1FORH

Structure determination of an fab fragment that neutralizes human rhinovirus and analysis of the fab-virus complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
QGQLQQSGAELVRPGSSVKISCKASGYAFSSFWVNWVKQRPGQGLEWIGQIYPGDGDNKYNGKFKGKATLTADKSSTTAYMQLYSLTSEDSAVYFCARSGNYPYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQTITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 17-IA FAB (LIGHT CHAIN)
publication title Structure determination of an Fab fragment that neutralizes human rhinovirus 14 and analysis of the Fab-virus complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1994-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1forH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1forH02
2R0WH 3WV0A 1V7NH 4PS4L 5BJTA 3C60C 5JOPD 3AGVA 5EU5A 5EFIB 4HWEH 2FO1A 1ZGLP 2Y06H 3T0EE 3S5LG 1F97A 5DJ6B 1DBBH 4WCYH 1BJ1J 1DQQA 4P0DA 3VXTA 1D6EB 2A6JB 2DQFA 2X7LA 5ILTH 1XGYH 2E8ZA 1I3RA 4D0BA 4WI4A 5LKNA 3LQZA 1ZT4B 1YEHH 3TNMA 2ICWJ 1T83C 5DO2D 1FL3B 2VZTA 3U0TA 4E41B 4BSVA 1K5NA 1KCLA 4LIQL 5JIHA 2JJTC 2OCFD 3KYNA 5GS3A 4HH9B 1AD9B 3RHWF 4MJID 1MIEL 4Y16D 2ERJB 4F8TA 1CG9A 1BM3H 4XCNB 2M26A 5I1KH 5L0QC 1MQ8A 4TUKH 5I66A 4KMTL 2B1HL 5KVGH 4O2CA 1NGPL 1BMGA 4NBXB 4QF1A 2VWEE 3DVNB 3SDDB 4G3YL 3MRHB 4JFYA 4FZ8L 1BF2A 4GXVH 2X4QA 5FGSA 1VGEL 4QHNB 3BDYL 3X12B 2W59A 4DUWA 4W81A 4KU1A 3ARVA 3MREA 4I0PD 3MV7E 3QQ9C 5IHUL 1JGDA 1WK0A 4JPVL 1DN0A 4KDTC 3U2SB 1UZ8B 1G9EA 1WCBA 3V4PH 2C1PB 3QUZA 3MLYL 4BQ6A 2BXYA 5KVEH 3KYKH 4Y5YA 5IJVA 2DIJA 4P2QB 1NLBH 4LHUB 5IVXB 1FJ1A 2OLDA 3OXSA 3EJYD 1UWEH 2ZWLT 5E2VH 2AJVL 4YX2H 1BX2B 1JGVH 3BKML 5CZXD 4R4BA 3HZKA 4GBXC 4IDJH 4JZNA 4PP2B 5DK3A 4RFEB 4FTVE 4N1HB 2LE9A 4Z7WB 4P3CL 3W0WE 3D2UA 2R2BB 1LILA 2CKBL 1RIHL 4L9LA 3QNZA 4IRSA 1Q1JL 2F53D 1FNAA 2NY6B 4FFWC 3I6KB 1TZIB 3FT3A 3BKCL 5CLWA 1TJHL 2G60H 4I0CC 3GSOA 1MFAH 3ARGD 1IGFH 1TNMA 1W8NA 1X4ZA 2AEQL 5BCAA 2V5TA 2B1AH 1JI2A 5FUCC 4Z0BL 4F9LA 1OAZH 4HEME 4F7EB 5HVWA 1YEKH 3ELAT 2CDGA 1YPZF 3QFDB 3EYVB 2Q87A 2WZPD 4MZ3A 3F7YA 5M7QA 2ZUQC 2WLYA 4Y7MA 3O6KL 5T1DL 3ZKXB 4ZOCA 4DN4H 1VFBA 2E6JA 1F3JB 1WFUA 3D39D 4TULH 4AEHL 1QBML 1S9YB 1G7IB 3FO1B 4OF3A 3RI5F 4RGNE 5E6IB 4JO2L 1QBLH 4NBYB 4P4RA 3VH8G 2GKIA 1UWGH 5KSBF 3UTTB 3GIZH 5TE6L 2ZSWA 3NFSH 1HH9B 5C0AE 1KPUA 1BWMA 2PYEA 5C6PB 1N3NA 4OGAC 1K4CB 3IS1X 1PYWB 3UAJC 1JNNH 3DV6A 2WBWB 3LKOA 3MRMA 4UV7L 3RIAK 1ED3A 2MJWA 1QRKA 2VL4A 3PJSB 5EBGA 4GW5A 4KHXL 4ZS6C 5DSCB 1XGUB 9CGTA 2PW2B 1SYSB 3MV01 3VXSD 43CAA 5JUEL 4L3EE 3UC0L 3NFPA 5JHDA 4JJHA 3SCMD 1BAFH 4NOFA 3I50L 5EOTA 3BWUC 3NIDE 3OJVC 2WIIB 5TPWH 4QRPB 3ULVH 5GSRB 3JV6A 3G6JB 4NZUH 4WUUE 1U8OA 4IOFC 3FT4A 3O0RH 2UY7A 1JNLL 3EOBA 4JG0L 4PJCA 5BRZD 5JXED 5IFAH 5JA9A 1J86A 3RUGB 3NZHL 1KEGH 4EI5A 3MA9H 4LVHB 3B8YA 3MLSL 1PG7L 3B5TA 3RFZC 2BNUA 4HEPG 5D2NB 5KG9B 4Z7OF 3REWA 4Y4HB 1UYWH 3RNQA 4I1NB 4HIEB 4WDIA 1M7DB 4HGWB 2DIAA 1J88A 4LP5A 2QQLL 2VERN 2HJLB 3K1KC 3QQ9D 4QKXB 4JJ5B 3ZT5A 5BZWA 3BGFC 1D9KC 1DQJA 3PHQB 4S1DD 4O5LL 1A5FL 4KV5E 4YHZH 2FX8L 3PGFL 3F7VB 4UDTB 1HWGB 1DVFA 3BPNC 3DIFB 4PJDB 1X5YA 5HHVH 1WGOA 3MCLL 3FAWA 1KB9K 4U6HB 5B38G 4JZJB 3HE7C 2VABA 4P5TD 4UB0H 1A1OB 3REVB 4NKDB 4XPAH 1T5WA 4G8IA 3MNZB 1JPST 2EYTA 4MQ7B 4ONGH 1JHLH 2HMID 1NEZB 1OP3H 3R06A 4M7ZB 1ES0B 3ZLQC 1NDGB 5IIEB 4HKJA 2KH2B 3S9DB 4PJ8A 4XMLL 1A1MA 1A4KA 3GUTB 4WI8A 3TFKC 4K3DH 2UWEA 1ZSDB 2GSGA 5EUOB 1FSKC 2WUCH 4OCYH 3AREC 3BP5B 4J3VA 3CNKA 1A2YA 1GZPB 5SWZD 2DQIH 4OD3H 3HNSH 2QKIA 3UCRA 4ORZC 4X4YB 4OV6F 4PBVC 1YEDB 1LWRA 4X99B 3KPRB 1BFVH 2OQJB 4G5ZL 3ZSTA 3JTTA 5GS1C 5BOZG 2D03H 4JHBA 2IBZY 1P4LB 2A6KB 3BEWA 2C3VA 3L3JA 3THML 1H0DB 2XZZA 4PGEB 1KJ2H 3Q1SH 3RGHA 4YFEA 5KAQF 4G8GB 4KKLC 1PD6A 5KSUA 1AGFA 4MX7B 3VDCA 4JGMA 2C5DC 1KULA 4XWGL 1U8KB 3PABB 4RQQA 1ZVHA 4PRHB 4LPUA 4UAOB 4GKZA 6FABL 2BNQA 2B2XH 2ZJSL 4GMTL 4XNMA 4WJ5B 3L7FA 1DN2A 1DQTA 2Z35B 4PYHA 3KLDA 2NXYC 1XCQB 1EEUA 4PJAA 1TDQA 1MCDA 1K8DA 2AV7B 2EYSB 4OTXH 4R7DA 3E2HB 4NOBA 2FATL 3TZVB 2A9NL 1JP5A 5DR5H 3ZTJG 1WTLA 3KPOB 1MOEA 3C08L 4JDTH 5FYLD 3N1QC 4OUUB 3HNVL 4HGKC 4H5SA 5GSVB 1CGUA 4OGAD 2DMKA 5FM8A 4HXAH 4OZIB 4QOKD 4DZBA 1TCMA 5HHXH 2YKLH 4QHMA 2VE6A 3DVIA 3FCTA 4U4BA 4Y1AB 1CDBA 2DB8A 1HXMA 1P53A 2X4PB 1ERNA 1QYGL 2IPTL 3HS0B 1IJ9A 1SJXA 4U1NA 3WJJA 4OI7A 2JJSA 4HIJB 3GSRA 1R3HB 4KVNH 3ULVC 5B3JE 5GXBB 4V1DE 3DI2B 2ATPA 3GSWA 4ZSOE 5MEND 1QSFD 5E1AB 4OD1L 1KG0A 1NCDL 5HDQH 2PTVA 1I8LC 1J1PH 4YAQA 2AGJH 3MGOA 3P11L 5INDB 1HINL 4J23A 1HOCA 4RA0C 4HHAA 5FKAB 1EEQA 5I1GL 5CZKA 2CJUH 5GS0L 2FIKA 3LV3A 4G43A 5CMAA 3ECBB 4LLDB 4Z7VF 1RQ5A 4NO3B 1FN4A 3QDMB 4KUCF 1LNUA 1IAII 3SPVA 3TV3L 3VGGA 1IAMA 5HHPA 1AO7D 3HFML 5IVXF 4BQBA 5HVHC 4U6VH 1MJJB 4JM2B 1DE4A 4QXGL 1D9KD 1FRGL 3WIHA 3JV4A 4OI8A 1MRFL 32C2B 4Y5XB 1B6DA 3VWKA 2NY7L 3MLXL 1P1ZB 3WDHA 1I8IA 5ESAA 3HC0A 1ND0B 2APFA 3O9WA 1I7RB 1RFDL 2VR4A 4XNYH 5E9DE 3QRFM 3LN4A 3O3BA 2VL5A 3UXFA 2ID5A 1AC6A 4F7TA 1KIRA 3JVGC 4KQ4H 3BVNA 4J3OC 5I8KH 4PJFA 4UT6H 2L0DA 3ARDB 1RUKH 1RUMH 4UT7L 2Q86A 3OAUL 4PREB 4JFHE 3NCFB 1AQDB 1RVFL 3GGWB 4BH7A 4NGHL 5SV4A 