1FORH

Structure determination of an fab fragment that neutralizes human rhinovirus and analysis of the fab-virus complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
b'QGQLQQSGAELVRPGSSVKISCKASGYAFSSFWVNWVKQRPGQGLEWIGQIYPGDGDNKYNGKFKGKATLTADKSSTTAYMQLYSLTSEDSAVYFCARSGNYPYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQTITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 17-IA FAB (LIGHT CHAIN)
publication title Structure determination of an Fab fragment that neutralizes human rhinovirus 14 and analysis of the Fab-virus complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1994-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1forH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1forH02
4JLRB 2EXWD 3BEWB 1I4FB 1UKQA 5LJYH 3L7EA 5D7LE 3FQXA 1IVLA 5E2UL 1HINH 3ZKNC 4JDZA 1I3RB 5J13B 1BM3H 1I1AC 1Q9KB 3BIKB 3BQUA 3GSWB 2F8OA 5I30L 5J89A 1FFPA 4EN3C 5D1ZB 3E3QC 5FHAL 4ZO6A 1B2WH 2GITB 1U8JB 1JZ5A 2GT9B 3BP5B 4XAWH 4GW4B 3KYOB 2R56L 1N2RB 4W4OC 1PEWA 3D3VD 5CLWA 4NQEE 1PX3A 1IEBA 3BYYA 4M62H 1T7WA 3H9ZA 4QKXB 1A1NA 5D1XA 1GGTA 4GQ9H 1YY9D 5TGBA 1UWXH 3JTTA 2XFXA 4J3XA 4KZDH 2QADB 3WE6B 5HDQL 2DN7A 3ROLA 4ZSOE 1KEGH 5IFJB 3O6FA 1QBBA 1MCOH 2VH5H 3MOBH 1A0QH 3VA6A 1GZQA 5BV7C 4G8FA 4C57C 3AREB 3TZVA 4MA3A 4WUKH 3LQAC 1RI8A 2I27N 3RWIA 5F72S 2NY3C 2OL3B 3AS3A 4JN2A 4Z0XB 1BF2A 5GJTL 3QHFH 1F6LL 5DHVA 3ZHDA 1WEJL 3IS1X 3ILQC 1U95B 3BWAA 3I6GB 2VISA 2CLZA 2FR4B 2R2HA 3EZJB 1I1FA 1S9YB 3RI5F 1UXWA 2QHRH 3MCG1 3TCXA 2BERA 5C0AE 4RFOL 3QB7C 4JM4H 2R0KL 4I18B 4Z7UF 1RU9H 5KSUB 2DJUA 1KTRL 3GI8H 4WTZG 4XTRC 4WFFE 1CXEA 4WV1C 3S36H 4F8TA 1ORSA 3DX6A 5SV4A 1JWSA 3D39D 1FFRA 1HQRA 4K3EL 4WEBH 3LZFH 4OSUL 5GS1C 5LAXB 1HXYA 2LTQC 3MJ6A 3TM6A 3O4LB 4ONHA 5L2KE 2ICEB 4WEUD 4XPGL 3CXHK 4QT5B 3I6KA 1P7KA 3PV7A 2EE2A 2PYFB 3S35L 4DGVH 5IFAH 1CDGA 3ARXA 3O45B 3DYPA 5M7QA 3FTGB 5IUSA 3MUHL 2UV3A 4XBGB 5KJRL 5L2JA 4ZFOA 1RUPL 3BSZH 2XN9E 1S7XB 3FRUA 5BRZD 4JO2L 2Z4QA 3EO0B 4QRPA 4X5WA 2Z92A 2VOTA 1S7QA 4Z78A 1TZHA 5ALCL 3BYTA 1JI1A 5HI3C 3VJ6B 4Z7UB 4PJBF 2ADIB 1V7NL 2E6QA 4J6RH 5HYEA 2A9NL 4PJDE 5IF0B 3IETA 1EGJH 4JFFD 3P4MA 2NYYC 4Y5VA 4KJYA 1VFUA 5T1LD 4R96B 4DQOL 1CGSL 3KPQA 4Q97A 4PJGA 3ARFB 2APBA 1LO5A 2DM4A 2AABL 4OGZA 5CZVH 3MLVL 4MS8C 4NQCE 2NY0B 2AQ2A 1R5WA 3JWNC 4XBEL 1A7OH 2HT3C 3MC0A 3GIVA 3KXFA 1BZQK 3IS0X 4HKZA 1ZT7A 1TFHA 3U4BL 5SWZA 1JGDA 3HR6A 4YGAB 2J8OA 2IPUK 3ARWA 4MDIA 1NAML 1UENA 4HXBL 3P4OB 4X7SH 5D7SH 2EDNA 1T20A 4AZ8A 1X4XA 1BBJA 3C5JB 3OHXB 1QBMH 4RBPK 3OKKA 5JHDE 4UNVA 4XP5H 3G6JE 3LV3B 3OKNB 4OZFH 2O5ZL 4P3CL 2J5LC 4MAYA 4QRUB 2X4UB 4KKLD 3BXNA 1KELL 4M5ZL 3AMLA 3GSVB 2YD3A 1CDUA 4LLUA 2ERJC 4XGZA 1MVFA 1RULH 3VFGL 2Q87A 4LFHD 1G1CA 1P6AB 4I0KA 2ADJA 4BFIA 5HBBA 4NUGL 1XIWC 2XTJD 2OTWA 3PWUB 1NMCC 4LLWB 4M6ML 4DW2L 2AJ3A 2AQ3A 4OZFB 2FX9L 1QVOB 3AB0C 5LG1A 5F89A 4YHZH 3BP7A 3U0PB 2B4CL 1RVFL 3FFCB 3HRPA 3GSQB 5DMIH 4G42A 4OLEA 3ZKMD 4X8XA 1T1WB 3INUL 5F7LB 1S7RB 1OT1A 4P4KC 3Q6FB 1U58A 3MO1A 4B53A 1KB5L 1BZ7B 3HI5L 4IDJH 2M2DA 3PHQB 4G80B 3BQUD 1TJGL 2AJXL 3MNVA 2R69H 1MCLA 4XCYA 1D5IH 1XEDA 3V2AR 4LAJH 4GAYB 3NCJH 3TPUA 5F8QC 5L88L 1T3FA 1HHIB 5T1KA 3LRSA 3LH2L 1I7UA 1MAML 3OAUL 4L9DA 4NOBA 4Y5XB 2OS7A 3LY6A 4X7DC 3VFRB 4MAUH 3QUZA 2V5TA 3EYQC 3PGDB 4OCWL 2A73B 4ODXB 1JRHI 4KMLB 1RZ8A 4S0SD 2Q8BH 3NIDE 2NLJB 5D1XD 1U3YA 4Z7WB 3QRGH 4DAGH 4I3SL 3OPZH 2GJ6A 4Y4FC 1C5BH 5D70H 4UINL 4XCFH 5J12B 4O2FA 4N68A 3MGTA 1FNEB 2APTA 4MD5A 2X40A 3WN5A 1G7LB 1NCTA 4LSTL 3LSOA 3F6IA 3MRFA 4PB0L 4H20L 4PJ5A 3G5XB 2ATPB 3BKYH 4M7ZB 1QFOA 1B4JL 3NIGE 3TZVD 3P9LA 3FB8A 3SO5A 4HS6B 7CGTA 3OKEA 2B2XL 5FUOL 4R2GC 3RPKA 4F9PC 4P9ML 2QKIB 2X9XA 5E2VH 2OK0H 3HZKB 5JTWA 1Q9LB 4F7MA 2DKMA 2Q20A 5BMFL 3G5ZA 1TLKA 4Z18A 3ZE1F 2FBOJ 1D5XA 3C5SA 3SJVA 3VXMB 4KUZL 2CDEB 1MLCB 4ODTH 5JNYA 4YHLH 3I75A 1K4CA 3CVHL 1J8HA 4F9LC 3Q0HA 3SE8L 5BO1L 4JKLA 4J8RA 1NAKH 3VFSA 3D2UA 5EN2A 2F5BH 4LSQL 2Z8VC 1KIPB 4KKCC 2FRGP 4PG2C 3QZWG 1H5BB 5HGBA 1FL6A 5C0EB 4CBPA 1P9MC 4NYLA 3SDDC 4L4VE 3NAAL 4AIOA 1L0YA 2HYMA 5C0GB 5HYQA 5BZDA 2CIIB 1LEIB 3X17A 5ILTH 3SE9H 3NVQA 4HZLB 1EMTL 4GKZA 2WIIB 3L95B 2ARWA 4U1IB 1YEHH 1SEQL 3BRGC 1CVRA 3LEXA 3TJHD 3WFDL 1T66D 5AYUL 2ZUXA 1CLOL 3C6SB 4KROC 5DMGD 5DJCA 2YBRA 2AJZB 2BVEA 3H8NA 1BFSA 2C4XA 3PQYB 1S3KL 4QRPD 3MFFB 1BFVL 1IGCH 1CGYA 5GRUL 3U7WL 5EU6A 3ZE0F 3GRWA 1U8NA 1KGCE 4HJ0D 4Y0GA 3C6LA 4ZUTA 5JMRA 5EZOH 4JO4H 3OKMA 3F8UB 2OX5A 4LQFL 3IKCA 1DUYA 3PABB 5KVDL 1BZ9A 1DSFL 3WMSA 3MBEA 3HCVB 3L3OB 3U7AA 4L8CA 1EHLL 1OTSC 2AKRB 3U7YL 4L3CB 2P43B 4X6DA 3GSNA 3EOTL 2BNQB 5I6XC 4CKVX 5D93B 2VDKH 3HUJA 5SWZD 3PHOB 1PG7L 1I9IL 4FNLH 1I9RH 2X4OB 3B4NA 4HMEA 1I9JL 2YPLA 3K1DA 3RTQC 1XGQB 4HMDA 4JFDB 1P4LB 1ZLUK 4UT6L 2FB4H 1TJHH 5EZLA 2WM0A 3WSQH 4J2XA 1RZKH 1QFHA 2BNRA 3KPLB 4TSAH 5MERA 4OD1L 1FAKT 3DV6B 3QJFA 3A6CH 4MAYD 5DJ8B 2F8XC 2W0FA 2BXYA 5HJ3B 2WQRA 5J6HB 4AEHH 2O61A 4M4PA 3R0NA 2BJMH 3QISA 3RWDA 5FGBC 3CK0H 2FYYB 4F3FA 1N5AA 2NZ9C 4LLYB 1JNNL 3NZ8A 3UTZA 3OKLB 1FNGA 3GMOB 1HHHA 1SJHA 2WP3T 2FHBA 4NO3B 4M1CD 3CCHA 4J1UA 4TUKL 