4WFED

Human traak k+ channel in a k+ bound conductive conformation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
211
structure length
211
Chain Sequence
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSNSPPTFGAGAKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
total genus 51
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfeD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfeD01
4QRRB 4I0PA 4TQEL 4DUVA 1QBBA 3VGGA 4TNWF 5EN2B 1KJMA 1QRND 3D85D 4XC3H 1B0GA 2HVJB 3ARFC 3GSQB 2ITDA 5FYKH 2OYPA 3S4SA 3VA6A 5K93A 3S34L 2ZPKL 4ONGH 4YBHA 3WEXA 4LPCA 5L8KB 4F9PA 3PV7A 4Z7UB 1MQKL 3EZ8A 3OKEA 5CBEA 1OM3H 3AS0A 5FYKE 4NOBA 2NX5A 4K94L 5GS0H 4OFKA 1YYLL 3T1WA 3T0WA 3E8UH 2N1KA 4KJYB 4XXCA 5D8JL 4NZTH 4U7MA 4XVUC 5HD8D 3T0XA 4OCSL 2EKJA 1QFPA 4EN3D 4X4XA 3VG0L 4EDWH 4N8PA 1CFNB 3MLTB 3K1KC 1QHPA 2UZXB 1Y6KR 1C08A 5I74B 1KN4L 4QTHB 1ZT7B 3OF6A 5HPOA 3KNBA 2HFGL 3X11A 3UPCA 2HFEA 1PG7W 1FE8L 4RFNC 3WUWB 2DLEA 2XKSA 1NMCC 4GQ9L 1AGBA 1FL5A 2VC2L 4P48A 2EH8H 2VAAB 3TT1H 3D9AL 3CU7A 1S7TB 4IIQA 4JRXB 4X6CB 2OL3H 3REWA 3SKJH 1F42A 2QHLA 1KCVL 2OI9B 2DI8A 5E4IA 4GXUN 5D1QA 1I1FB 2DQJH 1EFXA 2J8UF 2DB8A 3S4SG 3LPWA 2FEDD 2IFGA 4MA7H 2RAMA 2FATL 1LEIA 2Z8WC 3DUUB 3DURA 3IGAB 2FL5A 5AZEL 4BQBA 5DI8A 3S35X 3HZYB 1CGUA 1MCPL 2Q8BH 4XVTL 1JGEA 1KNOB 4GRMB 4A2LA 4LNRB 1PKQE 3U9UB 1EHNA 4X80L 3LVEA 3QIBC 3MNWA 3QEGH 1TCRB 4TSBH 4TUKH 2R2BB 5EO0B 3D0VA 4CVWA 3KDMB 4APQD 1A1NA 1VADB 2EYRB 4NKIH 5HHOB 5CEZH 4PRNA 3K81A 4FQ1L 1GL4B 4S1DC 4LLUB 2J6EH 4X6FB 3VXUA 4Z6AT 3QEGL 4TSBL 1CZ8L 5F9WB 1MI5E 3MUZ1 1F11A 1QSEA 2A6JB 4G5ZH 3BYYA 5B8CC 3SO5A 1QP1A 1JHLL 4I2XE 2H32H 3TNNB 2YC1B 5EBMB 1K4CB 2YHGA 1BM3L 1ORSB 3P9LA 2YUVA 1AR1C 4LF3A 4BZ1L 1BFOB 4KAQL 5I9QB 4BFEA 3FOMA 4UNVA 5AZ2H 3T0ED 1KCRH 4PIRF 1DEEB 3F7YB 4LPVA 2BSTA 1VFAB 2F54E 3OKKB 1L7TL 5SWZD 3DECA 3HS0B 4GXVH 1H3XA 4JE4B 1NC4A 2J7LA 5IMLA 2I9TB 2JJSA 5C0FA 3BH9A 3G6JF 3QUYC 1V3KA 4POZC 4U1GC 3KGRA 2EEAA 1EERB 4R2GB 5J6HA 2WANA 2YK1L 5E6YA 1E27B 4GKSB 3LRSA 3IXAB 1W72H 2FO4A 3LN4B 2ARJB 1J0YA 1EGJA 5GGSB 3WFCL 2P1YA 2V2TA 3HNTL 5HDQL 1DSFH 1QBML 3VFGL 1HH9A 3I6KB 4GG6A 4U6YA 1G7LA 4ZFZA 1CLZH 3AMLA 3P0VH 2X4NA 4MSWB 1RUAH 5TE6H 3WFHB 4PJDB 3ZLQC 3GBMH 3CH8A 4L4JA 4ZUTB 5TPWL 1NBVL 5CBAB 3BHBA 3OKDB 3QHZH 1BWMA 3AREB 2ICWB 1IM3B 3HUJF 2QL1A 3ULVF 1VFUA 4OCWL 3AM8A 1MEXH 3GBNL 3L3DB 3KDMA 5GRXG 3WHE0 2WM0A 4PLNC 5IVOA 4JDVA 5DJ8B 4MXWL 5GS0L 2W92A 3FMGL 4IRSC 5A2IH 1EVTC 4PJCF 4PJHF 2UYLB 2D7TL 4G80A 5DRZA 1S7XB 2VWEC 5I18L 1D3CA 1KLUB 3DURB 2DYPD 4OF0A 2PNDA 2VXTL 3HZVA 4P3DB 3SDYL 3TT1L 3ZYOA 1Q9WA 4LQ1A 1UJ3B 1BQHG 1UWGL 4PTTA 4HIXH 3NZHH 4R90H 4PYGA 5H8DA 4GJTB 3HI6H 5JDSA 3WHE1 2KKQA 4OZGB 5JZ7D 1DQLH 4YK4B 1DLFL 1T0NB 5ALCL 1CXHA 1TZGL 1YYMH 2Q76A 5F7UA 5T33H 1OGTA 5ACMA 4S1QL 3ZDZF 4EDWL 3QRGH 5TH2B 4S10A 3QDGB 1LK3H 1RD6A 4XPAL 1FFPA 3I02A 3MUGA 3FFCE 1WGOA 5DJCA 5I75C 5LG1A 5CGTA 3QDJD 3WIIL 3MRHB 3LV3A 4PJBE 4PGEA 1V5JA 3OB8A 2DYPB 3W5NA 2ZSWA 1LDSA 1ZKAA 5H2BB 1T2QH 3O41B 4J6RH 1LK3L 3PE9A 2NY0D 4HCRL 1FYTA 4HMEA 4P46C 2BOCB 5DSCB 1NAMA 4JZNA 3TEUA 1DBJL 4CN1A 1A6VH 2EDJA 1TLKA 1Y6MR 4X99B 5T33L 2XA3A 2DAVA 2AK1L 5HHXH 1U9KA 4M7LL 1DEDA 5CIPA 2QSCH 1JWSB 5TE7H 4PD4K 5F88B 3OX8B 2V17L 4GSDL 5FK9B 4RA0C 3GGWB 3SDAB 4C56E 1TVHB 4EN3C 1ZV5A 3L5XL 2BFVH 2E7LC 4WUKH 1FC1A 1T5WB 3DHMA 1NBYA 43C9B 1QO3A 3I6LE 3ZDYF 4LLWB 4P9HL 2ATKA 3MOQA 1GGCL 3BJ91 4U49A 2ARJQ 2BERA 3LKQA 1CFTB 5EDXA 4CW1B 4N1HB 4Z8FL 2YRLA 3R8QA 4NJ9L 1WWAX 4Q2ZA 1GGBH 3GB7B 5L2KE 5BQ7B 3EOBB 4KDTA 3O3EA 5LGHL 1MFEH 3JWOC 1B90A 5DEFA 5FIEA 3MRRA 5IG7B 4YQXL 3KPLB 3U7AA 2YD3A 1WUNT 4K3JH 3V6FB 4CMHC 5LXGH 5FGRA 4JZOA 3MLVL 4KJWC 1KC5L 4TNVK 5HI4C 2BRRH 3C5ZB 5GXBB 5CMAB 1XGQB 3JWOH 1P5VA 3MCKA 5DEZA 1O7SA 4DAGL 5I8KL 4ESKA 3WBDA 3EFFA 3X12A 5D7IE 1Q9OA 1U3JA 2CQVA 5D7IA 4YK4C 5IF0B 1S3KL 3LY6A 4O2EA 4HDIB 3THML 1T20B 5HHVL 1CD0A 5GGRA 1ORQB 5GRUL 4YBQD 4UU9A 3GIZL 2PYEA 3DVFA 3MOBH 1S5IL 1BBDL 3OGCA 3TA3B 2OR7A 4B50A 3ARXA 1ES0B 1NBQA 2ICEA 4JREC 2OP4H 2FNBA 1OAXH 3SO3C 1EMTH 5CCKH 2NY1C 1CD1B 4PJFF 1ZHNA 3DO3A 2BVOA 4POZD 3D39A 5D93B 1A4KA 1K8DB 1L4IA 3KLAA 3JTSB 3GI9L 5EU4B 3D3VB 4HPYH 4S0TD 4HJGB 5FYLL 4MA3B 1MHHB 2VLRA 1G7PB 1HXMB 3RY4A 5IQ9A 4E0RB 4BZ2L 4YHIA 1IAIH 3B2UC 4UV4H 4GLRI 5EZJA 3BKJH 4NM4L 1P1ZB 1G7HA 4ZUSB 3WE6A 3P30L 2MKLC 1G9NC 3TN0B 4Y1AB 1RJLA 4TTDC 4NWUL 5C0IB 5C0AE 4XNMA 4XPGL 5D1ZB 1V7NH 2ZUQC 4P4RB 4GAGH 4HFWB 3NA9H 2Y7QB 1CDJA 5JQ6L 1FZKB 5IMMB 4YDVA 4HIIA 2R1XA 2C9AA 1A6UH 2MMXA 4U1GB 4ZAKD 1SJEA 4QRRD 2AJVL 4KZEL 1KIPB 4HK0A 1FHGA 1E28B 1A7QH 3RBGA 1MREH 4O02L 3HMXL 4APQA 1HSBA 4OLXH 2Y36H 3RX5A 2Y72A 4LKXA 4O51B 4N9OB 2X1WL 2R1YA 8FABB 4CJ0A 5C0EA 3FOMB 3I84A 1MCOL 1F6FB 1KB5L 1V7NL 2EO9A 2GAZA 4M1DL 5JZ7C 1JPFA 2EKSA 1CDGA 5BS0B 3CUPB 4HPOL 5SWSD 1PBYA 5IBTL 2NY5L 2CPCA 1RFDL 5B38B 4X4MA 4C4KT 3ZE1E 2PCPA 5GGTA 5DQ9B 3WXWL 4LIQE 3PGFL 4C58B 2CRYA 1Z3GH 3D0VB 4RIRB 2PW1B 2Z91B 1B0RB 1WBYA 4XPTH 5K9KA 4Z7UE 3QSKB 3S3SA 4PRPD 5D5MA 4Y4FA 5HHQB 2LVEA 3QFJA 