3PGDB

Crystal structure of hla-dr1 with clip106-120, canonical peptide orientation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
191
structure length
185
Chain Sequence
MGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Bidirectional binding of invariant chain peptides to an MHC class II molecule.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 185
sequence length 191
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pgdB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3pgdB01
3PWUB 2WBJB 3QSKB 1JRHL 3FQRB 4XVJH 3FONB 3AFLA 3IS0X 3EFFA 1U8JA 1IEBA 1PSKH 4PV8B 4ZDHB 4Y4FA 3MLPA 1KTDA 4KV5F 3NZ8A 3RVTD 3CDGA 5LAXA 4HFWA 1MCOL 1HHGA 4DFIA 3INUL 1FFNB 4OB5L 3U30B 1MAJA 5FA3A 3GJFA 4BK5A 2YKLL 3H2WA 3IJHB 4KJQC 1MQKH 5FGSA 1U8IB 1JHTB 3JWOL 3MRIB 3MLUH 2V5RA 3E3QC 3A67L 1G6RB 5C0BD 1KCVL 5T3XD 3QJFA 1NC2D 3BKCH 3VA2C 3AM8C 4PJIB 1NGZA 4YHZH 1AE6L 4GAJH 3T0AA 2QSCL 4N0UA 2AEQL 3RWIB 2ILLA 1F6AB 3O3UN 5MEQA 1Q72L 3HMWL 1OF2B 3B2UD 2ITDB 1KB9K 3WDJA 3QUZB 5M95B 4X6CB 2NY2D 4LSVH 5L88H 1SM3H 2PW2B 5E2VH 2P8LB 4FXKA 3O4LD 4H1LG 5IM7A 3ZKMD 1GYAA 1S7WB 3RZCA 5GJSL 4YDLC 1AKJB 4QRSA 4OZIB 2CLZA 2YUVA 3WFHB 2CK2A 4WV1A 1S8DA 2DKUA 1TVDA 4HJ0D 2J88L 5EU5B 1IKNA 5DDHA 1ACZA 4K7FA 3WIIH 1C12B 4EBQL 1JWMA 1LP9A 4ODUB 5I66B 3WUZA 2X1PA 3F7PC 2B8OT 2NXYB 5GHWH 4EOWH 3KNBB 1AQDB 4OQ1A 3OKMB 5EBMA 1SYSA 3OKKB 3VFMA 2DJSA 5TFSL 5IHBA 2BNUA 1WFTA 2V7HA 1DEEA 2NY1D 1D5XA 5ACMA 2IPUG 1AHWB 3TV3H 4J12A 3I75B 4BYHA 2ICEB 2HFEB 1L7IH 3GSRA 4JPWH 4K8RH 4MNGB 1MHEB 2B4CH 3K80A 1O5DT 5SWSE 5DURD 2IANB 2HH0L 5I2IB 4LARH 1R3IH 35C8L 2FR4B 2XG5A 2VABA 3TBYA 1AD9A 2Y06H 4YXLH 1V7MH 5MI0C 1H8OA 4NJ9H 4YDVA 5F9OH 5HYSG 1GZQB 3JWOC 3DECA 2VDLH 1I1RA 4WW1A 3BMWA 4Z9KB 3Q6FA 4Y2DA 5JIKA 4O2FA 5C0RH 5FUCE 1BBDL 4PJFB 5D1ZB 4HCRA 3QWOB 4ZO8A 2X89D 1FL6A 1G1YA 4G9FD 5B38B 1OT2A 4FQPA 3ULUD 2IEPA 2CXGA 2GSGA 5IKCA 1GPOH 5KVGH 3MRRA 3W0WB 1Y0LA 2B0SL 3ARGA 5GZND 1WCBB 2UWEB 3UTSA 5F3BA 3FOMA 4Z0BL 1TZHA 3QG6A 1PBYA 3G6DL 4LCUB 1JF5A 4QO1A 5FKAA 5CJXC 1P1ZB 2CJUH 3QJHA 1BVLB 4QHLB 5F97E 4LLUB 1CXEA 4CNIB 1U91A 4YXHH 3CVIL 4YHIA 3LKRA 4RQQA 4NWUH 1JGEB 5IW6A 3K0WA 1I9EA 1N5AB 5TPWL 2OL3B 3DUUA 3UTPE 5E2UH 4PJGB 1FE8H 2GCYB 2HFGL 2NY2C 4WIQA 3L3KA 1LK2A 3DUHA 4PG2C 1KCSH 4S0SD 4PRID 3QIUC 1ND0A 3PV6A 4RA0C 5L0QC 3MV7A 2WINB 3LPWA 5F70A 2GITA 5DQDH 4GRMA 3S97C 3U7YH 1C5DA 5TF1H 4FQJH 4HLZG 4JCLA 1IFHL 1LDPL 1NAKL 2XQBL 4PJ8A 4WI4A 3UP1A 5C0GB 5LXGH 4PUBH 2NCMA 2QHRL 1XF2B 5C0AD 2H26B 2PW1A 4GS7C 1CVSC 2C4FU 3MJ8A 4KJPD 3TO2A 3DRTB 5E6ID 5H2BA 1JTOA 4H8WL 2VXVL 2QSTA 2NR6D 3A6CH 4IJ3C 1XF4B 4PTTB 5GS2D 2EYRA 2EYSB 5CJOH 2NY1C 3RNQA 5KVFL 3TIDB 5EUOA 7CGTA 3TBVA 4HS6A 3MRBB 4JM2F 5EZLB 2Q86A 1V8HA 4OLVH 4LCYA 1ITCA 4Q6IC 1JZ7A 3SGJA 1IL1B 3MNVA 3PWVB 2YPLD 4I18B 4PB0H 4X8XA 1FCGA 4BSJA 2AJ3B 4P3CL 3KPNA 1WISA 3UTZB 1C16B 3BGMA 5ID0B 4Z77B 3R06A 5BZWB 4K3JL 3DMMA 5IQ9A 1FO0H 1SY6A 5JORA 5H8DA 4WO4D 2IC2A 3BYYA 1A22B 4YBLC 4U7MA 2IGFL 1AFVL 1T66D 1JCKA 4ZOCA 3C60B 4DQOH 4BK4A 4HKZA 4JFOA 5FYKD 3SE8L 1QR1B 4JDZB 2P47B 2IPTH 2WQ8A 2XTLA 1TPXC 4F7PB 5MENE 5DUBB 3SBWC 3ARDA 2VUYA 3SDAB 1J86A 4AH2A 4N90E 4JY6A 3WJJC 3WSQL 3ULUC 5AYUH 3DIFB 2OLDA 2MQ0A 5DMGC 1RZGA 4JQIH 2X10A 5GZNC 3B6SA 3CVHB 5E2JA 3NFNA 5JW3H 5D2NE 1EEYA 5FM4A 2R4SL 1U8NA 1KJMB 3D25B 2PO6D 2LTQC 5CINL 4F58L 4LVOC 4WCYL 2OI9C 5SWSA 4X6DB 2FSEA 3I6GA 3L3HB 2J8UB 3S88L 1FNSH 2W0KA 4ISVB 5JXAH 1SJEB 2CDFB 1Q9OA 3QCVH 4HIEB 4QT5B 4KKCD 5SWQB 5HHMD 1NMAH 5T1KB 2OK0L 1U8LA 5FO7B 2Q6WA 2EDDA 1JGDB 2DTML 2WBKA 1HHIB 1CLYL 3O3DB 4NCC2 1OGAD 4FTVB 2PF6A 2IMNA 4H8WC 4LP4A 2DWDA 1KIQB 3T2QA 5HHNB 4JO3H 4IRJA 4YPGB 1QFUH 4WHTA 2J7LA 3OZ9H 3D69B 4M7LH 4QTHA 2B5IB 