1FORH

Structure determination of an fab fragment that neutralizes human rhinovirus and analysis of the fab-virus complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
QGQLQQSGAELVRPGSSVKISCKASGYAFSSFWVNWVKQRPGQGLEWIGQIYPGDGDNKYNGKFKGKATLTADKSSTTAYMQLYSLTSEDSAVYFCARSGNYPYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQTITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 17-IA FAB (LIGHT CHAIN)
publication title Structure determination of an Fab fragment that neutralizes human rhinovirus 14 and analysis of the Fab-virus complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1994-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1forH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1forH02
1IVLA 1KB5A 3CVHB 4XH2B 4I5BA 3CFEA 3K3QA 3NIFE 1GGIL 1HQ4A 1T04A 4K71B 4FFVC 3NBNA 4P2OB 2NCMA 3DNKA 4Q6IA 3TIDA 4ONOA 3OPZH 4UTAH 3O3UN 5HHNB 4OI7A 1S9VA 4ODHH 4H26A 3DO3A 3RVTD 4AL8L 1MY5A 5IHZB 1MREL 2X4OB 3O2WL 2VL5A 1T2QL 1KFAH 2GJZB 3HB3C 3OR7A 1CBVH 1YNKL 4OJFH 5AYQA 3X13A 4U2ZA 3CFCL 4PGJA 1I1FA 4C56D 2CDEA 3SDXF 2J1KA 3SE4A 2DL2A 3ILPA 4AH2B 1CZ8H 5C08B 1FPTL 4X6EA 2PYEA 1KOAA 1K6QL 4A6YA 1MHHB 1CS6A 4JO3L 3BPLB 3BGFB 4HEME 3IDJA 1CFBA 2XFXA 4LBEA 4Y4KA 1XH3B 3GSRB 4YQXL 5K9QG 1IEBB 4F57L 1F2QA 4PJHF 4XP9H 2FL5B 2VISB 4HF5L 3NIFF 3EW3B 5FA3A 3WD5L 1RK0B 1K85A 1FFPB 3ULUC 3MRKB 3FQTA 4YXLL 3LY6A 2VQ1B 1DUYB 4J8RA 4GSDL 4AY0A 1T6VN 3TO2B 1J1XL 5HY9A 5L6YH 3MCLH 1ZS8A 2F58H 2OSLA 3RIAF 4M1CC 4Y19E 5E8EB 3QI9C 3WDHA 4OCRH 3A6BH 1G7IA 3Q5OA 1SYVA 1OP9A 2H45A 4ZXBD 2VN7A 2AEWA 3IRZA 4RAVB 4O2EA 3L5JA 4K8RD 4Z77B 1U91B 3O45B 3JZ7A 4S2SB 3B9DA 4LSSH 6FABH 3RWDB 5E0QA 5JHLH 1H3UA 2CGRL 2PR4L 5F7WC 4LGPB 1NGZB 1IRAY 2FRGP 3DMMD 4MNQE 5TE4L 4HJJH 3V6OC 3O6FC 2VMFA 3IFNH 4NGHL 3P9WB 4W6XB 1V05A 2R1YB 1EERB 5I0DA 2VB5A 1IILE 2CK2A 1KYOK 4HKZA 2VZTA 1KJVB 3GMLA 1V3MA 5DUBB 4LCIH 3LKPA 2EH8H 4WEUD 1U6AH 3RX7A 4ZFFB 3IU4H 4ZNEE 1Y0LB 3IFLH 4FZ8L 4BSJA 5D2NE 1RJZB 1WZKA 4CVUA 3QI9B 3KPOA 1KT2A 1I9IH 4JREC 4G7VH 2IALB 1CQKA 1YMHA 2YXMA 5CSGA 2Q1EA 5DD6A 5IB5B 1QR1B 3G5YB 4G9FE 4KRPD 2Y7QA 4NNXB 1MI5D 4K3GA 1U8KB 4G7YH 3QHTC 4KI1A 5AUMA 3LIZL 3HLAA 5DJDB 3BD3A 2VDML 1F4XH 2W1NA 3GSNL 5C0AA 3WS3A 1NCTA 1I9RL 1KN4L 3DX6A 2BOCA 3I84A 4JHBA 2WUBH 5EOQH 1K5NA 2VE6A 3GNMH 4EDWL 1JZ7A 1NQBA 3S37H 4EVNB 3O6FB 4FQJH 3EZ8A 3FN3A 4NKOA 5D1QD 3UTZA 3G5XB 4XB7A 5E5RB 1Q9WA 2I26N 4J3OC 1RQ5A 1N4XH 4H0GA 2HVKA 3GSQA 3F6LA 1HYSC 4E0RB 1FVCA 4U0QB 4PV8A 5J1SC 4Y2DC 2B4CL 1P4LB 3TZVA 4HPOL 4OCLC 1MFDL 2NNAA 4RBPK 4JFEE 3SOBL 3E3QC 3QSKB 2BZDA 3IVKB 5H94A 1PX4A 2Y5TA 2NY6D 4R8WL 4XAWH 1QNZL 4HULB 1U95A 3TVMA 4K9EH 1SQ2N 4JREB 4KQ4L 1ZSDA 2V2XA 4XP5H 5JQHC 3TN0C 5SWSD 3NFNA 1HCVA 4OKDA 1TVHB 1L0XA 1NDGB 1A6UH 5KG9B 4LGSB 3ZKXB 3WNKA 3OGOE 3SCMA 2X9XA 1YN6A 4JFYA 3WS6A 3B83A 1OSZB 4WI4A 4NC1E 4HIHA 5EOCJ 3LRSB 4NHCL 2IPUG 3WEXA 5K59E 5TF1L 4PLJC 2E9WA 1KTLA 1ROWA 2BVPB 1W72L 4NFDA 3TBYA 4I48B 5KTEH 1LMKA 4UOW1 5IQ7L 5I1AA 1EO8H 3O3DA 2VLKD 1OPGL 1JWSA 3NN8A 1VSCA 3LEVH 2PF6A 3B2UD 1UEYA 4JVPA 4Y2DB 4YO0B 3IDNA 1YQ2A 3LQAH 3OKDB 2VZOA 4XMPH 1ACZA 3ZZ1A 1BGXL 1QO3A 2ADIA 5HDOA 2FX9L 5TQ0L 3DVNB 4U3XA 1KLUA 2R1XA 1I3UA 4JRYE 3ELAT 3GMRB 3D1MC 3SQOL 1HHIA 1LE5A 5I30H 1WWBX 5B38A 1ZA6A 3TN0B 1SVCP 3QQ9C 3UYOD 4QEGA 3S36H 1U8LA 1S7TB 1CGVA 2WBWB 1DQML 2P5WA 3QZWG 2YS4A 4KTEL 2X70A 2PXYC 3QCUH 4IDJL 2C1OA 3TA3D 1NCDL 5JUEL 3VWJD 1RUKL 4UBDC 4U6YA 1BVKB 2FJFA 5DYOB 2FATL 4ZFOA 4NKDA 1QBAA 3TEUA 3L3KB 4U1IA 4DKDC 5GZND 5I17B 1B6UA 1MNUH 1A6VH 5AD0A 4ZTPH 1RZJL 1ZLSH 1FIGH 1KCSL 3IDGA 5I1DA 1KB5H 2JLLA 1F6FB 1M05A 5C08E 3QZWB 1WLHA 3SHSA 4TUJA 3U0PB 1TJGL 2NY1D 2DICA 1RZIB 2UVFA 4DUVA 3C5SA 3ZYJA 1YQVL 5L2KA 5E2TL 2F53A 2DWEB 2V17L 3HE7D 1C16A 1V7NH 3PWNB 2YMXH 4ZOEA 4IM8A 4HJGB 3FRPG 5D6CA 1X4XA 1F45A 5L2JA 5I8EB 3VXTB 3GI8H 1G7MA 5EPMB 2VOTA 4X6FB 5ACZB 1FYTB 5ISZD 2PXYB 1S9WB 2C3VA 3OF6D 4A6YH 4JFPA 2B2XL 4QOKD 1UM6H 2R69H 1CCZA 1EBAA 4LKCB 4XWOC 1LK2A 3BGMB 3IJSB 1D6EB 2EYSA 1KJ2B 5AWNL 1HXYA 4KHTH 2HH0L 3VXPB 1SEBA 1BQLH 3GBNL 5IROA 4C83A 4J3VA 2R0LL 4MB5A 4YDJA 4NWUH 3LZFL 3QUYC 5CKGA 5E1HB 4J1UB 5IVXB 3JV5A 5EA0L 5C0JA 5HD8D 1NGPH 4BFEA 3Q5TA 4DGVL 1EHXA 1NC2A 1A6TB 1J11A 3ARGD 1FG9C 1XGQA 4YHKL 3GMOB 4YAQB 3BT2L 4Y2OA 3WBDA 2HFFA 2A38A 2DOCA 3ULUE 4LAQH 1V5JA 1ADQL 1OGAD 4F3FA 4MSWB 1FCCA 4MLIA 2Z92A 3C5ZC 3IDXL 1ND0B 1OW0C 2YD5A 4OGXL 2AABL 4UOW0 3RL1B 2GUOA 5FCSH 1VACA 5LWYH 1JV5B 4LGRB 2VLLB 1M4KA 1NL0L 3MREA 4ELKB 4HZAA 5HHVH 4LP4A 4U1LB 1BFOB 3AXLB 4PBVC 4R7DA 2XWTB 4QHMA 5CLWA 2J4WL 4IRSC 2AJ3B 1MQKH 4WV1C 3SDYH 1A9BB 3OBAA 1JGLH 3WNLA 3QUYB 3CFJB 1OAKL 3DETC 3VFTB 2I07A 3FFCD 4UQ3B 5KSUA 4LCCC 3V6OE 5HVGB 2IC2A 3MGTA 3BGAA 3ULUF 4LCYB 1JGVL 2R15A 5GRJL 5CJOL 2X4QB 3O2VL 4CNIB 5IW6A 1S5IH 1K9TA 3SKJL 5SWQA 2FB4L 4FNLL 1HHGB 5H2BA 1N3NA 4UB0H 3CVHL 3IS1X 2WWMD 4RFOL 1ZANL 4JB9H 3C5ZB 2WP3O 3MJ9A 3L7EB 4RRPG 1A0QL 1I75A 3C60A 4I9WE 3T2QA 1SBSH 4PY8J 2CUIA 5FUOH 1HKLL 2JK5B 2P1YA 5IHBA 4XCNB 1IBGH 2QQNL 4WI8A 2FEEL 5LQBL 1IEAB 5MP6H 1T89C 1MCRA 4LPUA 3P0VL 2BRRH 2RR3A 