1NL0H 3MLYL 3W9EA 4LSRH 3PWLB 4PRNA 5I9QC 1BAFL 5DVOA 4XMKH 2P7TA 4H0GA 3VMPA 5TFSL 1YEIH 5ADPH 3O3AA 1MRCH 4X6EB 1YJDL 5IROA 3VWJB 4P23C 2HAZA 3E8UL 2BY2A 3HA0A 1RUAH 3PGCB 3CFDB 5JW4R 5HHOE 4KMQA 1IAOA 4U05A 3S5LG 2LQRA 3CIQA 3KYKL 3MRQA 4G7YL 2HFTA 4R4BA 3FONA 1MJUH 5JXEC 2OJZL 4QXUH 2H1PL 2NNAB 4HT1H 5T1KD 4YHKL 1RFDH 3HC0A 4BSJA 3DMMB 1RIUL 4HWBA 4ZFZA 3QUZD 1JCKA 2P5EB 4RDQF 1OVZA 3QAZB 4ZFOL 2YSSB 5E2WH 3KPRA 15C8H 5E2TL 3MV9A 3TWCL 2G75B 5CSGA 2R1WB 4N90E 2CUHA 4QHUA 1T03L 1WK0A 1S8DA 2GJ6D 4HIHA 1U3ZA 5AUMB 3IXAB 5CWSA 1CD1B 2MHAA 1PDKA 1CF8H 4TNVK 4PJ5D 4JFZH 4XNZB 1HILA 3F7VB 2YXFA 4DKFH 5GSRB 1NFIA 2R2CA 1TDQA 3VFWB 4PJFE 4P59L 3QNXA 3GMPA 2JB6B 1JF1A 1J18A 5DUBA 5IW6A 3B9KC 1MY5A 4OLZL 3QDGA 3E3QE 3EJZC 1KLFA 1LE9B 4OB5H 4JANB 4RRPA 4NHUB 4U1NB 5GRYA 3GHBL 2ESVB 4UV7L 3D0VB 3SJVD 2WAHA 1EK3A 4OLXL 4OLYH 2DMKA 3ARRA 3EO1B 1ONQA 3PUCA 1U8KA 1X5YA 1J8HD 3QUYA 4AEFA 5D5ME 3S37H 4XNYH 3M1BB 1RZ7L 2BFVH 4B41A 1HK6A 3D2UD 3MCLL 5FCUL 3SDCC 3R06B 4O2EA 1MAKA 2YPKA 2VZ3A 2C3GA 4R4ND 3QBTB 4YHYC 3RIAK 3MRMA 4UIKH 2XA8L 2I60H 5EO1B 3T0XA 1HDMA 4NM4H 3JTSA 2DQCH 3QG6A 2HFFB 3VXRA 2EDDA 2FGZA 3KLAB 1G9NL 2VLKD 1IAII 3EYFB 3IAGC 5C6TH 5D1QC 1T7VA 5GSVB 2IANA 3PV6B 2QSCL 2RFXA 1DANT 2Z8RA 5EH1A 3MRHB 1JTOA 3QFDA 4NO5B 3QUMA 3OAZK 4AL8L 1NCUA 2W65B 4LLAA 4DEPC 1NCWL 1OARL 4YXKL 4XMLL 3G5VA 3RWHA 4PJAB 5FO8A 3RNQA 3V52L 1LP9E 2Y72A 3VFMA 1K3IA 3MROA 5CBEB 5EU6D 3EYUL 5CKGA 5ENWB 3MBXH 2IBZY 1CK0L 4XWGL 3GSRA 3DBXB 4HPYL 3C6LD 4HW6A 4X8JA 4LPXA 1Q72L 2X4RA 5ADOL 4U0QB 1RMFL 3JUZA 1E4WH 3WS3A 5AAMA 4G7VL 4GG6F 3H9SB 2JIXB 1N64H 1NUNB 3MBED 3OZ9L 5B8CB 2G9HB 3OJDA 3S96B 3CLFL 5T5NF 1HWHB 1JRHH 5CMAA 3PDGA 3T0DA 5C2BL 1BF8A 5CEYA 3VFNB 3W5MA 2DMBA 1WWAX 1MI5B 4YLQT 2I9TB 1K8DB 2DD8L 4GRLC 4MXQD 5T5FH 3V0WH 1HXMB 3PWPA 4IRJD 1FZKB 3IU4H 3PP3K 3NFSL 4W70A 3L1OH 1KEML 4H88H 3QI9B 2AGJL 5IV2A 4L4TE 5EOQL 2YPLD 5E99H 4NPYA 4K8RH 4LHUG 2JTDA 4XMPL 2VQ1A 4PJ9B 3MJ9H 2CO6B 3LKQB 3HR5B 3NOIA 5IVXB 5EO9A 4ODHH 4XB8A 3EYSH 3SPVB 3G04B 5D7KE 4NQDE 5IHUL 2HFGL 3IYLW 3QCVL 4Y16C 1EHNA 3MLUL 1I85A 2BXZA 4YHOL 1CFQA 4F57L 1IARB 3QQ3A 5C0CA 4CJ1A 3OB0K 3AAZB 4ELMB 4U1HB 2IPKB 4Y19A 4GG6B 5KSBF 2P48B 1YN7B 4MQTB 3LRHA 5GRXG 3U4EB 3L5XH 3L6FB 5EIQA 4BZ2L 4IMKC 2X5PA 5E00A 1IM3A 5IBTL 4DKEL 3K8LA 1BJ1J 5I15L 4UOJA 4RAUA 1D5BA 2CDGA 5FUZH 3WHE0 4JM2F 4FQLH 3TO4B 4S1DC 5GGSY 3MV8E 5CSBA 3CX5J 4OIAA 1CXFA 1XF3A 1RSFA 1U8OB 3MLZH 2M8XA 1UH4A 3OXRA 4UDUA 5FGRA 1E6OH 4G9FE 1JMZA 4GQPH 2ZUVA 1KLUA 2OTUB 2XQBH 2YOCA 4QHMA 3DXAA 2VAJA 3I9GL 3ZKSD 5GGVH 2B8OT 3E2HC 1F4YL 1KJMB 5HY9B 4JY4A 3CVIL 3V0VB 4POYA 5DQDH 5EOCH 4HK3N 3KPRD 3VE0B 2D7OA 3MV9D 5L8KB 3NCYP 5SWSE 2QQNH 2BNUA 4X4ZA 3NCEB 3MJ7A 4JPKL 3IFOA 3RWGA 3T0EA 5JPNB 3GRWL 4X4MA 4XPBL 2UZIH 1AE6L 1TETL 2VLRE 4MD4B 4N0CC 5ICZB 2YEZA 1TMCB 3FAXA 4MLSA 2G60H 3QIBC 3QHZH 4LPCA 3BPCB 4KGJA 5AWNL 3KS0J 5C0IA 5IW1A 5I0ZA 3U6RA 4HHAB 1FH5L 1MCDA 4N1HB 4OAWA 1JPFA 1JGEA 3GBLA 3LEVH 3QDGD 1FVEA 1MUJB 1FNFA 3GSNL 4JFQA 3RVXD 4RWYH 2EXWC 1SM3H 1T0NA 2FGWH 4DUWA 2A1WL 5KVMC 3VXOA 2VUOA 5I8KH 4KTEL 1B0RB 3CH1B 3DX9A 1PY4A 3QUYD 1YPZE 4ZFFA 1CE6A 4DZ8A 4M03A 1IKFL 4R90L 1I7RB 1PZ5B 4HGWB 4P2RA 1YNTB 1AC0A 5CEZH 3ARUA 3ULUF 3BKML 4IIQC 2D7QA 3EBAA 3MCKB 4APQA 2QQLH 5ACMA 4MZ2A 5HHNB 3QUXB 35C8H 3VXRD 3Q1SH 5EC2B 1TPXC 4M7LH 5IHLB 1BQHA 2KBGA 4HKJB 1A6PA 1YY9C 1ZK9A 3WIFA 1CD0A 2XQYK 4X98A 4U2YA 1EEZA 4M48L 5E03A 3P4NB 4HC1H 4WCYH 1NUDA 4JJHA 3WO4B 1J11A 4LCWA 5I66B 2GTZB 1C5DB 4S1RL 1A1MA 4H1LA 4LDOB 4OI9A 1EZVX 4CW1A 1U8MB 3SGEI 1MLBB 3NA9H 3ZKXC 1EUTA 4WFHE 4XH2A 4GKNA 4YXLH 1J1XL 1M6OB 1JYWA 3BIBX 1X5JA 3BWUC 5IFHL 1OWRM 4LCUB 4NRZA 4BH8A 1OAZL 1GOFA 3P9MB 4LVEA 4M1GH 4WUUE 3WHE1 1TVHB 5IWLC 4PRPD 4N0FB 1CBVL 4GT7A 4N1EA 3RVVD 3SKMA 3BKCL 4AY0A 5E4EB 3WD5H 2GSGA 4HWBL 2PW1A 4CNIA 2FJFA 1A6AB 4CU8A 3LS4H 2GCYA 3C5ZB 3PWPD 4P48A 3P30L 5C09E 4HEPG 5KSAC 2FD6L 3T77A 1E28A 1JPGB 3FQWB 1CTNA 4HS8L 2EDBA 3L7FB 2W9DH 4I8DA 5FGCB 2VDRL 4N0UA 3V5HA 3LKRA 5GISH 2GUOA 3VXPA 4K7PH 5JA8B 1JZ6A 4BK5A 5DD6A 5DRWA 3VGBA 5HPOA 5DQ9A 2HFEB 1QG3A 3BT2H 4K3GA 3FFDA 5D7IF 1HHKB 4O9HL 5DTFA 5C0CD 5DUML 1Y18A 4OZIE 1CDJA 1P2CA 2W9EL 3O6KH 4MDJA 2DQUL 4YQXH 4PJIF 4U1MB 3VD5A 1EIBA 4Y19D 1IC4H 5FYKD 2CLVA 2J3SA 1D5MA 4TUJB 3BGMA 1Z9MA 2YRLA 1W2KT 3VGGA 1S7SA 3O2WL 1G9ML 5FA4B 5IEHB 2SEBA 2Y25A 1INEH 3C8DA 4HBCL 2VXVH 4KRNA 2WLZA 5GS2D 3NCBB 5B38B 4DN4L 1MF2H 2EH7L 3V6FA 5ACZA 5KVGL 4JGUA 5IKCB 3NPSC 1CFSB 2R8SH 5KS9F 1PJ9A 1RK1A 3CZFB 5I71C 1MJ8L 1FYTA 1MFDL 4HGKC 2OZ4L 2CKBH 1AO7B 3RI5K 1U42A 4JZOA 1IAIH 5FYLD 3NCYS 3L3IA 3RFZC 1A3QA 3U46A 4CVUA 3FB6A 1K85A 5IB3A 1T0MB 4JG1L 1R3IH 3DXAD 1FGNH 4PBVC 5EFIB 1T2QL 1YEEL 1A6VH 2DLHA 1MRFL 4KC3B 4UZGA 5B22A 5BVJB 3RDTA 3W2DH 1IZJA 3LCYA 5D2LE 2R15A 2CKBB 3G6AB 4I0PA 1AGEB 2NXZB 3FQUB 3FCTA 2MKWA 1H0DA 3I2CH 5SX5H 3NH7L 4OZGF 4MMXC 2XPGB 4OT1L 4I48B 1W8NA 3SBWA 1EXUA 3B43A 3HC3H 4MCYA 4UAOB 4KKLC 3T0ED 1ACZA 1CR9H 3LPGA 1QNZH 1ZA3A 4FQQA 4M3JA 3ULVH 3IDIA 1UB6B 4HCRL 3O9WA 4UBDD 1TQBC 3V5KA 4LKXA 2XTJC 4K23L 1N4XH 3IGAB 