3AREB 4JZOA 3BKJH 4XP6L 2AJYL 5CBEA 3GIVA 4P59H 3QEQE 5FA4A 1FFRA 5B8CB 3KPPB 4JVPA 5IEHA 3OAZK 3SCMC 4KJPC 1IGYA 3D39B 4TVSa 5EZOH 5MEOA 5E6IC 4DEPB 3LEYL 2V9QA 3GSWA 1HIMH 2NR6C 4KROD 4RGMB 4PGCA 3UTTE 3BJLA 1VFBB 3BUYA 4PJDB 5IBTH 4WNQA 1NBVL 4RFNB 1CT8A 4GMTL 5LJYH 3QUMB 4S1RH 4DKFH 1MRDH 5HI5D 3P73B 5EZJB 4XPHH 3RNKB 1AJ7H 3L3IA 1EHAA 4P0DA 1CD1B 4UINL 2MQ3A 4X9HA 3DHJA 2Y36L 1T22B 5E8DL 1J1OL 1SBSL 5HHQA 4YGAB 2XOTA 3TH4T 3W11D 5L8LB 4ODHL 3NCBB 3TH2T 3KJ4B 1G7LB 5GGVY 1M6OB 3EKCA 3QDMD 5HJ3A 2EYTB 3MBXL 4HAGA 3CSGA 4KQ3L 3DO7B 1BJMA 3MROB 2MKWA 3CUPB 1SHMA 2HT4D 4JM2A 3VWKD 4D0CB 4WUKH 1QFWL 4ZTOH 4R2GB 3E8UL 3OF6A 4IRSD 5JHLH 4TUOA 2C4FT 4LLQA 2X4QA 2YUWA 4LAQH 4R7DB 3TP4A 1Q0XL 2CIKB 2R1YA 4RMRA 3I2CH 2CUMA 3RHWF 2FLBT 2F54B 4JN1L 1J87A 4JFFD 5ID1B 4WI3A 3P4NB 5IK3B 4R8WL 2R2BB 1ZLSL 4IHOA 4OIIH 4V2BA 4MQTB 5JUEL 4QRUB 2PO6C 2DLTA 2VQ1B 4Y5VA 1EK3A 4YHLL 1P7KB 5GS0H 1QA9A 4HPYH 4OSUL 4GLRI 4TPRH 5CGYD 1KJVA 1R3HA 3K74B 1P5VA 1YMHB 4KKCC 3K1DA 5DRWB 3H6JA 1IC5H 2A6IA 2HTLD 1S3KL 3GNML 4I9WE 2J3SA 5CSZB 1I7RA 4N8VA 2VZSA 4IDJH 4OLYL 2JTDA 1ZHLA 2G2RB 3QUKA 5I71C 3MCG1 2HJKA 4YHYC 3VXOA 3NOIA 3C6LD 1RQ5A 3X11B 5IFHH 4DGYH 1DEDA 2I07A 2M1KA 4YDJA 5DTFB 3ZMRA 4RSVA 2DQHH 5CCKH 1OHQA 1W2KT 4ZFFB 5MENA 1HI6B 1KB5B 1TQBC 4LMQE 1AGBA 3BWAB 4L3CB 5EBWB 1T1ZA 1A21A 3CMGA 3G6AA 4M4RA 1CG9B 5EU7E 4AG4L 3ELAT 1J18A 4G7VH 4ZAKD 1LE9B 5A16A 2W0FA 3DRQA 1UVQB 3R8QA 3L3GB 5D2NA 4APQB 4CMHB 4JY4B 1N59B 5J6HA 4FZEL 3L5WA 4XB7A 2HJLB 4X99A 3GHEL 8CGTA 1ZGLB 5IGXH 5HY9A 3TN0B 5DRZA 3CXDL 4EIGB 4YHML 5AG9A 3D9AL 3GSNA 1ZLUH 2DYPA 4L3EB 5HI5C 2XICA 1U92A 4P23C 1Z9LA 2Z91B 4MZ3A 5AZEL 2MCPH 4DUWA 2DLEA 1QG3A 2KDGA 1LEGB 3FFCA 4N5ED 3H0TB 3QULA 5DR5H 4ZFZB 4Q0XL 1F4YL 3GSOB 3QNXB 1HH9B 1TITA 3MLSL 1ACYL 1JWUA 4IMKA 4S1SH 2XN9B 4KZEL 2X05A 1LHZA 3GKWL 3W11C 4JQXA 5DD0L 1C8PA 1NGQL 3CZFA 4R0LA 3RIAK 1TJIH 3QEQA 5F89A 1G7PB 4NN5C 4TNWK 1HQRA 2R69H 2M2DA 3TIEB 5C8JB 3RWHA 5KZCB 2NY5H 4KRLB 5C9JA 3V6OC 2HT4C 3VWKC 3HG1B 1PAMA 5L7XH 3WJLC 3NTCL 1BJ8A 1KXQE 4G6KL 2XTJE 2Y5TA 4GKSB 2COQA 1TETH 2JCCE 4IRSC 3BAEL 2R29L 4GRLA 3S4SA 3FL7A 3UTTA 5T1MA 3NH7H 5TGBA 2E9WA 4FXGB 1WWAX 5IB5B 3U46A 3QRGH 4HC1L 4YDKH 3Q0HA 3SDYH 3CU7A 5D72H 4POZD 5JR1H 2OJZH 1TCMA 2JCCF 1MJ8H 1CCZA 1NMCB 5FYKU 5CGYC 1NL0L 2BY1A 1H3VA 3NN8A 3NIFE 3RVWD 3VFSA 1JGVH 2ZOLB 3U6RB 1T7WA 4JKWA 4OF8A 1A4KA 3BWUC 5DLMH 3FFDA 4ZTPH 5FYLE 2KZ1B 5D71H 4LLVB 1ZHBA 2DLFL 4LEOA 3LD8B 4EUPB 2DM7A 3VXRE 1X7QB 4G8GD 2R0LH 4KDTA 3V4VL 3I50H 1D6EA 2J8OA 5DS8A 1B88A 3IT8D 3NIFF 2DLHA 3BP6A 3FHQA 3PDDA 5JDSB 2ZUSA 1JUFB 1KOAA 5ENWA 4N9GA 1MLCA 1J9CT 2APXA 4MJIB 1EEZB 1MCDA 1A7RH 3L7FB 5I18H 1WGOA 3BMVA 4HWNA 4OFYD 3IDGB 3V5HA 2Q1EA 2CKBL 1KELL 1U8KA 4ZAKC 5AZ2H 3WDHA 4UV4L 2X4RA 4U1KA 2JB5L 4OFDA 3UJTL 2DIJA 5L2JA 3TO4A 4XNQA 5HYJE 5LQBL 4XCYA 4JM4L 1JGLL 3CXHK 3O6LH 3CNKA 3K4ZA 4GRWH 5DO2D 3HNSL 3RWDB 4CW1A 3PG2A 4UTBL 3UZQA 1DJSA 2VDNL 4RGND 2CRYA 3PHQA 4NQDE 3T0EA 1OW0A 5KSAA 4U6YA 5FM8A 3WNPA 1MJ7L 2OSLA 4O2EB 4ETYA 4N5EC 2O5ZH 4NKQB 3OGCB 3R8BB 2ED8A 5I1IH 4KRPD 4KTEH 1MLBB 2ZCLL 5DRXA 3UBXB 2F5BL 2BNQD 2AS5M 2EDJA 4Z7VE 4HD9A 3BP5A 5E00A 4XVTL 5FV1L 2YA1A 3AY4A 2YMXH 1IAOB 3WHE0 3W9DA 1X4XA 4GBXA 4K07A 1KBGL 1CBVL 4MSWA 1UWEL 4NNPH 4KHXH 1H0DA 4JKMA 3UAJC 1NANI 1OTTD 4Z7VF 4UT7L 5MEPB 3RTQA 4M6ML 4NSKA 4H0IA 1UXSA 1UQSA 4PRPD 3CH1B 3VD3A 3P9MA 1UA6L 2ATPB 2QQLL 5DJAA 1F6LL 5EO9B 5MHSD 1MCKA 1DE4A 4UTAH 4BSWA 2DI8A 3PNWA 4MMZC 4OJFH 1P84J 2HRPL 2G60H 4POZC 2NY7H 3GMOB 1P4BH 3D0LB 4DKEH 3LKPA 5EO0B 3RVWC 5L2KB 1FNFA 3B9KA 1MRCL 4FQQA 3ZTNL 1JPSH 4EQ3A 1J8HE 4AEIL 1B2WL 4XWOD 3MJGX 5T5FH 4ZG1A 4UIMB 4U1LA 2BVYA 1OWRM 4QYOB 1H8NA 4XNYH 1N5YL 1I4FA 4GSDL 2J12B 