3PGDB

Crystal structure of hla-dr1 with clip106-120, canonical peptide orientation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
191
structure length
185
Chain Sequence
MGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bidirectional binding of invariant chain peptides to an MHC class II molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 43
structure length 185
sequence length 191
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pgdB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3pgdB01
3JWDH 3JUYA 5JA8B 5ICYA 4PJIF 5C07B 1BF8A 4PS4L 3TCLA 1HK6A 2NY3D 5D96B 4WUUE 4LQFL 5E1AA 1SYVA 4Q9RH 5C1MB 3GMQA 4QRRB 3S6CA 1GGBL 1ZA3B 2ZJSL 2RQ8A 4YBLB 5IR1A 2QHRH 2VLKE 5MERA 3WDHA 2BY0A 1I7ZB 4P9ML 5FYLH 4YFLF 3UTTB 4I3SL 5SX4I 3MACL 1UVQB 1NPUA 3QHZL 2GYSA 3GMOA 3RPKA 2VITA 5MHSD 3ZTNH 4G8FA 1AO7E 4YE4H 3QUYA 4HMEA 5IIEA 3FZUC 1INDH 4X4YA 3TBYB 2CKBA 4XHJD 4M1DL 2I26N 1KTDA 2F53A 3VXQB 1A6UH 3DARA 4J12A 4XGZA 4QWWC 4MX7A 3WHE0 5K9QG 1I8LA 1HZHL 1ONQB 3PGCB 4OCXH 4M7LT 4N8PA 5E8NA 4MVBD 4HT1H 4G5ZH 3V0VB 5C0BB 1FFNB 4ZG1A 3BDXA 4YQXL 5D1QA 2VL4A 1EZVX 1ZLSH 1SY6A 5TQ2H 1KNOB 2W65A 3ZYZA 1XT5A 5T33L 5EG6C 1IM3B 3ARTA 1J1OH 4HS3B 3DPBA 4XWOD 4JQVA 3G6JA 3GB7B 4D9RD 3CIQA 1QA9A 1KB5B 3V6OE 4LCYA 1I9RH 2ZPKH 4PJ8B 1QLRB 2ARJB 2ESVD 1YEDA 3TO4C 5JO5A 3SJVD 1R5IA 3IDNA 5HI4C 1ORSB 3WLBA 1EO7A 2M26A 1XGRB 3VFUA 4AH2B 3BEWB 5ICXA 4NP4L 2EIZB 3KYMB 4MNQE 1AC6A 2NX5A 3S9DB 2QSCH 4L3EE 4G43A 4L8SB 1DVFD 3MOAH 4KRLB 3VFVA 4KJQD 3EOAB 4FHBD 3KPRE 1SBSH 4KUZH 4RFOL 4GMTL 5J13C 2DMKA 3RY6A 1KEGH 5IB5B 4MA7H 3Q1SL 3OXRB 4JO3L 5ETUA 1PFCA 1RJZA 4JPWH 2FH6A 3CFKA 4GS7B 4HBQA 4IJ3C 1MFBL 1AJ7L 1RUKL 4MJ4A 4PBXA 2QTEA 4HX1A 4Y4FC 4QOKE 3LVEA 4IOSD 3KLHD 3V7MA 4HXAL 1ZLSL 1DL7H 5ADPH 3T8XA 4XTRC 1U8MB 3ZKXB 3WKMH 4LIQH 1MCOL 1LK3L 5IJKA 1EUUA 3HAEH 3N1FC 3WJLC 4MB4A 2X4NA 2YMXH 1BVLA 3PXHA 2ZUYA 2PNDA 5EC1B 1YMHA 4PJ5E 1I9RL 4KVNL 3NCJL 3MRFA 2KBGA 4KY1L 4FMKA 3BPNB 3S8WA 1MFAH 4BJLA 1WTLA 4HGKC 5FUCC 2X6MA 3FQTB 3KHQA 4XP4H 2AW2A 3WJJA 3SDDD 1KLFA 3B9KA 2DOCA 4LSTH 1FIGH 4X6BB 4EIZC 1NC2B 2HTKD 1P84J 4GBXD 5JW3L 5EU4A 2VJXA 4XWGL 5FGRA 4GMTH 1YJDH 4OFYD 2YA2A 3VXOB 3L95A 4JLRB 1C5CH 5C7XL 3HAEB 1X44A 3ILQC 1S9WB 3V6FA 1BEYH 2BC4A 4XVTL 4YHMH 2K1MA 4KK5C 3LPGA 1Q8MA 4M6MH 4MD5A 1IEAB 4BH7A 3L6FB 5IQ7L 3SDDB 2LFGA 4M03A 4LP5A 2PETA 3NZ8A 1S5IL 4QHKJ 2CQVA 4K3JL 4Y16C 4U1HA 2CK2A 4ZXBC 1DZBA 4U1NA 4NKMA 3FMGH 5EIQA 2YOCA 2IH1A 3G6AA 1D5MA 4APQD 3MUGB 1JYVA 4P3CH 4M7ZB 1E4XH 2I60H 3WEXB 3MRLA 1QFUH 1VGEH 1JCKA 2UVEA 3FQUA 4YAQA 3OJ2C 2PTTB 5CP3A 1RAMA 4FFVC 1QBML 1K5NA 4P57A 4Z7OE 3OSKA 5FM5O 4NN7B 4KVNH 2YUVA 3NCCB 1NCNA 1FPTL 4LCIL 1CVSC 1KNOA 2W65B 3L5XL 5CJ8A 5FDYA 1KBGL 3G5VB 5DS8B 5JW4R 1MEXL 4PRHE 3V95A 2ZJSH 4OT1H 2QHRL 5E24E 4XVSL 3LV3A 2Q6WB 1UM5H 3W0WE 5D1ZA 4N9OB 5F97E 5D7LE 5DO2C 5D7JD 5B8CB 3PGFL 3C6LA 5GGRB 2EO1A 3ILPB 1JYXA 4LEOA 4HH9A 2F53D 5EFIB 1K4CA 2O5YL 4OD2B 2JK5A 3B9KB 5F1KC 4ZPTA 4R90L 1HXMA 4ZAKD 1W72H 1TPXB 4JM2B 1G1CA 4U4BA 5GGVL 5L88H 4M6ML 3S4SA 5IQ7H 3NCMA 1U8OA 4PFEA 1DVFC 4U7SA 3CDGA 4LLDA 3ZE2E 1JWUB 3WL9B 1G6RB 4S2SA 1HWHB 3LS4H 3O41B 2APTA 4KHXH 3PP3H 1WWBX 3S3SA 3IJYA 4FFZL 1KCVH 3G5ZB 3WUWB 4DWHA 3C08H 3BW9A 4IMLB 4HLZG 4Y1AD 4Y19B 5J6HB 1KJMB 4JCMA 3O6MH 1R3JA 4Z7WB 5DMIL 4KI5E 1BECA 1CS6A 3ARGD 4L8BB 3UCRA 1IQWH 4Q0XL 2ZPKL 1D5MB 2FIRT 5DO2D 5E56A 2VXSH 3WE6A 1T7VA 5D2NC 2C3HA 4A2LA 2ESVB 4XTRD 4MJ5B 1AGEB 3RP1A 4NKDB 1RK0B 2OI9B 3L3HB 4RRPA 3KXFA 1UM5L 4BH8A 4JY5L 3DSFL 2CKNA 3G9AB 5IG7A 1NEZG 1RZ8B 2RCSH 2LAGB 3KLAB 1Q9LB 3THML 4LCCC 2FBJL 1DVFB 4CMMB 3KG5A 2ZUUA 4DN4H 3FN9A 2F19L 4H0IA 1OSPL 3FKUS 1DDHB 2Z93B 1LK2B 2FBOJ 1FFNA 2JE8A 1R5IB 4I0PC 4FQCL 5K9OB 2WQRA 5HHOE 3VDAA 2J6EL 4KKLD 1J05B 3MLSH 4GRMA 3QH3A 5JMRA 5JIIA 1IBGH 3ARUA 3NZHL 1KEML 3CFEA 1H3UA 1T5XB 3HAEA 4D0DA 4NCC2 4PJBF 5FCSH 1T83A 2JCCF 4J3TA 1LP9F 3MRNB 3QWOB 1E4KA 3QIUD 4R4NC 5MENB 2OI9C 5I71C 1JPTL 2AQ1A 1B0GB 3PP3K 1P9MA 4I8DA 2YK1H 1DBML 4P9HC 1CFQA 3OJMB 5F7FA 1IM9D 4JY6B 5HYJD 4LSSL 3O9WC 3VFGH 2LVEA 3KR3H 2GTZA 2XQYG 1F4XL 2DI8A 1QRNE 4WCYL 1NMBH 2ATPB 3EFDL 3F7PC 1E4WH 4ISVB 4PRPE 1N3NA 2HH0H 4QRSB 3NTCL 1P1ZB 1KB9J 3MYJB 3V6OC 1I8LC 2Q76A 2BVOA 4U1LA 1ZHLB 2V7HB 4Y4HA 4L3CA 4LRNL 4QTIH 2X7LA 4YR6A 1I9IL 5JXAL 4NQUA 3P9MB 5JORA 1W0WA 2BMKB 3VXTA 4OZ4B 4UT6L 3VXRB 4M93C 3RRQA 2G75B 4TQEL 3E2HB 1BVKB 1V3KA 4QO1A 3LEVL 3MV7A 1OGAB 3D39E 1FSKB 1GGTA 1LEGB 1OD9A 3SQOL 3MJ8B 3C6LB 5DRWA 1H8NA 1JP5A 4FQ1L 4I2XB 4NDMB 5FB8B 1IC1A 3VD4A 3KLAA 1IBGL 4OD1H 4PJDB 2X9YA 4PP2B 1ORSA 3WLBB 2BHZA 5IVOA 5ACLA 1S8DB 4FTVB 1BQHG 1A9BA 5L0QC 1UM4L 3EDJA 4FTVE 2IH3A 5BCAA 4HKJB 4AJ0A 1FNHA 1OD7A 5F9JA 1EEYB 1I85A 3IKCA 3NFSL 4FQQB 5E2JA 3MGOB 3QZWB 4PRNB 4WV1C 3E3QE 4ZUUB 1KBGH 1KTKE 4TUKL 3IF1B 4YC2C 5K9JH 4YXKH 5I1GL 4ODWB 4HS6A 3BWUC 2IH1B 4Y4KD 4FABH 4QHMA 5AAWA 1C1EH 2D7PA 2JB6A 4NT6B 1JYNA 5I16A 2AXJA 5DJDB 4I3GA 1MI5E 4F7TA 2DICA 3TVMA 3U9UA 1I3GH 4AY0A 4NZUH 4Z8FH 2PN5A 1OAYH 1BM3L 4K7FA 4KZDH 3HMXA 4OF0A 2BJMH 3RAJH 