5J3HD 5CIPH 3MLSL 3DRQB 1LEKB 1X5IA 3T4AB 4KK8D 3MNWA 1L7IH 1UYWH 1NEZG 4C83A 1JHTB 5LQBH 2HG5A 4NRXA 2XZQL 3CXHJ 1S9WA 2ARJQ 4XZUB 3ZKMC 5D72L 3SO3B 3IDNA 2AK4E 1RJLB 5CIPB 3UTSA 4FABL 3QYCA 4NM8H 4IHOB 3BQUC 5FEBA 3QWRA 3LKNA 3NGBB 3OB8A 2PXYB 5E6IA 4ZS7L 3UC0L 4P2RD 1GHFL 2HT4C 4Y2OA 4YR6B 3DSFH 2VLME 3MLWH 4D2NA 2V7NB 1S7VA 5HHQA 4APQD 4WVRA 4J12A 5DYOA 4WU7B 1P7QB 3L5HA 4FQ2L 4NQEB 5E5MA 1RHHB 3VRJB 1XCQA 3VRLE 2YZ8A 3AY4C 4NKMA 2NR6D 2NX5A 5JORA 4P46A 1G7HB 1AGCB 3FO0H 2DM7A 2YN3A 1QSEA 5D1XC 4HUUA 1NGXA 5KBNC 3EYVA 5F9DC 3U30B 4P2QE 1U93A 2MSPA 3IFLH 4KFZC 5FM4A 3ETBF 4M1DH 5GIRA 4EXKA 4UQ2B 2NTFA 5CP3H 1LMKA 1JF6A 4ZSOB 5T3XL 3C8HA 5EUKA 3MYZA 1VFBA 1P4IL 5IHZB 4LARH 3JBG7 1OP5H 3TZVC 4TRPH 3WIHA 1BLNA 4QHKJ 4MQXD 4V1DA 4LCWD 5K9QG 1WGOA 4PTTB 4YHNB 4EOWL 1T5WA 5FF6A 1U8HA 2FH6A 2AEQL 5E8OB 2DLEA 4GAFB 3B83A 3ESVF 5KN5B 5F6IC 1DQQB 3UBXG 4WW2F 2VABB 1QO3B 4GW5B 1J5OL 1TVDA 2VZOA 1TCRB 4ZO7A 1WZKA 2OR8A 3OX8B 4O5LL 5E70A 1AXTH 3ALPA 2FECI 2ICES 3BGFC 4ODSH 2J8UA 2IJ0C 2P46B 3H7BA 3OKOA 5D71H 3QSKB 4X7FC 1IC7L 2FATL 1A1OB 1AP2B 5KSVB 3S37X 3MLRL 5KW9L 2VAAB 2NY2D 2Q76A 1JWMB 1KFAH 3N9GL 5HHPB 1DBAH 4BQ6A 4WY7H 3KR3L 2YC1A 4P49A 5E7BA 1MCSA 1PSKH 1G6RA 4TOYH 4R0LC 3HLAB 3EKCA 4BKLA 2QEJA 3U9UA 3FOLA 5C9JA 4KMTL 3QQ4B 3V5DB 3QPXL 3TJHC 3OQ3B 4EIZC 1NC4B 1T66C 1LK2A 3ILPA 4BQ9A 1HQ4B 5T3ZE 1H9VA 4NHCH 4FQJL 4G8EA 2FX7L 3L9RA 4PGBB 1TQCC 3LIZH 2ZOLA 4U7KA 2EYTA 3SGJA 3VFVB 4GO6B 4E41A 1WIUA 4HJ0C 4HUNB 4PJDB 2OMNA 4U3CA 3G6JF 1O5DT 4D9RD 4N8VA 5EC1B 1S9XB 4ORGA 1UZ6E 3RY4A 4Y5VC 1GPOL 2AW2A 4YJZL 1ADQH 4TSBH 4UOW0 4J23A 4W68A 1PFCA 1ND0A 4RFOH 3FQTB 5CUSL 4EBQH 2BMKA 3VXUA 2IPTL 1J0JA 1FYTD 4NQCB 1AR2A 1AXIB 4JDTH 2B39A 4MA1B 4EQ2A 1XGPB 4LVOB 4LKCA 4PGCA 1ULVA 2HJLB 4KVCL 4X6CE 1WJ3A 3K8MA 1U8LB 3RDTD 3NN8A 1NCCL 5ESAB 3I50L 2C1OA 3WIIL 3G9AB 4HF5L 3T0AA 1HHJA 4WENB 5D4QA 5CSZA 1TENA 3SGEH 5AAWA 4IRSB 2X9WA 2UZYB 1C16A 3GIZH 4NQVB 4G8IB 5ANME 5E95B 3RUGA 2E9WA 4PRIA 2PYEE 1P69B 1X5KA 4O2CA 4Z8FL 2VE6A 5D2NB 4ZOAA 4JLRA 1F02I 3BEWA 4AK1A 4QY8B 5TDOB 4K3JH 4N0YL 1HH6B 3NIDF 5IM7B 1I3RA 5MHSD 1I7ZB 1GRWA 1KNOB 5JO5B 4M1CC 4RNRB 5E8NB 5H94B 2VDOH 2FHFA 1Q9KA 5J4MA 3BIKA 1UKTA 3GSWA 5F9WC 2AABH 4WDIB 1IGIH 4Y89A 1XF1A 3FQNB 1WFOA 3NIGF 5D1ZA 1CDIA 4I3GA 1OAXH 4YGVB 1CG9B 2Y6SD 4PJ7A 3UTSD 2GITA 4K7FB 2CO7B 1WWBX 4NUJB 1U8JA 5I76B 2GT9A 2XY1A 2JCCE 2XZAL 3BP5A 2WZPD 3QIUB 4GW4A 3KYOA 1NGYB 5E6ID 2C4FU 5T1MB 1EAJA 5KANI 3KPSE 4WJ5B 2Y36L 3CSBA 5C0JA 1ORQB 1I8MB 1NCDH 3WE6A 3IDXH 3QUZC 2NX5D 5IFJA 4EXPX 3KDMB 4RFNC 2O5ZH 2EZ0C 1A7QL 5DEFB 4EUPB 3DYMA 2B5IB 3AREA 3WNOA 2CR6A 4YK4B 2WLYA 1OHQA 4FQIH 3UTQB 2OL3A 4Z0XA 3V6ZA 3WN5C 4PJHB 4NQSB 4NUGH 1NGWB 4ODBD 1U95A 3I6GA 1E6JH 4E0RB 4V1DD 5C0RH 1V8HA 4X99B 5DXWA 2FR4A 4QHNB 4PS4H 5JW4M 3BEVB 5JIKA 3WLWD 2IMMA 1S9YA 5HYFA 4FFVD 5MI0B 1OAKL 5H8DA 1FDLL 4JHAL 4R7DB 4NZUL 3ZDZE 1DBMH 4HLZG 2CUIA 1J0KA 3D3VE 5J56B 3UZEA 1G7PB 1ED3B 1MFAH 5KSUA 1A4JB 4HBQA 4MVBD 4UOW1 5IJKA 1T1XB 1F97A 3GI9H 1KG0B 3N85L 5ALBH 5LAXA 2D0HA 1NKOA 3OAUH 4ZNEE 4FZEL 5I8OH 3BMWA 5DFWH 1IGJB 3FZUD 3O4LA 4R4NC 2ICEA 4X4XB 1LO4H 2IFGA 4QT5A 5GGQL 2PYFA 1SVZA 4QRRB 1F6AB 1UCTA 4CRPA 4NGHL 1OSZB 1EBAA 3O45A 3FT3B 3FTGA 1EFQA 2JF1A 4Q2ZB 1FLRL 5C0DB 4XBGA 1SVCP 3CZJA 4OFYA 4HGMA 1S7XA 1XGYL 1M7IB 2XQYG 3EO0A 3KYMB 1DBBH 4R26L 4PB0H 1JNLL 2F53A 2YMXL 4KVNL 2DOCA 5F7HA 4CMHC 1M7DB 1J05B 3VJ6A 1B4RA 1PLGH 4ZODA 2ADIA 5KOMC 5IF0A 4S10A 1QPXA 4HUMB 5ELIA 2DQHH 1NFDE 4HIXL 5IGXH 1NCBL 1OD9A 4RA0C 1CGWA 4R96A 4E41D 4TYUA 4JGJA 5EU5B 3UPRB 1WTLA 3C6LC 4S1QH 3AFLA 4YPGB 2AEWA 4CMMB 4GAJH 2VDMH 3SGDI 1DLHB 1OAUL 3D39E 4D3CH 3CVHH 2YD8A 2VZTA 8FABB 4LRNH 2Y9RT 2DIBA 3MBEC 1MJJB 3SE8H 2DBLH 3VXUD 3PG2A 4HWEL 4U1LB 4XVTH 4PLKD 3NFNA 3C2AH 4KV5E 4GG8A 2YPVL 3ZYZA 1MCCA 3SCMB 4N8CL 4TSCH 1AFVL 4MXQC 3P4OA 4JN1H 3LEYH 4IRJC 3CVHB 4GS7C 3CUPB 4P9HL 4G6KL 3RL1B 3NPZB 3NAAH 5A43C 4I3RH 3C5JA 3OHXA 4RWHA 5HDBE 3NZHL 3ZE2E 3LV3A 3OKNA 1MCFA 3RX5A 3BISA 3TBVB 2HKFL 4LIQE 4QRUA 1JNHB 2X4UA 3V4UL 4RMWA 2Z0BA 4ZOEA 4NZDA 3GSVA 4JZJB 2NY4B 4G6AC 4KJQD 4JFFE 1AD0B 4UV4L 4JR9L 4POZD 1KOAA 5I19L 4ORZC 2AEIT 4M61B 5FYJD 4R3SB 4TTGA 1P5UA 3PWUA 4LLWA 3RU8H 4OZFA 3B9DA 2AERT 5DT1L 1BFVH 2YHGA 1QVOA 4PRID 3UYOD 4JFPB 3DOSA 4FQPA 1A7PL 3CDFA 4FMKA 1YEGH 3FFCA 3GSQA 4PV8B 1AI1H 2A77L 1T1WA 5I73B 3T1FB 2BY1A 1S7RA 4NKOB 3Q6FA 1J0HA 3DUSB 4L8SB 1BZ7A 2BVYA 3PHQA 4G80A 4ZG1A 1ZMYA 5L0QC 4ONFL 2LVEA 5D1ZD 3MRGB 4GAYA 1HKFA 3VFPB 2XI9A 4PJFF 1KXVC 4YEFA 3T1WA 4HUVB 1DQDL 4MJIB 4Y5XA 5LWYL 3HAEH 3VMNA 4PGEB 3VFRA 1G6RL 3PGDA 4ODXA 2A73A 4PGDB 4Q9QH 2QL1A 4ZOBA 3BIAX 2C26A 1MJ7L 2NLJA 4GSDL 4Z7WA 1OW0A 3V7AG 4XVJL 3ROOB 3QDJA 2FLRT 1KYOK 2QADD 1J86A 3VFUA 5C9KA 2XTJE 1FNEA 1G7LA 1A02N 1BREA 3HAEB 5D5MF 4OM1L 5FM5O 4JQVA 3G5XA 4GAGH 3ARED 2KH2B 1WZ1L 4HS6A 5EO0B 3WEXB 4ONGL 2QKIA 4HUXB 2KKQA 4XVSL 4XNMB 2W0PA 1A3RH 1R3KB 3HZKA 3O41B 3S97C 2DLFL 5F97E 5D8JH 3HRZB 1EO7A 3VXMA 1JYVA 4Z7NE 5A3ID 1YUHB 2CDEA 1MLCA 5GZOC 5I8CB 4ZYKB 2R2EB 3TJEH 3SDYH 3AGVA 2H45A 1QQDB 1F3DH 1DQJB 3X13B 