YEEH 4D0BB 3L1OL 2E8YA 5CJ5A 4PY7A 1IMHC 4JY6B 3VFSA 2SEBA 1MCWW 1FAIH 5TGBB 1IGJA 2R9HD 2AGJH 5H94A 3MCKB 2OM5A 1DDHA 1JNNL 1TVBB 3TPUB 3N85H 3QP3A 3VXUE 2BVQB 5A40E 3QHTC 1BPVA 5TH2A 2AK4E 5D1ZC 3ARSA 2VZ3A 4UQ2B 1GCFA 1D5IL 35C8H 3TN0A 1U3HD 4HG4K 5I1GL 3CFKB 5CFHA 4X6DA 3PF2A 4WGVB 4UT7H 1JZ5A 1GGUA 3NAAL 3TPKA 4XNZC 1NJ9B 5LXGH 2WBJA 1N59B 3FQTA 4YHNB 3O8XB 3QUMA 2D7PA 4H5SA 3UJJL 1JHLH 4WHDA 3I6LD 3QG6A 2J5LC 5DJDA 3ULSA 1FSKB 2EIZA 1HEZB 4H26B 1A9EA 2XA8L 1NGZB 2GTZA 4APQC 3A6OA 3GSXB 5EBWB 2OL3L 4P2QE 2FIRT 1S3KH 3EDKA 2VLRD 4KI5F 4RMWA 3OKYA 5FUOL 3O4OB 1CI5A 3UPCA 2HT4C 4KY1L 4R9HA 4WTZA 5CIPH 3WS6C 3KYMB 5EZIL 3G6DH 5T1LD 3MV01 1Q9WA 4HMDA 4N8PA 3IS1X 5GXBB 4Y5VA 2AQ3A 3SDCC 5FO7B 5KVFH 3OG4B 4PJAA 1GSMA 3M8OH 4Y2DC 4N8VG 2APWA 3QAZB 4OZHA 4X7SL 1GHFL 1MRFL 1BFVH 1FLTX 2UZIH 2DQUH 4JG0L 1K4DA 2ZCHL 3E1F1 3INUH 5LCVL 4R96B 3QUYD 4Y19D 5TE6H 2J7LA 1JK8A 2X9XA 3R06B 5EZJA 1FFOB 3ZHLA 3G08A 4HULB 4L4TE 1ZGLA 3O2VL 5FYJL 1I1RA 3TVMB 3ROOA 1PJ9A 5HHOA 4HGKC 3TH4T 5FYJU 1IC5H 4HPOL 4Z7UE 1OAUL 5H35B 3EHBD 4MA3A 4S1DC 3Q1SL 4NDMB 4GW4A 5KANI 2XZAL 3EOBA 5CWSB 5I6XC 3D69A 4OD1H 3F7VA 1QFUL 1I1FA 1HN1A 4Q6YA 4Z9KB 5ESVB 3TJEL 3CUPA 4U7KA 1ACYH 1KJ3H 5EUOF 3HR5B 1JJUA 4HH8A 5I30L 1MUJA 4UI2A 5CJ8A 1I1AB 1ODAA 3U6RB 4PJFA 2Q86B 3S37H 5BRZE 4GRLC 3X13B 1F11A 3RWHB 2X4RA 4RFNC 1FZOB 1Z6JT 5GIRB 2XKUA 4GUPA 5CEZE 1G7MB 1HNFA 4Y16B 4MDIA 1NLBL 3E3QE 2P8MB 1U8KB 1H8OA 5F9DC 3LHPL 1I8MB 3WKNA 4DKAA 3BUYA 3KYOB 1JYXA 1KCLA 3B5GA 5CHNA 3UBXI 3BKYL 1MCFA 4Z7WF 3DOSA 4F7EB 3ECBB 2P45B 4K3DH 4JQVC 3UBXB 2Z31D 4JGJA 3UYOD 2X10A 4U05A 5ID0A 1B4JL 2FLBT 5DMJB 3D2UD 4PLOB 1UZ8A 2VE6A 3TN0C 2BVYA 3QPQD 4M3JA 4NN6C 1YNTB 1ROWA 4PJ5D 1BLNB 4J4PD 2IANE 4NRZA 5FF6A 2AEPL 4J7RA 3ALPA 3VFOB 3S88L 3OKKB 4R4ND 4YC2C 5HDQH 3AB0B 2WBJC 1N5YL 3L5XL 1IKFH 2IH1A 2MKLC 1X4XA 3MRQB 1T66D 4KUZL 1UB5A 4JJ5A 3PWPB 3BIBX 3S8WA 1Q1JH 1H3WM 2AEQL 3RWIB 3STZA 1DQMH 3ZE0F 1U8JB 4LP5A 1AJ7H 4M3KB 3SE8H 3I6GB 2XA8H 2DKMA 3LD8C 4Z0XB 4DGVH 1SM3L 2OL3H 5EO0A 4HUWA 2A0LD 5HGDB 4WI9A 3WBDA 1S5IL 2UWEF 5E99L 5MP6H 2FL5A 2YEZB 1D7FA 5HJ3B 1TENA 5F1NB 5FUOH 3MROB 4F9LA 1IT9H 3QWOA 1ADQA 1DQLL 1VPOL 2X9YA 5I0ZA 2JTDA 4Y5VC 5EZIH 4NUGH 3U30C 3OKMB 4M7ZC 3K8LA 3QULB 4U6VL 3KXFD 1L0XA 4CMMB 2DQGH 3S96B 4ZFOL 5EH1A 1LMKA 5I66B 4I4WB 3AS2A 4MLIA 3CXHK 3J8F7 2NY1B 4GJTB 3QEHA 2O61A 3MV9B 5KSBF 1NANI 3GK8L 4X7SH 1T3FA 2R0KL 1UQSB 5E2UL 2A6JB 5E4EB 3VXUA 4YPGB 4QCIB 4NZRL 1KJMA 3WHE0 4KVCH 4X9HA 4OGAC 4X7EC 3Q6FA 3DPBA 3FT2B 2NYYC 2HT3C 4KC3B 4G8GD 4OFYA 3HPLB 3Q2CA 3P0GB 4LHUD 2NY4B 1QPPA 3QG7L 3A67H 4O02L 5DJCB 4F7CB 5FYJH 3QHZH 4Y7MA 3AU1A 4QTHB 2Q8BL 4H1LH 5JOFB 4LRNL 3E6FA 2AABL 5C0JB 4Q2ZA 1QPXA 4GFTB 1AO7D 3W39A 1MFAL 1IQWH 5E6IB 1CCZA 3GMNA 1IEHA 3OKDB 3Q1SH 2ICEB 3VFRB 2PYFA 3UTSB 3X12A 2XZAH 4NKIH 4UBDD 4I3GA 4PRHB 1FYTA 1GJIA 3TJEH 1IM9D 2WK2A 5CJXA 1HKLL 4C55A 3BKCH 4P4KB 3U0TB 1ZMYA 3CDFA 2VDKL 2IAMD 1IL1A 5KBNC 3C5SA 1HHKA 2PYED 1TPXC 5D2LE 2VSCA 3K3QA 1JP5A 3NZ8A 4JFOA 1AKJD 4MD5A 1RK0B 5KSUB 1NLBH 1R6VA 5E8NB 1NUGA 2NW3B 1I1YB 4G8IB 2IF7A 3LHPH 1OGAB 2D31B 4F57L 1T5WB 3E0GA 5EU4A 2YD7A 3MRPB 4OZGF 2MNUA 4L3CB 3V52L 4PJHB 3BKYH 3EOTL 2GJZB 1JPTH 4W6YB 5C08E 1RZ7L 2J8OA 4NHUA 1U8OA 3H9YA 4XPGH 1KN4H 1B4JH 1KN2L 4WWKC 2FEDC 3O45A 1TZIB 5TE4L 1KC5L 5J11C 1JPST 3FHQA 2QL1A 1KIUA 3X14B 1LO2H 4OIIL 1SBBA 2AEPH 5I1JL 2E9WA 1ZHBB 5EORH 3JTTB 4ZTOL 3B9AA 5GS0C 4GW1A 3MLTA 1N5YH 2UVFA 3L5XH 4NCC1 1HQRA 4JM4L 4CKVX 4XCNB 2IC2A 3HRZA 4X6EB 5JA8B 3MRBA 1T89A 2AEQH 4DGIL 4U6HA 2XZZA 1DSFH 1MHPH 1U8IA 5HGBB 4YGVA 3BT2L 4MAYA 2DMKA 1YY9C 1SM3H 1A6WL 4R6UA 4F7PA 2DQFA 5DD6A 1FC1A 1UB6B 5DRWB 5E99H 3EW3B 3ZYZA 3BWUC 4GKSB 3U0PA 1A6AA 3D3VB 5FKAB 4K3GA 4FXLA 2VLME 3MR9B 3UPRA 4FQXD 1IFHL 1CFVL 3CMGA 3QISA 5JQHC 4GMSL 1A0QL 3HC0A 2P24B 3FQRA 4RFEA 4LCWD 1U58A 3G6JB 5HBBA 3G5YB 3W82A 5IW1A 1U8NB 1BHGA 3ALWA 5KANG 1J0JA 2A73A 1P2CB 3MACL 3SEPA 2FHCA 5IESL 3NBNA 3DUHA 1EGJL 4M1CD 2EDDA 3MNWB 5IT2H 2CDGA 2YKLH 1EJOL 1E27B 3B5TA 2R0KH 5GS1B 1MCNA 2C5DC 3QNXB 2BNQE 1JZ7A 1X5KA 1YC8A 3HS0A 5ERWA 1DQDL 3DMMD 4RRPG 1A7BA 2WLYA 1EPFA 1SJEA 6FABL 2IBBA 1WBXA 3QG7H 4O02H 1NCCL 1C7TA 3MOAH 1FN4A 2Q8BH 1QO3A 4LRNH 4D9QD 2CD0A 3IAPA 1MFAH 3KDMA 2NY3B 3OR7B 5IVXB 4TUKL 3ARFA 1RFDL 4P57B 3S3SA 1QSZA 5HSFA 3FQUB 1RURL 5CJXC 2BOBB 3LV3B 4JFDA 1A2YA 2F54E 1OGTB 4I18A 3I50L 2LV4A 1AXIB 4L4VB 4MJ6B 1CDYA 3CFDB 5BQ7B 3HB3C 1NFDF 3BPLC 3DIFA 2VDKH 4K2UL 4ODWB 4QRQB 3MRKA 4ODXA 2XG5A 2X4OB 3PQYD 4JKKA 1MFDH 2GSIB 4EI5A 1XF2B 3OJDB 5INCA 3GJFA 2BC4A 3KPPA 3TBWB 4OLZL 2LU7A 4UV7L 5ADOH 3EYFB 5CIPB 5FDWB 2JK5B 4ZS6D 3FKUS 1B0RA 2D0FA 2XXMB 4I0PD 4PGEB 4HIXL 4YUEH 3ZKXC 1IBGL 3ILPA 5D93C 3NCJH 4ZUWA 3SE4A 1JN6B 1T1YB 