2FSEB 4IRSB 5LBSH 1A6AB 4XNYH 2VR9A 2YD8A 4H8WH 1OAZH 3ET9F 3I6KB 4WV1B 5HI4D 5ICZB 5HHXH 2Q20A 5FDYA 2QR0A 5T1LA 1QSEB 1BX2A 1R3KB 3CX5K 4LCCB 5CGYD 1GPOL 3AS1A 4HQQL 5H8DA 4G8GB 3MV7B 4NOBA 1ZHNB 1UVQA 5IEKB 1RSFA 2BMKA 1LEGA 1A6ZB 3ZKQD 1JGEA 3J7HA 4X0KB 3PXHA 3RBSA 1FH5H 2N56A 4FQXC 4GH7B 4PJAF 3LN4A 3BSZL 4NCC2 5D7KD 1D9KB 1CTNA 1KIQA 2EH7L 3MZGB 3EJYC 1XF3A 3T09A 1AQKL 5EU5B 4NQCB 4N0UA 3MRLA 1A4JA 4F33B 1WBZB 3L5IA 1L7IH 1BFSA 4LF3B 3UTSD 4F2MA 4APQD 3HZYB 4K7PH 4L8BA 3ZE0E 1YEKH 4UDUA 5F7UA 4JG1L 1Z9OA 1QG3A 1QEWA 5D1XD 2C9AA 1VPOH 4BZ2L 2NZ9D 5L7XH 4GLRH 2QJDA 4CADB 5ESQA 4PJDB 1MCEA 3IXTB 3HNSL 3P40A 1PY4A 1OAUL 4W4OA 5I1CL 3VXOB 5CD5D 2DQEH 2ZCLL 3B43A 1TCRB 2BOBA 1U58B 1WISA 3HG1D 1AKJB 3LKOB 3OKOA 2PYFA 3P11L 1UM5H 3U7YL 3THML 3VWKD 4X6DF 2OZ4A 2W0KA 4J4PD 2P5ED 1XF5A 3D85A 1F00I 3DUUB 1H3TA 1XIWA 3LN5A 4QXWA 2WNGA 3ULUL 4FQXB 1CLOH 3H9SD 4YFLI 4NO2A 4Z5RA 1BIIA 1ZTXH 2J6EA 3WN5C 5HDQL 2ZUTA 1M6OA 1JZ2A 4N0CC 2I5YH 2GCYB 1P53A 2DQGL 5F1SA 3SJVA 2MSPA 4UDTB 5A3IC 5C0BB 4RISH 1SJHA 1AR2A 2Z9TA 1IQDB 1B0RA 3C5JB 5I1HH 1F8TL 2OP4H 1LDPH 4O5LH 2Y25A 3G6JF 5C2UB 2H8PA 5INDA 3KYKH 1FYTE 2IFFH 3ULVE 3K8MA 3RZCC 1BREA 4WU7A 4ODWA 4WI7A 5JMRA 5DFWH 3D2UA 3QO1A 2HG5A 4MWFB 1QLFB 3GMQA 5TPWH 1PFCA 3CCHA 5CGTA 1BVZA 1CLYL 2F5BL 1IGCL 2CQVA 3X11A 3MRGA 1C1EL 1FDLH 2BNUA 2JE8A 4HKBA 4N5UA 1IT9L 4HEPG 4P57A 2X4NA 5CUSH 2EDEA 3QCTH 4PTTA 3G9AB 3ZO0A 4G8IB 5TH2A 2C4FT 1MPAH 5JOPD 5IVXE 3EJZD 3WN5B 3BX7C 1T7YA 2VZVA 3GBMH 2HT2C 4HUWB 1LEIB 3FO2B 3ETBF 2VDQH 4Y1AB 2DMBA 1JI1A 4XMLH 2IPKA 3NPZB 3QO0A 4RGMC 3VXSA 1PYWA 1WV7T 3IJHA 1UCTA 4IOIA 5B39A 4HHAA 1IC4L 2VDOL 2VC2H 1FZMB 1KYOJ 5D93C 2F74B 4RA3A 2QSQA 1WGOA 4AEFA 3UTTA 5T3ZE 3TP4A 4PJCA 1F90L 3HC3L 2EEDA 4N5EC 4WO4A 2YUVA 5I2IB 5MEOA 4HIIB 4PRAA 4MJ5B 2ERJC 1QYGL 5IEHB 4YHPB 1EAPA 1H3PL 3S5LB 4O58H 3JWOH 4GAJH 1OAXL 5T1KD 2O5YL 3HZVB 3B3IA 1A4KA 1K4DA 3VFVA 1W8NA 4HAGA 4KK8C 3DRQB 1T1XA 3VGAC 3EAKA 2NY7H 2APVA 2M26A 1BLNB 2BJML 4P46C 1CGXA 4KKCC 3L1OH 3HA0A 3U4BH 3GI9L 1HIML 5IBTH 5TDNB 1TZGL 4HXAL 4ELMF 1HQRB 2LU3A 4FQLH 3SY0B 1KIRB 4X7DC 1NBVH 3MRNB 3WKML 1EGJL 4RGMB 3CUPB 3N0PB 3Q6GL 4X6CA 5HVFB 3VCLA 4NRYB 4P4KD 3VXRB 1RY7B 1H3VA 4X8XA 3MRIA 4NO0D 5D93B 3UROR 3EO0B 1CICD 1CXEA 4U1NA 5C09A 4R4ND 1YJDH 2QQLH 3DX9A 1TZIB 1TFHA 2JJTC 4OLXH 3MRQA 1M7DA 4R2GD 1C08A 1G7QB 2EDBA 3S96B 4KI5C 2ERJB 4MVBD 4TUKH 1ZVSB 2KPNA 4N0YH 4N1EA 2APWA 2VITB 4FQHB 3UDWC 1MH5B 3GMMA 5C0FA 4FRWA 4XXDA 1YECL 4HK0A 1KPUB 3I75B 2ZCHL 3LPWA 5KSAD 5MEQB 1TCMA 3CMGA 4B7IA 2BX5A 4Q6IC 3VGAB 3K0WA 1UXWA 1FNEB 4FXLA 1BF8A 3TBWA 4JY5H 3G08A 1NH6A 2WINB 1QSEE 4FXGB 4P46B 3MJ9H 4KMTH 4HGMA 1T20B 4NRZB 1P6AB 5F1NA 2KZWA 5BZDB 1LP9F 1YEHL 4G8GE 1OARL 4UIMB 5K9OA 3MV7E 4JG0H 5GGQL 3QA3B 3G5ZB 1KJ3H 1Y18A 2G75B 5DMGD 3RA7H 1YYLL 1IM9B 2ARJB 1I1AD 3SE4C 4UQ2B 2JB6B 1YEFH 1DQJB 5I76A 2ZP0T 4L8SA 4LSPH 5D71H 4Y4KC 2ZCKL 3TBSB 4NQCE 3TO4D 3V4UL 1BFVL 3H7BA 3BN9C 2FECL 4BYHA 3U79A 3HRZA 1XR9B 2I60H 1NFDA 4UV7L 4JKMA 1MJ8L 2NY4C 1KJ2L 4JO4H 4MQSB 4P2YA 4ZUVA 1T04B 3BQUC 2VR5A 4PJDE 4EUPA 5GRUL 4Q6IB 3TIDB 5C0ND 4ZUTA 2ENSA 1IM3B 1OSPH 5IW3A 2ZJSH 5IHUH 1S9VB 4H26B 5DA4A 3MSPA 2P7TA 4RGOH 4FN0A 4HZLA 3BD5A 1Q72H 3GSUA 1LK3L 2PTTA 2BY2A 4JM2D 3LPGA 3BPOB 1I1FB 2CDEB 1A02N 1WWAX 1C5BL 3OR6A 3ZHDA 4R96A 4MJ6A 3V4VH 5INCB 2PYEB 2CLVB 2X9YA 4A6YB 4GUPA 1F42A 5JR1H 5C0IB 5T3ZL 1OB1A 1MHCA 2HKFH 4Y4KB 1GRWA 4TQEH 1BZ9A 3MA9L 3RY4A 4P2RB 1UWEL 3B2VH 3N1GC 4F37F 5CEXB 4JN2B 1A7PH 5FA3B 5C0BE 3MBED 1MHEA 3WFZA 2NY4B 3FQTB 3IDIA 4EI5C 2A83B 3FJTA 1OM3H 2VZ1A 2YPKA 1B4JL 2XNAA 3BQUB 1N2RB 3VD9A 8CGTA 2OSLB 2OJZL 4TSBL 3IS0X 4M7KH 3T4AB 4J6RH 2J6EH 1OD9A 4KAQL 1ZT7B 5LJYH 1SYVB 2C4FU 3VG0L 1LHZA 1S9KC 4MD0B 1SM3L 3NFSH 5HBBA 5LG1A 5FM8A 4NJAH 3TJEL 2XTJD 4Y89A 3W5MA 3JVGC 1CWVA 2X44D 2O5ZL 4MNHA 4U6XA 1P9MA 4NPYA 5E2VH 5IK3A 1I7RB 4GXVL 2VYRE 3QRGH 4X7SH 1WICA 5C3TA 4Z78A 4JDTL 3MACL 5EWIL 3ZHLA 3G6AA 1LE9A 2AI0H 1HILB 3DLQR 1U8IB 4Y1AE 2IQAB 3RWFB 4KK5D 1YEJL 4KKAD 1EHAA 2YEZA 3A6CL 4FA8A 1FRGH 4Z7UA 3OKKA 2FX7L 1RJLA 2V2WA 4HKZB 4FHBD 4XHJD 4EI5B 2OCFD 3K4DA 1BP3B 4JPIB 2VLME 5IBUG 2ARJQ 3L7FA 3FN0L 4W81A 3ALPA 5E00A 2PW1B 4L5FH 1RZ8A 3RNKA 2OJEA 2XKUA 3KPOB 1KT2B 1OGTA 2BXZA 2E5EA 5D4QA 2P44B 1YMHB 2BNRD 5DD6B 4PY7B 3TNMB 1D6VL 3IGAA 5AUMB 2E7HA 5EBWA 3HLAB 1OP3K 3TIEA 1G7PB 3WS3B 3E6HB 1FAKT 3DX6B 5DTFA 3WS6C 5B8CA 4OFPA 4U1KA 3OPZL 4P5TA 1K5NB 2VE6B 4KWUA 5KSBA 4ODHL 5FA4A 2Z8VC 2AXFA 2QADC 1AO7D 5D7SH 7CGTA 3JXAA 1KFAL 2GYSA 1Q9WB 4ZDHB 3BH8A 4OJFL 5F7FA 3GSQB 5H35A 1NCAH 3PWPB 3I02B 4UNVA 1PQZA 3MV8A 1CR9H 1RFDL 1CD8A 1YMMB 3TH4T 1CZ8L 3ESUF 1MLCA 3VXRE 1GZQB 2NNAB 3QPXH 4TTDD 2XN9A 3ZDYE 4P3WA 5FYJD 5H94B 2OTPA 3SDAB 4FFWD 1U95B 4X6BB 2EDRA 5DJ0B 2OM5A 3C87A 1MCKA 2DBJA 2YBRA 1ZSDB 4XP9L 1DBBH 2V2XB 5JZ7C 4RIRA 3NFNB 3PDDA 4JKLA 1KCRL 2QHLA 4G43A 3OWEA 5F72S 2FD6L 2XQYG 4WHTA 4LSRH 4OIIH 1YN6B 5L6YL 3MCLL 2F58L 4JFYB 2XZAH 5IMLB 2YD9A 4HUMB 3QIWC 4HIHB 2H26B 4OCRL 3WEXB 4P3DA 2RAMA 1KTLB 1XT5A 1IMHC 3FTGA 3L3JA 5B38G 1J7VR 1R3LA 2QADB 4MDJA 3BDYL 