1A6WH 1AGBB 3LPWA 1K4DB 1KIQB 1KIPA 5CP7B 1CLYH 3LQAH 3QUYC 4DZBB 1H5BA 5D5MB 1LP9F 1QSZA 4U2ZA 3B5GA 5C0EA 5DZOA 2EIEA 3PDOB 1K5NB 3V4VH 1WBYB 5C0GA 4UB0H 4L5FH 2CIIA 1LEIA 3O4LD 5CILL 5ETUB 4BSWA 5A2KH 3MLTB 4HZLA 1A7RL 2DM3A 3BAEH 4GRWF 3SKJH 2WIIA 3L95A 3TN0C 4U1IA 5FYJL 2ORBH 3TWCH 3T8XB 1VACA 1UA6H 3UPCA 1M7XA 2X6MA 2YR3A 2J6EH 5K9JL 3S88H 4C4KT 3C6SA 3O6LH 1MCWW 1E4JA 4E5XB 5MEOB 2AJZA 4OFYD 3IDYC 1BEYH 3VMOA 3PQYA 3MFFA 3K1KC 1N7ML 2F53D 1S9KC 3ZZ1A 2EH8L 4M93B 4U3HA 5JQ6L 3K7UA 5FK9B 3FHAA 4YUEH 1TZGL 3PABA 3QULB 4GFTB 4JREC 2FEDD 4LQ1A 2ZUYA 4PJEF 3HCVA 3L3OA 1A6ZA 1QYGL 2AKRA 3SQBA 3IU3B 4L3CA 4NNXB 4WV1B 2BNQA 1BM3L 2FLBT 2NY0D 3BPNC 2EDHA 5JW5B 2F9BT 5DK0B 2LTQB 3WHXB 3MCLH 3RVVC 2X4OA 5ITFB 1XGQA 4JFDA 1P4LA 4Y4KB 4F7EB 1NBYB 1UWGH 4LOUD 4U6HB 1CDBA 3DX8B 1NLBL 3TYGL 3FO1B 5CBAB 4KI5D 5DI8B 4L4TB 1BJ1H 4M62L 1G9NH 2BHYA 2E7LA 1S9VB 3KPLA 1RJZA 3DV6A 2UVEA 4GQ9L 5DJ8A 3JWOC 4KZDL 5HJ3A 5C0FB 5J6HA 1KEGL 1O7VA 1KJ2L 5HI5D 1CFNB 4HS3B 3K4DA 1MREH 4NQDB 1MCOL 2VH5L 1I85C 1A0QL 1JPSH 2FYYA 3MOBL 1OARH 4LLYA 4YXKH 4QHKI 3HG1A 4WUKL 3V6OA 1A7NH 1VSCA 2DI8A 3WUWB 3UZQA 3OKLA 4BSVA 3GMOA 3QHFL 3QZWB 4PTUB 4NO3A 1F3JB 5DFTA 4Y1AB 3RNKB 5BQ7B 1F4HA 3FFCD 3PWLA 2IALB 1BIHA 4HKXB 4HPYH 1FIEA 4K3DL 5FV1L 4PRBB 5AZEH 4L1HA 5C0BE 2BDNH 5SWZE 4X6EA 2PTVA 2QHRL 3VWJA 1LD9A 3PGCA 3CFDA 5GJSH 2ZCLH 4LSPH 2OP4H 5C2BH 3P9WB 4LVNB 1RU9L 3BN9C 3UJIH 4LVHB 2N1KA 3QRFM 3FO2B 3GI8L 2NNAA 1F58H 1PW3A 4RRPG 3S36L 3DMMA 4CN1A 3PXJA 3FB5B 1KXQE 4WEBL 2P5EA 3KS0H 2E9IA 2YSSA 4TVPL 3GSOB 2R39A 1FZJB 2G75A 1GGIH 2BSTB 1RUQH 2R1WA 3QDJD 2A74B 3GHEL 2AJUL 2XKUA 3SOBL 5GRZA 5AUMA 4DGVL 3IXAA 1BP3B 1HZHH 1CD1A 1NMCB 3DGCR 1YPZF 3OJ2C 4MB4A 4FQXD 5SWSB 1DN0B 3F7VA 4RAHA 1BWWA 4NWUL 3VFTB 1KN2H 1I8KB 3S35X 5GSRA 5EG6C 3CXDH 3B8SA 3VFWA 3SGDH 1ITBB 3T0EC 3HN3A 2CXKA 5GGTH 2JB6A 4XXCC 6FABH 5GGRY 4ETYA 1LE9A 4J6RL 4JANA 2OTPA 1EGJL 4NHUA 4U1NA 1QLFB 4TPRH 2ESVA 3D0VA 3GUTB 1XGTB 3O11B 1F3RB 1QP1A 1ITCA 5C70A 1KJVB 3WJJC 2EIDA 4TUOB 3EO1A 1ZXQA 4KK8C 1UM5H 2R23A 5CZVL 5BOZG 3M1BA 1QRNB 4MGXA 2H41A 1ZS8B 1JJUA 2O5XL 1MHHB 1A7OL 2ZNXA 3TT3H 3R06A 5HVHC 3BPOC 3GK8H 4LP4A 4LPUA 3DV4B 1P53A 3I9GH 5EO1A 3KPOB 1AGDB 2GJ6E 5F1SA 2HFFA 2HMIC 3D25B 1F4YH 3U36B 3U9PL 3KLAA 4Q7DA 3LMJL 4X7SL 2APVA 4GMTH 5D7SL 4APQC 3BMVA 5TE7H 5JHLL 5J9PB 3EYFA 5GSVA 3PV6A 1QBML 3MRHA 3F6LA 4XP5L 1F2XK 4NO5A 3RHWF 5FAAA 3MV01 3ESUF 2W65A 4HAFA 4HXAH 3C60B 3PQYD 1AE6H 2QV2A 1X5GA 3S5LB 4PJAA 1RZIB 1RULL 1ES0B 4HH8A 3SJVE 1CGXA 4C59B 2ID5A 4HQQH 5CBEA 3RL2B 5ENWA 3VXNB 2X05A 5E1AB 3CDGB 2Q6WB 3DBXA 5ID0B 3V7AE 1J8HE 4QRTB 4MQXC 1CT8B 4YHZL 4FN0A 3U83A 1XF2B 1YYMH 3H9SA 2JIXA 5DMIL 5E94B 5TDPB 1EHAA 2XXMB 1MFCH 2A1WH 3S96A 5J1TC 1T7YA 1PQZB 2BNQD 2RBLA 4OZIF 4X9IA 4NJAH 1LO0H 5L9DH 1AIFB 2HLFC 3VFNA 4IDJL 3UP1A 1MI5A 3KJ4B 3SDDB 4LCIH 1K8DA 1SYSB 1SYVB 1T4KB 4IMLB 1HXMA 2R69L 4KDWA 2DTSA 5FOBB 1FZKA 3AU1B 5F7WC 1N6UA 5I1KL 4IS6B 1D5IL 1YEKH 4X4YA 2VLKE 2KL6A 5J6GB 1NBZB 5DJ0B 3QI9A 3LN5B 2X1WL 5BS0B 3BKMH 4NBZB 4WI9A 4JFDD 4JQIH 4MCZB 2K9UA 4PJ9A 4KROB 1VCAA 3LKQA 4UTAH 4MAUL 4YFLI 3O3BB 5IVXA 3SPVA 3G04A 2X2YA 3VRIB 2NY2C 4KK9C 2Q8BL 4PRDB 1M05B 4XVUD 4DAGL 1DP0A 3OPZL 3AAZA 4ELMA 1C5BL 1R3LB 4U1HA 2IPKA 4XCFL 5EU6E 2DWDB 4NT6B 4GG6A 1OP5K 1HH9B 1YN7A 5CFHA 3U4EA 2JJSA 3L6FA 3TNNB 3MJ9A 1KJ3H 4Y4HB 3BKYL 1KC5H 2C3VB 4OZIB 3HG1D 1ZT1B 5FXCH 4YBLC 5EOTB 3WL9B 5JIPA 3MOAH 5E2VL 2OK0L 5D2LF 4YAQB 1G7QA 1WSST 5I6XB 1DCLA 2D4FA 1U8OA 5IBUG 2IH1B 3HUJE 1QA9B 2CJUH 2MFNA 1VKXA 4ODTL 3VWJD 4YHLL 1KUMA 2W59A 2YPLE 3RTQB 2GSIB 1YN6B 5CGTA 2OTUA 1W0YT 4B7LA 3BKCH 1NAKL 1D6EB 2HVKB 2F5BL 3MREA 3N1FC 2VDNH 1KJMA 1WTGT 5HY9A 4BUGA 3DMMD 3V0VA 1AXSB 2W92A 5DVLA 2P5ED 4TVSa 4NN5C 5HYSB 4I5BB 3VE0A 1IAIM 4JY5L 1T22B 4UMGA 5ILTL 4RGMB 4FQCH 3SE9L 1EUUA 3SQOH 3WO3B 2ED9A 1YEHL 5JPNA 2GK2A 4K2UH 4DTGH 4MD4A 2X4NB 5ICZA 4WFED 3C09B 5FKAB 1HN1A 3BPCA 1L0XA 5GGSB 2H3NB 4JKKA 3SBWC 5IMKB 3K3QA 4NN7B 3VU2A 4HHAA 1XAUA 3V8CA 1IGCL 1HKLH 3U0WH 2YA1A 1MUJA 2PF6A 3U48A 3JWDL 3VRLF 3RZCB 4G6FD 4JRXD 3KGRA 5EZOL 2FL5B 4JO4L 2ESVD 1MCNA 3KJ6H 1D9KB 2EH7H 3QUKB 1B0RA 3BDBA 3CH1A 1W0VB 1R0AH 3DPBA 5IB5B 1I7RA 1PZ5A 4HGWA 5HGHA 1A64A 1YNTA 1QHOA 4H1LG 1N0LA 1Y0LB 3KPRE 1UG9A 2B0SH 2Y6SC 3MV9E 4KDVA 3RJQB 4F15C 4FNLL 1I9RL 2V2TB 5E6IC 1CLZH 1I3GH 32C2B 5HHNA 3BFOA 3QUXA 3IJSB 1MRFH 5EC2A 2AXHA 3LKOB 2FB4L 4ZXBD 1TJHL 2Y4SA 3NBNA 4U33A 1PG7X 4HKJA 3UBXI 3MLXH 3WSQL 4QXGH 1RZKL 3WFCH 3NH7H 4TSAL 1X4ZA 1AR1D 3SKOB 4G5ZH 3A6CL 4Z7OE 2EEAA 4RBPH 3P4NA 2EKJA 4AEHL 4IJ3C 2BJML 3HPLA 4DOHE 4P2QB 2Y06H 4NDMB 2GTZA 3CK0L 1C5DA 4HCRH 1UJ3C 1U8MA 1MLBA 3WBDA 4OI7A 5FHBL 2MWCA 1IILE 4FG6D 3MLSH 4DFHA 1CDYA 1M6OA 4HC1A 4J3SA 4OIIL 2BSRB 1ZHLB 3BDXA 3WLWC 1NL0L 1QR4A 4LCUA 4LSRL 4EVNB 3H9SD 2JIXD 1G0DA 4XMKL 4FFVC 3P9MA 4CVWA 3SDCB 1M1SA 2XZQH 1WT5C 1YEIL 5ADPL 4N0FA 1MRCL 5B3NA 4KZEL 2AQ1A 1MI5D 5IJVB 1KCVH 5DR5H 4EZMA 2LV4A 2H8PB 3CPLB 1OGAE 3C5ZA 3DUUA 3QWOB 4MX7A 5DS8B 3VXRE 4YIQB 5JPMB 1YEDB 4MVBC 4DGIH 1JPGA 3FQWA 3QI9D 4OGXH 3VA2C 1MJUL 3F65A 4PP1D 