4WFED

Human traak k+ channel in a k+ bound conductive conformation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
211
structure length
211
Chain Sequence
b'QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSNSPPTFGAGAKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
molecule tags Metal transport
source organism Homo sapiens
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
total genus 51
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfeD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfeD01
5E5MA 3FB8B 4KTEL 3VXUA 5IBUG 3R0MA 2C4FT 4O02L 2FYYB 4KVNL 1O5DT 2EO9A 3WS6A 4YGVB 4X7EC 4OLXH 1MFNA 1QEWA 3H42L 2BY2A 3WXVL 1BLNB 4U3XA 2A1WL 3FOMB 1RZJH 5E8OB 4MB4A 4LLVA 2G5BA 1R5VA 4CL7A 4FFZL 4R8WH 5I76A 5CIPB 2BOBB 1I9RH 5IB2A 4Y19B 3STZB 1BQLL 4X99A 5KBNC 4RMUA 4NDMB 5KG9B 4GMTL 1NCBL 3ULVE 1G7HB 4KKLD 2Z4QA 2OZ4L 2UZIH 3BP4A 1F58L 5EU5A 4QRSB 1UWEH 5HVWA 1ZHLA 4MSWB 5T5FH 4J3OC 3CZFA 3GO1H 4HUVB 4PGEA 3MV7D 4M8QA 1BHGA 2G75A 2M26A 3GGWA 5DXWA 3UO1H 3IDIA 1LILA 1Z9OA 5C0AA 3QIUD 4PYGA 4K7FB 4PGCA 4UIKH 1E28A 2FBJH 3SGDH 1PJ9A 3SCMA 5IFJB 2OLDA 3CJJA 5I73C 1HOCA 2J8UF 1RJYA 1IRAY 2H8PB 3V6FB 3C5ZD 3GKWH 2H6PA 4OCYH 2Z35B 1H5BC 3DECA 4MLSA 1OW0A 4HUXA 3IDJA 3KPLA 4BQCA 2DLTA 4L4TD 3ARDA 1ZLSH 4IRSA 4EDXA 1RZIA 1U3HC 5JA8B 3EDFA 5E2TL 4TVPL 5IMOB 1ULVA 2VLJD 3DVFA 2DJSA 1KNOA 1YEDB 1IAMA 1MJ7L 4KQ4L 4X7DC 4PJ9C 3O6FD 4CMHC 3VD5A 3F5WB 3R4DA 2BSSB 3H8NA 1LHZA 2CUMA 4UT6L 1U95A 4KMLB 4JB9L 1P4IH 3SOBH 3CFDB 5JR1H 3VXQB 2X1WL 1JPGB 1E27A 4L4VA 5D7SH 1I8MB 5JQ6L 5IMMA 4YXKL 1MCKA 2B2XH 2EKSA 3HNVL 4E5XB 5LWYH 1IC4H 2O61A 4QTIL 4XI5D 4LAQL 5HGAB 5C09A 2NY4D 3V2AR 1JL8A 4LPYA 3S36H 3HE7B 4O4YL 5A1AA 5GRVK 4HXBH 3SDDC 4Z0BL 2FJGB 3IFPB 5K9KB 1PLGH 2NY5H 4AEEA 2Z91A 3H42H 4NQEE 1P4LB 3OV6A 4NJAL 4Y4FB 2HTKC 3SPVA 1YNKL 3G5VB 3DHJA 3LN4A 4XMKL 4OZ4B 5I1AA 2FEEL 3M1BB 1A64A 4UINL 3D3VA 3W0WA 1S9XB 4KKAD 1KJ2B 1REIA 5GGTH 5E2UH 5H2BA 2IFFL 2IBGA 4PD4J 3QHFL 1MRFL 3EJYD 4XP9L 4NC1E 2F74B 2JK5B 3WO3B 2Z31B 4Y2DC 4ELMA 1ZK9A 4ZNEE 4NNYB 3V52L 5D7LD 4QY8A 4KRPB 4PRIA 5DJCB 2Z92A 3FB8A 4TVSa 2GK0A 5C2BH 3VMOA 4X4YA 3FQWB 1Z5LA 4JJ5A 1KLGA 2FL5A 2AK1H 1T2QL 3DPBA 4OCNC 4FP8L 4ZFOL 3L7FB 2OTPA 4ODSH 1JGUL 4U1IA 2XWJB 4HPYH 5I1LA 2ATPA 2QHLA 1OARH 2XTLA 2D7OA 3K8KA 2F19H 3EHBD 4WTZA 1YPZF 1YY8A 4G9FE 2AS5M 1WAAF 3HG1E 4R90L 1P69B 4JDZA 1FG2A 5J6HA 1K2DA 2VQ1B 4GRWH 4KC3B 3RNKA 1CDBA 3TFKD 3IXAA 3QEUB 1AQDB 3JWOC 4NNPH 3V4VH 3ZDYE 4OZIF 2J88L 3TBWB 3Q5TA 5GS0D 3ZKNC 2Z8VC 2VDPH 4LGPB 1UCTA 4Q9QH 1V8HA 3BKMH 4K2UL 1HHKB 3ZYIA 1H8OA 2J4WH 4WV1A 2WANA 3HE7A 3ILQD 1ZTXL 1FO0L 1WFNA 4L29A 4OZHA 5TF1L 3MA7A 2YD5A 4V2BA 1K4CA 4KQ4H 3DROB 4M03A 4BK5A 1MNUH 5FCSH 3I85A 3PV6A 5E99L 3ARPA 3H7LA 1T83A 3RI5F 1WJ3A 4GT7A 1D5XB 3PWPE 2XQBH 1GOFA 3VWKD 3S37L 2NW3B 5ICXA 2G9HB 3O6LH 4X4XA 1Y6KR 1Z9LA 3N1FC 3RWEB 1LO0L 4X0KA 1CS6A 3H3PH 1OQXA 2YWZA 4JFPA 5DYOA 5IMOA 4TNWK 1U3JA 5GQBA 4D9QE 1ZHKB 4GG8A 4BK4A 3T0VA 3ARBA 1X5KA 2K7QA 1HHIB 2VZVA 2KDGA 1DL7H 3MLVL 4W4OA 1DANU 5DMJB 1IGFL 4M93B 4RQQB 2IMMA 3UXFA 1BX2A 5FYJD 2O93L 4OUOA 4L3CB 4FTVA 4XP9H 5KANG 4G8EB 1WICA 2FATH 1ZSDA 5MERA 2R39A 3O8XD 2UZYB 2OM5A 5E2UL 3GNMH 2P44B 4K7FA 4QOKD 3RY5A 4OF8A 1TITA 2R23B 1I9IL 3C60B 1LEGB 4MD0B 1CDCA 4HBCH 5I8OH 3JV4B 3TCXA 5CEXB 4WI9A 3DXAA 3REVA 2AEPL 1MCSA 1U8JA 3TN0A 1F3JB 2ED9A 4KDWA 4U1LB 4BQ8A 3P4OA 1EGJA 3QFJA 3RWGA 2EECA 4NHUA 4KROC 1L7TH 5GGSB 5F9JA 1BOYA 1G7HA 4LSSL 2ICEA 1WWWX 1NC4A 5F3HA 5FOBB 3ARBC 4DVRL 4APQB 2EC9T 4GUPB 5JXEC 3MX0A 1N7MH 4RZCB 2NY7H 1B2WL 3QCTH 4ZUTB 4Z7WF 3B9KC 3KPOA 5HDBE 4Y5YA 5HGHA 3IETB 1JGLH 5IQ9B 1VCAA 2ZPKL 3X11B 3EGSB 4MJ6B 2H9GA 4EUPG 5TDOA 2DRUA 4LKCA 4OZHE 2VE6A 5T1KB 3VXUB 2Y1VA 1HNGA 1NMCB 1MCOH 2FSEA 3FL7A 2VYRE 1CGUA 1U8MB 1X5YA 1KSRA 1TFHA 3AREB 1J88A 5D1QD 3VH8A 3JV5A 3QRGH 1MNUL 2FO4B 1GHFL 3L3JB 1UT9A 3GIZH 3O3AB 4YBLB 1EAPA 4IOIA 2J4WL 3SE4A 3GHEH 1NCWL 4OJFH 5DK0B 1BF8A 1KPRA 1OAUH 3SKMB 3TESA 1BP3B 1SVZA 5I30H 3OX8A 3GI8L 1R3HA 4LVHB 3GHBH 4K9EL 5CZXC 4F58H 4EKXA 2EDTA 1I4FA 5DC0A 3N0PB 4DGVH 5L0QB 3LIZH 4KVCL 4F9PA 1HCFX 3IFNL 1BQUA 3BGMB 4LASH 5KSBE 2A6IB 3IU4L 5KVGL 3MJ8B 3SCMD 3P4MA 4PJ9A 1VADA 1DJSA 3NTCL 4ZAKC 5E9DD 3LQZB 1G7LA 4XPTL 2VLMD 2ARJA 3GIZL 2EKJA 1F58H 3F7RA 3MRRB 1CFTB 4M1GL 3HC4H 4HXAH 5C0AD 4ELKA 3T65A 3EYSH 5L2KA 4OGXH 4XI5C 5DC9B 4WFEE 4FQXD 4RFNC 3MRIA 4DEPB 1IQWL 3MCKB 3MRGB 3G6DH 2ITDA 3RIFF 3HE6C 4HLJA 1QBMH 2VXVH 4CVWA 4J1UB 1KIPB 2SEBA 2VDQH 2WWMC 3SE8L 2H41A 2HKHH 4PR5B 1F4HA 4HIJB 3ZHKA 3DSNA 4JFDA 4XVJH 4GO6B 1C5CH 2NXZD 5GRWA 3PGFH 2A0LC 2JLLA 3PDOA 5B3NA 2W60A 1JHLH 2XACC 3DX7A 1IGIL 2Y07L 1TVHB 2XWBA 3GUTA 4NRXA 3VXTA 1RZ7H 1A22B 4WV1B 2Y25A 5HHQB 3RGVD 4ZQKA 2FX9L 2XKUA 3OAZH 3A0OA 3RZCB 4PUBH 5I1EL 5I6XB 3OHXB 3TIDB 3MRMA 4NKOA 3M8OH 2YPLE 3TWCH 3GSUB 1FGVH 4F37F 2X4OA 3HPLA 5DJZA 4NKMB 1CGXA 4TRPH 4NT6A 4H1LA 3S37X 1M7IA 4JFOB 5CSGA 1M7DA 2E27L 4H25A 4OIAA 2NY1C 2XZAL 1YNTA 5JR1L 5L2JB 4KH2A 5F7DB 3QXAB 3IJYA 3J8F7 3AMKA 2N4IA 2R4RL 1MFDH 4XH2B 3C08H 3QQ9D 