4PJIB 1OW0A 1KJ2B 1QSEB 4N90E 3U0WL 3R06A 1AQDB 4J4PD 4ELMF 4QXGL 2DM3A 3LEVH 2EDNA 3FRPA 1AFVL 4QRPE 2H2PD 3O6FB 4N0UB 3TH2T 3VWKD 4HHAB 4YGVB 3GKZA 1MJ7L 2AK4E 4MZ2A 3VG9B 2E5EA 3MRRA 4XBEH 4ONGL 2VN4A 1PKQA 1F6AA 3GGWB 2G5BA 4RGOH 4PLKC 3BAEH 1LD9B 1LO2L 2OTPA 3QI9D 3OR6A 3QZWG 5JIHA 1KJVB 1QBBA 5B4MC 2EDJA 1NJ9B 5IV2B 5GSRB 5FA4B 3C08L 3ILPA 2XT1B 4M7KH 5EBLA 3R1GL 3O6ML 4I2XA 3MV8A 4UT9H 5JW4M 5CJBA 2HMIC 4PB9L 5SV4A 2Q7YA 5CCKL 4A6YH 5IVXF 2P5WE 3SKOB 1YEKL 1C5BL 1Q0XH 4PGCB 1YY8A 4Z7NE 5FA3B 5JDSA 1NCCH 3CJJA 2Q1EA 4CNIB 4RMQA 3VE0B 3U4BL 2YBRB 4K71B 5HHOA 3VXRE 1AHWB 4O58H 5DT1L 3F6LA 3MRPA 1EO8L 5EIIA 1N3NB 2E9IA 3PUCA 2HFGH 4KMQA 4HV8A 2R9HC 2ZCLH 1OSPH 1OP3K 1CGVA 2UV3A 4BKLB 1PLGL 4IOIA 2JTDA 1IZKA 1VHPA 4HSQA 5E6YA 1FVCB 4ORGB 1NBVL 1XGYL 1FAIH 3SGKA 3RPIB 2V2TB 3VXME 5MENA 2C3WA 5INDB 1VADA 3LKOB 4BM7A 4IJ3B 2AABH 3TYFB 4CJ1A 2BNQE 4KQ4L 2XWJB 4PP1C 2H26B 5I75B 1P5UA 1RK1A 5JXEC 3VFPB 3L3KA 1PAMA 3BESR 2JJUA 3HPJB 3PJSB 3F6IA 2GK2A 2LVCA 3UPRB 1DBMH 3WNPA 4DVBB 4TULL 4L4TE 5I18H 4LEOB 3BIAX 4OJFH 2ZUQB 4L8SC 4Q7DA 5ID0A 1RK0A 4A6YL 1I8IB 3VFGL 4C59B 5HYJB 3C2AH 4MQSB 4WEBL 2BRRH 3IDMA 2LE9A 3QG6A 3MRGA 1Q0YL 2HJLA 4L1HA 2UY7A 5HYFA 4TVPL 3NCFB 4MXWH 3MV8B 4D8PA 5JPNB 5BV7C 2VDKH 2XYCA 4GBXB 4DN3H 1DVFA 1YPZA 4HQQL 3O81A 5HHMB 2AV7A 3MV9B 1OL0A 4UOW1 5ICZA 3U48A 4NO3A 4FFVD 3BW9B 3ZKND 3VRLF 4NRYA 2VLLA 5DRZA 5FYJE 3QEUB 1QEWA 1I3UA 4GRMB 5E0QA 1LDSA 1CBVH 3G6JE 5ILTH 2AJVL 4NBYB 5ESQA 4PP2A 3JV4A 3L3OB 1LO3H 2AEPH 5FGCB 3VCLB 1CLOL 3LIZH 2EDKA 4RISH 1NMAL 2YD3A 4IIQA 5D5MF 3VXPB 5FO9A 4ZFOA 3CVHB 3KPRD 4EDWH 1I9JL 1AHWC 3PWNB 2MPAL 5ALBH 3FTGA 4WW2A 4ZNCD 3MXWL 4X9HA 3MNWB 5T5NF 2XIDA 4K2UL 4D9RE 4N0UA 5BOZG 5DJYA 3IJHB 3DIFB 3FCTB 5E00A 4GXVL 5AYUL 2VOTA 3O6FC 3HZYA 3V2AR 4EXKA 4M3KB 1Q9LA 4PLOB 2HN7B 4Y5VA 2D7TL 4GRLC 3DUUB 1SVZA 5C0AE 5DRWB 1Y18B 4EXPX 3MGTA 3HC3L 2XICA 1ZHBB 3LPWA 4KKLC 4YXKL 1BAFL 2DJSA 3PL6D 5ISZA 3X12B 2VLRD 3P9LA 1IJ9A 5L0QB 1NAKH 1FDLH 5DHVB 1R5WA 1FH5L 3TO4A 3W2DH 4OI9A 4HQQH 2B0SL 4Q2ZB 2FECI 3QIWB 3CDFA 1DEEB 1OAYL 1TJGL 4GUPA 2R2HA 3CFJB 4UDUB 3HMWH 2DBLH 5HYSB 4U2YA 5IBTH 3F7QA 3QDGD 4S11A 1AGBB 3BKML 1CBVL 4WGWB 3BIKA 5FIEA 2ATKB 4JFFB 3ZKMC 4X98A 1S9KC 4MD4B 1MJ7H 1IKNA 4G6MH 2CRYA 4YHYC 5DD5L 1KT2B 3DUSA 3C5ZC 4ONGH 1YEIH 5EBMB 5CIPA 3LSOB 3GBNL 3TZVA 2GJJA 2DQCH 4LRIC 5CJQH 4ETYA 3ECBB 1NL0L 5EU3B 4PJXA 5I76B 5CWSB 4NO2A 3UTSB 4UIMA 5ISZE 5DJ8A 2WLZA 4OGAC 1A6TA 4LLAA 1FZOA 5IVZB 3TP4A 3X13B 5JORB 3OR7A 1EFQA 2D7TH 1L0YA 2VAJA 1CXEA 1KCSL 2X4RB 1UWGH 4S1QL 5GGUB 3OHXB 5HHVH 4KKBC 2A1WL 4YUEL 4UIKL 4JM4H 3V0AC 1TETH 4UB0H 4U33A 5E8OA 5TFSL 5DJZA 3PHQB 4BQ6A 4C56A 3QT2A 1WFTA 5E7BA 4GG6E 2CRIA 4PJIA 1T1ZA 5DZLA 4NCC1 4X4ME 1I1YB 1WEJH 4NPYA 4ALAH 5KBNC 4ZOBA 1N6QL 4LAQH 1PVHA 3FB5A 1BD2E 5KANG 4ONFH 4QRRD 5F9OH 3RL2B 2CGRL 3QDJA 1U6AH 5FKAA 1DQJB 5TF1L 5GHWL 1NGWA 1S7WA 2WUCH 1MREH 3ZHDA 3UAJD 3MA7B 3RY5A 1WTGT 7CGTA 2V5SA 4WFED 5C0JA 3GO1L 3MBXL 1A7RL 3EJZD 2IFGA 4G6ML 4L5FH 1I8KA 4ZSOB 5TE7L 2QSTA 3EYQD 4QTHB 2Q20A 3UTSE 1BOGA 3HE7C 1KCUL 1ERNA 1FBIH 2EDLA 2DQGH 1N64L 4JHWL 4GFTB 3ARDA 4WUKL 3HZVB 4JDTH 2IGFH 5JPMA 4MD4A 3V6ZA 4I1NB 3AM8A 4TPRH 2OTWA 4KZEH 3BMWA 1H15B 1JGUL 5I18L 4ERSH 2VE6B 3T2PA 5EO1B 5T3XL 3QG7H 1OP3H 1MCCA 2NW2B 2GY5A 4PYHA 1DUYB 3R06B 4LLVA 4YXLL 1A7QH 1VEMA 2B4CC 3AC0A 4XXDB 2BRRL 5FUZH 5HHOB 1U8MA 4JM4L 1VADB 3FCTA 4HCRH 5E00B 4JJ5A 4RGND 4WW2C 1M7XA 4JEGB 4KKCC 1D5ZB 3NIFE 3RL1A 4FQ2H 4XCEB 1KB5A 1VFUA 1RZFL 1YMMD 3RVVD 1OAKH 3ZE2F 1RSFA 4WO4A 4KJWC 4HG4K 4NN5C 2CLZB 1WT5C 2OL3L 1A2YB 1ZSDB 5CEXA 3T1FB 2RIKA 3GMRB 3TJHC 3WXVL 1NQBA 2GCYA 3I02B 2PR4L 2AJVH 3V0VA 4FNLH 3QSKB 1GZQB 1YEEH 5INDA 5J9PA 4N8VG 3PWJA 1NAMB 3WJJC 4R97B 4KMLB 3G5XA 4LCCB 1CLOH 4XPAH 1WICA 3BXNA 4NCDA 5I8KH 2XZAH 5DRXA 3TT3L 3OJDA 2EICA 3KPTA 3RL2A 5J57B 1MPAL 3H3PH 1MHEA 3VFPA 1IM3A 4U49A 3LKSB 3IAGC 2ICWI 2YPVL 1RULH 1N4XL 2BXZA 3BIKB 5JIKA 3WS3A 3TLRA 4YHKH 1I1CA 4WUKH 3I6GA 2XN9A 3CFKB 2FX9L 1LO4L 3WIHL 4GXVH 3DX8B 4OM1H 5T1MB 4U1HB 4WU7A 5DSCB 4K7PY 1JYWA 3PWLB 1YMMA 3BGFC 4I77L 4ESKA 5JXEA 1IVLA 3CK0H 4EI6B 1WAAA 2EIZA 5TH2B 5ANMB 2AV7B 2P8MB 1W72A 3S5LA 2HFTA 4JZOB 3AY4C 1FO0H 1RZFH 1D9KA 3I6LE 4X6CB 4M00A 5ESQB 5B38G 3DX6A 5GRJH 3VD9A 2OL3H 4OLYH 5ACMA 4ZNEE 1UCBH 2MKWA 3K2UH 5TQ0H 1EAPB 1R3KA 3RWGA 4P5KB 5JNYB 4G8GD 4HX1B 1F3RB 3JV5A 2OX5A 3ZL4H 3QDGB 3PP4H 4ZUTA 4QF1A 1I3RA 1SMOA 5I1HL 3OMZA 4QHNB 2OZ4L 1LE9A 1FFOB 3HE6D 1MPAH 1L0QA 3QG6B 1JWSB 4D0BB 4UT7L 1I7UB 1GGYA 2CH8A 3ZT5A 4Y2DA 2FJHA 4NQCB 3BD3A 4JQVC 5IEHA 2IWGA 3ULUH 3VGAC 5E9DB 5I1CH 2ATKA 1TQCB 3QIBB 4YPJA 3BUYB 1GIGH 5I1AB 1JNLH 3O41A 5E2TH 1BLNB 4G80B 3GJFA 4GQ9H 3U83A 2F5BH 3RBSA 5GGRY 3AREB 3M17B 2Z35B 1I7RA 5AD0A 3W9EB 4KRPC 3RKPA 3UJTH 1B0RA 5IB3B 1UKSA 4WJ5A 2UZXB 4KK9C 1QRND 3KAAA 1DBAH 1HHGA 5DUBA 3CC5B 1B4JL 2IAND 2QKIB 4G8GA 3QA3A 3V5HA 2BC4B 3WN5C 5DJ0B 4PJ7A 4JHZA 5I30H 1EA9C 3LQZA 2ESVA 3BKYH 5AYQA 2Z8WC 4Z6AT 3MLPA 4ODBD 4Q6IA 4LKCB 5LGJB 1FZKB 1OCWL 1P7KB 3MC0A 4YHIA 3GHBL 3GEWB 3MBEB 