1KNOA 4GRMA 1OF2B 1OY3B 3LEVH 3DUSA 1FV1A 5I1EH 1ZWIB 2CGRL 2W0PA 4FQXA 1CE6B 1DL7H 4S1RL 3T04D 2HLAB 3JTTB 1LEIB 4JPKH 2VISB 2VXQL 3T0DA 1WZ1H 5GGVL 3DYMA 5JW3L 3G6JB 1MY5A 4OCRH 1CG9B 5K59E 4OFDA 1VA9A 3UTQA 4WO4C 5EH1A 5FO9B 3UPRB 1CTOA 4NUGH 5F8QC 1U3HA 4UNUA 5IW1B 4OGXL 4QRUA 4KJQD 1C16A 1IBGL 2JCCF 2GAZB 4A2MA 5FECA 1UCTA 2XXCB 5E0QA 2FJFB 2MNUA 1A47A 3QIUD 3HC0B 1VEPA 3TBYB 1S8DA 5ANME 1B0GB 4XP4L 2FYYA 4M61A 1DFBH 1ZLUK 2XKUA 1BJ1J 4K7PY 2PF6A 2DLHA 3MROB 3MOAL 4Y5XB 4OJFH 2BDNL 4LARL 3MLVH 4APQB 2R2EA 2VDML 5I76A 1U8MB 2OX5A 2R4RL 3HNVL 1NCDH 4LSRH 2IQAA 1FVCB 3QEUB 1BZ9A 1YNLL 1DQJB 4X4XB 4JAMB 1FZJB 4TVPE 2Y6SC 3CJJA 4X6CF 1I8LC 2BVEA 5F7LB 1BBDH 5ICZB 1ND0B 1AQKH 1FG9C 1OTTD 1VFBB 2DQHH 1WICA 2R4RH 1F58H 4N8VA 4E5XB 3QXVA 3I2CH 1JPFB 5HHVH 4ZFZB 2Q3ZA 3MRHA 3RRQA 4PY8J 1ODAA 4WUKL 2EZ0D 3QCUH 3IFPA 4M8QB 1YEGH 4DUXA 3OZ9H 3FRUB 2XA8H 3MZGB 3MXWH 5HHOE 4LMQE 5INDA 1U0QA 5IR1B 4U6XA 4Y19B 3QIBD 1HHIB 2HJKB 4JVPA 2IJ0C 3BHBB 3OKDA 2DQDH 3CC5B 5E8DL 1VGKB 1F4YL 1TFHA 2Q76B 4HAFA 5I15L 5DJYB 4L29B 4UI2A 2BOBA 2WWMD 3FAWA 1G7LB 3PV6B 3I2CL 4OCRL 4GG6B 3CSPA 3L6FB 4HUVA 2RIKA 5MEPA 4PRDA 5CD5C 5GJSH 3QG6A 4H5SA 4RAVA 3LB6D 3IKCB 5KOMC 3VGBA 3LPGA 1KELL 5I66A 3PDDA 1U8JA 4S2SB 1S7XA 1RU9H 2F54B 3SE8L 3ULVH 3WUZA 4JHZA 3WFZA 4XCFL 5IM7A 4PJAE 3PG2A 4XXDB 1NFDA 2QKIB 4NC2B 3OKOA 3GJFA 2FX9H 1A7OL 3TNMB 4TSAL 3K4ZA 4HIJA 4B0MM 3T2NL 5BW7C 2ZOLB 3ZTNL 5CZVH 1UT9A 4ODWB 5IMKA 4FFVD 4LSDA 2BY1A 2DIAA 3EKCA 4I77H 5HVHC 1ZA3B 3RA7H 1EXUA 4X98A 2OI9C 3ULUD 5HHXL 2VLKA 3VJ6A 4MJID 1MCRA 4X98B 4ZUUB 2HFFB 1DN0B 3BVNA 5DRXB 4NKDB 1G9ML 5HDOA 3BP7A 4NO5A 4HGWA 3MLUH 5F6IB 4HS6A 5IT2L 5GS1A 2GW5A 3MV8E 2IAMC 3EYFB 1JNLL 3MJ7B 3QCVL 3JV6A 1IM9A 3KS0H 4P5MB 3SDCA 2QQQA 4JHWH 4BKLB 1LO5B 4LOUC 3LKQB 2C3WA 5IM7B 4HC1H 1T1WB 1QO3B 2CLZA 3CK0L 3CAFA 1A9EB 2CDGA 3RIAK 1ITBB 1NMAH 4WW2F 4ISVB 1IL1B 5D7LB 2YOCA 5KSUA 4F7EA 3OJ2C 5KVDL 4I3GA 12E8L 4K3DL 5AAMA 4NFDA 3LDBC 2FJHB 4TVSa 1P9MC 5TGBA 1RFDH 3C09C 5DUML 5E8NB 4YO0A 5CIPB 1IAII 3W39A 3QO0A 3MRKB 5F9OL 4RRPG 3O6ML 4PR5A 2W0FA 4HD9A 3MLPA 1PLGL 5FGCB 3WFBL 4U1JB 5DJAA 4R90L 2P4AB 1FO0B 5IB2A 2WQRA 4YHYB 1RUKL 5AWNH 4MD4B 2W9LA 4PRNB 4DGVL 4NNXA 1GJIA 1N0XL 4FTVE 4I5BB 1BPVA 3ARZA 3KJ4B 1NSNH 4WWID 1LE9B 4JVWA 1SYVB 3QUXB 2FWOA 4PGJA 1BEYL 1MCHA 5DT1L 3MO1A 2A77H 4M62L 2IPKA 2JK5A 5HYIA 1AGCB 4OUOA 4UBDD 4HLJA 3W9EA 2P8MB 3TH3T 3P77B 1GGTA 5DF0A 2ZJSL 2J8UE 3AY4C 3QHTC 3O3EB 2BP3A 1KIQA 3QIUC 4YFEA 3EJYC 4KGJA 3O3DB 3WDHA 4XHQA 2VMFA 1A14H 5FGBC 3PDOB 4WI2A 1PAMA 4L8SC 4M4PA 1U8PB 3UO1L 4OB5L 4PV9A 5I6XB 3QWRD 1AFVL 1INDH 3MRKA 1C16B 3FO9B 4HS8L 1A7RH 3DWTA 1O5DT 4FQ1H 4QGYA 3RZCD 3LQZA 1ZGLP 4AZ8A 3VFGH 1B0WA 3NCFB 2EC9U 3PQYB 5J3HC 3E6HA 5DUPH 2VDNH 2OJZH 3SDAA 4WY7L 4JPIA 4J4PC 4QHUB 1KJMB 3MREB 4NJAH 3QWQB 1G7IA 5DZLA 4K9EL 3VCLB 4E41A 2LV4A 3WFEH 1HIMH 5D72H 3BUYB 4D9RD 1VENA 2GJ6D 3GMNA 1U92A 2MQ0A 4OZIB 5D6CB 3CZFA 5EOCH 4ZOCA 1QLFB 4Y0GA 2FHBA 2CDEB 4XCNB 3D1MC 4U1IB 1OAKH 3JV6B 1P5UA 2JJUA 4RFEB 4MD0B 2D9QB 1MJUL 3HC4H 1BLNA 5D5ME 3LZFH 1RY7B 1XIWB 3O41A 3QDME 2FIKB 4RMRA 3MOBL 3D87B 4KMTL 1HNFA 4ODTL 1I8KA 5CUSL 3EAKA 3T4YA 2YRPA 4XNUH 3DTXB 3I3BA 2NX5B 4JRYB 3MLZH 2XNAA 5HYFA 1IE5A 2HT4C 4OLVL 4N0FA 3T0AA 3TO2B 1RIHL 5HPMA 5IHZA 4OV5A 3NFNB 2FX8L 5BS0E 2R29H 5JIPA 1FDLH 5IQ9B 1HXYA 1Z9OA 1MHPH 1EUTA 2GT9A 2BNRB 3KPSE 2EDOA 2R9HD 4WWKC 2V17H 3PWVB 3EW3B 3MNZB 3X3GH 3C87A 1MJJA 5HBBA 1MOEA 4LASH 5KJRH 1DQQB 3CXHJ 4U33A 3LKRA 4NQED 3SCMD 5HHOD 4RMWA 4RDQF 2P42B 4P99A 3BWAA 2BRRL 1LO5A 4H8WL 5I1HH 4G6AC 4D0BB 2NW3A 5BS0A 1NCAL 4KZDL 4X9GA 1QFUH 3GHBH 3MV9B 4Y2DB 4H1LA 1ZTXH 3F7QA 5AZEH 4P46B 2R1XB 4XBEH 5IMMA 1QEWB 1S7UB 4UINL 5HHNA 1GGUA 5EU7C 2MCG1 1ZHBA 1QEWA 1S7UA 2NXZB 2ZP0T 4P2YA 2VABA 4NQVB 4DVRH 5EU5A 5TQ2L 3CSGA 3BUTA 2JCCE 4ONFH 3V4PL 3HRPA 5F9JB 4HUUA 1K3IA 1XGPB 3JV5A 2P8PB 4MB5A 5E2TL 4OZFA 4YHKH 4L8SB 2YPVL 4QRQA 5SWSE 3IRPX 4MCYA 4X7FC 4NC0B 5E6IA 4N0CC 4PS4L 5T3ZL 3EFFB 3X12B 1KIPA 4HK0B 1UEYA 3BGAA 3IT8D 1CFSB 5IT2H 1VGEL 3QHFL 5HJ3B 4Y8AA 5C7XL 1JF1A 1FFOB 1U8NA 2H3NB 5HJ3A 1Y6NR 2AK4A 2VR9A 1JYVA 1B9ZA 4WNQB 4HXBL 3SKNB 3HRZB 4LPWA 2APBA 2HFGH 5C08B 5CBAA 2VLRE 4LCUB 4RFOL 3D6GA 2E9JA 3DMMC 5IHUH 5D2LE 4Z18A 2A0LC 3MRFB 3CIQA 5D1XA 1G7HB 3REVA 1S5HA 2DDQH 2SEBA 3VFUA 2O5ZL 1QSED 2Y1VA 2EDBA 4OV6F 2DQEL 3WFDL 2VDPH 4XX1E 1M71A 4L4TA 2X4OB 4WI7A 4ZOEA 3UYRL 2VXUL 4FZEL 1ZVSA 2AJYH 3H42L 1OLZA 2RHEA 5EO9A 2H45A 4KC3B 2W9DL 4K94H 5GGRB 3I3EA 4UQ3A 1BBJB 3BWAB 3TBTB 1ZHNB 1DQDL 4PJ9A 5ESAA 4ZFOB 5BV7H 4KRNA 4LSUL 5L9DH 4RZCA 2ESVB 3T1FB 1SVCP 1ES0A 3TVMC 4DK6A 1M4KA 5DC9B 2GT9B 3FO1A 4Z0XA 5IVNA 3GUTA 3SQOL 4RCAA 3P0YH 4RGMC 5I1JL 5IHUL 3EDFA 4G3YL 4X6DF 3TO2A 3EO9H 4IEFB 1JZ5A 1RK1A 5D70L 4QHMB 1F02I 2ICWI 1D7FA 5FO7A 3TV3H 4HDIA 4JR9L 1P4IH 3X13B 5IFAH 3FN0L 3MZTA 4BK5A 3GRWA 3DYOA 2VAAA 2NXZD 2EO1A 3VG9C 3BZ4B 2R29L 2E6JA 5E95B 3RVTC 3KWWB 3V0VA 1RZ7L 2AJZB 4W6WB 5DMKB 3QNXB 5KVGL 1HHGB 4FFYL 3PF2A 4AEEA 5I8OL 4I8DA 1C1EH 1JPGA 2L4OA 1VACB 4Y4FB 