4EN3B 4N0FA 1VFOA 3GMOB 1PZ5B 1MCIA 1UJ3B 2ICWI 3VU2A 5EBMA 2Z93B 4X8JA 1AHWB 3S3PA 4ONFL 2YD1A 4CNIA 1RJCA 5IHZB 3L1OL 2KPNA 4BYHA 3LKPB 4NBYB 3D85B 2W0PA 5KSAD 5IHBA 3TA3B 5L2KE 2OYPA 4WJ5A 1HWGB 3CDYA 2MNUA 5L8JB 2V2TB 1AKJD 4U1GC 4RMTA 2D31A 2V7HA 3KPSD 1G1YA 1UB6A 3C09C 3PV7A 2CXGA 5C0GB 5GGTL 3KJ6L 1MI5A 3GSUA 2BY0A 3L95B 4WI7A 2BZDA 3PNWB 5DD6B 4Q6IA 1T2XA 3VXMD 2W65A 2XIDA 5E08H 3U0TA 5FA3A 4U6XA 3TBYA 4Z7NE 1PG7H 1BECA 3WUWB 2N7AA 3E2HC 1KCRH 1CGYA 1ORSB 1E4XL 2AJYL 1A7PL 1WEJL 4YWGH 3CPLB 3VXPA 4U7KA 1KLUB 4I8DA 5HYQA 4Z7QF 2GSIB 1FH5H 2P8LA 3WDHA 2C3WA 2Y6SD 2BNUA 1VFMA 2BY1A 3IDNA 1DBBL 1JGUH 3NFPA 4EZMA 1WC7A 2PW1B 2R2BB 3O45A 3L3IB 1FNSL 3PWUA 1MCHA 1FORH 2VLJE 5GGVH 1NGYA 2X4RA 4TPRH 4EI5B 1I8LC 4WFFE 4NHCL 3F5WA 4KKBD 3RWIB 3SO3C 3WXVH 5B8CC 1BM3H 2NXZC 3DUUA 4JRWA 1OTTC 4N0CD 1T5XB 1X5LA 2C1OA 3GSNB 3RA7H 2CIKA 3KPMA 1H5BA 3P0GB 3CFCH 1T1WB 4YHLH 1CICD 2PW2B 3IFNH 2EXYD 3V5HB 3IDUA 2D0GA 4K7PX 3VXUE 2MCPL 1FGNH 3BGMA 1JZ2A 4DCQA 4U1NA 5K93A 1KTDA 5H94A 5TQ2H 4Z5RB 5I71B 3GI8H 2GCYA 1U91B 1QBLL 1SMAA 1UWXH 4MCZA 3QDJA 3P4NB 4KMTH 3ZT7A 5FV2A 3GO1L 4JPIB 4B7IA 1KJMA 3HB3D 1MUJA 1RK0A 4U6YA 3JUYA 1ZS8B 4EI6A 1KBGL 5EBLB 4C83A 4KJQD 4OI9A 4P5TD 1ZT1B 3STLB 4LP5A 5K9JL 1BMGA 4JM2D 5EULV 2A6DA 1MHHB 3MFFB 2DBLL 3GSXB 1B2WH 3QCTL 3ZO0A 5JO5A 3T4YA 4FZ8H 1BBJA 1I8LA 2E6QA 4UUJA 2PF6A 3C2AH 2VISA 3O6KL 2YPVH 4BFEA 3WIHH 3LEVH 1EUUA 3PQYD 2F5AL 5DMKB 1J0YA 1AC0A 3QQ3B 2VLKE 4M8VA 1MREL 3WNOA 2GAZB 2NYYC 3FFCE 3VGDA 3OB0H 4F57L 1AGCA 5D1ZB 3EW3B 4KDVA 4KI5C 4NGHL 2XY2A 3WSQH 4UOW1 3ABZA 4YHOL 1S5IH 4FRWA 4F33A 5DD0L 5KSUB 1IBGH 2C26A 1ZS8A 1FCCA 5T33H 2XZAH 2QKIA 4YNYB 5BZWB 2UWEA 2EDYA 4JZNB 3DGCR 3G5YA 4YR6B 4KK9C 3F7YB 1UGNA 5EIIB 3DBXA 2YPLB 1VFUA 3M8OL 3TWCL 3VFRA 5I8KL 2VDLL 3PP3K 5IHUL 2FR4B 5HI4C 2RFXA 3VFSA 3QI9A 3I02A 4R7NB 4HMCA 4QYOB 3WLBA 4LARL 1UWGH 3M17A 3QPXL 4OTXL 1G9NL 1WCBA 3BMWA 4TQEH 4JAMA 1VA9A 1MHEA 4GRWF 4XP6L 4P2YA 4N0CC 5I0DA 5HJ3A 1PKQB 2BC4A 4DKEH 4GG6E 2C1OB 3GSNA 4WDIA 3KYOA 2R29L 3HMWL 2AV1B 3GMRA 5A2JH 3QCUL 5B4MC 1N2RB 2Y06H 4N0UB 3FO0H 1KULA 3QIWD 3S7GA 4GG8B 1LO0H 5IOPA 4I77L 4D2NA 1T1ZA 1D3CA 1S78D 1GC1H 1IE5A 1RSFA 3GSVA 5DEFB 4HFWA 2R69H 3VGAC 1MCJA 4QT5B 2R1WB 3MROA 4WNQB 4DZBB 1GCFA 4XNUL 4LSPH 2HJKB 3OJVC 4LCCB 1S7UB 4Y4HA 3ULVF 3M07A 3OAUH 2P5ED 5EDXA 4PJCA 2XKSA 4CVUA 4FQHB 5M95B 3RPKA 3MV7A 1TJGL 2EEBA 1EXUA 3SDCD 1MQKL 2GJ6A 2JJTC 2XTJB 4JFEE 4XHJD 1NDMA 4WFED 1SEBB 4KUZL 5D6CB 5HHMB 2HFEB 3V8CA 1XIWB 4LLWB 2V7NB 3FQUB 1PG7L 4ZNEA 2XKNB 5HDOA 1II4E 4KROB 1W0VB 4XCEB 5EUKB 1KC5L 2J8UE 3BMVA 3O3BA 3LY6A 2XYCA 1CLOL 4XVJL 5GRYA 1QQDA 2A73A 4RAUB 2Q8AH 5DJ8A 1KIQA 3KPRB 1JNHB 2PYFB 4GKSB 4TTDD 3SKNA 2EYSB 1G7IA 1A7QL 3LD8C 5GS0L 1WBZB 3STBA 5DJ0A 3PL6B 2P5WB 5FHBL 4HAFA 5JNYA 3MXWL 4KUCD 3MOQA 3IT8D 4BH8B 4LCWD 4AEHH 1LO4H 4YQXH 2VR5A 4ODVH 2BNQB 5J6GB 4FQPA 1UZ8A 4R6UA 5AUMB 4LHUA 1T7WA 5MEND 3MRBA 2R4RH 3HAEG 1K6QL 4DN3L 5DMIH 4F7PB 1NDGB 3P73A 2HA1A 1LD9A 4MDIB 1WGOA 1OP5K 1F8TL 1V05A 1J9CT 1IAIL 5F6IB 1T80A 3SPVB 1F02I 4G5ZL 4O4YH 5AD0B 5ICZA 1RUPL 2Z91B 4IOSD 1HI6A 3BDBA 1WFUA 2GJ6B 4LHUG 1OP3H 2WBJB 4YHYC 5C86A 4J4PC 5DA0B 5E8NB 2VXUH 2CQVA 3V6BR 1UM4L 3GJFB 4S1RH 4B50A 4MA3A 2O5ZH 3BD4A 1EJ6A 2D4FA 2HT4D 3NZHL 3Q6GL 3VXRB 2WLYA 1FZOA 3NABL 4MJIA 4N8VA 1ZV5A 3UTTD 3NN8B 1NCCL 1N5YL 3ARGC 3AMLA 1WIOA 1PFCA 3BE1H 5ACZA 2Y7QB 2LTQC 1ZHBA 3BPOC 4L8BB 1DR9A 1DQML 2A9NH 1ZVYA 2W38A 1MCRA 3EJJX 5C2UB 4W6YB 1SYSA 3T1FB 2Y5TA 5C0JB 2VITB 2YPVL 5E2TH 2ZJSL 3ARBD 4L3EB 4JVPA 4WU5B 5ITBH 5JXED 3G5XA 1ZA6B 4NRZA 4Y2OA 3ZTNH 3RL1A 1PX4A 2ZG2A 4OM0H 1CVSC 5I1HL 3OGOE 1FNEB 2DM3A 3K1KC 3L3KA 2IBBA 4ELKB 2GSGB 3NA9L 3A6BH 3MV9B 3QCVH 1HWHB 5ANMA 4I9WE 3VFOB 1BQSA 3U4AA 1BPVA 2ITCB 3CSPA 3ZT5A 3MBXL 1CGWA 3ROOA 3ARFC 4QYOA 2EIZB 3VGGA 5J1SC 4E0RA 4NKDB 2DAVA 4MZ2A 4HXBL 2YA0A 1NLBH 4MD4B 2BVQB 1N8ZA 1I1YB 3V5KA 2CDFB 4JRXB 1F97A 2X7LB 2Q7NA 2OR9H 2P1YA 5IB1B 1CFQA 4PJIB 1R3IL 3K2MC 3UTSA 2VMFA 3BFOA 2X44D 2R0ZL 3U9UB 5CJ8A 3L3JA 4X99B 2Z4QB 3SQOH 3RTQA 3IDMA 1JRHI 1E6JL 4PRAA 5HPMB 3R1GH 1OPGL 3KYMA 3QZWA 4J3SA 3U1SH 3FAXA 4JCLA 5FGSA 1GAFL 4S0SD 1Q9LB 3LEYL 3IU3A 1YEFH 2A6KB 4G5ZH 1TZHA 4ZD3H 1S7XB 2VXSL 3VDBA 2CDGA 4MB3A 3PWVB 4OT1L 3KPRD 2R1YB 4RRPA 4XTRC 4L9DA 4ZPVB 5SWZB 2DQUH 1K4DA 1U3YA 3ULUD 1EO8H 1LGVA 4OF6A 4OQ1A 4XZUB 4DFIA 3AB0C 3IU3B 1MSPA 3IXTA 4J8RB 4PJXB 2NR6C 2YZ8A 1JI2A 4P2QD 5BCAA 4DUXA 1EFXA 5F88B 1EUTA 5E7FA 4QRUA 2H3NA 4NN6C 5DJDB 3DX9A 2EE3A 2GKIA 4NQSB 1Y0LA 5HI5C 3NCMA 4FFWC 4HF5H 3U9UA 3VE0A 1OAYL 5IVXF 2GFBA 5M94B 4ESKA 3N1MC 4MCYB 3RRQA 2R23A 4TNVK 5GRXG 2Q8AL 4NQEB 1SEQH 4E0RB 1S7QB 3LVEA 4YE4H 5DRNB 2HJFB 1N8ZB 2IPUK 4KXZH 1AJ7L 3MOAL 1KTDB 4P2OC 5H94B 4FTVB 3ROOB 2A6DB 5DF0A 3C9NB 4G6ML 1JI1A 4AEHL 3QEGH 3LSOA 4QGTA 4JR9L 3RTQB 4QHUB 5A2FA 3LRSB 2MQCA 1SJXA 3HMXH 4YPJA 3GSQB 4Q6YA 5LWYL 1J1PL 2ZUVA 3BSZL 1UQSA 1VEPA 5HGBB 1DBJL 3BQUB 4KQ3H 1AXSA 4DKDC 3V52H 3NIDF 3NFNB 3BXNB 4XHJC 3PWNB 4MQTB 1NGXB 3O6LL 4HH9A 3ZE2F 1NGYB 2V5YA 4XAKD 3VFNA 4LCCC 1JNNL 2HLAB 