4AIZB 1GC1C 1QR4A 3SDAC 3KS0H 1C12B 3UPAA 2KZ1B 4G8EB 4M6OH 4M9PA 5JW4Q 2YN5A 3T8XB 1FZJB 4U1MA 2H45A 3DV4A 5DHYA 2GK0B 1ZHBA 1F00I 1BQLH 1NCAH 3IFLL 3LN5B 2F8XC 1KCUH 2GCYB 2YKLH 2WAHA 1L6ZA 1SJHA 4YAQB 5I0DA 4KI5C 2P43B 4JHWH 4F7EB 2H32A 1TJIH 3OG6B 3ZSTA 2Z0BA 4ZUWB 5K9OA 2OTUA 2X4OB 3R0MA 4JFEA 2P46B 1IFHL 2AJ3B 3U6RA 3EDFA 4ZUSB 2AJZB 1HI6B 4KQ3H 2O5ZH 1DE4B 2OBGA 3TA3A 5TE4L 5FYLE 5C0FA 5SWQB 1JNLL 1U8QA 2CDGA 4YWGL 4JFDD 4UINL 3HS0A 5FHAH 2FD6L 1VFAB 1A7QL 4GKSB 1ZEAH 5K93A 5C0AD 1V7ML 1M7DB 3RVXC 1CD1B 4HWUA 1B0GA 1LK2A 2FX7L 3LKPA 3SDCA 4NYLB 1G6RH 1HHKA 1KACB 2NY4B 1OAKL 5I15L 4PUBH 1PX3A 3AREA 4XP5H 3WE6B 2AEQL 3UPCA 2ZWLT 4N1EA 5EU3A 2DQJL 4DKFL 4D94A 5D70L 5EO1A 3X3GH 1W72B 4GAFB 3S4SB 1B88A 2GJ6B 4Y1AE 2X40A 3VWJA 5INCB 5E2UH 4D0CB 5CILH 2NY2B 1OAZL 2V2WA 1KTLA 4IDLA 3DGCR 3QA3B 3V5HB 3JSSA 4F2MB 3B8YA 3O3BA 4YDJB 3F5WB 1JZ8A 4OV5B 4F58H 4NJ9H 4KKBD 5F9AC 2C5DC 3ARBD 3EDEA 3F12B 3QXVA 1KN4H 1EHLL 2M1KA 1L0XA 4K07A 5DR5L 4PYGA 1QR1A 3U1SH 4Z78B 3FO2A 1A2YA 1ZSDA 3L3IA 3EFFB 3LN9A 4ZUTB 2AK4D 4OFDA 4YBLC 1P1ZA 4MNGE 5KSBA 2F15A 3QUMB 5HHMD 1ZLVK 1XGQB 3QH3B 4O02L 4G6AD 4PB0H 5I75C 3ZKMD 4WO4C 5TE4H 3I6KA 1H3WM 3FAWA 3QFDB 1TQBC 3S36L 3KYAA 2FECL 4JRYE 2WUBH 4LL9A 3VFWA 4KJPD 4Q9QL 1MSPA 1I1AC 1ZEAL 5D71H 5GGVY 1XF3A 4IMKA 1YQVH 3UYRL 5J13B 4EVNA 1PG7L 1G9NH 1I1FA 1PW3A 3NFNB 5F96L 2ICEA 4M8QA 4FQPA 2VAAB 1G6RL 1K8DB 1ZS8B 1EEYA 3L5HA 3EOTL 2AQ3A 1RV6X 5HXMA 1X9QA 5DTFB 5GRJL 4L9LB 4CVXA 4PJXE 5BS0B 4OCRL 5TQ0L 4WU7B 5DSCA 1DSFH 3UYPA 1P4BL 2DQIL 4JDZB 4M43L 3I9GH 5K9KB 4TN9A 3HR5B 1A3LL 4WI7A 3A6BL 4KK9D 1U8JA 2MQ0A 5KANI 4LSVH 35C8H 2PF6A 1NFDE 3AB0C 2CMRL 2E8ZA 4JO4H 3VMNA 1UYWH 1MAJA 4KTDH 4F58L 2XZCH 3MNZA 5J4MA 5E08H 2A6DB 4AENA 4G9FE 3D85B 3MRJB 4JFPA 3O9WD 4NM8L 4NO0B 1FGVH 2ZOKB 1WLHA 1J12A 2B5IB 4HK3J 4WHCA 4X6EA 3WO4B 5BXFB 5IIEB 3D6GA 5DD1L 3NAAH 2I07A 3ULUL 4LLQA 3OPZL 4YZFF 1RUML 5FB8A 3F12A 4MJIB 5IMLA 2FB4L 4JRXB 2M2DA 5E2TL 3RZWA 1ZGLA 5C0CA 2ZKHL 3NN8B 1G9MH 1UZ8A 2F54B 2F5BL 1UA6H 1KLUA 25C8H 3HI6L 1TTFA 3X14B 2G2RA 3PABB 4R26L 2R4SL 3CC5A 5KVFH 1YQVL 4HAGA 1CD8A 4LHUD 1JHTA 2OJZH 2CUIA 1BP3B 3LKQB 1XFPA 5EULV 2AK1L 1KIRA 1NGYB 3P9WB 4Y2DB 3V8CA 4BFEA 3LKNB 3MRMB 5HHQB 1DBAL 4M7LL 4HGWA 3P0VH 1B4JH 5FV2A 5F7HA 4UDTA 2RGSA 4RAUA 4N0UE 4PJFE 4HPYL 3O11B 3BGMA 1S7TB 4H1LB 4LF3A 1P4BH 2UWEB 4PJAB 3ZYOA 5JMOC 3PDGA 2UYLB 4FQJL 2Y36H 3C6LC 3QO1B 4KRPB 2RJMA 3TVMB 3H9SD 1JGVL 4TRPL 5LQBH 4QXWA 4Y1AB 4DJMA 2NY1D 2BFVH 2MFNA 2VLRA 5I8CA 1MVUA 2CK0H 4N90D 5F3HB 3O0RL 2BVPA 3PQYE 4PGEB 4OFVA 5DK2A 3SE3C 1OLZA 1G7JB 2NTSP 2VZOA 3BYTA 5FGSA 3RWFA 1NBZB 1AQDA 2P45B 2YD5A 4LARL 1RJYB 1KIQB 4HIHB 4NM4L 1FYTD 4OAWB 4UOJA 3AVEA 4YBQD 2OP4L 1KENL 1MI5D 5E2VL 1T21B 1T1WB 3OPZH 2D31A 2Q8AH 4GKSA 1OPGH 4X7SH 4P23C 5FO8A 43CAA 3RDTD 1IEAA 2ESVE 2FB4H 1K9TA 5TDNB 3TVMD 3DJ9A 4NNYB 4MD0B 1SYVB 3BKJL 3DMMC 1G1YA 4MMZC 4NWUL 5HDOA 1L7TH 3L3IB 3TBSA 4KRMB 3QNYB 4X6FA 1MHCB 1FNFA 4ZO8A 1AY1L 5DLML 5IHZA 5B39G 2AK1H 4NHCH 5ITBH 1FVCA 1WWCA 3P0VL 1PZUB 5DDHA 4U6YA 1LQSR 1B4RA 2WQ8A 3SKOA 3C09B 5GJTL 4NGHL 2EXYD 1DQMH 2DQEH 1B6UA 2BXYA 4XGZB 1DFBH 2GJ6D 3VXRD 4Y2OA 3AUVA 1OAZH 1S7RB 3GSNH 4TRPH 4TTDD 4ODSL 4OCLC 1OGAD 2HG5B 1H5BC 2AERT 4PRDB 1HILB 1IQDA 4JM2C 3BGFB 4O9HL 2ADFH 3OKOB 3AFLA 2OR8A 3B9KC 1CCZA 2Y5TA 4LVHB 1S9VA 1NANH 3O2WL 3B2VL 1CT8A 4NM4H 1HHIB 4FQIL 3QO1A 1A7OH 1UEMA 1FRGH 1WCBB 1ZANL 1TIUA 3GNMH 5CS7A 4P49A 4J6RH 4GKNA 3EIFA 3CXHK 4JO1H 3DMMB 1KF9B 3CVHA 3HG1B 1DQLH 1MAKA 4PRAB 4KK6D 4FN0A 1U41A 5IW6A 1HHKB 2VLMD 4ZTPH 4O2CB 4S1RL 3K7UA 4ZMAT 4PRBA 4N0YL 3BE1H 2EC8A 3OJVC 4IDJL 1YECH 1KTDB 2F53B 4L9LA 5DVKA 4CVXB 4I0PB 5F96H 1UZ6F 2BSRB 3RX8A 4NHCL 4DGIH 4CU6A 4OCYL 5IROC 5ALCL 4K94L 1PYWA 3IVKB 5I73B 4WEUD 1V5JA 1XGQA 1D5IH 4KDTA 1FCGA 1JRHI 4K8RD 3BH9A 4NGHH 4E9LA 3C9NA 4Q9RL 3RGVA 2VZ1A 3GM8A 4Y4KC 4M43H 4PBWD 3RWJB 3GRWL 5C3LD 4U3CA 4QT5A 4CL7A 1NGQH 2EECA 5AZ2H 5A43C 3GMMA 2OK0H 4XPHL 5EZLA 5I8OL 1I8MB 4OLXH 1VFAA 4PJ7E 1S7QB 2FIKA 3MLYL 1IZJA 4MAUL 1JPFB 1FZMB 5LG1A 1RHFA 3JUZA 4UU9B 4WGVB 3VFRB 4W6XB 1CICD 3O8XD 4CDHA 4OLZL 3D0VB 3IXAB 4UQ3B 5CBEA 3NAAL 1BVLB 2NXZC 5JIPA 3CSYA 3IFOA 4KJPC 5EPMA 5BO1L 3SN6N 3MRKB 3WIFB 3RUGA 1EHAA 3FQWA 2BCKA 1AKJA 3BGAA 1KIRB 4G5ZL 2GJZB 5DJ6B 5GGSY 5CIPH 4HC1H 3VWJB 4FQLL 1FNGA 2DL2A 2WLYA 3REVA 3HCVA 4G7YL 4PJ9A 4ELKA 3MRNA 5IBLC 3MRPB 3P2TA 4KI5D 4OZIA 5JR1L 1HCVA 5EU4B 4OCYH 3ESVF 1MCIA 4KTEL 2YPKA 3SJVB 3T0EE 3QNYA 2A83A 4XHQA 5FOBB 4Z7QF 4NNPH 1DBBH 5DGQA 1VPOH 4NN6C 2NQCA 1RZIB 1AGFA 2Y06H 1MLBA 4RFEB 2WWKT 2JCCE 2ICCA 2MSPA 1OGTB 4JRYD 3OKEB 3U2SA 3NACH 3UBXG 1EEZA 3P73B 4P4KB 4PJGE 4R8WL 5T3ZE 3MJ7B 2OK0L 4UNUA 4Z7UF 3IJSA 4Y2DC 4ZO9A 5BVPH 2IBBA 2O5XL 3NMEA 3DURA 2R1WB 2BRQA 4NKMB 2K7QA 3V4VL 3D2UA 5T3ZD 2JJSA 3QRGH 2GSIB 2P44B 2YRLA 4HULB 4JO3H 2BOBB 1JIBA 1KJ3L 1ZA6A 1ITCA 1S7TA 4PRDA 5F1OB 4YHZH 4PJFA 2HT3C 3B83A 4V1DE 3RGVC 3N0PB 3QDMD 4XT1C 3TNNB 1A1OB 1Q94B 3OAZK 4YHYB 3WFDH 4OTXH 3T4AA 5J06A 2XY1A 4D0DB 3TPKA 4Q2ZA 3GSWB 1A21A 4BZ2L 4XMPH 