3IDIA 1GGBL 3MRCB 4M6MH 1A7PH 2NR6C 3UPCA 1OM3H 3KJ6L 3VGBA 5IBUB 4CMMA 2Y6SC 1QHPA 1GRWA 3RAJH 1IM9A 1JF6A 4KK6D 2EH7H 1Q72L 3F12B 4U6TA 3X3FL 5T5NF 1J11A 1FL5A 3HMXA 4APQC 2BCKA 1YJDH 4CVXB 1CFVL 3LKQB 4FG6C 3VXNA 1XGRB 2W9EL 5DT1H 5F71A 3DRQA 4K23L 1QFUH 3M1BB 4PJ7E 4NQCA 1M7XA 1U8HB 2N56A 4QWWC 3SDDD 2AJXH 3TO4D 4X6CA 3QFJA 3ZKNC 3TWCL 1FAIL 3BHBB 4KKLD 1CL7L 2PO6A 2FR4B 1MHHA 4ZOEA 1QSEA 4BZ2H 3HCVA 1JNHA 4MAYC 4MJIE 5F7UA 1ONQB 4PJHE 5F3BA 4JFOB 2DQCH 1QFPA 3VCLB 3MRDB 3OKLB 2R15A 4NWUL 3L3KA 1M05B 1IGYA 4BZ1H 3OKYA 1G1YA 5DMYA 4MMXC 2HWZL 5JOFB 3CDFA 5BVJA 3SBWA 1KNOA 1UG9A 5JTWA 3PL6B 3OF6A 5KAQG 3S7GA 3IFPB 3FQXB 5I15L 4DGYH 1X5IA 2LFGA 5F9AC 3G6JF 1KJ3L 1HQRB 5FM5M 5DLMH 2NZIA 4FQXC 3Q6GL 2WIMA 4K2UL 3VD4A 1I1AA 4OCNC 1T22B 3QPXH 1QRNA 4C83B 1T0NA 5IKCA 4JO3H 2FBJH 3DROB 1H9VA 3QO0A 3IETA 2YPLB 3C9NA 2ZKHH 4JY6B 1Q94B 3FT2B 4OQTA 3QUMB 1K3IA 1Q9WB 1Z0NA 4CW1B 1SQ2N 5D6DA 3V52H 2A9MH 3RL2A 1LQSR 5JPMB 2OZ4A 1N7MH 4OFKA 4IMKC 5CZVH 4NNYB 3EYQD 3O2DA 3VA6A 4PRDB 3RGVB 2FH8A 1UB6A 2NY6D 1CI5A 4OCSL 4M6AA 3VG0H 5IW1A 2CPCA 5JDJA 5FK9B 4BA8A 3MOQA 3QUKA 4BUHA 1TZGH 1BBJB 1KTLA 4YHPA 3KWWB 1HHKA 4JY4B 5EBMB 2F15A 4HKXA 3JWDL 3ARXA 4OKVB 1PKQE 3MBEB 5GRUL 4OFIA 1TTGA 4XC3L 1R0AL 1N0LA 2D4DA 4LP4A 3O4LB 1HZHH 3T0EA 4QHUB 5HTSA 1TJIL 4I2XB 2F53E 4PJDF 1QOKA 1B9ZA 2VZVA 1RK1B 4ODUB 4M5ZL 4KDWA 4ODTH 1JFQL 1JPTH 2OTWB 4UQ2A 4Z7UB 5FO7B 5C2UB 3MFFA 2Q7YA 4EXPX 1KXTB 4OJFH 5FYJD 3EFFB 1U36A 1QP1A 5BW7A 3CFCL 5IWLC 2HLAA 2BDNL 2J12B 1I8MA 3PV7A 3EBAA 1ZK9A 1IAKA 3SE8H 3BPCA 4HLZH 5KN5B 5KS9E 1MCIA 3HPJA 4RMWA 1W72B 3GSNB 4HWZA 1EAPA 4HUVA 3VI4E 4PJ5A 3VFVB 3RVWC 3QUXC 1UH3A 2A6IB 3VD3A 1SMOA 1UM4H 2NY1B 5C0RH 5E00A 1FFRA 4JR9L 5IW6A 1C12B 2YSSB 2GY7B 1IGMH 1JL8A 3GK8H 5FYJU 3QDHA 1ZOXA 3D39E 1HSBB 2R4RH 3GJFH 4DEPC 4YXKH 2NX5B 3KPMB 1A6TA 3VMNA 5C0JA 1VDGA 3LB6D 4LBEA 3STLA 5LGHH 4Y4FC 3GRWH 4DCQB 3V9FA 1CK0H 2XRAL 3VD7A 3MV7A 2AQ3A 2Y6SD 4G7VL 4MHHG 5DJZA 3PV6B 1AXIB 2JCCE 3PDOB 5EIQA 3MFGB 3QHZL 2RFXB 3EDFA 2VXSL 5LAXA 2H2SC 3VXSE 3ZE0F 1RV6X 3KHOA 5LCVH 1L4IA 1QZ1A 5IMMA 3QCVH 5DUPL 2ZOLA 3RTQB 2FO4A 5E8DH 1FPTL 3ZHKA 4OLYH 1YA5A 4XPHL 3WFCL 3QZWA 3ZKND 4NIKB 3ILQC 2UZIL 1ZT1A 2OBGA 2BERA 3N9GL 1F4YH 4OB5H 5EC1B 3WXWH 5TF0A 1XGPB 4FTVA 4XP4L 4YHNA 3TBSB 4IIQA 3OKDB 1QO3A 5FV1L 5DRWA 4PGBB 3C87A 3LS4L 4O9HL 3FB5A 3HI5H 4LPCA 1I3GH 1YMHA 4Z5RA 2YUVA 1TVBA 4OCRL 2GJ6B 2F58H 3LH2L 3D48R 2OXGA 4FQXD 1G9NL 5KVFL 1JZ2A 5GRXG 3VXRA 5ID1A 1BWWA 2DL2A 4EI6A 4JKMA 1NCWL 5DJAB 2R1WB 3RWJB 1T03L 4FXKA 2DQUH 2AI0L 4QNPE 2IAMB 4JFZL 2R29H 3H6JA 1XR8B 5T1MA 3BT2H 4GO6B 5MERA 1UT9A 4M9OA 4W4OC 3KPNB 5HJ3A 2VH5H 3ZE2F 5FHBL 4OV5B 3MLVH 4N8VG 3BE1L 3DYPA 3L95B 3JZ7A 4JB9L 4AENA 4JQXC 1T89A 4M61A 5JO5A 2PETA 3KS0J 4YBQC 3KPSE 1PLGL 4LARL 1E6JH 2EIEA 4PR5A 4PP1C 3NA9H 1NCAL 3S3JA 2HTLD 1EDQA 2H32H 5GGTA 4D9LL 4EUPA 4U05A 5C0AA 1MWAA 4YHIB 5J3HC 3MACL 3P30L 4PPTA 5D7IE 3IS0X 4LPXA 4PJIB 5DJ2A 5SWZE 5HHQA 4YDLC 2G2RB 1PAMA 3EYFB 3RU8H 2IGFL 5HGGS 4NM8L 4HPYH 3M45A 1BBDH 1UCBH 5FHAH 4PGDA 4L3EA 5CD5D 2VLKE 4WI5A 2KQNA 4M43L 2XPGA 2XI9A 4U1GC 1ZLUK 4OQ1A 3SJVB 3DMMD 2DKMA 3GSVB 3MBXH 3OJDB 3EOYG 4H20L 3TZVD 3NA4A 3DX9B 4LSSH 4Z18A 4WUUA 2EXYD 4PJ9A 4UQ3B 5E8PA 1B0RA 1NBYA 4PS4H 3SKNA 2FJFA 3BPLC 2P8LB 1MCFA 1SYVA 4LASL 2W65A 3SDAB 5F70A 4LOUC 3MLWL 4XP9L 4TSAL 3LN5B 5C3TA 2P5EB 3WCYA 1HE7A 3UROR 1MJUL 2IQAB 2VXTL 4PY7A 1J8HB 1KLFA 5MI0B 2P7TA 2XQBL 4Y1AD 1I1RA 1NC2B 1RJYA 3CFDB 4P46B 1T20B 5MEQA 5FYLE 5HHOD 1AJ7H 1KB9J 4IRJC 2R9HD 1QACA 3C6LC 4NKQB 5IFJA 5GS2H 1IKNC 4YK4C 5IHZA 1FVEB 1AIFB 1PG7X 5HYEA 5J7CC 3DXAD 1A3RL 5HYQA 1DDHB 1MCPL 3DVGA 1XF4A 4LIQH 1XF5A 1FNEA 3KLSA 4FABL 1MIEH 3IDJA 4K3JL 1K4DB 4OBSA 5T1KB 4I4WB 4KMTH 2B1HH 1EHLL 3MJ9A 1NGPH 5FYKL 4UBDC 1TPXC 2PUQT 2O5XL 2XWTA 4G3YH 4W6WB 4FZ8H 5MENE 5FAAA 1DBJL 1QSFE 3FB8A 3G6AB 1VGEH 4XC1H 1J18A 4OZHB 4KMQA 5F9WC 3BDYH 3ILQD 1PKOA 1JF1B 3V6BR 3MLUL 3IGAA 1JZ3A 3UPRB 1YN6A 4MA7L 5D2LB 2GSIA 1OGAB 3CZJA 4DFHA 4F80A 4J7RA 5IHUH 4UILL 4WFGD 1UB5A 2Z91B 1GOHA 4JPVH 2RIKA 3ZDZE 1G6VK 1WLHA 2UVFA 3MRBB 4NP4L 4WO4A 2DL9A 2D9CA 1G7MA 3K2UL 4KWUA 4A2LA 1T1YB 3MLYH 4GRWB 4XXDB 2H26B 2RQ8A 4FMKA 1TLKA 3K4AA 1AO7E 5EPMB 1OLZA 3K4DA 3RVTD 3I02A 2J1KA 2NTFA 2EIDA 1MAMH 3F5WB 3QEHB 3WUWG 5EUKB 3ARDD 3LEYL 2EIZA 1KTDA 2HFFB 3TLRA 4NHUA 4OM1L 3QUML 1K3ZA 1SEQH 3ZYOA 2ZPKL 2AJVH 3LD8C 2IALB 3T09A 5T3ZD 2HVKB 1T7ZA 3CPLA 3GKWL 3LOWA 1ITCA 1DR9A 1A9EB 6CGTA 1OP9A 4PLJC 1A7QL 3TA3D 4NKIH 4P3CH 2CKBH 1RIHH 4NDMA 1VFMA 5ACZA 4YDKL 4ZFOB 4X5WA 4H26A 2PF6A 1IGJB 1R5IA 1Q1JH 2I07A 1I75A 2AJ3A 4LRNL 4PB9L 1Y18A 3P3YA 3VRLF 4MLIA 4HS8L 4LRIA 4OLXL 3DUSA 4NSKA 3BKCH 2Y07H 3IRPX 4ISVB 4WV1B 4D2NA 1TJHH 3QDJD 2AEQH 2CGRH 4Z0BH 1KT2B 4IOIB 4E41E 5JPNA 3JTSB 1U95A 4LSDA 5EZJA 4XAKE 1PFCA 3ZT6A 3HUJB 4RSVA 1EEZB 3NIFE 5D70L 5E8EA 1MFCL 3LHPL 4WI7A 3VFWB 3O3EA 4LVNC 3DO3A 4QGYA 3O6KH 4Y2OA 4ZPVB 3GSNL 4KI5D 5T1DH 4F37F 2X44D 1NDMA 1NFDF 5EO0B 1C08A 4NUGL 5J6HB 4U1KB 2ATKB 2FEEI 4AEHH 4D9QD 2R56L 4JHWL 5L2JB 1BFTA 1QBMH 2C4XA 2G75B 2VN7A 4V1DA 4ZSOA 