3V8CA 4Y4KD 1CXKA 4F7MB 5TQ2H 2FYYB 3V4PH 4XPHH 4L9LA 2B39A 5JXED 3BPLB 3FHQA 3RNKA 2NY2C 3O3UN 5E2JA 1S9VB 3CFJB 4LP4A 1IJ9A 5TQ0L 5F7DA 4CGTA 5FYLD 3HTLX 1FVEB 1YN7B 4NN6B 1DUZB 4PRBB 1FGNL 2AEPH 4XWGL 3QIBB 2HH0H 5DDHA 4I2XB 5CWSA 5DMYA 1RZKH 1U3HB 1CZ8H 3QG7L 4DCQA 4LHUG 1IC5H 5T1KA 1UJ3A 5GS0D 1FL5B 2NX5D 1OTSD 4KKLC 1N4XH 1LO4H 2Z4QA 4Z78B 3QJFA 1U58A 1NLBL 3GSVB 5K9QI 4HMDA 2I07A 4UUJB 5HGAB 3MRBA 1INDL 3MGOB 4XNQB 1K2DA 1QZ1A 4AMKH 4QTHA 4NSKA 4D0DA 5L6YH 3C60D 3MUGB 3HLAB 1E28A 2R2CA 4IOIB 4B41A 1CS6A 5EU6A 3TIDB 4P2QB 5HDBE 3RWFB 1X5YA 4R26L 2ADJA 4G8FB 5DYOB 4MA7L 4F15C 3HC4L 5E2UL 4DGIL 4FQQA 3T4AB 2DM3A 2BNQB 3ETBF 3LEVL 4Y2OA 5I1EL 4G43B 3VGHA 4MQXD 4HHAB 3B5TA 3GIVB 4TUOA 1P7QA 2GUOB 4BFIB 3PWLB 5LQBH 5JPNB 1XZ0A 4B53A 4EDXB 4OLZL 3K2MC 4DZ8B 4Y16C 2XZQL 5KS9B 5EUKB 1NGQH 4DFHA 2ZOLA 5TF1H 4JRYD 5CEZL 4WHTB 4P2CG 5E08H 5FKPB 3TNMA 4QHNA 1WWBX 4OF6A 2OMNA 3T0EB 5BZDA 3QXWA 1Q8MA 5ICYA 5MHSD 4ZXBB 1U8IA 1KULA 3CD4A 5SWQB 1MCPH 2Q8BL 1EGJH 2VDQH 3W9DA 2W1NA 1SQ2N 3CVIH 3GJEA 3DX9A 4M4RA 4QCIB 3P9LB 2R39A 4PB0L 3O8XD 4K55A 4LKCA 1ROWA 2D03H 3ULUC 3O9WA 4YBLC 1JP5A 1F00I 4GW5A 1QSEB 2HRPH 3MNVB 3NZ8A 3L6FA 3FFDA 2IQ9L 1AGFA 2XFXB 2OL3A 3SKJL 2EE3A 4WO4A 5GSRB 3D9AH 1NMCB 1UB5A 4K71B 4WI3A 1DVFB 3O45B 1CR9L 2VKXA 3LN4A 1NDGB 2A83B 3IXAA 1JNHA 3C5JA 2BMKB 4HJ0C 4NIKB 1UWEL 4ZTOH 1NUGA 2OK0L 2X1XR 2XKNB 3SDCD 1NCTA 1HHKA 1JUFA 3VI4E 1RK0A 3BPCB 4RGMB 4G8EB 5EO1B 4YHZH 3H9SB 2I07B 4UUJA 5D7JC 3FQRA 4LCCB 2PYED 5JUEL 4H5SB 3QG6B 4RAVB 3B5GA 2QLVB 1AD0B 3IDNA 1ORSA 4MXVF 4WHCA 4UOW0 4L8CA 2W0KA 4P2QA 3PV6A 1EMTL 2AABL 3RI5K 4I0CC 2K7PA 1U8IB 1FGVL 1C7TA 1YN6B 5IBLD 2ZUXA 4I3RH 43CAB 2DBJA 5BVPL 2H41A 3FQWB 3KPMA 2YSSB 1R3KB 2F8XC 3L7EA 1A1NB 1VADA 1KACB 2ATPB 2J5LC 3LS4H 4KTDL 3ZHDA 3V6ZA 3VFRB 1JNNL 1ADQA 1YEEH 5C0GB 3C9NB 3MNWB 3F62A 4PFEA 4NNYA 4JZOB 5HPMB 1PG7H 1QTYT 5H35B 3RA7L 3BSZL 3QNZB 5SWZA 1IT9H 5HGHA 3H7BB 3DXAD 2UUDH 2OR9L 4YC2B 4KTEL 1BIIA 4DAGH 5DMGC 2O26U 2NY2D 2AS5M 5JA8B 2CLVB 1YEGL 1P84K 4XP6H 4UDTA 3VFVA 1ZAGA 1IGYA 4J23A 3KYNB 3WSQL 4R8WH 4XHJC 3C6LB 2GSIB 1SHMA 1I9EA 4K3HA 1U42A 3UBXG 4NRZA 3J7HA 3RWFA 1GOFA 4RMVA 4IS6B 4HG4J 1N6UA 5JXEC 2WIIA 5H94A 1FCGA 4F9LC 3QZWB 4QRSA 3VWKB 5HYSB 4LLQA 4M43L 4YR6B 3RTQA 3HNVH 1CL7H 4HKJA 3VWKA 3RUGE 5IEHB 4RGOL 1J86A 5HYJB 2MJWA 1DR9A 3TBVA 3B9VA 5DK2A 2IAND 4PLJD 4ZS7L 5CZXD 4ZSOE 3H6JA 3IU4L 5GSVB 5DURB 1G7QB 4KROC 4XP4H 5ECJE 1OTSC 4KKLD 5M7QA 3QEHB 3RGVA 3U0PB 3DNKA 5LBSL 3VWJD 3QO1B 1AGBB 4KQ4H 5BW7A 3FO1B 4LSVL 4LIQL 3ARGC 3H3PH 5EU6D 3RVWD 4EIZC 4ZSOB 5TDPA 5IHLB 2FR4B 1EHAA 1AJ7L 1T1YA 4EQ2A 4Z76A 4HKBA 4X6BB 3B9KC 4W4NA 3PGCA 1YJDH 1MAKA 1RZJH 4KTDH 3SEPA 2OTWB 4ZDHB 1OHQA 1CL7L 1HYRC 3IJHA 2EE2A 2BNUB 4PBWD 1T1ZA 3CZJA 3PL6B 3BJLA 4GW4A 4JHAL 1B4JL 4WEBH 3IXTB 4S0SD 2HVJA 4HIIB 4XPFL 1R3KA 1J0JA 5CHNA 5C9JA 1QFWM 2JJTC 1QKZH 1X6NA 3NPSB 4OCYL 2EDWA 4HQQL 2KBGA 4M00A 3X14B 2IMMA 4E9LA 4MCYB 4F80A 4ELKA 3QB7C 4PR5B 2QHRH 2UWEA 4Z7WF 5DC0A 3QNZA 3W0WB 2YA1A 4PJDA 1DBBL 1CGWA 5C08A 5FO7B 3WFEL 5E8NA 1KTKE 2A74A 4M7KL 1IARB 2Z8RA 4AIZA 3ZKXC 1SYSA 1Q1JL 3BPOB 3MFFA 2HT4D 2ZUSA 4K8RH 1JZ8A 5KTEL 1OPGH 5FGBA 4Z0XB 4ORGB 2YN5A 4JZJA 3TA3D 4I0PB 4DTGH 5IW6B 1YEEL 4L3AA 4G8GB 5JHDE 4XCEA 2CRZA 3D3VE 3SGJC 1N6QL 4P4KC 1ZGLA 1FNSH 5L7XH 3S88L 3QDMD 2NXYD 4PV8A 4LEOA 1QFHA 1SEQH 1AR2A 4LBEB 1U2HA 4TUJA 2NXYC 4KKAC 3UTSE 2WIMA 4HJ0D 5E1HB 5T1KD 2VSDA 3CX5J 1S5HB 3BQUA 4WV1A 5ENWB 4OQTL 1DVFD 4K7PX 4HUXB 5D7SL 1MCWW 3B2UD 4QXTB 5ENWA 3RHWK 3FHAA 2A6KB 1M7XA 3SGKC 3ZKSD 1EJOL 3MNZA 2FIKA 3DOSA 4ODSH 4UT9H 1RUKH 1LEGB 3VI3F 5CS7A 5JNYB 3BIAX 3QXAB 4GKOA 4UTBL 3AFLA 3BKML 5I30H 4H1LG 1C7SA 2BNRA 2VLRB 4DTGL 1JHTB 2WUCH 3MCKB 3IJSA 1IQDB 1NBVH 3QXAA 4HPOH 2A38A 4Q0XH 4AG4L 4OCXH 3RVUC 2M8XA 2OR8A 1DDHA 5EWIL 1ZGLB 1PZUB 2AJSL 4YDIL 2XN9B 2FD6H 1U92B 1IAOA 1NGQL 3BKMH 4XVSL 4L4TD 4Z7WA 5IW6A 4PGDB 3PGDA 1T6VN 5IVXF 5F9DC 3DI2B 3HI1A 5KVDH 3D2UD 1CFVL 5JLZA 3CDFA 4ZMAT 3L3OA 3PIQA 4XC1H 2Q7YB 4KHTL 3MFFB 4N0YL 3IDNB 2JCCA 5HY9B 3BRGC 5C71A 3D2UB 1FYTE 3AS3A 4OUUA 4K8RD 3HMWH 1MREL 4KK8D 4Y2DA 3T09A 3MV8B 5CJ5A 2GYSA 4PB9H 1E4XL 3GNMH 3IDJB 4CMMA 1S5IH 4R26H 3IS0X 3U36A 4BK4A 4KAQH 1GZPB 1DQML 5JQ6H 3X14A 1N3NA 4JY6A 3WIHH 4G7YL 4MXQD 4W68A 2XICA 1H8OA 1FJ1B 2YD7A 2R15A 3L3KA 3FTGA 5J4MA 1BMGA 1EEUA 4D9QE 1KOAA 2YD9A 4AEHL 3NCMA 4I77L 1JGEB 1JZ3A 2QR0B 1MRCL 4NSKB 4WEUD 1WQVT 1CFBA 1CICA 3GMPA 1Q1JH 4KI5F 1SVZA 2ZCLL 4WJ5A 2EDHA 5JIKA 3VMOA 4N9GA 4YPJA 1G9EA 1JWUA 1M05B 3KXFB 1LNUA 2VZ3A 1YECH 5D1QB 3ZKND 4MD4A 4I3SL 1E4JA 4ZNEE 4X4ZA 1BQSA 4GAFB 1RZKL 1MWAL 2GK2A 3ZKNC 3G08B 3QDMA 2APXA 1OWWA 3DO7B 3U4AA 3HC3H 1A4JB 5E94A 4FFZH 1FGNH 2AEPL 1MPAH 5A2LH 5LGJB 5ISZD 5CBEB 3FT4A 4JN1H 3HLAA 4M7ZC 2EDDA 4P2RB 1IEBA 4MAYD 3RP1A 2CDEA 4XCNA 3K74B 5CWSB 1AXSB 4PJ8C 1GC1H 4PRHB 4WW2C 1AC6A 4XNQA 3HPJB 1MHEA 4JO2H 2X9WA 4KPHL 4ORZC 3QAZB 5ERWB 1GVIA 2VIRB 4LLVA 1M7IA 2BCKB 3DROB 4HUNB 4JRWA 3D39D 3O6FD 3WL9B 5A16A 2XZZA 5ACZA 4QOKD 1LO0L 2D0HA 4Y4FC 4CJ1A 5C0BA 1AIFB 