2R1XA 5FYLE 3L3DB 1RZ7H 3V79C 5GGRA 3OXSB 5FIEA 3S4SG 3H9HB 4ODBD 3L5WA 1FO0L 1KN2H 1IGTB 3P0VH 4GG6A 3TT3H 5DSCB 3C2SA 5TE4H 1KC5H 5I8EB 4ZOAA 4EXPX 5CD5D 1EVTC 2VLKD 3PE9A 4M02A 3DVNB 5F6IB 3WFBL 2YC1B 1J11A 3HI5H 4R0LB 3AUVA 1FL5A 4NQSB 4LVOB 3O3EA 1OAKH 3UTZB 5SWQA 5KSVA 3D0LB 3WL9A 3LS4L 4JM4H 2VL5B 4K3JH 3RWGB 1YEHL 3VRLF 1FNEA 4BH7A 3ZSTA 4U1MA 3VI3E 3VXME 4X7FC 1WAAE 3VWKD 3ZKND 3VXNA 4LL9A 1XCTA 3ZDYE 4G6FB 1BGXL 4LARL 2UZXB 1R3LA 3VE0A 1KCUL 1A6WH 1T1WA 3NN8A 1EEZB 5IOPA 1X5FA 3AS1A 4Y8DC 4R97C 5DMIL 3V4PL 1F42A 3PV6B 1U8HA 4QTIL 1OT1A 3MOBL 1XIWD 2VLJB 2NTSP 1S5HA 3FMGL 4DN3L 3M17B 2YD5A 3CZFB 5F96L 5A43C 4OZGB 1IFHH 2V9RA 3QIUB 4GMSH 4KKBC 1R5WA 3H9SD 3TBSA 4JFXA 5EU5A 2ZSVB 2P5WE 4RGNC 3MACH 1EHNA 3RWJB 2EO9A 1NPUA 5IESH 2NY2D 4JDVB 4Y4HB 4QHMA 1EGJH 3TO4D 3FT4A 1EJOH 2FR4A 4F7MB 2EYRB 4JGMA 5ALCL 1FG2B 4ELKA 4MA1B 4ORGB 4K7PY 1NC2D 4TTGA 2IWGA 2Y07L 3BKJL 6FABH 4PRPE 1BQUA 1NC4A 2CKBL 3VGEA 2JJWA 5IF0B 4U6YA 1NCCH 2B1AL 1V7NL 4LVNB 1SQ2N 4G8EA 4GBXA 5D7KE 5D70H 1CD9B 3MRJA 1D5XB 4HK0B 3BZFB 3UROR 5HGHB 2X1OA 3ARFC 5K9QG 1JNHB 4MXQD 1DLFL 5K59F 5IMOA 2XI9A 1RFDH 1YYLL 2QJDA 3BX7C 1RURH 3O6MH 3T77B 1RI8A 3SDXE 4YHPA 5HVWA 1J8HD 5H2BA 2DBLL 3ARVA 2GK0A 3CGTA 1FFPA 5DURD 2ZKHH 2YD6A 1CDIA 1WCBB 3JV4A 4EI5C 1QRKA 2R23B 5I17B 3O4LE 1HOCA 2XWBB 2FYYB 4K7FB 4LLYA 4M6NL 1YEDA 2V7NB 4X6CF 4OLZH 2R2BA 4UV7H 1ZHNA 4WNQB 3SE4C 4HIXH 1OSZA 3TBYA 1J5OL 3QUMH 5JW5B 2ESVE 2DAVA 2W9EL 4X80H 4CL7A 1ITCA 1EAPA 5F7DA 2CSPA 3RBGA 5FB8B 4JLRB 3FFCE 5HHQA 4A2MA 5BCAA 3VXRE 1G0DA 1DBAL 4Z0BL 4N5EC 1FO0H 4FFVC 2BX5A 1MELA 2BVOB 5FA4B 3HNVL 5FGRA 1RHFA 3N9GH 1KPUB 3FOLA 1BFOB 1WISA 2NXZB 3WFBH 5JW3L 3TH3T 5DK3A 1AY1L 1FP5A 3W9DA 4CADB 1V8HA 5BJTA 1MI5B 3LS4H 3QI9D 1YEHH 1RZFL 4H1LB 4ZO7A 2YA1A 1KNOB 1HILA 3C8KB 4L3EB 2NNAB 4LARH 1QUNA 4WU5B 3S37X 1U8MB 2EH7L 2XTJD 4KMQA 5GJTL 5DMIH 3V4PH 4HMEA 1XGRA 3GHEL 3SKJH 4QTIH 2FSEB 3FZUD 1B6DA 3MV11 3MOBH 3MRIA 2I24N 3PGCA 1G0YR 4U31A 4DN3H 1JGUH 1AC0A 1L0YA 3T0WA 1YN7A 1KXVC 2A6IA 4O2EA 1H8SA 5A3ID 1OP5K 3VA2C 3OPZL 2XKNA 3PJSA 3NIGE 3VFWA 4Y1AA 5HY9B 2CRZA 4J3VA 1TQCC 3ORJA 4XCEA 3VMPA 4X7CC 3NFNA 2HJFB 4PJCA 1NCAL 2DQDL 1QA9B 5D7LD 1MHHA 3BGAA 4JRWA 2OYPA 1T1ZA 1S7VA 2AV7B 2P43B 2DICA 4YPJA 3NA9H 1PX3A 4X4XB 1HSAB 4PJIA 4MQ7A 2BP3A 4GBXC 2Y07H 3BKJH 2EDLA 4LCCB 4MX7A 5B4MD 3C5JB 5J4MA 4IRZH 1V7NH 3OAUL 1HXMA 2ADJB 3DUUB 1A3QA 4DAGH 3EYVB 1B88A 4K23L 5ACZA 1IEBA 4LLDA 1EEUA 2DLHA 4PJ7B 3IT8D 4ZPVB 2IG2L 4PV8A 3LDBC 1WAAA 4NQVB 4MQTB 3QIWB 3AMKA 4HF5L 4UNUA 4XC3L 3R0NA 4ELMF 2QBWA 4P5MA 1WITA 5IIEB 4JDZB 4MJIE 3TZVD 2IADB 4IRJB 5C0EA 1IAKB 2I9TB 5FGCB 4JFED 1VGKA 5IB4A 1S9WA 1MEXL 3CZJA 4M1GH 3SKNA 1MLBA 2GI7A 3KLSA 2YRPA 5IW3A 4PGJA 5I1LA 4P99A 2AEIT 4YHYC 3CC5A 1GZQA 5TDPA 2DQCL 5KSAA 2A1WH 5IFJB 2P5WA 4M6NH 3DXAB 4WEBL 2H8PA 2HT2D 2YN5A 3NIFF 1RJZB 3WS3A 1PYWA 1BOYA 4KRPC 5GS0H 4DKEL 5IG7A 1E28A 3QDJA 1J5OH 1YDPB 3SDAB 3MGOB 2AK1L 5L7XL 3ARGA 1JRHH 1A7RL 4Z8FL 1XR9B 1HH6A 3EO0A 1BQHB 1DBAH 1AXSB 4KU1A 3FB6B 5GGUA 3QCUL 2E9IA 5DMGC 2NZ9D 4PYGA 3TFKD 3HNVH 2Y5EA 3MV8A 3UTTE 4QNPE 5IQ9B 5CEZL 2YZ1A 1U6AH 4OF7A 1AY1H 4CBPA 1QFWI 2QSCL 4M7LL 4NO3B 3D39B 4YAQA 4F33A 1M7IA 3WN5B 4IRSD 1XGUA 1RZFH 2YPLA 5J1AB 4HLZG 4BSVB 1JPFA 5HI5D 3RTQA 4M43H 1ORQB 4YXKH 4P46D 3PWJB 5BVPL 1TJHL 2QTEA 4YX2L 1VACA 1YNLH 7CGTA 5EZOH 3I6LE 1BBJB 5GJTH 4YDVB 2OI9B 3ZKQD 3GHEH 1I7UA 4WFFD 3KPOB 5DHYB 4X4MA 1BAFL 3R1GH 3CFBA 2VLRE 3N06B 3MYZA 5DRZB 3ZYOA 5IHZA 3OPZH 5SWZA 5MENB 5D1ZB 2ZSWA 4CUCA 5C0CB 3FFCA 4HUUB 4W6WB 5IB5B 3VXRA 4RSVA 4ZFOA 1PKOA 4XZUA 4IS6A 1NCAH 2DQDH 4HKZA 3IAGC 5C3TA 3VCLB 5F9WC 2EDEA 5IKCA 5DJAA 4XNZB 1IC7H 4KRMB 1TVHA 1TMCB 4QRUB 1Z9SA 1EHAA 4I48B 2J5LB 4QHUB 1M05A 1U95B 3VD5A 3OAUH 2XYCA 4HHAA 3WLBA 4WHTA 3LB6D 4Y19E 5D7JA 1VA9A 2AJZA 3DRTB 2IG2H 3FO9B 3CVHL 1GOFA 1PY4A 4XC3H 5GHWH 4MJ5A 1PVHA 4N9GA 4XP1L 4GKOA 4TTDD 5DJZB 2HWZL 2APBA 3LKNA 5JIKA 2P5EE 1QBML 3L3HB 1JWUA 4L3AA 4YHLL 4ONOA 1ORSB 5JW4R 2DKSA 2HN7B 3NZHL 5E6ZA 2DJUA 2IBZX 3OGOE 4OCNC 5DUBA 4GQ9L 1MJJA 4KQ3L 3VFUA 1RULL 4Y2DB 3P4LA 5ICYB 5KSAC 4HKBB 2WIIB 4FQHB 3OKEB 2D3VA 4I5BB 5I73C 5FKPB 4ZD3L 3RUGA 4WEBH 1UXWA 2HRPL 1CLYL 5T33L 4KTEL 1T0PB 4DKEH 2HLFD 2DL9A 1AFVL 5D9SB 5C07A 4LEOB 4ZNEA 2DLIA 1AXTL 3UZEA 1PKQE 2Z8RA 2AK1H 4YWGL 2Y5TB 1CFTA 3GSNL 4JY4A 1HK6A 5IVOA 1A7RH 4Z8FH 4EN3C 1QSFE 1S7QB 43CAB 3IDIB 3QZWA 3VXTA 3P77B 1ZS8B 5I6XB 5CEZH 4LCIL 5J89A 5D1XD 3HNTL 1OOAA 3RDTA 3TH2T 3BPNB 5C09D 5F21B 5FA3A 4M7LH 1T83A 3UCRA 3DI2B 3CVIH 1RVFL 2FBOJ 2XN9B 3RTQC 5JHDD 3BD5A 3EJZD 2AQ2A 4HQQL 1DVFB 1A1NB 2NR6C 3ARTA 3EBAA 4I77H 4JN1L 5J1SC 3PP4L 4GRLB 4PP2B 1NL0H 1NKOA 1N0XH 4MQSB 1QACA 2P8LA 4PY7B 3VFSB 1NBVL 1H3TA 4YX2H 4MSWA 4OGXL 4QKXB 