3QEUA 4QXUL 1NMCC 4JO2H 1F4WH 1KELL 3RZCA 1N8ZB 5DZNA 2A1WH 1KV3A 5D4QA 1KTKE 4HKBB 5TE6H 3CU1A 1J9CT 4DJMA 1L7IL 1ZGLM 5GZNC 3MRIA 3ARFC 3EJJX 3IDYC 4KTYA 3QWRD 4DGIL 4UNTA 4XP6L 1NFIB 5E4EB 4YXLL 2EKSA 3QXAA 2ZNWA 4UV7H 3G5YA 4FN0A 4OFDA 4KHXH 3SDCA 3MUJA 3BRFA 5JUEH 2VLRB 4P2QE 3UC0H 4WW2B 2JJVA 1CXIA 3I50H 4LFHD 5FGCE 3B9KA 4JN2B 1D5IL 4NQSB 3U0PB 5KJRH 1A9BB 4LMQI 5DA4A 2PCPB 4J12A 4DVBA 3MUGB 1JNLH 4JG0H 5MHSD 3STZA 3T2QA 4Z7WE 3NZHH 1W0YT 3MV9B 2VQTA 4J8RB 1VADB 3MLSH 5E9DA 1PG7H 1ROWA 1X5XA 5DFVC 4ZFFB 1EK3A 4UBDD 4TNVK 1KPVB 3U4BL 3H7LA 3ARSA 4JO1L 4HS3A 4CNIA 4EDWL 4XCEA 2IH1B 2W60A 3ARBC 1GGCL 1RK0A 1SJHB 5DMJB 5DD0L 3KGRA 4M9PA 2QQLH 5IQ7L 4UV4L 4U31A 5DHYB 1WICA 4EDXB 5GGRA 4L8DB 4BJLA 5IM7A 4PJGF 5J1AA 4X80L 4O5LH 1A5FH 5KBNC 1WEJL 2MHAA 5JR1L 1WZLA 4DFIA 2FX8H 2HJFB 1MUJB 2IC2A 1TNNA 2A83A 2QQNL 1T4KB 3MRGB 3T2NL 3MCLH 4ELMB 3O8XB 1X5LA 3O11A 3LKRB 5FYJE 4PRIB 4NZDA 3FONB 1G7JA 4P57A 4PJ7A 2CLZA 1HHJA 5I75B 1JMZA 4NO2A 4MS8C 3G04A 4U2ZA 3MODL 2VISB 4ZXBC 5JOEA 5DD6B 1AI1L 2A0LC 4KMLB 2X1WL 1KB5B 2YC1A 4YEEA 2R1YA 4OSUL 5DMIL 5BQ7B 5D96C 4XXCA 4UMGA 3NPSC 3D25B 4XMLH 4PLJD 2P44B 4MJIA 4MA3B 1LO2L 3GI9L 4MWFA 4PJIF 4KUZL 1ETZA 1WUNT 1U8MA 2K1MA 1JE6A 3MRFA 5K9QI 1UH4A 3WS3B 3VFTA 3C8KA 2DAVA 4PRNA 4OGYL 4CVZA 3MNVA 2D31A 4OCXL 4G5ZH 4ZUUB 4JHAL 5LVEA 2BVPB 1KIPA 4I0PA 5E95B 1GVIA 1KBGL 4R8WL 5CJBA 5H37H 5LBSL 1HHIA 3D3VD 3THMH 2P46B 1DLFL 3DO7B 4LCUA 4CL7A 1U8JB 4XWGH 1FNGA 5LGJB 3T08A 1XCTA 3ZHLA 2ZUXA 3GI8L 4XZUA 5I76B 6FABH 2H45A 2YXFA 2ZJSH 4GMTH 5D5MF 4XCYA 4Q7DA 3FTGA 4K3EL 3DGGB 1I9RL 4P23B 5EZLA 4Z7NF 1TVHB 1UC6A 2D2OA 3U6RB 4QRTB 4PRAA 3PHOA 1NBZA 3SHSA 3U0WL 1KXQE 2FATH 5F9JA 2G9HA 3KPTA 1CXKA 2A9NH 4WI6A 3ZL4L 3H2WA 3ES6A 3LRSB 1FYTB 2XQYK 2GJ6D 4UZGA 1YY8A 3C08H 3L3OB 4MNGB 1TQBC 4PUBL 3HNVH 4CMHB 4JGUA 1DANU 4UTBL 3ARFD 4WHTA 2CSPA 2FGWL 5DJCB 1PKQA 4CADB 2OL3A 2NLJB 2ADJA 1S7VA 4JHZA 5DC0A 3RIFF 3IKCB 5C0DB 4Y4KB 5DTFB 4U49A 1MCOL 3WBDA 4IDLA 1FV1B 2F53A 3D18B 4PJEF 4XH2A 2XA8H 2X2YA 4TPRL 4NKMA 2F54D 1CR9L 5FM5O 2B39A 1QYGH 2IPTH 1MCEA 3D69A 5CBAA 2DDQL 3ARGA 2G5RA 3T4AB 4BZYA 5DWUH 3BKJL 3BN3B 4OZHF 4WNQB 1P69B 3OGCB 4OD1H 5KS9A 5GIRA 1EFQA 3LZFL 2V7HA 2PYFA 5BJTB 3MX0A 2A2QT 3P11H 1HINH 4NRXA 2J4WH 4XNUL 4RDQG 5I1GH 5GS0H 3VGAB 3RWGA 4IOSD 4RWYL 1Y0LA 3D39A 1X3DA 4GRWF 4NHCL 1DQQB 3VXTB 5KW9L 4M5YL 4LLMB 2H2PC 3TV3H 3SE3A 1BF8A 1I3RB 4D0BB 3HFMH 3LQZB 1U8NA 5EBWA 4J2XA 4ONOA 4YBLC 1FRGH 3TNMB 3MLZL 3VD5A 3EDDA 2E9BA 1T80A 1MHEA 2OR7A 4RGOL 5IMKB 5IEHA 1MRFH 2EDQA 3H9HA 3U0TB 4I9WD 1JWMA 2X4SB 4G8GE 5IOPA 4BSVB 2NY7H 5JW4M 2JCCA 4LGSB 1ZKAA 2VDLL 5LGKA 4WTWA 4O2EA 4BYHA 1WV7T 3BUTA 1RFDH 4NO0A 2ILLA 3BZ4A 3VXSA 5I66B 1S8DA 4O2CB 1A6ZA 3H0TA 2FBOJ 3SCMA 1JI1A 1T2QL 4JFYB 4MS8D 4UT7H 2X4QB 3OAUH 3EO0A 1T83A 4ZXBD 5C1MB 1NC2D 3VXUD 4HWUA 2F8XC 4Q9BA 1RVFH 4NGHH 2A0LD 4L1HA 1GGBH 4FHBD 1NGWA 4ZFOL 2JJTA 5JXEA 1J05A 2DQTL 1JGDB 3KJ6H 2XICA 4HC1L 4MGXA 1DN0B 3UJIL 1H5BC 1YNLL 1AGCA 2HA1A 1FYHB 1WCBB 3P73A 1P4IL 1Q72H 3QUZB 4Y1AE 3X3FH 1ACZA 1NKOA 3FKUS 4NFBA 5CINL 4HFUL 2E7MA 1CFVH 5IJVB 5MEPA 1LO5A 1NAML 2W9EH 3SGDI 2YN3A 1OSZA 2NYYC 4K23H 1FJ1B 3AB0C 3QQNA 3OXSB 2HAZA 4G6JL 5TDNA 5ICYA 5H8DA 3DXAE 5EDXA 3TWCH 1FAIH 4R4BB 1CL7H 2MNUA 3HZKB 4JZNB 3QI9C 5JZ7D 3MA7A 2FDBP 4O00A 3FRPA 3NFNA 3MRJA 5TJWK 1LK2A 2ZUWA 1QFOA 5I8CA 2WBJA 3MR9A 4X9FA 4M93C 3ROLA 4WFHD 2X10A 4NWUH 4P5TA 3QNZB 4IRSB 4NPYA 1EXUA 1TXKA 3G5VB 3FO9A 2HWZH 3EYSH 1A14H 3OX8B 3FT3B 3TIEB 4L3AA 5I15H 1JZ7A 2PKDA 3OGOE 4WFGE 1F3DJ 5CSBA 2DQGL 3V0VA 3SGJC 1KJ3H 1XH3A 4KROC 2CR6A 3Q6GH 2CDGB 4K2UH 3CMOL 1S9XB 3OKNA 1T5XA 4ZO8A 5D7IA 5EU6D 5SWZA 5BO1L 4CVWA 3LKPA 1MCRA 5FV2A 4GRMA 5E8NA 1BJMA 5B39G 5E2JA 2VLKA 2X9WA 4PTUA 4P2RD 4P5KA 4OFYD 2Z31B 4OCSH 4L8SA 4HSQA 4AH2A 4P4RB 3QG7L 5T3ZE 1KPRA 1WSST 2ZSWB 3JWDH 2PYEB 4WU7A 3NCCB 1N3NB 1A7RL 5ESVA 1NGYB 5GS0C 3DV6B 2V7NA 1P7QD 1R0AH 2C3HA 4XBPA 2J8UE 3LKOB 3MRMB 3L3DA 4ZUVA 1ED3B 1TJIH 4ZUTB 4WFFD 3N1MC 4F7MA 4GW5B 4TRPL 3OB8A 3AXLA 3FOMB 4M5ZH 3STBA 1JFQH 43CAB 5EIVA 2H2PD 3I85A 3NFPB 5JHDB 3QDJE 5IG7A 5EOTB 4WUKL 3CFCH 3QIWD 2BDNH 2EIBA 2X05A 4MD0A 1DBMH 2BSSB 3WNKA 4UTAH 1U8OB 1HH6B 1G7PB 4HX1A 3IDMA 3TIDB 1B90A 3EOBB 4PJCB 1YMMD 1DUZA 3U79A 4KKCD 2EDKA 1MRCL 3TCXA 4X4ME 4HJJL 4Z7QF 5TGBA 4DTGL 4JR9H 4DOHB 1FFOA 3TCLA 4KI5E 1T6VN 4KGJA 1CFTA 3FZUC 4KJWC 4D9QE 3LRHA 1KB5L 1IKFL 3REWB 3ARRA 1JPGA 3HI6L 5C0CD 3GNML 1Z3GL 3C2SA 1J10A 2E8YA 5MENA 5GJTL 1QSFA 3RNQB 1SJEA 1E28A 4WDIB 3O4OB 1G1CA 5KSVA 5KSAB 3B9AA 5BZWB 2XRAH 1DANT 3VWJD 1LD9A 5E99L 4G7VH 4CGTA 1CGSL 3QHZH 4ZTOL 3PWVA 2VXSH 1FFNA 3S37L 3VA2C 2YD8A 1MFEL 5DYOA 1JRHL 1U8LB 1A3LL 1AO7A 2VABB 3NCYS 2NY0D 5DUPH 1QKZL 5HGHA 4X98B 5DF0A 1D9KA 3MLRL 3L3HA 4OZFA 3V6FA 1FPTH 4BQ8A 5JW5B 4XPHH 1WBZA 4G8IB 3GHBH 3WFCH 2EYTB 3ZKXC 3MRQA 5INCA 3R06B 3N9GH 4KRPB 5MHSE 3D5OF 1IZKA 4HKJB 1Y6MR 4K7PL 1A1MB 1JJUA 2DM4A 2V5MA 4X7FC 2XFXA 2VYRE 3N85L 3DLQR 3CX5K 1X7QA 1ZA6A 2GSGB 3O4LE 3CXDL 4YFDB 1A2YB 5CJQH 2HFTA 3WDIA 3LS4H 1AFVL 1I1FB 4FXGB 4O9HH 5GRVK 5EIIB 1EGJL 1MELA 