2NY4B 1U6AL 4LIQE 2H9GB 4GQ9H 5ICZB 4FQCL 2ARJB 5JHDD 4M4PA 5HDBE 4G8IB 4XPTH 2JCCA 5I76B 3LZFL 5DK3A 5HHVH 3S5LA 3QUYA 2YZ1A 3IFNH 4PJ5D 1I9JL 5D93B 1IC7L 2VDPL 1JZ3A 4HG4J 5T5NG 3S7GA 4U6VH 5HDBF 1U2HA 3BQUB 4JDTL 3ZYJA 3KS0J 5DO2C 1X5XA 1CIUA 2LVEA 4L4VD 4AQOA 3C5SB 4LLYB 5C08B 1AD0A 4R4BB 2A9NH 4HF5L 5DJ6B 4RGNC 5FGCE 2HT3C 4NQSB 1H3PL 4HMDA 3SKNB 4JO4L 1U95B 3VXRA 1J5OL 1P4LA 1ONQA 4JFEA 1GVIA 4F9PA 3WUWA 1QYGL 4PJ7E 3U9UA 4KRPC 4WGVB 3LDBC 1DUZA 5KTEH 4W4OA 4LASL 3OKNA 1LWRA 1HINH 5DJZA 3HZYA 4UNVA 2JK5B 5BRZE 3EBAA 2V7NA 7FABL 3AS1A 1HILA 5IB3A 2C26A 4LGRB 2UYLB 5D6DA 1ZT7B 3V6FB 1BLNA 3BP7A 4PJ7F 2IWGA 1S7RA 4JRYB 1N6QL 1KLGA 1P9MA 5DI8A 3Q2CA 4NN6C 3SQBA 3T3PE 5INCA 1XT5A 3KYMB 1OTTC 5HYJA 2Z31D 4KPHH 1DN0A 2PETA 3TYGL 1AP2B 5JMRA 3TC9A 4J3OC 4WY7H 4PG9A 5ECJE 3V0VA 2ESVD 1RJLB 2NY3D 3LQZA 1EEUA 1S9WA 1FL3A 3S37L 1TZGL 2AXGA 3G6JB 4ZPVB 1QRND 4NQDA 5JQ6H 3T3PF 2MQCA 5ITBL 2APWA 2FB4H 4HZLA 1MH5A 3MCLL 1E6OH 1XGPB 1FBIL 5INDA 4GAGH 5I1AB 1NGYB 4LU5H 1YY8A 5CZXD 2OZ4L 3ALPA 3RVXD 3GSUB 5GIRB 1PKOA 5KSVB 4QF1A 1QBML 1AI1H 4EI5B 1ZS8B 4NRYA 1QFWI 4YHPA 4XWOC 2E7CA 1DLHB 5D1QC 1AO7E 3U48A 1JZ4A 3Q3GA 2FD6H 2HA1A 4G8EA 3IFOA 3CVHH 3T4YB 3IRZA 4QRPB 2CDEA 2GKIA 2J4WL 3OKDB 1DVFD 4LSDA 5DEGB 4X0KA 1IGML 3C5JB 2GJJA 3L3JA 3LVEA 4M48L 2VR9A 1DL7H 3OR7A 5EU6D 4ZYKB 1HHJB 3FB5B 1NDMB 3DV6A 5B39G 2APVA 2X70A 3EDFA 3GFUA 4K94L 4FFZL 4J3XA 4OZ4B 3SJVB 2D2OA 3IVKB 3E6FB 4XP9H 4PBXA 1T6VN 3AB0B 4Q9RL 5T1LA 2GT9A 1JYVA 1IM3B 5E7BA 1QHOA 4M93B 4F7MA 4AIZA 4JFYA 3QA3A 4I3GA 3KLHD 1TLKA 4FNLL 1KGCD 3VXPA 3PHOA 2R1XB 1RJCA 1JZ2A 1BEYH 4OZHB 2BC4A 3QFDB 2HAZA 4U3CA 3H42L 3KPSB 4TOYH 1OLLA 4C83B 4H5SB 4NUGH 2G9HA 5E9DD 5KS9E 4D0BB 1T0NB 5IROA 3O2DL 4KMTL 4PTUA 3PQYB 1FAKT 3NPZB 3MLRH 5F9JB 5C0ND 5F7UA 3IXTB 1I3UA 2VXQL 4H26A 3JWNC 3MSPA 4YH6A 3ILPB 1M71B 4DW2H 4LL9A 2WUBH 3QUMH 4I77H 5KS9F 4NC0B 1PX3A 1IARB 4NO0D 3DX8A 5EUKA 3NCEB 4E42A 4JAMB 2WNGA 3TT1H 4Q9QH 1S9XA 1IGIH 4G43A 2O5XL 4UV7H 3DXAD 1NGPH 4YX2H 2JJSC 4NZTH 1L9MA 2D0FA 5FYJD 3DBXB 4HKBB 5I16B 4GW1B 3THML 3IDMB 4Y19D 4HBQA 2X9YA 1T20B 4LCCC 2JELH 3BISA 4OV6F 2P46B 1PFCA 3V8CA 4WI2A 4PJ7A 5LBSH 5FCUL 2F74A 4FFVC 5CZXC 3QO0A 5D1XB 5GRJH 3RVXC 4NKIL 3QG7H 4EDXA 5IHZA 5D8JL 4F33B 3QQ9C 3FB8B 4FFYL 1KCRH 4NGHH 3OSKA 3EFDL 2YD4A 2DMBA 4A6YB 3FT2A 4K94C 1LO4L 5F96H 4YR6A 4V2CB 2O93L 4L9LB 4YHNA 4OAWA 1YEIH 2ZKHL 3BPLB 5KSUA 1NCCL 5ESVB 4J4PC 5E8OB 4JPIB 1DVFC 5BV7B 1J1PH 4I2XB 1ZHKA 4HGWA 5I1GH 2E7LC 3MRKB 1ED3A 2MFNA 1SMOA 3QP3A 1A5FH 1R3LB 4HK0A 3ZHLA 2AERT 1NJ9B 3C6SB 4UAOB 4K2UL 3MRJA 3LN4A 1EO8L 1GSMA 1TZIB 2IAMA 5IBLD 5HHOB 3RIAF 4GFTB 2C1PB 4X6CE 5F1IA 1CFQA 5HI3C 4LNVA 4EN3D 3QHFL 1FP5A 1NMBH 4PYGA 5IG7A 5K9OA 1NAML 4OZIE 4PV9B 1GGUA 1J12A 1EV2E 3KPLA 3VH8B 4E41E 3DX9B 1BGXL 2OTUA 3MA9L 1PVHA 3WS3A 2A6JA 2JJTC 4M43L 3E1F1 1UEMA 1XCQB 3KLHC 4W6YB 4X6CF 1IE5A 1KB5H 1MELA 4X6BA 5JW4Q 5C0FB 1WIPA 2BVTA 5D2LB 1HXMA 1L0XA 3MC0A 4NQCB 4D9QD 5J9PB 3VXQA 2DM4A 1AO7A 1TTUA 4OZIF 2OQJA 1GIGL 4KAQL 4ODWB 2VLRB 3WLBA 3MQIA 2E5EA 5D7LD 4DGVL 2R0ZH 4F37K 5DSCB 1UH3A 1OAKL 5C0NC 1ZEAL 4LBEA 4K71C 1T2JA 4QRRB 5LWYH 3EUUA 2FECI 5HYFA 3X14B 1A7QH 1MCPH 3AU1B 2E9JA 4MNGE 1EXUB 2X44D 3U83A 1I9IL 4AM0A 5BJTA 3QR2A 5E6ZA 2V2TA 4O58L 4OM1H 3CSBA 1A6AB 3S37X 2XZZA 4U49A 2GJZA 1RAMA 1A6WH 2XA8L 2FCBA 4RWHA 1INEH 1F4WL 4PRHD 1CGWA 4O2CA 4JN2A 5F9WC 3KPRD 1AQKL 1U8PB 5CIPH 3MJ9H 3PGCB 3RA7H 2MMXA 2OMNA 5J1AA 4C54A 1G9NC 4HDIA 5IIEA 4ODVH 3CFCH 3EO9H 1XH3B 1MVFA 4TVPE 1I8MA 3UC0H 1U36A 3LEXA 4PJFE 4R7NB 1CZ8L 2AV1A 3P0YL 4XGZA 1KEGL 3QPXH 3MYJA 4M6OL 1H3XA 1T6WA 5C09D 3S96A 5GQBA 1H15A 3RU8H 1XGQB 3W0WE 1T2XA 3FN9A 1YQVL 5KVEH 2UWEE 4YHOH 1T04A 4HS8H 4L4JA 4PJFF 3GRWL 