5HVHC 4N0FA 2VDNL 3O6LL 4LRIA 1IGJB 5SV3A 5H94B 3ROLA 2YHGA 1X4YA 1DDHB 2P49B 4XVSL 3V8CA 4N90E 1BAFH 2ZCLL 3W11C 4MHHI 5TH2B 4TSAH 1BZQK 3TN0B 2AJVL 4WU7A 1XAUA 4I9WE 1A14H 2OR7A 3IDGA 4R4BA 4P3CH 4X6DB 4P3DB 4XGZA 3OQ3B 4YC2B 2WBJB 3EIFA 1AD0A 3FQTB 2VN4A 3QUMB 1FNSL 1UKTA 4H5SB 4AL8L 5DJDB 3ULSB 4JFFD 2EIZB 4DKFL 3DETC 4K8RC 3VXQA 4X9FA 1A9EB 2GTZB 3PHOA 3UTQA 1VEOA 5D7JC 3CFCL 2KDGA 3LD8B 2RHEA 1KBGH 1U0QA 4LLVA 4UU9A 1I8KA 1W72A 5GGTA 1Q0YL 4G8GE 1NGYA 1U3HA 3CVHH 3NPZB 3MRGA 5DMYA 1NKRA 3REVA 3IXTA 3PL6C 1N8ZA 5GJSH 1BQHG 1FVDA 1Q9WB 2BNUA 4LGPB 3T0ED 5FO9A 1MCIA 2HWZH 3NIDE 4Y5VB 3KPRE 4XBPA 3PDGA 3U30B 1JGLL 4M7ZB 4YHLH 4PJAB 5E2VL 3NZHH 1BM3L 2R56H 4LPWA 3PNWB 1KIRA 4OZHB 4KQ3H 2VLRA 2CK2A 3GSVA 1D9KD 2WUBH 1K4DB 4NKDA 5LGHH 5SWSD 1R5VA 4YDIL 3KPMA 3P0YH 4OB5H 1JK8B 5EZJB 3G08B 5T1LA 1HH9A 1CLYH 2DQEL 1ZGLB 4L9LA 3X3FH 2GFBA 2WWMD 4QRSA 3ROOB 1AFVH 5HHOB 3HE6D 4TULL 2OQJA 3MRCA 4N0UA 4YWGH 1N3NA 4UQ3A 5TFSL 3HG1D 1JTTA 4MA3B 1G9MC 3GSOA 5I1HL 3OKNA 4GW4B 4U1SA 2JCCB 4Z7UF 1CXHA 3EOBB 4OZIE 2Z0BA 2QHLA 3D69B 1U92B 3F7VB 4W68A 3RDTC 1I1FB 4HC1L 2OX5A 2VZTA 3BDXA 3CUPB 4EDWH 1T83C 4FQLL 3IU3A 2PXYD 4LCIH 1J1PL 4ODSL 1FNGA 4DCQA 2PR4L 4N68A 1RZKL 4XT1C 1MUJB 3N1FC 3GIZH 2NY3D 4OAWA 4PJFB 2NY0D 5DD0H 3MXVH 1TPXB 2X4RB 4GUPB 5FYLL 1O7VA 4V1DD 4JN1H 3EYQD 1W8NA 3PP4H 4MDIB 1OAYH 4TYUA 4YBQC 3WDJA 3WKMH 3KJ6L 2XWTA 2E7LA 4LRIC 3BUYB 1ZHLA 1KXTB 4OGXH 4B0MM 1KXQE 4F80A 5CHNB 5L0QC 2VDNH 3O9WD 3O6LH 4H0HB 4LASL 5FYKL 1JZ4A 1MVUA 5ID0B 1FGNL 3JV5A 4XVSH 5HVFB 1GOHA 4HPYL 2ZCLH 4GMTL 4WEMB 5DO2D 1UZ8B 1EFXD 2VE6B 5D5ME 3S35L 1YQVL 4NRZB 5FF6B 4HBCL 3QH3A 2AJVH 5J11B 4OF0A 1G7QA 4GRMA 4NWTL 3A0OA 5DQ9A 4MD0A 4LCWE 2IH1B 1FVCA 2R9HC 1UB5B 4JJ5B 3STZB 2Q3ZA 3VXSE 1FNSH 3NCYP 2Z31A 4AL8H 3AM8A 4O00A 4DOHE 4A6YL 1WIPA 3D2UA 5EBGA 2RJMA 5EO0B 2WM0A 4LAJH 3V0WL 4HUWB 1U3HC 3CFCH 1XGYH 5F93C 4PJ5A 2VXQH 2FL5B 4J4PA 1UJTA 4MMXC 3HE7D 4PGDA 4OFPA 2CKBA 1Q0YH 4FXGA 3BO8A 1OL0A 2L4OA 4HCRL 3QWOB 4PBXA 5BMFL 4LNVA 1ZLUH 1EJ6A 3TNNA 2C9AA 1MQKL 2WUCL 4D9QE 5F70A 1OB1A 4Q6IA 3IDMA 3QEHB 2O61B 2UY6A 1BM3H 1UADC 4S10A 5MHSD 5EIQA 1T3FB 1DBKL 5C6TL 3VXUB 1KJMB 5CGMA 1W0WA 4PRIE 4YDIH 5EU7E 5GZOC 3Q6FB 3BW9A 4P3WA 1VFOA 3GMPA 3PQYE 5E0QA 3KXFA 3AU1B 4NM4L 1A7QL 2E8ZA 4TULH 5CSGA 3E6FB 5A2KH 1AH1A 5E5RB 4Q2ZB 3ARBC 4BFIA 1A64A 5TFSH 1YMHA 4RDQF 3W39B 3GMNB 5HHXH 2Z8VC 3L3OA 3QUYC 5I1HH 1FIGL 3IU4L 2PYFB 3X12B 1FHGA 1OAQL 4NCDA 1LDPH 1DQJA 1FYTB 4IDLA 4PRDA 5A2JH 2Z91A 4G8GA 1J1PH 4LHUA 1DQTA 2IALA 4NNXA 2DMBA 1RZKH 2LE9A 3FQWA 1IL1B 4D9LL 3C5SB 4LIQE 1HHKB 1RAMA 4EEEA 3GRWA 4XAKD 3WO3B 4KKCD 1G6RL 2VTFA 3SGKA 5CZVL 4L8CA 2F5AL 3EHBC 3SDYL 3B2UD 1OQXA 3NZ8B 4OCMC 4JFOB 2K7QA 5FYLH 5T3XD 1AO7A 5D2LF 5GGVY 2FO1A 4MD5B 1IKNA 2Y36L 4BA8A 4Z7QE 3KJ6H 2DOCA 2AXGA 5EU4B 5AZ2L 1IM9A 4FHBD 1KB9J 2LFGA 3BXNA 3ZKXB 3I75A 5F1IA 3LRSA 2OMNA 4DTGL 5KVGL 3HC4L 5D93B 2IAMA 3RFZC 1U8OB 4OCSL 2XZQL 3RP1A 2CUMA 5DHVA 3WE6A 2YZ8A 2PYEA 4HK3N 3BJLA 4HPYH 3O45B 4GMTH 3HUJE 4OI8A 4BSJA 2CH8A 1AKJA 4HBCH 3P30L 2RCSL 5DUPL 3V2AR 4NWTH 1UACH 5FUZL 4GW1B 1ZLUK 3MLTB 3H9SE 4ZSOA 1HQRB 2YUXA 1NCNA 3HRZB 2Z31C 3AM8C 3MRBB 2AXHA 3FQNA 2G5RA 3PXJA 4OSUL 4U6HB 4ZUVA 3FT3A 2EDYA 4UTBL 1U8IB 1MCKA 1J0IA 4M7KH 5I1EL 4YGVB 4A6YH 3OX8A 4MAYB 3QPQC 2ID5A 2C1OA 3ARYA 4J4PC 5TE7H 1MFCL 4F7PB 2DQFB 2VDLH 4KWUA 5DD6B 3EFFA 2VDOL 4TSCL 3U0PB 1X7QA 1A6AB 1ZOXA 1XGTA 3MJ7A 4PUBL 1UM5H 2ORBH 4HCRH 4WENB 5AYUH 1R3HA 3UPRB 4R97B 5T3ZD 4AT6A 5BMFH 1HDMA 1D6VL 3HC0B 3FQRB 1U58B 3RVUD 3P4OA 4XVTH 1S78D 5IW1B 1MQKH 5DI8A 2A73B 4ODUA 3BEVA 2B1HH 1QR4A 2A0LC 1P7HL 5E08H 1T4KA 4OLWL 4RGNB 3S5LA 3RRQA 2CDGB 3MBED 2EE2A 1DBKH 5C6TH 2HFTA 3OTTA 3P40A 5BV7L 3QA3A 3HS0B 5ERWB 4XNXL 3CH1A 4XRCA 4FQ2H 4FQXA 1SJEB 5CD3A 4JHWL 4UUJA 2Q20A 3HHRB 1MCCA 3VA6A 4GG8A 4HIJB 1WBXB 3KHOA 4LCWA 1FN4B 3B6SA 1A7QH 1A7NL 5DQDH 1GGYA 1QO3B 1FJ1A 5J6GA 2ATPA 1KCRL 1JGDA 1H15A 3Q5TA 4KK8D 1F8TL 3L5JA 3KDMB 1BIIA 5JDJA 3ARFB 1FIGH 1XT5A 3RWDA 1OAQH 1NFIA 1EO7A 4JFDB 1A2YB 3DMMA 1J0ZA 4I18B 4DN4H 3H7BA 2VXTL 4PJ9D 1NCTA 4WCYH 3DIFB 3RGVC 5DK0A 3C08L 4LCYA 3SGKC 4PYHA 3TCXA 3T4AA 5AAWA 1RUKL 2BDNH 3MRKB 2VXUH 4ODXB 4XXCA 5CP3H 3NOIA 1KLGA 3SDYH 4EI5B 5HYSG 2Y6SD 4MXVE 2Q3AA 1IKNC 5INCB 3GJFB 2BC4B 3KPPB 4JANA 1BZ9A 4UBDC 1OP3K 2A9NH 1B0RB 3MRFA 2ARJA 3EYSL 2GJJA 2ZJSH 3SY0A 5DEGA 5DVKA 4NZJA 3ILPB 5CGYD 4ZUWB 2IAMC 3BRDA 4G80A 2R1XB 3HC4H 2RIKA 5GGRB 4AH2A 5E24E 1JZ3A 2WAHA 4Z78A 3L3GA 3L5WB 4Q0XL 1HINL 4K8RH 2BY3A 5ITBL 2R8SL 4GG6B 3PQYA 3MLVL 2XTJE 1T03L 3BP6A 3EJYD 5LG1A 2CO7B 1QBLH 1TDQA 4KDVA 4R7DA 4I2XE 1A7PL 3NCYS 1FL5B 4DJMA 5DUPH 3O3EB 1MFBL 1KEGL 5FUZH 4I0PA 5SWQB 2J6EA 3BZEA 5KSVB 3WL9B 3U0WL 2NXYD 1Y18A 1FNEB 2VSDA 3K1DA 