4Z7UE 4ZD3L 3C8HA 1D6EA 1OTTC 4OCRH 3JTTB 1U93A 3LH2H 3BP7A 3V0AC 3BEWB 5B21A 2C3VB 3L3JB 3BD4A 3SO3C 4KROD 4HJGA 1UH2A 4KRNA 1G9NH 5KVFH 5JW3L 4HPOL 3B2UC 1NCWH 1OD7A 4E41A 4RISL 2V2TA 1CD1A 1T03H 5KSUB 1AGFB 4K3GA 2AI0H 1N2RA 4JFZH 1Q8MA 5AWNL 2WNGA 4RQQB 4WEBL 3ZSSA 3OG4B 3AFLA 4ZAKD 2DLFL 4GKZB 2VXUL 1J0ZA 2BNQB 2A38A 5CSZA 4XNMB 3L7FB 2DM7A 4JKWA 5FHBH 3BE1H 4PJAB 3DVNA 3SDDA 1K8DB 4JB9H 4TN9A 2DRUA 3TO4A 4R7DB 4LVHC 2FJGA 5DD3H 3KLAB 4P2OC 1PLGH 4LARH 2ZUUA 3LQAL 3S4SB 4Y4HC 2LAGB 4H5SB 1NCAH 2CUIA 4D9LH 1NBQA 5I74B 4QYOB 2XTJD 3RX8A 4FFYL 4DZBB 3MACH 3GZKA 3P30H 4QHMB 1FAKT 2VE6B 3SY0B 4K8RH 2COQA 1YECL 5F88A 1HXMB 4NM8H 4QRSA 3TPKA 4U1NB 2BMKA 4J3SA 2NZ9C 4Q6YA 4LHUA 1UJ3B 3GSRB 3D3VE 1INEL 4M43H 5C0FA 2ATPB 3GSWB 4LSTL 3HAEG 3KS0H 4KZDL 2YD2A 4KUCD 4H1LB 5D1XC 2FEDC 1BX2A 3R0NA 4JZJC 1B88A 1YQVH 2IG2L 2I60L 4PP2A 3VE0A 3MGOB 4LASH 4XP9H 3MLWH 4TSAH 4HHAB 3SE4A 1FO0A 1A7BA 4X4XA 4Z7WA 4GW4A 2FIKB 4KJWD 1MJUH 5J9PA 2BHYA 2B20A 2VXTH 4M7ZC 5CMAB 3CIQA 4TNVF 5I9QB 2FLBT 1FN4B 2YK1L 2YOCA 4M4PA 1EUTA 2XQBH 3SQBA 2J6EA 3SPVB 1T1XB 1UKSA 2GJ6E 5HHPB 3WS6A 1I8LA 4NNPL 1NMAH 1S78D 4K94L 5C71A 1DE4B 1CT8B 5BMFL 4Z9KB 2Q7NA 3JV4B 4CJ0A 2CIKA 5GISL 3VWKB 1PY9A 5LQBL 4MLSA 4S2SA 1A3RH 3EYVA 4ZPTA 1I8IB 1MCPH 2BSED 4HQQL 3HC0B 5AUMA 2AS5M 3ALWA 3HZMA 3O9WB 2F54E 2GIYA 3IXTB 3E6FA 1P9MC 4FABH 5J1TC 4K3JH 4NQTA 3CSYA 3BVNB 1U8IB 2YD1A 2APWA 1WFTA 5FYKH 4PJFB 2HKHL 1IC1A 4MXQC 4ODWA 5IBLD 2O5XH 4U3XA 5TE7L 2Q86B 1DBJH 1CICB 2FD6L 1G7IA 3CSGA 4BH7B 4XB8A 5E6IA 2OMNA 3IDIB 4JRXD 1ITBB 3NGBB 3GIVB 4MA7H 4U1JB 3MCKA 4UILH 1NBVL 2HH0L 3ZDYE 2OI9C 1MY5A 1LP9A 1HCFX 4LVOB 3JVGA 1IM9B 4WTZG 3ESUF 4NP4H 3MRPB 4XRCA 1FL5B 3K2UH 3PJSA 1Q0XH 1EJ6A 2BCKB 1XGUA 3H9SB 3M8OL 4Q9QL 4DKEL 3PP3K 2PW2A 3VXNB 5E24E 3DRQB 3IU4L 3RY4A 2R4SH 1IGCL 4OLVL 3LEYH 4G6FB 4DAGL 2WIIA 4X6CB 1ZANL 1G9NC 4OM1H 4I9WE 3QUMH 3QFJB 5GSRA 2FCBA 2ZPKH 4O02L 3B2UD 4X4ZA 4M8QA 5JIKA 2XYCA 1I9JL 1MHHB 4FOMA 1QSEB 3SGEI 3GKWH 4AZ8A 1JNHB 3RWEA 2YS4A 1PG7W 5DXWA 5CEYA 3QUYC 4J3XA 5F3BB 1A7QH 3DTXA 1HK6A 2ICEA 5C09D 3L3KB 4YDKH 5H94A 5IESH 2CDEA 4MDJA 3VXUE 5BVJB 4PB9H 3B6SA 1V7ML 2I26N 2C3GA 4HS8H 4HWBH 4OLXH 3RVXD 4HIEA 2BSRA 3I3DA 2OSLA 2J3SA 3CZFA 2HJLA 3KXFB 5C7XL 3PHQA 1JTOA 1O7SA 1UACL 1I1AB 2YHGA 1QRNB 5IKCB 5CUSL 2DLTA 5DRNB 3QO0B 5D70H 4K8RC 3C9NB 3IETB 2IBGA 4JM2C 4RCAA 2HT2C 4L8BA 3V2AR 1MFCH 3LHPH 3LY6A 1ZLVK 5KTEL 4PJXF 3RL2B 3GSNH 3ARPA 1H3PL 1F8TL 1RHFA 5J13B 1CTNA 3U9PL 4NUGH 4PG2C 2R56H 1ZLWK 4JHWH 4KFZC 1UB6B 3MV8D 4R96A 1A1OA 5SWSB 3W2DL 2P8MA 4U0RC 4FQXA 5E56A 1CQYA 5IW1B 5D1XD 2Y5EA 4QXUH 1NJ9A 1CFQA 1KELH 3QUKB 1VACA 5D2LE 1KTLB 1CLOL 4YHPB 5E08L 1HHKB 3AROA 1EUUA 2NY3B 1MHPL 1L7IH 2GFBA 2GY5A 4DGIH 4WFHE 5D1ZC 4L4VD 4XP6H 4LAQL 3T0EB 5GRZA 1OAYL 5D93B 3BP5A 5AG9A 1GHFL 1E6OL 3FO0L 1SBSL 4GLRI 2ADGB 4MXWL 4UQ2B 1A02N 4X99A 5GRYA 1G9ML 4HWNA 2Q76A 5L2KD 3ULUE 4J3TA 2XWBA 2Q7YB 2XY2A 1HNGA 2HN7B 1P4LA 2Q6WA 3QEGL 2HLAB 4M6NL 1IAOA 4J4PD 1I8MB 3DOSA 1D5IH 3BPCB 3C8DA 4JFDD 4LCCA 2Z31D 3RX7A 5FO8A 1ZHKA 4HWZB 4ZO6A 4HUVB 4M1CD 4PJ5B 1CLYH 5DK2B 5EU6E 4MX7A 4MAUL 5E00B 2WINA 2UWEF 1N4XH 2FEEL 5AAMA 1E4WL 2GTWA 2I24N 5ITBL 4MXQD 1GXEA 3NMEA 4KH2A 1W2KT 1QG3A 4P2RE 4L29A 1B0WA 3U4BH 3DMMA 3FN3A 4JO1H 5C0JB 1ADQA 2D0HA 4LSUL 4LBEB 4KJQC 2CH8A 3TZVA 3STLB 4EDWH 1S9VA 5I2IB 2E9JA 4DUVA 4JREC 1LO4L 1GGCH 5DD0H 5A43C 2MTPA 1WWBX 1ZWIA 4HIHB 1PY4A 5IQ7H 4UV4H 1GOFA 4M00A 1ZTXL 3MV7B 5K59F 2M1KA 4UNUA 1V8HA 4OZ4A 5DJZB 3ZO0A 2HTKC 4X80H 1HEZA 1WEJH 3PL6C 5JR1H 2WW8A 4KJPD 2MMXA 4WFFE 2H41A 4XCFL 2FHBA 5CIPB 4NQXA 2QQNH 2UZYB 4Y1AA 3T2NH 3S35L 1YNKL 3KYMA 1CWVA 2X4PA 2BY2A 5IMMB 5HHOA 5AYQA 2YD3A 2B5IC 4PJAF 2ZOLB 1KN2L 5JMOC 4YHKL 3P9WB 2J8HA 3QZWB 3HZYB 3MODH 1ZT1B 3DXAA 1AI1H 3O2WL 1YMME 1MCKA 3R1GL 4OSUH 5CP3H 5DMIH 4CDHA 3RGVC 3QUYD 3HA0A 3RDTB 4YHNB 2D7TL 1Q38A 4IIQB 1LO2H 1QO3B 3GI9H 3E6HA 5DRWB 4KUZH 1T1ZA 3NCMA 5C0CE 3S6CA 4LGRB 2HT4D 4XP5H 3NH7L 3ARZA 3MOBL 1YMHB 1A0QL 4Z5RB 3FAXA 2VLRE 1RURL 4OGYH 4Z78B 3EHBC 4OCXH 1LEGA 2QSCL 4JHAH 4GG6B 2UYLA 1MJJA 1KBGH 3BIBX 4R8WH 2EO9A 5LBSH 3VXRB 5ID1B 4EI6B 4K55A 3RWDA 1DLFH 4FXKB 2HKFL 4K8RD 1KIUA 1D5MB 1XAUA 4NN5B 2JB6A 5T1MB 5MERB 5I1DB 4JO4L 3B2VL 5JDSA 1U2HA 3GI8H 5HJ3B 3ORJA 2MCG1 5A2KH 4EN3B 2UY6A 5KVMC 4K3EH 2NY1C 3ARDA 4AENB 4YUEL 4M61B 5JO5B 4N9OB 4PREA 3B5HA 4NN6C 3U0WH 2EC9U 4IMLB 4XX1G 3WE6B 3GGWA 1FG2A 1C5DA 3ZL4H 4RGNB 3OAZK 2CR3A 4PR5B 1A1NA 3V8CA 2VIRA 3S36L 4PUBH 4QTHA 2EYRA 1XF2A 4UTBH 1MJ8L 5C0AB 4LEOA 2FGWH 3TA3A 1I7ZB 1J87A 5GGSY 5EG6C 5GGVL 5DJ2B 3VD9A 2BNRB 2J8UA 3TEUA 1S7XB 4UI2A 3LSOA 1NCCL 4NZJA 4RNRA 1MCOH 1VERA 2V9TA 1T6WA 3WIHL 2P42B 4TPRH 3NTCL 1CR9H 4CVXA 1FC1A 1XGRA 4WHYH 3DHJA 2DDQH 3FMGL 1GGTA 3QDJA 1CD8A 3BKJH 2NW2A 2L7JA 2X4NA 4K7PY 3WN5C 3EUUA 4WUUB 3WFHA 5E8PB 1B0RB 1NBYB 2AAVA 2FJFB 3SKNB 3LZFH 1TJGL 1SYVB 2W65B 2J88L 3HNTL 5CEZD 3UBXG 1FVCB 4JAMA 1MVUA 4F9PC 1B4RA 1ONQA 4XNUH 4B5EA 3DBXA 4RMRA 3MSPA 1Z9OA 5TH2B 3U36A 3MRDA 3OKLA 4PY7B 1MCJA 4RWYH 1KF9B 2P7TB 4NHCH 3MXVL 1CLCA 5CGYC 5IMOA 1NLDL 5KW9H 