3LD8B 2FECI 4NM8L 4LQFL 2BNQE 3L6FA 3WIFB 1F6FB 1I1AD 3GMNB 4JRYB 5JW4N 3S9DB 4KZEH 3WJJA 1AHWC 1UQSB 5HGBA 4C4KO 4UINH 3QJHB 5JHDD 4LVEA 4L4JA 3QUMH 2Y06L 3RJQB 1UXWA 1F4WH 2AJ3B 3EDDA 2PO6A 5J0BA 2B39A 3MRJA 4NN7C 1GZPA 5E8NA 1WZMA 5SWQA 3VXRA 3BZFA 3DURB 4DGVL 1P7KA 5CUSH 3HMWH 4LLMA 2Q76A 4PGDB 3WIHA 3SDYH 1EEUA 4NQCB 4Q0XL 3QEQA 3F7QA 4HMEA 1NC2B 4PPTA 3K2UL 4Z7UF 2E7LA 1CLCA 3BN3B 4F15B 1BREA 3MRBB 3S3JA 4MA8L 3MFGB 1LO2L 4JPKL 5IB4A 4GW4B 4QXUL 3TT3L 5C0GA 1T7YA 3RVTD 1JUFA 1KCUL 4PJHA 4JM4L 4EJ1C 4I3SL 1HH6A 4GKOA 2B2XL 1JHTB 1RHFA 3CH1A 2E7BA 3CPLA 4KTDH 4KRLB 4RCAA 5KZCD 1L6ZA 3CDGB 4JM2F 2DMKA 4LLQA 3GJFA 4NZTH 5IHZA 2DLIA 5T5NF 1AGEA 5GGVL 4JQVA 3MUGB 1S9YB 1RPQA 1ZLWK 3P77B 3QHZH 3TBVA 3L3HA 2OTUA 4YHNA 1OAYH 5FK9A 3QXAA 4KI5E 3ARUA 2B4CH 1U92A 4Y19D 4ZOEA 3HE6B 3P40A 5IROC 1QQDB 5EUOA 6FABL 3DVIA 1OSPL 5KS9B 1PY4A 5I66B 4PJEF 3DX8A 4GJTB 1XZ0A 2IPTL 2BVPA 5IFHL 1BZ9B 2PYED 3HAEH 5T1LD 1NCDL 1ZEAH 1CXIA 3ZKMC 1HKLL 3VRLF 1NGZB 5C71A 3OHXA 4LDLB 4P9HH 2CJUH 1BOGB 2VXSH 4Y16B 4H8WC 3ALPA 4MDJA 2K1MA 3CX5J 4A2LA 2EE6A 4JCMA 4E5XA 2DTMH 3BDXA 5IQ7L 1T6VN 3B6SB 1WV7T 4LLYA 4FQHA 1GPOH 2O61B 4PLJC 1CK0H 4GW4A 4A2MA 1G1CA 2PYEA 5JMOC 1GIGH 5E70A 4NO2B 1JPFA 3RTQD 1CD8A 2X4UB 3HN3A 5EOQH 2W9LA 4H5SA 4P5TC 5CBEB 2D2OA 3UZVB 3FQNA 2V6HA 3QUZC 4HS3A 3W0WD 4V1DE 3PDGA 2AV1A 1OP5H 3GBNL 1Q0YH 4G9FB 2VN4A 3B43A 5D2NA 2Z35A 4QKXB 1BQHG 1T0NB 3ZTJG 5EC1B 2O5XL 1QFUH 1YJDH 3BEVA 4OKVA 2GJJA 3C6LC 1X5ZA 4PJ9B 1VHPA 3B2VL 4U49A 1H0DA 3W0WE 3FT4A 2ZNWA 3HLAB 3N1QC 1IGYB 3INUL 4HBQA 2XN9B 3ZE2E 4PR5A 2LABA 3Q5OA 1IEHA 2OR8A 4MA3B 5IMLB 4HBCL 2IG2H 4YWGL 5I1EH 4ZFFB 2AP2A 3MODH 5DZOA 1PQZB 2E7MA 4UQ3A 5LCVH 4HH8A 1F3DH 1N64H 5DHYB 1IJ9A 1NBYA 1TMCB 1T5WB 2OXHA 3VRIA 3SJVA 1AGCB 3PNWA 5CSZA 1P7HL 3FT3B 1EAPB 3T0ED 1OAKL 1BGXL 1MAJA 2FJHA 2A6JB 2XA8H 4ODWB 1LO3L 2A2QT 4MNGB 4BQBA 5I30L 1G7PA 1YN6B 3NA9H 3T3PF 3QI9B 4R7NA 1A3RL 3I3DA 3IGAA 1QEWB 4X4ZA 1IQWH 3GHEL 5BOPA 4RA3A 3CZJA 1CDGA 1CG9A 3QNYB 5ANME 5I75C 4QRQA 4AZ8A 2HT2C 1R3HB 2ZSWB 4I2XB 5EUOF 4XGZA 3V7MA 1FV1B 4GKZA 2IAMD 3FO9A 3O11A 3MFFA 3HTLX 4K3DL 1G7PB 1CIDA 1YN6A 1HYSC 3MA9L 2DQGH 1LE9A 5JPNB 3PXHA 4FXGB 3QUXA 1ITCA 1UM5L 4HC1L 3NTCH 5D2LB 3QAZC 2F53A 4XAWH 5D6DA 2BY3A 1Q9KA 4MS8C 3QQ3A 3HC3H 4LKCB 2CH8A 2RB8A 1CXHA 5J1AB 3VFPA 3X11A 4HX1A 1DE4A 1I3GH 2GITA 4D9QD 3KXFD 4JPWH 1BVZA 2EICA 4P23C 3DO7B 3MLZH 1C7SA 1VPOL 4KMTL 1L0YA 4UMGA 1QRNB 4EN3D 4NJ9L 1FFQA 1G9NC 5FF6A 3I2CL 1KJ2H 1F2XK 3FB6A 5GZNC 3DSFL 1BJMA 3IF1A 4YHMH 2XWBB 2BSRA 1KACB 4A6YH 5CEZL 3FQTA 2XWTB 3QIBD 5SWZE 2Q1EA 2QQNL 1F5WA 5I74B 4QOKE 3VFTA 3O81A 4NRZB 5IHLB 1MFDL 4C56A 2GQHA 1ZLVK 2X7LA 3B8YA 2L4OA 4JREB 4YC2B 4YQXL 1OAXL 1R24A 1ZE3C 3TIEB 1XCTA 4PJ8A 2WZPD 3C5ZA 1VFAB 4OI7A 3MACH 5HYJD 5FHBH 3NFPB 5F1SA 1LP9A 3DV4A 5F93C 3ROLA 1V7NL 4PJGF 3SGJA 3PWUB 3ECBA 2JELL 1S7SB 2IFFH 2VDML 2J8UA 1J8HA 2AJUL 2BK8A 3I50L 3MNVB 1ONQA 2GT9A 4GQ9H 1DEEB 1QSEB 3BP7A 2FX8H 3TPUA 3HMXL 4HT1H 4OZGB 5DQDL 2FR4A 1FL3B 2CLRB 3B8SA 2VWEC 2ZUYA 3ALXA 3RNKB 3UBXI 1BD2D 2VNCA 2YPLA 5E2VL 2D03H 3DUUB 3Q0HA 3T77B 1TCRB 4PJ8D 2UYLB 1IAIM 2N1KA 4TN9A 4PJCE 2H2PD 3WFEH 1NMAH 2VL5A 4MMXC 2Y7QA 4HLZG 1DBMH 2K7PA 2BHZA 4KVCH 1YY8B 4OTXH 1YC7A 1RUQH 1YMME 1IEBB 2DQCH 3HPJB 4XAWL 4N8VG 1EPFA 2PXYC 3KPSE 4QHMA 5IV2A 1S7TA 3HUJA 4UTBL 4GW1B 3SGKA 4RMQA 2AEQH 2CIIA 1TZIB 3QI9D 4NO0D 5A16B 3KYKL 4Y5VB 3AY4C 4ORGA 3HZVA 2QSVA 3RVXC 4LCYB 3R8QA 3ARED 3AU1A 5L8KB 3RUGE 15C8H 4HIIA 1SVCP 1O0VA 3MOBL 1RZJC 5IB5A 3GRWL 4U1SB 5IWLA 1QR1B 3X13B 1PKOA 1QPXA 4KKAC 4OCYL 5ECJE 1NCAL 3VXMA 5FB8A 3UYPA 1MLCB 5BRZD 3U2SB 3WNKA 3GFUA 3UTPE 5KSBA 2FIKB 2I24N 5DEGA 1F2QA 1IT9L 1G0YR 1ZT1A 2IJ0C 3QA3A 3EJYC 3O6ML 3WFCH 1F4YL 4LNRB 1BGXH 3KWWA 5J9PB 3MUJA 4UQ3B 3QQNA 1P6AB 3TBVB 3C5SA 2C3VB 25C8H 1XH3A 1WBXB 2OSLB 4F7MB 4ZFGH 5ID0A 4OFVA 5HHME 5ID1B 3MBED 3DURA 3VRLE 4WO4A 2XZCL 3OB0K 1HDMB 1FSKC 5EOTB 3SN6N 3I3EA 1JYXA 1Q0XH 3I3BA 3T8XA 2R56L 2ESVE 1E27B 1K5NA 1GH7A 1R3IH 1YQVH 3WFBH 3DX7B 3TT1L 5TDNA 2EKSB 3FB7B 4JM2A 4LGRB 1MCNA 3FQRA 4G8IB 3FT2B 2P45B 4JGUA 3C5JA 3FHAA 3BGFB 4JRXD 4LLAA 2B5IB 3DI3B 4X6EA 1W0VA 4PJFF 5D96C 4X98B 4LPTA 4JO4H 3Q1SH 4LHUD 4OF7A 4Z77B 2AJSH 4Y4FA 4PS4L 2RQ8A 5L7XL 4UDTB 3G6JE 2HFEA 5D72L 4I2XE 5KW9H 4JFYB 3CUPB 1T0MA 1KB5A 5FO9A 1CFTA 5DUML 1JGEA 1U8QB 4KRPD 1Y6MR 3NCFB 4WDIB 3V7AG 6CGTA 3L3IA 4OZHF 3F7VB 2Z8WC 3ULUF 4I18C 4Z7WA 1JWMB 2QQLL 3RAJL 1MWAL 4G7YH 5B39G 1IGML 3U46B 2XG4A 4RNRB 4OFIA 4QT5A 4NZUH 4LRNH 3C60D 5GGUA 2AJZB 1J12A 4R9HA 4HH9B 1GGCH 3UTZA 1ZOXA 3DRQB 3G5ZA 3NPSB 1D5IH 1A7RL 2CLVB 5DD1H 5HBBA 5HI5D 2RBLA 3QIWB 4XBPA 2HT3C 1FZJA 4CGTA 4Y4FC 5C0EB 3VXOA 3IAGC 1HYSD 5CIPA 5DJDA 4JFDE 4MHHG 3QULA 3X12A 4NCC2 1P4IL 3LEXB 3LQZA 4M5YH 5J1TC 2IQAA 5EZOL 1NSNL 3KYNB 2R8SL 2IAMA 4KGJA 3IS0X 4M62L 5JW4R 4AL8L 1CL7I 3LN5B 2DQFA 5ISZE 2DWEB 1I4FB 2L0DA 4N8PA 1EMTL 3MMEB 1U3HD 4O9HL 5I1HH 4PGEB 1DQQB 1ZT7A 4M7LH 2BSTB 3I84A 2XTJD 2AGJL 3CSBA 3WE6A 1S7XA 2ARWA 3GI9L 3CFBA 1BM3L 2CD0A 4YC2C 3QJFA 4OZIE 3ZTNL 1A1OB 5F1NB 