3SDDA 2ZUVA 3N85H 2EH8L 5IW1A 1P7KA 4OGYL 3LQAH 1JTOA 5JPNA 1J1XL 4PREB 5EOQH 2AJZA 2GUOA 5AD0A 3JV4B 4RX4D 3IDXL 3MGAA 4KUCF 5ALBL 1FSKB 5H37G 2W65B 3NN8A 3GMLB 1F90H 5IB3B 4UTAL 3ILQC 1OP3H 1KN4H 4WW2B 1JUFB 2VB5A 2R1WA 5JOPE 1UCBH 3BEVB 5F7YC 1EO5A 3WEXB 5IBUG 1A5FL 3NIFF 5A3ID 1D5IH 2E3VA 1OAUH 1JPGB 2Q6WB 3OKYA 4WUUB 1AQKL 5F6HI 1YNKH 4Z7QE 5KVEH 3DVGA 3GSQA 4LLAA 1JV5A 5LGHH 2Z93A 4NZRL 2UZYB 1AHWA 2NY6B 5IMOA 1IEHA 4FQ2H 4URTB 5C0DB 2HMIC 4OZHA 2FWOB 4XPHL 4LLVB 1X5IA 3AVEA 5J13C 2ESVA 3T1FA 5ADOH 1V3LA 2X89D 1XGYH 1MELA 4PGCB 4NN7C 1EHXA 2OLDA 3U0WH 1TJHH 2VXUH 4APQC 3VRLF 4OLUL 3KLHC 3NMEA 4MB3A 3JUZA 1R0AH 2DWEB 2DQEH 4L3EA 3RPKA 3QRGL 5BJTB 4DKEL 4QHMA 1Q72L 4UIMB 5D7KE 3PWJA 4AH2B 2R9HC 4Z7VA 3CU1A 3HNSL 4AQ1B 5IFAL 5C0GA 5KZCD 1EVUA 2VIRA 3BISA 2H9GB 3CFCL 3V6BR 3VG9B 4JFDE 4KQ3H 1D9KA 3ROLA 1WWWX 3CFEB 2EE6A 4X8JB 2CKNA 4MZ3A 4JY5H 4QGTA 3F7RA 1WAAE 1RK0B 4BQ9A 3S7GA 4U1LB 3EYSH 1QFWL 3CC5A 2WBJB 1VGEH 3QHFH 1WEJL 1VACA 5D7LE 2YMXH 1IGJA 3DIFA 2V2WB 2BHZA 1SJEB 1E0OB 1X4YA 2CK2A 4FQPA 3NACH 3V5HB 2JKXA 3MJ7A 3Q6GH 3VWJA 4RX4A 2XG4A 3VXPB 1S9WB 3FMGH 3QQ9D 1E4WH 4WTZA 5MENE 3RVUD 2B8OT 3QULA 4KUZL 4KRPC 1TPXC 1FIGL 4BFIA 1CIUA 4BSVA 3WJLA 4E5XA 3QULB 4FFVC 2ZKHH 3NFPA 3FT2B 4X4YA 4YDLB 5LGKA 4E0RA 1CLCA 2MOVA 1JF1B 1OSPH 4F3FB 3DV6A 1TNNA 5EOTA 1NUDA 2A83A 3U7WH 3SDCC 1VDGA 4POYA 4FG6C 3PHSA 2HG5A 1UWEH 1UB5B 4P2OD 4HH9B 4MDIA 4FQCL 3IRZA 2XN9A 5EOQL 2DWDA 3UDWC 1QBLH 3R06B 2EYSA 3TPKA 1FDLL 3QUZB 1FPTH 2BSTB 4TULL 5F21B 3MXVH 2DD8L 1GXEA 4DQOL 3TPUA 2X4OA 1QFWI 2P44B 5JW5B 2ADFH 2D7QA 3D0LA 3VRLE 3FCTB 3MRDB 5E6IC 4L3EB 2CMRL 3OAZK 1KCRL 5FM4A 4KV5E 2XYCA 5C92A 3DRQB 3D25B 3L9RB 4L8BB 3G6JA 4U3HA 3DXAE 4G43A 3IXTA 1A7PH 1QLRB 5EO0A 3L3JA 1MJ8L 2XT1B 4U6XB 4JFFA 1MWAH 4Y89A 4XPGH 4WHTA 4D9LH 2I5YL 1YECL 3LEYL 3OQ3B 4M6OL 4OFYA 3FRUA 2MSPA 1JN6A 4IIQC 3PGCB 5E9DA 1NGZB 4JKPL 1DSFL 4GMTL 3F7PC 1WZMA 3MRQA 3OWEA 3QJHB 4LPXA 4NGHL 1KGCE 4Y5VC 5JORA 3EYQC 1FL6A 2G5BA 4RIRA 1F4AA 2OTUA 2Z8SA 1UADC 4TRPL 2GEEA 3QEHA 3RGVB 2R2HB 2F19L 2C1OB 2APTA 2GITA 2YA2A 5D93C 5C0JB 3VXNB 3SY0A 1OF2A 3QEUA 1YY8B 4Q9BA 4M3JA 3FO0L 4Q9QH 1F13A 5ILTL 3T08A 1VKXB 5EC2B 2B4CL 4ODXB 1T5WA 4PJCA 3VH8A 4DKDC 5GHWL 1GIGL 4GRLC 1BFSA 2EYTA 2IMNA 4OM1L 3LOWA 2F5AH 4U6VL 4HZLB 2NY0C 1E4XI 3L7FB 2PO6C 1YMMD 1CU4L 3PL6A 3JVGC 4GW4B 4JY4A 1QA9B 4ZFGL 1H5BC 1RPQA 1U3YA 5ID1A 5F7KC 1FP5A 1DTUA 1JMXA 1HEZA 2VTFA 4RGNC 3RL1B 1J11A 1S3KH 5ANMB 1IKFL 1FZMA 4KJQC 5DO2D 3BGFC 1FPTL 2YRZA 1QQDA 1NLBH 4P3CH 1U8HA 3JSSA 4JR9H 5EC1B 1OT1A 5I17B 5E56A 4AG4H 5FDWB 3ARDC 4KRLB 1BF2A 2X10A 2LU7A 3TJHC 3RUGF 2WUCL 1R6VA 1YUHA 3H7BA 1PFCA 5BV7B 1CD8A 2UVFA 4LCUA 5DD0H 4YJZL 3H7LA 4DGYH 2X4SB 3T3PE 1Y18A 1RHHA 1T66C 3EDDA 2E9WA 5D7JA 2V5TA 3GO1H 4NQEB 5ITFB 3SKOB 5TH2A 2NY1B 4ZUWA 1OB1B 3ARSA 3G6AA 4FNLL 1AQDA 2HT2D 4YR6A 1TQBB 3RTQB 1KCVH 2RFXB 1RZGB 1Z5LA 1KLFA 3QIUA 4JFOB 1UFUA 3KLHD 1RIUH 5E6IB 3LKOB 2DQCL 2QEJA 3MRJA 1JZ4A 3SBWA 3MBXH 4OZFB 3R1GH 2VO5A 3E2HC 5AAWA 5BOZG 5IFJA 1LP9E 4OZGA 1Q94A 3R0NA 2I9LB 3FO9A 4LSSL 5T1DL 5A2JH 4PV9B 2W60A 3VXRE 4GG8B 3EHBD 3KYNA 1NC2D 5F7EH 4XTRD 3QIWB 4YGAB 3AS2A 2AXGB 1H3PH 1C12B 2CLVA 3WJJA 3KPQB 2XV6B 4LSTH 1TXKA 1INQA 1D5MB 2O5YH 3MV7D 1IZKA 1WIOA 4MA1B 1RV6X 5TE4H 5CEXB 1HINL 3VDCA 4LFHD 4NRZB 2CLRA 3EJZD 4PJIE 4WGWB 3VFMA 2QHRL 4KWUA 2ZG3A 1ZHKB 4KUZH 3TA3A 1KEGL 2W9EL 5EFIA 1XGYL 3EOYG 5BMFL 1T0MB 3MLYH 5E8OA 2FLRT 1RZFL 3RZCA 1D6VL 5CP7B 3V79C 3UTTE 4JFEB 3LKPB 4HUXA 5J56B 3GMQA 3W2DH 2JELL 5EZIL 4L8SA 3QO0B 4EUPG 1NEZG 2IANA 3GMQB 5F3HA 1IEAB 1MUJA 4MVBD 4AM0B 3LKPA 2YBRA 4M48L 3B8SA 3IKCA 3MRMB 4XBPB 1I1AB 4P57B 1FH5L 1XIWA 4NQVA 4TTDD 2NY0B 4JRXE 4X6CE 4X7SH 5IBUB 2V2TB 1RURH 3V0WH 1AP2B 5DMIL 4YHIB 5M95B 1U8NB 2H3NA 3IF1B 3RIAF 4R0LB 5E9DE 4ZYKA 4NN5C 4XZUA 2C26A 1KJ3H 4CN4A 2AQ3A 2ESVD 2D3VA 5B3JF 5ISZE 1A21A 2XKNA 3L3HB 3HNSH 4G8GA 1Q9LB 2H6PA 4NBXB 4ZAKA 4JFFE 3QUXC 3Q3GA 1IKNA 1DQQA 1A7OH 5C8JB 4PLKC 1WJ3A 1QR4A 2X05A 3RWGA 4A6YL 1AD9A 2XWBB 2H9GA 1AD0A 1PDKA 4YHKL 4O58H 4X7CC 5IESL 2APVA 1OSZB 1IGCH 1VFOA 3MRIB 3U9PH 3ZL4L 1XGTB 1XCTA 5DRXA 3DPBA 3BKYH 3NCJL 4XAKE 3BRDA 3BE1H 4JB9L 3FL7A 3QH3A 1WV7T 5CP7A 3ECBB 5IVXE 5BO1H 5C07A 4Z77B 4K9EC 1K5NA 1WIPA 3O9WB 3O4OC 5IR1A 3PWVA 3PL6D 2VDLL 3K1DA 3O45A 2IALA 3QIWC 3TZVA 3O4LE 2FBJH 4IRSD 4GFTB 1DFBL 3IFPB 3BP6A 4XNZB 5TDNB 2IG2L 1S7SB 5I1LA 2ED8A 3NIDF 5IGXL 1U2CA 5CMAA 2UUDK 4OZFH 4IOSD 2J8OA 1V7ML 1X5AA 3B6SB 1CDCA 3PNWB 3VRIA 1QACA 3HZMA 1BGXH 4E41B 3GSVA 1FFRA 1MY7A 1U58B 1KCUL 3H9YA 1UM5L 2FJFA 3ARDA 5FA3A 4BH8A 1NGXA 2E27H 5AD0B 3O4LA 5MENA 3ZZ1A 1U8MA 5MEPB 1HK6A 4U1IA 4H88L 4KPHH 3WKMH 1EO8L 2BOBB 2PUQT 1BVZA 2LU3A 4NT6B 1DUZA 1JFQL 4PRBA 4YIQA 5B38G 2HA1A 1RZGA 3BDBA 2A6DB 3PDOA 4JN1L 1M7IB 2JE8A 5F7DB 2EC9T 4NO2B 3WIFB 2A6DA 1JHLH 4OLEA 4X5XB 1T7ZA 3STZA 4TRPH 3HPJA 4Z9KB 3BWUC 2VH5H 5F9WC 5GRVK 1C08B 4GAYA 1J0IA 3GSNA 3BEVA 3UTSD 4YDIH 2Q86A 3GSNH 2D7MA 1B0RA 4JKPH 4Y4HA 3QNYA 4U1SA 4RMUA 2ZG1A 1BIHA 5HGAA 4P46D 1IC7H 4PG2C 3IETB 