4KJQD 2NY4C 4M5YH 3VXOA 3S5LA 2K7PA 1LE5A 3FQXA 4J6RL 3P4LA 2V5RA 2CD0A 5DA0B 4XPBL 2W0KA 1VPOL 1UWXH 3HMXL 1CGYA 2XTJE 4O2FA 4GRWH 5IHZB 5A2LH 1I3UA 3QWRA 5HYQB 5DURB 3DVGB 1XF4B 3TO2A 1XF5B 3DROA 3B9EA 4LU5L 2VDLH 1BZ7B 1QSZA 1FNEB 1Q94A 3IDJB 2J2ZA 3L5XL 4GSDL 1XF3A 5FGBC 3X17A 1Q9WA 5A1AA 3CX5J 4BK5A 4Z7VE 1T2QH 3V95A 2XWTB 4PRDA 3S34L 5AYUH 3FB8B 4D0CA 2QADC 3C6SA 8CGTA 1OQOA 3ALXA 4H8WL 4MNQB 5E6YA 4Y5VC 3IGAB 2WUBL 3KLHC 1NGZB 3MGAA 4MD5A 1BBJA 3KWWA 2DQTH 4JY4A 3W9DA 1UB5B 3QXVA 5SX5H 4HC1H 3S37X 3UJIH 3HG1D 1YNLH 1CXFA 5DJXB 1B3JA 4WO4B 1YZZA 1P4IH 4GXUM 5C6WH 3CFEA 5FOBA 4HFUH 4HUXA 2OTWA 4RBPH 1PZUB 1HCVA 1OPGH 4Z7UA 3EHBD 3RL1A 4ZUSA 3LDBB 1NAMH 2NTFB 2HLFC 2EE6A 5IVZA 4KVCL 4OZGF 5I1IL 2EIZB 5BOPA 3EFFA 1KTDB 4G6JH 4OQTL 4K7PX 4F33A 5GRVL 3OTTA 1CICD 5KN5A 5I0ZA 1W72A 2MQ3A 4NBZB 2P1YA 1QLEL 2OZ4L 3CPLB 3O2DL 3SKMB 4Q2ZB 3GMRA 4KGLA 3UYRL 2L4OA 4NDMB 5A16A 5ACZB 2QJDA 3AMLA 4X5WB 4H26B 3DHMA 3LIZH 2YUWA 2AJ3B 1NGQL 3H9SD 4U1LA 4JRXE 3MJGX 2VZ1A 3BMWA 3IF1A 3DUSB 2XKNA 4OIIL 4DCQA 2DQGH 1DSFL 4ENEC 2OYPA 5JPNB 1U95B 5C0NC 5EZJB 2WWKO 3CMOH 4WW1B 1RZFL 5BO1H 1BQHG 3JV5A 3L7EA 4NN7C 1VHPA 3OXRA 4P4KC 3CUPA 1ZMYA 3F7PC 4L5FL 1NDMB 1C08B 1MJ7L 3GMLA 4JPKL 4KRLB 4I48A 5DEGA 1Q9LA 4LNVA 1BECA 3D3VA 2AKRA 4JDVA 4ZSOB 3QEUB 2FNBA 3LCYA 3QG7H 3RZCB 4FFVC 2DQDL 5ICZA 4QHLA 5TQ2L 2EDDA 4XBEL 4YO0A 3SDXF 5IMLB 1F3DH 3KXFD 3MRIB 1A7RH 4MJ5A 2Y7QB 3HHRB 5KANG 5C09E 4XGZB 3VH8A 2EDRA 2HT3C 3QXAB 1C16B 3SQOL 2NXZB 4OCWL 1AXSA 3GMMB 1YDPA 3G5YB 3IDNB 5CGYD 5ISZD 4TRPH 1YC8A 5FO9B 1JZ8A 3HAEH 4QCIB 3TBWA 4KKAC 2GJ6A 4WUKH 3ARFA 5SWSD 3WHE0 4F57L 1PDKA 2JKXA 1V05A 1DUYA 1U3HD 2RBLA 2X89D 4DVBB 1UEMA 2R1WA 5F6HI 3TJHC 3STZB 2IAMA 1MRCH 4NQDD 3QBTB 4HJJH 4DTGH 2F54A 1GZQA 5E9DB 1LO0L 3KPNA 4AIZA 4OV5A 2ED9A 2YD7A 1KB5H 3MOAL 3MV8E 3S98A 2WP3T 3HI6H 2DTML 3GNMH 1Z3GH 2QADD 4NC2B 4HMEA 4PLKC 4HS3B 4CNIB 2EC9T 2ZUVA 3I3BA 5GJTH 4UDUA 2W60B 1CE1H 4RGMB 5GGRB 3C2AL 3HE6C 2MCPH 5J1AB 4L4VE 5E99H 1EBAA 2FWOB 1BD2D 1IARB 2IAND 4N9GA 1S9KC 1CGSH 4ZTOH 1NCTA 1RU9L 3VGFA 4NQED 3EYFA 2A83B 3RZWA 3O3UN 4Y0GA 1MFEH 1JRHH 1A3LH 2ARWA 5L2KE 1CLZL 3O11B 5I73B 5I71C 1C7TA 1L0YA 4PJBF 1QKZH 2KQMA 1G7JB 1UM6L 4P57B 2YPVL 1F3RB 3RRQA 2ARJA 4HJ0C 3MLRH 4JFDE 1LEKA 1JGEB 2PR4L 5AG8A 4R0LC 1AHWC 1OW0A 3DX9A 1YEFL 2YC1B 3VGDA 2R1YB 4UOW1 1H3TA 2PYEE 4PGZA 1AD0B 4Y19D 4K7PH 2F5AL 4MJIB 4Y16B 1XFPA 4OI9A 3N85H 3CSBA 3VFMA 1U9KA 2YWYA 2OX5A 2IQAA 1YEJL 3CXDH 1U8MB 4U1MA 2LU3A 1KCUL 5F93C 4WI3A 1AFVH 3VFTB 3C8KB 2VQ1B 1EGJH 5GGTL 4QO1A 2VMFA 5JHLL 5F7WC 4ZXBA 1NC2A 3VXUA 3PIQA 4CVZB 4ZD3H 1MWAL 2D31B 3MNVB 1VFOA 4P46A 4PRPD 5E4EC 3BZEA 3U7AA 3AM8A 1KIPB 4JM4L 1M7IB 1BJ8A 1HHIB 4ENED 3NCJH 2AXGA 3HRZA 5HGAA 3DSFL 2CKBA 1KCSL 5C0ND 5JW3H 4HPOH 7FABL 1AIFA 4U7SA 4RISH 1EJOL 4LCUB 1FNGB 5AWNH 5BV7B 4DOHE 1XCTB 1IT9H 4WEBH 1U8QA 1TENA 2B8OT 4ZFGL 3RDTD 4XZUB 5BVPL 2DLFH 4P4KD 1K6QL 3GSXB 2LVEA 2UV3A 4I4WA 3L5IA 1SM3L 3FTGB 5ADOL 2DD8L 3T2PA 3MTRA 5DMGD 4NJAL 5EZLB 3QIUC 5ERWA 1CDHA 5F9JB 5K9JL 2G9HB 2AK4D 3FQTA 1QFWM 5ETUA 3T3ME 3ES6B 1XR9A 5HI4C 5C0IA 3D0VA 3UPRA 3LQAH 1ZV5A 3UP1A 2VLJD 3VU2A 1PKQB 1JTTA 2OL3B 4KTEH 2VDML 4KV5F 2ADJB 4FFYH 1S7VB 4M7LT 2HVJA 3HC4L 3MRBA 3S88L 2R2CA 3O6LL 3HZVA 2F53B 2YUXA 4XH2B 3BD3A 3RNKA 1T1YA 1YECH 4NKMB 4CJ1A 1HYRC 5FM4A 1UZ6F 3T0DA 3IXAA 1WITA 3D69B 5CBAB 1X44A 2XT1B 3ARGB 4LKCA 4M3JA 4EN3D 1INEH 3CLEL 1I85A 2ZNXA 4TNWF 1S7SA 1G6RB 1MLBA 4LSTH 4LLUB 3O8XC 1GIGL 2FIRT 3RVUD 3QXDA 4B7IA 2HG5A 3MJ9L 4OCLC 1RJZA 4YPGA 5GIRB 5L9DL 2IG2H 2V7HB 2PYFB 4N0RA 2I60H 2EC8A 4M7KL 5EU6A 4ETYA 3UTSD 1GOGA 4NRXB 4IJ3B 3EGSA 5JIIA 3KNBB 1Q9KA 3RWGB 4LVEA 1Y0LB 3KPPA 3KJ4C 3SE9L 2BNRD 1S7RA 2BP3A 4Y2DC 4ELKB 2YK1H 4PLKD 4NO5A 4P2RA 4OFYA 1GJIA 5AZ2L 2IH3A 3VDAA 4JVUA 4AMKL 2LTQB 4NNPH 1AR1D 4K94H 5DQ9A 3WIFA 5EBWB 5CJXA 2R8SL 5BMFH 4QY8A 3CLFL 2QEJA 1CXEA 3HE6D 1WC7B 2VUOA 1UXSA 5IEHB 5GISH 3H9HB 1JWMB 5IOPB 1P7QA 3HPLA 5LQBH 4HF5L 1DJSA 2JCCB 4LMQE 1EEZA 1FG9C 2K9UA 3IFOA 4O2EB 3BZ4B 2AV1B 3Q0HA 5DZOA 1A6ZB 3H0TB 4M02A 3SCMB 3DETC 1VFUA 2HKHH 4HJ0D 1CDIA 4U1KA 5TE7H 3FOLB 5CJOL 3QIWA 3EO0B 4RFOL 4Y89A 4YIQB 1DQML 2FD6H 3BW9A 5EU3B 3V0WL 4HUMB 1QR4A 1N8ZA 1NGWB 5BRZB 3MRNA 1J05B 1YMMA 1WBXB 1ZHBA 5GGVY 3V7AG 4S1QL 5CEZE 1I8KA 4HKBA 4G9FD 4KZEL 2ADFL 5L0QB 5J0BA 1NBVH 2HH0H 5D7LD 2XV6B 3S35X 1AGCB 4JZOA 5D6CA 2DKSA 2V5SA 3P73B 3IRZA 4CMHC 5IVOA 5C0CA 1I1YA 3FB7A 1E4XI 4HZAA 3M8OH 4Q9QH 4DKEH 4NQVA 1ZA3A 5MEPB 1LO5B 2DI9A 2VLRA 2XNAA 1CXHA 1OSZB 4KY1L 5D1QC 4WW2A 2FHFA 3IU4H 4EUPG 1IGCH 3BQUC 4OLVH 3VWJA 4DAGH 5B3JF 5TDNB 1ZANH 5ICYB 4WRLA 4JN2A 4LEXL 4MA1C 3TBVA 4O02H 2F74A 4OAWA 2B4CL 4MNQD 3TJEH 1I9JH 1PSKL 3MA7B 5HYSG 3NFNB 3MRJB 4WU5B 1LK2B 5FA3B 2ESVD 5I8CB 2ICCA 3MR9B 1VADA 2D0GA 3ROLB 3WMSA 2H3NA 4H0HB 2ZCLL 1ZT7A 4ZFFA 4P5TB 5I16A 3CXHK 1KPVA 2NPLX 2AEWA 3QIUD 4NPYB 1EXUB 3FO9B 3H3PL 4GW1A 1IL1B 5DEFB 1V7MH 3VGAC 1CXLA 2F19L 3LQAC 4MB4A 3MUZ1 4XWOC 3KR3L 3VG9C 5SX4H 2GCYA 4XPFL 5DQDL 3V0VB 1XH3B 5C7XH 1OB1A 4A6YB 1Z9LA 2BVQA 1RI8A 1TITA 4RMTA 1X9QA 1UACH 2A74A 