4NBYB 3VGBA 2GFBB 4Z8FH 5CGMA 3O3DB 6FABL 1EUUA 1JWSB 5JHLL 5ALCH 2WQ8A 1ZGLM 4MA3A 3QXAB 4M9PA 1BM3H 4R4FH 5GISH 4I3SH 1KCKA 1QO3B 4OZ4A 4HJJL 4WW2F 4D9RE 2DBLL 3IFNL 1KLUB 4ODVH 3BZEA 1N5AA 1HHIB 1LE5B 4PRIA 2VZUA 5B38B 1YEEL 2EDNA 5J3HD 2D7OA 1YNTA 1CL7I 4QNPF 2P5WB 5I1EH 3PHQA 1UJ3A 4Y88A 4LCIL 2EH8L 1FL6A 1MUJA 2L7UA 3IU3B 2C1OB 5GGSA 3TV3H 4P0DA 3IFLL 5HGHA 2YWYA 4U6YB 4ZTOH 2FJFB 2Z31D 3L9RA 3QIWB 1VKXB 1F58H 4NKDB 1I9IL 4O9HL 5JNYB 4NQDA 1SJVA 4QRSA 3MJGX 3VFSA 5D1ZC 2DYPD 1RHHA 4QCIB 4U1IB 1J1OH 5E94A 3T3ME 4G7YL 5IF0A 5JA9A 5HHOA 3KG5A 3S3PA 5JQ6H 1Q9LB 1YPZA 3WFEH 1F4XL 5IROC 3ORJA 1JF6A 2LAGB 2IQ9L 4PJ5D 5JOFB 2PYEE 4M5ZH 1FVEA 2WUBL 2FBJH 4DVBA 4KI5F 5EOQL 4OCMC 4ALAH 1A8JH 3C5SB 3GNML 2MKWA 3KPRD 2ITCB 4XCFH 2DQCH 4FQJL 1CVSC 2F53B 5I1IH 3IFPA 3S3SA 4P2RE 1MIMH 2DM7A 4O2CA 4I8DA 5FGSA 1GSMA 2H3NB 1N4XL 2AEPH 4XVUD 2RQ8A 2GAZB 1JF5A 3PL6D 1G7MB 1U3HA 2JJSC 3KHQA 1IJ9A 1V3JA 2C3VB 3BWUC 1ORSA 1NGXA 1G7JA 1NPUA 2EIZB 4K3HA 4XAWL 4JFPB 4FG6C 2W60A 1FZOA 3QWQB 5GZOD 4FTVB 1N26A 4LSDA 5D1ZB 5J57B 4GKZA 4NO5B 3WO4C 4OV5A 1HXYB 3ME0A 4LMQE 3IAGC 3MXVH 1PKQA 1A6UL 3HAEA 3PQYA 4C83B 2YUWA 1CQYA 1DVFC 1YJDC 2ZWLT 2JF1A 1VGKA 4OGAC 1OTTD 3VI3E 1U8QA 3T3PF 5A2FA 3BO8A 2W65A 1IAIL 4PJ9D 3O4LD 2ZSVA 1XGQB 1IGFH 5GGRA 1OP5K 1FFRA 3ILQD 3QDJA 3T0DA 4R7NA 3PNWB 1GC1H 4DGYH 1MIEH 7FABH 2JKXA 1RZKH 3C6SB 1D5XA 1P7KB 3VXMA 4XMPL 2IPUK 4PGDB 4RA0C 3LCYA 3C60C 2GUOB 1BD2D 1FP5A 5MHSD 1FGVH 3CIQA 4LCUA 3MREB 4G9DA 1QOKA 2ZOLA 2OL3H 3FZUC 4BSVA 4R7DB 4MQXC 3RWCA 4NQTA 4QHMB 1SMOA 3WO4B 5IIEB 4ISVB 1IE5A 3S36L 3VI3F 1ZHBA 25C8H 4QHNA 3FAWA 3TYGL 2AS5M 5I1JL 3QCUL 5DXWA 3SDDC 1DVFB 2H9GA 2GSIB 2MTPA 5JO5A 2V2TB 3GJFA 5KSUB 4MJID 1EO5A 4M1GL 3RKDC 4QRPE 3MLWH 3F7YB 3ARYA 4PGCA 1CFNB 5E08H 1UEMA 4AJ0A 3LQZB 1CDUA 1MF2H 4IIQA 2DTMH 3P0GB 1XGUA 1YY9D 5IW6B 2EIEA 3GDBA 1IL1A 4PRNB 1MNUL 4U6TA 3ARFA 3EBAA 5CZXC 3PWPE 4ZTPL 5SWQB 2WIIB 1FIGL 3MOAL 1YMME 3MV9E 4NBZB 4JZJC 4OLEA 1WWWX 4Y5XA 1Y6KR 4OKVB 3OSKA 2F19H 2WM0A 3C60B 4F9PA 4J3XA 5JW4M 3WNPA 4DZBB 2APXA 2YMXL 2DDQL 1CLZH 3H9HA 2X4UB 3ARPA 4U7MA 3EGSA 2ZOKA 4ODUB 2K7QA 5FB8B 1P5VA 2NY5H 3QG7L 3GI8L 1FNSH 5I8KL 4KKBC 3GUTA 4TSAH 3GHBH 1JPST 2YSSA 2NXYC 3SDDB 3WJJA 2QR0B 5DWUH 4L4JA 1BX2B 4A6YL 4K7PY 3BKJH 3W0WE 1UM6L 1CF8H 2C4XA 1FN4B 2AK4A 3T0ED 1TMCB 3EO1A 3SGDI 4KHTL 1Q0YL 1BQLL 1XIWC 2ARWA 2Z35B 3FQNA 3OXRB 1O0VA 4NWUL 1KLFA 4RGNC 3LV3A 1YEIH 2AEIT 2D4DA 4JFFA 2J2ZA 4KJYB 1XF3B 4JZJB 4GJTB 4NQEE 4KRLB 1FZJA 4QTHB 4V1DD 5D7LA 1C5DA 4NRXA 5IT2L 4EN3C 4L8BB 3S4SG 4OTXH 4UDUB 2UZYB 2ADGA 4NP4L 3C8KA 4ZAKC 1M71B 3T2NH 1S7WB 5FXCH 2LVCA 1QEWB 4NQUA 4LAQL 5BW7C 4Z7VF 1BJ8A 3GKWH 2R9HC 1WF5A 4WU5A 1A7OH 2QHRH 2NXYB 3L6FA 2CIKB 4UILH 4DAGH 4N1CA 4TOYH 2PYFB 4KDTC 1ZLVK 4GG6A 4WNQB 1KIPB 5KZCD 4D3CH 5DMIH 3T65A 3U4EB 5T3XE 2R8SH 4K94H 1XIWB 4KGJA 5EIVA 4L4VE 1MQKL 4JCMA 1JGLL 4RGNB 4Z5RB 1BIIB 2UWEA 4TNVK 4OBRA 5LCVL 4XP1H 1NFKA 1QSZA 2HJLA 3U0TA 4TULH 2DM2A 4NCDA 2F53E 3HPJA 3OKLA 5JXED 3MLPA 1ZVHA 3I9GL 4XPTH 4Y4FA 3SJVB 4EN3B 1GGCH 5DD1H 2AAVA 4KTDH 4ZD3H 1F3DJ 2DIAA 1BQSA 1MCLA 1KLGA 4ZAKB 1B0RB 1BQHA 1I3VA 5FKAB 4CDGC 1N64H 2DB8A 1GZPA 1A5FL 4P5MB 2VH5H 5FDWA 3O0RH 4M5YL 4G6FB 5IFJA 4ODWB 3LSOB 1YN7A 3D2UB 3QO1B 2HG5B 1RJYA 1A7NH 1M1SA 3GRWA 4FTVE 2VZSA 3MRDA 1HHKB 1MFCH 3NH7L 2IAMA 5B39G 3QDAA 3OHXA 4OFIA 2BRRL 5F88A 4XNYL 5TF0A 4M6ML 2X4NB 4R90L 4Z7OF 5CJ5A 1OAZL 3I2CH 5ITFA 4PTTB 4F58H 1KC5H 4WUKL 4PJIA 2C5DC 2EC8A 3CLFL 3X14A 2VQTA 2M8XA 2CR6A 2DN7A 5ERWA 4HSQA 3OAZK 2BVEA 4MGXA 4NM8H 4PJXA 1I9EA 2IPKB 1E4XI 3LKQA 2VZ3A 1PYWB 1FH5L 5I66A 3MUGB 2EZ0C 5E9DD 3HAEH 4XHQA 12E8L 4KGLA 1P2CB 4PJCB 1CFQA 2Y06H 1XGPA 4PRAB 1R3JB 2E7CA 4G6KH 1L7IL 1BECA 4DWHA 3MROB 3D18B 2VABA 1EUTA 4F37K 1EAPB 4IMKC 1JWMA 4MHHI 3B3IB 3EZJB 3F65A 3P3YA 3VFVB 3HR6A 1S78D 4LSUH 1P1ZB 5DFVC 4MA8H 1ONQA 5E8OA 1S7VB 3I6LD 3NTCL 1SBBA 4C4KT 1W0YT 2PO6D 1UM5L 5J7CC 1MJUH 5EUKA 2DAVA 3E2HC 2IMMA 3X12A 1RV6X 1BFTA 3PJSA 4O51A 3EOBA 4X6CB 2J5LC 3VCLB 5DD0H 3MMEA 5D2LA 1ZTXL 4L8SC 5DHYA 3P77A 4JQVA 4LPWA 4LQ1A 2I5YL 5C09B 3ZE2F 2X4SA 4X9IA 4XAKE 1CVRA 2JJUA 3MRQB 5KANI 3GJFH 2P8LB 3RJQB 5JIPA 5HDLA 4U3CA 3U0WL 3GMMB 3BW9A 3C2AL 4HGKC 3UO1L 3H9ZA 1KG0B 1IC7L 4LLVB 5I1HL 2BVQA 2OP4L 5T3XL 3VGGA 1LDPL 5IOPA 3O6KL 1WFNA 2J12B 2QSTA 3VXNA 2IFFL 1L0YA 1UXWB 3QFJA 5FHAH 3KXFD 3TBWB 3G08B 2ICWA 1J0HA 1A7QH 2MHAA 2C3GA 3MXWL 1OOAA 1NMCC 2I9LA 5GJTL 1T03H 3MYJB 3DHMA 1DLHB 3LS5L 4PLNC 4QRRD 2EDYA 4N1HB 5TPWL 3AUVA 1FLRH 1AXSA 3JV6B 4NNPH 4PBXA 2XZCH 4UT6L 4HUXA 3DMMA 2ZUSA 3E2HB 4JY6B 3RWIB 1W0WB 2I25N 4OV6F 1U92A 4XNMB 4EUPG 5CUSL 2LE9A 1F2XK 2J5LB 4YFLF 5L9DH 4NSKB 4O2FA 3DV4B 3VU2A 5HYJA 1MPAL 1U8JA 3KS0J 4L8SB 5HGAA 4LLYB 3GBML 4C55A 5J1AA 4G8FA 4U31A 3H7BB 1ITBB 1RIVH 4MS8D 1XMWA 2AQ2A 3JTTB 1UACL 2VDQL 1NFDB 4YBLC 3GIVB 4HD9A 5TDOB 4KJQC 4XMLL 4POZD 4PJGA 1NANI 1NBYA 3V2AR 5IM7A 3WHXB 4X5XA 1EMTH 3LB6D 3G9VA 1XEDA 2VC2L 4QHUB 1AC0A 3VFNB 1U0QA 2EDKA 1KACB 3RJDA 3EOTH 2NX5D 5MEPA 1NMCB 3UYRL 1VEOA 1RK1A 1YC8A 2APTA 2P7TB 1GC1C 1Q9KA 4O58L 4M7LT 4GAJL 