5FM4A 4BH7B 4U1MB 3RAJL 4OSUH 4UTBH 5A1AA 4J3SA 5E2WH 1XCTB 4K9EC 3VXNB 5I1EH 3HZVA 3PGFH 4HDIA 5ISZD 1R3LB 5D7LE 3VE0B 3VI3F 4NO2A 5LGJA 1MFCH 1T1WB 4ZPTA 3NN8B 3D39D 1CQYA 4NRXA 2VLKA 4MJ2A 3ZDYF 5IOPB 2VDOH 5IGXH 1N0LA 4IOFD 5DJ8A 1U8HB 2H9GA 3K8MA 4PUBH 1S5HB 5HTSA 4OQTH 3IRZA 3TNMA 5IWLA 3KPQA 1R5WB 4TNWK 1MCRA 4G8FA 3TBSB 4PLNC 4JFXB 5EU5B 4CW1A 3VWKA 2KH2B 4XPHL 3SKUD 4QXWA 5DHXB 3FHAA 1F90L 3QT2A 4P4RA 4KUCF 4OLWH 4ETYA 4WI5A 4B50A 2GAZA 3ILQD 2FR4B 4BQ8A 2M26A 1G9MH 4ODHL 3DLQR 3TA3D 4ELKB 4FQXC 1JHKL 2F8VA 4TNVK 4O4YL 1CR9L 1XIWA 4XMPL 2P42B 1RY7B 4PJBA 4YDJA 4OZFH 1NC4B 4UOW1 4U6YB 4WUUD 3H9SA 3LVEA 1JCKA 4G8EB 3DROA 4GBXB 4OV5A 1A7NH 2CO6B 2J12B 5D96C 4ZAKD 4M1CC 3SGEH 4XP4H 1W0YT 4MS8C 4L4JA 5E2TL 5IMKA 3LEVH 1F8TH 1T2QL 3TO4A 1JYNA 3DMMC 5IMOB 3EO9H 1JTOA 5ID1A 4YHPB 1NC2A 3VG0L 2VXTH 5H2BB 5GGQH 3PIQA 4XXCC 4NN5B 2GK0B 3C08H 1FFPB 4WY7L 1KV3A 3JV4B 4UAOB 3SDXF 3MMEA 4ODVL 1HOCB 4TNWF 3DYPA 4YHYB 4LLYB 1GOGA 3C9NB 1YEDB 3BSZL 3UJIH 4LSDA 3KYAA 1WQVT 2R2BB 3HCVA 3L9RA 1AI1H 1FGVL 1ZHNB 1R3IL 1H9VA 1OSZB 3TBYB 1WSST 1Q9OA 2WSKA 4KRPB 4JRXD 2C7UA 3RHWK 4ZTPH 4FQCL 1J8HA 5GSRA 5F7DB 4TNVF 5HHQB 1HINH 5ITBH 3NMEA 1N26A 2N7BA 5GGTH 1T03H 1FPTL 3FOLB 1TIUA 2B0SL 4ZS6C 4Y4KA 2WQ8A 3B9KA 1A7PH 2JELL 3W9DB 5HPMA 1HWGB 5BJTB 4FFZL 2AJXL 5CLTA 5ANMA 1OW0A 2H3NA 4XVUD 5D6CA 5T1MA 4QGYA 5CJQH 4HWNA 3RAJH 1HILB 1K8IA 4E5XA 2EYTA 5CD5C 2M8XA 2FH6A 2IMNA 1ZT7A 2X4SA 1TJIL 2COQA 2QADD 2VXVL 1SJHB 3DRQA 4HWBA 1NEUA 1XGRB 4N0RA 5H37H 3MRIB 4XNUL 3MGTA 3PGCB 1OTUD 3H3PH 2P8PA 4XCFL 3PABA 4LSUL 3QI9A 1YN7B 2A6IB 2E27H 4O2EB 2ERJC 3VWKC 3ZKNC 3PWPE 2B4CL 3UXFA 5C0BD 3RHWF 1KTKE 3QR2A 2C3XA 2XKNB 3PJSB 4PRBA 2NW2A 3VFWB 4Y1AB 1I7TA 3RVXD 1OPGH 1F6FB 4XCEB 3MLXH 2BSTA 3NFNB 4PJCB 3JBG7 4LVHC 1F02I 1MHHB 4ODHH 5F7YC 1ITBB 3V5KA 2KL6A 1T1ZB 1S7VB 4JPVH 1JHKH 3VGDA 1CR9H 5F88A 4PJIB 4MQ7B 5FECA 5F9WB 4XMPH 3C60D 3SGJA 1GIGH 4MX7B 3GKZA 4OLXL 4AMKL 5J56B 3CIQA 1HXMB 5EZLA 3CD4A 2W0KA 2NY2C 4K94C 5ACZB 1IEBB 1T5XA 3UTPE 3MJ9H 4LLDB 3TO4C 4PV8B 4U0QB 4GS7C 1CFNA 1D5BA 1HZHL 4GAJH 1T2QH 3CLEH 4JG1L 3WJJA 5D7LA 4P5MB 5T5NF 2DQHH 1R5IA 1TZGH 1JF5A 5C0EB 2FBJH 3VG0H 5ICZA 4OTXL 1OD9A 1VGKB 5IB4B 1S9WB 4WY7H 3SKNB 1MLBB 3FO0H 1QFHA 3GNML 5I1LB 4HC1A 2I07A 3CC5B 1GZQB 4ODVH 5GS2D 5TDPB 3F12A 2X44D 4MXQC 4CVZA 1HYRC 2HKHL 4C57C 5KSAB 1GGIH 1EZVY 2P5WB 5C09E 3BSZH 2H8PB 4XCYA 2JB5H 2LTQC 3WS3B 1PYWB 1MWAL 1R3IH 3T09A 5L6YL 2VR4A 3UTSE 4M6ML 5K9JL 3TZVA 5IG7B 5FDYA 1E28B 5HHPA 3QDJB 4NHCL 1FL6A 5DDHA 2YA2A 4FQCH 3O2DA 4RZCA 1NCUA 3ARGB 3MLZH 3REWA 1FL3A 4JFEA 5DWUL 1RUMH 3LKRA 3W2DH 1HH6B 3EO0B 4P9HL 5GGUB 1BWMA 1QYGL 3WNLA 3V6OE 3MV8B 2I5YH 3FN9A 2B0SH 5HHMB 4PS4L 1HSBA 5JORA 4P59L 1MJ7L 3WNMA 1K85A 1OW0C 1FNAA 1QRND 4LHQB 1NCDL 4QNPF 5KZCB 4YAQB 4FFZH 2AJXH 2JJTA 4F33B 2AP2A 1M7IB 1OGAE 1XGUB 2YPLB 1C8PA 3MA7A 4PJHE 1JPFB 5MEOA 4JFHD 2VKXA 3RTQB 1TCMA 4ZUUA 5J13C 2BY0A 3SBWC 3N1QC 1VACB 2VDQH 2VXVH 2A6KA 4JFFE 3F65A 5LAXA 1I7UB 1DUYA 2YWYA 3QI9C 3JWDC 5HVHB 1A5FL 2X70A 4MVBD 4ZDHA 4LLQA 3GDBA 2L0DA 3CFBB 4LSUH 3B5HA 4IRSA 4G6KL 5HYJD 2EYSA 2B4CH 3CNKA 5IHZB 4YFDB 1T6VN 4ENED 5SWZB 2ZSWB 4P46A 4WWID 2XTJC 3FFCB 5DD1L 4JEGB 3S35X 3VXRB 3S3PA 4ZFOB 4DGYH 2DDQL 4XZUB 4IS6B 3FZUC 4HKZB 3K0WA 1TZHA 3VD9A 3D3VE 5IKCB 5DJAB 3EDDA 3VXOA 1TVHB 3CK0L 4EXKA 5A3IC 3BMWA 5DZLA 3EGSA 1M05B 1N5AA 1YMMD 5GRWA 4JM2D 4AMKH 1KEML 4HHAB 2R39A 3WLBB 1DQQA 4WHTB 4TVPE 1G0XA 5D7JB 5E1HB 5TF0A 1OCWH 2AJZB 1V3LA 4RAVA 3WJJC 1NGWA 1X9QA 2FEEI 1HZHH 3ZTJH 4JG1H 3CFEA 1DE4A 4MJ5B 4N9GB 3VU2A 1QFWM 1UC6A 1JUFA 3LKNB 2DM2A 3IFNL 5B4MC 3TYGL 1IVLA 2FD6H 5I15H 1JWUB 3SGDH 2EDOA 4OTXH 1A4KA 5DHVH 5DUBB 1Q72L 1MJJB 1E4XH 3GNMH 3VFUB 3ARDD 3RU8H 1PX4A 2KKQA 5BZDA 4R4FH 1KF9B 2HKHH 3BJ91 1F4YL 3PUCA 3IXAA 3LEYH 3RUGB 1UXWB 2OXGA 3GBNL 5IVXE 5C6WH 1MWAH 4YBHA 3T0BA 1KB9K 2V17L 5L6YH 4M6MH 1RJYA 5K9JH 3MREA 4YJZL 4NHCH 1QP1A 1PG7L 5C07B 3LZFL 4NOBA 1CFTB 2BSED 5DWUH 4JY4B 3S4SA 1BX2A 4ZO8A 4U3CA 4LIQL 1F58L 4H20H 4KPHH 1QYGH 4AIXA 8FABA 1FNFA 4LQFL 5M7QA 1K6QL 2HT2C 3QZWB 3VXTB 5DC0A 4LPXA 4LPVA 2VQUA 3RDTB 2JJTC 2Y4SA 1MJ7H 5FA3B 4OKDA 1NCDH 5JW4Q 5D72L 5F7EH 5C0ND 3E2HC 1WT5A 3RJDA 4DK6A 4L1HA 3SGEI 4QGTA 4G43A 3EFDL 3ZO0A 1SEQL 4K07A 3TIDA 2NZ9C 3TFKC 1T7XA 2E7MA 3VFGH 1JMXA 1YEJL 1ACZA 4JO4H 4M1DL 2P8LB 4MSWB 4FS0A 4N0FB 5BS0D 3HAEH 1JE6A 3MV7D 5EUKA 4D8PA 5D1XA 3ZLQC 4J8RA 3O41A 4Z7VA 3ROLB 1A5FH 4IRSC 5C09A 5L0QB 5J7CC 5KVDH 1LO4L 5E4IA 5DFVD 1HIML 1KCSL 5HI5C 5JHDA 3C6SA 2IPKA 3OKLA 4P46C 3BGFC 1JPGA 1R3JA 4WU7B 1U42A 3U4EA 4L8BA 4JFYA 4XP6L 3VGBA 2DTMH 4R4BB 5DD1H 3U7AA 4XGZB 1ULVA 1AD0B 3V6OA 3T65A 4U6TA 4XP5L 1TCRA 1I7RA 3JWOC 2VLJE 3CK0H 3VXQB 1UCTA 3PHOB 2R2CA 4GRWB 3UTQB 3MRMA 