4QHKI 4CU7A 3OKNB 1T5XB 5CUSH 5D7IB 1RZ7L 3T0XA 1T4KA 1OGTA 3LKPB 3QIBC 3VW3L 4GRMB 5KTEH 3ILPB 1H3PH 1JPSL 1F8TH 1NGXA 1H3UA 3U9PH 4B0MM 3FONA 4GKSA 3S36X 3SGJA 3W2DH 4HG4K 4L8SB 2VISA 4AH2B 4JKLA 3QNXA 2V17L 4TTDC 2E6QA 5E08H 1CLOH 5HDBF 1B0GA 4WU7B 5BQ7A 4JG1L 5CHNA 3O6FC 1DEDA 4QRRB 4ZAKA 4U2YA 5F72S 5ESVB 4MA3A 2V7NB 1TZHA 4XBPB 4DUXA 4J1UA 4LAQH 4NM4L 4ZUVB 1OAYH 1C7SA 2VB5A 4Y2DD 5L6YL 2APXA 1WT5A 1CN4A 1GHFH 2I9LB 1E6OH 3FO0H 3H9SE 1SBSH 3DURB 4MXWH 4U6YB 1HDMA 1NFDE 2R0LH 1G9MH 4EBQL 2H6PA 4JRYD 4K94C 4PJ7F 4ZUUA 4LSRL 2OJZL 3QUZC 4RMVA 5TFSL 3QEGH 3KDMB 3BPOC 4M6NH 3I75A 4MD0B 5ACMA 4Y5YC 5EOQL 4HX1B 3BEVA 4QOKB 3IDMB 1FP5A 2X4OB 1XIWC 3O3AA 1DUZB 3V6OE 4MAUH 1HILA 3PQYD 1U8JA 5TGBB 3WLWC 5LGJA 1FFOB 3TCLB 2P24A 4PJHF 5IB1B 1E4WH 2BVEA 2L7UA 1XGQA 3O6ML 3DETD 1II4E 5ITBH 3AS3A 2DQHL 4YDJB 1JPGB 1BQUA 5ANMB 3ZDXF 1FGNL 4Z7VA 1TVHA 4QRTA 1OP3K 5MENB 1QSFB 4TOYL 4LSUH 1SJEB 1E28B 3JBG7 4L9LC 5L8KB 2DWEA 4FRWA 4XVTL 1WFNA 3N0PB 5KSVB 1J5OL 4IRSC 3KXFE 2DBLL 4F7PA 3L3IA 1ZTXH 4POZC 1LVEA 4HMDA 3WFZA 1QRNE 4U3CA 3UTZB 3PWLB 4LGPB 3V4VL 1F13A 1BOGA 1HKFA 4KHTL 4UT9L 4G9DA 2FH6A 2RAMA 5ISZE 1RZJC 1FFNB 4YBHA 4F9LC 1FV1A 3Q6FB 1WWWX 5DYOB 3CFJA 1YNKH 1EX0A 1AO7B 1W0VA 2M8XA 5HGHB 5D1QD 1KN2H 2R69H 4RRPA 3BQUD 3BGFB 1D9KB 4OZFB 3L3HB 5SWSE 2FX9L 3V6FB 5BV7L 1OSPL 3LVEA 5LWYL 4YHKH 2MFNA 1WBZB 1JGLH 3OGCA 5INCB 4CRPA 3O2WH 2VRAA 3WFBL 1J1OL 4NQDE 3R1GH 5GZOC 3QEQD 3H8NA 2AQ1A 2CMRL 3I9GL 4U33A 4HLZG 5J12B 1ZLSL 2XFXB 5DS8A 1X7QB 1ZA6B 2D7TH 1RUAL 2F8VA 4OD2A 1HHGA 3CSPA 1D5XA 3NH7H 3TN0D 3MOBH 1G7LA 1A0QH 2OL3L 4LLMA 1ZVSA 1RURH 1MPAL 4JRXA 1U93B 25C8L 1MRDL 3BP7B 4WIQA 1OP5H 2QSCH 3OV6A 3SKOA 4FP8L 2QR0B 3A6BL 1YY9C 4FA8A 4HJGB 5IJKA 1BD2E 1F2QA 3C09B 5IMKA 2IANE 4PJ5E 5T3XD 1FSKB 5KS9F 2V2TB 2X4SA 1CD1B 2X9YA 2DM3A 2HKFH 4NQEE 1SY6A 2DLHA 1JNJA 3ARYA 1N2RB 1GGYA 2X4RA 4YHML 2IPUK 4B7LA 2VXVL 3QJHB 4JO4H 5F7KC 3B2VH 3QIBD 5CSZB 1E4KA 4PY8I 3TVMC 1GC1L 1A3QA 4ODXB 5C8JA 4YUEH 3TO4B 4EI5C 3OB0H 2FJGB 1D5ZA 3GSUA 4JFPB 4TTDD 4N8VA 4Y19E 4TVPD 1JGUL 1EO7A 3S36H 4HFWB 3O6FD 4KJYA 1MJ8H 2NNAA 4LHQB 2AJZA 1TIUA 1OT2A 5CBEB 5EA0L 5GGVH 2NXYB 5C09A 2VDPL 1NCCH 1Z0MA 1ZXQA 3E8UL 5F88B 3WIHH 4GRLD 5JQ6L 4PRPE 3NTCH 4QRSB 4QLRA 5F7YC 1G9MC 5EU7E 1EO8L 3T8XA 1JPFB 2BMKB 1DVFC 3H9ZA 2XZCL 3S97C 4DN3L 4ZS7L 3FMGH 5C0FB 1CU4H 2YZ8A 3U9UB 5FGCB 3OQ3B 4YFLF 3T77B 3EFDL 4I5BB 5I6XC 4LLAA 1XIWD 2NY2D 2PXYD 4EQ2A 5CP7A 5H35B 3VE0B 1NL0L 1TJGH 1WWCA 3HNTH 4DW2L 4P9HL 1FO0B 1NFKA 4X4XB 4GW4B 4H0GA 4WY7L 3AU1A 5J9PB 4UUJB 1OT1A 4Z95L 1ZS8A 4CN4A 1R5WB 3NIGF 4PJ8C 2WAHA 3MV8A 2AK4E 3G5VA 3D2UD 4I13B 1NLDH 5D1XA 1Q0YL 3OX8A 4MXVE 3TIEA 4GH7B 4GG6E 1AGEB 4J6RH 4XPBH 3P0VL 1VPOH 2CIKB 3HMXH 4FQLL 1J0KA 3VXRE 4X7CC 3QDGD 3O3DA 4PV8B 3J7HA 1EMTL 2OR9L 4L4VA 3FFCD 4S2SB 4ZPTB 1S9XA 4MB5A 4XTRD 5AUMB 4LU5H 3HZMB 1AE6L 2YD6A 1FNHA 3E6FB 1W0WA 3L5XH 4LPYA 4GSDH 4H88L 3KYOB 3CSYB 3F6IA 2Y9RT 4R6UA 3K1DA 5L2KA 5HVHB 3WL9A 4ODWB 4RAVB 5FEBA 3T0BA 4J4PA 3S34H 3CDGB 3DPBA 4JFDA 4PV9A 2Z31A 4H8WH 4KC3B 3Q3GA 1UEYA 2WUBH 3UTSE 5GZOD 3C60D 3MCKB 4ZUWA 1AKJB 1CGXA 3LS5L 1LP9B 3QCTL 4NZRH 5F1KC 1NGYA 2BNRE 3EYUL 2Q20A 4XRCB 4ZUTA 4F58L 4Q97A 1X5KA 5I74C 3FOMA 2EZ0C 5C0BD 3E3QE 4KVCH 5I1IH 2AW2A 4OQTH 5GJSL 2F8OA 3AUVA 2BSSA 4M8QB 4X7TA 3WJJC 1HH6A 1G7PA 4MNHA 5F1OB 2JJSC 4F8QA 3TIDA 1QLEH 2OZ4H 3RWEB 3O2DH 4DWHA 3X3GL 5CEYB 2CK0L 4JQVC 1V3MA 3DTXB 3UYRH 3G5ZA 3TVMD 2ICEB 5BS0D 5E6ZA 5H94B 2DQJL 5LXGL 2CDEB 4EI5D 4MDJB 1KJ2B 3TH4T 1F5WA 4Q6IA 5SWQA 1PJ9A 2X09A 3B6SB 1E0OB 2BSRB 3QQ4A 3HN3A 2OSLB 4OIIH 35C8L 4G9FE 4IRZL 3CZFB 4MAYB 5KSAA 3QUYA 4X7DC 1A4JA 2E9IA 5GGUA 2Z8WC 5FYLL 1JYVA 5DJ8B 1NPUA 4L8BB 1CS6A 4JPWL 5DC9B 1N59B 4OF7A 5GGQL 1K9TA 1U8LA 2PTTA 4L5FH 4E9LA 5F3HA 1BIHA 1MJ7H 2FSEA 4JPKH 3X14A 4A2MA 3O9WC 1PX4A 4EKXA 4X98A 1R24B 4NC1C 4R96B 2Z8VC 2P8MB 4E42B 4FQXB 3WNOA 3H42L 4MNQE 5JW5A 3B43A 3UTPD 1NJ9B 1CFQB 1QPPA 1VACB 4GS7C 2DQDH 4GBXD 5TQ2H 4XBEH 1YYMH 1F90L 2ESVE 3SGKA 3ALPA 2GFBB 2CLRB 5K9OA 3U7YL 4OLEA 3GEWB 4JVWA 3GJFK 3ZDZF 3QP3A 5B8CA 3SQOH 2CXGA 4NFDA 4OCWH 1BOYA 1I1FA 4FXGA 5EIIA 4FFWD 3V8OA 3MGTA 2Q76B 2XWBB 5ICXA 2GITB 5DD1L 2Q6WB 5HPMB 1IAOB 3MXWL 4LCCB 4F57H 5HI5C 5FO8B 1ZHKB 4JRWA 4XNXL 1QPXA 3SOBL 4ZYKB 2Y4SA 4O51B 2JELL 3QXTA 5DUML 2D4FA 2WINB 1K2DB 1T7WA 4QRRD 4XVJL 1J8KA 2GTWB 1LO0H 4P99A 2PO6C 1JF5A 2ZOKA 5TE4L 3FHQA 3MOAH 5CJ8A 1DQDL 1X5AA 4QRQA 3ZKMC 4PTTA 2DTMH 4L29B 5F6HJ 3DMMB 4AQOA 4H8WC 1JHTA 2IADB 2JK5A 1S9VB 1BEYL 3KLAA 4X6DB 4JANB 4MCYA 5DEZA 3VI3E 1N26A 1ZWIB 3FRPG 1GCFA 3S4SA 3NCYP 3C2AH 1CDJA 4OZ4B 4QYOA 1HEZB 2VLME 3UAJD 1G7HB 1X6LA 5HI3C 1EO5A 5I0DA 4KK8C 3NIFF 4Z7QE 1RU9H 3C5ZC 3MZTA 4DEPB 3SY0A 4NQXB 4ZS6D 1WQVT 1FNFA 4P5MB 4C54A 1EV2E 3KYMB 4POYA 1I1AC 1MHCA 1CLZH 4JRYE 5HYJD 5H2BB 5HHOB 4XVUC 1TCRA 5F1NA 3SEPA 4KAQL 1UJ3A 1UM6H 2YPVH 3CXHJ 5B22A 4N0UE 2WV3A 4XMPL 1U41A 2PR4H 3HMWH 5D6DC 3DXAB 5IQ9A 4H1LA 4IOFD 3PP3H 3DNKA 1YEFH 3PQYE 5D71L 2QQQA 2XN9D 3TPUA 2F5AH 4WWID 4ODVL 3BDBA 3E6HB 5EORL 1YEJH 2HJKB 3E1F1 1T1ZB 1A8JH 4HDIA 1KCUH 5KZCD 2NY3C 