3SE3C 1KIQB 2BOCB 5FOBA 1KB9K 1FVCB 4RRPG 5F3HB 5I1KL 4NC1C 4KROD 5L2JA 4OFYD 4GG6F 3TVMB 1KPVB 2NZ9D 4OLUL 1MLCA 2WQRA 2NY3B 4RX4A 4OSUH 5HHPA 3MRHA 3H3KA 4HSQA 2R0KH 2F54E 5DJ2B 3BN9C 5CILH 4OZGE 3JWDL 4IRJB 3V4UH 5AYQA 5KANI 4BQ9A 4N1HB 4S2SB 2WIIA 3IDGA 1YEJH 2OK0H 4TSCL 3QSKB 5D7LE 3CFJA 4LARH 1X6LA 1Q9LA 1TJHH 5SWQB 1CGTA 5F21B 1G7QA 1RK1B 1RVFL 3QZWB 2X9WA 3F8UB 2VUOA 4M9OA 5HY9B 1FNEA 1TQBB 3L3KB 4LCWE 4QRPA 3KJ6H 1T7XA 3DWTA 5DJ6A 5GS2D 4YX2H 4LLDA 3SDDB 3L9RA 1NC4D 5MEQB 3HR5A 4NZJA 4JPIA 4BSVA 3QFJD 1VEOA 3RWHA 3H2WA 3Q6FB 3HC3L 5F7KC 1E4XI 3QDHA 3UPCA 1T0PB 4D9LL 2MMXA 4K94H 2YXMA 3BKYL 2NXZB 3GB7A 1OTSD 4R4BB 4AENB 3RFZC 3U7WL 1OOAA 4OKDA 4OLWL 5TGBA 2AV7A 1EIBA 1ZGLB 5C6TH 1MAKA 5FXCH 3T65B 4NO5B 2VLRB 5DGQA 4DAGH 4Q97A 1MWAB 1X5GA 4GBXA 3OAZK 4P5KA 5JPMA 3T0EA 3WUZA 3L3OA 2HT3D 1OWRM 2R29H 4PJ7E 1UCBH 2X9YA 2VAAB 3KPQB 4PJ5E 5F9WB 1EJOL 1RQ5A 4OZIA 5ICXB 3F7PC 1HH9B 5JQ6H 2GTZA 3THML 5C1MB 5D1XD 5IFAH 2H32A 3JZ7A 4Z76A 4P9HL 2WWKT 1JYWA 1NMAL 4Q9RH 5HDQH 4NZDA 3VE0B 3QUYC 1KTRL 1RIHH 4Z7UE 5C7XH 3ARWA 4TUKL 1H15B 4ZXBD 4LEXH 2ATPB 4HT1L 5DQDH 2J12B 4G6FB 4Y19A 4GAJH 2FLBT 4PTUB 5FF6B 4UNVA 3ZKXC 5ID0B 3HG1D 5KVFH 2OZ4H 3NMEA 4K9EH 3FO9B 4GKZB 3BKJH 4HWZB 3DO7A 1UENA 1DVFB 4B0MM 1QFWH 1F3RB 1RZJL 4JLRA 5GS0C 5L8LB 3CGTA 3PIQA 1AQDA 2DWEA 1CU4H 3MGTA 3D85D 4FFYL 2D7QA 2DQUL 1UM6H 5FYKH 1MLBB 4LBEA 1MHHA 1U8IA 2NYYD 5FDWB 3RX8A 1YNTB 4WTXA 4ODWA 4CMHB 2YHGA 4HV8A 2HVJB 4NNXA 3MRPB 4N5ED 1J0JA 2VH5H 1T1YA 3ARZA 3MLUH 1G7JA 2WBWB 4DGIL 1EFXD 4P3WA 2VXQL 4WGWB 2VR9A 5DUPL 5B38B 1UXSA 4D9RE 3TBSA 2DLHA 1W72H 1MCQA 3LHPH 1FL6A 3CX5K 4JG0L 1MFAL 2DKUA 2I60L 2YPKA 5C9JA 1D5IL 1UYWH 2CR6A 3L3DA 2GCYB 4NJ9H 3W9DA 4TVPD 5KN5A 4C56E 4ZTOH 4M6AA 5E2JA 3NPSC 1KEML 5IVXB 1SY6H 3SGDI 1MJJB 1URLA 4DAGL 2BVTA 3TN0C 5MENE 4L5FH 1T22B 5F7EL 3HZMB 1IC4L 4EI5D 4R0LA 3TO4B 4HJJH 1T5WA 3VRIB 1P84K 3O8XC 1U6AL 4J12A 3F58L 5SWSE 1X9QA 4Z9KB 1W72L 4G9FA 4YXLH 1AI1H 2XKNA 3EYUH 5FFLA 4HIXL 5T1MA 3CLEH 2V17L 4J3WA 4PGDA 3OWEA 5JA9A 5B21A 4IMLB 2RCSL 3JWOL 2DQGL 1V7NH 4P5KB 4ZUSB 3WDIA 3GK8H 3T2NH 4PGJA 5I2IB 2H6PB 2ATKB 4XP5H 2ZCLL 1FAKT 3HLAA 3ARQA 2ADFH 4G8IA 4KZEL 2NX5D 2I27N 4JFED 1WC7B 2PW1A 1GGUA 2R2BA 3O45B 3TJEL 5DK2A 3PV6B 4FTVD 4TRPL 3QBTB 2ERJC 5KS9E 5T3ZD 3QHFH 2F5BL 4X6CA 2VLKB 2HP4A 3C08L 3OKMA 2QHRL 2DBLH 1XGQA 5D2LF 5LXGH 2MPAH 1R24B 3TIEA 1ACZA 4RWYH 5FYLE 5FEBA 4UIKL 2VZOA 1FLRH 3NCCB 2IPKA 5DZLA 2AEPH 1L0QA 2W0FA 3UO1L 5J9PA 1A3LL 4FQ1L 3FRPA 4LLDB 1OLLA 4D8PB 4HIEB 2Q86B 3UTPD 2F15A 4MDIA 4QWWC 3W81A 1C5CL 2E9WA 2O5ZL 4P23D 2EH8L 1XZ0B 2NPLX 4HUKB 2D0FA 3SE9L 2FB4H 4L3EE 5DD5L 4X7CC 3O3UN 1JWSA 1QRNA 2DM7A 4XMLL 5CEYB 5JDSB 2X4TA 4Z8FH 4OCWL 5KSAC 2BJMH 5GZOD 5J89A 3IAPA 3ZT6A 2GITB 3K0WA 4KRNA 5EIIA 1KFAH 4MXQC 1JF1A 4CAGA 4LRNL 3UTQA 1TVBA 3OX8B 5DUPH 1YJDL 3QIBC 5F3BB 3OZ9L 5FGBA 4P4RB 5K9OA 1J10A 2YEZB 1RU9L 3CFEB 2BHUA 5B38A 1IC7L 4G3YH 3ZDYF 3MRCB 5JUEL 3E8UL 3SCMC 3QIBB 4APQA 5I1DA 4EOWL 1NKRA 3BUYA 1X6NA 4P59L 2H3NB 2JE8A 1DEDA 5DEZA 3HPJA 1PYWB 4GQ9L 1CE1L 4GFTB 1K8DA 4DQOH 2DYPA 3MRQA 5FDWA 4AT6A 1A9BA 4JRXE 3AY4A 1V3KA 3BISA 2V5SA 3SKJL 5B3JF 2ZPKH 4XCFL 4GOSA 5IVZA 1A6ZB 1U92B 4MJ6A 4PJ5B 5SX5H 5SWZA 4WHYH 4XP6H 5H37H 1YNLL 1VDGA 3RP1A 4YGVA 3BKML 4K2UH 4HULB 1B0GA 3OR7A 3HMXA 1FPTH 2V7NA 3V6OA 3RNQB 1RUAL 3MXVL 4I48A 4P3CH 5DJAB 1WZKA 3LQAH 5DFTA 4LF3A 4PGBA 4DVBB 5HHNA 4N9GA 2JF1A 2AJ3A 2VOTA 5GPRA 5DJXB 4HDIB 2VDOH 4X6DA 2W60B 2XPGA 4KI5D 4MAUH 5ILTL 2YKLL 4YJZL 1BD2B 3GEWB 5EA0H 2W0FB 5E6ID 2QR0B 1OGAD 4Z78B 4OLZH 1EBPA 4MGXA 3DXAB 3REVB 3DRQA 3K80A 3MJGX 4P9ML 2PETA 1TCRA 2ICWA 2E3VA 5IMLA 4HWNA 1A8JH 4GKNA 2HRPL 3L5XL 3QDME 1KT2B 1RMFL 1WF5A 2B4CL 1FZMA 1R5IA 1A9EB 3DV6B 4DUWA 4Z7WB 3ULVD 43C9A 1H3UA 1S8DA 3MLPA 1A6WL 4QRPB 1EO8L 4JO1H 3GRWH 3TCLB 1FVDA 3BE1L 3QP3A 4Z95H 4PB9L 3BX7C 4H0IA 4L9LC 1LDPH 4EN3C 3DV4B 3ROLB 1ES0B 2NLJB 4XVUD 1KT2A 1XIWD 2NY6D 1FL5A 1N7ML 2I07B 3L6FB 1XF4A 3BW9B 3QDAA 1P1ZB 1ZA3B 4Z0BH 1KJVB 4Y5XC 4YO0A 1FO0H 1BEYH 3QUYB 1IC7H 1B4JL 1XCQB 1F45A 3GJFH 4Z78A 3HI1B 4OF0A 1T22A 4PRPE 4B41A 1BQHA 2DDQL 4ZS7L 4GAGL 4IDLA 5MEQA 2ZCKL 5CJXA 2V7HB 2GJ6E 2EDBA 5KG9A 2GYSA 4N9GB 2BRQA 4UT6H 2BVUA 1Q72L 4N5EC 5C0BB 4XCFH 1KXVC 5E6ZA 5CZVL 4WI3A 1R5VB 4I48B 3IJSA 4JHWH 4CBPA 5I8CB 1JE6A 4LL9A 5EZIH 4HMDA 4Z7VA 3LS5H 4D0CB 1TZGL 5FECA 3RVWC 3S37H 1R3KA 1ZHNA 3QEUA 1QUNA 4RA0C 1NFIB 4X6BA 3FN3A 4M1DL 3SY0B 5I16A 2VQ1A 3FKUS 4BZYA 4GG6A 1CN4A 4PJ5A 3NACL 5IBUB 3CC5A 1WZ1L 5ADPL 3T3ME 2P47B 3VCLB 4FP8H 4NSKA 4WTZG 4YDKL 3BWAA 3OKKA 2WUCL 2XWJA 2C3GA 5I1LB 2QTEA 5GGSA 4ALAL 2HKFH 3WN5B 2FGZA 4D8PA 4KRPC 5D7IB 4NBXB 2BOCA 3O11B 2EYTB 4QO1A 4JLRB 2EH8H 4OLVL 4PY7B 5JNYB 1K4DB 4HG4J 3IVKB 5TF0A 1JHKH 3WE6B 2QADC 3FO0L 3H9SE 1CG9B 4G9DA 3S96A 2P24B 2IANB 4CRPA 2Q6WB 5HVFB 1WEJH 4QXTB 1Q9WA 4KWUA 5EO0A 3VD9A 4P2OD 3V4PL 1NANH 3T09A 1U8LB 1TJIH 2X4TB 3PQYE 5C70A 4FQQA 4D3CH 3CH8A 2A83A 3QISA 2IBZY 2W9DH 2PCPB 4MX7A 2A74B 4QHKI 2F9BT 3MO1B 1I7RB 3HHRB 3FFDB 4MQSB 4Y4FD 4OGYH 4PJGA 5SX4H 1T0MB 2EDWA 