4LCWE 1EUUA 3WO4C 3TGXA 4AEHH 5BZWA 2IWGA 2AJUL 2QQLH 1CL7I 4IJ3B 4KGLA 1M6OA 5EORH 4ZUUA 4GRLB 4RQQB 3MUJA 4XMLH 3U4BH 3BKCH 1EXUB 5GGTL 1T66D 3MJ9A 5C09D 2D0FA 2HMID 2YKLH 1J10A 2ESVE 4R3SB 4Y5XC 3UTTB 1TTGA 1FFNA 4Y19D 1AY1L 1T5XB 4FS0A 1UC6A 3FB5B 1Q38A 2DQJL 2YS4A 4XVJL 4HW6A 3LS5H 4I5BA 1L0QA 2DQIH 1ACYH 2OQJB 4OKVA 4YHNA 1KPRB 3M8OH 3CSYA 1FYHB 3QUML 1I8MA 1MCJA 4JFPB 5EIIA 2A77L 3ZE2F 2PTTB 1V8HA 2DL9A 3O11A 1XAUA 5FECB 1AXSA 3BH9B 1VFMA 1QBAA 4MCZB 1CTNA 1P69B 4MQ7B 1F4WL 1N59B 5B3NA 4HIEA 5EORL 1ZT1B 2J1KA 5CJBA 5D2LB 1CG9A 1TQCC 3T2OA 5IBTH 4RA3A 3KWWA 3V0VB 1CICC 4JO4H 4NN7B 4Y2DD 5GZND 2GQHA 5E08L 3VXMB 4KJWD 4Y88A 3TN0A 1IAOB 1A02N 4UT7H 5IB4B 3GM8A 3FKUS 2P5EA 1NANH 2DF3A 1UQSA 4QRTA 4MVBC 1CE1L 1EHLL 5GS2H 1EH9A 4XCFH 1K9TA 4XTRC 2YPKA 4P5MA 1KPVB 2ZOKB 5FF6B 2IANE 3CK0H 4XNXL 1IFHH 3M8OL 4L8DB 4HV8B 3L95B 1OAXL 4HUWB 2ZOKA 1I7UA 3Q6GL 4HS6B 1XT5A 3HB3C 4ZUVA 2NYYD 5MI0B 1MLCA 5F7FA 4QRQB 2P24A 5DZNA 4NQTA 1W72A 3DX6A 1JGDB 4JGUA 5E2WL 3UJIH 3WNKA 1GPOL 5GJSL 5HXMA 2R56H 1IC1A 1WFTA 3HZYA 1A0QL 5C08D 3MLWL 3EJZC 4JG1L 3BKCL 3WKNA 5LWYH 1QG3A 4UOW1 1IGIL 2DMKA 4F33A 3QDGE 1F4YH 4RBPK 2FGZA 4XP5H 4X0KA 4HUVB 3GJFB 5J57B 4PG2A 4PRPE 2YUXA 4TNWK 1H15B 2D0GA 5T5NG 1IAIL 4UV4L 3QUXD 4BSWA 1OVZA 3PABA 2WBJA 2A0LD 1JK8B 2B2XL 3KPSA 4U6HB 3MODL 2Z0BA 3KPOA 5T3XE 1B4RA 4M7ZB 5IBLC 1B2WL 4PBVC 1CGVA 5LXGL 3UXFA 1GAFL 2XN9D 3EYVB 5D6DC 4XCCL 2BVTA 3BPNC 1D5XB 4MJ5B 3BN9D 4Y16B 1X7QA 4JB9H 1F3JA 3VW3H 4GBXB 2P24B 5FDYA 4WWKB 4F58H 2GTZA 2E27L 3O11B 1J9CT 2D7OA 2IFFL 3LN5B 1S7WB 2EIZA 3SE3C 2Q7NA 3M17B 1S9YB 4D94A 5I15H 1ADQH 5KW9H 4FQXD 2G75A 3VWKD 3H2WA 5L0QC 2IPUG 3UTPE 5D6CA 4D0BA 4KTEH 4QRRE 3B43A 7FABL 1U8QB 1IGML 3MXWL 1HNGA 5JW4R 4F9PC 2NXYB 3LD8B 5B8CA 3H9HB 1Y0LB 4JO3L 1NGYB 3UJTH 3FB5A 5I1JH 4WW2A 1CT8A 1I9IH 1XH3B 4N5UA 1FVDA 5LWYL 2X4RB 2RB8A 5FCUH 4OI9A 2NY6C 3O2WH 3KHQA 4I1NB 4ODUB 2ATKB 4DN3L 1JI2A 2OJEA 2X9XA 3WDIA 3I6GB 2XNAB 4ODUA 1EIBA 2X4TB 4LEXL 3BE1L 4S1RH 1HEZB 3DXAA 4IMKC 3RL1A 2EIEA 2VLJB 5DFVC 4JZNB 1LO3H 3RAJH 1W0YT 3O2DA 3QWRA 4PJEA 5I8CB 4P2OA 1N2RB 5C9JB 2VDMH 1KEGH 1IAKA 1CXFA 3C5ZD 4MNQE 1BLNB 3EJYD 2Z31C 3KXFE 5EULV 3U30B 1MIEH 4LKXB 1RUQH 4WO4D 3B9KA 3ZKXB 3V5KB 1ZHLA 3VGEA 3OXRB 3UROR 5TE4L 2BK8A 3C5ZA 4NC1C 3ULVD 4G42A 3AB0B 1KFAL 3OXRA 2X4PB 2ZCLH 1G6VK 4QF1B 3J8F7 4Y4KA 3ULUL 1JTTA 1WWCA 3O3BA 3VMNA 1DQLL 2VDOL 1AGEB 2XQYG 2A9NL 3QO1A 1FAIH 3ARFB 5C08E 1OP5H 4I18A 1H5BA 3NTCH 1AGEA 4X7SL 4GRWF 2H26A 1RJLB 1WAAF 2DQGH 4Q58C 2X4TA 3TO4D 3BESR 2BY0A 2EZ0C 3FCTA 3FO2A 3FQXB 1MFCL 5CZXC 5EIVA 1A6AA 1XIWC 4P9ML 4QWWD 5T1LA 4NZUL 1WBYB 4GS7C 1OSZA 4OLXL 1KYOJ 1UVQA 1AI1L 3IYLW 3NIDE 1JGVH 2COQA 3MPCA 5DR5H 3O4OB 1UJTA 1D5ZA 4EQ3A 5GQBA 1P4LA 3BP4B 3RNQA 2CXKA 1MAMH 1N2RA 5I19H 4XBEL 3P77A 5E00B 2XZAH 4POUB 3HFMH 4PY8I 4LCIH 4JGJA 4Y5YC 3SCMC 4XVSH 4H8WH 2C4XA 5GISL 2JTDA 2XTJC 4YE4L 2XWTA 1IAIM 3LB6C 5JOFA 2JJTA 4NKQB 4ZYKB 3DV6B 3C8KA 4ZO9A 3CDYA 4HX1A 4PJGA 1JPSL 1V3MA 2VLKE 1I3VA 3DGGB 1EZVX 2KZ1B 4KK5D 3TLRA 2DM2A 2W0FB 4P3CL 3HI1B 5TDOA 1CF8L 1YY9C 1ZEAL 3T3ME 3R06A 4PGEB 2LABA 4OGAC 2MPAL 2YK1H 4PJEE 3BGMA 3MYJB 3HCVB 3TWCL 1UH4A 4UQ2A 3I02B 1HOCB 5MEOB 5FKAB 1ONQA 3BX7C 3D85B 2IQ9H 1J1OH 3BW9A 4M6NH 4XAWL 2VYRE 3LS5L 3F58L 5FKAA 3AUVA 5EU4A 4JFEE 4M7JH 5GGVY 1NL0H 5E4EC 2CLZB 2BVOB 4NQCE 4HS3B 4YBLB 4JHBA 1ZLVH 5IV2A 5DD0L 4HUUB 4PJIF 4ZUSA 3HPLB 1AP2A 2KZWA 1HIML 2AXGA 3GSOB 2FZ3B 1WSST 4GBXC 4R4FH 4N68A 4Y5VB 3WN5B 4H1LB 2DMCA 4GRWE 1HKLH 2VE6A 4PJGF 4LLWA 1A2YB 1ORQA 5HI5D 1HHKB 4R96A 3MGTA 3L3HA 2FX7L 1T20A 5IGXH 4WDIB 3LEYH 4M6OH 4GUPA 1BFVH 3C6LC 5HHOA 3NPSC 1IQDA 3KR3H 1NEZA 3TIEA 2NMSA 1MJ8H 3QIUB 4U6VH 1OW0C 4UQ2B 2YR3A 1QR1B 1HQRB 2ENYA 4YXKH 5IVXB 1MFEL 2IANB 1A6AB 1CDHA 1CGSL 3LD8C 1NL0L 4P2QE 2H8PA 1CLYL 4QY8B 2V9TA 1P9MA 5DLMH 2APFA 1J05B 4YXHH 1G6RA 2E7HA 1KG0A 5CILH 1IGCL 5L2JA 4RBPH 2ICWJ 4WFFE 2VLME 4JJHA 1FN4A 4TUJB 1NMBL 4LPUA 3DV4B 1Z5LB 3L95A 3GMOB 1OGAB 4XCYA 1LE5A 1N0XH 5B39B 3BN9C 3H3PL 1RAMA 2QKIA 5IFJB 4L3CA 5FUCC 3NCBB 5ISZB 3VFTB 3Q48A 4PRPB 2D31B 1ZMYA 3EYOA 4H26B 4EBQL 1CBVH 3JUYA 4B5EA 2ED7A 2VDKL 5E24E 4Y19A 5GGUA 1DN2A 2JF1A 4HKBB 3LKSB 3GMLA 4NKMA 2YEZB 4F9LA 5DVNA 4BFBD 4TOYL 3KPNB 4PJAB 5D1XD 1T21B 1TPXB 3OKMA 3P9MA 5AUMA 4LFHG 1T0NA 1GZQB 3HE7B 2DKMA 3REWB 2KH2B 5DFVD 1NC2A 4RWYL 4FQIH 1CGXA 3NAAL 5LCVL 2PXYB 5FV2A 4BH8B 4UV7H 4M7LT 1NAMB 1ND0A 2P5EE 1AQDB 4PTUB 3PWUA 5ERWA 1KF9B 4JFFD 5D2NA 3QFJE 5KSVA 5IJVA 3SDAC 4I0KA 3NFSH 4Z7UA 3OB0K 1SJVA 1TCRA 3QUZC 3V0AC 5FM5O 2VC2H 4YAQB 4HXAH 2F54D 1JN6B 4ZNEA 1DE4B 1I7ZB 2VZUA 2BJMH 4IMLA 5J8OA 5C6WH 1UACL 1KB9J 1MCLA 3TFKD 3S37H 3V7AG 5JIIA 2FR4A 1MIML 3TBYA 2EIZB 1HH6A 5B38A 2YD1A 1LNUB 4G3YH 4S1SL 3NOIA 5IB3A 1K3ZA 4HXAL 3WDJA 1NFDF 3ILPA 1A6TB 2QBWA 4TSAH 3LS4L 3RY6A 1U36A 1DBJH 1VERA 4MAUH 4PREA 5CSBA 1RUQL 1T4KB 3QPXH 1BOGA 3S4SB 2H2SC 1RU9L 5CAYB 4PJ8A 2DQUH 1HQRA 3RY5A 3STZB 5ADOL 2FHCA 4P5TC 3HAEB 5A16B 4NKMB 2DQUL 5D4QA 3VFRA 4ZFFA 1OTTC 2F53E 3QPXL 3U36B 3MRNB 2AEIT 4PJ9B 3TBSB 