2PN5A 4O58L 5GGTH 4EUPH 4G8FA 5JHLH 1BZ9A 5CCKL 1MWAH 1T1XA 3T0EC 3Q2CA 2BY3A 1LEGB 5IB4A 2UYLB 4JM4H 1CT8A 1FZOB 3N1GC 1JMXA 2KPNA 3TT3L 3DSFH 1KCSH 3A67L 3DUUA 3HG1A 3RWDB 4XI5C 1UWGL 4HG4J 7FABH 3UPAA 1EJOH 3NFSL 2GEEA 5HD8C 4RIRA 5TQ0L 5BW7C 2JB6B 4AEIL 4Z7WF 4I18C 1F00I 5GRJL 5JDSB 5DVNA 2HP4A 4ZFGH 5HYFA 3IXTA 4HWBA 4TQEL 4W6XB 5BVPH 1NAKL 1K6QH 1NMBL 1U8IA 3HE7D 1SM3H 3LQMA 2DD8H 2EDBA 4NJAH 4JPIB 1FO0L 4N5EC 3IDGB 5K9JH 1CICA 1FG2B 1C5DB 4HGMA 3IJHA 3QEQE 3PNWA 4OKDA 1AQKH 1A1NB 2VWEC 4GAJL 2VIRB 1RUQH 3GIVA 3PWJA 4QTHB 2EYRB 3DX7A 5JOPE 1XF2B 4U1JA 3CGTA 2AJUL 1ZGLB 4LEOB 3TA3B 3TFKD 4Y8DC 5J1SC 2J6EL 1CQKA 3NAAL 2VDMH 3ARED 3HC4H 3S88H 2J8UB 3LSOB 4EJ1C 4RNRB 3MRPA 3O6LH 3H9SA 2VLLA 3DECA 4HBCL 5D7SL 3EOTL 5I30L 1NFDA 1F6AA 4MZ2A 3QDJB 3AS0A 3MQIA 2NW2B 3WO4C 2C26A 5T3XE 2GW5A 2X4NB 3PWPD 5HI5D 1GIGH 3OKMB 1L0QA 4E5XA 3WFHB 1MAJA 5L9DH 5FYJL 5H37G 2OTUB 4M7KH 1QEWA 2Y5TA 3D1MC 1HYSC 4JAMB 3V6OA 1MVUB 3LPWA 4P9ML 1J12A 4YHZL 3DBXB 2PO6D 1H15A 3SO5A 3U36B 2NXYD 3SE9H 5F7NC 3RHWK 4U1GB 3EO9L 3ZKMD 5A2IH 5IMOB 3WN5A 2AP2A 5AZ2H 3VXOB 4DZ8A 1DEEA 4TVPE 4UB0L 3S5LB 5ABDE 1LE5B 3BIAX 4AMKH 3WKNA 1MIML 4AT6A 8FABA 2R8SH 4NJ9H 3KXFA 3CLFH 4O2FB 3CH1B 1IVLA 3OF6D 2DLGA 4HF5H 2DYPD 3GJFB 3P2TA 4KK8D 3TO2B 5DRNA 1TETL 3C5ZD 1QBAA 5JMRA 2AXFA 3RUGF 5C0GB 5ISZA 3IDUA 3VXMD 1XF3B 4JQIL 4HXBL 2YBRA 3PGDB 4L4TD 2N1KA 1PVHA 3WFEL 3VFRA 4G42A 3ULVD 4PD4K 4D0CB 2VO5A 3MRRA 5CJOH 2D7QA 3C6SB 2R0ZH 4RFOH 5SWSA 5HYIA 4RFNB 1VFAA 4U1IA 1DQMH 1U3HA 2E7HA 2X89A 3V0WH 4MD5B 4MQXC 4LLWA 1BVKB 2DMCA 1LK3H 1RJLA 1T89C 4S1QH 3U4AA 4NQDA 3W9DB 5I17A 4KZEH 2ADFH 1VESA 2JF1A 4N90D 2N7AA 1V3JA 4RGNC 3VJ6A 4S1RL 1PW3A 4HUKB 4ZFZB 3CFEB 2JTDA 2P5WD 5FOBB 4HV8A 3PWUA 2OJEB 4HUXB 2ADGA 4DK6A 3RL1B 4ZUSB 5C07D 3X13A 1O7VA 4KY1H 2OXHA 1FL6A 5IVZB 1KUMA 2HN7A 3QDGE 3EOAA 4F33B 4LEXH 3OKEB 4L1DA 1BD2A 2B4CH 5IB5A 2H9GA 2IANA 3B4NA 4U7KA 3L5WA 5DK2A 3JUYA 1PSKH 4NQEA 5J11B 3GMRB 2MKWA 1AKJD 1ODAA 3DWTA 2RHEA 2YKLL 3MV11 4PJ9C 1ZHLA 5EUOF 5A16B 3AY4A 4LHUG 4NKOA 5EZIL 5A3IC 2ZCLH 2HRLA 2JJWA 4S0SD 5DRXA 1AGBA 4HUWA 3H3PH 2E3VA 3GSQA 4U1LB 3LD8B 2AJSL 3RWIB 1BLNA 3IF1B 5I2IA 3IAQA 2F19H 2XKNB 4D94A 3KR3H 2NR6D 2YR3A 4HIHA 4XPFH 5DQDH 4Y19A 3RI5K 2VDQL 3Q5YA 1BQSA 1E4XL 1J1PL 5FB8A 5T33L 1BFSA 3WJLA 1B2WH 1RZ7H 3EDEA 2CRYA 2ENYA 5FCUL 4MHHI 3L7EB 4N8PA 4APQD 5CIPA 1YJDC 1FORL 3OXRB 5C0BE 2Z4QA 3H3KA 3BIKA 3I3EA 3CUPB 4FG6D 5D5MA 4PRPA 1N0XL 3VW3H 4YR6A 1JPSH 1U0QA 3GMLB 4I48B 4QHKJ 5DEGB 1Q9LB 4QWWD 3RWFA 3D3VB 4JKPL 2AKRB 4JDVB 3HZYA 4UINH 1FZJA 1F4XL 2P8PB 4POUB 2EEAA 5ICZB 4QHLB 5BRZE 1VEMA 2V17H 1JWSA 4YO0B 5C3LD 5B39A 5T5NG 4MAYD 1KGCD 4JG1H 4LVNB 4XX1E 4MJ5B 3RDTA 1ADQL 2IJ0C 4P4KA 4OZIF 3VH8B 5C70A 3JUZA 3BOVA 4NM4H 1AXSB 2LU4A 3L5JA 1YDPB 5L6YH 1MCWW 3ZTNL 1CL7I 4FTVD 5IW3A 3V5HB 1L6XA 4R4NC 4KQ4L 4HKZA 1NMCB 2AK4A 3HC3H 3TBWB 3W0WD 1FHGA 5IFHL 1D5BA 4Z78A 4FFZL 4UT6L 4EBQH 5DVOA 1RUML 3WD5H 2MPAL 2OJZH 4LSRH 5F6IC 4GG6A 5TFSH 3ARFB 2VQUA 3IDYB 3WKML 3V5KA 5EOQH 1DUYB 4XPGL 4XP1L 3LDBC 3B5GA 3FJTA 3SDYL 4QRUB 3WNNA 1D5MA 5I1DA 2EXWC 2F54B 1GZQB 3GO1L 3O6MH 4AIZB 4MSWA 15C8L 3DARA 4EN3A 3F58L 2DQHH 1YYLL 1FGNH 3B8SA 1RZ8A 1I9IL 3M07A 4IMLA 4TOYH 4UDUB 2Q8AH 3WE6A 1RULH 2VJXA 3ZYIA 4XVTH 2FECI 3I6GA 4JM2F 1X4XA 3UTSA 2DBLH 3T1WA 1NCBL 3BXNB 4QGTA 4TTGA 1I7ZA 3GBML 3V4VH 1OTUC 4KHTH 4N9GB 4UT9H 2EDTA 2W91A 4WWKC 1QQDA 2BNRA 2O5ZL 3RIAF 1S7XA 4X7SL 2EECA 3ESVF 4YC2C 5D7JC 5HHMD 3VFNB 1A6UL 5FUCE 2ARJB 1LEKB 5BV7H 1OSPH 3HE6A 4W4NA 1A6WL 3ZHDA 4XMKL 5JW4N 4WGVB 5B38B 5HPOA 3RVWD 3QUXD 2BSTB 3WFBH 1J1OH 5K59E 4QRRE 2PNDA 2CMRH 2YD5A 3I9GH 3HRPA 1FVCA 1ZLSH 3JXAA 4PJ9D 3VFMB 1Z2KA 1RUAH 1H3GA 1TVDA 4U1MB 5T3ZL 5AD0A 5TH2A 2E5EA 3OKOA 4ZTPL 4ZXBB 1AHWA 1P4BL 2A9ML 3PIQB 3V52L 3VXUB 1NEZG 2OL3H 3BZEB 1U8PA 2OK0L 3MYJA 4Y4FD 25C8H 1MRDH 5ECJE 5D96B 3NPSB 4FP8H 4NC0B 3A6BH 3D9AL 4G9FA 5E70A 2AXGB 4JVPA 3HRZB 1U92A 5HGAB 3SDCC 2CKBB 4QOKE 2A6DB 1A22B 1OAKL 4KXZH 5E03A 2BX5A 5IGXL 3B9KC 1XEDA 4YHMH 1BZ7A 1U8QB 2H2SD 2VXVH 3F7QA 1S7QB 2D7MA 5HYJE 1KLGA 1P6FA 4KI5F 4YXHL 3UZVB 2JIXD 1I1CA 1GC1H 2Q8BL 2KDGA 5E0QA 1GGIL 5ANME 3X11B 3RVVC 5HBBA 3V5DB 1XZ0A 5ERWB 1P7KB 1BJ1H 1UM5L 3FQTB 1MH5A 5ETUB 4MNQA 1XR9B 3CCHA 5D8JL 5E2WL 5C0IB 3D0VB 2AQ2A 4PY8J 1NGZA 5E94A 4OFPA 4LPVA 3VFSB 1JGUH 4GFTB 3CFKA 2ESVA 4CN1A 4NZTL 2Q3AA 1YPZB 2RJMA 5IEKA 2HVJB 5EA0H 5DJXA 2VDPH 1RIUL 1QR1A 1RZIB 3QDAA 3HZVB 3QIUA 3RNKB 1LE9A 3E8UH 5JQ6H 1TQCC 3IXAB 4NRYA 1EO8H 2R4RL 3T0AA 1UJTA 1T1WA 4ETQA 2Q3ZA 1WJ3A 2XZCH 4LKCB 2VOTA 4DN3H 1CIUA 4ZS7H 3ZE1E 5HY9A 1S7SB 3HLAA 3QSKB 1MLBB 5JLZA 3EFDH 2QL1A 3QXDB 1UVQB 2XZAL 3QWQB 2HG5B 4TYUA 4YPGB 1RJZB 1IGIL 3BKMH 1ZE3C 5HGBA 1NL0H 1ZVYA 5EU6B 3SKMA 4Q2ZA 4BSWA 3RKDC 3EGSB 4P9HH 4DW2H 4LQFL 3HAEA 4WY7H 1Q9KB 3T2OA 4DQOL 4W70A 4Z95H 3KPPB 2IF7A 2GHWB 4XXCC 1S7RB 4AIOA 4NO5B 4P2RB 4HT1L 4Z7UF 4XNZC 3GKZA 4YBQD 3FQWA 5IP4A 2IH3B 2E9WA 2ITCA 1Q0YH 1CDGA 1X5HA 1A7NL 5DQ9B 3WIFB 3D87B 4PP1D 3P0VH 4QY8B 1S5HA 5GHWL 4FQLH 1UXSB 1BVLA 5J3HD 1IQWL 1EMTH 1P7QB 2OR9H 3HPLB 4R7NA 4WWKD 