4NQCA 4JVWA 1FZJB 1SJEB 3OF6D 1EO7A 1LK3L 3WBDA 1SEBA 5D6CA 3QIWA 4X4XB 5DFVD 5GSRB 32C2B 3B9KB 4HGWA 4X6EB 2X42A 4MNQA 3LH2L 2X5PA 4KVNH 1FJ1B 2ITCA 3KG5A 1OAZH 3VGAB 5D7LA 4JY6A 5KJRL 1ODAA 2H8PA 3V6FA 2E9BA 1UM5H 3MBEA 4HC1H 2R2CA 2IQ9H 5AYUH 4L29B 4OZHB 2IADA 4XXDB 3U79A 2HMIC 1ZLVH 2V2WA 1U3HB 1OSPH 3ALWA 5E6YA 3VGFA 5DLML 3C5ZB 1NC2D 3W9DB 3LQMA 4GRLA 2KZ1B 4I0PA 1BFTA 1OPGH 3U1SL 1EBAA 1OWWA 1KCLA 2DQDH 4PJAF 1PVHA 1MFBH 3U7AA 1WFTA 2GJZA 2IH1A 3EUUA 1QNZL 3O4OC 1AFVL 3CLEL 5F9DC 2A77L 4R26L 2V5MA 2DTML 2EXWD 4UT7L 5ITFA 4GLRH 2IEPA 5ISZD 2X40A 1I3VA 3UZEA 3L95A 3P9WB 5HD8C 3STZA 2VDOL 3VW3L 1MJUL 5BZDA 4I0PD 3U2SA 2VSDA 4X7FC 3P0YL 4JGJA 3GMQB 5E6IA 5SV3A 2VDKL 3S5LG 2RR3A 1T04A 2DQTL 3F6LA 5IVXA 4PG2C 3PG2A 4WO4B 2P5EE 3LPGA 3WHE0 1AE6H 4JY4A 1S7QA 3CXHK 3I6LD 4OFKA 5DR5L 1TENA 1D7FA 1L7IH 3X3GL 5BV7C 4P2CG 1MQKH 2HKFL 1DN0B 5BZWA 2FWOA 5CWSB 1A6AA 2B0SH 3QG7H 4U7MA 4Y4KD 4F57H 4GXVL 2XN9E 3UBXB 5IJVB 2ICEB 3QUMB 2OTWB 3QFJB 4TNWF 1B0WA 4LVOC 5AG9A 3BWAB 3OKKB 4YDIL 4IEFB 4DWHA 2FHBA 1ED3B 4KTDL 1KJ2A 2ZSWA 4I2XA 1U8IB 3WNMA 4HIIB 1CFNB 5E8EB 2AJXH 4WW2F 4X5XA 7FABH 2NW2B 2ADIA 2OTUB 3L3HB 2YC1A 3Q5YA 3T4YB 2R4SH 2OL3B 3VWJA 1K9TA 2M8XA 1ZT4A 2J8OA 2YUWA 4QRRA 4HCRL 4RAVA 1DEEA 4HHAB 4FQIH 4BZ1L 1CFSB 4OLEA 1UXWB 4P2OB 3PJSA 1L9NA 4M48H 2VZTA 2IWGA 3CMGA 4CN1A 3X14B 3KPRE 1G0DA 2XTJC 1AY1L 4ZFOB 3RPIA 4V1DD 5KOVC 4WEBH 5JXAL 5HI3C 4MA1B 2X4QB 5E2VH 3TVMD 2NY3D 2HLAA 3SDXB 2P43B 1KJVA 3P30L 3T77A 5IBTH 1LDSA 1NC2A 4MD0A 1XCTB 4NUGH 5CKGA 3VMNA 5JORB 4DKFL 3QZWG 1ADQH 4BKLB 4U2ZA 4K07A 4R8WL 4WUUD 4KHXH 3V0VA 3KPNB 1L6XA 5JHDB 1IL1A 3L9RB 3WJJC 3WEXA 4XB8A 2OQJA 4AIZB 1LE5B 2DQDL 4LIQL 3KYOB 4XNQB 5GGSY 3SEPA 4HUUA 5JPMB 3DROA 3V5HA 3SQBA 4POYA 1RAMA 2WK2A 4PJXE 3OBAA 5C07B 3TJHC 4BZ2L 1G6RB 1EO5A 5I1GH 5DA4A 2ZCHL 5HSFA 1OP9A 4I1NB 5ERWB 5HHOA 3CUPA 4K3EH 4M61A 3K8LA 1S8DB 2VN7A 4MJ5A 5E2WL 2HRPH 1PEWA 4OCSH 3JV6B 5C0NC 1B6UA 3RU8H 5T1KD 2OZ4A 4WFGD 2NNAB 2ZOKA 3VG9B 2FNBA 2LU7A 1HILB 5JOPE 1X4XA 2WM0A 4CMMB 4X5WB 1MVUA 5A2IH 4X5LA 1R5WA 1XF3A 3HR6A 2XZCH 1JBJA 2EC8A 5EB9A 3MR9B 1WWBX 4K7PL 2FH8A 5GRUH 5TDNB 4L5FL 5I8OL 5BVJB 5HJ3B 3LB6C 1WVZA 5DVLA 1YZZA 3NA4A 1CFSA 4XNZB 1BJ1H 3PWPB 5CJOH 2HFTA 3PJSB 1BIIA 5TE6L 3PGFL 3GJFK 5HHNB 4PJAE 5CJXC 5C8JA 1OL0A 1U42A 5D93C 3VFRB 4PJDF 3OR7B 4Y4KC 3MRDA 1OSZB 1HXMA 2CR3A 4RSVA 4XWOC 4WHYG 5ICZB 4JKPH 1YMMA 1I7UA 1W72A 5IJKA 2V9TA 5JW4M 5IR1B 3S4SG 3HI5L 4S2SA 1TNMA 5DD6A 3U36A 3F6IA 1C5BL 2AGJH 2V2XA 3OKNA 4P59H 3IDXH 3AC0A 3TF7C 1F90L 1NCAH 2ICWJ 4XP1H 1M6OB 3EKCA 4PBXA 2Q7YB 4ENEC 1KGCE 4CVXB 3O2VH 4MAYD 5J57B 4PJHF 4OBRA 1EEZA 4WW2A 5INCA 4NP4H 2QQLH 5E24E 3EO1B 4YPGA 2E27H 4JANA 4F7TA 3PHOB 3BUYB 1UJ3C 2BSTA 2EIBA 1FV1A 4GRWE 3SGEI 3RL2B 2AJVL 3FTGB 3QJFB 4OM1L 3MUGA 1TVBB 1KV3A 5DWUH 5E94A 1INEH 2FHCA 2HFGH 1ZANH 4PJIE 5K9OB 4OUUB 2AXJA 2Z31D 3WXWH 4ELMB 4XNYL 1KG0A 3D6GA 1FZKA 5JLZB 5HHXL 1VFBB 4XPTH 1MRCL 4HK3J 4M7JL 1KIUA 3ULUE 4ONHB 5ETUB 1W0YT 1P2CB 4P46B 4DK6A 3G08B 4LASL 4WI8A 2IPUG 4Z0XB 4UAOC 1U8OB 3QWOB 5T3XD 1YUHB 5CGYD 4MXWL 1B9ZA 1MCPL 3QDMD 1WZLA 2DYPD 2IPKB 4TUOA 4UDTA 3GSOB 4ODHL 4ODXA 4DN4H 1I1YA 2AXHA 3DMMA 4LSPL 1T2QH 3G5ZB 2BFVH 4NM4L 1T4KB 1A6WH 2W0KA 4OZFB 2YSSB 1IGYA 4K8RH 1SBBA 4O51B 5HD8D 5IBLC 5GIRA 3SCMB 5IFJA 3MGOA 1WTLA 1F4YH 1V3JA 3MRKB 3QEGL 3DUSA 3SO3B 3MZGB 3D0LA 4ETQA 2IANE 4DQOL 5C0AB 5E1AA 1U8QA 4I13B 3BEWA 2JIXA 3TO2A 4HGWB 5EUOE 3O0RL 5AWNL 4Y1AD 2QSCH 4JG1H 5FA3B 4IRSB 2Y5TB 3DETC 2AI0H 1G9NH 3CVHA 5C0JA 5EU6D 4ELMF 3JV0A 3P3YA 4X7SL 4L8CA 1KB9J 3VWKA 4NIKB 1Y18A 2ZCKH 5I8KH 4YHYB 3RGVA 3FFDA 4ZUVB 4Q9BA 1MJJA 3E2HB 4ZSOA 3TM6A 3CIQA 4M5YL 3HZMA 4M48L 3NAAL 4MWFB 1N26A 5DMIL 3RWDA 3WFBL 5J56B 3QXUA 5FM5O 3NOIA 3MNWA 5C0CA 1I75A 1P5VA 1N0XH 2VLKD 2MCPH 5EOTA 1BOGA 3BOVA 5ID1A 1MEXH 4JDTH 2YD8A 1RIUH 2P7TA 2LU4A 4PLKC 3MV9E 4XNUH 1W0WB 1KYOJ 3KLAB 5C9JB 1YEEL 4YDJA 5CHNB 3HNTL 4K8RC 1QFHA 2WBKA 5D2LA 4B5EA 4IOFD 4WY7L 5HHXH 1MPAH 2HN7B 5LGHH 3TNMA 3OQ3B 5D7IA 1RZ8B 2AXFB 4PJHB 3HAEB 1MCBA 2YD7A 1C8PA 1DN2A 2VB5A 3SBWA 3P2TA 4G9FD 4PJEA 5K9QI 3QWRA 4DVRH 4U0QB 4ZSOE 1A1NA 4HS6B 1JGVH 4NKMA 2CKBL 4O2EA 3AU1B 2Y5EA 2ZOLB 4PJ9D 4ZXBB 3TFKC 3TZVB 3QNYA 1R3KB 1ZHNB 2VDRH 1CGSL 4L4TA 1DTUA 5BVPH 1A6VL 2AEWA 5DR5H 1QRND 1WBZA 4RZCA 4PJGE 1J0IA 2C1PB 5D5MF 1I9IH 1XIWC 1IM3A 3MBEC 4O2FB 5DT1H 2XTJE 4JFEB 1AC6A 1NCCH 4LSSH 5DRXB 4GAYA 4L1DA 1PG7W 1Q9OA 3NIGF 3ARYA 2YRLA 1ONQB 1RZFL 1Q72H 5DD3L 2FLRT 3GBMH 4HUWB 3VGBA 2I25N 5IVNA 4HPOL 2DI8A 1XF1A 1FSKB 4JZOB 1S7UA 3QUKB 1INQB 3QWRD 3GSRB 4J23A 1H3PH 4Y1AA 1Q1JL 5F7EH 3WKML 5AZ2H 1EHLL 4OJFL 1NBQA 1AIFB 3D25A 1PLGL 2GW5A 2NY5L 5CINH 5KTEL 4YXHH 1K3IA 4OZIB 3I50H 3U83A 2P8PB 3QFDA 3QPQC 4PREA 2GTZB 1YPZE 5CD3A 3S36L 2G2RB 4U1NB 4NOBA 4UT9L 1K6QH 1ORQB 4JY5L 1G9MC 2KZWA 3FB5B 3K7UA 3U7WH 2GI7A 3LRSA 4XP1L 3O2DH 1YJDC 4ZUWA 1I9EA 4HKBB 5C0CD 3HE7D 3LB6D 1IGTA 1QG3A 1WCBB 1P7QB 4WWKB 1CLZH 1ZVHA 1A6UH 1R5IB 3DV6A 5FUCE 3S35X 4XBEH 2F5BH 1PSKH 43C9B 1N0XL 2MKWA 5I75B 1A9EA 3PDDA 3GB7B 1JGDB 