5D1QB 1OM3H 4QXUL 1FC2D 2ICWJ 1RFDL 4PJ9D 4FQ2H 2ZZUT 2XG5A 2UUDK 4YDLC 3SY0B 3FZUC 5L6YH 5E2WL 2HFEA 1C08B 15C8L 5F9JB 1HHKA 5DJXB 4XP9H 4C56B 1U92B 3RWFB 4U1MA 5INCB 3MMEB 3BJ91 4K8RD 4WI7A 1RQ5A 3IDGB 2OR9L 1Y6MR 1CF8L 5IMLB 3AS0A 4FXLA 2Z91B 4DKFL 1RPQA 4X6CF 2W07A 5FA4A 5IEHA 2QSTA 4OTXH 5IVOA 4PRPE 3WDHA 1H3WM 3MR9B 5GGVY 3BE1H 5B38A 4OB5L 2Y23A 1FHGA 1JGLH 3SE3A 4IBLT 5IKCA 1CFSA 4JFOB 3SGJC 3PWPE 3TBYA 3LB6D 4WIQA 5I8EA 3CZFA 4OLYL 1AY1H 1AO7A 4F37F 1U8IB 3FJTA 4OF5A 1YEJH 1Q38A 4Z6AT 2H26B 4XNYL 2BFVL 3WDJA 1T0MA 2VN7A 4ZUWB 4DGYH 2VRAA 4OV5B 5GS3A 3IJYB 1GAFH 5EFIA 1J1PL 1FCCA 1XMWA 2FATH 4LSDA 1DQMH 2PTUA 4UIKL 1UWEH 2I60L 4FS0A 4NZTH 3G6AA 2CKBA 4NM4L 1AGEA 2DQCL 2I9LB 4Y19E 3D69B 3FQUA 4X6CB 2JKXA 3DURB 5FYKE 3UTTB 2EEDA 1CQKA 2XPGA 4I48A 5C6TL 4JJ5B 1MVUA 1N0XH 1OL0A 3SKUD 4YO0B 1JYXA 4KJQC 2C3XA 1UB6A 4YFLF 4POZC 3WJLA 2NY1B 3UTOA 1UCBH 3IGAA 1Z5LB 3HS0B 3KPPB 3DRQA 1LEKA 2PYEB 4HIIB 4QXTB 3MBXL 5HDLA 4O4YH 4JFEB 5F7EH 5HXMA 1JHTA 4XAKE 3HMXH 3EDFA 5FYLE 1E4WL 2VYRE 4XZUA 3PHSA 4Q6IB 4KWUA 5J13C 1N64L 3DXAE 1RJLA 5CIPA 4MD0B 3HZMB 2BVQA 1LO2H 3VW3H 4IHOA 1JRHL 3E2HB 2IPTH 2PXYA 2X4PB 3BUYB 4YR6A 2VUYA 2UWEB 3MUJA 5D1ZC 5DC4B 2FIKA 3V0WL 5T5FL 2V7NA 3DX7B 3RQ3A 3ARGC 3ULSB 3IU4L 3BPLB 4RISH 4W6XB 2JCCB 4U6YB 4WU7A 4H88L 1P7QA 3QQ9D 4H8WL 1RHHA 3VRJA 4LMQI 3QUXD 4K8RL 1FV1B 2X42A 3T0EE 3CAFA 4X4ME 4XP6H 3I50H 1G7HA 1MQKH 3WIIH 3MXVH 1AGCA 3ZDZF 1DN2A 3QXTA 3P2TA 5CEZD 3H42H 3QIBB 4ODHL 1OQXA 2XRAH 1ZLUH 3ZTJG 2NY7L 3EYSL 5E2JA 2Q3ZA 4RIRB 4HFUH 3L3HB 1BVLB 2QADC 4UQ2A 4ZSOA 4IM8A 1T1ZB 1EEUA 3SDAB 3MRNA 4PB9H 4HX1B 2P47B 4FTVE 3AREC 4XP4L 1CYGA 4BZYA 3L5XL 2V2XB 1RUKH 4G3YH 4YHNA 4PTTA 2L7JA 3IXTB 2BX5A 5E8OA 3LKPB 4OZHF 2QR0B 5KN5A 1DQQA 5CP3A 4OCLC 4J3VA 4MJ5B 5IMMB 5F9OH 3OXSA 3T08A 2VABA 5FUZL 1QO3A 4GW5A 2DJ4A 4FQLL 3SN6N 1WAAA 5I1HH 3OX8A 3VGEA 1YMMB 3I3DA 1KACB 3GEWB 4W4NA 1P5VA 5A3IC 4NKIH 4P2RE 3MLZL 5F7UA 3QFJE 5C07E 3G08B 1EBPA 1II4E 2VDPH 5CKAA 2MPAH 1Z2KA 1S5HB 1E0OB 3CC5A 3C5ZD 3V0AC 1A1OA 3LQZB 1JZ3A 5KSVA 4GH7B 5KAQF 3DGGB 4OKVA 2ED7A 1UM4H 1NFDF 5IJKC 3NCMA 3SDXB 3U2SB 2VAAA 2E7CA 3H9HB 4OQTH 4F58H 2I5YH 3GBNH 5HHPA 5GGVL 4PYHA 3MZGB 4EEEA 2RIKA 5EOCL 4KHTH 1NEZB 3B6SB 3HLAA 4ODVH 3VG0H 1CD8A 1A7QH 3QQ4A 2QQNL 4LCWE 3V5DA 5GQBA 5CD3B 4NCDA 1NC4A 3M07A 4WU5B 1HQ4A 2Q7NA 3O4OC 4KV5F 3E6HB 1MQ8A 4QCIB 4PGBA 2G60L 4NNPH 2X1PA 5FECB 3T0BA 3VFVA 4R4FH 3D6GA 5HDBF 1IEHA 4PJDA 2E9BA 4CVXA 4PJXB 3LEVL 5EC1A 1S9XA 1FYHB 1ZE3C 5AG9A 4RWYL 2FEDC 1FDLH 5IBLD 2PW2B 3H0TB 1SM3L 4M7LT 1BQSA 4XX1G 1ZHBB 4S1SH 2FGWL 1KYOJ 4RAVB 5KSAB 3N1PC 3TV3H 2ZJSH 5I8KL 2VLJD 3RIAF 2OSLB 4CVZB 5DGRA 1AO7D 4NQCA 1RY7B 2NY0C 1K3ZA 3D39B 3MRPB 2EXYC 2VQUA 5DRZB 1XGPA 4L8DB 1ADQA 1H8NA 5KSBE 5DC0A 2HJLA 5CEZL 3VXTB 3PXHA 1HCVA 1OQOA 3WKMH 1U8LA 2XYCA 3MJGX 2QQLL 3IAQA 5ESAA 2XIDA 4M6OH 2D7MA 4RGOH 2RCSH 3NFPB 4LOUC 4XP1H 5JLZB 3UBXB 1U36A 1OPGL 4MJ4A 4MNQB 35C8L 1ACYL 4KI5C 1PAMA 4IRSA 3QXWA 2IBZX 2W91A 1CIUA 4M7LL 4JCMA 1V7MH 5I1AB 2LU7A 1BIIB 1SEBB 1K2DA 1GXEA 4MQSB 4NQVA 1NBVH 4HH9B 4G8IA 1BD2B 2BVOB 4GMSH 1JNLH 5JUEL 2Z31C 1MCKA 3SEPA 3ULUL 5HI5C 1CGTA 4HDIB 1FPTH 4D9RE 1FRGH 5KVEH 4HC1L 4D9LH 1KN4H 5D2NA 4WCYL 4Y5YA 4QY8A 5TDOA 3TVMB 5T1LB 3OAZH 1G0YR 1HH6A 3DO7B 5IM7A 1I7ZA 1KNOA 5JO5A 4RNRA 5E8NA 5H94A 5ACLA 3ZYIA 3NA9L 5I71B 1FYTE 4H0HB 3T04D 2P8PB 2VXTH 1HHGB 3ULVD 4YXLL 2FEEI 4WDIA 2EDWA 5C08D 2DQIH 3FQNA 2CSPA 1OAUH 5EPMB 3RVWD 2BSED 5FYJU 1OP3K 4M1GL 4D9QE 2RR3A 4MZ3A 4U6VH 4YGVA 1CG9A 2O93L 2QQQA 4HJGB 4K7FA 4MYWB 4NUJA 1N3NB 5I76A 2LE9A 4G8GB 3QIUA 2IAMB 4ACPA 2XV6B 1NGYA 5J7CC 2PXYD 3WD5L 2APXA 3EJYD 1JZ8A 2JJVA 4N8CH 3AMKA 1KCKA 2NXYB 5T1MA 5K9KB 1U41A 4WJ5A 2PO6A 4NO0B 4D8PB 3MZTA 1P7QD 4Z7NF 4Y5XC 2EDLA 5SWQB 1I8MA 1W72H 2P49B 3KVQA 2AV7B 1K6QH 2W9DL 3GBMH 5CJQH 3KDMA 3PP3H 1C5CL 1A22B 5GISL 4N5EC 3KLHD 4K7PL 5DEFA 2JJUA 3V4UH 4LNRB 4EUPA 4O51B 2IBGA 3BT2L 4JQXA 4J3TA 3HB3C 1TQBB 1QBAA 1WLHA 3V9FA 5J12C 4P5MB 3UTQA 3Q5YA 4UV4H 2ZUTA 1N26A 4KTDH 4PJHA 4NQSA 3O6KL 5MHSE 1E27B 3R0MA 1W72B 1NGWA 3MODH 2VZ1A 4FQXC 4RGNB 1IC4L 4E0RA 4Z9KB 2I24N 4X99A 5JXAL 4DKAA 4QHNA 1B3JA 3BEVA 3OB0H 3FQXB 4XPTH 1A7PH 3HI6H 1G84A 1R3HB 4QRQB 4JZNB 3G5YA 3T2PA 3VH8G 4N8PA 1Z9OA 4WWKB 3UTSE 4R7DA 1BJ8A 1INEL 2A2QT 2VXVL 5LGKA 4NKQB 4KQ3L 2GQHA 2XTLA 2ZPKH 1MF2L 4K9EH 1G7PA 1ED3A 3CGTA 4I4WB 4HZAA 3S98A 4OFDA 2R8SL 1A4JA 3THMH 3P40A 2N4IA 5ID1B 4LHJB 4NIKB 1T1XA 2F5AH 2CKBL 4ETQB 5EULV 1KG0A 1IAIL 1TJIH 1CZ8H 2KUTA 2NX5E 4F7TB 3WNKA 2FZ3B 5ABDE 4OUOA 1KB9J 1TTFA 5DRXB 1IGJA 1R3IL 3CDCA 1FGNL 3SGKA 4X4XA 1BOGA 4P3DB 2VKXA 3KPMA 4MHHI 4QRRA 1NDMB 1F6AA 1A6VL 3O2DL 3N1QC 3FT3A 3T2QA 3NABH 3QXUA 5EZJB 4Q2ZA 4FA8A 3DVFA 4Q0XH 3VD9A 2FH8A 2K3TA 1Z0MA 3TC9A 3MRBB 5F96H 5F7YC 1M7IA 1YNLH 3KYMA 3I2CL 4V1DE 3ZDXF 5DGQA 1NC4D 1P84K 2D7TH 4FRWA 3EAKA 4QEGA 1M7DA 1J05A 3HC3L 1CR9L 1QNZL 3PE9A 3ULVL 6CGTA 4XVSH 1IEAB 4X7EC 4LF3B 1QKZH 3F7PC 4JHZA 1PKQB 4JAMB 5C8JB 3FQRB 1KT2B 5FB8B 1N4XL 5EU5A 3UPRA 2J8UE 4YPGA 5H2BB 4CMMA 2C3HA 1DLHA 2L7UA 5JR1H 1L7IL 1UYWL 4LCCB 2HKHH 