5J13B 4G80B 1N8ZA 3KNBB 2N7AA 4MWFB 5IB1B 2JIXD 3HS0A 4C4KO 1NCAH 4N8VG 3IAGC 4IDJL 4YFLI 4LCWA 2LTQB 5TF0A 3FN9A 4LSTL 1JNJA 3HI5L 2PW1A 4P23D 1DLFH 1IGYB 3IVKA 2P46B 4NN6C 3AAZB 3G5YA 4HC1A 5F7EL 3B2VL 1IM3A 5ELIA 4D8PA 5C7XH 3PXHA 4DOHB 5HGHB 2EYSB 4XWOD 4ZUTA 2DRUA 3OKEB 4DW2H 2NTSP 3ARBD 4JPVH 1W72B 1MQ8A 3DX6B 4PS4H 5KAQG 3KYMA 1Z0MA 2H2PD 2EYRA 5EA0L 1IMHC 1QR1A 5MEQB 3OKLB 4XX1G 4L8DA 5CUSH 4J1UB 3N1GC 3NIGE 3SDXE 1JK8A 5HDBF 4PP1C 3UJJH 3AS1A 5C70A 1T89A 5ILTH 4UINH 3DRTB 1CGSH 5HSFA 5FAAA 4OI8A 5GSRA 1OAZL 1EZVY 3ARPA 3VXQA 1RZKC 4ZFOL 1UCBL 4KRPB 1NCCL 4F33B 1DEEA 2QSTA 3O9WC 3VXPA 4JG0L 4LASL 5C07D 1MF2H 3QI9B 5KSBE 2YPLB 4RGNE 3OJVC 4IDLA 1UWXK 5ACLA 4ZS6D 5DQDL 3RWCB 3QUZA 2KL6A 1FG2A 4QXGH 4WFGD 4KVCL 3VDBA 4ZAKB 1UKSA 3F6LA 2XZQH 3IDIB 4A6YB 4Q6IA 1MWAA 4LLUA 4WU5B 3QR2A 1IGIH 5DD1L 2P5ED 5CHNB 5HHMD 2EDYA 2YPKB 2AEQL 4FFWD 4LAJH 1N5AA 3MLWH 4LSPH 4PGBB 3BQUC 4PJBB 2HJLA 1OCWL 1S7QB 5CILL 4KMTH 1QRNB 1U8OA 4RAUB 1LGVA 4KY1H 3V4VH 1L7TH 2Z93B 2X4SA 4KKNA 1X5HA 5HHMB 3U9UA 5DJDA 1G7JA 3RIFF 5EU3A 1S78D 1J1OL 3EO0A 3FONA 4GW5B 3WCYA 1JRHH 2VR5A 2RCSL 1OWRM 1KIUA 2A1WH 1JGUL 5D2LA 4L3ED 1JYWA 2IGFH 5JW4Q 4TULH 4DGVH 1Z3GL 1XF2B 4K7PH 5F3BB 5CSZA 3W11D 4GQ9H 5CLTA 4OT1H 3KLAB 1Q94B 5EBWB 4GAYB 1TITA 5D9SB 1ZS8B 2OTWA 4ZDHA 2EDKA 3ZDYE 5DHXB 5ID0B 1MRCH 4OCXL 1ZANH 5IP4A 3V5KA 4F57L 3FQTA 5DUMH 5E5UB 3GSUB 1KEMH 2HP4A 1T1YB 1LP9A 1VB9A 3BP5B 2FGWH 3KPQA 4KDWA 4J8RA 3MRBB 1AE6L 5KS9E 4L4VB 1QPPA 3HAEA 4MMZC 4ODSL 4UT9L 4XB7A 4HLZH 3N9GH 3U0PA 1SEBA 5F71A 3MLRL 1TJGL 3SDAD 3JWDC 4ODBD 1NQBA 3FO2B 3FQXA 2PW2B 5D8JH 5CEYB 5KN5A 2DWEA 1YEIL 5EZLB 1WTLA 2HKHL 1I3RB 1LK2B 4OZIF 2H26B 1E6JL 4Z95H 1FYTB 1ULVA 2VQUA 3LKOA 1JHKH 2OCFD 2YPLD 3G08A 2ADFL 1CK0L 4HK3N 1WF5A 2X1OA 3BZDA 4K7FB 5EA0H 2RFXA 4HAGA 1A6UL 5C6TH 2DYPA 3BZEA 3CFDA 1BIIB 2GK0B 3FFCA 3H9ZA 4HLZG 4XC3L 4MDJB 1QFWH 5SWZB 1B6UA 4X9FA 4IMKA 3OAZH 1FAIL 2FJGA 3FB8B 2AERT 3KLDA 1QLRA 1YUHB 5KTEH 4OSUL 5HYSG 4JPIB 4P5KB 3FTGB 4QHUA 3VFVB 3BKJL 4OZGE 4YE4H 1RMFH 2ZCKH 3C08L 5I8EB 4DVBB 1HZHL 5SWZE 1F6AB 4ZOBA 1I3GH 1TJIH 3O6KL 2F5BL 3HFML 3HG1A 2HT2C 4EI6B 2DL2A 3ARDD 4MNGA 2E8ZA 2CIIA 1R0AL 4IHOA 3NVQA 5JO5B 4WU7A 1YY8A 4N0RA 3VXTB 1TZHA 5JW5A 3VXNA 1J0HA 3HG1D 5CEYA 3ARDB 3CCHB 3V9FA 4OCYH 2GY7B 5T3XH 3L7EB 5IEHA 4I4WA 2AV1B 3P0GB 5HGBB 4BUGA 1IC4H 1X3DA 2X70B 3KPPB 4XT1C 1NAMH 1E4KC 1SBSH 2GJZB 5DRZB 4YHLL 2EYTB 3R4DA 3VXSB 4NHUA 3ZTJH 4YNYA 4YHPB 3W9EB 3I3DA 5FYKL 1OAUL 4MJ6A 3B9KD 4JKMA 1VKXA 3DVIA 4E42A 3CX2A 3EYSL 3IS1X 4MB4A 1V3JA 3FQNB 1EEYB 2P8LB 1II4E 4RFOH 3THMH 5F6IC 5EOCJ 1KCUH 4LCYA 3FB6B 4PJ9D 1NDGA 5B39A 4NNXB 3CNKA 2VN4A 1RIVH 3MV9D 4EN3B 4G6FB 4HFUL 2R2HA 4JFXB 4HXBH 3V7MA 1R5IB 5D1ZD 7FABH 2ZUTA 3ARGA 4NRYB 1RJZA 5SX4H 4PP1D 3PDGA 3U6RB 4QTIH 3ARVA 3PGDB 2NR6C 4ZO6A 2B1AH 1Q72H 2E5EA 4DKEH 3INUH 5C0CA 4OD1L 4S1DD 1VHPA 1B88A 4Q6IC 4ZD3H 1XF5A 1OP3K 3RDTD 3HRZA 3U30C 1U8OB 3GHEL 4HV8A 1J8HB 3K2UL 4Y5YB 3AY4A 1YPZB 3VFPA 3L3JB 4JFQA 1NEZB 1ITCA 1YMHB 3NAAH 4U1MA 5IOPB 4P59L 4OKDA 4YHYC 3MX0A 1GGBL 4PRHE 5KVEL 3IJYB 5JOPD 4M5YH 4ZNCD 4U1HB 4V1DE 3WYRA 3QI9D 1B2WH 2IAMD 2PN5A 1JHTA 4OD1H 4CBPA 1NLDH 3GSOA 4P57A 3GMRB 1UB6B 2BFVL 5DWUL 4QTIL 1FQ9C 4KQ4L 1IGMH 4LDOB 4YHOH 1MI5A 4K2UL 5C0RL 5CJQH 3U1SH 5K9JH 5BJTA 4M1GL 2Z35B 1G1CA 2YWZA 3ALXA 2NW3B 5DVLA 2AK1H 3QFJD 4CRPA 2HWZH 1LO0H 1RURL 4Q7DA 4YX2L 2OZ4H 1PKQB 5IROC 1NH6A 1LD9B 2EXYC 2GTWA 5FF6A 3BW9B 3MLSH 2WAHA 4F58L 1NCBH 3FQUA 4M5YL 1PKQA 4U31A 4LGPB 1SM3H 3GNML 5I1GL 2P5EB 2BNUA 4ZAKC 2JIXB 2EIDA 1I9RH 3NFNA 3MV7A 2G2RA 3K2UH 3PHQB 3TZVD 4NFBA 3DUUA 1MPAL 3MRPA 3SPVB 1GAFH 2NPLX 5JW4M 2YA0A 4H8WC 4XPAH 1RZIB 1X5KA 1I1CA 4NOFA 4OQTA 3MOAH 4MXQC 3BMVA 3C8KB 4TTGA 5L8JB 2I9LA 1J7VR 4XMPH 3RWHA 4FRWA 5L8LB 1U8HB 2IPTL 4LP5A 2OZ4A 5CGYC 1P6AB 5DRWA 6FABL 5EPMA 3GSNB 5LJYH 4JN2A 5ALCH 4EI6A 3IAQA 3CXDL 4LLDB 5K33A 1MLBA 5DDHB 5DC4B 4HWEL 4JO4L 1JZ6A 1XF3A 2AGJH 3LEXA 2WZPD 4WFEE 4XPBL 5FA4B 4TN9A 4WHDA 5IVZB 3QA3A 2C4FT 5T1KB 4ZG1A 1RHHB 3SKUD 1FFNB 5BRZA 2YC1A 5EBMA 3MBXL 4AL8L 1GPOH 4P2RA 4CVXA 2WIIB 1K6QL 2M2DA 4NHCH 5C1MB 2Y36L 4YDJA 3QDMB 1R3JB 1VFBA 3ESVF 1I8KB 4G8IB 1X5XA 1MNUH 4TSCL 5T3XD 3QDHA 3NH7L 1FVEA 4XPTL 1C5DA 2IADB 4O2FA 3CLFH 4PP2B 4LQFL 3ZKMD 4EN3A 5DHVH 4LSQH 4FXGA 2F8OA 4L9LB 2Q86B 2D31A 4OFIA 1I7RB 4S11A 3DUSB 3LAFA 1BECA 1HZHH 5DRNA 3B3IA 1RK1B 3LKNA 3ZT7A 5GRYA 2ITDB 4ZTPL 4XB8A 1FO0L 4LHJB 4U0RC 1ZANL 3VCLA 4XP9H 1TQCB 2D2OA 5I73B 1OARL 5C0BE 3WLWC 2BY2A 1Z9MA 3EGSA 5DJ6B 5HYJE 4Z7NE 4NQDE 1F4WH 1JL8A 3RPIA 2AK4E 1IKFH 4YC2C 5DJ2A 4GKZA 5E03A 5DD5L 3TBTA 3O2DL 3K46A 1N5YH 2DN7A 4YDJB 1CVSC 3VXTA 3BZFB 1CDIA 3JWNC 2CUHA 1S7VA 3IFLH 5HHPA 4L9LC 2JCCB 5HY9A 1ACYL 3DO7A 4O02H 1X5FA 3GUTB 2H32A 2OXGA 2X4QB 3L1OH 3TPUB 1ZXQA 2W59A 2G9HB 1B4JH 4WEBL 1YN7A 2P45B 4FQXB 32C2B 1FC2D 3O2VL 2J88L 4WUUE 43CAA 4HS3A 1XGRA 5D9SA 2QR0A 2LVCA 4JN2B 3RQ3A 5A3IC 3MBEB 1T04A 5D7LD 3V4UL 3FAXA 2J6EL 2VDOH 5DA0B 3M17A 4LDLB 3C5JB 1KPUA 1IC7L 4ZXBD 1EFXD 4NQSA 3QFDB 3HR5A 3RDTA 