2VERN 4PJ8B 5BOZG 1Z0MA 2HJFA 5IROA 3RUGF 5D72H 1OW0C 3CSYA 3RQ3A 3G5YB 4UILL 1XGYL 4DZ8B 4N90E 5KSVB 3MRFA 4RBPK 4XVSH 2AEQL 4PP2B 1FFOB 3KPTA 3WYRA 3SBWC 1AIFA 5C6WH 3R1GL 3ZTJH 2G5RA 4XNZC 1RVFH 1IM9A 5EA0L 3I75B 4X6DB 5A2LH 1B4RA 2W9EL 5BO1H 2DQJH 4J3UA 2BFVL 1JZ4A 1KTLB 5DSCA 5DVKA 2YA2A 3U4EA 4I5BA 3V7AE 1RULL 2I60H 5ILTH 4N90D 1M1SA 1QR4A 1WCQA 2WIIB 3CFJB 2BERA 25C8L 5T3ZE 2JB5L 4M1CD 4AEFA 2NQCA 5ENWA 4KUZH 3K2UH 2FJFB 2O5YH 4X9FA 3A6BL 4XCNA 1Q94B 2JCCE 5J12B 3MODL 3TH4T 4K3HA 4OLWH 4C4KT 4EIZC 3T3PE 1ED3A 4YAQB 5BW7A 2PUQT 1QHPA 3U82B 5F7NC 4WIQA 2HN7A 2VO5A 1OAZL 1A6AB 2NZ9C 1CL7L 3CXDL 2FSEB 5ACLA 5J13C 4H88L 4OZFG 5DRWA 4LSRL 4FQLL 3PL6A 3CFBB 3ZHLA 1DSFL 1K8IA 4O9HH 3ZDZF 4M6NH 3KVQA 2R1YA 4QY8B 2J6EL 2Z31A 1KB5L 5TE4H 5C08B 4X80L 2MCG1 3RWDB 2EIEA 3N9GH 1JUFB 3OR6B 3WJLC 1MRDL 3I6KB 3RVWD 3GJEA 3D9AH 5IHUH 5D7JB 3QULB 2HTLC 3D3VB 3PGCA 4F80A 4FQXC 2HFGL 5C0RL 3DGGA 4U1HA 4YHZL 1IAOB 3EBAA 1ZHKA 3UTSB 4RAHA 5L0QC 4OLYL 2DQTH 1JPSH 1ND0B 1IAIH 4MD4A 1KTKE 2P5WE 5TE4L 5FYLD 1EXUB 4OCRL 2W07A 5F8QC 3S6CA 1EGJL 3PL6C 2RHEA 5FV1L 4ALAH 4OFDA 1U3HA 3LPWA 3EYFB 4OQTA 4RGOH 2ESVA 4JO1L 3SDXF 1DBBH 1B3JA 1EX0A 3MV9A 4MNQB 1B0RB 4OCSL 2D7TH 4IDJL 5I1JL 4PJBE 3CLFH 2VAJA 4XXCC 3DMMB 4KKCD 4L3EA 4WUKL 2DOCA 3VXME 5ISZA 3ARDB 4R97B 4HKJB 2VZSA 3IAQA 3BKYH 1MIEH 4IIQC 4ZODA 5I9QB 4GRLB 2EDRA 3MOAH 4RFOL 3EOTH 5DMGD 3SDAA 5IEKB 2FHFA 1QSFB 5ESVB 3M17B 1DUZA 3QIUB 4PYHA 1CD0A 4FTVE 5E00B 1KEMH 4XNMA 1CGVA 5J7CC 1T7ZA 1I7TA 3T0AA 3AGVA 4MDJB 4F9LA 1UCBL 1R3JA 2WW8A 4EXPX 3IB4A 4QRRB 3C5SB 2WBJA 3S34H 3WFCL 2A1WH 3L3DB 3VXUD 1ZLUH 3LKQB 5CP3H 4TSAH 3QO1B 2C3VA 2NY6B 5IFAL 2I5YL 1QA9B 3JSSA 3G6JB 5EU4A 5JW3H 1EEZB 4IOIB 1AO7A 4MD5A 3KLSA 2HH0H 4W68A 1YDPB 3O2WH 3G08A 1EEYB 1NBVH 1WZ1H 1FAIH 5ADPH 2HLFC 5IB4B 5L6YL 5IF0B 3OKNB 4LAJH 4OI8A 1QLFA 4P57B 1A2YB 4P2RD 1S9XA 1SYVA 2AJSL 3IFOB 2YUVA 2VLLB 4M1GH 4O02H 3L5XH 4O5LH 4ORGB 1CGSH 1ZLSL 1YEFL 1AGEB 4JPKH 4ZUTA 5DUMH 5CP7A 1K8IB 2A6KA 1J8HD 1S9YA 3OKDB 3V0WL 4AYFA 4NNYA 5FUZH 3MV9D 1CXKA 2L7JA 1R3JB 5F96H 4RDQG 3PHQA 1F4XH 1CICA 1UEMA 4D3CL 4JPVL 4F15C 1MY5A 1I1CA 2E9IA 1LP9E 3BD5A 4MMZC 3CFDA 2EH7L 3UJJL 3DARA 1U95B 5GGRA 1J7VR 2D7PA 3FFCD 4ZUVA 4XC3H 2V9RA 2BRRH 1HILA 4BQ6A 2YZ1A 1HH9A 1W8OA 1FL3A 2CLRA 3EO9L 1YNLH 4Y89A 2NX5B 5LQBL 1J86A 3HS0A 3MCG1 5C8JB 2WBJD 1JNNH 4X7TB 3VI3E 3VXTB 1D6EA 3G9VA 4ZAKD 1U8HA 1T21A 2J3SA 5FM4A 1MHEB 3TYFB 3GSNH 4WW1A 1XR8B 4YDKH 1JZ7A 2VTFA 5J12C 3AB0B 1AXTL 4Y2DB 5DFWH 4DTGH 3G6AA 3KPMB 3QUML 4LU5L 1CLYL 3KPNA 3MV8B 5D4QA 4PRDA 4ZNCD 3WLBB 2IQ9L 3S88H 1DVFC 2ILLA 4GKNB 2F58L 3ES6B 4H88H 1HYRC 4XPHH 4KV5F 1DBAH 1L9MA 2V17H 4PFEA 43CAA 1AD0A 4X6FB 4P9MH 2V5TA 2LAGB 5DEFA 4D0DA 4HUVA 1C1EH 4L3ED 2VABB 3BXNA 3P9MB 3AAZB 1UH4A 5B4MD 1DBML 5DS8B 2JJSA 3NABH 5HVGB 4L8DA 3REWA 4FQCH 4UT9H 2UZXB 1KPUA 2I26N 3QIWC 4GRLD 1YUHA 1NCWH 4TSAL 1UG9A 1VENA 3QDGE 2I5YH 4MX7B 4OGAD 5I17B 3O3DA 1CK0L 5E9DB 3MJ8A 4GAYB 4PV8A 1G9ML 1VFBA 2UY6A 2V9QA 3EYOB 4LVHC 4UILH 3V0VB 3VWKC 3DJ9A 2OK0L 4X5XB 3MQIA 4JGMA 2I9LA 3SKUD 3W5MA 3IDGB 2UWEB 4JZNA 2VUYA 1FG2B 2DQJL 5IW6A 5FYJE 1KIRA 2MJWA 5FIEA 4TSBH 5E0QA 2X4QA 4JN2B 5DHVB 4CJ0A 5GSVB 1INQA 4JANB 3KYMB 4LCIL 3BGFC 4V1DB 3O3AA 4PLNC 5HPMA 2R2HA 5DRZA 2B1HL 4RWHA 4PG9B 2YS4A 4NO3A 4DK3A 2GAZA 2OCFD 3NGBC 4RAVB 2VXVL 4IDJH 1AQKL 1KJMB 4ZPTA 4FG6C 3QQ9C 2BSED 2Z8RA 2HKHL 1CTOA 3H7BA 4LSVH 5KVDL 1FBIL 2BVQA 4KJPC 4JVUA 5E4IA 5HPOA 4PJBB 1OF2B 2IFGA 2F74A 2JK5A 2YK1H 15C8L 2CRMA 4KRMB 4U2YA 5E5MB 4C57C 2GK2A 3W82A 4PB0H 3PL6D 3TT1H 4HJGB 4GMSH 4ZFZA 1J1XL 5FA4B 3T0EE 3U0WL 4LVNB 4PBWD 1H9VA 1KC5H 4FN0A 3HI6L 3PWLA 3DETD 4DUVA 4RFEA 4YEFA 2BNQD 2OXGA 4Z7UB 3DIFB 4XRCB 5ESAB 5F7WC 4EI6B 2LAAA 4PRNA 1OTSC 2IH1B 3RZCC 3I75A 3T4AB 5I6XC 3C60C 2WBJC 3G6JA 2VABA 1XIWA 4M00A 4HKJA 2V5RA 2CDFA 2AXGA 1AP2A 1RJZA 1XCQA 4APQD 5IT2H 1YMHB 4NWTH 3GHBL 4F58L 5MEOA 3MLVH 1DFBH 2EIZA 4JM2C 4R4FH 1FYHB 4HS8H 3DRTB 1T04B 3MLYL 3HI6H 4E41B 4PRBB 1F4WL 4AMKH 1FZOB 3MV11 5KSAB 1H0DB 4Y0GA 2HTKD 2BVYA 4K8RD 3VXPB 1T20B 2EZ0D 2VDRL 2VKXA 3TV3L 5GSRA 2FX7L 1E6OH 3SDCC 4U6VH 4JFYA 1A4KB 1T03H 1IFHL 3BVNA 3E6FA 3RWJB 1CU4L 5JHDA 5D2NC 1JGVL 5EC2A 4I3RL 2VR4A 3RU8L 1T83C 1F6LL 2B0SL 3BQUD 3QG7L 1J11A 1MIMH 1JGLL 1J1OH 1MI5D 3RWIA 1MREH 2R9HD 3ARGD 5T3ZL 3KPLB 5CGYC 5D7IF 1WFOA 4UIMA 4G6AC 1SYSB 5B8CA 2VXUL 3H6JA 3LEVL 1YN7B 1UADC 1IVLA 3WLWD 2EXYC 3KHQA 5C3LD 3VFWB 4LDEB 1Z3GH 1AGBB 1UH3A 5AUMA 3MSPA 1TTGA 1S5HA 2RFXB 4TSBL 5DMYA 3VWJC 1OGTA 2FL5B 2NY2D 4KZDL 3EDEA 4AIOA 1PAMA 5FYLL 3IVKA 1A21A 4JFEA 1H3PL 3FMGH 2IANA 5IBTL 2Z93A 4W6WB 1JF5A 1W8NA 3RNQA 1KPRB 1HI6B 1HEZA 2YPKB 5FM5M 3MXVH 3T2QA 1WAAA 4U6XB 3TBYB 1K2DB 2BVOA 2CRZA 4NQTA 1MAML 1KJ3H 3MO1A 4JFXB 4LPVA 1R3LB 3OGCA 4OLUH 4KJWD 5C07E 4X9HA 4DTGL 4CVZB 3VFVB 5I19H 5J11C 1JYNA 4PJ7B 1AR1D 3W0WB 2VLJA 2FRGP 3KXFE 3C8KA 2DI7A 4OZ4A 5C08A 4QGYA 3G6DL 1IKNC 1DBAL 4HJJL 4HWZA 4M3JA 1TZIA 5FK9B 3GSXA 1RV6X 1EMTH 3P30H 1VGKB 2QADD 2W92A 4KY1L 3T3MF 1NLDH 4S1QL 4LVNC 4RMRA 3H9YA 2C5DC 4HS8L 4PV9A 