8FABA 2ZOKB 1IJ9A 5LQBL 1MJJA 1P4BH 3F7YB 5IT2H 1N6QH 2MCPH 4U1LA 4ENED 1ORSB 4NQCD 4QOKB 1T0PB 4NM8L 1V05A 3SCMA 5LGJB 4ZD3H 4PJGF 4HPOL 2W60B 3BP4A 1IGYB 1OSPH 4NSKB 3CVHA 2VWEC 3CUPA 4JB9H 3RL1A 3VWKB 4R0LB 3DSFL 3MLWL 5DJAB 2WUCH 1A9BB 1A8JH 1ZLWK 5CILH 1CFBA 4UQ3B 3TBVA 3U4AA 1FFNB 2IF7A 4WNQB 1JNHA 1ODAA 2EE3A 5DD5H 4JZJA 3AC0A 3WKNA 4GXUM 4IRSD 2E7LC 4XVUC 1HOCB 2AK1H 4M61A 1VPOH 4R3SA 3IFLL 1KTLA 2D7PA 5KS9E 1M71B 1L0QA 4E41E 3P77B 1RZJH 4WTZA 1EHXA 1A47A 1MIEH 3QNYB 1SQ2N 4JFPA 5ICXB 4LARL 3TO2B 3RHWK 4TRPL 2A0LD 1PGRB 3QDME 4PV8A 2UY6A 4DWHA 3T1FA 4NKOA 1INQB 1LO5B 1VENA 3VXUE 1YA5A 4QO1A 3DUSA 3IAPA 1E4XI 1KPRB 2WANA 4L8SA 1QTYT 2XA3A 2IMNA 1QYGH 4I1NB 3ARZA 1WBZB 1L9MA 5C0BB 1X5XA 3E6FB 3PL6B 3EFDH 3QR2A 4PD4J 1AXTL 3MRGA 3VWJC 3VFPA 4OZGE 4ODSL 4HUVA 3QIUD 5DQJB 5DZNA 1DVFA 4MJIA 1UVQA 5D71L 4PGEA 1Q8MA 1IL1B 1KTKE 2ICWI 1U6AH 4A2LA 4PGDA 4YHPB 2F58H 1AKJB 4PRHB 2BVTA 2PO6D 1FAIH 1NLBH 3TYGH 1KCUL 1XFPA 1WC7B 4LP5A 3ROOA 3DMMC 4XX1E 3GJFK 5TE6H 1KFAL 3QAZC 1DBAL 4WY7L 2H32A 2VDLL 5I17B 1PSKL 3HAEA 4LK4A 2LU3A 4TOYL 4KPHH 1KJ2H 2UVFA 5EO0A 3EO9H 1Y6NR 3WEXA 2D0FA 4UNTA 3UYPA 4YWGH 3EW3B 4XNMA 5F89B 4XNZC 1R3KA 2DWEB 3O41A 3KWWB 4NHCL 3FHQA 1MHEB 1ZKAA 1GIGH 2BOCB 1FL5B 3LIZL 5K33A 3HRZA 2P44B 1KJ2B 3ZDYF 1V3MA 4DFIA 4K3DH 4NC1C 5I8CA 5E4IA 4ZYKA 4KRPB 2R2EA 3DLQR 4PJ7E 1JF5A 1QQDA 3DNKA 1DQJA 3X13A 4W4OA 5F1KC 5BOPA 1ADQL 1AGBA 1KCSH 4KK6D 3RGVB 4TSBL 1CXHA 1MRDH 1K4DA 1KIQA 5IR1B 2R9HD 1T6WA 4EBQL 5DJDB 2ZG3A 3PNWB 4WHCA 5D5MA 5K9OB 4QHLA 1Q94B 3PDOA 1K5NA 4JDTL 2NY5C 3CFEB 3I6LD 2A83B 1WBYA 3QCUL 1S5IH 4RFNB 4YNYB 3STLB 3UPAA 1JZ7A 3TFKD 2ZUSA 1RZ8B 5ETUA 4XCNA 3MLTA 3CX2A 4TVPH 1EO8H 4M02A 4QRRD 3T8XA 5F88B 4O2FB 3BD5A 1CDCA 2J88H 4OM0H 4ZXBC 3GHEH 1KSRA 2AJUH 3SOBH 4E5XA 5CJBA 5MEOA 1AGFB 1Q9OB 2GI7A 3OMZA 1ZVYA 5J11C 3GIZL 1ZGLB 1AR1C 4NWUH 4OF8A 3WFBH 1MOEA 1BX2B 5DJ2B 3PIQB 2X7LB 2FIRT 1WVZA 3CSGA 4G6MH 2J6EA 3VCLB 5FK9A 4F7MB 3QULA 1VDGA 1XGRA 1WIOA 1JL8A 3C5SB 5TPWL 5HYJE 1T2XA 4K3JL 2DM2A 3IU3A 3WLBB 4NZRH 4NNXA 4PFEA 4WV1A 5EA0H 1FNSH 5HHMB 2VDOL 5JW5A 3SHSA 5DK0A 3WHXA 1IGIL 3O2VH 4X0KB 3O4LE 2YKLH 2YA2A 2O5XH 2OBGA 5HGBB 4GRMA 3TYFB 1EDQA 1OAXL 5ITFA 1I75A 4Y4KA 5I1EH 4F7EA 1NBYA 3DARA 2EECA 4U6HA 4XPHH 3DX8A 2PCPB 3GNML 4X6DF 4Z77B 1QHPA 2VLKB 5DRNB 1MFBH 3FO1A 2WV3A 3QI9C 5CBAA 1IBGH 4L4TA 2QLVB 2X4TB 3U9PH 4L9LB 4PP1C 1L6ZA 1SY6H 7FABH 1S9VA 1FE8H 3LMJH 4UT9H 4AEIH 5JHLH 2LAGB 3HUJF 1ZA6B 2F53E 2UZXB 4JY6B 4PJ9C 3BRFA 5I1IH 4CMHB 4PJBB 5D7JA 1NCDL 3IDXL 5C0FA 2NY4D 3HNSH 1CFNA 1X5LA 4HS3A 1HI6B 5JW3H 4NQDA 3RPIB 4NKDB 2Q3AA 1A9EB 2ZG1A 3WUWA 4LSUH 1Q0XH 4FQIL 3AM8A 1BFOB 3QZWA 4PTUA 4XWOD 2JJSC 3T2OA 1F3JA 3OGOE 4Y1AA 3RNKA 5BQ7A 2E9JA 1HYSD 1UEMA 2EDKA 4Q74A 5ISZE 3OKDB 1E6JL 4J3WA 4OD3L 4YDIH 5C0RL 1JGUH 4PS4L 4PRBA 3N06B 4KH2A 4JFXB 1CFVH 1HWGB 4S2SB 1ZLSH 1OCWH 5TQ0H 3K8KA 5E9DE 4CADB 1FJ1B 1JV5B 1WZLA 1DBML 4IRJB 3LB6C 3ARVA 1FFQA 1MFAL 3FO2A 4KI5E 1XR8B 3S3PA 2HLAB 5I1KH 4M9PA 1DVFD 1NCNA 4MJID 4Z7VE 1Q0YH 3FB5A 3GI9L 1C1EL 5ALBL 5IMOB 3GSOA 4JRYE 1TVBB 1ZHKB 1FZJA 4NWTH 1D6VH 3RJDA 5I8OL 2L4OA 1PKOA 2BSTA 3KPNB 4FXGB 2A74A 3QCTH 1LO4L 1Z3GH 2YXMA 4FFYH 4ELKB 1P6FA 1WWWX 5SWSA 4MXVE 3VFTA 4GLRI 2O5YH 3GMMB 2CMRH 1I8KA 3FFCE 1DBBL 3O6FD 3LOWA 4LLVB 1INDH 2Y07H 3ME0A 3W81A 2D31B 4JPWL 2FBJH 1PLGL 2ITDB 2Z35A 1FZOB 1QLFA 4P5KB 1TXKA 2DQHL 3EHBD 5L0QB 5IGXL 4LEOB 3GUTA 1XGTA 3C08H 3O11A 4DK3A 3AROA 3O3AB 2EE9A 1KJVA 4TUOA 3D5OF 3UJTH 1GGCH 5C3LD 4S1QL 2P8MB 2ATKB 4KI1A 4KKAD 1BVZA 4GAJL 1QRNA 3QEQE 2VDML 4Z7OF 1UQSB 4D3CL 1ZS8A 1OP9A 1MHHA 4LRNL 3I84A 2DBLL 2MQ0A 1FNAA 4MSWB 4RMVA 1NC2B 4Z7WE 3DV4A 3KPOA 3LD8B 1UC6A 3QDJE 4XVTL 1AGDA 3C2AL 4WI5A 4N9GB 3D25A 4L4JA 3U36A 4TSCL 4F37K 4JN1L 4OLVH 3LEYL 2DICA 1FSKC 2GEEA 5J9PA 4FFZH 4I3RL 3QQ9C 2I07A 5JMOC 4PRAB 1RK0B 3QUXC 4JGMA 1DQTA 3FRPG 1NEUA 4JY5H 1GGUA 4WI3A 3C60A 3F58H 5GGRB 4AENB 3ARDB 3WFHB 2EIZB 4OCYL 3S5LA 1E4XH 1RZIA 2DYPB 3HNVH 1ES0A 2DAVA 2RQ8A 3X14B 5C0ND 3VXNA 5E1AA 3CDGA 2Q6WA 3RU8L 5ID0A 4FQHB 3BX7C 2FECL 4QRTA 3WO4C 4LU5H 1CT8A 2VIRB 5DWUH 1MCBA 4L3EB 3ZHLA 4P2YA 1XF2A 1YEGL 4M5YH 3JWDH 3LN4B 4X9BA 5E94A 1AI1L 3JZ7A 2E27H 2YD5A 5TDPA 4AYFA 1ONQB 3P0GB 2Q7YB 1JUFB 4OCXH 4LBEB 1PQZA 2A6IB 1AIFA 4GBXB 4CN4A 3SDDA 1SYSA 1SYVA 1T4KA 4IMLA 2V17H 3AU1A 2EYSB 4O2EB 4IS6A 2YPKB 5MEQB 5J6GA 1NBZA 5DJ0A 3LN5A 5BS0A 3GMRB 1QRKA 5HVGB 3KXFD 5E4EC 1NCAH 2XICA 3TN0B 4MCZA 1U3HA 2ICWB 3FO9A 4Y4KD 3P3YA 1UM6H 1C12B 3QT2A 1DBJH 1OGAB 3C5ZC 2DQGH 4XI5C 3D0LB 5EZIH 3O3BA 3HMWH 1EA9C 4L4TD 2YN5A 4Q9QL 3IDYB 4U6XB 3VRIA 5I75B 4PRDA 1M05A 4G6JH 2RFXB 5ICYB 4LNVA 3TESA 5D7JD 5DK2B 1R3LA 3AXLB 1DFBH 4KAQH 2DWDA 2N7AA 4NT6A 3LHPH 1HH9A 3RKPA 3TNNA 5E1HB 2WINB 4Y4HA 3IVKA 2C3VA 4GAGL 4OZIA 3VXQB 1ZT1A 4NC0B 5BJTB 5CGYD 5EOTA 3WL9A 5IK3B 4Y1AD 1A3RL 1H8SA 2BNQE 1S7TB 2R4SH 3Q5OA 5FHBH 5MENA 4M7JH 5IVZB 4H26B 5J1AB 4XXDB 5C7XH 4OIIH 5D8JL 2IH1A 1QA9A 1DEEB 3ZTNH 2I26N 2VWEE 2WBJB 4PRPB 4Z5RB 5EU3B 3TIEB 3C8KB 4O02H 1GJIA 2ZCHH 3TJEL 3SDYL 3RTQA 2GSIA 3FB7B 4JFDE 5IBLC 5JOPD 3BVNB 