4ZXBC 4OZHF 5ETUB 3MRFA 1PW3A 1T03H 1UZ8A 4UB0H 1IM9D 2DKSA 3CSBA 4XNMB 3BP7B 4NO5B 4WJ5B 3MRDA 2F15A 4I9WD 3TH4T 1NLDL 5E1AA 4EOWL 2VLJD 5LQBL 5D7KD 1MAJA 5ESVB 1TZIA 2RCSH 4PJ9C 5E70A 4LBEA 2HJLB 4LKCB 4UIKL 3SOBL 4NCC2 4XPFH 3MBEC 4G8EA 1AXTL 1UEMA 4X5WB 2VQ1A 5HYJD 2NR6D 1HDMB 4F37K 1U93B 1ZK9A 2VQ1B 3C5SB 1HSAA 1ZS8A 3SDDC 4ONHB 2DTSA 4ZO7A 3OKKA 3TCXA 5F9JA 3FFCD 3DMMA 4U05A 2AAVA 1ERNA 1DZBA 1XF2A 2HKFL 1KYOK 3PWNA 1F8TL 1T3FB 3NFPB 4NDMA 5JXAL 1VEOA 1RI8A 1V7MH 1GC1C 5FM5M 3O9WD 4DZ8A 2YPLE 3QQ9C 1LP9F 3CMGA 3UP1A 3PWPE 4QYOA 4D8PB 1NBZA 2WWKT 1G7MA 4M7LH 1ADQL 4UDUA 2NTFA 3U7WL 3DUHA 4ZS7H 5FUCE 3SQOH 1KB5A 2HFTA 1NANI 1MFAL 5C2BH 4QHNB 4NNPL 3SJVD 3EOAB 3OKLA 4PGBA 4QOKE 2ED9A 2EDNA 4OD3L 3VW3L 3E8UL 4ZXBA 4P59H 4WUUA 4MS8C 2OL3B 3TBSA 4JFYA 1BD2B 1D9KD 1HDMA 1TTFA 2ICEB 2DBLH 3RVTD 3BIKB 4LVOB 3WSQH 5FKPA 4JLRA 4ZPTB 2N4IA 5I1DA 5BQ7A 1SJXA 1HINH 2NY7L 2F5BH 2PR4H 4KDVA 2PXYD 1W2KT 4OF7A 3H9SE 1URLA 4WI5A 1G7QA 3P40A 4J3SA 1P7KB 1P4IL 3WJLC 4E41E 3VXQB 4G42B 4LGRB 1XGUA 5FCSH 2WP3O 3RJDA 2CRMA 4IJ3C 1U8KA 5HYJA 3TH2T 1Q9OB 5MERB 1FVDB 3LIZL 1JTPA 3SGDI 1K2DB 3HUJE 4FP8H 5DMIH 1FNGA 3T8XB 4NUGL 2UWEE 2Z92B 1M7DA 5J1TC 4M48H 5M94B 4KI5E 3SE4C 1RJCA 5HVFB 5GRVL 3IFOB 1R3LA 1O0VA 4TYUA 3EOTH 2I60H 2P8MA 5F1KC 2VLJA 2V9RA 4YH6A 5ESVA 2LE9A 4OLUH 4M9OA 1IC4L 4H25B 1RIUL 3R0MA 4M1CC 4RGND 4I0PC 5BMFH 4O9HL 3OPZH 3QYCA 2PYEE 3QNXA 4MXWH 5HYEA 3DTXA 4XNXH 1CWVA 2BOCA 4OF3A 1YNKL 5BXFA 2A73A 5JUEH 5J0BA 1FYTD 2BVUA 3MLRH 2I26N 2WQ8A 1QFUL 4FQHB 3RNKB 2YD4A 1QQDB 4PRIE 2NNAA 5BRZE 4FTVA 4LK4A 1LO2H 15C8L 2NY5H 3WHXA 2X89A 4ELMA 3T0EE 5KSBB 3DHJA 4EBQH 1CBVL 3V6ZB 1H3PL 1N5AB 4X5XA 2MHAA 4OAWA 4UZGA 3EGSB 2EC8A 4ZSOA 5TDPB 4PJDE 4NBZB 4OT1L 4WTXA 3ZDZE 5DJAB 2FX8H 3VH8B 3KPSD 4OLZH 4JM2C 3B5HA 4ALAL 1TETH 2IGFL 3NABL 1R3IH 1UA6L 3X13A 2AW2A 1KB9K 4MD5A 2DQCH 5I18H 4JFHE 2YPVH 2X1PA 3I6GA 4PJBF 3QUMH 1IM9B 4MLSA 2C1OA 4PJAA 1H3GA 3TBVB 1RZIA 3NIGF 4ZOAA 5D6DA 1YEIH 4JLRB 3PP4H 5AZ2L 3BO8A 3UC0L 4R0LC 4LU5H 4QWWC 5HYSA 4NUJA 1CE6A 3VFSA 2G2RB 1OCWH 3TC9A 3A6CL 3JVGA 1HKFA 1EGJL 2VDQL 2CJUH 2EDQA 4HWZA 2AEQH 2ICCA 2CR6A 4OCWH 1YMMA 1U3ZA 1WCBB 4KVNH 2K7QA 1DCLA 3AU1B 2JLLA 3E6FB 1LE5B 1D5BB 3BI9X 3OHXA 2OJZL 4PP2A 2F53D 4NM4H 5HDQH 4JFHD 4ZPVB 2HFFA 4K7PL 4RGNB 3V4UH 1DBAL 5DRWB 2P48B 3C09B 4EKXA 1JRHL 3MYZA 3A6CH 4NC1E 1FNLA 1D5XA 4OGAD 4JPWL 1T21A 2OP4L 4TNVF 4PJBA 1U6AL 1AD9B 2XWBA 3UC0H 1F3DH 2FATH 4KKAD 3ULVE 3HE6A 1DBKH 1Q0YL 4P46A 4V1DA 4PGZA 3WV0A 1CD9B 4O51A 3GIZH 4RSVA 1T80A 3JTSA 1C1EL 2YXMA 2EXYD 2YUZA 4M62H 1KTLA 3O6LH 3Q2CA 3VI4F 3CVHA 2W91A 3O8XC 5FM8A 4ERSL 4YBQC 5DD1H 4CVUA 3CGTA 4N0UE 3KAAA 1KPRA 5EU5B 3IF1A 2VUOA 1XR8B 3RGVC 4JVUA 4WFED 4D0CA 2IBGA 4J4PA 2HTKC 4IOFC 5C0CE 1LO4L 2RGSA 3S9DB 4XBPA 3AREA 1FE8H 2QQKL 3PWJB 4N8CH 4NP4L 4UU9B 2A74B 4NQDB 5C0IA 4MCZA 1X5ZA 2NY4C 3GK8L 3U6RA 1X6LA 3RVXC 3QUYA 2CO6B 4JG0H 4P4KA 3A6OA 5I6XC 1AFVH 2HJKA 3G6DH 4NCDA 1EBAA 1KC5H 2CXGA 3LKRB 3RZCB 1R5IA 4TVPH 4CDGC 3EZJB 4CAGA 1HH6B 4PJGB 2B5IB 3UZQA 2OS7A 1OAZH 4HSQA 4J1UA 4XBGA 4EXPX 4OF5A 2IQAB 3KPTA 3ES6A 3S98A 4NBYB 3UJJL 4E41D 3KYMB 5DVOA 5GRJH 4J2XA 3BGFB 2P5WE 3WD5H 2ITCB 3S36X 2HLFC 4NO0D 2ORBL 4PY7B 4O58L 1GGCH 4WI9A 1MSPA 2I60L 4G6KH 5IG7A 5C0AD 3BD5A 4Y5VA 1I8LA 1UB6A 1FZJA 3MLUL 3FB7B 1YEDB 4R7DB 3MV11 5CEZD 5IHZB 2EDTA 4OV5B 5EUKA 4N0FB 3HPLA 2BY3A 4FP8L 3QQ3A 2HTLC 3TV3L 2N7BA 4KQ3L 1R5VB 3S37L 1TENA 1OPGL 1NCNA 1NUNB 5C2UB 5FB8B 3Q5YA 3P11L 1DLHB 1ZT4B 3O4LD 5K9OB 3ZTNH 2IPTH 4P2RD 4G6MH 5DJ6A 4IDJH 2BX5A 4QNPE 1RVFL 2CK0H 2ARWA 1A6VL 2KQMA 3VRIB 1MRFL 2X4UB 4XGZA 2XZAL 3U4EB 1MHEB 4L3CB 3O0RL 5H94B 3QFJB 1C5CL 4Z7VF 1OTUD 5HHQA 5I19L 4FOMA 2W07A 3EYQD 4D0DB 3IFNH 2CKBH 2R23A 2N56A 1NFIA 1X4XA 2FL5B 4IRZL 4P49A 4YZFE 3BAEL 1I9RL 3IFNL 4YDKH 3ARGD 3GMOA 2ZUYA 4RWYH 4XCYB 1A7NH 5JOEA 4O2FB 4OD3H 4I4WB 2FO1A 1EFXB 4WFGE 4HIHA 3PWUB 5IWLC 3WFDH 4NZJA 5F89A 3D18A 3AMKA 3QUMB 2IAMA 2DMBA 3B83A 5I2IB 2JJSC 3B6SA 4O5LL 4CU6A 4PLOB 2VZOA 4CADA 4UTAH 1CGTA 5B4MC 1UXSB 2JJVA 1HHJA 4NQCD 1F4HA 3WXVH 4P5TA 4IRJC 5C0RH 1KXVC 1LP9B 3BP5A 1KFAH 3PWPB 2HYMA 4BH7B 3LKSA 4K71C 4I13B 4CL7A 2D7NA 1BBJA 5MEND 4DKAA 3LN9A 4F7MA 3IDJA 5DVMA 4Q9RH 4F8QA 1EEQA 3CDGB 2XWJA 2VLKD 3PXJA 1SYVA 3JV0A 1ZA6B 3KYOA 3HE7A 1HHGA 4TPRH 4U0QB 4QRPA 3QWOA 3AM8C 2W0LA 2P43B 1LHZA 3KPNA 4ZPTA 4K7FA 1ZVHA 1FNHA 2R1YB 1MJ7H 4DN3H 2CO7B 5IIEB 3QUKA 1NCDL 4LSRL 1A8JH 3PUCA 1BQLH 1U3HC 4FZ8H 5CJOH 4H25A 4OM0L 1UZ6E 4KI1A 1A6ZB 2WINA 3UJTL 1P1ZA 3AROA 5E99H 5KJRL 2L0DA 2BMKA 2ATPA 3VD9A 5MHSE 3ME0A 1RULL 3LN5A 1M7DB 2UV3A 1J1PL 3KPRB 1GH7A 1GSMA 1JWMB 1HI6B 3UYPA 4YWGH 1AC0A 4HFWA 3IDIA 3PABB 3TT3L 4KK5C 2Y9RT 1S9KC 5SX5K 2NTFB 2V5RA 3HE7D 3AXLB 1F3JB 2H1PL 1YDPA 3UO1H 2UY6A 3IAPA 3ABZA 4ERSH 2OBGA 5HGDB 5KG9A 3B9AA 5JW3H 4GO6B 3WNPA 4ETQB 3MRIA 4GKNA 3P4OB 4U4BA 3SHSA 4NKDA 1DBKL 1R24A 3OKNB 1KLUA 4C83B 1A9EA 5SV3A 5SWQA 2C3XA 4V2BA 3ZDXF 4HUKB 4D9RE 3DRTA 4MLIA 4MJ2A 5DJDB 1ZE3C 4NCC1 3T77B 5L2KA 1J8KA 1CFQB 4KHTH 4N0YH 4QRPE 4ZUVB 