3NCYP 5F44A 5I6XC 4JGJA 3NGBB 3B5HA 1BAFH 2FDBP 3CMOL 1K3IA 4NRXA 1S7TB 3ARFD 5F3HA 1MHHA 4PYHA 2J5LB 1RPQA 4PP2A 3SE3A 3VXSB 2UWEF 3P0VH 4OLZH 1A3RL 3N50A 3PP4L 1CGYA 4P4RB 3T8XB 2EZ0D 3B8YA 3HZVB 5GJTH 4BKLA 4QHNA 2KBGA 5F6IB 1X6LA 4RISH 1CGXA 4ELMB 5IBLC 2RB8A 4PJGE 4MLIA 3BI9X 3VFOB 4OCSH 4OLUL 5KJRL 3S36H 1Y18A 4WDIA 3PWNB 4EUPH 4EN3C 3LHPL 3VW3H 3BZEB 1CS6A 5DYOB 3KLAA 3BKML 3SEPA 3QFJD 3BZDA 4XMPH 5GRVL 1N6VA 2BJMH 2Y72A 3WE6A 4PJ9A 1VACB 4QHUA 5TJWK 5DJ8B 1AH1A 2CO7B 1KNOB 5DZOA 1T2QH 4PJGF 4OKDA 3OJDB 2VH5L 4L8BB 4XCFH 1C08A 5EO1A 2X4PB 3C5ZD 1J7VR 1PYWB 2X1WL 4NZUL 4QY8B 5D6CB 1U8IA 3CC5B 5H35B 3S3JA 4UB0H 3UXFA 1JHTA 1ZTXH 2HLFD 1I1AA 1G6RA 1T0MA 1FL5B 4C56D 4U3HA 1SEBB 2UY6A 4X9BA 1S5IH 3NABH 4U6XB 4Z0XB 3VG9C 5SV3A 2RIKA 4FS0A 1BIHA 2KPNA 4PRNB 3EHBD 3G04A 1JYXA 2P24B 4KRNA 4TSAL 4LKCB 3RWIA 4HWBH 3B9AA 1F6AA 3DVNA 5IR1B 1YJDC 2YUZA 2R0WL 4I0PB 4P3DA 1Z5LB 1MWAH 4U1NA 5C0DB 4X6CA 3FAWA 3A6BH 2P5WB 1FC1A 2PW2A 3VFVB 2P8LA 4Y4FD 5CKGA 3D3VA 4I0CC 4HZAA 4OZIA 4E41A 4EVNB 4UU9A 4WI7A 4JJ5B 3FHAA 1FNAA 4OTXH 3U2SA 5F1NB 4NO3B 1IGCL 4Q6YA 3U4BL 4P5MA 1R0AL 4NZRH 4NP4H 2VAAA 1C12A 5C07B 4XP4H 4ACPA 3MYZA 5AG8A 4N1CA 4X4ZA 3QO1B 4DZBB 3KNBA 1AQDA 4TULH 3FB7A 3GMMB 5IMOB 3DURB 2J1KA 4RZCB 3I75A 4D2NA 2HFEA 1JGUH 5FYJU 4HIJA 1XF3A 1RD6A 3CK0L 4M5YH 1KCUL 4XCNA 1KIPB 4X6DE 1MCLA 2J8UE 5I2IA 1MPAH 3RZCD 1ZT4A 1ADQL 5BMFL 5C1MB 3VGDA 4E0RA 4S2SB 4UQ3B 2EZ0C 2VLJB 1JN6B 4MB3A 2DQUH 3D2UB 4XAWL 4FTVE 4ODXB 4X7EC 4X6DF 3QIWB 3PP3H 2J8UF 4H88H 1F6FB 5GGVL 1QVOB 2F9BT 1RUKL 3NPSC 5IWLC 3U0PB 4PJFA 4HT1L 5D1ZA 2HMIC 5B38A 4LEXH 5IB2B 5JXEA 1R5WB 4CU6A 1DZBA 2XFXB 5T3ZD 3LKQB 3W0WA 2F8XC 1WCBA 3OKLB 1PGRB 2UWEA 5I1KL 5HGBB 3EOTL 1UB5B 1GHFL 3D39E 3C5ZC 4LQFH 4WFHE 2W9EL 3LS4H 4LCUA 5FHBL 2PCPB 5F21B 1F02I 2Y23A 3ULVD 2HLFC 4XZUB 1L4IA 4X6EB 1E4JA 4PJDE 1RUML 1EFXB 4Z8FL 1U8HA 2EDKA 5DZNA 1JGEA 3ECBB 1J05A 2JJUA 5I1EH 4M1CD 4BH7B 3I6KB 2OL3A 5BOPA 1T7VA 5JPMB 5EN2B 3BJ91 4Y2DD 4PJGA 1CE1L 1CDUA 5TH2B 3WIHH 3H9SB 4PJDF 3DOSA 4JLRB 4AEHL 4OCXH 2BFVL 1BVZA 2DQJH 2WINA 2FATL 5ITFB 1NSNL 1IKFL 5DMJB 1HH6B 1DQDH 1JV5B 4Y16B 1ZSDB 4JPKH 3VFTA 5ISZB 4XPFH 3ARGD 2IG2L 2FHCA 3FZUC 3UTSD 3IJSB 1YN7A 5C0GA 4M7JH 1NGWA 3PWLB 1XF2A 1KUMA 4XNXL 2H26A 4DVRL 4XXDB 2EKSB 3S4SG 4JDVB 3O9WB 2FEDD 4QXUH 4MAYB 1EJOH 3F7VB 5DMYA 2ADJA 5GSVB 4A2LA 4PTTA 1YUHB 1UZ8A 5DJCB 3FB6A 4UT6H 3S35L 5AYQA 2F54E 3P0GB 4P4KB 3WD5H 5F71A 2AJZB 1JHKL 3O45A 3RBGA 1RJZB 1YZZA 3V0WH 1IL1A 4LKXB 5BS0E 1IAIM 1MQ8A 3BOVA 1JPFB 4I18A 4KK5D 1KPVA 3RZCC 3MV7D 1X5KA 1DUYB 5BW7A 4YNYB 1JFQL 3BIKA 2R1WA 3OB0H 3IETA 4N8CH 5MI0B 2H3NA 3T4AB 1A6ZA 2X4OA 4Z77A 1REIA 4ALAH 1XEDA 4WV1C 3IF1B 4OM0H 3EYVA 1OAUL 2CUHA 1MFCL 3OPZH 2X4UB 4QTIH 1Q1JH 5C3LD 3LEVL 4PJ8D 1IKNC 5FDWB 2C3WA 1NUNB 2YEZA 3U0WL 1U3ZA 3OAYK 1F4XH 1QQDB 2IF7A 3C60A 4V1DE 4DOHB 5AD0B 5IEKB 5C0EB 5DC0A 2Y6SC 1LILA 1QR1A 4G6JL 4JDZA 3L3OA 4MWFB 5FUOH 1YEDB 5DUBA 1XCTB 2ZJSL 3O2VH 4UDTB 1QSFA 4OF0A 5IOPA 2VOTA 4QKXB 1VFAB 4PRBA 2J2ZA 2HKFH 2L7UA 3OTTA 2BVQB 4K9EL 4MZ2A 3TNNA 4OGYH 1SEQH 5D7KE 2V5YA 4AMKH 4Y5YC 3VFNB 5IHLB 5BZDB 1IGFH 1KJMA 1NC2B 1PKQB 1P6AB 3R1GH 2YSSB 3ULVC 4XRCB 3L3HA 2J8UA 1F13A 4KZDL 1GAFL 3DMMD 3UPCA 2FBOJ 4GKOA 1IAMA 5EC2B 1ZXQA 5EPMB 5CBAB 4NKDB 5SWQA 3CSYA 1YEGL 5T1KA 1P2CA 5GISL 4MD5A 2VSCA 3NAAH 4M1CC 3TEUA 4R9HA 4TNVF 2D4FA 4Y2DC 3QCUL 4JHWL 3QQ4A 1C5CH 3BDYL 5HHNA 2FL5B 4YPGA 1FG2B 3RFZC 1OP9A 2BSED 2XN9E 3ARDD 1DBJH 3AREA 2AXFA 3CFKB 4CADB 4RMUA 3PWJB 2XIDA 5F6HI 3ARGC 5B8CA 3KPPA 4NCDA 4GS7B 3M8OL 1BOGB 4HUWB 4M7ZC 2VZ3A 1CFSB 3WFBH 4M62H 4NHCL 5K9QG 3QCTL 3W5NA 1IEAB 2OXHA 1NCBH 2BNRB 5SWSD 1AGCB 2FEDC 5I75C 3N85H 4BFGA 5FM5M 1G7IB 5AAWA 1TJHL 4J8RB 