3BYTA 3D0VB 2WMPA 4KKLC 3EO1A 1J8KA 3WN5A 5SWZD 4XNMB 5AG8A 5D5ME 1UZ6E 3TBTA 1KCUH 2QLVB 2CLZB 2E6PA 1TNNA 4M7JH 2R1XB 2JB6B 4HV8B 4KJYA 1MELA 2X4NA 3S3SA 4CKVX 1QBLH 4MNGE 2MSPA 1OD9A 4Y7MA 3SDAB 5KVEL 3LDBC 1KUMA 1R5WB 1XF3B 4XXCA 5ENWB 2VJXA 4E42A 4B53A 1GZQB 5ITFB 5F1KC 5FGRA 5FUZL 1RURH 1YMMB 2VAAA 5T1LB 1H3XA 2FD6H 1DQJA 1QFOA 1RZIB 2YWYA 2P46B 1B4JH 5CFHA 1YEKL 2DQHL 1NL0L 3KLDA 4U31A 1FVEA 4LLMB 3V9FA 1DCLA 5E9DA 1QFUL 5TDPB 4JFZL 3VXSB 1MJ8L 5F6HI 3HZYA 3A6CL 1JZ6A 3OJDB 4I0CC 5GRUL 1F4XL 1HXYA 5I74C 3BQUC 4YDIH 1CDUA 4PB0L 3TLRA 1N6QL 1H15A 4MNHB 3I02B 4G80B 5D5MA 3UCRA 3FN9A 4JFFE 4PGCB 1FNSH 1YN7A 3TA3D 3VFGL 3DYPA 4R7DB 1W2KT 3HUJE 4OF3A 4NZTL 1CBVH 4KI5F 4FXKB 2OJZH 1I8IA 4EI5A 1FCGA 3C2AL 1KXTB 4W4NA 4Z6AT 2EDJA 1T1ZB 3EO9H 4QRSA 5C92A 4PJEE 4YEEA 1ZGLM 5IOPB 4UU9B 5KS9F 5IQ7H 2G60L 4WI6A 5JOEA 3GSRA 5E4EC 1X3DA 1C5BH 3T2NL 3D2UB 1F00I 3L5IA 4JZOA 4AY0A 4LIQH 2OJEA 3WIIH 3RWFA 5JIIA 1FIEA 5I18H 4P2RE 1FVEB 1OAQH 5E8OA 1G9MH 3QEHA 2NX5A 1OAKH 1ZT4B 1D9KB 5CUSL 1RUML 4XMPL 4AEIH 2Q6WA 4Q6IB 2VLRE 2A77H 1IC5L 4OUUA 1X5JA 4JDZB 4AH2B 3T0WA 5J1AA 1A6TB 1YEHL 2CGRL 4ZFOA 1J1OL 1FVCA 5T3ZH 3NGBB 5FO8A 1PEZA 3X14A 3LPFA 5JOFB 3QH3A 4KAQH 4PJFB 4FQCL 2J2ZA 4ZO7A 4AM0A 3MLTA 3VD3A 5EBLA 3QG6A 4EI5C 4OD2B 3ILPA 4HUNB 2R2EB 3QT2A 3TV3H 1JIBA 4QRPD 4U6VL 4XBEL 3B2VH 4QOKA 2DS4A 4GSDH 5MENA 1Q94A 3UTQB 4ZO9A 2V2XB 3KDMA 5HYEA 4QCIA 3NVQA 3RY6C 1FNFA 2DQFB 5EORH 4UB0H 4X6BB 3SY0A 2KUTA 2VL4A 3IDYB 3U6RA 5KZCB 3WIHL 5FKPA 1OLZA 4S1DC 3MUZ1 4X9IA 2QADB 4GUPA 4WRLA 4R97C 4EXKA 3C6LA 4UNUA 1HSBA 3LCYA 5DI8A 1CIUA 4YHKH 3QYCA 5CSZB 1LVEA 3MYZA 4R4ND 3HAEA 1XF5A 3HE6D 3L5WB 4QXGH 4OQTH 3M1BA 4MAYA 1RZ7L 3QEQD 1MCPH 3QNXB 4RX4D 4KZDH 4I3SH 3B2UC 2F54A 1U9KA 3LOWA 2F8OA 5GZOC 4KU1A 4P2QA 1MVUB 3BHBB 2JJSC 3QUYA 2JIXB 3TO2B 2PO6D 3AM8C 3B5TA 3TZVD 5DDHA 1I7TB 3UTTA 4HK0A 2HT4C 4ODTL 1QBAA 4XPAH 2OJZL 5GS2H 4QF1A 5HDQL 5K59F 3ESVF 1CYGA 3WUWG 1A4JA 2AJUH 3GMQA 4ORZC 2R0LL 3MREA 4KPHH 1QKZH 3S5LB 5CCKL 4QRRD 2DWDA 1DZBA 2BSSA 3JTSB 1HHIA 4O5LL 1YY9C 2QL1A 4ELME 3VWJD 2VXTL 4IMLA 3U30C 3O3EB 4QEGA 1CTNA 1ORQA 2L7UA 1H5BB 1GL4B 5IVXE 3FQNB 1E0OB 1NMBL 4K94C 4GS7C 4J3XA 4I77H 5EZJA 3Q1SL 5CD3B 1C16A 5D71H 1JPFB 2VITA 1Q0YL 2X4RB 4TUKH 1D5XA 2EDHA 4PJXF 3OAYH 4IBLT 1X4YA 5SWSB 5IGXL 3KHOA 1I3RA 2FCBA 2LFGA 2VLKA 2H2SC 4MJ2A 1J0HA 3UROR 3G6AB 4YUEL 4P4KA 2FIRT 3QUKA 3O4LB 4ONGH 1LEKB 4RIRB 4Y4KA 2GSIA 4TYUA 4PLOB 1I85A 5JIHA 3ARXA 3LKPA 4BELD 5HDLA 3UJIL 4JO4L 1MFEL 2J7LA 4M8QB 1IM3B 3A67H 4LCWB 5MI0B 3OKOB 2D7MA 1I3GL 1DP0A 3ZDXF 2DF3A 1B0GB 4OFYA 2QSCL 1V3LA 3UP1A 4H1LG 1ZWIA 1HINL 4HCRH 4MAYB 4FHBD 4K7PH 4X7SH 1PDKA 1KENL 3SDXE 4UV4L 1HN1A 1NGQL 5J6HB 3EDJA 4IM8A 4KJYB 4J3VA 5T5NG 2X70A 1ZAGA 2N56A 4JHBA 1R0AL 3G04B 1KPVA 2D31B 1NEUA 4JRYE 2X4SA 2X4OB 4NWUL 2NY1B 3U36B 3LN4B 4MNQE 5CILL 2B1AH 4LCYA 5CWSA 3ULUC 1ZT7B 4D0CA 2NMSA 3HUJB 2DL2A 5DJ0B 1RIUL 2CIIB 4X6DE 2EC9U 3HCVA 2Y36L 3MYJB 3QDMA 5HHVL 5I9QC 5LGHL 5KVFL 1JCKA 2FIKA 3O2DL 1U93A 5GHWH 3QXTA 4ODTH 5I18L 2HT2D 5CBAB 1WWCA 4GXUM 4OGXL 5IJKC 3BDYH 4H26B 4IRZH 1QR1A 4EDWL 5CKAA 1A14L 1S3KH 1P4LA 2VIRA 2EEDA 3K46A 1CICC 3QO1A 4Q9CA 1KXQE 1P1ZA 2ITDB 4Y5VA 2AQ2A 1QSEA 5TQ2L 3MLRL 3MRIB 4F2MB 1HSAB 1BZQK 3OAUL 3UTZB 4HUXB 5HGAA 4LSUH 5JMRA 3KXFB 5DSCB 4A6YA 4AENA 1A4JB 2M1KA 4PP1C 1IGMH 4GAFB 1MWAH 4R2GC 3TYGL 2WUBH 4IRZL 3N85H 4QHKJ 5FYJU 1I1FA 3UTOA 2AERT 4X5WA 4CJ1A 3MROB 3H9SB 1T4KA 4HKZA 5I2IA 3GGWB 1DSFH 5A43C 3H0TB 2YK1L 5BW7C 1CZ8L 3NFNA 1ND0A 3RWHB 3W2DL 4K9EC 1P9MA 4BSVB 3IDXL 1CFVH 1KELL 3ZKSD 2FB4L 4MA7L 1HXYB 4R96A 3PWPD 2FBJL 2VLRA 3D3VE 1KJ2L 1Q1JH 2AV7B 1GGBH 3FB7A 1M7XA 3X3FH 3ECBB 4NRYA 5EZIL 1LWRA 2QSQA 4ZYKA 3FCTB 3UTTB 2FX8L 1QOKA 1DE4B 2GY7B 4QF1B 3U6RB 1T7VA 5C0ND 1OF2A 1A0QL 4MNQD 2AK4B 1AI1L 2P24A 4MCYA 1SEQL 2Y23A 4NQEA 1S7WB 4IRJA 2OR9L 3CFKA 2B4CC 5INDA 5HYSA 1JF6A 2X4PA 3LQAL 1ZHLB 4MSWA 2WP3T 3SDDD 1MFCH 1MRCH 1NC4B 4FS0A 3L5WA 3BPOB 1L4IA 2FBOJ 1IC1A 3ZZ1A 2XNAB 2R0KL 2B8OT 3FQWA 3MLXL 5A2KH 3BD3A 2Q8BH 5T1DL 4EVNA 5B39A 4Y16D 4Y4HC 4JN1H 5IQ9A 1AD9A 3DTXB 4K71C 2H9GB 4KHXL 5IR1A 1T03L 4XWOD 3BPCB 3UPRA 2EZ0C 5HI3D 5MERB 4YDVA 1H3VA 1HNFA 12E8L 4G8EA 4P57A 1UB5A 4MXVE 5A3ID 1YEHH 3RKDC 3VXOB 1KYOK 3TVMA 1HINH 1DQMH 2XOTA 3O9WB 2GUOA 1PYWA 2PTVA 1ZWIB 3QDGB 3AREC 4LSUL 3G5VA 1CE6B 5D8JL 1U8JB 3QNZA 5BRZA 5DYOB 4HKXB 5IW6B 5FUCC 3JV4A 5TE7H 3EDKA 4C59B 1UA6H 1AD0B 3SDYL 1ZA3A 4P4KC 1NGWA 1CFVL 1I1FB 3C6SB 3ES6A 4PJDB 3CFCL 3O4LA 4R90H 4PLJD 4ZYKB 3BP7B 3MOBH 3U4EB 5IEHA 2KH2B 4RISL 3TO4C 4IIQA 2IC2A 1T1WA 4WO4C 4LQ1A 1QPPA 5EWIL 5F89A 1AXTH 4CDGC 3QQ4A 1XGPB 1MHCB 3G5XB 4OQTL 3ISWA 3EFDH 3D87B 1PD6A 3HS0B 4R96B 3RL1B 1YYML 3EOBB 5ADOH 5FOJA 2G2RA 4BKLA 1CD1B 5E4EB 3L7EB 1X4ZA 1IZKA 3BIBX 4XP4L 4KPHL 1T89A 2CMRL 4FXKA 3QDJD 4IS6A 2X4NB 5D70L 1HOCB 3VFTB 5GIRB 2RCSH 1UKQA 2FECL 3EYSL 1P7QA 4WWKA 1F13A 2APXA 3OXRA 5EWIH 2VDKH 4M7KL 2YA1A 5MEPB 1KLGB 3DNKA 5AAMA 1JFQL 5F9WC 3F58H 3TC9A 4F9LC 4YHIA 4F2MA 1TQCC 2CDEB 4F8TA 4HIXH 5TH2A 1G7MB 4MAYC 1XH3B 3MCLH 