4ALAL 4H25A 1MCPL 3N50A 2D31A 3C5ZD 4LLVB 3OZ9L 4UU9B 5ALBL 1I8KB 1W72B 2F19H 4YHOL 4KI5D 1NGYB 1U3HB 3ZT6A 3TV3L 4X6FA 3MRGB 4FQIL 2WWKT 4ESKA 5K9KA 5DZOA 3REVB 2XPGA 2Y72A 1N8ZB 1FVDB 2BNUB 5FO9B 3WIIL 4J6RL 3IFNH 3AMLA 1KIPA 4XBPB 3TYGH 1EHXA 4G9FD 4JFFA 4RFOH 3AB0C 4LSVL 3NIDF 4JPWH 2I60L 3LB6C 2CRMA 1KIRB 1FG9C 1A8JH 3WLWD 4NZTL 4U1GC 2D0GA 4EZMA 2VLRB 3GSVB 2EDJA 4NKDB 1R5VB 3DGGA 1I3GL 3TT1L 3KPMB 2EDWA 5IHUH 5IQ7L 4NQDD 4WUKL 2ZNWA 1G7LA 4TTDC 1XF4A 2I26N 3GBNH 5T1LB 1JWSA 1HH9B 2J6EH 4XVJH 5GGRY 1G84A 3T0EA 2FECI 1ED3A 3GO1H 4L9LB 2GFBB 2CLRA 4QRSB 4S2SA 1B0WA 1PG7H 2BJML 2OQJB 3BPOB 4MD4A 1RUAL 3MRCB 4N0UB 3LZFH 5B39G 1EX0A 1N3NB 3RZCD 4UQ3B 5DFTA 4X8XA 3B9EA 1IGCL 2EXYD 3GSOB 4F15C 3OKNB 4U1SB 2PTUA 4LIQH 1ZANL 1D9KA 5SWSA 3R4DA 1EO8L 3ULVE 4LQFH 1CE6A 4YHZL 2NY1C 5KTEL 5HDLA 2D7TL 2A9MH 5HYQA 4YK4C 3IU3B 4OZIF 1FNGB 2C3WA 2HLFC 3RVTD 4DCQB 2UVEA 4G3YL 2ICES 1WT5C 4MNGE 2ZG1A 4JJHA 5D72H 4OAWB 3HE6A 2V9QA 3GSWA 4NFCA 4LU5L 3EFDH 3HG1A 1SEQH 3O11A 4QHLA 2I27N 1CFQA 4NO5A 3KYNA 2XWTB 4M1DH 5D1XC 1ZHLB 1KYOJ 1J1OL 4MNQD 1HHIA 2PXYA 5E6IC 3SCMD 2BNRD 2Q7YA 4DWHA 1MVUB 1A1OA 5JR1H 1LO4H 2OJZL 3U9PH 1MI5E 4WFHE 3IFLL 1HIMH 3HR6A 4ZYKA 3T3PE 5C2BL 1FORL 1B0GA 1BIHA 3UYRL 4V1DA 3C2AL 3BDYL 4K94H 3QH3B 4OJFL 1G7QB 5I18L 4GRMB 1X5GA 4XP6H 5D5MF 1INDL 3F6LA 3IJSA 4TQEL 4AQOA 5DQ9B 4E41D 5I1AA 1KJ2A 4MD0B 3V6OC 1FVCB 3QPXH 1ZGLM 3C6LD 1V3KA 1LE9A 3ZDXE 3LQAL 4LPCA 2E7BA 3O9WA 1XF2A 1O5DT 4CVUA 4XP5H 1HKFA 3WFHA 2Z31B 3D18A 4ZG1A 5DJXA 4MA7L 3D2UB 4KV5E 4PJXF 1EFXA 1FRGL 5HXMA 1NAML 4PJ5B 3OZ9H 1OTTC 5ALBH 4YHOH 4PGDB 2CKBB 4FXGB 3BO8B 1FFRA 3TV3H 4KTDL 4FQIH 3PWVA 5M95B 1GGCL 1U91A 3EUUA 2GQHA 3TNNB 1UKQA 4JVUA 3QZWG 1OB1B 1X5JA 4Q6IB 1ZWIA 4LSVH 1LO0L 3IDMB 1EHLL 3ARED 4GW5A 4GAGL 4W70A 2XACC 3S3JA 4UILL 2BMKA 1W0WB 3G9VA 3HE7A 2P44B 1DN2A 1X5YA 3BW9B 3KYKL 5J0BA 4WUKH 4JVPA 3T0EC 1WJ3A 1ZEAL 2A74A 3K74B 3GMPB 5T1KD 1F4XL 3KXFB 4PJGA 3NGBC 4I3RL 4YBLC 1XZ0A 2HLAA 4LGRB 4MMZC 5TF1L 4JRYD 4Z18A 4YHIA 4X8JA 1I8IA 2O5YL 4BFIB 5FGCE 1H0DA 1D9KC 1YMHB 1KTLA 2C26A 4FP8L 5HI3D 3ZSSA 4YHKL 3MRRA 1D3CA 3L3OB 1BBDL 3MOQA 3WYRA 1ZANH 2HFFA 4NM8L 3NH7L 1DQJB 5I74B 4UTAL 1OQOA 4K7PH 4MNHA 4PRDB 5KTEH 3UC0L 2DLGA 2Z91B 1A9BA 1L7TL 4G8GB 3DXAE 4HMCA 2V2TA 2WWMC 4LHUB 2IALB 4NNXB 3HE6C 1BQLL 1AGFA 4M62L 1MRDL 3FQWB 1IILE 5F9AC 2YMXL 2IPUK 3B43A 3MA9H 3PHSA 4L8CB 2D7NA 4Q9QL 2EE9A 4HH9A 2CLZA 2G60L 1AO7B 1S9XA 5CGTA 5C9KA 1JI2A 3GHBL 5D8JL 1P7QD 1MAKA 1FZKA 4M5ZH 3QEUA 2PXYC 1UFUA 5GRXG 1VFAA 2AXGB 5F8QC 4PRNA 4CJ0A 1IM9B 4WO4D 5IP4A 4Z7QF 3BXNB 3KAAA 3I75B 5F1IB 3LRSB 3ZYJA 2NY3C 5L9DH 2IAMB 5DA0B 3EJJX 3JWOL 1E4XI 5DHVB 2LU4A 2NY0C 3D39E 3NPSB 3WE6B 2PYEB 4LSQL 1CD1A 3EYQC 5C2BH 2YUZA 4QXTA 1T2JA 5F44A 1AKJB 4XAWL 3BDYH 4OJFH 3BZDA 5I18H 1YEGL 4NRYA 5GRUH 3HUJF 1CGYA 3O9WC 2PNDA 4ZSOB 4N8CL 1MPAL 3I3EA 4J2XA 2HVKA 2D7OA 1W0VA 3FQNB 4IMLA 1G9NC 4ZUVB 3FT3B 3SDDD 3Q6GH 2FYYA 4OLUL 2IMMA 2XOTA 3OX8B 4PPTA 4FZEH 5DO2C 3C8HA 5DJ0A 3UAJD 2C1OB 4MNGA 4JB9L 5ESAA 4UT9L 1FRGH 3H7LA 3EFFB 5F89A 3TF7C 1X7QB 3OL2A 4RAHA 1MY7A 1QQDA 1XGTB 2AJ3A 3X3GL 3MJ7B 1DBBH 4IOIA 1VGEL 5TDOA 4YXHH 1R3HB 5C0CE 2NMSA 4AT6B 3WIHA 1GGCH 4K71C 1HDMB 4XPBL 3PV7A 3P4OB 3UJTL 3O2DH 3PP3H 4EUPA 4J3TA 5DI8B 3FOMA 4EIGB 4ODUB 1YJDC 2V9TA 3BRFA 3OXRB 4NNPL 1I7ZA 3BEVB 4MZ2A 1H3VA 4GAGH 1T4KB 3S5LB 3HE7C 5F97E 3T0XA 3J7HA 1CTNA 3KLHD 1CFBA 4UILH 4P2RD 1LK2A 2ED9A 3QA3B 1UH2A 4W81A 4WW1A 3CH1B 3KYKH 4XRCB 4FQXB 5CD3B 1I85A 3T2NL 4UUJB 4NIKB 3IDJA 1J8KA 4MWFA 4GG8B 2NY7H 3BEWA 5J8OA 4LCWB 2R1YA 1F4XH 3B6SB 1A1MA 4KTYA 4XMLL 4I3RH 3T1FA 4X7DC 1FJ1B 5J6GB 4FFWD 2ATPB 2O5YH 4HXAL 4WRLA 3ZTNH 3FAXA 1JGDB 1H15B 4FP8H 3B4NA 3MBEA 4XMKH 1BIIB 1BBDH 1OVZA 1MCBA 3RWDB 4G6AD 4JRXE 3LIZH 1NFIB 3NH7H 4NM8H 3ESUF 1NMCB 1QHPA 3B2VL 3NCEB 4UTAH 3F8UB 1MHEA 3H7BB 3UC0H 4HFWA 2GITA 4Y5YA 4Y4HC 5JDSB 1JZ2A 2H32A 4FNLL 2M2DA 5DK0B 4LSPH 1OTSD 4LCYB 2XNAA 5FYJD 3T4AB 4M62H 1MRDH 3CCHA 4RISL 2BSRA 5AUMB 1S7XA 3FN0H 4Q9QH 4EJ1C 2FJFA 3O3DA 3UYPA 1KLGB 4PP1D 1GRWA 1OSPH 1YPZA 5IBLD 2G60H 1BOGA 4FTVD 4JANB 4U2ZA 1BZ9B 3MRFB 4MXVF 5D8JH 2ARJB 4NQCD 4NFBA 3SY0B 5DEGB 1LEIA 2R29L 2WINA 3AY4C 1QNZL 1CBVL 2R2EA 1P6FA 4PJ9A 4G80B 3LEXB 4KKCC 2HJKA 4AH2B 1LP9A 3LH2H 4Z78B 3JWOH 3L3GB 1L4IA 3B2UC 4CU7A 5KJRL 3PQYB 1GH7A 4LSQH 2V5TA 2OZ4A 5EOTA 3BP6B 1KT2A 1LDSA 1ZLVH 1ZA6A 1UCBL 4R7DB 1VENA 4OGYL 4I0PB 3ULVC 3WUWG 3BZEB 3MSPA 3C87A 4G6JL 1Y18B 2CIKA 4HXBL 4S1SL 3ZKMD 1TJGL 4TRPH 3HN3A 3GBMH 1HHGA 5HHMD 3HZVB 2X09A 4HDIB 4U0RC 3AC0A 5D7SL 3P73A 4NO2B 4JB9H 3WHXA 4ZPTB 5LGJB 4UT9H 1NLDL 5KZCD 3KJ4C 2N4IA 2VLKB 4NRXB 2X4PA 3MZGB 5JUEL 4MB4A 4H88H 5DJ8B 2H9GB 5KS9A 3TM6A 4XH2B 2ZUWA 3TNMB 4G7VL 1F3DJ 3KPQB 2NXZC 3ZKSD 