3F7VB 1G7JA 1A6PA 5C3TA 3W11C 3IB4A 3O4LD 4GH7B 3JWOL 4ONHA 4G6JH 4OZGB 1T1WA 2NY6C 1JZ5A 3D0LB 3M07A 3GIZH 3KPNB 1EERB 4LNVA 3P3YA 4IRJD 1H3TA 3G6AB 1GGBH 1ZLUH 3BFOA 5IMLB 5F3HA 4WUUB 2R0LL 1ED3B 4M6NL 3ZE1F 4L9DA 4ODSH 2B20A 3P30H 1B9ZA 5GJSL 3QI9C 4GRLB 1E6JH 2C3VB 1WUNT 5BZDA 1T7ZA 3FJTA 3VFNB 5IW1A 1JHTB 4AEFA 5GS0L 1EGJL 4XMKH 1IKNC 4KUCF 2NY7H 3QUXB 1ZANH 1MIMH 5KSUA 2GT9B 4PY8I 3QDAA 4XVTH 4MDIA 4JE4B 4LPTA 4R96B 4JN1L 4QGYA 3MMEA 1H3XA 2GAZA 2PUQT 1EMTH 4Y4HC 2DI7A 3X12A 1KYOJ 5A2LH 3SY0A 2EEDA 3HZVA 1AGEA 1R5WB 3TO4B 1J1PH 4JKLA 1I1YA 5IV2A 2JK5B 1OY3B 2H9GA 4FP8H 4U0RC 5C0BE 1GGUA 1GZQA 3TCLB 3X11B 3OAYH 3PNWB 4G6JL 2H41A 5ALCH 2HVJB 3U46A 3VI4F 3LRHA 2GW5A 3WUWG 1QBMH 4ZD3H 4AG4H 1U95B 4G9DA 1P69B 2AK4B 3DI2B 1HEZA 4EI5D 2JB5H 1MEXH 3AAZA 5F8RC 5IBLD 3P4NB 1WIUA 2NLJB 3GHEH 3TZVD 3S96B 2A38A 4XVSH 3W5MA 3MJ9H 4Z7VE 3VH8G 5DJDA 3X3FH 4TOYH 3BKCH 3U79A 2CDEA 2VDLL 4J4PA 3VFSA 2D03H 2VDQH 2YD4A 3QHTC 1G7LB 2C1PB 5E1HB 2O61B 1MOEA 4GW4A 1CYGA 2G60L 5TH2A 1J0HA 4GG6F 4R90H 3SHSA 2QQLH 4UAOC 3O6LL 1UXWA 1EXUB 2DBJA 1FL3A 4E0RA 5H8DA 3Q3GA 3OJDB 4LLUB 1U8LA 3C8HA 2WP3O 2XN9D 2FJFA 3ZTJG 2DKSA 5E8PB 3VWJC 4ZS6C 3SE9H 1NUGA 1X3DA 5T1LA 3I3EA 5ECJE 1TZIA 4O2FB 4HKBA 2Z31D 4EQ3A 3JV6A 4I9WD 3KPMB 3ULVE 4U1LB 4ZSOE 5ADPL 4M5ZL 4WENB 3IDIB 1YEFH 3ZT7A 4PJ8A 4XMLH 1OLLA 3BPCA 4XC3L 3PQYB 5B4MD 5C09D 4N8CH 3T1WA 4KRPD 1BIIA 4OZFA 4LASL 1ES0A 4MS8D 2OJEA 1RZKL 3E8UL 3RNQA 3GMNA 5EIVA 3EJJX 4GQPH 5JZ7C 5I1KL 3T3ME 5EU6D 3PE9A 4Z7VB 1BD2D 4P5TB 1A4KB 4WW1A 3SPVB 3FRUB 4G3YH 2X44D 1FLTX 2FATH 3D69B 4MCYA 2ICWJ 4UBDD 2UUDH 3HCVB 3VFRA 4LOUC 4A2MA 5MP6H 4DUVA 1G7QA 1Z0MA 5IMKA 5IHUL 3V6ZB 1HQ4B 5CKGA 5SX4H 3FFCA 1VGKA 5HDQH 3RWDA 2JJTA 1IGYA 1QVOA 3SDCD 1E27B 4J3OC 3U7WL 3TNMB 1IGFL 1RUPL 3ARQA 3X17A 2NW2A 1KJ3H 5JHDE 3QPXL 3IFPA 3CX5K 4OD3L 2IJ0C 5A3ID 1ZHLA 2V7HA 3MRIB 1GXEA 2HLFD 1A8JH 5E94A 1JRHL 3BH9B 3FFDA 5IKCB 4HUVA 1JHKL 2PYED 3S5LB 1A6AA 4HWZA 4LGSB 4NKIH 4UUJA 3QXUA 3O2VH 4LSQL 4GLRH 2DKUA 4OUUA 2VUOA 4X4XB 4ZDHA 1KULA 4NT6A 2ZG3A 5KTEH 4HUWA 2VN7A 3CCHA 3OB0H 3WKNA 3N9GH 3PIQA 3RI5F 1J1OL 1K4DA 2CDGB 4L3ED 4G8EA 2WBJA 5BVJB 4K23H 3RVTD 2X09A 4OZHA 2HN7A 1RZKH 1EEZB 1XR8B 4LVHC 3KR3L 5D8JH 2RR3A 2AI0L 3TN0C 1X5AA 3LQMA 3N1MC 1AXIB 2NZ9D 3W0WB 3ELAT 4WWKD 3LQAH 4DZBB 1IC7H 2VZSA 2ILLA 3BISA 4G8GB 3FQWB 5C6TH 1DE4A 1F42A 5ESAA 4F7MA 4NP4H 4OLUH 2BSTA 1HOCA 5F1NA 5MP6L 1MCLA 5LCVL 2QSCL 4NJAH 3TJHD 2W9EH 1FFPB 2V7NB 2RHEA 5J11B 1HN1A 3RWIB 4P5TA 3NCYP 4L4TB 4RAHA 4WU5B 3OZ9H 2FYYB 4B41A 2O5YH 3O8XA 3RVUD 3S96A 5AWNL 4PJEF 1QFWH 2V5MA 2V17L 2J88L 1JWMA 1T04B 1CE1H 4P0DA 3S37H 3W5NA 3JWOC 1Q72H 5DVNA 2KH2B 3ULSB 3FOMB 5J56B 1D9KB 3WEXA 4KROB 3D85D 4HXAH 4NO0D 5KTEL 2X4SA 4QY8A 5I1JL 5DJ0A 5CWSA 3KPNA 3DX9B 4HJGA 1CDHA 3PWVA 3O3BB 3HZYB 3G6JB 3GB7A 4GW1A 4M4PA 1YPZE 3ARRA 4ZD3L 3OR7B 1Y6NR 5CKAA 3NCJH 1U93B 4ZDHB 5GQBA 5F7KC 1ZE3C 1G0XA 1AD0A 2WSKA 3ULVH 3AU1B 1JGDB 5KN5B 2UZYB 5HHME 3PQYA 3TZVC 2EDOA 4R4BB 2XNAA 3GHEL 3VRJA 3T2QA 4JFZH 3MJ9L 5H2BB 3VFTA 3H9HA 2B1HL 4Q97A 4AT6A 5JW3H 1MIEH 4OCWL 3UBXI 3OKNA 4M62H 1FL3B 4OCNC 3ARGC 1AC0A 2V6HA 3Q0HA 1M7IB 2FBJH 1WQVT 5KS9E 2EDEA 2HKFH 1MHPL 1LEKB 1ZGLM 1TCMA 5A2IH 3KWWB 3O6LH 3MRDB 2DIJA 2HLAB 3K1KC 4S2SB 4Z7VF 1G7IA 2A0LC 2A6DA 4QOKB 4BUHA 3S37L 1HZHH 5GRXG 4FA8A 3VD7A 4OF6A 5F9WC 5LBSL 1ACYL 2YD1A 3HI1A 4G8IB 1AP2B 3NZHH 3LKPB 3SDCB 3BAEL 1JHLL 2HJLB 3MLXL 3IFNL 4KVCL 1R3JB 5AZEL 4XI5D 4F7PA 2C4FT 1A02N 1D3CA 1YEFL 4PRHA 1PG7X 1FV1A 1MRCL 3K8LA 4TNVF 4KUCD 5IHLB 3GSNA 2C3VA 3LH2H 3I84A 1A1MB 3U7YH 3M45A 1A3RH 5KSAD 4LNRB 1P2CB 4APQA 3QJHA 3RZCC 1RMFH 3EDKA 2ICWA 5KAQF 4G7VL 5IP4A 4P2QE 2D2OA 2R8SH 5I2IA 4X9FA 4LLMB 3ULVL 1J0KA 4MDIB 4RRPG 1A22B 2VO5A 3EZJB 4JFDA 5CEYA 1R3IL 3TCXA 1BPVA 3DV4B 1Y0LA 5J7CC 5IG7B 5JHLL 2SEBB 3MRCB 2YRZA 2Y07H 4GMSL 3O45B 3ZKSD 1IGYB 3T3PE 2EXWD 2YD6A 4P2YA 1F3DJ 5IMOA 3MRLB 2VLKB 4OLWL 2FGWH 5IHUH 3VW3H 3UO1L 1I4FA 2UY6A 4KH2A 1MRFL 3ARBB 4H1LA 1XMWA 3QAZB 5HDQL 3NVQA 3T09A 3DX7A 3FO9B 4R4BA 3C60D 4UTBL 4WI3A 1KEGL 4DKEH 3WFHA 3Q1SH 4XNXH 3FZUD 1HOCB 5F1NB 4PV9B 4HK0A 4K94C 3HUJF 3MRMA 2E9WA 5FGBC 1MCWW 3SDDA 3UAJC 5C2UB 1AJ7H 4JPKH 4EI5A 2ED7A 5T3XE 4NO3B 4BQCA 2Y23A 3IFNH 4KVCH 1E28A 4HKZB 2MKLC 3HZMA 4PJDE 3TN0B 4HPOH 1HHHA 4HGMA 2EZ0D 3VFSB 4JDVB 2IALB 1H15A 1RI8A 4JDZA 1IM9A 5C0DA 4PRIA 3KPPB 4U1GC 1QD0A 3ROLA 3NH7H 4JHAL 2ZCKH 2AJSH 2R69H 3QNXA 3KPLA 4EN3B 1I85C 1ND0B 1NDGB 1KIPB 4F3FB 4MB5A 3QIUC 3D85A 3MRJA 4NO0A 5HHOD 4UILL 3C8KA 2VDKL 3D18B 2Z91A 3IJYB 3WUWA 3P4OB 1XGPB 2Y07L 3AXLA 4GMSH 1TENA 4HXBH 4LSTL 4X80H 2R23A 5EZOL 3RTQB 4V1DA 4X5WB 5LCVH 1GSMA 4XWGH 2DIAA 1KCLA 2PO6D 4Z7WA 4OUOA 5JUEH 1BWMA 1JPST 5L2KB 1HYSD 4LLYB 3T77A 3MRBA 4QGTA 4NSKB 1J88A 5EFIA 1DUZB 3CFIC 3GSVA 5BMFL 1XIWC 3AS3A 5F1IA 5DWUH 2OMBA 1UZ8B 4RMWA 4HWZB 2NY1B 3UMTA 1KUMA 4POZC 1UB5A 4JZJB 1WGOA 3TFKC 1U8NB 4L8CA 1T89C 4OQTH 5CBAB 2HVKA 2VWEE 1A6VH 1NBZA 4JPKL 5I66B 1KXTB 1QSFA 4UDUA 2HMID 5FYJL 5DEFB 3U0TA 1FCCA 2R1YB 4P5TC 4YPGA 4LOUD 3BP6B 1RJLA 3VA2C 