1HKLH 5T1MB 4G6JL 2XY1A 4M5ZL 4N0UE 4S1RL 1A7RH 3EIFA 2AK4D 3U0TB 2X4UA 1PW3A 2OX5A 1MI5B 3K1DA 2VZ3A 4LHQB 1IKNA 4Q2ZA 3GMLA 2BOBA 4HS6A 2NCMA 3GJEB 1HHGB 1B90A 4JM2B 5DURD 2Z31C 5J8OA 4PRHE 3D39A 5I1JH 3X13A 4JJ5B 4CADA 3VG0L 4K55A 1LDPL 3QUZB 5I16B 5EU4B 1RJLA 4JG0H 2NY2B 1RI8A 3PIQB 1NCNA 5CP7B 4LCUA 3SHSA 5F7UA 4Y16A 5F3BA 1DQQA 3ARFA 4UV4H 5EN2B 2G60H 3MMEA 4WU7B 3GMOA 3F65A 5FM8A 2NY4C 4JKPL 4JY5H 4X6CE 3CVIH 1NCTA 2EYSA 2PYFA 3SKNB 5C09B 3W39A 3KPRA 4NQCD 3O4OB 4NM4H 3IJYB 1FGVL 1S5HB 3MRPA 1A7PH 2X4SB 1L7TL 5TF1H 4JJHA 3VCLA 4H20L 3CC5B 4ISVB 3GSNL 4UBDC 5I0ZA 5I66A 4PP1D 3HPLB 4HIHB 4HQQL 4PJ8C 5CLWA 5DVOA 3QO0B 4NT6B 4QTIH 4AEIL 1RHHB 4KK8D 1NCDH 1NFDA 3UX9B 4JFFA 5T33L 4YZFE 4MVBD 4OZGA 2IGFH 4AL8H 3NCJH 2CLVA 5I15L 4KI1A 1YEJL 1QNZH 1XFPA 3I9GH 4U0RC 4Q9RL 2C4XA 4NQXB 3DVGA 2OJEB 4LPCA 2F8VA 5JDJA 3RGHA 5IMMB 1RUAH 5C7XL 2DJUA 3HKFA 4G42A 4M7KH 1MCFA 4U0RB 5LKNA 5BVJA 4ODBD 3FT4B 4NC2B 3BESR 3QXDA 2ZKHH 5B8CB 2OI9B 3VFNB 5LXGL 3FOLA 1BQLH 3RVVD 1WK0A 3NFSL 1V3MA 3VD7A 3MLUL 3T04D 4C56B 4NQDE 3GRWA 2RAMA 1MPAL 2NTSP 3GSQA 5F9AC 3GMRB 3BT2H 4JQXA 2EDEA 1F11A 1QSZA 1AXSB 2B1HH 5GS1A 1G6RA 4XCYB 4ENED 3S5LA 2IALB 1E4XH 2AJYH 4OGYL 4NO5A 1NAMB 5TGBB 5AZEH 3VFMA 1O7SA 3LKRB 4XX1E 5BS0B 1INDH 4K3JL 4Z8FL 4NQUA 1J0KA 1AGFA 4M6OH 4QXGL 4K23H 5FYKE 3AXLA 1NBZB 5MP6L 4PJBA 3EFFB 3AS3A 1YMHA 1T89C 5DD5H 4F9PC 2H32H 4ZOBA 1JNLH 3QR2A 1LK2B 2DIAA 3PWNA 1V7MH 5L9DH 4F37K 5IESH 2YRPA 3SKMA 4LGSB 4ZTOL 4E41E 1BEYL 4FXGA 1MCWW 5DLMH 5HYJB 3RA7L 1AJ7H 3DXAD 1SJVA 2ADGB 3RKDD 3FO1A 1S7RA 4ONHA 4NFCA 2FO1A 4JB9H 2X05A 1A1OA 4LF3B 2MPAL 1MHPH 3WS3B 4AH2A 4NZRH 5T1KA 3T2PA 5JW5A 4KMQA 4OLVH 3CDCA 1I7UB 4XPGH 1F6AB 3CX2A 5GS0H 5DQ9A 4DEPC 5D6DC 4G8GA 3BP6A 1GPOL 2VKWA 3BRDA 2DQIH 2W91A 4ZTPH 2XNAA 4ZPTB 1ZVSA 1KEGH 3P0VH 2MQ3A 3C8DA 4MVBC 3NCBB 2QQKL 5JPNA 3CMOH 3P0YH 1FDLL 3NZHH 4J4PD 3KPSB 4OLZL 1CFQB 3EOAB 5K9JH 1A1MB 1ZEAL 5EG6C 4P5MB 1NAKL 3MC0A 1F3JA 2X4PB 2ZG3A 5GRJH 4D0DB 2WINB 4XVSL 3NH7L 3JVGC 4WENB 2RJMA 3CD4A 4R3SB 1FFNA 3EOYG 3D2UD 4R7DA 1WT5C 1BJ8A 1M05B 4LKXB 3VGHA 3EYQD 4LPXA 2Q76B 1NFDF 4HZLB 1RIVH 2BCKB 3MNZA 4GRWB 4R2GB 3S4SA 3L3OB 2D7NA 3QEHB 1NJ9B 3HG1A 3O3DB 2DMBA 5I17A 1ZXQA 3MPCA 4ZSOB 4L3CA 3CVIL 1MCCA 1KTLA 3V4PH 1JVKA 3FT3A 2IMNA 3G9AB 4HPOH 4K3JH 3SJVB 5CD5C 2R4SL 5D7IE 1U58B 1HZHL 3ARBB 3BH9A 2NY7L 3R06A 3ZE1F 7FABL 3RVTC 3N1PC 1QVOB 4Z77A 2QV2A 3Q6FA 3CNKA 3VXNB 4M3KB 4K71B 3JWDC 3MUY1 4G80A 5D5MB 1JPTL 1IARB 3O2WL 5GRVL 3BQUA 2ESVB 4HCRA 1BVKA 4TULL 3SO5A 4Y2DA 4GRLC 1A3RH 5D7LB 5FGBC 5CAYB 1J05B 1UWGL 3FJTA 4BFIA 3RWCA 3TZVC 4HDIA 4KV5E 2HVKB 3V8OA 2E8YA 2R0ZH 5I71C 1TLKA 2PTTB 3DVGB 2AAVA 4KQ3L 3KGRA 4Y5XB 3OMZA 4EDWH 4X80H 4J4PA 3NCJL 5I15H 3ARTA 3AROA 1OQOA 4L4TB 2YC1B 5HYIA 4J6RL 2BMKB 5E8EA 1LD9B 3A6OA 4PJIF 4AK1A 4JHAH 1BBDL 3JBG7 4NO2A 2NTFA 1ACYH 3PWLB 3BZDA 4R26H 5EUOB 4PB9H 4OM1H 3GBLA 4P5TB 1PG7X 3X17A 1RUPH 4KFZC 4CNIB 4NPYB 4KTYA 2ZCHH 2VZ1A 1N59A 1XMWA 2LVEA 3OB8A 4KDTA 4WY7H 3RIFK 4PJ7F 2P7TB 2ZUUA 5EORL 1UZ6F 5DJYB 3CH1B 1UXSB 2VDQL 1QRKA 2DD8L 3CDGA 4LLQB 3O9WC 3UC0H 5E1HB 3VG9C 1S7VA 2MHAA 4NPYA 4Q7DA 3VMPA 4CDHA 5IF0A 2E7HA 2XT1B 2AKRA 4JE4B 3TN0D 4JKLA 5T3XH 4ERSL 5C3TA 3WL9B 1I8KB 5H2BB 1SQ2N 4XCEA 3BN9D 4U1SA 1HIML 2DIJA 3O4LE 4OV6F 3TIDA 3D69B 1IGJA 4JQVC 5EUKA 2WAHA 4L8CB 1NBYB 4M4RA 2E8ZA 3GMPA 1W0WA 4RGNC 5ISZB 2W9DL 3DOSA 4W70A 3RVXD 4U1MB 4F7EB 3E3QC 2CXKA 2AI0L 4Q9QL 2VDPL 4NKIL 4I0PB 4PRHB 2HVKA 3WFEL 3RY6A 1S5IL 1JHTA 4Y88A 4KK9D 4ODVL 2B7DT 3QIUA 5T3XL 5MEPA 1MCDA 3DO3A 5E00A 3D48R 4LSTH 2VZUA 1N64L 3QUXC 3QJHA 3WIFA 2R1WA 4JO3L 3N06B 4H0HB 1XF2A 1QTYT 2W59A 4NP4L 3QWQB 2H32B 1D6VH 5GS1C 1CWVA 4NCDA 2OL3L 2P42B 1EHXA 2ZUWA 4XNYH 3B3IB 1KNOB 2QSTA 3RBSA 4XPGL 1OT2A 1UM6L 1ZA6A 2KBGA 1XF4B 3BW9A 3U4BL 5I1KH 1I1AB 2NY0D 2R9HC 4WEMB 3WMSA 1QFWL 1VESA 3KAAA 4QHUA 1QBBA 4Y5XA 3JTSA 4WW2C 3MV7B 4G6FD 2AABH 5GGQL 2VDMH 4IIQB 4NKQB 4MXWH 4S10A 1GRWA 1ADQA 4F3FA 3MBEB 3UZQA 1QYGL 3LN9A 3BAEH 3WKNA 2XFXB 3IKCA 1BFVL 1LP9B 2F53E 3MNZB 5TE6H 5EU7C 3ULVC 3K81A 3C09B 4WHTB 3GNML 4MYWB 3ZHDA 3HA0A 1U8PA 2AVGA 4L8SA 1NANI 2LE9A 5IMKB 2CK0L 1SJHB 1DANT 5E08L 4P2RA 5JXEA 5F96L 1Y0LB 1VACB 3QDJE 2YD6A 3E3QE 1MH5A 4NQDD 1X5XA 2NX5E 4B7LA 5GGQH 1RIVL 1U8OA 2J88H 4G7VH 3HC0A 3R0NA 4Z7UA 5IW3A 3D5OF 5GISL 2DM4A 3O6FB 1RK1A 1JPTH 4WCYH 4K3EL 2ORBH 3FRPG 5FKAB 4U3HA 4TVPH 1AKJA 1I9JL 3BZ4B 3V0AC 1HZHH 1EA9C 1UZ8B 2X2YA 4WO4D 1N5AA 4MXVF 3OG4B 1JPST 4IJ3C 1DVFA 5B39B 5L88H 3NZ8A 2VC2H 3IGAB 1QKZL 4TTDC 5HHOE 4K94L 4ZTPL 5FKAA 5KSUA 4F33B 3HI5H 1A7NL 3QUMA 4PG9A 5D1XB 5DMGC 3BP5B 4UZGA 2R2EA 3VFUB 6FABH 4RGND 5F6IC 4ZD3L 5CJOL 1CT8A 2Q7YA 2WLZA 3NAAH 1MH5B 5IB1A 1PQZA 5KSVA 1MUJB 1EEQA 4XZUA 1LEGA 3O3BB 4WI4A 5HYSB 5CSBA 1GVIA 2Z9TA 2EEAA 5HYJE 1O7VA 1AGFB 2HYMA 3O41B 1DVFD 2P49B 4YUEH 1Q0XL 4Y4HD 1A6PA 1NBZA 3BZ4A 5ANMB 1RD6A 4UT7H 4NJAH 1NDMB 4I4WA 3CMOL 3RWFB 2ARJQ 3BZFB 3WCYA 5BXFB 3LKRA 2ENYA 5IEKA 1IGTB 4OLYH 4HF5L 3RGVB 5EU3B 1JN6B 2J6EA 2PNDA 4WFFD 4BZ2H 1JWUA 1OCWL 4LK4A 1U8NB 3O6KH 4IHOA