5AG8A 4G8FB 1KSRA 5EC1A 3UJTH 4KAQL 4PJEA 1MCLA 4C56A 2EZ0D 4CW1B 5ICXA 3VWKB 2ERJB 1CDUA 1UWEH 3VH8G 4M4RA 5ISZA 1H3GA 1MNUL 4JY5L 1RZJC 3IDUA 4P4RB 4LHUG 5I1CH 4J3OC 2GAZB 2O5XH 2W1NA 3CLFL 1U9KA 1RJLA 4O58L 4ONGL 1TQBC 4TVPL 1I85C 4LVHB 2ATKA 1XIWB 4TPRL 3T2NH 5L8LB 3RVUC 4PJBB 4YDJB 1S78C 3BN3B 4MB5A 3VWJD 1YEEL 1NANH 1UH3A 4OV5B 3DROB 4EDXA 3D9AH 4XMLH 3OBAA 3MBEC 2V6HA 2AGJL 2NY2B 4HT1L 3SOBL 1A4JA 5IMKB 1HWHB 3TO4B 4OZHE 4G5ZL 2V2XA 4GS7B 4LGSB 3TA3A 4Y5YC 3BD3A 3L7FA 3B2VH 1RK1A 2X4QA 2Y25A 5ID1B 4MGXA 5HGGS 1NC2B 1MREH 4YFLF 3PIQB 1FLRH 4FNLH 4BYHA 4X83A 4WUUA 4PY8I 4POZD 1MHCA 1UKSA 1ZLVK 4LDEB 3MMEB 3QDGD 5HHOE 4ZAKA 4PBWD 4KK8C 4P49A 1P84K 4LCCC 1JHLL 4WHYG 1DEEA 2G9HA 1YEIH 2YPVL 3HCVB 3L9RB 2MQCA 3K46A 2JCCE 2VJXA 1S3KL 4PJ9C 4PREA 4WW2A 3WDIA 4S1RL 1Q9OB 2LTQB 1B9ZA 2E9BA 1NBZA 2C7UB 1I3UA 4JKPL 2LQRA 1QNZH 1CBVH 1J8HB 2HH0H 5GSRB 1T0NA 1BMGA 3ZMRA 5DURB 4YE4L 3BMVA 1B6UA 1C5CH 1PG7X 3LY6A 4R26L 2Y6SC 2IFGA 3S7GA 2FJHA 4BZYA 4PJFE 1BREA 2NY6D 1S7TA 1M1SA 3VRIA 4Y4KB 3B9KB 1QG3A 1UCBH 3M8OL 5HPMB 1PG7W 1CK0H 3FRPA 1G7PA 3S5LG 2H45A 1BFVL 2BVPA 4G6JH 5ANMB 2H3NB 3IF1A 1SEBA 5D6CB 4JRXA 2UZIL 2DQUL 5T1MB 1G9EA 4ZO6A 2VXSL 3T4YA 3ZL4L 1MOEA 3L3KA 4RIRA 5JXEC 1K8IB 4QHNA 1GGTA 5JIIA 4E5XB 2EYTB 3EJYC 4U1LA 2OR8A 4XNYH 3SDAC 1F6LL 1NLDH 1ZT7B 5D71H 2X4SB 5AG9A 1NGPL 4RMTA 5JUEH 3DRQB 4NZDA 3CDGA 4XBEH 4D0CA 1G1CA 2ITCA 1RIHL 3MGTB 4IOSD 2NXYC 1YMME 2P8PB 4KHTH 5AYQA 2YS4A 1NCBL 3PABB 3DTXA 3QI9B 1QOKA 4G7VH 5JO5A 3KGRA 1M4KA 3SDCD 2QLVB 2CGRH 3OR6A 1C1EH 4PRBB 2NW2B 3GI8H 3FTGB 1KJ3L 1T6WA 3MBXH 3QEGL 1I7TB 4RX4D 2BSTB 1BFTA 1DFBL 4ONGH 1UYWH 2XTJB 2DYPD 3V5KB 4TVPH 1RIUL 4HWEH 2RAMA 5F88B 3ME0A 4TPRH 5C6PB 5FECB 4P0DA 4WI4A 5FHAH 4GQPH 3D85D 1K8DA 3NCMA 5DYOA 3QFJD 5EZLB 4IJ3C 2OI9C 5C0BA 1TNMA 3GSQA 5GRVL 1T5XB 2GUOA 5BVJA 1L7IL 4Y2OA 3ILQC 3QCTH 4K3DL 4HT1H 43C9A 1CFNB 4N0CD 3F7YA 1D5BB 3QCVH 4WI3A 5SX5H 3SOBH 2ZWLT 3TBTA 5I1IL 4G5ZH 2FO4A 5D7LB 1KB5A 3H3BC 1AGEA 1R5IB 3CAFA 1ERNA 5MI0C 2YPKA 4K55A 1SY6L 3T8XA 1GC1L 5ICZB 3QUZD 3C60A 1BWWA 2ZUUA 4ZAKC 5HDQL 2CK0L 4P3DA 1IKFL 2I07B 1JF1A 3QUXD 1Q1JL 4HUKB 3F12B 4F8TA 1DQML 4CVZB 1W8OA 2JJSC 1IM3A 4QF1A 2YPVH 1AJ7L 4WW2C 4XCYB 3SE8L 2FGZA 1KJ2H 3WFDH 4DGVL 4G9DA 3DHMA 1L0QA 3OHXA 4QYOA 3TZVB 1RMFL 3KPSA 3ULVL 4S1RH 1FYTE 1Z3GL 5HHPB 5MEPA 1FL6B 5MP6L 5DDHB 4RZCB 3HMWL 4JKPH 1DLHA 5GZND 1FC2D 3REWB 1FL3B 4JFEB 1NFKA 1IT9L 3LKRB 3OJMB 2GY7B 4YE4H 4R26H 5GGSA 4DZBA 4NUGL 2KZ1B 3MV7E 2W92A 1P4IL 5ILTH 2DQGL 4WHCA 3EOYG 4YFEA 4J12A 1HSBB 5JORB 1OF2A 5BW7A 4H8WC 4FRWA 4KK9D 3PNWA 4YFLI 3HZMA 3ZE2E 5ECJE 1NSNL 3DX9A 4KVCL 2VXSH 3MA7B 1ONQA 3ZL4H 5MEOB 4M6AA 1BVLA 5CZXD 3E2HB 4F7TA 1YJDH 3DUSA 4UOW0 4RDQG 5GISH 4PJHF 4ZUUB 5GRJH 3A67L 1RZJL 3QHZL 1OM3H 1IC4L 4NSKA 3JTSA 1NGPH 3N1GC 2A6KB 2DBJA 4OGZA 1JYWA 2FIKA 3JXAA 3RL2A 2DQJL 5LAXB 1NGXA 1DUYB 5L88L 2F53D 3CSPA 2X70B 4ZDHB 1RIHH 3SQOL 1QRNA 4LLQB 4XVUC 4D94A 1P4LA 1NAMA 1FFQA 1IQWL 4KQ4L 1NCBH 1Q0XL 2OTWA 1GZPA 2JCCA 4IRSB 4HGMA 5LVEA 5HGAA 4NKIL 2EYSB 5SX5K 1U92A 4KI5E 1TNNA 5T1DH 5JXAH 3PDOA 5GGVL 3BPNC 2WP3T 5A2FA 5E9DD 3BKCL 5EPMA 4P46B 3QEGH 2MCPH 3BGFB 2QADC 4DVBA 4WGWB 1LD9A 3DV4A 3P4MA 3NFPA 4HEPG 2RR3A 1DFBH 4YDLC 1H8NA 5JW4N 2VISA 4G9FE 1DVFC 1RIUH 1TZHB 4FABH 2EH8L 2NYYD 3VXOB 1K9TA 3RIAF 3HLAA 2VN7A 3EGSB 2W9LA 1N5AB 2ZUTA 1DANT 5HYJA 5F9JA 4X5WA 4HLZH 1DQQB 2DWEA 3RVXC 3E8UH 4EBQH 1L7IH 1CLOH 1T0MA 1JPTL 2NX5D 4RAVB 5JOPD 3BISA 1NGWB 2JIXD 3BIAX 3G6JF 4O2CA 4BELD 4RGNE 3HNSH 4XPGL 1KN4L 3CFEB 3VRJA 4YDKH 5I1IH 1DE4B 2DM4A 4P2OD 1CS6A 1JUFB 1T1XA 1JNJA 2WWKO 3C60C 1WWWX 1SY6H 4YXLL 1LO2L 3EYOA 5EO9A 1Y6KR 4PBVC 1GC1H 5EORL 1A4KB 1LEKA 4BK5A 3QYCA 3TO2A 4R2GD 1YMMA 4JM2A 3EAKA 2CK0H 4AYFA 1I9JL 1P7KA 3BPCB 1FCGA 4U1GB 5BZDB 5HYSA 4KGLA 2DS4A 5AEAA 3LKOA 1DSFL 2VNCA 1MHPL 4X5LA 3IXAB 2D2OA 4NQXA 4WVRA 5E8DH 4UDUA 5HDOA 1TETL 1RJYB 3MREB 1RMFH 2D7MA 3ULVH 4JFDE 1Z3GH 1EBAA 5IVXF 2HTKC 3HI6L 3HMWH 4RWYH 3NCBB 3S4SB 1BX2B 2C4FT 1NEZA 2E7CA 3H2WA 4HJ0C 3FJTA 4WWKD 3ARDA 1I9EA 3G5ZA 8FABB 3ESVF 4HS3A 4F15B 5ITFA 1P4IH 5BW7C 4J3XA 2BNRE 3KWWA 1UEMA 1X5HA 4MLSA 4OLVH 1INEL 1PSKH 3VFTA 5EDXA 3THML 3ULUE 4YK4B 5IT2L 2YKLL 3MZTA 3HMXA 4GXUN 1NSNH 1Q9LA 1EVUA 3O3AA 4M03A 4G43B 4PLKC 4OCXH 2YWZA 4XNQA 4KKLD 1DR9A 3QIBD 3TIDB 4E41E 1YY9D 1QFWL 2QSVA 4GG6E 1RZJH 2VQ1A 5I9QC 3MOAL 1IC4H 1QSED 2OS7A 5F7UA 3SO3C 5EUKB 4D8PB 5IFHH 4DFIA 2R4RL 5D1XB 1VSCA 2DQJH 2OJEA 2MSPA 4J8RB 5L88H 3O41B 4Z7VB 3SQOH 5C09B 4KQ4H 3I9GH 5GRVK 1Q0XH 1ZT4A 1VHPA 5JHDB 3C6SB 2IPKB 3OKLB 1QBAA 5GGVH 1JPGB 1R3JB 2BY2A 4WFGD 3U4EB 4L8BB 4JFYB 1X5AA 4X0KA 2AK4D 4YHML 4AEEA 4PJ8D 4RCAA 2H2SD 4MVBC 5BS0A 1CD8A 3MV7A 4JFQA 1MFDL 1DL7L 3T65B 1TCRB 2DWDA 2EH8H 