4EQ2A 2DQFA 3QJHA 1RZKC 4GKSA 1KEMH 3IDUA 5D1QA 2A1WL 3PF2A 2CLZA 4R96B 4MJ6B 5BS0A 2NY7L 2VXUH 4RGNE 4QTIH 4QXTA 4LIQH 4Z7NF 3QUMH 3L1OL 1OB1B 1I3RA 1MHCB 2RCSH 1QHPA 5JW4Q 3U4BL 1FFNB 4BH8B 5E6IA 4CVXB 5IBTL 2X05A 3RQ3A 5I6XC 4IRJC 3FRUA 3SJVE 4LLUB 3QUZB 4YBLB 3BWAA 3F58L 1MHEB 1JYVA 3VFMB 5LGJA 1QRND 1EDQA 1Z0NA 1NBVL 4JY4B 4LCWD 2YK1H 3IDIB 5EC2A 2P48B 2R56H 1B2WH 2BHUA 3SGJA 1MCFA 2Q3ZA 2YN5A 5SWSA 4XNQB 1BVLB 4OZHA 5DF0A 2IMNA 1I8IA 5IGXH 4OLXL 1NMBL 1DQQA 1KENH 4I0CC 3FQRA 4FABH 2YD7A 4TUKL 4N0YL 3UX9B 4LFHG 1AFVL 1TVBB 4YX2L 3ZHKA 1KNOB 1Z9LA 2Y1VA 3MR9A 4QRTA 4FFVD 1JUFA 1ORQB 3FQXA 5F8RC 3MCKA 1NGYA 4NPYB 4P5TC 3KYOA 4RQQB 4JY5L 4D9QD 4GW5A 4KJWD 4LQFH 3BI9X 3MJ9L 5IW1B 3GSWB 4Z78B 4P2QD 3G6AB 4KMTL 1LE9B 2OL3B 3E8UH 2BNQA 1Q1JH 4IRJB 2NY5C 5I6XB 2BRQA 5T1MB 4C54A 4JFDD 2YEZB 2ZG1A 2B5IC 5B22A 3OKKB 4MDIA 3UAJC 1RJLB 2V2WB 2AGJL 4PB0L 4I0KA 3CLEL 4OB5H 1EEQA 5IBLD 2EYTA 2X6MA 3L7FB 2YWZA 4PJCE 3GB7B 4LL9A 4JN1H 4YK4C 5D71L 1KJMA 3PWLA 1EFXA 4ORGA 1VFUA 1MCJA 1RZ8B 2OJEB 4NZRH 1A6WH 1OGTB 1JYWA 5DR5L 2OTWB 3FMGH 3B6SA 2A6IA 5EZJB 5CBAB 5CHNA 3IGAB 4JO4L 5HTSA 5CJ8A 4DOHB 4PD4K 2YKLH 4OCYH 2JIXB 3CAFA 4DK3A 1YYMH 2D7MA 1GVIA 1HH6B 4U1KB 1UWXK 5LGKA 5C0EB 4P5TB 1OSPL 1T1WB 3MRBB 2ZJSL 5KSBB 4KV5F 5IHUL 2RHEA 5IB2B 2SEBB 1X5LA 5FA4B 3MOBH 1I7UA 4QT5B 3KPSB 1B6DA 4RGOL 2FR4A 2Q86A 3BH8B 4LP5A 1W72A 3RWHA 1KN2L 2H1PH 5H35B 3UCRA 4DZ8A 2DM4A 4F7TA 1AD9B 4PJCF 3V4PH 2NY2C 2B5IB 3KPLA 3P4NA 3MV8B 4GRWB 2BC4A 5DHVA 4X6CE 4G6ML 3V4VL 4M8QA 4BQ9A 2BERA 3PWVB 3QEQD 2XI9A 1VA9A 4DVRH 5JR1L 4NNYA 2NY3C 5J06A 1N6UA 4KXZI 3O6FD 1NCWL 5DD5H 5C09E 4YK4B 2HKFL 4TQEL 1QA9A 3KPNB 2GW5A 5SWZD 4DK6A 3FT3A 4NZUH 4Y19A 5A1AA 5T1DL 4K94C 1R5IA 2WK2A 3OF6A 1AI1H 4U1HB 1H3XA 2CSPA 4G43B 4WFGD 1IAMA 4ZUWA 4QOKA 2HMIC 3AU1B 1OM3L 3BEWA 3G04B 3F7VB 3T77B 4FQCH 4UV4H 4M7KL 1CT8B 2DLFH 2CLRA 4J6RL 5ICXA 5TQ2H 3IDMB 1QBLL 3NCBB 4P3DB 4Z6AT 1AIFB 1HE7A 4LKXA 4MNQA 1A9EB 1R3LB 1QFPA 2X10A 3G5VA 3NFSL 3SKOA 4NJAL 2X40A 2QSCL 1UXSA 4L3EB 3UTOA 1I7TA 2NY2B 3L3DB 4MA3B 4I3RH 1TJIH 1NKOA 4Q9CA 5E2VL 3QRGL 4GAFB 4X7SL 2NY3B 4K8RH 1I85A 3O3AA 8FABB 5FYLD 3K4AA 2AI0L 4DCQB 3BVNB 5JOEA 3TJHC 4AL8H 4U1SB 1MREH 1YNTB 2BSSA 4PB9H 4GRLC 2O61A 3O2WH 1HYSD 1REIA 4KK9C 4XB8A 4G9FA 1U3HC 4Y2DD 1G0DA 3PHQB 4BKLB 5F93C 2EO1A 2VDNH 3MLTA 1OWRM 2ZPKH 1MUJB 4XCYA 3H9YA 1R24B 5GGSB 2C7UB 4LHJB 5HGHB 4XGZA 4MCZA 4RNRA 3L9RB 1I3GL 4L5FL 3SKUD 3LPFA 1NEZA 4JO3H 4HUNB 4QRSB 4GAGH 4ZFZA 2KDGA 4KUCF 4WW1B 1RHHB 1SMAA 5IF0B 3AROA 5HHOB 1IGJA 3FFCA 4MAYA 1YPZB 2VSDA 4HF5H 2ZUYA 5HHQA 5JTWA 3VJ6B 1ITCA 4UINL 1MAKA 1INQB 3WD5H 1X9QA 3RDTA 1AD0B 1C5CH 4AEEA 1SYSA 1FVEB 4YXLH 2BCKA 5IG7A 2NW2B 1NFDF 4LHUG 3QQ3A 2BSTB 1CIUA 4JFEA 1QSFD 5DK3A 3NCYS 2X1WL 2H2SD 4O2CB 1UWGH 5F3HA 1Q94A 3RVVC 3T0BA 3UBXG 3V8OA 4OI9A 4RMUA 1NCAL 3HAEG 1WTLA 4GRLB 1JZ8A 2AP2A 4JO2H 2NXZC 1U3HB 1CR9L 3V7MA 4N0FA 3OAUL 4PRHD 2AJVL 2EC9U 2GT9A 3QPXL 1W0VA 3RWGB 3GHEH 1DANT 1S7SA 1G7JB 4WY7H 1MVUB 4WDIA 2AXGA 1FZOB 3O6MH 2MKLC 5GS0D 3D9AH 3QDMD 1FG2B 1UZ8A 3O11A 4NGHH 4OV5B 2PN5A 4BQBA 3VI4F 1PKQB 2D7TH 2ZZUT 3HAEB 5CEYB 4JRXB 1RZ7H 3CSYA 3QWOB 2ORBL 4OF6A 4OIIL 2X89D 2E7LA 2XG5A 2XZAL 3P30H 1B9ZA 1U8QB 3V5HA 4NKQB 1KSRA 3BO8B 4I0PB 3L95A 3C6LD 2W65B 2E27H 2VL4A 4X9BA 5C70A 1P7QD 2ZSVB 4FZ8H 4M61B 3SGEI 4IIQC 4DN3H 2O5XH 4OLYL 4JRYA 5HI3C 3ARFC 5GGRB 1AP2A 4TTGA 2KBGA 4R7NB 5BRZD 4OD2B 5GS2D 5ALCL 2XY2A 4APQA 2NXZB 1D5XB 1BM3L 2VDMH 4R4FL 4E41D 1JPSH 5GISL 4I3SL 3H0TA 5KVFH 1KN4H 4P2OA 2YPLB 4ODVL 4QXUL 5DJ2B 5E7BA 4EDWH 4PPTA 2IGFH 3H8NA 4F7MA 4BSVB 4P23D 5IHZA 5TDPA 2X4OA 4DOHE 5DQDH 2GJZA 3QISA 4QHNB 5I1EL 2WWKT 1IAKA 2P45B 4LNRB 4WFEE 5CAYB 3VGEA 3CFDA 1J12A 1S7UA 3WJJC 4Q58C 2P5EA 2CJUH 4AH2A 1UCBH 3GJFB 4KU1A 5LAXB 4HPOH 5C08A 5KSBE 1F58L 4S1DD 5EU3B 1FAIH 3FT2B 3VFOA 3VW3H 4Z7UF 3KPSE 4R8WH 3QIBB 3T04D 1QNZH 3H9SA 4IIQB 1RUQL 4Z7QF 1QFWH 3GSRA 3MOQA 1IEBA 1ZK9A 4OFDA 5JQ6L 4X7TA 4KQ4H 2G5BB 5F7KC 4OFYD 5F7NC 2FL5A 2V9QA 2VISA 3WFEL 3ARDA 4G6AD 3MV8E 4GRWE 4PG9A 3CU7A 1Q0XH 3MFFA 3TNNA 5C0CB 3MRKA 1NCUA 4M5ZL 5FOBB 1KB9J 2FBJL 4LVOC 3MJ8B 4ALAL 2VQ1A 1DUYA 3SN6N 1JRHI 3TO2A 4XCFL 3FAXA 3NVQA 2DQCL 4OIAA 3V6BR 1MIML 3OJVC 5E8EA 2EDQA 5J6HB 1EEYB 3H9HB 2YR3A 2HWZL 4IJ3C 3EGSB 3EDKA 2AEPL 1CDIA 1QKZH 1TTGA 1IGML 3F12A 3TBVB 3RRQA 5KSBF 1U8OA 1ZLWH 4Z77A 2XWJB 4PP1C 3O45A 3GUTB 4S2SA 1YNLH 5DHVH 2YSSB 1MWAB 1TITA 3KPMB 5D9SB 1NGZA 4JHWH 5HYIA 1OT1A 1JIBA 3FB8A 2R29L 4UNTA 3TBTB 2K9UA 4L3EE 5TGBA 4J3UA 2R1YA 1F5WA 3VFRB 4DGIH 1MRFH 4FXKB 1KJVA 1JWUB 3WIIH 4F8QA 4LVOB 4PJBA 5DUBA 2Z91B 2BXYA 4WVRA 2OMNA 2VAAB 5BQ7A 4ZFFA 5JUEH 1S7QA 2FEEI 1RJZA 2YD3A 1IGFL 2FATH 3S9DB 5DVOA 5DFTA 2IALA 4IJ3B 4JGMA 5IFAH 5IB5A 4NNXA 1GC1L 3GZKA 1U8KA 1EFQA 5CSBA 1MIEL 7FABL 4Q0XH 1RZKL 5DJDA 3QUMB 1RZJH 4WU5B 1MCSA 5GGSY 3ZYZA 4JAMA 4OQTL 1IGTB 1QFOA 3JV4B 2AJZA 3ULSA 3GKZA 5EN2B 1FGVL 1CD9B 1YQVH 4FQ2L 1GL4B 2OL3L 4EVNA 3SE9L 3CD4A 3V6OA 5E2TH 3MLXH 1AGEA 1BQHG 5HHOE 4QRQB 3G5XA 3V0VA 2X9WA 1LILA 2GI7A 4CN4A 3AM8A 2J3SA 5DJCB 4S1SH 2V7HB 5AAMA 2F5AH 