5MI0C 3CUPB 2O26U 3WLWD 1JPTH 1JZ4A 3CFBA 2CO7B 4KKAC 1TVBB 2BVEA 3HC4H 3P11H 4M61A 3NGBB 2UWEA 4DGYL 5L2KD 1U92B 4MNHB 1ADQA 3I3BA 4XC1H 1KC5L 1CICB 3DROA 1A0QH 1UWEL 3C2SA 3KPSA 3ECBA 4F8QA 5EUKA 2JIXA 1E4WL 5E9DD 4R7NB 4XPFH 2VNCA 5J3HD 1D6EA 5IBUG 4Z0BL 4OZFG 5KOMC 4P2OA 1FFPA 3RTQC 2W0FB 2WWMD 5D1XD 3NPSB 1YNKH 5MHSE 5IVZA 3W2DL 4JPIA 4U1SB 4WWID 4HG4J 3R8QA 3L7FA 5IW3A 3PHSA 5CHNA 1HDMA 4RGMB 4YGVA 3FRPG 5EOCH 2DQDL 4OZ4A 3AS1A 2VLME 4AEIH 4JZJC 1INEH 4F15B 1W72L 1CZ8H 3WCYA 2DLTA 1S7QA 5F8QC 3BQUC 3WNLA 5GSRA 3WHXB 5E03A 3ORJA 1F11B 3MO1A 5DUMH 3U0PA 5E8EB 4N5ED 2JELH 4JJ5B 5E4EC 3U9PH 5BS0D 3P0YL 5T3XD 1X5FA 4FFZH 5HVHB 3JTTA 4XRCA 1NCWL 1QSED 1YEJH 2BNQB 3BZ4B 5HGHA 3AU1A 1HINH 5IW6B 2C7UB 3GMRA 3EYOB 1A7NL 2DLGA 4N0FB 1XCTB 4K3EL 3PV7A 3HZMB 5C08B 1A0QL 2VXSL 1BBDL 1GGCH 3FB8B 1JMXA 3GBML 5HBBA 3G08A 4RQQA 4PLNC 4M1CD 1NAMA 1AXSB 1TETL 3UP1A 4UTAL 4BUGA 1CFNA 3ZTJH 5CJ5A 5MI0B 1EIBA 4PJBE 2C9AA 4Y4HB 3O3DB 5B39B 4Y5YB 1I3GL 4I48B 5E99H 1T80A 1TXKA 4IRSD 3WS3B 4Z8FL 4EOWH 4K9EC 1DUYA 5CZKA 4LNRA 3QO0A 2DQDH 2X2YA 3MV9E 1MREL 3ZDYF 2W60A 4L8DA 4AEIL 4DKEL 1OF2B 1BVKA 4QXGH 4CU8A 4EI5B 5EZLB 3QQ9D 1IGML 3MBED 1M1SA 2R15A 4XI5C 4JGUA 5L2KA 4QRRE 4M5YL 4EDWL 2DM2A 1Q9KB 1A6ZB 3TN0A 2EEBA 5CEXB 5CD3A 2IADB 4CN1A 2J4WH 1JBJA 4PJ5D 2XG4A 2YZ1A 4Z95L 4LBEB 1U91B 2W9DH 3MOBH 2UUDK 3U4AA 2BDNL 2PXYB 5J6GA 1F90L 4DW2H 2DB8A 1WV7T 4G9FA 1Z9OA 3R1GH 1FG9C 3O9WA 4UT9L 3UJJL 4F3FA 3WNOA 1T4KB 3GBLA 1VENA 1MWAH 2OSLA 4XP1H 1P7QD 1P7QA 3DV6B 3GBMH 3LEYL 3WV0A 1XF3B 3DXAA 2XWTB 1Q9OA 2HH0L 1YA5A 3MRFB 4LPVA 4XZUA 5IB1A 3RWHB 4HF5L 5C0CE 4FQ2L 4N5UA 4EUPB 5SX5H 4B7IA 4S0SD 2CJUL 4ODTL 2IG2L 3DVIA 3VE0A 3CFEB 5D96C 4LRNH 3IXTB 4HWNA 4CVUA 1ZGLP 2X4PB 4JFXA 2VXVH 4F7PB 4XPGH 2HFGL 3QNZA 2W0FA 2Q86A 4NUGH 5IM7A 5C0BA 5EORH 1WBXA 5ENWA 3UDWC 4ZOAA 1R5VA 3QUYC 3HE6A 1XGYH 1TFHA 4YDJA 3FB7A 3MUY1 1XGPA 5KOVC 1QLEH 5E5MA 4WHTB 3CLEH 3BMVA 4QRSA 2W60B 2WNGA 3ARFD 4Z95H 5J1AA 3HPLB 1MCJA 1WFNA 3T77B 2YXFA 4YO0A 1F90H 1F6LL 4DW2L 5IHBA 4GRWH 3VI3F 1PEWA 5CFHA 1FSKC 4AL8H 5I73C 5EU6E 1XR9B 4TVPD 3QULA 5IF0B 3QFDA 1XGRA 1KCSH 4W81A 5KVEL 5I6XB 3C2AL 1MQKH 3KDMB 5EOTA 3R8BB 5IBUB 4XPFL 3WFBL 5TFSH 4XP6L 2XFXB 3RDTA 2R1YA 2ICEB 2AQ2A 2XZQL 5TPWL 1RJLB 2EDTA 5LJYH 1GYAA 4LVEA 3PXJA 3LV3B 1OAUH 3FT2A 2Z4QA 4MVBC 4FFWD 2DDQL 2QQNL 5F9OL 4JZJA 2HAZA 3T65A 3MFGB 2X70B 3QXDA 3U0WH 3DUSB 3BRDA 2BSSA 3HR5A 4E41D 5CIPB 3VXUE 3PP4L 1IL1B 5EORL 3H9SA 3HUJB 1LO3L 2AEPL 2BZDA 5DJAB 3UX9B 3UTOA 4EN3A 5KSAA 1FVDB 3QO0B 2MPAH 5C8JA 1XF4A 2HRPL 3QIWD 2YHGA 5DFVD 5KSUB 1KJ2L 1ZVHA 4HIHA 3IDXH 1F4WL 4R96A 3C5JB 5FUOL 1JUFA 5FAAA 4U7MA 5FYJD 4DZ8A 4LEXH 2B8OT 1BZ7A 2FEDD 1R6VA 1MLBB 3UPRA 4AL8L 3SY0B 3DRTA 4MD0A 5ID0B 2PTTA 3VI3E 3HPLA 2DAVA 4FQXB 1BBDH 1GGCL 3MV7D 1BJ8A 4P3DA 4HUUA 1ZVSA 2BVQA 4OFKA 4Q9CA 4NPYB 3O6FA 4E5XB 2P49B 4HCRL 3VXNB 4P2RE 3GMPB 3WFBH 2OTUB 3QUML 5HYEA 1A3QA 5DQ9B 4ZXBA 2OL3B 2PW2B 1FDLL 5DJYB 4KPHH 4XP9L 4EQ2A 1PGRB 4MMXC 1BFVH 1QP1A 2FJFB 4O58L 1Q1JH 3VXMA 5MENE 3HG1E 1F3DH 4G6FD 5KAQG 2GAZB 5EO9B 3G04A 1EBPA 1Y18A 2NY5H 4HUNB 4PJDF 2D7MA 1IGTA 4RX4A 4QTHA 1PLGH 1JNNH 1HWGB 2YPLB 1U91A 3BEWA 3JWNC 5F89B 3V5DB 3VD5A 4PJ5A 5GISH 3GBNH 5B39A 3RFZC 2AABL 4Z7QE 1EHXA 1N4XH 2J4WL 5D1XC 5JW5B 2A6KA 2A9ML 2J6EA 3T2NH 1CT8B 2W59A 4I0PD 4ETQA 1TJIL 3FQTA 2OSLB 3H9SB 4YEFA 4XCNA 3VGHA 5KZCB 3I2CL 5A2KH 2BNRA 12E8H 4HIXH 4LVNB 2D4FA 1F8TL 4CJ0A 1OF2A 4LHJB 4YHLL 3KPRB 3PDOA 3ZKNC 43CAB 1MJUH 3AROA 5ELIA 2QSQA 3V79C 1WZ1H 3UXFA 1ORQA 2X1QA 1UWGL 5KSBF 2XQYK 4CN6A 2J2ZA 5IVXE 3SDYH 4X6FB 2XTJD 2VH5H 3GSQA 3MNVA 4JQXC 4DOHB 3E6FB 2NX5D 2X4PA 3W9DB 1CD9B 1DP0A 3KYKL 5J6GB 4QNPF 3TV3H 1T1ZB 4YDLC 4XP9H 2HKHH 4P2RB 1DQDL 1TVHB 4NNXB 3B5HA 2AEQH 2X1XR 4IRJA 1ADQL 5EC1A 4RNRB 2HP4A 3ALWA 5DA4A 5LWYH 4NN7C 3HNTH 3BZ4A 1NC2D 4NUGL 5C0JB 3C6SB 1A7RH 5A16A 2P8PB 2EXYC 1EX0A 3GMMB 4M9OA 1KT2A 3BVNB 2EYTA 2C1OA 5DK0B 2EO9A 2FHCA 4RMTA 2WMPA 5GISL 4E42A 2I27N 4U6TA 2A9MH 3DVNB 1RZ7L 2P5WA 4ZS7L 2A73A 2PKDA 1OT1A 3KPOB 2FX8H 3A67L 1R3LB 3IXAA 3WDIA 3S98A 2XPGB 4O02H 4ACPA 5AYUH 2OTWB 4KZEL 1CLZL 3HG1A 4RA3A 1JGUH 5BJTB 5BOPA 3M1BA 2H6PA 3RUGB 2ZNXA 5DFVC 3RDTB 4P4RB 4TUJA 2P7TB 2L0DA 1OGAE 3D39B 3QQ9C 1UJ3C 1MFEL 3PL6A 4X6EB 3LKRA 2EH7L 2VDPH 4HFUH 4V2BA 5BXFA 4XXDA 1QFWM 4RFNB 3TGXA 3H3BC 3PWVB 1F4YH 1G7PB 3H6JA 2H2SD 4C56B 1AGDA 1XGUB 4IS6B 1T83C 4TVSa 3MUGA 4Z7WF 3QR2A 4PJHB 3C8DA 5CD3B 4Z7OF 1Z3GL 5GGQH 1K6QL 3SGJA 3ZDXF 3NFPB 2BNUA 3QJFA 1TJGH 1CU4L 5CP7B 2QQNH 3MRQA 2ZCHH 5FYKE 1CFSB 1DSFL 1NKOA 1RZIA 2VMFA 1E4XI 3IETB 4YIQB 5DC9B 2CLVB 1N59B 2G75A 1G7HB 4DVRH 1R24A 3G5XB 4LCCA 5KS9F 1QRNB 5I8KL 1I8KB 1SJEA 2OXGA 4XXCA 2EE6A 2MQ3A 3H3PL 3OQ3B 4HHAA 1NCBH 2R1WA 4NM8H 3OB8A 4OIIH 4AM0B 2XWTA 5C09A 2WBJB 3DYOA 5BVJA 3KYOB 5HVWA 1NH6A 1RZ7H 3T1FA 3OAYK 1T04A 2IFFH 4HDIA 3RNQB 4UQ2A 1TTUA 1C08B 3PF2A 3ESUF 3IDYC 1QBAA 3DX8A 4AT6B 1CLZH 3IFOB 4WY7H 3EYFB 5KS9A 4UV7H 3PQYD 3BEVB 3QUKB 4U1KB 3WMSA 2H1PL 3CDGB 4LLDB 2R39A 5HVGB 4MNQA 2WBKA 4CMMA 1KIQA 2EH8H 4YBHA 