3SE3C 2XY2A 3WS6A 2CPCA 1A6WL 4KZEH 1DL7L 5E8DH 1D6EA 3NCCB 2AV1B 2HVKA 2EDYA 1UH2A 5BV7L 5IV2B 1F5WA 1CLYL 1FIGH 3LQAL 1T5XB 1MHCB 1AXSA 3Q48A 5EBLB 1F42A 5BXFB 3V4VL 5HYSA 4XHJC 4I5BA 1LQSR 5DJZA 4UB0L 4L5FL 1IGTB 43CAB 1NBQA 1QEWB 3ECBA 1T22A 4X6FA 3SKJL 3WFEH 3BAEL 2OMBA 3BP6B 3QQ3B 4CAGA 4OUUA 3HG1E 5C1MB 2IG2H 2ORBL 3K2UH 1RIVH 1UA6L 3IFPA 3KAAA 2J6EL 2X4NA 3S88L 5SWSD 3X3GH 3O6LL 5FKAA 4K55A 5D9SA 5FDWB 4IOFD 1J1OH 5GGSA 1BEYL 2OR9H 5IMKA 4MJ6B 3Q2CA 4BQCA 4UAOC 1EAPB 3IDJB 2AEPH 2X1QA 2ED8A 3TBWB 4GW1B 1K8IB 1DBKH 4JFYB 5FYLH 3REVA 3RZCA 1B6DA 4KUCD 2FL5A 3WJLC 1XF3B 4YUEL 3BHBB 5DD0H 4QGTA 5LXGH 1D9KA 2CIKB 3QUKA 4GKSB 4WW1B 2R2BA 2NCMA 1W0VA 2VB5A 1JGVH 2PTTB 3ULVC 1QRND 1UZ8B 1X6LA 1F13A 4QHMB 4EI6B 5GXBB 4YDVB 5IB5A 2IADB 4MQ7B 5IESL 1I1YB 3RVWC 4KHXH 5BZWA 1JPST 1LO3L 1F4XH 1J7VR 1KXTB 5BW7A 3HZYB 1J1PH 2V2TA 3NGBC 2PXYC 3CFCH 4ZS6D 32C2A 3AUVA 4DKDC 3CFJB 3EJYC 3IJSA 3S8WA 1UWGL 2OZ4A 4PGZA 2HVJB 4ZDHB 4WFEE 4X7CC 1LE5B 2ZKHH 3MJ7B 4OF6A 1F3DJ 1KBGH 2CUMA 3SKOA 4NQUA 5HTSA 4QNPE 2W9LA 3KLHC 3C60D 4NC1E 1JPTH 3VI3E 5IW1B 4Y8DC 3U30C 4P2QA 4JRXE 1MREL 4NDMA 4X80H 1EJOH 3U6RB 1JPSL 2ESVE 4L8BB 3PDDA 1JGEB 1CICA 1KCLA 3ARSA 3VXSB 2A9ML 1A7NL 2Z93B 4ZTPH 4I13B 4FTVB 3RRQA 1OWWA 4K71C 3QJHA 2BSRA 1ZHLA 2DMCA 1AJ7L 4EVNA 4XNUH 1VGEH 4HCRA 4YHMH 1ROWA 3BDYH 5AZEL 1DQLH 4GRWE 2BDNL 1AHWB 5DMJB 1MH5B 2Y5TB 2YD9A 5ESVA 5GJSL 3JV5A 3SDDD 5IJVA 4YE4H 1F8TL 3H9YA 2H8PA 3OGCB 3CPLA 5DS8A 2ZCLL 3QWOA 1IAKB 4AT6B 2KZWA 3JXAA 3QFJB 4FFWC 4LSPL 2OP4L 3H6JA 4YIQA 5C07B 5AD0B 5JPMA 3TP4A 2AJSL 4APQB 5BS0D 3UJIL 1U3HD 4PJ8B 1F58L 2YD6A 4GLRH 5GRVL 3O8XB 1WITA 4LHQB 1ZANH 4H8WH 5FO7A 2WIMA 3SY0A 4AJ0A 1C08A 1BQLH 5F9JA 5DJXA 4PJAE 4PJEE 3S36X 1GGIL 1RUQL 4C56A 2NY7H 1U92A 3RWFA 2AP2A 5INCA 3MMEA 2BNRD 1IFHH 1HZHL 3NTCH 1T6VN 2IH3B 3IDGA 2QQKH 2HH0L 4CUCA 4YHIA 5IMLA 1SMOA 4Y4HD 4LCWB 3MV11 1A4KA 3IRPX 1KN2L 2Z91A 4XP4H 4WHDA 3CXDL 3NACH 3H9SE 5GGTL 1OTSD 4GKNB 4XNQB 2AAVA 5INDB 4WI4A 2V2WB 3MR9A 6FABL 4FHBD 5MEND 1MI5E 4LDEB 4N1CA 4WGVB 4JFOA 4TPRL 4Q6YA 5EB9A 2MNUA 5E08H 3U1SL 3FKUS 1A5FH 2WSKA 4IOSD 2R0LH 1U8IA 1ZVHA 1UM5L 2FJFB 4U0RC 1JMXA 2H26A 4MNGE 4Y2DA 4ZUSB 4ZUWA 4OV5A 3IJYA 1IQDA 5IVXE 1QBLH 4U1GC 1WF5A 2J2ZA 3TT3L 4LASH 3DVGB 4ENEC 3MRIB 2V5MA 3GK8L 4JO1H 4MA1C 3WNMA 1IGFH 4LVOC 4J3UA 4NFBA 2A6KB 3VXPB 4ELME 4KRMB 5KSBB 3D69A 12E8H 1WCQA 1G7MB 1HSAB 5LGHL 3UTTA 3ES6B 3FMGH 2F19H 1H3TA 4GMTL 3PGFH 5TE7L 4TULH 1OGTB 4JJ5A 2DRUA 1T1YB 4YO0A 2P45B 4JM2B 1OT2A 2IFFH 5LCVH 4FP8H 4HXAL 3BGMB 1FNHA 3JV6B 1SBBA 1N59B 1XH3B 2OQJA 1Z5LA 3HS0A 2ENSA 5JOFB 1TTUA 1ZVSB 4HQQL 4ODWB 2VR5A 4HIIA 4QXTA 1KPUB 4MA8H 5D2NC 3RZCD 4JFEA 4Y5YC 1LHZA 4Z0BH 5ACZB 2A0LC 4OIBA 4NBXB 5F3HA 2X41A 5IVNA 3S4SG 1YYML 5DVNA 4W6YB 1D9KD 4Q6IA 4PREB 4YDKH 4MD0A 4RFEB 1U9KA 1MFCL 3HI1B 1DE4B 2BP3A 4NC2B 4NJAL 1LO0L 5L9DL 2X4PA 3BUYA 5HVWA 5B39B 1FLTX 3UAJD 5IB3B 2UWEA 3HMXA 4LCIL 2PR4L 4LPYA 1P84J 5KOVC 3DX7A 1YEKL 2JCCA 4U6YA 3QIUC 1NMAL 2ZSWB 2XWTA 4JQIL 1Q1JL 1FV1A 3W0WA 1P1ZB 2GK0B 3QG7H 4UTAL 2PO6C 1OPGH 2XOTA 4RMSA 1ACYH 4RIRA 1BVLA 4XRCA 5E5UB 1IC5H 3MRRB 1MCPH 1T1ZA 2BRQA 2YD4A 1FL3A 1ZHNB 2IAND 3SDAA 4HX1A 1BHGA 3PWNB 3TGXA 2B5IC 5JUEH 1MAJA 4P2QD 4JQXC 5DF0A 4HULB 3ULUH 4UDTB 2V2XA 1KJ3L 4YK4C 1KC5L 3IXTA 3QH3B 4ALAH 3LKPA 4Y88A 2QR0A 1CICD 1UGNA 1FC1A 3TA3B 2FDBP 3LS5L 4MA7H 4MJ5A 4YBQD 3REWB 5IMMA 4NFCA 3TF7C 3MOAL 4WO4B 3C2SA 1S9WB 2BHZA 3IF1B 1YMMA 4HIJB 2BC4B 3NIFE 3P4LA 5MI0C 3UTSB 2CLRB 3G08A 5I1DB 2CJUL 3MFGB 1A6UH 3G6DH 3GB7B 3F7RA 1S5HA 3F5WB 3NA4A 4KK6C 3F62A 1U3JA 2JE8A 3LQZA 2B4CC 3DGGA 4X5LA 5FIEA 3QP3A 3SDXA 3U2SA 3H9HA 2VDNL 4KQ4H 5EUOE 3K0WA 2WNGA 5JORB 4ZNEA 2J8UF 3TFKC 4OCNC 3WIHH 4PYGA 2AI0H 3SGKC 4JVUA 1NEZA 3B6SA 1LWRA 1OTTD 2F54A 3L5WB 1C5CH 4C58B 5GIRB 5CD3A 2X4QB 3OWEA 1F6FB 2EE6A 3WNNA 5EORH 2R0WH 1QSFB 4FQCL 4C56D 3SQOL 2OI9C 4OQTA 1UJ3B 4WU5A 1ZGLP 2BOBB 3E6HA 4ZUVB 4K2UL 1B0GB 4DTGL 4QCIA 5EBWB 4V1DB 3ALWA 5GRJH 5ITBL 3BH9B 5HGAB 2J4WH 5FF6B 3MUZ1 5FECA 5JXAH 5D96B 3VGAC 1HKLL 2E6PA 3U0WL 1IAMA 4PJXA 5B3JF 5T3XD 2NY6B 4OCSH 3H3PH 2PW2A 3H0TA 1ZHBA 2A6DB 2DQFA 4RAVA 4KQ3H 2FX8H 3KJ6L 5KSAA 2ZP0T 1E4KA 1FGVH 4HK3J 2OSLA 4UIMB 4CVZA 2NMSA 3BOVA 1UH3A 3MRPA 1U91B 2DLTA 4XPAL 5FGCE 1R0AL 5DRZA 4L8DA 3L3KA 1EVTC 1KENH 4Y2DD 3RX7A 4X9HA 3VXTA 1UJTA 5D7IB 3KLSA 2VTFA 2B0SL 3IDMB 1U8QB 2M26A 4PJIB 5E7FA 2YC1B 4QTHB 3NFPA 5JLZA 5I74C 1CLZL 1I3GL 3UBXA 4MNQA 3O2DH 3FN0H 1IM9B 1W0WB 4NO2B 5IB4B 3VG9B 3I3BA 3UTTD 4EI5A 25C8H 1IMHC 5I1AA 1BIIA 1SEBA 3MLXL 5IOPA 4QXGL 1CU4H 1F90H 3WFCL 1BD2A 4M9OA 2V5SA 1B0WA 2BVOA 2H9GB 5T33L 2M1KA 1A14H 4JZJC 4G5ZL 2NY4C 4HDIA 2VERN 1YNKH 3L9RB 4WFGD 2X1OA 3SKNB 2C1PB 1NLDH 4WRLA 2VO5A 2NY1D 2Y06L 3TVMA 5T1LA 5KS9B 1HEZB 2AJYH 3LKSB 3DO7A 1PY9A 3DVNB 4XWOC 2VLJE 1CQYA 3UCRA 1ZOXA 4JFED 1HYSC 1AO7E 2P8PA 4EUPG 1HHGA 3QEUB 4HUWB 2AXFB 3QDMB 2VL4A 2DBJA 3GSUB 3BZFB 5EPMA 4YH6A 5D7LB 4HJGA 4L8SC 2NW3B 1N3NA 4G8GA 3DI3B 5E5RB 2IAMA 5GHWL 3HE7B 3Q6GL 3EDKA 4W6WB 3MA9L 3IKKA 4LKCB 3W39B 1KCVL 5DR5L 3DJ9A 1X3DA 1FN4B 2ZUWA 4HPOH 4OZGB 