4XXCA 4MJ6B 4CVXB 1BHGA 3QEHB 4PJDA 4JREB 5FXCH 2IPKA 4Q6IB 3WS6C 2EH7L 4LSPL 4NDMB 5EOCH 3P73A 5EZJA 3HI5H 5GGQL 1R24A 4K3GA 1FFPA 4WRLA 3KYAA 1CD1A 2JIXA 1QFPA 3DSNA 2NY6D 4IRJD 3QNZB 2UZIH 5HBBA 1T22A 5CJQH 3BH8B 2NTFB 5CUSH 4BZ2H 3HI1B 2B2XH 3RWGB 1W72H 4F37F 1GC1H 5IBUG 5ABDE 1M6OA 4PJ8C 4NC1E 1YECH 1QEWB 2EYTA 2ZCHH 5AWNH 4M7LT 3BN9D 1F4HA 1HHKB 4A6YH 1U8MB 4JFDE 4OLXH 4ZUWB 4D0CA 4OGXL 2CIIB 3E2HC 3QIUA 1G9EA 4DK6A 1CU4H 4Y7MA 3FT3A 4ZQKB 5BV7H 2CIKA 1KTKE 3BE1L 1YNKL 1OQXA 3ISWA 3C2SA 5TDPB 1MEXL 3SGJC 2BSRB 5IK3A 2OI9B 2Y25A 2XNAB 3UTPD 1PZUB 4KI5E 1CXIA 5A3ID 4KXZH 1D5BA 4QRUA 5BS0A 5D7JB 2VQ1A 4QCIB 1XGYH 1UXWB 2W60B 2HT2D 2YZ8A 1V5JA 3DMMC 5J89A 1UYWL 4RX4A 2EIZB 1EJ6A 1K5NB 1OGTB 2FWOB 5DRWA 5E1HB 2VDQH 4L8SB 2H32B 2YC1B 3FO0H 3G5ZA 5F8QC 3IRPX 3HMXH 5CSZA 1OAYL 4KI5F 4I4WA 3HZKA 1QKZL 1PG7W 3VXUB 4FQ1H 1HYSD 5ICXB 3HC3H 2G2RA 4PRIB 1I1YA 4CAGA 2PYEE 1EPFA 4V1DA 3NZHL 4FP8L 4JM2D 4R97C 4FQIL 3TCXA 4JKPH 4NZDA 3X11A 1OT1A 3LKNA 3GUTB 4ZXBC 2X41A 1EDQA 3ARDC 1MFDH 3OF6D 4ZFFA 1R5VA 1J1XH 1BQLL 1HI6A 3SKOB 1O7VA 4HKJB 4QRQB 1C7TA 1CG9A 1Q9LB 4X5XB 3BD5A 5C0AB 3L3DA 2ERJC 2ADIB 1LE9A 4QHKJ 1ETZA 3MA7B 2DI7A 2EE9A 3MV9B 5C7XH 1F58H 4ZPTB 1UVQA 4PJBB 4F8TA 4HLJA 4APQA 5EIQA 4Y1AB 1N59A 5IHUH 3UO1L 5CGMA 3S35X 2XKNB 3O6KH 2HJLA 4U7SA 1B0GA 1ZGLA 2E7BA 4ZUUB 4FZ8L 3GHBL 2YPKB 1WBYA 1TXKA 4U1GB 1CD8A 2XZCH 2VLME 3MLTB 1ZK9A 1A1MB 8FABB 2YPLB 4ZNEE 1L7TH 4HPOH 4WHYG 5IV2B 5FEBA 1LEGA 3H0TA 3LKOA 2NY6C 1U3JA 5FUCC 2PXYC 3GSOA 3QNXA 1HH9A 5L2KE 4U1JA 4JY5H 5MEND 2XN9A 4HHAB 1OAQH 1DP0A 2BCKB 4N0CD 1MI5E 4WO4B 4N90D 3ARQA 4UT9L 1JK8B 5I73C 1A7OH 3FN3A 4D9LL 5IFJB 5DK2B 5I74C 2QQQA 3BZFA 3FN0L 1N0XH 3T77A 4RA3A 3HRPA 3DTXA 4XTRD 4ZUTB 5F7EL 1NEZA 1WTLA 2EICA 3WN5C 5D9SB 3BN9C 1FNGA 5F7KC 5C0CA 1D3CA 4FN0A 2IBGA 5I19H 2V9TA 2B1AH 4FQLL 5A1AA 1M7DB 5H37H 3H7BB 1U58B 2ZOKB 4RMWA 4MQ7A 1FHGA 3Q5TA 1I3RA 3PHSA 2FEEL 1C5BL 2DYPD 1UJ3B 4KFZC 2UV3A 4FXGA 3RVVD 4KQ4L 2F19H 3EYUL 4J3VA 1XZ0B 1V7NH 4JO1L 3SCMA 1TVBB 3FFCD 3GBNL 4PJAB 2DQTL 4ZFGL 5EFIB 4XBPA 3WFEL 1DLFH 1CWVA 4NT6A 4U1HB 2HT2C 5HHMB 4NO5B 1INQA 3P4MB 5DMKA 5C08E 3LQAC 2ZOLA 2K3TA 3MOAL 3QEQD 3T65B 5I71B 4LLVA 1HYSC 5HVFB 4KY1H 5I1LB 1E4WL 5JW4R 1OPGH 2AJSH 2A83B 4JM2C 5SV4A 2QQNL 2ITCB 2YK1L 2XPGB 4XPBL 4OF6A 3IYLW 4JFDA 5JDSA 2PNDA 3MRDA 4PP1D 1YEKH 4GRLD 1NDGB 1JPTH 3ZO0A 2AJUH 3L7FA 3UTTD 2R0KH 5H94B 4NN7B 1L0QA 1OARH 4MA3B 3IDGA 3ZDYE 5GS1A 1QSZA 5DJ2A 3JV4A 3NACL 4G3YH 4DGIH 1F11B 4XH2B 5J13B 2Q8AL 2RR3A 2X9WA 1KN2H 3WNMA 5HPMB 1RFDL 3DV4B 1MCWM 2OR7A 4KROB 4MA1C 4MYWB 1MREH 3QHZL 4PY7B 4NRZB 2CLRB 2A1WL 4GW5A 1NGXA 3ZDYF 3MJ7B 3RWDA 3OWEA 2HKHL 2Z8RA 3W2DL 3G6JE 1PZ5A 1OD9A 4OD1H 5CMAB 1JZ5A 2R8SL 5HHXL 2DDQL 4PREA 1KJ2L 1E6JH 1AXSB 1RI8A 5HGAA 1HOCA 2P45B 4NNXB 3AMKA 4M6NL 1Z2KA 2PYEA 1I7TB 4OD2B 2FIRT 1CYGA 1T5XB 3VCLA 3U1SH 1MFAL 3UBXA 1KN4H 4O5LH 3ZZ1A 4N0CC 3CCHB 2J6EH 3G6JF 3V5KA 3QDMB 4CU8A 2DQDH 1JL8A 4LCWE 4X4ME 1J0KA 3RKPA 5EZIH 4EQ2A 4XVJL 3TBSB 5D2NC 3WNOA 3TO4D 3ROLA 2DRUA 4QRPE 1PSKL 3RY6A 2YD5A 1B90A 4P9ML 5MEPA 1VGKB 4MD0A 4FABH 1QO3A 1F97A 5F9DC 1LK3H 4HIHA 4LCIH 2BOCB 1MCCA 4JFFB 3T0ED 3LPFA 3RVVC 3MGOB 2D7TH 4H0GA 3CFJB 4I9WD 5EO9A 3LH2H 5KSAD 2LU7A 3BDXA 4GT7A 3FKUS 1A6UH 1MQKL 4IMLB 4ZNEA 4ODSH 1MCRA 4JG0L 3MLUL 4U7KA 3SHSA 2VLKA 4IMKC 3BKCL 3GMOA 4OF3A 4H1LB 2NMSA 4XP5H 5EO0A 3V4PH 4YHZL 5L2KA 4JQXC 5CWSA 1N3NA 1MCHA 4GAJL 1MI5A 4R0LC 1HZHH 3RGHA 1NBYA 3LB6C 4GBXD 4P46B 1XGUB 1KPUA 5GGRB 2VL4A 4P23A 4OZHE 3FO1B 3MREB 3C6LB 4QYOA 1WBZB 1RZJH 2CPCA 4G80A 3A0OA 3KPSE 4LSVL 1SYVB 5L88L 5E2VL 3ES6B 4YWGH 3M45A 1CLOH 2L7JA 2CMRH 3RTQD 2H9GA 5ICZA 3PQYE 2RAMA 4PP1C 3RAJH 2VE6B 2VDRH 5D4QA 2EDHA 3V79C 1MHCA 4K55A 