4YWGL 3CVHA 4I0PC 3IFOB 3MJ6A 1BVZA 2I27N 4WW1A 1AE6H 4ZOAA 5DK0B 2IFGA 3UJJL 4AM0A 4H88H 1W72L 3BP6A 5D7JD 4JRYA 5CGTA 4ACPA 4YDIL 2E7LA 5BV7C 4YBLB 3BRDA 4PBWD 3S8WA 3PWPE 3QIWB 1I3GL 2W0PA 1M6OA 4IS6B 4N0UA 1NUFA 3BW9B 3U46A 4S1SL 3MRNB 1YMMB 4P3DB 1WBYB 1ZHBB 3PQYA 1I8KB 4LOUD 5GGSA 2DN7A 5IMLA 4AY0A 4V1DD 3LS5H 4TUJA 4HCRA 4JZOB 3QCTH 2Y7QA 5D6CB 3MLTB 1HI6A 5CZXC 4AEFA 2X70A 4XGZA 3D85B 4MMZC 3EYUH 1YQ2A 1C16A 3MRKA 5C0CB 3GMMA 4F58H 3AVEA 1I1YB 3FB7B 3IDNA 4I3RL 1F2XK 4NQVB 5FO9A 1ZA3B 4NNXB 4QT5A 2ZCHL 2XNAB 3K8MA 4QCIA 4WTZA 4LCWD 1GGUA 4IRJD 3C6LD 1DLHB 5IBUG 3VWJB 2GK2A 4WENB 3SDCD 4QEGA 1KTRL 1H5BB 5GJSH 3TBVB 2F74B 4OAWB 5I19L 5C9JA 4BK4A 4WVRA 3L1OL 3B9KD 3PDGA 1MSPA 3PGCB 5T1LD 3SKUD 3X3GH 1U3YA 2CK0H 5EBLB 1P2CA 3MCG1 4L4TE 2H3NB 1GC1C 5E7BA 1ZT7B 2NY0B 1PZ5A 4BKLB 3ULVE 5D1QA 5I16B 4P3WA 2DQJH 3BQUA 3UJTL 1N6VA 5CLTA 5J56B 5LXGH 4Z8FL 3QH3B 4B41A 1WIPA 2AERT 4GW1B 4IEFB 2Y23A 1IILE 4UIMA 4OZGE 4PB0L 2XIDA 4OLWL 4IRZH 2GCYB 5FF6A 3QEQA 1EZVY 4E0RB 2OMBA 1OB1B 1U42A 4M93B 2BVQB 3BZDA 4N90E 1R3JB 2A74B 1G0XA 3SE3C 2FWOA 5IK3B 2DF3A 3PGFH 2I5YL 2LTQC 3CFBA 4C4KO 5FYLH 1MQKL 2P5WE 5K9KB 4JPWH 2VDRL 3SN6N 4HK0B 3TN0A 1G0DA 1OGTB 5C07E 5GGQH 4LKXA 2QSQA 1WAAE 2WK2A 1NGXB 4HZLA 5FECA 5I1CL 4GKSB 3T0VA 4KROB 5IVNA 3FQUA 5IROA 3GM8A 3H42H 2DTSA 3NVQA 1J0YA 1JGEA 3GBNL 1AJ7L 3CC5B 3SCMC 3QNXB 3LEXA 2VC2L 1B0GB 3QAZC 5E5UB 1AD0A 1F90H 1EFXB 3RKDD 4P9HC 1WIUA 3R4DA 5CHNB 4ZAKB 1YN7A 1LP9E 3QIBA 3ZDYF 4Y16A 5C86A 3U7YH 1TZHB 4J1UB 4HBQA 4LFHG 5JXEC 2FB4L 1PQZA 3CAFA 2CIIA 2VQ1A 2V6HA 1HDMB 2AXHA 3WNLA 5TF1L 2H6PB 5DD1H 3WHXA 5B3NA 4FQ2L 1M7IA 4XC1L 2OP4L 3O6FA 1TTFA 3I75B 3MXWH 2XTJB 4PD4J 3BEVB 3OL2A 4XNXH 2G5BA 3O3AB 3SDXE 3SOBH 5F89B 1HILB 1JYNA 5DHVH 5IF0A 2JELH 1WF5A 4OZFH 5DUMH 4R2GC 4GRLA 4S1DC 2P24B 3L5HA 1XGQB 4XVJH 2ZG3A 5JXAL 3GSXA 4M1DL 5TE4H 2YRLA 4K71C 1QSVA 4XPTL 4Z7VB 1DQDH 2XWJB 1F6FB 2EE3A 2IFFL 3ZKQD 2WBJC 5DQJA 1BEYH 2YD4A 5TDPA 1XIWA 2DWEB 1MAML 2PXYA 4P5TC 1AC0A 3VXQA 4JDZA 1EZVX 1KGCE 4I77L 4ESKA 4F7PB 3U30B 3L3IB 1IC4L 1SEQL 3WYRA 1DQLL 2UUDH 5GZND 1IE5A 5CSGA 2HMIC 1BOGB 2BVOA 3AAZA 4G9DB 2EDNA 5L7XL 1QLRA 1XGTA 1U91B 2J5LC 4OGXL 1H8SA 2GAZA 4NKIL 4WTXA 3CFJB 3T4YA 2CXKA 1VGKA 1W0VB 2CDFA 1INDL 5GS2D 4KAQH 2WM0A 1KIQA 1XMWA 1OF2B 1G6RA 3QDGA 4LLUA 4XMPH 3CX2A 2Y07L 3FFCA 1NCDH 5JW4R 3QO1A 3G9VA 5D2LF 1S7TA 5D71H 3CDYA 2CGRL 4O4YL 1I7UA 3HKFA 4L8SC 1FE8L 5DS8B 2CO7B 4ODVH 3KNBA 2AABL 5DFVD 5EORH 4OD2B 1OTSC 1I4FA 3V7AE 1HHGB 4G7YL 2CLVA 1D5XB 2JE8A 4PYGA 4ELKA 4O58H 1G7LB 3T1FA 4PJBE 3FFDA 1ZVSB 5CCKH 1R6VA 4JRXB 1R3LA 1IEAA 3ARBD 3DRTB 1OWWA 4L3CA 3ULUF 2BRRL 3SKOB 5IBTL 1Q9OB 1Y6NR 3C60A 4N0FB 1W8OA 4F15C 4QXGH 2W38A 3CK0L 3TT3H 1WC7A 2C9AA 1F4WL 3A67H 2A1WL 1RHHB 3MLXH 3P77A 3ULUL 2X4RB 5TQ0H 4OF6A 1IEBA 2EH8L 5IV2B 4AEIH 2Y36L 5GRJH 4TQEH 5HSFA 1NAKH 2AV1A 2E27L 5HHME 5C0BA 3PF2A 3MLPA 1NMBH 1T21A 1BP3B 5C8JB 3SO3B 4NO0D 3FOLA 1FO0H 1D5ZB 3GSUB 4YIQA 2DJUA 4X6DE 3MNWB 4HH8A 5EU3A 4F2MA 2FYYB 1Z6JT 4N8VB 2E7BA 4IHOA 4MB3A 5DDHA 2QTEA 5BRZA 1NC4D 4GAJH 1WBXA 4KJYB 3ARWA 1J0JA 3R8BB 2NNAB 2AJUH 5KJRL 4M4RA 2AJZB 1J0IA 2J6EH 1TTUA 3NAAH 2C3XA 2D7NA 3TVMA 3HUJF 1FNSL 5F7DA 5C09B 5BS0A 1IAIL 4EIGB 1WWAX 3T0WA 3TH2T 4AL8L 1O0VA 2BOCA 4LSPL 4M03A 4P2OB 4LCIL 5HHOE 4PJXA 4HBCH 5D7SH 3T8XB 3EOTH 2YPKA 5I30H 3W5MA 4GG8A 2DLEA 3ROOB 1IBGL 4KDTA 3DX6A 3DI3B 3WIIL 3DX8B 1QVOB 5CD3A 5CP7B 4X9GA 2PTUA 1LDPL 5C0EB 5FYJH 5FOJA 3BISA 4LHJB 3ETBF 1JK8A 1JN6A 4R2GD 2IMMA 3CVIL 5EC2A 4WGWB 4P9MH 4WU5A 3ZKSD 5FA3A 1IC7L 3AU1B 4R97B 5E5MA 4EOWL 1RD6A 3QQ3B 4YZFE 2YMXL 1ZS8B 3DGCR 2APVA 2BZDA 3LRGA 3EO9H 4LF3A 3MV8B 4Q74A 5J12C 3UBXA 2WBJD 1UZ6E 1QFWI 5D1XB 4YQXL 1IL1A 5DEFA 1NSNL 3LPGA 4GBXA 4WW2F 3TGXA 4V2CB 1MIMH 1OCWL 3BESR 4WHDA 1JIBA 3O3DB 4A6YA 2P4AB 4L4VB 3KPSD 1YUHA 2X6MA 5L8JB 4D0DA 1TETH 1BHGA 3T3PE 4ORGA 1W0WB 1AXTL 3C09C 4JQIH 4HXBH 1HXYA 2ZP0T 5L2KB 4KK6C 3WL9B 1XF1A 3ILPA 3WFEH 3K8KA 3OAYH 1NANI 4JFDB 2ERJC 4PV9B 3WO3B 1U6AL 4JKKA 4WHYG 3NZ8A 3Q3GB 3DJ9A 1VENA 3PG2A 1KJVA 3BJ91 2VLKD 3SDDC 4ZUWB 3TO4C 3P4NA 3IJSB 4HIXL 5GRUH 4QRRA 5DUBA 3FN0L 1QLFB 3IAPA 4XC3H 1RY7B 1OTSD 5J89A 3A0OA 4S1RH 1MFDL 2I9LA 3P9LB 4ELMF 1KCKA 1YEIL 3DURA 4OLUL 4U6YA 1EVUA 1CFNA 2WMPA 5ESQA 4FQCL 4EEEA 1V5JA 2OI9B 3KDMA 3T65A 2P43B 4FZEL 4NCDA 4X7TB 4MNHB 4QOKA 2X4OA 3WUWB 4X5XB 2FJHA 4G6KL 3IAGC 5FA4A 3AC0A 3PWNA 2CUMA 5IB1A 3G5ZB 5DVKA 5HYJA 4YJZL 2A77L 5EZIH 1QHOA 3D85D 4YDJA 3WDJA 2XA8L 2DQEL 2W9LA 5ANMA 3SE4C 4Q6IB 4ALAL 4F37K 3FQNA 5F7LB 3P0GB 5SWQB 2AJSH 2ZUTA 3B9VA 5M94B 3QQ4B 3EYQC 5DWUL 1T66C 2XN9A 3QUYB 2NY6C 4WEMB 4L8CA 3QA3A 2VDQH 4JQVA 1A4JB 3WS6C 3TYGL 5EOCJ 4EQ3A 1E4XH 3UTZA 3PWLA 2FX7L 1NKRA 5GGUB 5T33H 1L9MA 1P7HL 5FCUH 3PHSA 3WUZA 12E8L 2J4WL 2MWCA 3Q6FA 4JFED 1FORH 2VDNL 2AJYL 4LCWE 3OHXA 4JFFD 3WSQL 2PTTB 1N0XH 2NYYD 5F3HB 5ADPL 2XZQL 2FSEB 2QLVB 4X6BB 3VFGL 3X14B 3BGMA 1L0XA 1LHZA 1BQHA 4G8EA 4JKPH 3U83A 3TYFB 4AYFA 1EERB 2YRPA 1AGDA 2VTFA 3ARTA 1F4XH 2IBZX 1ULVA 2UZIH 5ID0A 3FO2A 3QI9D 1I7TA 4HIIA 5GPRA 2CRMA 4KPHL 1RUPL 2QHRL