2W91A 4LLMB 3QDGB 1P4LA 3VGDA 1GCFA 1MHPH 2A0LD 2HJLB 3HPJB 3OKLB 3MLWL 3U1SH 5K9QI 1DANU 3MO1A 2E6PA 5DQ9B 1MF2L 2DTML 2B2XH 2NYYC 4NO0A 1ZWIB 5GRZA 5LGHH 1Q9OB 1CICA 4JFXB 2HTKC 2FYYB 5FEBA 1IC1A 3KLHC 4FQXD 1NC4B 1TVHA 1NDGA 1FNAA 1GZPB 1EVUA 3EJYD 5KG9A 1BEYH 5IFJB 2F19L 5JHDD 2EDOA 5A16A 4XX1E 1YN7B 3F62A 5KSAA 4NZJA 2YN3A 1RIHH 1YPZF 1I9JL 4XPBH 2QQKH 5EA0H 3P9LA 1CLZL 3MRDB 3BIBX 4PGZA 3D87B 5DC4B 4DGVH 3OAYH 4W68A 4WTWA 2VDKH 5DUPH 3CXDL 3OHXB 2NY5L 3TM6A 1UG9A 1FQ9C 5DVKA 4JRXE 3VXUD 4HIXL 5GRYA 3EDDA 1LDSA 4TSAL 3GHBL 3X14B 4PJIB 4FQPA 4N8CH 3JSSA 3QUXD 3HI5H 2GSGA 4L8DB 4YO0A 1UC6A 3V52L 3BKJL 5ERWB 3OKDA 4Q74A 5FAAA 4K2UH 1CF8L 5EU6B 2AABH 4PREB 3L3GB 5DJXB 5KVGH 3DVNA 3PWJA 4GT7A 1I1RA 5GGRY 3PGDA 1B0WA 1NL0H 3QXUA 4D0BB 3LKQB 4WFFE 5ESAA 1G9EA 3VMNA 3TN0A 4EIGB 4D2NA 1EGJA 4HWBA 1S7TA 1YEIL 3MFGB 1XGPB 4OGYL 3MLRL 5DZOA 4JR9H 2YPLE 1OAKH 1NCCL 3MRPA 3NGBC 1BVKA 4OTXL 3AMLA 1VENA 5A3ID 5DYOA 2VABB 3KLSA 2DQTH 2HT4D 3L3KA 2WLYA 3B9EA 5KVEL 4X80L 1JGVH 1DTUA 2JELH 2D2OA 4ZXBC 1CTOA 3C8HA 2VDPL 3O2VH 3GKWL 5I1LA 4PD4J 3NCCB 4NUJA 4K8RC 3RZCD 2VJXA 1A7OL 5FYJU 5DK2A 2X09A 2QHRL 3SE3A 4UILL 5DC9B 4DAGL 1HZHL 4Q7DA 4TOYL 4C56B 4RFOH 1ZANH 3DARA 1RZIA 3C9NB 1A0QH 3DVGB 5EUKB 1JK8A 4I4WB 4HBQA 4ESKA 4OF0A 3DMMC 1U3ZA 4D3CL 5DMIL 3VMPA 1U8HA 1K8DB 3X12B 3PWNA 2OTUB 1FE8L 5C07D 4PJ8D 3N85H 4K94L 4O51B 1LEKB 2IAND 1F3RB 4R97C 5C0CE 3VXTA 2ADFH 1FJ1A 4LLDA 4OZGB 3P77B 2MQ3A 4X6FA 1FFOA 2X4SB 1FYTA 3K81A 4HFWA 2LQRA 3TYFB 4Z76B 4TULL 2PXYA 3D0LA 4P49A 3T08A 4MQTB 4XPTL 3NGBB 4KTDL 4ZD3L 3QFDB 1KPRB 1ZT4A 5CSZB 1A7BA 1IZKA 3C8DA 1HWHB 5GSVB 4LKCA 1U36A 5IOPB 5F9JA 4ZXBB 1N64L 2VH5L 3O0RL 4Z7WA 4E5XA 2C3WA 2XPGB 2WUCH 5MEND 1FC2D 2ICWB 4L8CB 3REVB 4ODBD 2MHAB 5CZVH 1P84K 5E8NA 1DFBH 3ALXA 1ZVYA 5IVXA 1A7NL 5HYEA 4NO3B 2D0GA 4NZDA 2FDBP 4H88H 4HUXB 1MFCL 3DMMB 4AIZA 1ZGLB 3QQNA 5D1QC 3GMOA 3MYZA 2PTUA 4YJZL 3ZDXE 4YAQA 1U92B 4L9LA 4D94A 4JG1H 1HHHB 1KC5L 4R97B 1V7MH 2E8YA 4GQ9L 4BZ2H 3DOSA 4R9HA 5HGAB 4MSWA 5FO7B 3D0VB 1E28A 1OAUH 5E6IC 1YEDA 4GMSH 3RL1A 3EYFB 1JV5A 5GSRB 2NY6C 2ZG3A 1BOGA 3V8CA 2VLLA 3THMH 4ELKA 2HFGH 3ZSSA 4U1LA 5IM7B 3AXLA 2XWTA 3SGJC 3GM0A 4X5XB 3RTQD 2HJFA 4MX7A 4EZMA 1MI5B 4M43H 2AJ3A 4YE4L 2DIBA 2Y06L 3QHFL 5D7JD 5CEZD 1A9BA 4B53A 4G6KL 5MEPB 3UJTL 3QUYA 2EECA 3CFJA 4KI5D 1RK1B 4NZTL 3VFTA 2CXKA 1XGRA 3QNZB 4UQ3A 4F7EB 3MODL 2W0FB 5F89A 1DL7L 1T4KA 3QJHB 3PHSA 5D1QB 4AK1A 4JE4B 5FO9B 1AO7A 4CNIA 3V0AC 5JW4N 5CZKA 4MA8L 1HHGA 2IFGA 4CN1A 2FECI 3QDGE 3O41A 1NAKH 3C5ZA 3B2UC 3BJ91 4XVSL 4QO1A 3LHPH 3L7EA 5BVJB 2K7PA 5E6IB 1OW0A 4NN5C 3FRUB 4JZNA 3RUGA 3DJ9A 2NY6B 2R2EA 4UOJA 5LGJB 2JK5A 1CLYH 2F5BH 2EIDA 2B39A 2D3VA 4ZOAA 1IEAA 3S8WA 5SWSB 4J3WA 1LWRA 2FSEA 4GG6F 1A6AA 4FQQA 3MA7A 2EIBA 1PKOA 3I6KA 4WV1A 5AAWA 4MCYB 4YPGA 5ICZA 1DSFL 1DQQB 3HKFA 2BVTA 1TLKA 5I73C 1C8PA 4RMRA 1QSEA 4MJ4A 3TA3C 1J05A 3EYUL 3VWJC 5KW9L 2AERT 1BAFH 4LCCA 5MI0C 5FYKD 4XXCA 1QLRB 2UWEF 4FFZH 3RAJH 5DVLA 3MR9B 4LAJH 4QRTB 3AGVA 5IEKA 5GZNC 4LK4A 2J8UA 4J2XA 4PJIE 1A6ZA 4X0KA 3KYOB 2FCBA 1J1PH 4URTB 4GW5B 4CMHC 4DQOL 4M48H 4ONHA 1D9KA 1F90H 3CXHK 4KJPD 1FLRL 4XBGA 5EU6E 5EU5A 4NQCA 2NY1C 4NNPL 4NN5B 1I8MB 1WBZA 4U33A 1BQUA 1UA6H 1JTTA 4LF3A 1QYGH 3RU8H 3SGKC 5CJQH 1R3IH 3HE7C 4MDIB 1FL5A 2CIIA 3T0WA 1OAXH 5L9DL 1INDH 2O5YH 2XYCA 1T66D 1MCCA 4JFHD 3TH3T 1MWAL 3VH8A 3DI2B 4PJDA 3IXTA 5I8CB 5IESH 5EZIH 1KV3A 1RIVL 3DBXB 1RHFA 3UC0H 5I73B 1NSNH 1TCRA 4KRMB 1U58A 5T5NG 1K3ZA 4IMLB 3TA3B 1AKJA 5F7DA 2A6IB 3VWJB 1VHPA 5CHNB 5MI0B 9CGTA 3AS2A 3MV11 4K23H 1BZ7A 3T1WA 4EI6B 1EMTL 4DN4H 2DYPA 2GJ6D 1FBIH 2MOVA 3WKMH 4XTRD 3ZT7A 3DUUA 4HWBH 3Q6GH 4PJXF 4C56E 5EUOA 4CMHB 1I7UB 3ZTJG 3LRHA 1CE1H 2GCYA 2UUDH 2YRLA 2Q86B 4BFIB 3DO7A 3IFOB 2NY1B 1G7HB 3WIFB 5HD8C 4DZ8B 5C0AD 1OF2B 1KEML 3KPLB 3P4NB 3ARGC 3HE7B 2BC4B 5J6GA 5BMFL 2VXUL 4U3HA 3C5JA 4QTIL 2ZCHH 4OZGE 5FM5O 4NNYB 3OQ3B 3QUML 1I85C 3SGDH 1UZ6E 5BV7H 2RCSL 3PP4L 4HBCL 1UH3A 4HWNA 3FT3B 4NHUA 5ISZB 3DUSB 1FLTX 5I74C 4MWFA 1R5IB 5I1GL 4OM1H 5CP7A 1PY9A 3TCXA 4QOKB 3GIZH 1Y6MR 1HINL 3TZVD 2VTFA 1VEMA 2R56L 1B2WL 3AC0A 3H6JA 1N7MH 2FJGB 1GIGH 4V2BA 1ULVA 1IZJA 3TVMD 4UT7H 2CLRB 5IGXL 4MA1C 2Q8BL 1PW3A 4Q9BA 4G8IA 4PRDA 5BCAA 1G9NL 1UQSA 3ULVH 3WN5A 4X7CC 3DXAD 5DK0B 3WDIA 3V4UH 3G5VB 5C7XL 5ENWA 4MAYC 1LEIA 1E4WL 3SKOB 5D2LF 3PABA 4KPHH 4Y1AA 4W70A 4P9ML 2AV1B 3O4LA 3SCMD 3ZKND 3ARGB 4L1DA 1MJ8H 4PG2A 4PJ7F 4PUBH 3OZ9L 4Q2ZB 2CH8A 1BBDH 2E7MA 4MB4A 4YXHH 1I8KB 2QV2A 4GAYB 4LQFL 3O3AB 4LEXL 4NKIH 2DMKA 1L0QA 1OGAB 3E8UL 5DVMA 5I2IA 1Q1JL 2PUQT 4HIIA 5BZWB 4AQOA 5I74B 2BSSB 3CFBB 2YUZA 1GGUA 4BZ1H 3K1KC 2FH6A 3OKYA 4KC3B 4OB5L 3MLTB 5C0GB 3HZVA 3ROLA 2KUTA 4A2LA 1IKFL 1BJMA 1MI5E 3CPLB 4NKMB 1M7XA 4JN1L 4RNRB 4YHYC 1UB5B 4MA1B 4EJ1C 4NZRL 1A6WL 1NEZB 3EUUA 5EFIB 1DN0A 4N8VB 4ZFZB 5HI4C 1P4BH 4M62L 3FMGL 1RULH 2PETA 5DI8A 3NIGE 1IGJB 3FFCB 2P5WD 4MJIA 5TDNA 5CGYC 3QXTA 5HHQB 2YKLL 2DQDH 4OCYL 3TCLA 2B0SH 3QP3A 3SY0A 1KIRA 1YYML 3B5HA 3U83A 1SYSB 5F70A 5DJZA 3CUPA 4CJ1A 3QPQD 3VXRA 2GY5A 4PJGF 5DO2D 3MOBL 3JV0A 5GGTA 