4ZAKB 4OZHF 2QADC 1BOYA 5DVNA 4HEME 4BZYA 3BXNB 3WIIL 4LLWB 4GXVH 3VRIB 4ZSOB 3I85A 1M7IB 4U1MA 4JZJA 4EOWL 2R56L 4LVNC 1A14H 3R0MA 4P57B 1ZVSB 3O3BA 4NQXA 3O81A 3B9KD 4JGUA 5BVPH 1EBAA 3DARA 3C5SA 1H3TA 5C08A 3TV3L 3VMOA 4NWTH 3CXHJ 1IC4H 3UZVB 3PJSB 1EMTH 5A2JH 4K8RL 4JPWL 2VRAA 2B4CL 2DQCH 4KDTC 5HYSB 2KZWA 1I3GH 1XAUA 2R4RH 3NA9H 3QQ3B 1UB6A 1N64L 1OAZL 1R3IL 4MNHB 4X6FB 3MPCA 4IS6A 2XTJD 1HKLL 4U4BA 2Y06L 4A2MA 3I9GH 1RZKH 4YXLL 1CFTA 3QUYD 3AS3A 3F7QA 3QXDB 1JRHH 4IOFD 5ESAB 1MRFH 1FNEA 1ZT7A 2WUCH 4MX7A 2W38A 3T2NH 2VDLL 4YK4C 1IQDB 3TO4C 5C0RL 1Z0MA 3KYMA 3SGKA 3VXMB 1EHNA 5TE4H 4I2XE 2DJUA 5ADOH 1AP2A 4GG8A 3TCLA 2IALB 3PGFH 4WWKB 1ZGLM 5GRVK 1GPOL 1QSEE 5IJKA 5DJ0B 4JANB 5KOMC 4ONHB 2YKLH 3QZWA 2IMMA 3G6JA 4ZPVA 5FYLD 2WWKO 4LPVA 2R15A 5KSAC 5J6GA 5HHOE 4E5XA 3VXRD 4JFED 4NOBA 1XGPA 3JWOH 1QPXA 5I1AA 1JMXA 2W91A 4RNRB 5GRZA 1RIVH 2ZG3A 2XI9A 3KLSA 1B0WA 5C70A 1A6TB 3GSUA 3MRQB 5GIRA 3SOBH 1NLBH 3AY4C 2BSSB 1A7PH 4YXHL 3TFKD 4GBXC 4NWUL 1JZ8A 4G8GB 1A7BA 4G8FB 3O4OB 5D2LE 5EU7C 1DLHA 4LCWA 2CRMA 5HI4D 4NQCE 1A9EB 4XP1H 5HXMA 1BWWA 2VLRE 2IFFL 5HYJD 2BSTA 1YEFH 3RTQC 4KK8D 1VSCA 4F7EB 5T3XH 2QTEA 1NQBA 1A1NA 4XCEB 5DQDL 4PGJA 5DK0A 3C5JA 3E0GA 3O6FC 4QRRE 5D2LF 2FGZA 5TF1L 3HE6C 2YD7A 1Q9KB 4FQJL 3VFUA 1S7UA 4NQDD 1QLFA 4LLDB 4FA8A 1GRWA 4ZYKA 3FB5A 5LXGL 4FMKA 4PUBL 4HS3B 1KT2A 4K23H 5H37G 5TFSH 2EE6A 3F5WB 3ZT5A 4HFUH 1X5GA 1G7HB 1OSZB 3KPQB 4J3SA 1ERNA 3B9KC 4RGNB 5CJOL 5HDLA 3BGFB 5F7YC 1YEHH 3H3PH 4F7CB 2VMFA 3MLXH 4OLVL 2BMKA 4MJ2A 5IF0B 2HFTA 1KLUB 4OZHA 3QFDA 3NIDE 4F80A 3KPSA 3BHBA 4PB0L 4C83A 4H5SA 1KC5H 4NJAH 2X4SA 5GGSY 1UM4H 3DROB 2XTJC 1T0NA 1VPOH 2EH8H 1FO0L 2CKBA 5F9JA 3QUYC 2I24N 1FYTE 1H5BB 2Y07L 4ZOEA 1A64A 4XNUH 3BRDA 3NIDF 1RIUH 1BM3H 1ZMYA 4DQOL 2QSQA 3TA3A 5JLZB 3KPTA 1BBDH 1HHHA 4PRPB 5E0QA 2ZUWA 3REWA 2NW2B 3H9HB 4M61B 2I25N 3VXSE 5DD6A 5T1LD 2BOBB 2EDTA 5DJDB 1P84K 4BH8B 4HKBA 5I16A 2ZUUA 4Z0BH 4ELME 3LN5B 2FZ3B 1T20A 3LSOB 4F9PC 2ZCKL 2AK1H 4YZFE 4JB9L 1PDKA 2DMKA 4W4OC 1XGRA 3HNVH 5A43C 1S9VB 5IESH 5JXAL 5D1XA 3QCVL 1F45A 5JOPE 3OR6A 3CVIH 3QISA 4F33A 2EDLA 3O2WH 4ELMF 1ODAA 2DB8A 3FB8A 3ULUH 1Y6NR 3TFKC 3FQUB 2CDGB 3WFDH 4KVNH 4NKMB 3RIFK 3MODH 2VXUH 2PUQT 4OZFA 2D7NA 2PTTB 4XC1H 1UJTA 4LP5A 4YZFF 5HI4C 2LFGA 2HFGH 2SEBB 1MIMH 1P9MC 2FEEI 1FNHA 4CDGC 4MCYA 4WUUA 4Y4HA 1RUAL 1EGJH 5ESVA 1ZLWK 2YD3A 1QFUL 1ULVA 4JPIA 3OZ9L 4NUJA 4LPYA 1OOAA 4KK8C 4M7LL 2W59A 1CL7I 5CAYB 3HR5A 5DVMA 1WEJH 4I2XA 4XNMA 3MRKA 4P59L 4PJ5B 1R3LA 4MJ5A 1NAKH 1DDHB 1QSEA 5FF6A 1TZIA 3DVIA 4ZFOB 3SO3B 5HHOA 1JPGB 5EZOL 2P5WE 4ODBD 4QWWC 3SKMB 4L4VB 1T1XA 4HX1B 4KKBD 1HIML 2G5BA 1FZJA 4PV9A 3VH8A 5FGRA 3DYMA 3DX9A 4CJ0A 4N0FB 2C3HA 4YDIL 1ZA6B 4U2ZA 4XPHL 4KTDH 2NXZC 1AJ7L 4ZUVA 5D2LA 5C0FA 4UBDD 5C07E 4JZNA 4NQCA 3PDOB 5I30H 1RZIB 1QFWM 1TDQA 3NCJH 4WTXA 4P3CH 3PGDA 1A8JH 1ES0B 1WICA 4YO0A 4AYFA 3IXAB 1NCUA 3MMEB 2NNAB 3QDGB 1B0RB 1JIBA 5GS2H 2IGFH 1AR1D 4HBCH 3X14A 1CFNB 2W0LA 3CFDA 5D1QA 2IAMD 2OMBA 3SY0B 4PR5B 2ADGA 1MFEH 4MLSA 2Z31B 2VL5B 4DUVA 1R3JB 5LGJB 1GOGA 4WUKL 1QBAA 1FZKB 1WCQA 5KW9H 2ESVB 2NY3B 1CK0H 4RWYL 5JHLL 1UWGH 4NQEB 4JHAH 4LAQL 5F1OB 4WFEE 5DFTA 1TQCC 3G5YB 3BVNB 3P11H 2VLJE 3I2CL 5IMKB 5E5UB 4LCCB 4AT6B 3SPVA 4ZOBA 1EAPB 3NFSL 1D5MB 5ICYB 1T4KB 3NCMA 3CX2A 1AO7D 5CINH 4OIIL 3P4OB 3O11A 4WCYH 4XVSH 5ILTH 5FYKH 1NEUA 4HPYL 4TPRL 2DM2A 4ODTL 4MA7H 5IROC 3BKYH 5FO8B 3HRZA 3UMTA 1F42A 1IC5L 1CF8H 2G75A 1XGQA 2E7MA 2Q3AA 1QUNA 1OP5H 2I5YL 1T03H 1FYTA 5IMMA 1JHLH 1G7JB 1B3JA 4PJEB 2EC8A 1EEQA 4CJ1A 3V6BR 4FFWD 4LRNL 5IFHL 3HNTH 5LCVL 4XP6H 1BFVL 1S7TA 5E2WL 5CCKL 1OY3B 1OQOA 5C0IA 2EXYD 3EYSH 43C9B 3VXSA 1TCRB 3MGTA 3PABA 3HZVA 5I8KH 1AY1H 4S1DD 1VADA 4ELMA 1I1FB 