2H32H 4AQ1B 1I7RB 3QQ9D 2AI0L 2EEAA 2Z92A 1F6AA 5ADOL 5I8KH 3T3ME 3ARRA 3P9WB 4EOWH 1Z9MA 1F3DH 3MRMB 3LKSA 4H25B 4YUEL 3MQIA 3FO2A 4Z7OE 4ZMAT 1VDGA 2FX8H 5K9QI 3NCJL 4LVEA 4PJDE 1DBMH 4P2QD 4X6FB 3U7WL 5K9KB 1KGCD 5C7XL 2XPGB 5C3LD 1S7WA 3K81A 3P0VL 2BCKA 3TT3L 1KIPB 4YXLH 2MCG1 4JFFB 4JM2C 4E0RA 2K7PA 3HI5L 4HW6A 2V5RA 1AHWA 1OAKL 4ZQKA 3VI4E 3LS5H 3DWTA 3GBLA 2OZ4H 1I9JH 2V2WA 3C5ZA 1S7UA 4K3JL 5CEYA 4Z95L 1WZ1H 3DGGB 3L6FA 3VFVA 2PKDA 1G7LB 4JO1L 1XF4B 1JWSB 4KDTA 1A6VL 5T5FH 3T0EB 4NJ9L 3BWAA 1ED3B 1TETH 5LWYH 2CLRB 4UZGA 4S2SB 5DJYA 4F9PA 4TOYH 4F9LC 4G9FA 5I71C 3HI6H 4MD4B 5C1MB 3NGBB 4L4TD 3ARDC 1OD7A 2MHAA 4YBLB 2EXWD 1D9KB 2FX7H 5SWSB 5MERA 3TYFA 4JPIA 1CE6B 1HE7A 4NQDA 5HYQB 2AJUL 4YEFA 3ULVF 2OMBA 1INEH 2WBWB 1QKZH 3THMH 2F9BT 5D1QD 1WF5A 4XWGH 1YNKL 2YOCA 3HE6B 4G42A 3GSWB 3RZCA 12E8L 4LP4A 3HG1B 2G5BA 3MJ6A 3O11B 1IGMH 2VB5A 4QHLB 1CFQB 4NO5B 3KYNB 1KIQA 1CDBA 4HIJA 1QFWH 4KFZC 5BRZD 5CJOL 2Y1VA 5D70L 5CEZD 4DUXA 2FDBP 2EC8A 4M8QA 1HHIB 2R4RH 2PXYB 2KQNA 1RZGA 2Q7YB 5C0NC 3OMZA 1A1OB 2N56A 5E00A 5EUOA 1A7OL 2ENYA 4MAUH 1F4HA 2C1PA 3F7PC 2R69H 3WSQH 2JF1A 3SPVA 4ZYKB 3O6ML 1X5XA 2NY0B 1E6OH 1EUUA 1B0GB 4DW2L 4V1DB 1ZLWH 1N4XH 4U1JA 5D4QA 3T3PF 3IJSB 3I2CL 2ZKHL 5I1AB 1KJ2B 4YHMH 1LE9B 4MNQA 4N9OB 3NTCL 3O9WB 1DL7H 3SCMA 4GLRI 3WFHB 4L9DA 3U46A 2BNRA 5DFVC 3D18B 3A6CH 2AI0H 4ZO9A 3ZDXF 2C3VA 5CS7A 5DJXB 3JUZA 3VFMA 4LDLB 2P1YA 3CH8A 1EFXB 3STLA 1KTRL 1CLCA 1NMAH 1MIML 3QUML 4X80L 2M1KA 2C4FU 4MA8H 5ABDE 4Y1AE 3U7WH 4E41A 3PWVB 4LPTA 5C7XH 3RWEA 1U91B 4PJCE 3C6LA 3Q5OA 4QLRA 5F1SA 4CAGA 3N9GL 5EN2A 4K71B 4ONFL 3CXDL 1ZWIB 3O6FD 4PJIE 4HBQA 4GW5B 3C5ZC 4ZUSA 2AXFA 3LSOA 1T89C 4KI5C 4XI5D 1JZ6A 1Z2KA 3UP1A 2ICWA 2BMKB 1Z0NA 4Z95H 3HE7B 3MRDA 2UWEA 5JIPA 1EUTA 4MAYC 5GRZA 5JIHA 1CDCA 2LAGB 4B7IA 4PR5A 4JO1H 5DK2A 1U8QA 4Q58C 1P53A 2A74B 4F9PC 1A6VH 4H8WH 4PJ7F 3V4UH 4NJ9H 4DEPB 4PJGB 1LO3L 4JKLA 1CL7I 1VADA 4AIZA 1EFQA 2DI7A 1XZ0B 2HLAB 4KKNA 4LPUA 3WLWC 4FTVE 4YHIB 4X8JB 3SKJL 1I8IB 3O2WH 5BO1L 2RB8A 2R15A 3AREA 4OF6A 1H0DB 3CDYA 1L9NA 1KTLB 1KG0A 3OB0H 5KSBA 1JGUL 3MRRB 4KKAD 5DVNA 1B2WL 1NDGA 2HFFB 3LPGA 4KI1A 1MF2H 2BFVL 4MNHB 3RY6A 3MUZ1 4M7JH 1LE5A 4I1NB 1A9BB 2Y06H 4PJDA 2AJUH 3P11H 2PO6D 2V2TB 1AGFB 3AS0A 5F7HA 5T1KA 4JZOA 1KLFA 5DD5L 5IVZA 1YNKH 3RZCC 3UZVB 3QDJE 3AVEA 3WFCH 3RX8A 4JRYA 4OV6F 4HH9B 2VUOA 2CLZB 3I02A 3NA9L 3DURA 12E8H 5JPNA 2HFEA 1S9XB 1AQDA 1CDGA 1FZKB 4IRZL 3QEUB 5CJOH 3K4AA 1IAIH 3VRLE 3RVTC 1VFAB 3MV8E 4DAGL 4PRNB 1OWRM 4QXGL 2HVJA 1XF5A 3IJHA 5HHME 1QBBA 4WI6A 1JGEA 3NACH 1WCQA 1A7OH 1CG9A 1U3JA 4I18C 1CD1B 2YPLE 5C08D 4QXTB 4DW2H 4NRYB 3GZKA 3P9LA 1P7QA 3I2CH 1KB5H 4M1GL 3SCMC 1WUNT 1R24A 2HFGH 3V4VL 1RUPL 2EDFA 4JO3L 4HIHA 2HVKB 4WO4A 1W0VB 1FZJA 3NTCH 4IMLB 1MSPA 4LAQH 1S9KC 2GT9A 2A1WL 1L9MA 4Y4KD 3ULUC 3C9NA 3B9KD 2AXJA 5LBSH 4X4ME 1PLGL 5C0AD 5DJ0B 5EULV 4MNGB 5ESAB 2NZIA 5GS0L 4KJWD 1VFUA 4U0RB 5F3HA 1MIMH 1WTLA 5F89B 2MPAL 3VFNA 5B8CA 1QQDB 3KJ4B 2AJ3B 5SWZE 4IOIB 3TGXA 3C6LC 4RQQA 5TDOB 1JRHL 4JAMA 1IE5A 1S7RA 1ZT1A 3IB4A 5DEZA 4WI2A 4EUPB 4C58B 3OB0K 3SDDA 3FOMB 4DQOH 2DF3A 3LRGA 4ONFH 1I7ZB 1RUQL 1U6AL 1ADQL 3CXDH 1CICD 3MRLA 2PTVA 3DO3A 2IEPA 5TPWL 1LK2B 1A21A 4XNMA 3HI1A 3WEXA 5E7FA 4ZS7H 2IFFH 1TQBB 4WW2F 2VWEE 4WW1B 4M43L 3IDJB 2JLLA 1QLEL 4MWFB 4YXKL 5E03A 2BNQD 3QDGE 3BEWB 4GXVL 4MXWH 3T2OA 2R1YB 1LO3H 1A1MB 2NY5C 2VZ1A 1YNLL 2H41A 3AREC 5EZOL 4DKDC 3T1FB 2E6PA 1CWVA 1SJHA 4D9RD 5A2IH 1UWXH 2OL3A 5BO1H 2HAZA 3SJVA 5J3HD 3MBEB 3UDWA 3R1GL 5FGBA 5E1AA 1B2WH 2Z4QA 2YD1A 4P2RA 3EDEA 1E6JL 2BFVH 3MRNA 2J88H 5EU6D 1MHEB 4ETQA 5EA0L 4HFWB 2GITB 4Y5YB 2H32B 3RUGE 2VIRA 2XNAB 1GL4B 1CLZH 3BVNA 3WO4C 2BVUA 3CCHB 2F54D 2BSRB 5DD5H 4KXZI 1S7XB 2BXYA 2FJFB 3O3DB 5C07E 4ZNEE 5HI3C 4X5XA 2E5EA 2CMRL 5D2NA 1YPZB 1IC7L 1BOGB 1XGPA 4AEIL 5KVEH 1EO5A 5FEBA 5IM7A 1LEIB 2BRQA 4XB8A 1BD2A 2WINB 4QXGH 4AEFA 2R2EB 4PJ9B 4AG4H 3QEQD 1JPSH 1NFDA 1N2RA 2HJKB 3QFDA 1LP9B 3SKOA 3VG9C 3BH9A 5I2IA 3QXDA 3DBXA 5GHWL 1MLCA 2NQCA 1EAJA 5EOTB 3OJ2C 4KZEL 3K8KA 1KT2B 5FYLD 4NN5C 1ZA6B 4FTVA 3VGAC 4X6BA 1BJ1J 4UAOC 3WNNA 3ARPA 2OP4L 4S1QL 4UIMA 3X17A 4NQCA 4WO4C 3MPCA 3V4VH 1RUPH 2YSSA 4P2CG 4JO3H 5FYKD 2CIKB 4W4NA 1GGBH 2JB6A 1HHGB 2J8UE 4PTTA 1PLGH 4MQXC 4QXUH 3P73B 3WHXB 1CYGA 1U8PA 3KPNA 4BUGA 4IDJH 2X4PB 1WC7A 1BP3B 3MNVA 2MPAH 3G04A 5KS9B 3MUY1 3KPLA 3D5OF 3QBTB 4XPTH 3OGCA 1A3RH 4L29A 3F58L 3B8YA 3SDDC 1KACB 3VDCA 1UWXK 2NXYB 4JO2H 2AVGA 5EC1B 15C8L 4X6DF 4PJEB 2ZOLA 3QQNA 4C56B 3UAJC 5ICXB 1YECL 3WXWH 2R2HA 1RUQH 1ADQH 5ISZB 2NLJA 1WGOA 4GRWE 2XY1A 4TUOA 4KUCD 3V6FA 1XCQA 1FFNA 3CVIL 4ELME 5TPWH 1RJLB 1NBYA 1A3LL 1NMBH 3DVGA 4NJAH 3DNKA 1WWBX 5AD0A 3MO1A 4QHKJ 2ATKB 2ADFH 4M48H 4I77L 2Y9RT 1OLLA 1NL0L 