1KPRB 3EO9H 2E6QA 5ANMA 4UIKH 1R3LA 3DSNA 4AMKL 2F5AL 5A40E 1MNUL 1I1AB 3QZWA 4XX1E 1HE7A 5E95B 2NXYB 4CGTA 2YSSB 5FCUL 5FA3A 1WEJL 1OSZB 2WP3T 3QI9B 4P4KC 4ALAL 3ARFC 3D39A 5GGQL 3NIGF 5DFTA 4JN2A 4K7PX 1MQ8A 4ONFL 2DQJH 4JFDB 3K3QA 3MRIA 3IAQA 4WHDA 2YPLA 5GRVK 4KI5F 4L4JA 1A64A 4PJ8C 3DXAD 2ITCA 2F58H 2LU7A 4RFNC 3PWPE 4PRID 3EJYC 1EH9A 1ZLUK 1S7XA 1J8HA 3ZL4L 3D3VB 2IPKA 5IOPB 3GJEA 5MEPA 3QUXC 4NJ9L 5BV7L 1DLHA 1HHJB 3O0RH 3MZTA 1EHLH 3C5ZD 1EJOL 1NLBH 2G5BB 4LLMA 2DS4A 4QHLB 4W68A 4U05A 4HJJL 4WEMB 3LKOA 5A3IC 1Y0LB 3KLDA 1AGCB 4R0LC 1QOKA 4H20L 1YC8A 3ZE1E 1FLRH 1J0IA 1JGDA 1T5WB 2VQ1B 1B0WA 4WY7L 3LN4B 3B6SB 5EA0L 5IB4B 5JO5B 2R1XB 1UKTA 4NWUH 3T0DA 2WUBL 2P5ED 1U8HA 3CVHH 3EO9L 1MAMH 1MNUH 1UWXH 1F45A 1GGIH 3HTLX 4S0TD 1FJ1A 4Z76A 2NX5B 4R4ND 4JFYA 5IWLA 4HUMB 1FL6B 1P53A 4IRSA 5HYQB 4Y16A 3MROA 3HAEG 4AEHH 4PJAE 3QIBC 4XAWL 4Y88A 3SDXF 2HLAA 5L6YL 2CRMA 1ADQH 1BLNA 4G80A 1QSFE 4WRLA 2PCPA 2A9NL 5KVMC 1PKQE 2I24N 3C5SB 3L1OH 3T0WA 3B8SA 4DQOL 4U3XA 5DK0A 1F6FB 1XGTA 2OM5A 1CVRA 2BSRA 2NXZB 3P4NA 3MV11 2IANB 4PD4J 4PJ5B 1NGZB 3MRKA 3WIFA 3DRTB 1MCWM 1EHNA 1MCSA 4XPAL 5C0RL 4WIQA 4M6OL 3WFCL 3RJDA 3L5IA 4R2GB 1MLCA 2GTWB 2X1WL 2YR3A 4E5XA 2DJ4A 1NCAL 3IFLH 4HC1A 4NC0B 3MJ9A 1KB5L 1L9MA 4XPTL 5D7JA 2IBZY 1FRGL 5F6HI 1K8IA 1HQRA 2FX9H 4JRXE 2VLJE 3IS1X 3A67H 2DL9A 1ZAGA 2N4IA 4WWKB 4LMQE 2FNBA 4X4YB 5ADOH 3SE4A 4PJIE 3VXQA 3MRCA 4LLYA 5D6DC 4RAVB 4X6DB 1MELA 1ZS8A 1CQYA 1RPQA 4HKBB 1V7MH 4TSBH 2CO6B 1MAML 1QLRA 2ARJA 2MQCA 3BE1L 3MJ7A 4IDJH 3SKMA 3VH8A 4ODVL 2XTJE 1I4FB 3MLZH 2H2SC 1BHGA 2OS7A 1ZA3A 1T0PB 4M8VA 2ZOLA 3LKSA 4G42B 4HWEL 2CXKA 2VZUA 3BI9X 5MERB 2H3NB 3SDCC 1MCHA 3M8OL 2EDHA 1CU4H 5DJCA 3ZHKA 4ETQB 3KPQB 3G5YA 1ACZA 3V52L 3M1BB 5DD6A 2VERN 1L6XA 2R2HB 3CFJA 4HIIB 5EBGA 4PGBA 5F3BB 1AI1H 4OCMC 1JV5A 3GRWH 3OAUH 4AK1A 4LAJH 4PJHF 3O6KL 3MROB 3R4DA 2VSCA 3CXDL 4M61B 2P5WB 3K8KA 2OZ4H 1KGCE 1AGDB 1XGUA 4IS6A 1X4XA 1FV1B 1FZJA 2VLJB 4U1MB 4BZ1L 3BQUD 3TWCH 5JLZB 1G9NC 4WFEE 4XXCC 1BJ1J 2PW1A 4OF3A 3NBNA 3AGVA 4O4YH 2NNAA 4OKVB 3NN8A 5B3JF 5KSBB 1CQKA 4JREC 4L8CB 5I1CL 1OPGL 4X7SL 4JKWA 1HI6A 1IGIH 3MLVH 5D7LA 4AIXA 5HGBA 4H8WL 5ETUB 1NFDA 1OTSC 4NZJA 2Z91B 1QRKA 4HC1L 3A6CL 1L7TL 1U3ZA 3CX2A 3DYPA 3OR6B 3S37X 4OGAD 1U3JA 5DLMH 1FE8H 2R9HD 4OLVL 2BOBA 5CP7A 2IBGA 3FO2B 2HYMA 2VQ1A 2EYTB 1IC5L 5D1QC 1YUHA 1JWSA 1ZTXH 1UJ3A 4V1DD 2F53E 4MA8L 2ICES 5F88A 3FHAA 5IEKB 5I30L 3MREA 2R2CA 3P77A 4CKVX 4LPCA 2IQ9H 2VLKD 3BKYL 1XH3B 2Q7NA 4LSUH 2ADGB 4KV5F 5A1AA 2YC1A 5EU6B 1DLHB 1OCWH 4XNZC 2KUTA 1S7WB 4QHUA 1S9WA 4HBCL 4YPGB 4MSWA 4BSWB 5F6HJ 3CFCH 2VR5A 1B0RB 5IB3A 5HGAB 2YKLL 4NFCA 5LVEA 3O2WH 5EIIB 1A7OL 4D8PB 2EDQA 4PR5B 4U1KA 4BK5A 3VXMD 1IFHH 2JKXA 1NDGA 4NQCE 4MZ3A 4NC1E 1Q38A 4YWGH 4POYA 3LZFL 1DBKH 5I1EL 2XTJB 4X8XA 4MAYA 5F7WC 5JQ6L 3HR6A 3MPCA 4Z18A 5FYKL 5D2LF 3T0VA 2OJZL 5L2KE 2XOTA 8CGTA 2YD8A 2EIBA 2MOVA 3BN3B 3G9VA 4CUCA 2DKMA 5I15H 3DMMD 4AEHL 5SX5K 3VG0H 3V0WH 1SM3L 2XQBL 5L8KB 5L6YH 4KK6C 3STLB 4NFBA 1MJ8H 1MCNA 2BHYA 4OM0H 1C08A 1Y6KR 5FECB 1RFDH 2APFA 4KDWA 2G2RB 4YFEA 5GZOC 4O51A 1DQTA 1F11A 3QUZA 1HSBB 3GK8L 2NCMA 4CN4A 4PRIE 2XA8L 1KCRL 3H9HB 5I1LA 5C0RH 4X0KA 5M95B 4NO5A 1CN4A 1E6JL 2QADD 3T08A 4NHUB 3RWEB 5D7IE 1UH2A 3QUYD 1CD1A 3RUGF 5GS0H 4M48L 4MA1C 4MJIE 4NQTA 2EDFA 2NLJA 2OR7A 4FXKA 5EC2B 4W4NA 4LF3B 4PJAA 3C5SA 5E2VH 3EW3B 4WTWA 3GSUB 3FB8A 3RKDC 3DXAE 3WS6A 3KYMA 3ULUF 1RHHA 1S3KH 5D1ZD 3L3OA 2VYRE 3VCLA 1AE6L 1URLA 3LZFH 5E8OB 4Z7NF 4PRPD 5C0CB 3TH4T 1AXTH 2PYEE 2ITCB 5JQ6H 4QRPB 3A6OA 5D6CA 2MCPL 5DYOA 3IVKA 3RGHA 4FP8L 2EIEA 1PG7H 3U30C 3PGDA 2R56L 1H9VA 1T4KA 2ZUVA 4MQTB 5HI4D 1U3HA 5DQJB 5JR1H 4MJ5A 5I9QB 2DJUA 2QADB 4AZ8A 5GSVA 1NAML 4X9GA 2J12B 4AG4L 2AKRA 1VESA 4B0MM 3CMGA 1OTUC 2ICWB 4QEGA 1PKOA 4X6CA 2C4XA 5BRZB 1VPOL 2YD9A 5IB1B 2E9BA 4KJWD 1AO7A 4DEPB 4NUJA 2P4AB 3A6BH 3D25B 1MLCB 2E6JA 2GTWA 3OAUL 2J5LC 3RUGE 1GVIA 4ZPTB 2A6JB 3LDBB 3CXDH 3L5WA 1KCRH 4RIRA 5HD8D 4TOYL 3WO4C 3D1MC 3S36X 1RUQL 1S8DA 2CRZA 5FYKD 1T1XA 2FSEB 2Y5TB 3QXDB 4EVNB 3GZKA 5F71A 3O2DL 3QIUA 4WFFE 4YE4L 1RJYA 3CU1A 5GRVL 5IFAH 3B3IA 4Y5XC 3WDJA 5DD1H 1NUFA 1RZ8A 4KHTL 5IVXA 3QCTH 4P5MB 4XNUH 2XACC 1UB6A 2XN9B 4DTGL 3NPSC 1OP5K 3V8OA 3SOBL 4HZLB 4N0CD 5F7YC 2DLIA 5B3NA 5DEZA 1NLDH 4PJAF 4JG0L 3FFCB 5C07D 3SDXE 4OLEA 5IFHL 5BV7B 3RVVC 2V9RA 4PLKD 4R26H 1LMKA 3E6HB 1XF1A 1HSAA 2VABB 3TBWA 5J0BA 1YJDC 1ZLVH 3I85A 1FE8L 5IHZB 5IEKA 1OB1A 2DWEA 3MV8D 3ZYJA 1VCAA 2I5YH 3VWKB 5BQ7B 1A1MA 1EZVY 4XCCL 4OF5A 1XZ0A 3SCMA 4LVOB 3EYQC 4KGJA 1GOFA 3UJIH 3E3QC 2HA1A 4X4XA 4WWKA 1CFQB 1KIPA 3JXAA 3SDXA 4MXQC 4ELMB 3RWJA 1JUFB 1FL5B 2Y36L 4XNMA 2QR0B 2FATL 3MRRB 5AZ2L 4YZFE 2V9QA 3CSPA 3GI9L 4ONOA 3NABL 5DZNA 3WXWL 4GRWE 4MHHI 3C60A 4GW5A 1V3MA 3MLYH 1KFAL 1NSNH 1UJ3B 3LB6D 2XI9A 3IAPA 4NDMA 1DLFH 3HE6C 2KKQA 1HNGA 3U7WH 3ARSA 3V7AE 2FZ3B 3F7YA 4U6HB 1IL1A 2GHWB 1T5XA 4XCYA 2A6JA 4PG2A 4XH2A 4FZEH 1QKZH 1YMMB 4GW1B 4NQDE 5SWSA 2H3NA 5FV1L 3VXRA 4XX1G 3AS0A 1T1YB 3S3JA 3IDUA 1UJTA 3RWIA 4GBXC 1I7TA 5IFHH 2VL5B 