1TZIA 4N9GA 1Q94B 4GS7C 1G7QA 2H1PL 1OD7A 1GOGA 3V4PL 4XP6H 4FQHA 4APQC 1MH5A 1SM3H 4N0FB 3MLZH 3WUWA 1KPUA 5E1AA 4IHOB 5SWSE 1CXKA 1W0VB 5FOJA 4DVRL 5MEQA 4Q9QL 5L2KD 5C8JA 4OZIB 3NIGF 5D1XC 5DD5L 3C2SA 2NZ9C 2KL6A 4YHYB 1FNEA 3W11D 4GXVH 5D7IB 1TENA 4NZUL 2WINA 1UZ8B 4P46A 1FNHA 3O11B 3BE1L 3A67L 5CD5C 4KVCH 4YNYA 1AI1L 1UM4H 4NRZA 4R4BA 5FYJH 5BZDA 3WUZA 3BP5B 3V5DB 1YEJH 2ID5A 3QA3A 3VWKC 5JMOC 1WIPA 3CSYB 1S3KH 4J4PC 1CFTA 1IM9A 3QRFM 4FQCL 2FX7H 5HDBF 4UQ2A 2DLFL 2FGWH 2GITA 2ZUWA 3V5HB 3HMWH 1ETZB 1QFUH 3L95B 5EH1A 4XBEH 1ZXQA 1ZHKB 2V5MA 1WBYB 3JUZA 5I8OL 4NC0B 1TJHH 3W2DH 5IV2B 4GS7B 4OZHF 1AP2B 4V1DA 3TWCH 3ARDC 3OXSB 1AHWA 1G9ML 1DLFH 3UTSB 4APQB 2F8XC 4I3RL 3OX8B 1TJIL 4M9OA 4OF8A 3WXVH 4LASH 3OAZH 3H0TB 4K8RL 1KELH 1NC2D 4YZFE 5JDSA 4P4RB 5D1XB 3RVUD 4JFZH 4GRMA 3V7AE 1TZHA 1IM3A 4HUVB 4YWGL 4U6HA 3RGVA 4F7MB 3KJ4C 5TDPB 4PB9L 4OM0H 5DDHA 3HG1B 1AH1A 1X3DA 5AZ2H 1HI6A 1IAKB 2KKQA 3C08L 2VDNL 4LARH 3CFDB 2ZPKL 3VWKB 1S7UB 4I77H 5IMKB 1AGDA 2DRUA 2P5EB 1RFDH 1CGSH 5INCA 1S9YB 2CLVA 3BKYH 4GAGL 3VFOB 5C0IA 3H9SB 1BJ1H 4LEOB 3EJZC 1QR4A 2OR7A 4X9FA 4P2RA 4X7TB 5AZEH 1Z9MA 5CEXA 3ARDB 4JN2A 4YZFF 1RUPL 4WHYG 2N7BA 4PG9B 1KCRH 3MFFB 3TNNB 1C5CL 2AJXH 3BMWA 2FD6H 1P5UA 2H6PB 3P0YL 2A83A 1AGBB 5KVDL 1LVEA 3BQUA 4B5EA 1N2RA 3UPCA 4AQ1B 5AYUH 2YC1B 1MEXH 3T4AA 1UWGL 3GK8H 5ISZE 3ZE1E 1ZT7A 3KJ4B 3BD4A 2K1MA 5EC1A 4IS6B 1JNLH 5C9JA 3EFFB 3BDYH 4JO2L 4QOKE 1HSAB 2W92A 3F12B 4MD0A 4S1QH 3RHWF 1U8OB 3KLDA 2BVOA 4K55A 5ID1B 4G3YL 3STLB 4ODXA 3GHEL 5EBLB 3C60D 4YFEA 4WY7L 5T5NF 1KF9B 3O6ML 3PWUA 2NY0D 3D9AL 1I7RA 1N5YH 4Q97A 4U7KA 4YHNB 1VFBB 2DBLH 3FB8B 4GKOA 5F9AC 1HILA 3EO9H 3AM8C 2D7TL 1U8IA 4XI5D 2IQAA 1YEEH 4MJ2A 5TGBB 3RWFA 2X41A 1KXVC 1RZ7L 1BPVA 1BHGA 3LKNA 5T1LD 2OS7A 1IAOB 3P30L 4EI5A 4PJBB 4JPIA 2E27L 5BQ7B 1E6JH 5BVPL 4ZSOA 4P4KC 1JNHA 1OGAE 1S7QB 5JPNB 2PW1A 4DN3L 1CICC 4O9HH 2O5XL 4XZUA 4RAUA 3HI1B 5CZXD 4R2GC 4PY7A 3TNMA 4S10A 1LO2L 5E70A 5DZNA 1G7PA 5E5UB 3ZKXC 1JPSL 2FBOJ 5D70L 4JAMB 3JVGA 3E6HA 5T1KB 2XZQL 2IQ9H 5KVFL 2BDNL 5KSAC 2AJZB 3ULSB 4KK6D 1TXKA 2IGFL 2KQMA 1EHLL 4QRPA 1AGEB 3FFCE 3V0VB 4D0DA 3TFKD 1QD0A 1NGWA 1DP0A 5DQDL 2PO6A 4P59L 4ZDHA 3T2OA 4PLKD 3GJFK 5LVEA 3L3IB 3QT2A 4K3JH 3PWPA 3I02A 4CKVX 4ZO7A 2CJUL 5DMGC 1DE4B 2CRIA 1YMMA 2V5SA 3MV9A 1UCBL 3DURA 3CU1A 1G84A 1GZQA 1FAIL 6CGTA 2QKIA 3VW3L 3HE6A 4P4KB 3SDAA 3MO1B 4X6BA 1JL8A 4FMKA 1MELA 4NO0B 4NQVB 5EBMB 5DJ0A 1QFWL 3D85D 4LMQI 5D5ME 1CICB 1XIWD 4LU5H 1OAYL 4R2GB 3BIAX 1Q0XL 4HK3J 1QQDA 2CR3A 3LN9A 3STBA 4OZIE 1WZ1L 1KCUH 5A16B 5DS8A 3FO0H 4R26H 5KSAB 4O02H 5IMLA 1CN4A 3LEYL 5D7IE 3P9LB 5C0NC 2H26A 3MNWA 1T1ZB 2LVEA 5F9OH 3W0WA 1IAIH 2NTFB 3KXFA 5GGTH 1QKZL 3HFML 2DKMA 1H15B 3MRJB 4M3KB 4QRRA 2GFBA 3JBG7 3U7WH 5GHWH 2D7PA 5BV7C 1YNLL 1KCLA 3SE3C 4JM2C 2GSGB 1OY3B 3QXAA 5EO1B 1I1AB 1HCFX 4JHWL 4AMKH 4NQEA 4OLVL 2UZIL 1BZQK 3ZMRA 1N0LA 5FECA 4OZFA 1EBPA 3L5WB 3PWJB 5D7KE 3CXHJ 4ZOCA 3PGDB 2BVYA 1U8MA 3FQUA 5ESAB 2MPAH 4UU9A 3UTSE 1JPFB 4BUHA 4XPFH 4DGIL 5DURD 3EDJA 3MBEC 4L1HA 1MRFL 3WIIL 5K59F 3KYMB 3SE8H 3TLRA 3TYGH 3ULVC 5I1JH 3RKPA 4FP8L 3IU3A 4M1DH 4MB3A 3MRPB 4PTUB 2Q76A 4EOWL 3QIWA 1VKXA 1PZUB 3RIFF 4NT6B 2MQCA 4M1GH 5JNYA 1RAMA 3QWRA 3VXSD 1TPXC 5IFAL 3HG1E 4QCIA 1WCBB 4KXZH 4G8EB 3GSXB 5DGQA 4Q0XL 5I1LB 4NUJB 3UTTD 1Q9LA 4JPWH 5BV7B 1L6XA 1HYRC 1KEGH 5DK2B 4WO4D 4WEBL 4L4VA 2P5EE 3MOAH 4YH6A 3EFDH 2XTJC 4JM2B 3L3HB 5JOFA 1U8NB 3FT4A 3P2TA 4XMKH 1JK8B 2ITCA 3H9SE 4YBQD 1UH4A 4GW4B 2V7NB 3MLXL 1U8HB 1L6ZA 3MLSL 3EYOA 3KLAA 5C71A 2DDQH 1UWXH 2H3NA 4L9LC 4S1SL 1R0AH 1RZFL 2GAZA 2DIJA 1PSKH 1FJ1B 3QG7H 4LLDB 2F5AL 3MBEB 3T8XA 5I8KH 4L9DA 1FFOB 1TQCB 3UJIH 1MHPL 4HFWB 4XHJC 1RI8A 1SJXA 5FHBL 3D0LB 4J7RA 1VESA 4WUUD 3U1SL 2EIZA 3RGHA 2E9IA 5LGHL 2HAZA 3D25B 2F8VA 1ZT4B 3AMKA 3KYNB 43C9B 4ZPVA 3O6LL 2ESVD 2YD6A 4FTVA 1TPXB 3FOLB 3VG9C 4S1RH 4U2YA 5D1ZA 3B8YA 3MRRA 4NO5A 2Q6WB 5F9JB 2GTWA 1OVZA 1Q0YH 4E5XB 4Z7WB 5C09D 5F3BB 1BEYL 3U36A 4ZFGH 3LH2L 2XTJB 5E8NB 1RIHL 2ED9A 1IC5L 5IP4A 1H0DA 1R5VA 2QQKL 4XPBL 5SX4I 3BP4A 2YA2A 5IT2H 5JOPE 3P4OB 3U9UA 4EBQH 2VDKL 5DUPL 4AIZB 1AXTH 1MLBB 3D69B 4YBHA 4MA7H 4L9LB 1T5XA 3BZFA 4NP4H 4X7FC 1L7TL 3ARED 4DKFL 2L0DA 3FB5B 3HNTH 4UNUA 3PNWA 1MCBA 4N8CL 3GFUA 3RL2B 3HI5L 2JJSA 4PJBE 3Q6FA 3MNZB 4QGTA 2C1PA 3BUYB 3C6SA 4YPJA 1QHOA 1P7KA 1E28B 4GXUM 3VGHA 5F96H 1YEDB 4K2UL 4PGDA 2BY1A 3CDCA 2D31A 4TTDC 4YR6A 4XNZC 2HLFD 2XRAH 5KVGL 1BOGB 3FOMB 5EU4A 1GYAA 3UZQA 3SEPA 4FFYH 4B0MM 1CXIA 3VG9B 3S88H 4XNUH 4GG8B 5IIEA 4ISVA 1N59A 2BNRB 2HJFB 4MX7B 2CUHA 3NA9L 1EH9A 1X5AA 3LRGA 1A1NB 2NR6D 2Y6SD 1WCQA 1DVFA 3ALWA 5DT1L 2GSIA 4JR9L 5LCVH 1XGRB 2V2TA 4ZUSB 1Z3GL 2X1XR 3DHJA 4XXCC 2DQTL 5F89B 1GHFH 3F7YA 1T4KB 3I9GH 1CFNA 2ICCA 3EYQD 5K93A 3LQZA 2OX5A 1ZLUK 2JELL 2IJ0C 4PJBF 4BQ8A 1FZKA 4MXVE 3ZKMD 1AO7B 5ELIA 4PRNA 1MOEA 4UIKH 2WIIA 1WFUA 3PP3K 2ZUUA 5C6TH 4HH9B 1KIUA 1NBZB 3O41B 4NDMB 1A5FH 1D9KC 5CIPA 4M5YH 2LABA 5A2LH 4HS3A 4OKVA 4PRPD 1LGVA 1RIUH 2HYMA 3QEQA 4JZNB 3RUGB 1GJIA 4XNZB 4ZS6C 4DZBA 2BVUA 4DW2H 2R2EB 4F8TA 3N85L 5SWZA 3RZWA 2YRPA 