4QXTA 4Y0GA 3ZHDA 3VFOA 2OZ4A 1AGFB 1MJJB 3PWNA 5EBGA 4BQCA 4GOSA 3RX8A 3BZEA 4KKBC 1DBBH 3MRFB 1U3HC 3ZL4L 4HULB 4IIQB 3EZ8A 5E99H 2YN3A 3QXTA 2JJSA 1RJYB 4OBSA 3QDJB 5TQ2H 5DD3H 1E28A 5D70H 1HWHB 1UT9A 2OCFD 2FBJL 2MCPL 4Z7NE 1PYWA 5DR5L 5ERWA 3B5GA 3P9WB 4YXKH 3SN6N 3K1KC 1LE5A 1J1OH 3CC5A 5H35A 3GMLB 4JE4B 4GG6E 4S1SL 1TNNA 2YBRB 1FL5A 2YD8A 4GUPA 4K71B 3GSQB 1SEBA 4XAKD 3O8XB 5J12C 3GSVB 4U6XA 4N1HB 4DKAA 1KTRL 3GM8A 3BT2L 3DVFA 4U1IA 1I3VA 5E8EA 3WXVL 2P24A 2N56A 3LS5L 4Z7NF 4LKCA 4KQ3H 4OV5B 5L8KB 3SGEI 2IAMC 5EOQH 5IR1A 3LIZH 4KTYA 2QSVA 1D6VL 4YUEL 4J6RL 4GG6F 5C0DA 3FQNB 5L7XL 4J4PA 2P5WA 2X4NB 4R90H 4BQBA 3MRNA 3VFVA 4BELD 2EIBA 5C6PB 5FO9B 4KK9D 2ZG2A 4K7PH 1Q0XH 4PJ9D 2E7LA 1K2DB 2Z8VC 12E8H 1L9NA 3NH7L 4Y19B 4EVNA 5CP3H 4JN1H 4X4YB 1E27A 4MXQD 5E1AB 1U9KA 4PRAA 3BGAA 3DSFL 1IMHC 2AAVA 4DOHE 3VXNB 4YDKL 3SDYL 5D72L 5JR1L 3EDEA 5C07A 2OJZL 1NCTA 3JUZA 1KCLA 3DNKA 1MJ8L 2XYCA 3TBWA 1MCSA 3O2DA 1FO0B 5IVXB 1I1AD 2P49B 4U05A 4MA8L 1JGVL 1EUTA 3GMMA 5IMOA 3DURA 4N0YH 5DLML 3CX5J 4F7TA 4KUZH 4ZTPL 5D71L 3EOAA 4WGWB 1YN6B 2ZUQB 3B43A 3DX6B 5E94B 1UM5H 5ETUA 2R0LL 5DFVD 5T3XE 3TVMB 1P7QA 2E8ZA 3V7AE 1PKQE 3I50L 2GJ6B 1IM9B 3GI8H 1K3ZA 3D3VD 1A7RL 2EXYC 1YEEL 4EI6B 5I18L 4R4FL 3WCYA 3HC0B 1K4CB 1EFQA 4ZNCD 4E41D 1VERA 2IADA 2VJXA 4S2SA 4ONGH 4UQ3A 4B0MM 3MCKB 4G6ML 3VDAA 1JN6A 3ARBB 4S1DC 4PJCB 2E7HA 1BX2A 3N1GC 1UGNA 2PTVA 4S0TD 4EN3B 1UACH 5D96C 1QVOA 3GHEH 3X13B 4M8QB 2GY5A 1IC1A 5C0JB 3OAUH 1FGNH 5FKPA 3GEWB 4ONFH 3D9AH 5IB2A 2K9UA 1HEZB 1RIHL 2OP4H 3U4EB 2XWJA 4ZS7H 4UMGA 1R5WA 1EVUA 4IRZH 4OT1H 5AZEH 3LKQA 4R26H 3OKLA 3BPOB 4NBYB 2BZDA 1MAML 3HCVB 1F4YH 2P42B 2VDMH 2BNRE 2IQAA 5I1IL 3AVEA 1ACYH 2PCPA 4KTEL 2A73A 5F93C 4HWZB 3GKWH 1XF5B 5EIVA 4XZUA 3RGVB 3FQTB 4RIRA 4X6EA 3ZKXC 3SE3C 2HP4A 3NFPB 4RFEA 3WLWC 4TSBH 3K7UA 4FMFA 3VD4A 2BVUA 4NNPL 3ECBA 4HKXA 2EEAA 2Z0BA 4KHXL 4YAQB 2WBJC 3RBSA 4AENB 5HGHB 4KI1A 1J8KA 2WLYA 3W82A 5JPMA 3NTCH 5EN2A 4G6KH 1NAMA 4TVPD 4L29B 5D1ZD 4PRHB 4B53A 3CFBA 4JLRA 4FQXA 5DF0A 3S6CA 3QIBB 5JXED 3KPRB 3X3FL 5EORH 1HH6A 1NEZG 3U30C 1ZA3A 1OP3K 1URLA 4MXQC 3W0WD 2ATKB 3GO1H 4UTAL 4HC1H 4R3SB 3IJSA 3WEXB 2YXMA 4OZGB 4OJFL 2G60L 3GDBA 2EKSA 2Q7YB 4JDVA 3JVGA 3K46A 3WO3B 5K9JL 3O9WA 1P4BL 4DKEL 2ZSWA 4MAYA 4EZMA 5LGKA 4MCZB 4GG6A 1JPSL 4MDIB 5DHVH 1YUHA 5DJCA 3W39B 2DLFH 2P8MB 5T5FL 1BVKB 4J7RA 4P4KA 4XNYL 5GRXG 2AJZA 4O02H 5DFVC 3QUZC 2Q20A 5CD5D 3ARFB 1CD9B 5E5MB 1A2YB 1A0QH 4GQ9L 1IZJA 5C71A 4YBQD 5MERB 5JW5A 1DUYA 5SX5H 4YNYA 2D9CA 1Q9WA 2FJHB 2CKBH 5HHVL 1YYMH 1KELH 3IF1A 4QGYA 3EYOA 4X8JA 3DGGB 1JNHB 2JB5H 2F8OA 2DD8H 3IFNL 4OQTH 3VXUE 3G5XB 1YQ2A 2NLJB 3I3EA 5FDWA 4PRIE 3NPSB 3GB7B 3IU4H 5LQBH 1QQDA 2OX5A 1BBJB 4JM4H 1JGLH 5IEKA 3QFJB 4U6VL 1ZLVK 5C0EA 1H3UA 4HH9A 4G9DA 2OL3L 3SE4A 4MWFA 5FECB 4MGXA 2O61B 1YEDA 1K4DB 1XCTA 2N7BA 2DM3A 3STLB 2VDNH 2BERA 1OL0A 2A9NL 4L1DA 1VFAA 4P49A 3WIFA 1AHWC 3MRLA 3GRWA 2F53B 2VO5A 5EU4A 4BA8A 1OB1B 3MV9E 2OTPA 4PJBE 4RRPA 2VC2L 3MRPB 3VFNA 4BFEA 1CL7H 4Y1AE 4MD4B 4KJQD 2F5BH 3H3BC 5BZDA 2D9QB 3JTTB 1PKQA 3FQWB 4C4KT 2YSSA 3VE0B 5ADPH 5KTEL 4JFZL 4XRCA 2CK0H 5KSBB 4Y88A 3WFZA 1N7ML 5EPMA 5T1DH 1CBVH 1HCFX 2DQIH 5DVKA 4DJMA 3C8KA 4PJBF 2MKLC 4HUVB 3WL9B 3EFFB 1DSFL 1BQUA 1U8JB 4O9HH 4U33A 4D3CH 3BESR 2YPLE 1IEBB 1EO7A 3C60D 4Y4FB 3RIFF 3BPCA 1DBKL 3RP1A 1AGEA 1KTDB 4KPHL 3CDGB 5D1ZC 2FL5A 1UA6H 4Y5XB 1FG2A 5E8NA 4NO2B 1Z3GH 1QSFD 4WY7L 3RHWK 3ARXA 5FA3B 2A6DA 4HJJH 4CADA 3GJFB 3PWPB 3UPAA 2WAHA 1IZKA 2FB4L 4MDJA 5EWIH 1OTSC 1BOGA 1E6OL 1WZ1H 1CFSA 5GRYA 4GAGL 1II4E 2GEEA 1IEAA 4LU5L 5TF0A 2NZIA 4RBPH 2BNRA 3MUGA 3ZTNH 1NC4A 4N0UB 1G7IA 5EA0H 1AI1L 1D5IL 4J8RA 4DN4L 1E4XI 3QUXB 1B2WH 4MJ6A 4KC3B 5D5ME 5T1KD 