4U1KB 5K9KA 1OF2B 1QLEH 4DGIL 1JHLH 1L6XA 4NO0A 4OGXL 4D8PA 1DVFC 4H25B 5SWQA 1OM3L 4YFEA 2AV7A 4PJCA 3W0WD 4PJ7F 1T7XA 3QIWA 3B3IB 2FHCA 5KAQG 1KF9B 1FZMB 4LNRA 1JN6B 5L6YL 4O51A 3TCLB 4P5MA 1J88A 3H3BC 4OGYH 5T3ZL 4XP9L 2C5DC 4UTBH 1E27A 3SDAD 1W72A 4KXZH 4HFWB 3FT2B 1FFOB 1G7IB 3ULVE 3O6FC 4MWFB 1R3HA 2OXHA 4QRQA 3Q3GB 3HE6B 3OJVC 4JZNA 5C08E 2FO4B 1FG9C 4JG0H 4WWKA 4Z76A 5MEPB 1NPUA 4OTXL 3U82B 1FO0H 1XCTA 4AIXA 3BE1L 1YMMD 3EHBC 2RGSA 1UXSB 1Z6JT 5EU4B 2Q1EA 5HVFB 1JGLL 4I4WA 3X12B 3L3DA 4CDGC 2DF3A 2JELH 4PJ7B 2WBWB 3ARGB 3RBSA 5ID1A 2GY5A 2P24B 1JFQH 3BW9B 4KKAC 5TF1H 4V2BA 4CJ0A 1AY1L 2AVGA 4ETQA 3O3DB 5C92A 1A2YB 3AY4A 2D4DA 1FO0B 1YEJL 4FQ1H 4NJ9H 5C0AB 2FZ3A 3OF6A 4F7TA 2P5WE 4O58H 5DRXA 3W11D 4DGYL 5IEKB 5IB1B 1GAFL 2OL3H 4P3DA 1QR1B 4M6AA 3DUHA 3O81A 2XKSA 5C0JB 1DQML 3EJJX 1NANI 1MPAH 1NDMA 3ZMRA 2EDFA 4O00A 1KCUH 2CGRH 3TT1H 1QPPA 1YJDC 3ZSSA 1UWEL 4NZTL 5EZJA 3EUUA 4ZAKB 3W82A 1S7UB 3MRBA 2F54D 2VLLB 3RBGA 2VDLH 3FL7A 1BPVA 1FVCB 2N7BA 3V6ZB 5L2KB 1N0XL 2W38A 1OAYH 1J0ZA 4WW2B 1ZGLM 3ZYJA 1S7WB 5GS0H 1IEAA 4LF3A 5DMGC 4ZPVB 1WAAE 1PKQA 2XN9B 3M8OH 5JIIA 4JAMA 5C8JA 5C0NC 3FQRA 1KT2A 4DK6A 5FB8A 1UCBL 4M93C 4UUJB 4WHTB 4UILH 4XPFH 5H2BA 1GOHA 5I16B 4BYHA 4O4YL 4LCCA 5F7EL 3HMXL 2ZOKA 4BH7B 5HYJB 5KSAD 5KTEH 3F7YA 3MRKB 4LFHG 4HWUA 3TH4T 4QOKA 5EBMB 3EFFA 1LO2L 5LGJA 3VW3L 4OF3A 5IIEB 2W60A 2YWZA 1IGYA 1I9EA 4NSKA 5MP6H 2C9AA 2VQTA 3QXAB 3VWKA 4R0LA 1MIMH 3UZVB 5DJAA 3QCUH 1A9BA 5FKPB 4CGTA 4RISL 4Y4KC 4HAGA 4UQ3A 1FFNA 4NN6C 4WNQA 4IOIB 3VH8B 4EDWH 4MNQD 3O4OB 2W0LA 4L29B 4TQEL 4XP6L 4EI5D 1MQKL 4NP4H 3MXVL 4I0PD 4QTIL 4U1SA 1HOCA 3H42L 4LRIA 2XRAL 3NCFB 2F53B 3ALXA 5F7KC 5A1AA 1BD2D 1X7QB 2IQAB 4HFUL 5D7JC 1GGBL 1M71A 4KI5F 5JHDB 3P77A 3G6JB 3LDBC 3V79C 3QNYA 4MAYC 5ICXA 4Z7VF 4P0DA 4GUPB 4PB9L 3TO2A 2X70B 3FN3A 3TVMD 1RUKL 1G9NC 4G3YL 5CGYC 3AM8C 43C9B 1ZT4B 3DRTB 3O9WD 1INQA 1CFTB 2FSEB 1I4FA 2VDQH 5TPWH 4PY7B 3HAEG 4M6NH 4UNUA 1KPRA 5F9OL 4BZ1H 2DIAA 5ISZB 1MWAH 4M43H 1IQWH 4QXWA 1WBZA 5I1HL 5C0BA 2PETA 3KYNB 3PL6A 3E6FA 4MXVF 4NKIL 5E56A 1UFUA 3KLDA 2A6JB 5E9DB 3NFNB 4LLMB 4G8GD 4GG8B 2VDPL 2IAMD 5DQJA 5H37G 1CVSC 2MPAL 5H35B 3DSNA 1R24B 1EX0A 3GMQB 4S11A 4OGAD 4LVNC 2D9CA 1IL1A 1MWAB 3T2NH 4LVHC 4YHPA 2NXYD 1AKJA 4PRHA 1N2RA 1UT9A 3QWRD 3GNMH 3T65B 1WC7A 4NO0D 1UM4L 1MHPH 3D9AL 1CE1H 4JFHD 4Z7VB 5J8OA 3MV7E 1BQUA 3L5IA 4OQTL 4F58L 2I5YL 3GBNL 3QIWD 4JRYB 2Z31B 2D7NA 5I17A 4E42B 1SJXA 4KHTL 3IJHB 1NSNH 3DHMA 2XZCH 3OR6B 4ODVL 3VG0L 2D03H 5D2NE 3R8BB 4P46D 2AS5M 3WXWL 5L8JB 3JV4B 4K94H 4LGSB 1QSED 1EV2E 5FV2A 2UUDH 5A16B 4Z7WF 3BD3A 3BKJH 2DWEA 3ISWA 4UU9B 4RGND 4IOFC 3KWWA 1MHEA 4JEGB 1B9ZA 4I2XE 2XWJB 3ZHKA 2BOCA 2CRZA 3WDIA 4NNPL 1FL5A 3D85B 3GO1H 1KJ2A 4OD3H 4P2OB 4R4FL 4JKMA 5I1JH 4WWKD 1GC1H 1XF4B 3WCYA 3TPKA 1LDPH 1JZ2A 1FNLA 1EPFA 4GXVH 3MNZB 1EFXB 5DD3H 3RGVA 2DQDH 2HT4D 1CL7I 4AH2B 2Z8WC 4S1SL 5IR1A 3DROB 4P57B 4ERSH 2BSSB 5DJDA 3TV3L 2ZJSL 4I18A 3PNWA 1RZGB 1V5JA 3U0TB 5K9OA 1URLA 3QEQB 3KPTA 1Q94A 5DEGB 4KJWD 3CFEA 3RWJB 2A83A 3OF6D 3R8QA 4YNYA 3STLA 3BZEB 2F74B 2HRPL 1AQKH 5L8LB 1C1EH 4C54A 2AJVH 1ZLVK 3QDJB 2HP4A 4OFPA 4LIQL 3WKML 4ZS6C 5F88A 3VFUB 1VFAB 3AVEA 4J7RA 4OZHE 4M6OL 2DQEL 4WI6A 4IRZH 4PJHE 4RGOL 3E0GA 2RCSL 4XP1L 3T0WA 5ESQB 3T3ME 4FQXB 1AGFA 1Q9OA 4L4VB 3D87B 4PIRF 1C7SA 1V7ML 1BVKB 1ZGLA 3BRDA 2KQNA 5DJ2A 1BX2A 2CRIA 3PIQA 2X7LA 2C7UB 1NBVL 5KANG 3C60C 4GMSL 2Z8SA 4D0BB 3VCLA 5BVPH 1FPTL 4R8WH 1FRGL 3EDJA 3T4YB 5KVEL 1MELA 4D9LL 4Z7UA 1KN4L 4JPWH 4EDXB 4OV6F 4OLUH 3UXFA 1CLCA 1NGZB 5KVFH 4OZ4B 3WLBA 1I3VA 2DLGA 3ARTA 4HWZB 1ETZB 4XCCH 2VXTL 3ARFA 3CMOH 3K46A 4UI2A 3I6LE 2C4FT 3WUWG 5HSFA 4MMZC 1T04B 2YK1H 2DQIL 4X0KA 3RKDD 1EGJA 5FGSA 4QOKD 3TYFA 4U6VL 2Q8AH 2NQCA 5CINH 3KJ4C 4QRRE 2EDOA 2FJHB 1N8ZB 3EOYG 1XZ0B 2FJGB 3QXDB 3I85A 5CS7A 2PCPA 3V4PH 4Z77A 2VLKA 3VWKD 5DRNA 4BSWB 4D0CB 2X4TA 1IGMH 4L9LA 1MCJA 1FG2B 1U3HC 2E8ZA 4LPWA 1VACB 5A2IH 1J8KA 3IFNH 1ZA6A 4JY6A 4X6BB 5F70A 4PJBA 1W72L 2X4SB 5BRZE 5L7XH 1K6QL 3ARBB 3GBML 5CJQL 1HI6A 5KZCB 3RPIA 4JKPH 4XNXH 2GFBB 1F2QA 4NKDA 1A9EA 1SY6A 4OCYH 3O3EB 5A2LH 1OLLA 1BFOA 5KG9B 1QFWI 2D9QB 4KTDL 1J10A 4K7PX 3MODL 2ARJB 4Y4HC 1G7JB 3OKDA 4P5TB 4CDHA 5DZLA 2DDQH 2DTMH 5TE4H 4XPTL 3U0PA 5FUCC 3PWJB 3HI6L 5F7MC 1ZEAL 1A6ZB 4JFXA 4HK0B 4JO3H 4WHYG 1X4YA 3L3GB 4S2SA 1WFNA 2OM5A 4CADA 1HNGA 1BOYA 1FJ1A 1JV5A 5HGDB 4XT1C 1NANH 5C0BD 2ZUQB 3PL6D 2ZPKL 4IRJA 3IRZA 3N1GC 4K9EL 1RIHH 2BZDA 5TJWK 1VERA 1XR8A 3THML 2HLAA 1DLFH 4WTXA 3WS6C 3GDBA 1YYLH 5IROC 2F5AL 4PLOB 2AXGB 1TJIL 1HHIA 5IMOA 5HHOB 1NDGB 1CZ8L 1AKJD 4PRHD 1BWMA 2A38A 1TVBA 1ZHKA 2Q86B 1LEGB 4D94A 2W1NA 3BH8B 4B50A 3KPNA 4FXGA 5TQ2H 1RJZB 2ZWLT 1JBJA 5EWIH 4ELKA 2MCG1 1CS6A 3HNTH 3RIFF 3RVUD 3TIDB 5BCAA 4FXKB 5EDXA 3OTTA 4XC3H 1T21B 3ELAT 2GJZB 4YDJB 3NABL 4G43B 4Q0XL 2YD1A 4GJTB 4RGMC 2HTLD 3GMMA 5F96L 1YNLL 3MOQA 3HG1B 3WNPA 3MLPA 4LLVA 4DVRH 1UACH 2ATPA 3RWCB 4G9DB 4BSVB 3MACH 2D7TL 4H5SB 4NRYB 2D31A 3C09C 3A67H 2ITDA 1DANU 4TNWK 1FZOA 4UT7H 4NN7C 4P5KA 2FWOB 1QKZL 2XZZA 2XNAB 1I1AB 4LEOA 5C71A 1Q9LA