1T2QL 1F2XK 3G04B 2W0KA 1BF2A 3VXUD 3UROR 5I17A 4JGMA 4JRWA 3RNKB 4PJ9B 3ARDB 3D0LA 1BZ9A 1M7DA 2NY0D 1ZK9A 4HZLA 1DBJH 4Z9KB 1N0XL 1TVBA 2ZG1A 5CP3H 5MEQA 2W0PA 5DJ2B 1BJ1H 3VG0L 2JB6B 3BT2H 3Q6GH 2W91A 3MNVB 1R5VB 5I1LB 1U2HA 4XBGB 2P5EE 5EUKB 4G6AC 3LQZB 2GSGA 4MAYB 3VGAB 4JQIL 4U1IA 5GSVB 1EVTC 5J1AB 1OP5H 3MACH 2QADC 1KTLB 2VDLH 4O9HH 3L7FB 3ES6A 3O3AA 1EVUA 4M1GH 1U8KA 4NBZB 4OI8A 3FT4A 2WW8A 4FXLA 2PXYD 3TYGL 3DHMA 1DLFL 3LD8B 5IQ9B 4NSKA 1INDL 4P2QD 2JJTC 2NY0B 1IGJA 2BVUA 1QKZL 3OF6A 2J88H 4I5BB 1LNUA 2VZVA 4O51B 5TE6H 1G6VK 2X89A 1TVHA 3HG1D 4TNWK 2J8UA 5EOQH 5JHDB 4HT1L 3PGDB 1AKJB 3CH1B 1YYLL 4X4ZA 3ARFA 3I6KB 2FZ3A 3F7YB 3FMGL 1CFTB 2C26A 3SGDH 3K1DA 4Y7MA 5E2WL 1PBYA 1LP9B 3BP6A 3FFCE 1T6VN 3P0GB 3E2HC 3QWQB 1YNLL 2VDOL 1GZPA 3C6SA 2ZZUT 3B43A 1UVQA 1J10A 1DBJL 2XRAH 4ZAKC 1I1FB 4R97C 3VJ6A 4H8WC 3VXSA 4ORZC 3EOBB 5D6DA 3WIIL 4LRIA 1D5IL 4LPUA 3UYOD 4M02A 1U92A 2I9LA 3GIZL 3H9SE 4H26A 1QSVA 1WCBA 3QDJD 5TDPB 3L5XH 1F3JA 2X9XA 2NTFB 5AAMA 1NBYA 5KJRH 4JQIH 3WIHA 5F7LB 4NZTH 4CAGA 5CGTA 2IMMA 3PHOA 4Y4KB 5JHDD 2DQUL 3B3IB 4Q9BA 5HDBF 1LDPL 3RY6C 4M1GL 4YFLI 3F5WA 3RPIA 2F54D 4J8RB 4OF8A 3HNVH 5SWZA 3ARBC 5FEBA 3IS0X 1SEBB 5FK9B 5ID1B 4MJID 4CVZB 4XNUL 1A6WL 2EYSA 3BVNA 3JVGA 4JN1H 5B38A 2C3GA 3OL2A 5DYOB 2VC2H 4ZFZA 5EUOA 3QNXB 3DUUA 3MCLL 3STLA 1RUKH 4Z77A 1P6AB 3EYVA 4MA3A 3OWEA 1JK8B 2CIKB 4GT7A 2NMSA 3T4AB 4NC1C 1FC2D 4Y2DD 5DHVA 3MFFB 4FQXD 4QHKI 1MRCH 2PYFB 5GRUH 4Q6IC 4H25B 3BZEA 1LK3H 1Z9SA 3MLRL 3MV9D 3RWCA 2XXMB 3O9WB 2WINB 4OZGA 1X5IA 1YY9C 4Q0XH 5HJ3B 1IAIM 4N0FA 3LHPH 4GKZA 1GL4B 2D9QB 4LQFH 3WNKA 2GUOA 5I17B 5C6WH 3F62A 4X5LA 5ICYB 2HT2C 3EYSL 3O11A 4ZUWA 4GW5B 5F9WB 1IC7L 1WC7B 3B2UD 1UFUA 1DQQA 1U8NA 4YHPB 4ZTOL 4K7PH 1WVZA 3IDMB 1WK0A 1VB9A 2DQUH 4HKJA 4I3SH 1P84K 4BKLA 5CSZB 3PG2A 5DJXB 5ACZA 4NJAL 3QHZH 3ULUE 2IBZX 3HS0B 3U82B 4ZFOB 5FO9B 3THMH 1MJJB 4C4KT 2ORBL 5BJTA 1U8PB 2DQHL 3L6FA 2X05A 1A14H 4KXZH 3RVXD 1QFWL 4Z5RB 3QQNA 5IM7B 2NR6D 4Q6IB 1A6AB 1A6WH 1M71B 1P7KA 2R23B 2J6EH 4I18B 2YRPA 5GRWA 2K3TA 4IRJC 2F9BT 1CDUA 5IQ9A 3ROOA 4HUWB 1J5OL 1A6ZA 4JREB 3VFOB 15C8H 5CSGA 3U2SB 4L8SA 3OXSA 4JHBA 5MEOB 5CUSL 3LN5A 5DQDH 4TTDC 5HD8C 3RHWF 3GIVB 4P3CL 5T33H 3IDIA 4YNYA 3I75A 3SCMB 4PJGF 5GRUL 3TEUA 1IARB 2I60L 3MGTB 3RQ3A 3CNKA 3B6SA 3BP7A 3NA9H 1VGEL 3UTPD 3U46B 2AGJH 1ETZB 3U6RB 1X4ZA 5B8CC 1FL5A 4XNMB 3U36B 3UZVB 2ZCKL 1HXYB 1V3JA 1FPTH 2BSED 1D9KC 4LCIH 5T1LB 3RIFF 3ULVF 5I8EA 3SJVE 3T0EB 3EYSH 2YSSA 5JQHC 4AYFA 1AR2A 4JFPB 1VA9A 4NZRH 4PTTB 5F1SA 4HXBL 4J4PC 3Q5YA 4HH9B 2P24A 4H5SB 1KPUA 4LCUB 5A2FA 1BIHA 4JZNB 2R0KL 2JIXD 3FL7A 3WO3B 2Z8SA 1E6OH 1TZGH 1HH9A 5ICXB 1F13A 1R3HB 4GW4B 2DI9A 2ORBH 3L9RA 4UT6H 4LGPB 5I0ZA 1T1YA 4OZFH 2BY2A 5BMFH 1FNEA 2BNQA 5DWUL 1A14L 3GJFK 4GUPB 3L3DB 3CSBA 3VFVB 5DRNB 4MXVE 1WZMA 3OTTA 4OD3H 5L88L 2YWZA 3TT1L 1LWRA 4D0CA 3PL6B 4PPTA 4TUOA 1EMTL 2ITDA 4FQ1H 1T21A 1A6TB 4OQTL 2UWEE 5EOQL 4ODHL 4BZYA 4L4VA 3LS4L 4NKIL 1KPVB 4HUXA 4P23D 4RGNB 5D7JB 5IMKB 1G84A 3HFMH 1N6UA 1SEBA 4LSRH 5LKNA 5CUSH 2Q6WA 3DGGB 1PSKH 5GS0D 4LIQL 3HZKB 5DZOA 2ADJB 3JWDL 4ORGA 3K74B 4K23L 4OZFB 1JK8A 2CIKA 2EIDA 1LP9E 1TLKA 4UI2A 3RX7A 4PS4H 1N59A 3KJ4B 2UYLA 2V5RA 4QCIB 1YNTA 1HXMB 3WS6C 4N0CC 5EOTB 3GFUA 3QP3A 5K59E 2QQKH 5I1DB 2R0WL 1H3PH 4RWHA 1RK1B 3BZEB 5HGGS 3GI8H 4ZXBB 4U6XA 1U8OB 1C1EL 2I25N 3NFNA 5C6TL 4P9MH 5FYLL 4PRPB 5C0CD 3OKDA 3QWRD 1O7SA 1ITBB 1LDPH 2R0KH 4XB7A 1MRFH 5KSAC 1I8MA 4ZO6A 2NY0C 4YDIL 3G08B 3HNVL 4RQQB 5EUOB 3QEQE 3C5ZB 3TVMC 1NGZA 4MHHG 2EKSB 3B2UC 1NGXB 4XWOC 4B53A 4OGYL 3ARDC 4GAJH 3HKFA 4RA0C 4EZMA 1Q72L 3MCLH 4Y4FB 1WZKA 1CLYH 1HH9B 5H35B 4RGOL 4UDTB 1KEMH 5T3ZH 3QIBD 4ZQKB 2NYYC 3KPQA 1LO2H 5D2LA 3VGBA 3LEXA 4LSRL 1MRDH 5E4EB 1UENA 3DTXA 4HMCA 3LCYA 2ZSVB 5I1JH 1PSKL 1W0VA 3L3JA 4H26B 5DMKA 1NCWH 1TTGA 4ZPVA 4IIQB 3FQRB 5I2IB 4L3EA 1DQQB 4YHPA 2UVFA 1CL7H 1F4XH 3DETD 4WO4B 3MLTA 1DANU 4P3DB 4JM2D 3QDGA 4QWWD 5D7IF 3NTCH 4OKVA 1VERA 3FO1A 4UILH 3V4PH 3S88H 4PBVC 4ZTOH 3RBGA 4JFZL 1MJJA 4QHLA 2B1HH 5ESAB 1J1XH 1A4JB 2EYRA 1XF5A 5E99L 3PWJB 1MIEL 3RWCB 3PGFH 2R2BB 4P46B 1CIUA 5F7UA 4KUZL 4F57L 1DEDA 4ZOCA 4OGXL 3MLWH 1IGFH 1RUPH 5I1IH 1Z0NA 3QPXH 5C0EA 2CIIA 2XTLA 4OZIE 1FO0B 2ZUQC 3O8XC 9CGTA 2IAMD 4OD2A 1JGLL 3L3HA 1M05A 1FYTE 1ACYH 2BVTA 2EKJA 4OD1L 3I75B 1TCRB 3V5DA 1JHLH 3O2VL 3FAXA 1IC4L 5CSZA 4Y0GA 2ZOLB 2YD7A 5JW5A 1QYGH 2ADGA 3MOBL 4D3CL 1BD2A 3KNBA 4ZUVB 5TF0A 3PWUA 4PJCE 5EU5B 2W38A 3N9GL 2MHAA 3REVB 1L7IL 5GS2H 2ENSA 3KPRA 3PDOB 4GG6A 5CINL 4XCEA 4OJFL 4PJCB 3QJHB 1G0YR 1RU9L 4PREB 3ALXA 1QSZA 1UWEH 2YPKB 4MAYD 4WEBH 3TH3T 1JPGA 1MFAL 5CGYC 5DFWH 3MXVL 3T3MF 3DBXB 4MGXA 5HGDA 1RIUL 5K9JL 4Z0BH 2BOCA 5C0GB 2R4RH 1CFBA 5T1LD 4DN3L 4JFHD 4DEPC 4PJHA 4JY5H 1XF4B 1PJ9A 4J2XA 3WNNA 3D0VA 4NNXA 2Z9TA 3HRZA 5DD0L 1LE9B 5F7NC 5I1DA 3OKLB 1UB5B 1MHEB 4U6VL 4EN3C 4YH6A 1A9EA 1PQZB 4OGXH 5AWNH 4WVRA 4D2NA 3O3UN 4N9GA 2CLVA 3D9AH 3KJ6H 1CR9H 4FQCH 1U8QB 2ID5A 1R3KB 5AUMB 1MF2H 1NMAH 3E1F1 3TPUA 2GJ6E 2P5EB 1EFXB 5E6ID 3WSQH 4ODUB 3DYMA 2JELL 4GG8A 