2X4UA 3NH7H 4ODUA 5I15H 2Y72A 5FB8A 5J3HC 2ADFL 2XXMB 4WWKA 1JNNH 1J18A 2AEQH 4FQQB 3MA7B 1X5FA 4M6MH 3D5OF 4R90H 4N90D 3FCTB 4YPGB 1WEJL 2VN4A 2JJVA 4WUKH 3CLFH 3SDDA 1P6FA 2GTZA 4BSWA 3D48R 3IXAB 1J05B 3WNNA 3OKNB 2Z31C 4PJAA 1FN4A 1W2KT 2O26U 4BUGA 2XXCB 5DEFA 4LDLB 1FYHB 4WGVB 2J8UB 2X42A 2WUCL 1LO0L 2Z35A 3OXRA 2BSRA 3QXDA 5CZVL 4ONHB 12E8H 1D5ZB 1DFBL 4A2MA 4KJYA 4JZJA 3HHRB 1MRCH 4XBGB 4QTHA 4M8VA 4H88L 3DSNA 1X4YA 2YUXA 4PRBB 4YLQT 2P24A 1FL5B 3NZ8A 5D6DA 2CIIB 1M71A 1S7WA 1I4FB 4OFVA 1V7ML 4M93C 2A73B 4CBPA 4XVUC 3ZKSD 5J13C 2VKXA 4KQ3H 1QACA 1KGCD 3VH8B 5HYSB 3HI6H 5D72L 3NTCH 1UFUA 3L3OB 2CIKA 4GMSL 2YPVL 3FHQA 5F7DB 4LFHD 4OZFH 4JLRA 2Z31B 3ARZA 2HFGL 4WNQA 2J8HA 3DRTA 1JRHH 1KIPA 3D39D 1BZ7B 5GRVL 4WRLA 5GZOC 3U4EA 2DYPB 3U9PH 5FV1L 1DEEB 4W6YB 3VA6A 4M43L 3CFIC 2CKBB 3B9KD 4WFHD 1HDMB 4ONGH 3UJJH 5EUOB 3ZE0F 4ONFH 4MXQC 3Q48A 4MMZC 2OMBA 3EYSH 1OTTC 3DO7B 5TE7H 1V8HA 3G6JA 2Y9RT 4LNVA 3KPRB 4F15C 1D7FA 4EN3A 4HV8A 3L5HA 3CSBA 3U0WH 4E42B 3C2AH 4PG2C 5J6GB 5FGBC 1X5KA 3UO1H 4K3DH 1IC7H 4QHLB 4M4RA 4P5TD 4ZAKA 5T3XH 2X4PB 1OAQH 4L3AA 4M93B 4U7SA 3ILQC 5FKAA 4D8PA 5BW7A 2QBWA 2ZUXA 5J13B 1PG7X 3O6KH 4P5MA 1NAKL 5ESVB 3LHPL 1RZGB 2W07A 5J89A 4NHUB 3LSOA 1YY8B 3MXWH 4M3JA 1EK3A 4CAGA 5GJTH 1D5IL 5DRZB 5BO1H 3LS5H 3AS3A 3N1PC 5CP7B 4KDTA 3KDMA 1HHKA 1VFMA 3NFPA 4UT6H 1T5WA 1PX3A 2D7QA 5J8OA 2XN9D 4YDVA 2EDDA 4Z7WE 2F54D 4YDKH 2XTJE 4L4TD 1F97A 4PRDB 3UZEA 1CDCA 1UQSB 3HNVH 1U8PA 1FC1A 1EIBA 1BAFL 4HCRL 1KXQE 4HXBL 5ENWB 2DMCA 4FFZL 3BYTA 1NMAH 3RAJL 1UACH 3PABB 3EKCA 3S5LG 4QWWD 4F15B 3FO9A 4PJ9B 3ARXA 3O4LB 1P7QA 3ULVF 3ROOA 1YY9C 1VGEL 4YEEA 4BA8A 2HA1A 4KDWA 3RI5K 3MUGA 1J1PL 3IETA 2VERN 5TE6H 4M48L 4HPYL 1P2CA 2H32A 2DKSA 3P73B 1R3JA 2QSVA 1GXEA 1UA6L 3UYRH 4JRWA 4F7CA 3FONB 1RURH 5E8PB 3RU8L 3MROA 2NY2D 4Y5YC 3D18A 4Y7MA 5CJQL 1R3IL 4KMQA 3RWJB 2XZZA 1INDL 2BNRE 3ROLB 1DQLL 5IVXF 4P23A 1C7SA 3HS0A 2A1WH 1P1ZA 3KHOA 4RX4A 5IESL 1S7VA 5EZIL 1TQBC 1DN0B 3FHAA 4PRID 4C57C 3UC0L 1NSNL 2AJYH 5DI8B 5IJKC 2QLVB 5C0DA 4MJIB 3V5KB 2HMID 4TVPD 4K23L 4AT6B 1EV2E 2EXYD 3NZHL 3F58H 1AO7E 4DN4L 3RHWK 3T0EC 3TCLB 3EYVB 1FBIL 3S98A 3BN3B 3MLUH 4HWBL 2FEDC 5DJZB 5F1IB 4EIZC 4NQDD 1JN6B 5HGBB 4XBPB 5F6IC 1ZLWK 4RWHA 1CE1L 1UT9A 5FFLA 2A9MH 5HHOD 3RUGE 4N9GB 2JTDA 1NMBH 5FYJE 2P8LA 1X5JA 4QY8A 1AHWC 4LPTA 4Y5YB 3LEXB 1AFVH 2OBGA 1JTOA 4IMKA 4Y5VC 3WUWB 4YX2H 1KG0A 2VWEE 1FNLA 4RMWA 4GOSA 4LLVA 5E1AB 3V0WL 4NOFA 1T0MA 5IQ9B 5C8JB 5BV7L 5IB4A 2HKHH 3CC5A 4TNVF 2MCG1 43CAB 1XGTB 1TQBB 4KROD 5CIPH 3RGVC 3MYJA 4YNYB 1DLHA 3VMOA 3MUZ1 4OM1L 3N50A 1J8HD 4KUZH 4R4BB 3QNYB 3JV6A 3GIZL 4OT1H 1RMFH 3MRHB 3U4AA 1YA5A 1E6OL 1F11B 3BPOC 1N7ML 5FF6A 3T0EB 4JY6A 2NQCA 1CFTB 1GIGL 2J8UE 3RWIA 1W0WA 2F15A 5ICYB 2AGJH 4PB0H 2GITB 4UT7L 4XNMA 3CLEH 4LHUD 4N68A 4NSKA 3CNKA 3MLYL 3DV4A 5B4MD 4FZEH 4Y16A 1TNMA 4IOSD 3ULVL 5F6IB 2XWBA 4LLYA 5ADPH 1UH2A 5DR5H 1WZMA 3JTTA 4V1DB 2EDWA 3PQYD 4KPHL 5JXEC 4TNWF 2FO4B 5KSVB 3GIVA 4HWEH 5TDOA 1HNFA 1AHWB 3CK0L 4P3CL 5F7YC 1J10A 4PJEA 4PUBL 4Y5VB 1BBDL 3LAFA 1NAMA 4YXHL 3DSFH 3S35L 3D3VD 3WHXA 1CFVH 4ZQKB 4CMMA 5JDSB 4NKIL 4QHUA 4GRMB 3VFNA 1TZHB 4TN9A 4U6HB 1CGWA 3RGVB 3RVVD 4L29B 5F7HA 2R0WH 4CN6A 3QDJD 2JB5H 3O4OC 2J8UF 1AR1D 5DDHB 4BZ1L 1FO0B 2ZUQC 2I27N 1HI6B 1RU9H 3TT1H 1KN2H 5FYLH 3VXMD 2F9BT 1T1YB 4LSQH 3VRIA 3ZDZE 2A77H 5E7FA 5KZCB 1AGDB 3VRJA 2CRYA 4G6MH 4PJHB 5EORL 1ACYH 5EUOE 5E6YA 4LPYA 1P4BL 2APBA 1NCWH 1RULL 1GH7A 5E5MA 1FFNA 4BH8A 1NLDH 4CVXA 1IQWH 1CG9B 1BWWA 3KPRE 1XGYL 4LLUA 3QUZA 5T1DH 2VLJA 2DQDL 3BESR 4H0HB 4PJDF 3H3KA 1C12A 2B0SL 3VFMA 4W4NA 4JY4A 3O9WA 5C6PB 3CH1B 3OAYK 2ENYA 3BZ4B 4XNQA 1BVLA 4JPKL 2I24N 3NCMA 1QBLH 5I9QB 1T2XA 2OXHA 2PKDA 3QUKA 3ARFD 5EC1B 4HLJA 2G9HB 1FCGA 5C9JB 3O4OB 4XP6L 3CFKA 1F3JA 1TVBA 2ZUQB 3MLZL 1N0XH 1ERNA 2BVOB 1KNOA 2QSCH 1EEZB 4PYGA 4ODXB 3SKMA 4M4PA 1ORQA 4OQTA 1E4XL 1S78C 4RQQA 3PWUB 5I75C 5IW1A 3GSWA 4HAFA 4KVCL 3RIFK 3H42H 3WXWL 2WBJD 2KQNA 2D7NA 1UM4L 2OL3A 5HI5D 1ZE3C 2PO6C 5FYJL 1BMGA 35C8H 4IRJA 4GQPH 4LVNC 3O4LE 4FMFA 5T1MA 1ZMYA 1S3KL 4R0LC 3LKNB 5GS0H 2FGWL 5GGVH 3HMWL 1QFUL 4XBEL 1GGYA 5EU7C 5FGCB 4ZSOB 3HE6C 2AK4D 3GB7A 1JNHB 3SDAC 3BJLA 5E9DB 1I3GH 1TJHL 1OT2A 2E8ZA 3W2DL 1W8OA 4XZUB 2WP3T 4AG4H 2OTWA 3FFDA 4RAUB 4JVWA 1G1YA 3TWCL 1BD2E 5B21A 5MHSE 4J3TA 5EZJA 4LSVH 1DLFL 4IEFB 3VFWB 5CBAA 4JFFD 3OJ2C 4MLSA 2F8OA 3A6OA 4YHZH 3WXVL 4LASL 2Y5EA 5DJAB 5D7LD 2JIXA 4UINH 1KELL 1HH6A 3HR5B 2HN7A 4JFZL 2H2PC 2XG4A 4E9LA 5C0EA 1T1WA 4OCWH 3KPQB 2GEEA 5I75B 3MRBA 5GS2H 4U0RC 5IB2A 1U3YA 4EDXB 3H3PL 2H32H 4QRPB 2SEBA 5EIQA 5FO8B 4KHXH 4OM0L 3WJLA 1EHNA 4QT5A 1CE6B 1LD9A 3KPSA 1BF2A 4D0DB 4MJIE 1NGWB 2BY0A 5AZ2L 2PO6B 2XKSA 3DROB 2XKNB 4LVNB 4CW1A 4LARL 4PP1D 3N9GH 3QEHB 1AD9A 3VDBA 4R0LB 3ARBD 4I77L 5ANMB 1J8KA 2RIKA 4HC1A 4XC1L 1CGSL 3OAUH 4XPAH 3MV9B 3WLBB 3DURB 5L0QC 2EE9A 2AJVH 3PWVA 4PJ8A 4XCEA 3U46B 15C8H 4HW6A 2IANA 3BKYL 2QKIB 2C26A 3HE6B 1D5BA 1SJEB 3QHZL 5FYKU 3KPNA 2X7LB 4PP2B 5AZEL 1E27A 4JKKA 4MS8C 5ADOH 1G6RH 2Y23A 2AJSH 2A6DA 4U1HA 1MCPH 1QQDB 2AJXL 3LKRA 3OB8A 