1EHLH 4QXUH 1JNHB 4BA8A 1N5YL 2J2ZA 3IJSB 4WENB 2AQ2A 4KK6D 5CJ8A 4FQLH 3WXWH 5L2KD 5EOTB 3L3IB 1QNZL 5B22A 35C8H 4GBXD 1KB5B 1S7WA 1HYSC 5ICXB 4KK8C 1CLOL 3E1F1 2LFGA 3U46B 2VLKB 3HB3D 3VJ6B 4BQ6A 4U3CA 3BQUD 3QUYB 3WN5C 3ZMRA 2VL5A 1A64A 3VU2A 3ROOA 1YEKL 3C6LD 4AQOA 4OFVA 1HHIA 4XVTH 1O7VA 4XRCB 2QADD 3Q1SL 4WVRA 1S78C 1J5OH 3V5HA 4LQFH 4N0CD 2V7NB 3K8MA 5J11C 4F7PA 5C6TL 1KLGB 2DQFA 4OIIH 1E4XH 2ADJB 1FSKC 1UQSB 4H20L 1DL7L 2WMPA 5F1IB 3WJJC 1N8ZB 3MRLB 3GDBA 4F37F 2F53A 5HGGS 4EI5C 2F58H 3CSYB 2OL3L 1I8MB 5DEFB 5HGBA 1CFVH 3OJDA 2M26A 1Q9KA 2DJSA 4P2OB 1QLEH 2VN7A 4PUBH 1BZ7B 1F5WA 2ZUQB 3BFOA 5F93C 1PZ5A 4EDXA 3K0WA 2QQLL 1QBLL 3QDJE 1PLGH 2KUTA 1JIBA 3WFBH 4DCQB 3D48R 5F1NA 4L4VE 5KVMC 2NQCA 2YXFA 5FHBL 4PRAB 5I74C 1NGWA 1KBGL 3G5XA 1QA9A 1MCFA 2A6IA 3N1PC 1MCWM 3DSNA 4NQSB 2PETA 5I8EA 4DVBA 4JDTL 2AJ3B 2QQNL 3OHXB 2FX9L 1J88A 1NCWH 4AT6B 4UAOB 1OTUC 5F88A 2A1WL 1IILE 2F58L 1PYWB 2V2XA 3SCMA 2XIDA 4UT6H 1BJ8A 3ZDXE 5E9DD 3MSPA 1QD0A 3MQIA 4HWZB 5TFSL 5E7BA 3SCMB 1JBJA 1LE9A 4NHCL 2AJVH 3IGAA 4R4NC 4KZEH 5BVJB 3S5LB 4MA8H 3LQAC 5IB5B 4HIHB 1MFCH 3O3AB 2P5WA 3V4VL 4EEEA 3VH8G 4AL8H 2X7LB 3QQ4B 4DFIA 5DJXB 5IB5A 4J12A 5FCUL 1FNSL 2IH3B 1NC2B 4XMLL 4U7SA 3MMEA 3OG6B 4KTYA 4JQVC 4DK3A 4P3WA 3EDKA 4MQ7A 3MMEB 4PJXA 2NY3C 5F1NB 3UBXB 3N0PB 4M61B 1WCQA 5ACZB 1YQVH 5D1QC 3RZCC 2BHUA 1CT8B 1RULH 4J3VA 1F6LL 1BX2A 2EDLA 4OZ4A 3ZHLA 3MFGB 3QCTL 4AEIH 1TVHA 4M7KH 3GGWA 3C5ZC 2VH5L 5T1LD 4K07A 4PJ7B 2VITA 1HCFX 8CGTA 1MLBB 1JCKA 1R5VA 4OQ1A 2HH0L 2G5RA 3SE8H 1TJHL 4KKBC 2F53B 4N0UA 2WBJD 4YQXH 5C0CD 3D3VD 4YGVA 4ELMF 1I9JL 1HWGB 3U83A 4NZDA 5DZOA 5T1MB 1YEFH 4AENA 1OQXA 2AI0L 5BVJA 4P23B 1IQWH 2EECA 3MRGB 4PY7A 2YUWA 1QSZA 3GMPB 4L5FL 5KVGH 2B0SH 3MRQB 5JORB 1I9IL 5E8EA 4NQDA 4YX2H 4OJFL 1NFIB 3TF7C 4PJDF 3QBTB 3TO4C 2DQDL 4X7TA 4U3XA 1MCBA 3QCTH 4AEIL 5KANG 3MC0A 2XTLA 3TIEB 4Z5RA 4PJAF 4DOHE 4PBXA 3P4NB 2IG2H 2ICWA 4WDIA 1NGWB 1Q9LA 2H6PB 4PJ5E 4PG9B 3U7YL 5JMOC 5D70H 3HE6D 1DLHA 2LAAA 2NY1D 2R0KL 5KOVC 1VEMA 5F1IA 3TO4A 3AB0C 1WBZA 1QVOA 5JHLH 4BKLA 4FZ8L 4L4TB 5CJOL 1QYGH 4M43H 1Z2KA 1FZKA 1ZHBB 4KK6C 5ITBH 2Y7QA 5JQHC 3DV4A 4KRPD 2GFBA 5JLZB 3QRFM 3VGAB 2XG5A 5D1ZA 1MUJB 4BELD 1QSFB 3OJMB 5TFSH 2Q8AL 1NGPH 1F2QA 4OD2A 1DANU 1HSBB 3LHPL 4JFEA 25C8H 3SE9L 1MFDH 3SGEH 4IRSB 4RMSA 3C5SA 3TJEL 5DK0B 2LAGB 5EU6E 1FFOA 1NCWL 3A0OA 4Z5RB 1YMHA 4AJ0A 1KXTB 4GOSA 2MKWA 4JM4L 3TZVB 4MA3A 3E6FA 1G0XA 4LLYB 3GSRA 5IFHH 5FGCE 1KBGH 4ZS6C 1IEAA 4AM0A 2Y23A 3I9GL 4X4YB 2Y07H 3V52H 2W38A 5B39G 1PG7L 4P4KB 3HI6L 3LMJH 2VABB 3ALPA 4HBQA 2Q87A 3UTOA 3UAJD 2FH6A 3OTTA 4PUBL 5EZJB 4Z0BL 5BZWB 5T1DH 1XCTB 1ZLUH 4PJFB 4ELME 4LL9A 4K3EL 3S8WA 5ETUA 4I3RL 3VMPA 3ZYIA 3ORJA 2HAZA 4R2GC 4UNTA 1A4KB 1K8DA 1K85A 2V2WA 4GT7A 4K8RC 3SJVB 5L88H 1A6ZA 4JO1L 2DICA 2YZ8A 1D5ZB 4NHUB 3RBSA 4YDLC 3KPLA 4B7IA 5MI0C 4NO2A 5HVHB 1C12A 4Y5YA 5T5FH 1AKJB 3AGVA 3NPZB 2VXSL 3P4OA 1D9KB 4AIXA 3PL6C 4OTXH 2CK0L 4TVPL 2PKDA 3LQZB 5EUOF 5FYKD 3RHWF 4KMQA 2WINB 3ISWA 4LVHB 4XAKD 2MCPL 4HUMB 1INEH 1M1SA 5MP6H 3VDAA 1N59A 5TPWH 2VDKH 2X42A 4X6EB 4QXWA 4QHLB 2CIIB 1AIFA 4NP4H 4GRLD 1T1XB 3GBLA 4M1DH 4IBLT 3CMOH 1WFUA 4BZ2H 2QV2A 3NZHL 5J1SC 2NZIA 5DJ2B 2BZDA 3E3QC 4G6JH 1CDBA 1F4XL 4N9GB 4EI5B 1FV1B 3ULUF 2VKWA 5DO2C 4P5TB 2VUYA 5EU6B 4PRHA 1CICB 2FBOJ 4OQTH 1GCFA 2DQTH 3BGMB 1CK0H 4KRMB 2R2EB 5I76B 3NGBB 2R23B 1JHKL 4R3SA 2D7TH 3S3PA 1WC7A 3H9SD 5ESQA 3QUZD 1JFQH 4FNLH 3UDWA 2IALB 5E2UH 4PJ5D 5F97E 4XGZB 2AJXH 2D4DA 4KY1L 1AHWC 3GM0A 1KJVB 2R4SL 3WIFA 4BZ1H 3DLQR 2FEEL 4HEPG 4O2CA 2IADA 3ARUA 4ODXA 4L4TE 5EOCL 1DQJA 3KR3L 4D3CH 3ULVC 2H1PH 1YEHH 4JANA 1DBAH 3QHZL 4QHLA 5DHVA 3TP4A 2WLZA 3GBML 4YZFF 5I1AA 2FX7H 1X5JA 5DUBA 5DUPL 2FJHA 2Z31D 1QBMH 5F6HJ 3OJDB 5DQDH 3ARFA 1A3LL 5E2VL 3L5JA 3CFBB 4OZ4B 3MACH 2XY1A 4CNIB 4QRPD 5ADPL 1L7IH 3HC0A 2BHYA 4TUKL 4X7EC 5C8JA 1A7RL 3EIFA 4HS8H 5DJZB 4PGDA 5FYLH 4BUHA 3KYAA 3WUWA 4QRRA 5I73C 2CUIA 5KVFL 3WS6C 1ZWIA 2QSQA 1A6WH 3MRLA 2BNQE 1V05A 4XWGH 1BQLL 1FZOB 3JBG7 5IK3B 3UBXI 2NZ9C 3FT4B 5DMKA 2IAMB 2YD5A 2AJXL 4M93C 4M7JL 4R7DA 1LEKA 4HG4K 3L3DA 4CU8A 4J3UA 5J12B 3U9PL 3ZL4H 3V6OA 1K5NB 2HLAA 3JTTA 2AP2A 1NUFA 4MNGE 4RISH 3OG4B 3B4NA 1RQ5A 3MA9L 3L5WB 2R8SH 4QOKA 1KJ2B 2V5MA 5F7NC 1NSNL 4JKLA 2DD8H 5TGBB 1UM5H 4GW1B 2WWMC 5CD3A 1FNEA 3ARBC 4JFFB 4L4VA 3GI8H 5CJQL 3U1SL 5K9JL 1RZ8A 3QQNA 3O6FB 3B8YA 4K2UH 5IWLA 2AJ3A 4WW1A 1P2CB 4WFHE 5FYJE 3BN3B 1XF3B 1BREA 1OT2A 1MWAB 4A6YA 4M03A 1L6XA 3FOLB 4ZQKB 1OSPL 4LRIA 1UYWL 2C3VA 1HE7A 1A7PL 1NC4B 4RNRA 1N26A 3TBWA 1EEZA 3DJ9A 2EDXA 3SY0B 4G6AD 5GS1B 3F7YA 4PRID 4F7PB 2X4RA 4P4KD 1K4DB 3WUWG 4NZTL 2GFBB 4UOJA 1NMAL 1DVFC 1T2QL 4J6RL 3KXFD 1MH5B 2J6EA 1DN0A 1K4DA 2EDFA 3FQRB 1JGVL 4GKSA 4LCCA 3ZHKA 2ZZUT 5EU3B 2FECI 2W9DH 5F3HB 4GBXA 2MTPA 2ITCA 3HAEG 3VFOA 4OLWL 3SGJA 4DWHA 1BD2A 1AGDB 3S34H 4A6YH 1JWMA 3F65A 1TETL 2AK4B 1HYSD 4XMKH 1WEJH 2Q3AA 4K3EH 3HR5B 5DD3H 2DQGL 3L5XH 3S36H 1KXQE 4WW1B 1SMOA 1KIRA 3OKOB 3SQBA 1J87A 3LMJL 2CIKA 3VD5A 1AO7A 2GSGB 3P11H 5BCAA 2BNRE 3H3KA 3KPSB