4YGAB 2VLKA 3RGVB 3MXWH 1ZHNA 2E9JA 1KGCD 4QHNA 4K2UH 4BYHA 2IMNA 4NKQB 3WFEL 3BWAA 1G0DA 4OZHF 5DJCB 1M05B 3QFJB 4KMTH 3EHBC 4WJ5B 1QFUL 3JZ7A 1AGFB 1HINL 4RX4D 4MA1B 2K7PA 5ESVB 2ZUTA 4P2OB 4U6XB 3FB6B 1LHZA 4WTXA 3S34L 1NCDH 1MQKL 1C5BH 4S1SH 3MXVH 3C87A 5I1AA 2QQKL 5EZJB 1RIUH 2DM4A 3DVGB 5IB5A 4FXKB 1VFMA 4UTAH 2R4RL 5GZND 1KELH 1RIVL 4OV5A 2XZQH 2L7JA 3SKJL 5GGTH 2W1NA 1LD9A 4HIJB 4RMRA 3TBTA 4QTIL 2APVA 2A6IA 3CDCA 2ADJA 5H94A 5DJ6A 2I9TB 2DDQH 5EB9A 2VDML 2R0ZL 2X4SB 4QY8B 2HKFL 5IBTL 3G6JF 1G7LA 1V3LA 2VDRL 5DQ9A 2LTQC 5IMMA 5GGVH 1SVCP 1JI1A 4X0KB 4GAJL 5H37H 5F7EH 3B5GA 1IGMH 4K3HA 1U93A 4R4FH 5E6ZA 2WIIB 1SJXA 2MMXA 4P46D 4ZFFB 1W0VB 3L3JB 2YZ8A 3H7BA 2P8LA 4BSVA 3U9UB 3IRZA 5I8EB 3T0EA 5FYJH 3F8UB 4IRSC 4NN6B 4BSJA 4ONHB 1MRDL 1NL0H 2Y4SA 5H2BA 2CIIB 4RDQG 5D1XB 4GAGL 3P77B 3BZFA 1AIFA 4L4VD 4XBPB 3MLTB 5DMIH 4MB3A 3QEHB 2IALA 3OF6D 4POUB 4WHYG 1UACH 3S5LG 5T5FL 3X11A 1F97A 1QHOA 1T2XA 1VFOA 4RNRA 4DUWA 2WV3A 3UEZA 4MNHA 3TBWB 1CL7L 1ES0B 3S34H 2JLLA 5FYKU 1YPZB 2P8PA 2FLBT 1QACA 1U3HB 5DQJA 1R3IH 3V6FB 4XCNB 5C92A 4MJ2A 3VFNA 5DURD 2CUHA 1NANI 1YNKL 5GGTL 2E7HA 3DSFH 4NZDA 5IVNA 1HH6B 2FGWL 3TNNA 1T89A 4L3AA 5C0IA 5D5MA 4EDXA 4KZDL 1YDPA 5HYSG 5HGDB 3KPOA 1I9EA 4P4KD 2VABA 3HUJE 3SO3B 1NGPH 5I1IL 1WWAX 1TCRA 3PWNA 4XNXL 3ULVD 2H6PB 2Y5EA 4GAYB 2BNRE 4RISL 3FQUB 5IOPA 4XBEL 4R4FL 3MLSL 4V2CB 3SGEI 2B1AL 3OKLA 4IRJB 4LHUB 4QRUB 4JFED 1N5AA 1KYOK 4KROC 3MRGB 1IC4H 5C9JA 2DQGL 4I13B 5DVMA 4P46A 1FN4A 4L3EB 4HPOL 4OKDA 3CVIH 1L7IH 3MV9A 1MFCL 5D7IA 5SWSD 1KN2L 1PX4A 4J3XA 3DBXA 1UQSA 4JB9L 1UACL 5EBWA 3NH7L 2R1XA 1WZ1L 5KVEH 4S10A 5DMGD 1TJHL 1OQOA 1IAIL 4TTGA 4LCWD 1A1OA 5BRZD 4ZYKB 2DWEB 1XEDA 1PY4A 4KK8C 3MV7E 5DJ2A 3HE7B 2B0SH 2CD0A 4PGEA 2VLJD 3BH8B 1E28B 5T1KD 5JUEL 1EXUA 2P7TA 3LY6A 2E27H 1OWWA 1LE5A 4XCFH 1AQKH 1X6NA 3VFUB 4AH2A 5LWYL 1H8SA 4DGVH 3FOLA 4ODUA 5CZXD 1MH5A 2BY1A 1CR9L 3V4UL 1CE6A 3SQOH 4KAQH 5T1DH 1Q9WA 2I9TA 1HKLL 2V9TA 1WFUA 1P4LA 1X7QB 5E8EA 2Y6SC 3UTQB 4C83B 3NPZB 4GRLA 2GKIA 4U6HA 1WISA 4OQ1A 1T0MA 2D7NA 2MJWA 5E8DL 1U3HC 1GPOH 4JVPA 2FX8L 3MBEA 3JBG7 4AIZA 3CVIL 1C7TA 1AO7B 1KN2H 5HGHB 4Z7VA 5C0ND 5CGYD 4M8QB 3JV4B 4MLSA 4HJGB 4GLRI 4LGRB 3JTSA 3NFSH 1E0OB 3PHQA 4TVPE 4UBDC 3UTTE 4MJIA 1IAIH 2APBA 2EH7H 2VDPL 4S1SL 2LU4A 4TUKH 1Z9MA 3GRWA 5D7IB 5C0AB 1F02I 1RIVH 4FABL 4PJ9C 4Q58C 3GKWH 2IPTH 5CZXC 2WIMA 4ODTH 4J3VA 2X70A 4F37K 4O00A 1V05A 4QYOB 2J8UB 5JHDA 4J3UA 5IMMB 1AO7D 3EO1A 3DO7B 2CGRH 5ESVA 4ZAKB 3JV6B 3BRGC 1CFTA 4ZOEA 2NY5L 1E4KC 2LTQB 4PGBB 2Q86B 1GZPB 3ZYIA 5C8JB 1AFVH 3BH8A 1TPXC 4P9HH 3BHBA 3JV0A 3MRDA 1NEZA 3FQXA 5GGRA 1S5HA 3ARGA 5HDLA 2D31B 2WBJD 1JE6A 5DUML 3C5JA 3QDJE 3QDME 4QXTA 4HLJA 4PRBB 4JKKA 1J11A 1S7VB 3IGAA 3QEHA 4NQSB 3P0YH 4X4MA 5DK2B 3FONB 3NA4A 5TDOA 4Y16B 3T3PF 3MYJA 5EUOF 5DI8A 4Y4KA 3MRHB 4X6DE 1MJUL 3G5VA 5DS8A 4EN3D 3QXAB 5GS1C 4PB9H 1DQJA 2HFFA 1A7NH 3TO4D 3LRGA 3AY4A 4DZBA 3RIAK 2ARJQ 2JJVA 1QNZH 2WIIA 2XKNA 1UG9A 1QR1B 5SWZB 3VXTB 2H2PC 3VWKC 4AMKH 2F5AH 4KKNA 2DTSA 2PTVA 1M4KA 1ROWA 3T4YA 2YA0A 3TA3D 1EK3A 1FH5H 2WK2A 5D1XA 1IGCH 5E94B 4HW6A 3U4BH 8FABA 1YUHB 4NQXB 1DQDH 4XH2B 4B50A 1L9NA 1CFVL 4LLWB 5D2LE 4RMUA 2C4FU 3F65A 5FGBA 1VKXB 3KXFB 3WXVH 1TDQA 4JVWA 2EE3A 2G9HA 1MCPH 5EU6A 3CH1A 1A7PH 2PYFA 3SE4C 3B9EA 3H9YA 3WFHB 1RY7B 1NBVH 2XZAL 3TT3H 1N0LA 1JVKA 5D5ME 4ZO7A 3IKCB 3W39B 3QIWC 3I50H 1CD0A 1JI2A 2KZWA 4MQXC 3MCKB 4R7DB 4KQ4H 4UNVA 4NQEA 1CFNB 1G9EA 3IDXL 2OZ4A 3RL1B 1UADC 3N1QC 4G6FB 2IANA 4XHJC 4RMSA 1BZ7B 3BPNC 5H37G 2Y9RT 2V7NA 2B39A 2AJUH 3FFDB 5IKCA 2RAMA 5GGSB 3CK0L 4YFDB 1AD9A 5HHVL 1P7HL 2F8OA 3UC0H 1KJMA 4HUUB 4LHUA 1YPZF 1Q0YH 4JAMB 5D7KE 1U8KB 4HF5H 3HHRB 2FX7H 3ZKXC 5DRXB 4JY6A 4L29A 3S7GA 1U2CA 1ZT4B 1M7IA 3RA7H 2IG2H 5K33A 4QRQA 1BBJB 5L2JA 2CDFA 1KV3A 1Z3GH 4LAQL 3ROOB 5DJZB 2X9WA 3CU7A 4OLYL 4WFGE 4V1DB 4OZHB 2E27L 1QHPA 4HS8L 4L4VE 4DCQB 5KVGL 4QF1B 2UWEF 3O4OB 2Q76B 1JPFA 3MX0A 5DA0B 4DGVL 4RMVA 4OZHE 1J0ZA 5L7XL 1JNNL 1UM6H 5E70A 1NGWB 3L5WB 3LIZL 4HGWB 1H0DA 1LEIA 1HKLH 2BMKA 3F58H 5J1TC 2Q7YB 3N1PC 1YY9D 4HAFA 1FNEB 1KB5H 5B8CA 2WINA 5DR5H 1FBIL 4LU5L 4E41B 3T2NL 3L3GB 5DUPL 3G6DH 4EUPA 5DEFA 2IGFL 2HT2D 3CXHJ 2YPLD 3RVUC 2HT4D 2J5LB 1OTTC 1IGTB 4TPRL 4XNQB 1JZ7A 4H5SA 4YHLH 1JFQH 1FORH 4ISVA 4ERSL 4F33A 3CLFH 4ENED 5T3XH 1EAPA 2V5YA 4DOHE 3LPFA 4LPWA 3HB3D 4YXLH 3CSYB 4KGLA 2GITB 4QRPA 1BQSA 5FUZL 1WF5A 3UC0L 4JKPL 3GSQB 5FO7A 2FO1A 3MA9H 1OB1B 4XP6H 3FB7B 3I6GB 1KB9K 1NAKL 2QSVA 1ETZA 3GKWL 5FCUH 5TPWH 3EOTH 1OM3H 2D0FA 1J0JA 3RA7L 4GJTB 5KVDH 3TESA 1YNTB 3FOLB 3MV7B 4H88L 2AKRB 4X9IA 1K85A 4YO0B 4ZODA 1NEZB 4Y8AA 1EJ6A 4PTTA 4NUJB 3BOVA 1RZJL 3L3KB 5L7XH 2X7LB 4P9HL 1CK0L 2IQAB 3NOIA 1TITA 4JO4L 5DD5H 4FQHB 3KYOA 2GI7A 3J8F7 2QLVB 4HKXA 5F88B 4EJ1C 5F6IC 4KC3B 5IB2B 1KLGB 1RULL 5CBAA 5I66A 4YJZL 3G6DL 3W11D 1LEGA 4O4YL 2HFFB 5HI3C 5HJ3A 1LO4H 1P5VA 4H20H 3WIHH 5JNYA 1RUMH 5EZIH 3D2UB 1JFQL 2HG5A 1YYMH 2CKBH 4YEEA 4I0KA 4YDLB 1WC7A 3RVWC 4LK4A 1PZ5B 4TSAL 1UA6L 25C8L 3TF7C 4S1QH 1FZKA 1MCDA 2PTUA 1KPUB 3QEUA