4GKNB 3AU1A 5MERA 5GIRA 4FQIH 3RVXD 3G04A 1UADC 3F7VA 2CKBL 4OUUA 2ORBH 3ARSA 2ZNXA 5DS8B 3IT8D 2Z4QA 3T77A 4HH8A 3LB6C 4Y4FD 2DF3A 4OZFG 3GMNA 5AYUL 1MEXL 1CT8A 1CK0H 2VUYA 3GK8L 4XVTH 3MNWB 1J0ZA 3IDMA 4U0RB 3KXFB 2VXQH 1AIFA 1F6AB 3W0WB 1JPGA 2D9QB 1A9EA 1WAAE 1JNLL 5IVOA 3CX5J 3LD8C 1OTSC 5ETUA 1FNGB 4ENED 4QRRB 4S1QL 4OLYH 3ZDYF 4DUWA 3INUH 1NUGA 3BXNA 1XF4A 2ICWJ 4PGEB 3T0EE 4L3EA 4BK5A 3P9MB 5KAQG 4X9GA 3L3DA 3TGXA 1H9VA 2HFEA 5BOPA 1VB9A 3F7QA 4Z0XB 5L0QB 2HTLD 3QQ4A 4YGVB 1UB6B 1N5YL 5GRVK 4NQEB 5F7EL 5BJTB 2C3HA 3EIFA 5FECB 4OZFB 8FABA 1FIEA 5CD3A 2IAMD 4H5SB 4M02A 3K4ZA 1WBXA 4EKXA 4LVEA 3UP1A 4ACPA 4QXUH 3OGCA 3EO9L 4V1DE 1U8MB 2AVGA 3FQUB 3LVEA 4DCQA 3BVNA 3W5NA 4UU9B 4U1SA 2FIKA 5K33A 5B3JE 4XCCH 4M6NH 5ITBH 2OR9H 4BKLA 3V6FB 1NGQL 3LMJH 1XCTA 1E6JL 1R24A 2C7UA 2Q76B 2NYYD 1NUNB 5D7JA 4PY8I 4WW1A 5DQJA 4ZMAT 3PUCA 2NX5B 4AEHH 1RUQH 2VDLL 3LD8B 4HMDA 4QRUA 4HX1A 5IR1A 5JPMB 1YZZA 1JNJA 5DLMH 4L4VB 2N7AA 3VJ6A 1INQA 4JANA 4JQIL 4PJHE 1AD0A 2AQ3A 3FT4B 1NAMH 2UY7A 4I1NB 2DI9A 3TH2T 2EDFA 5CWSA 1MCQA 2NW2A 4RFEB 3V6ZB 2BSTA 2ICEA 3IJYB 5B3JF 5IHLB 4JM4L 4KJWC 3EYOB 3KLAB 4HFUL 2HWZH 4LLQB 1KPVA 4K3JL 4GRLA 1IGMH 3HZKA 1L9MA 3T8XB 4JFOB 1QRNB 4XVJH 4FOMA 3ESVF 4LCWB 4X5WB 3T3MF 1VCAA 3RWGA 5IBLC 4YDLC 1MVUA 3GO1H 5KN5A 2W0PA 3TT3L 2IG2H 2R23B 3FN9A 1F4YL 4ZPVB 3DI3B 5DJ8A 1FG2A 4LU5L 3MRRB 2R29H 3MJ7B 4RFNC 3DGCR 2QL1A 2GTWB 4X7EC 4ETQB 3ZYOA 4H25B 2VNCA 4UI2A 4V2CB 1WUNT 5CEYA 4JRXA 3U36B 4M6OH 1KCUL 1QBMH 3QWOA 1K3IA 3SDCD 3FO0L 4R26L 4O02L 5IVNA 1H0DB 1R5VB 3I3BA 3BP4B 4I0PA 1TIUA 3SKNA 5F9OL 4BQ6A 5GGTL 3U9UB 4M61A 2VLRD 4P2QB 2RFXB 3GMPA 1T5XB 3BZFB 3U7WL 5GHWL 1VEPA 3QFJD 5ILTL 1UYWL 3O3BA 3EHBD 4KKLC 4OD2A 5DA0B 4JFDB 2IH3B 3Q6FB 2C1PB 4AMKL 5FGCE 4ZSOE 2D4FA 4OQTH 5JLZB 2D31B 2EXWD 4YR6B 5E9DE 1HOCA 3ARRA 5GJSH 4YDLB 1JYNA 2YPLA 5EU4B 5DJ2A 3S6CA 1I7ZB 3BRDA 4FQ2H 2MPAL 5TFSH 3SE9H 2AQ1A 1VADB 1LO5B 4RFNB 2P43B 1N59B 4XPFL 1A7RH 5HYJD 2UUDK 1X5GA 4WWKC 2DWDB 4LNRA 4GBXA 4Z9KB 3SE8L 3WFHA 1XAUA 4M1DL 2ITDA 2GJ6A 3ZL4H 2HRLA 2IADA 5LAXA 3QJFA 1HNGA 1D5MB 3I6LE 5EU3A 2FO1A 3FT2A 3MC0A 1F4AA 4LVHC 3QIBA 3NABL 3VFPB 1FZKB 2G5BA 4JPWL 4AYFA 1CFSB 1DUZB 1KEGL 5ANME 3UTQA 3EFDL 3NA4A 5C0CA 2UVEA 2DJSA 3M1BB 5CIPB 5FOBA 4BM7A 3BIKA 3O8XA 1XF2B 3RBGA 3MGOB 3MJ8A 5EU7E 4XMKL 1H5BA 4HS3B 5I0ZA 3QEQB 3OG6B 3WV0A 3RPIA 3QH3A 4RMSA 2KZ1B 1TTFA 1H8SA 1I9JH 3UBXI 3QIUD 5E2UH 5D6DC 5J6HA 1EEYA 3BPCA 5SWZB 1Z2KA 2WSKA 5BS0D 1R0AL 1FO0L 3CXDH 2DLGA 1PSKL 2DD8H 5J11C 3NCJH 4WWKB 3TBVA 5EZOL 5CS7A 4HIXH 2XWJA 3UJIL 1U3JA 1X6NA 4ZO9A 4K7FB 4GRWH 4HC1H 4NN7C 5DC0A 5E6ID 2B8OT 5IFHL 1MWAA 4DTGH 2EDHA 1XFPA 2GTZB 4BSWB 1K8IB 3KPMA 3V52H 5D9SA 3KXFE 1B90A 4LOUD 4PJAB 4S1RL 2EYRB 4LVHB 2DLEA 3TBTA 4DKEH 4QRRE 5DEFB 3DXAA 1YUHB 3S3JA 3WIHA 2ATPB 4ZFGL 2BSRB 3CSGA 3FB7B 4NC2B 3QXDB 4X98B 1F6LL 2DL9A 4PYHA 3VFRA 3X3GL 1OTUC 4FXKA 1JWUA 5DRXA 4JDVB 4IRZH 2Z91A 3DYMA 3I6GA 4OGYH 2VAAA 2DJ4A 3MLRH 4Z7VA 1OLLA 4S11A 1NCCH 1XCQB 4EBQL 1AXTL 4OI8A 2P24B 2H2SC 3NZ8B 4MA7L 3CDGB 5GGUA 1A1MB 1DN2A 5KVEH 3HNTL 4POUB 4X80H 3K74B 3DPBA 5J11B 2VDPH 1PD6A 4MNGA 1AGFB 1CDJA 2DQUL 3U48A 4X6DB 4DJMA 3QUMA 5HXMA 4NN7B 3DTXA 3OTTA 5F96L 3UTPD 2BNQD 1IGTA 1HZHH 3I3EA 2XRAL 3JV4A 3EDEA 5EN2A 4JLRB 4FFYL 4OLWH 2NX5E 2FHBA 3DRTB 5GS0C 3S88L 5DSCA 4XNUL 1AE6H 4QRQA 1IGIH 1FE8H 4U1MA 2FJHA 5DJCA 1EFXD 4HKXB 3T1FA 5LXGH 3H3BC 2V7HA 4PR5A 3AY4C 5ABDE 3BP7B 4LLMA 1HHJA 3QDGA 2CRMA 2BSED 3QBTB 3G6JB 1GHFL 5HPMB 3C6LC 1S5HB 4HV8B 5DQ9A 1QSFB 1ZWIA 4JPVH 2ED7A 1Q9OA 5DRWA 5CEZH 5KAQF 3PE9A 4JFXA 3RNQA 3W81A 4BZYA 2FYYA 3ZT6A 1A3RH 1A14L 4UIKL 2E6QA 1I8LC 5HGDB 3P4MB 5C6TL 4D8PB 3QNXA 1NC4A 1CGTA 1DDHB 3FB6B 4JO1H 1QRNE 4LCWE 3RX8A 3TPUA 4PRHB 4X8JB 2QTEA 5BOZG 1RIUL 3HTLX 4DW2L 3KDMB 3HMXA 4TNWK 3NFPB 3MNVB 1J86A 1NBQA 5I15L 1T5WB 3QDMB 4YDVB 4P23C 1JNNL 2AEQL 2VRAA 4Y19D 4GQ9H 2Q8AH 2UYLA 3LKSB 4L8DA 2R1WA 1U8PB 3ABZA 2NMSA 3WKNA 3U2SA 2D0HA 1NJ9A 5E6ZA 4TUOA 4D9QE 4S1DC 5DEZA 5EU6A 2ZG2A 4PREA 3L3GA 3C6LB 5DJXA 2EDXA 3SPVB 1YEGH 4P2QE 3FO9B 1P7QB 5K9JL 3ROOB 4MD5A 4YXKL 3VDCA 4D0BA 2BHZA 4WWID 3LS4H 3RVWD 4UAOC 4JFDE 3IETB 5HJ3A 5FYKH 5BRZB 4G6AC 2P46B 3PV6A 4MNQD 3ARUA 4K07A 4YE4H 4DUXA 1MRCL 2H32B 3QHFH 5EO0B 3V79C 4E41B 3UJTH 2A2QT 4AM0B 4F7CB 3QEUB 4NZTH 4LRNH 4YDIH 1GAFH 3MODH 3U30C 4Y0GA 5F7LB 2XOTA 2EKSA 4CU6A 1DL7H 2AK1H 2R2HA 2B1AH 4P23B 1MY7A 3K8KA 3HS0B 4KQ3L 1D3CA 3WLWD 3HC4L 4F9LA 5F9WC 2WLZA 3HI6L 4ELMB 3SBWA 3RPKA 2FHFA 4C56A 4ZS7L 5C0DB 4XVSH 1G6RB 3C9NA 4G9FD 3BDBA 3DVGA 1QLEH 4I4WA 1INEH 1JRHL 5FV2A 1K8DA 4X4XA 2OTUA 3U9PL 5KBNC 1HH9B 1U93B 4H0IA 1LEKA 2CXGA 4UAOB 4ONGL 3UJJL 4Y16C 3QXWA 4ONFL 5CINL 4OZGA 2FWOB 4BFBD 4Y4HD 3EYSL 3BRFA 4YHLL 3QEQE 3TYFA 5TE7L 4Z76A 1DSFH 1AGCB 4MAYD 3LQMA 3DVIA 2CDFA 3H7LA 4QY8B 3EYUH 5KW9H 3QFDA 1KPRA 5SWZE 3RDTD 5CSZA 3S34L 5KS9A 3U30B 2DLIA 5GSVA 4XPGH 4K3DL 1CD1A 4EQ3A 2QEJA 1OAQL 4LSTH 1T0MB 2YD4A 4ZXBA 4NQSB 4JFED 1CGYA 4WFGE 5IB4B 5J56B 1LP9B 3CC5B 3DGGA 5F9WB 5DMYA 2XPGA 4L8CA 3REVA 5JIKA 4DQOH 5IB3A 5BO1L 5KOVC 1V3KA 1NDMB 2IPTH