1QLEH 3B83A 3HMXH 4LFHD 1N0XL 4YR6A 4GXVH 3V5HA 4EDXB 5B39A 4IMKA 4IJ3B 5J9PA 4PRPD 2CXGA 3UDWC 5DQJA 5FGBC 3KLHC 2YN3A 1MRCL 2ED7A 4BSWA 2W60A 1A4JB 3RJQB 4EN3D 1QD0A 2V2XB 4PJAF 3TA3B 1E6JH 3L7FB 1P4BH 1RK1B 2X4QB 4TSAL 4OZHF 3ZE1E 4R8WH 5EA0H 3SHSA 3QXUA 3CU7A 3H42H 5F7NC 1LK3H 2YD2A 5MI0B 1A14L 4QT5A 3VWJA 4P3CL 4WUUB 1CD0A 2ZPKL 1MHCB 4FFWC 4NCC2 1CXEA 4W6XB 3AGVA 1XEDA 3QXVA 4ZAKB 1Y6NR 4N0UE 1S9VA 3KHQA 2CMRH 1DEEB 2NR6D 2G9HB 4G6AC 2Q8AH 4AEIH 4JFZH 3PWNB 2E7HA 3O4LD 2VMFA 3DYMA 3IDXH 3QNZA 1FNLA 4P23D 25C8H 4PREB 4WW2B 4P9ML 5IBTH 2X4UA 2LVEA 2Z8WC 1KBGL 1OTSC 1NBZB 1J05A 1F4WL 1S9YA 4EKXA 1ND0A 5DJ2A 2JCCF 3HKFA 1T0NB 3RPIA 1UM4L 4M9PA 3P4NA 5IVNA 2XWJA 2EDKA 4PP1C 4P5TD 2BRRL 5GJSL 2ESVD 3QDGA 3W11D 5IBLC 1PGRB 2FJHB 4KZEH 1S7TB 1RIVL 4J3UA 3VRIB 4UNVA 4ODTL 4EUPG 3FRUA 1NH6A 1G7JA 4PJFF 4X6CA 3H6JA 2OP4H 4S1QH 2R56L 1F4AA 3QXTA 1G7PB 3LPFA 1KFAH 1BEYL 2BVPB 3IF1B 4LOUD 1SEBB 3UEZA 1N64H 4JRXB 2WUBL 5LGHL 3T4YB 2EKSA 3L3KB 4RIRB 1DTUA 4QHNB 3P0YL 1WFTA 4JPKL 4CVXA 4K8RD 4OB5L 2DTSA 2QR0A 4OM0L 4RGOL 2ZCKL 1S8DA 4U1LB 3W0WD 7FABL 2X6MA 5C2UB 3D0VA 3X3FL 1OHQA 3ARGC 5F7LB 3CDGB 2X40A 5F6HI 4D0CB 2ITCB 5DD3H 3DGCR 3F62A 3F58H 2X1WL 4G7YL 3ZKMC 3IGAA 1CIDA 3DTXB 2P7TA 1HYSC 5JO5B 1CXFA 4AJ0A 5E8OA 15C8H 2VAAA 2XZCL 4JM2F 2NY5L 3OR6B 1YECH 4EDWL 3GMLA 5HYFA 1I3VA 4APQA 2PW1B 5IK3A 4B7LA 3B9DA 1IAII 2WP3O 3GIZL 4LEXL 1A3LH 2QADB 4PJ5E 3ZDZE 3PHQA 5DD0L 3MXVL 1PFCA 4HFUL 4YDLB 3WS6A 3QJFA 4HEME 1GPOL 1OAYL 2EZ0C 1K8DB 4PLJD 4POYA 5DYOB 3WKML 1KCKA 2QV2A 4IMKC 3OG6B 5C0BB 3EZ8A 3SDCA 2MMXA 4XB7A 3GSQB 1ETZA 1J0KA 2E3VA 2GUOB 4ACPA 5BVJB 1N6VA 2EDXA 5CINH 2G75A 43C9B 1MRCH 3F7YB 4U1NA 2IQ9L 2J8UA 4RX4A 3TBTB 2FO4B 3RWFA 2R0LH 1KB5B 4L5FH 3P3YA 2DYPA 3BOVA 1AGEB 1Z0MA 2R0ZL 2BZDA 2QSQA 2YPKB 1J1XH 5CSZA 3VWJC 3BAEH 3T8XB 2H6PA 4RNRA 3C60B 3D85A 3BN9D 3QFJA 2E6QA 2ZPKH 4MCYA 3KPTA 2WMPA 4FZ8H 3KXFE 1JF1B 5DJ6A 2UYLA 4Q97A 1QFOA 2VZVA 4OBSA 1EGJA 4YZFE 1OT2A 1IM3B 4QF1B 5HVGB 3H0TA 4MDJA 2ADIA 4U49A 4YBQD 3BE1L 5E6YA 4G9DB 4M6OL 2ZZUT 4O51A 5GSVA 4JHBA 2VQTA 3OHXB 4QYOB 1AGDA 3KPSB 4ELMA 4ONHA 4P9MH 5MEPB 1XGYL 5FV2A 1DZBA 2QHRH 2VWEC 2VXQL 1CGSH 1F4WH 5FHBL 2W38A 1DLHB 3GJFH 3QUZA 1UM4H 1QFPA 2Z35A 1JBJA 5J12C 2VOTA 3ULUH 5GGSB 4DZBB 2BRRH 5F3BA 3QUXA 1IEAA 5FO8A 3BZ4A 1RIVH 1FBIH 3O0RL 4ODTH 4XXDA 4DFHA 2FB4H 1AO7E 1C12A 1OF2B 1QZ1A 3T0VA 1U3ZA 1ZLSH 4UDTA 3TBVA 4AIOA 1F2XK 3HZMB 3LAFA 3UTTD 1BEYH 5C0IA 1DP0A 5I75C 5EC2A 3DX9B 4WFGE 1ONQB 4C4KT 3WD5H 4JQVA 1BVLB 4JPKH 4NOFA 1FVEA 3MLYL 3ZE2F 4OM0H 1Q94A 4F7TB 3DUSB 3ABZA 4RGOH 2GEEA 2NY6C 2ZCKH 3Q3GA 3T0AA 2PYEE 7FABH 3DX8A 3NA4A 5IEHA 4NSKB 4MJ4A 3JTSB 5DZNA 3HZKA 5I9QB 1MFEL 2FIKB 3RL2B 1NGXB 4M00A 3L5HA 4WEUD 1QRNB 3SO3B 1MCJA 1P4LB 2CIIA 1NAMB 4Z5RA 3LKPA 5HHXL 1CFSA 1CE1H 3F5WA 2OTWB 4G7YH 4ZOBA 4ZSOE 4Z76A 1GZPB 4NQED 3S36L 3EYUL 5HGAB 4HLJA 5EWIL 1LDPL 4NP4L 2XZCH 3PDOB 2NY5H 1FO0A 1KGCE 2HMID 5EPMB 4DVBB 4AEHH 3K2MC 1LD9B 3DV4B 3P4MB 3NFPB 4LEXH 1A22B 2VISB 5JMOC 1CZ8H 5HHVH 5GZOD 1T7VA 3OB8A 1A6UL 4HFUH 4R90H 2F53A 4PG9A 4KZDH 3VJ6A 3HLAB 4L8SA 1GPOH 4Z7NE 2WQRA 3P2TA 3H8NA 5HYJB 3D6GA 5F9JB 4X5WB 4JVWA 2O5ZH 1FH5H 5IB1A 2DWEB 4RGMB 3GUTA 3AAZA 5E9DA 1T0MB 3ARBD 4TN9A 5ENWA 2IQ9H 4O2CB 3VRJB 4L8DA 3GJFK 2DL2A 2IPTL 2YBRA 2A38A 4XCCL 1T1XB 2ICCA 2R0ZH 1BQSA 3RKDD 3EYOB 3GJEA 5EO9B 1MQ8A 3W9EA 1LEKB 3ET9F 4X4ZA 3TO2B 1YMMB 1UACL 4JM2B 2P5ED 3FRPG 1P7KB 2AV1A 3WCYA 2IPUG 4N0CC 3EKCA 5HYSB 3IDYB 5L8JB 1R3KA 2NX5A 3LKOB 3KS0J 4WI7A 2JIXA 4NQXB 4M7KL 4UDUB 2CDFA 4CN4A 3RNQA 5C0GA 3BE1H 4M6OH 2L7JA 4P2OA 5TE7L 2VDLL 3QUZC 5FHBH 1CU4H 5DFWH 3WUZA 1C08A 4GT7A 1UM5L 2ORBL 4PB9H 3QUXC 5AYUL 5I71B 3LPWA 1R0AL 5KAQG 1NEZB 3ARDB 4X7TA 4I3SH 3V7AG 1DBJH 2W9DH 3G5ZB 3LOWA 5C0DA 3HPJA 3NABL 4HS3B 5ITFB 4XVTL 4HAGA 3VGFA 2EE3A 3L1OH 3O0RH 5LQBL 1QSFD 3KWWB 1AGCA 2B1HL 2VDPL 5E08L 4JZJA 3VFTB 1T2XA 3WUWA 5GZNC 1D6EA 2FGWL 5FCUL 3ARWA 4LMQE 2D4FA 2XA3A 2Y7QA 1Q9LB 3O3AB 2GY5A 3ULUF 1JNNH 4XNQB 5IW6A 1C5DA 1VB9A 4QRPD 3MLYH 4FQ2L 4L9LC 4JZNA 2D03L 4WWKA 5DRNA 5HI4D 2VQ1B 1D5IH 4ERSL 3BPOC 5I1GH 3IFPA 5DQDL 4KK9C 3GI9L 3QDMD 3ARQA 1MFEH 4GG6F 2OJEB 4FOMA 3NAAH 4F2MA 1CVSC 1BJ1H 5IB3A 5I16A 5CZKA 4U1IA 3UJJH 1ZT4B 5CZXC 4NKOA 3S36H 3EYUH 5EWIH 1SMOA 5HHNA 4MYWB 4NP4H 1WFOA 4BQBA 4DN4L 4FQ1L 3GMMA 3VH8A 3IYLW 4FG6D 3QIBA 4WV1A 4N90D 3DJ9A 4WCYL 4V2BA 1EZVX 4X0KB 2BDNL 3ARXA 2VXUL 2XQYG 1QSEA 4KY1H 3DO7A 2VLKE 5BS0B 3MV7B 4JFQB 2LU3A 1QEWA 2W91A 3MFFA 4I9WD 4L8SC 1A6UH 2DWDB 1ZVSA 2APTA 2Z92B 2E7LC 1F6AB 3WIFA 2A9NL 3MGAA 4XTRD 2ZJSL 3LKSB 1AGBA 3FO2B 3FB8B 2ZUYA 1U2CA 4F3FA 3T3MF 1GHFH 1MRFH 2CJUL 1JFQL 4JG0H 4Z7OF 2ZCHH 5LCVH 3TEUA 2AK4A 1S7WB 4K8RL 4PJ8A 4PJDF 2BCKB 1K4CA 2IPTH 3ARZA 4KK5D