1C7SA 1FORL 3OV6A 3C9NA 4UDUB 4NDMA 4UNUA 3VD5A 4FXKB 5B39B 3U4AA 4PJAE 2FD6L 5IM7B 3CVHL 3U36B 4FQCH 4QRSB 1KIRB 2CLZB 2YD2A 3MRCB 1ZE3C 2KQMA 4YBQC 5HHME 3CLFH 5E95B 3ARED 1BD2B 2V2WB 5D5MF 2H8PA 3BH8A 5E08H 4GW4B 3HI1A 3RWGA 4PJXB 1DL7L 5DDHB 1LD9A 5DHXB 3V95A 4PJAF 1JWMB 1IC7H 1LP9B 1RZFH 4XX1E 4HAFA 2X7LB 1I7ZB 4P2QB 2EC9U 1QEWA 4WFGE 1SYSB 2P43B 5FB8A 4WFHD 3VFMB 3VFRA 2BY3A 3MNZA 4ZUWA 4XP9L 2V7HB 3TJEH 1DEEB 3SDCB 1D5XB 3FMGL 5CEYB 1Q8MA 5TDNB 3VGAB 1R5IA 4ZQKA 3RJDA 5CEZE 4JO4H 3ARRA 4L4TB 1BEYL 1QYGH 2ARWA 5TDPA 2JIXD 3ILQD 4TOYL 5I9QB 1ADQA 2VABB 3TBYB 4I18C 1W0YT 5D7JA 1KCKA 5CZKA 1AD9B 4QCIA 5BW7C 3MLRL 4JFHE 3HPLB 1DN2A 5LGHH 1MNUH 5LKNA 3MJ6A 4L8SA 2H32A 2YC1A 3DPBA 4WW1B 1IVLA 3Q6FB 3BO8A 1BP3B 4Z7UA 4QXWA 3VXUA 3EO1B 2WUBL 3C60C 5ICXA 3QUML 4GRWB 4CN6A 1RSFA 4K3DL 1G9MC 5B21A 1HKFA 3TT1L 1JNLH 3QIUD 1J0ZA 3J7HA 1NGPL 3MRRB 3ARGB 4YX2L 3U9PL 3GI9L 1X6NA 4HKJA 4LGSB 4QRQA 5F3BB 3ETBF 1I8LA 3FOMB 5JMOC 1TZHB 4LHUA 1U93A 5FKAB 2JELL 3MA7A 3MV9A 4ZPTA 4JFPA 4PJBA 5DC4B 2JB6B 1FAIH 3CLEH 3QJHB 4Y1AA 5LBSL 5BS0D 4CVZB 1B9ZA 3HN3A 2XKNA 3QG7L 4X4XB 5IW1A 2W0PA 4RX4D 3QZWG 4RQQB 1QOKA 4YE4L 5IW6B 1KCRL 3SGEH 4NGHL 2I9TB 5T33H 5M7QA 2FHFA 3VU2A 3DUUB 4DVBB 3QWRA 2OR8A 3HR6A 1LK2B 1A1MA 2XRAL 4Y5YA 1ND0B 3PV6B 3P3YA 4V1DD 1WWWX 3MV7B 4GH7B 5IV2A 3HZMB 4LSRH 1TJGL 3FRPG 4D9RE 4TUJB 2WQRA 5IFAH 4CRPA 5DD1H 1J1PL 5I1GL 1C5DB 2B5IC 3AREC 4L8CB 5FK9B 1QTYT 4HHAA 5TE7H 2BCKA 2QLVB 1A5FL 1JK8A 4LLAA 1B4JL 1RZ8A 3S98A 5B8CC 1ORQB 4JFXB 2PW1B 1MY5A 3TO2B 2D7OA 3MJ8B 1AIFB 5IB4A 3ARVA 1FSKC 3ZE2E 4GKNA 1T7XA 4APQD 4NCC1 3MACL 5D9SA 3K3QA 1FIEA 4U0RB 4RMTA 4JRXB 4QGTA 4MS8D 1CICB 1DR9A 2DLGA 4KH2A 4PY8J 1CFVH 5EUOB 3IU3B 4RGMC 4XXCC 2DQFB 1CE6A 3V4UL 3NBNA 4HS6B 1MIEH 3H7BA 5LVEA 2Q86B 4LCYB 4WHCA 3MO1B 4JG1H 5DMGD 3ZE2F 1KB5L 1UJ3A 5D5MA 3CIQA 4EXKA 2LAAA 5K9KB 3IDJA 2WW8A 5DQJA 3JV6A 2DIBA 4ZSOE 3ILQC 4M7KH 4PJAA 2VR5A 3BGMB 5EFIA 1A4JB 5GSRB 4IBLT 4XC3H 4KMTH 1PX4A 3VRJB 3I02B 5JORB 2BDNH 2XN9D 4NO5A 1NCDH 4X7TA 2OS7A 5BQ7A 1H3WM 3RI5K 5LWYL 4I3SL 1MCPL 3WS6A 4HKZB 1PJ9A 2N1KA 3DVGA 3RWFA 3RDTB 5C0CD 5L6YH 4OM1L 2A83A 4AH2B 4JY6B 1ORSA 5ALBL 4TQEH 2EC9T 3C8HA 2WP3O 1NDGA 3REVB 3B6SB 2IH3A 5H94A 3NFNB 1EEYB 3MJ9L 1VDGA 2H6PA 1RY7B 4ODVL 3CFCL 4CL7A 3SCMD 3I6GB 3M1BA 4XH2A 5FCUH 3IKKA 3VXME 1Q9OB 4ZO7A 4NKIH 3GSXA 2R2EB 1HQ4A 2YWZA 1NFDB 3K2MC 3QPXL 4PY7A 5FOBB 2CLRA 1U8LB 4LSSL 3EFDH 2Q6WB 1LEKB 3WDIA 1L6XA 2M26A 4WU5B 2BHYA 3TH3T 5KVEL 5FYJH 4YHOL 3H9YA 2D0HA 1NLDH 3MRGA 1I8KA 1AXSA 4IRJB 1G7QB 2LVCA 1U41A 3MTRA 1G9NH 2YR3A 4QTHB 1NUFA 3FRUB 4AZ8A 1I7TA 4OD2A 1JMZA 5DUPL 4JFDD 1PEZA 2AP2A 5FA4B 1WTGT 4OZFG 3QRFM 4OLZL 3MLYH 3Q6GH 5GJTL 2CRZA 1EO8H 5IEHB 4Z7QE 4RISL 3FO9B 1IGYB 5MEOB 5CLTA 5SWZB 4GQPH 3TBSA 4APQC 3AGVA 4GXUN 4XVUC 3GSWB 3QHFH 4CMHC 4KI5D 2YD9A 5IB1B 3VW3L 4PGCB 4NBZB 4MS8C 3BUYB 2DMCA 3WNLA 5HDQL 4ZXBA 4XMPL 5FUZH 3MA9H 1CT8B 1OWWA 5J06A 1F2QA 1P4IH 3QEGH 3TN0C 4M43H 4Z7QF 3T0BA 3L3IB 1WIOA 3EAKA 5DRNB 3CFJA 1BQHA 1KENL 4WTZA 1VFOA 4MVBD 4QRTA 3GIZH 4X98B 4LRIC 4IMLA 1JJUA 3QXAB 2PYED 2P48B 4UB0L 1ZTXL 1OAKH 4RAHA 3EOBB 1RK1A 4YIQA 5CJ8A 3OJ2C 4JGMA 3NABL 3AS0A 1T89C 2GQHA 3D18A 5HJ3B 4F15B 4P46A 4HWBL 1I9IH 4RDQG 2CR3A 5GGRA 3ZYZA 4JM2B 1LDSA 2C4XA 3MREA 4Y4KB 1MWAL 1WBZA 1PG7H 1A6PA 2RFXA 1A3QA 4QHMA 3QYCA 4LLQB 4WU7B 3KPMA 2X4QB 1WFUA 2PXYA 4OLWH 2R1YB 3QNYA 5KAQG 3HE7B 4UILL 3IAQA 2DN7A 4RMQA 4OTXL 1LO0H 1QLRA 4TTDC 3EZJB 2CRIA 4IHOB 2YD1A 4U6TA 3SGDI 5C2BH 4NZRL 1YMME 4NP4L 2GTZB 2QL1A 4Y5VB 1YJDH 4XP4L 1QA9B 4ZSOA 3WN5A 4PRPE 1M7IA 1WT5A 1R3HB 1BFSA 2VLKD 2X9XA 1ZVSA 1UH2A 5L2KD 2A6IB 1CFBA 4AIOA 1DBMH 1MI5D 1ZHLB 2HJKB 3ZTJG 4I1NB 4P23D 3VXOB 3E6HA 4NC1C 1BJ1J 4YDJB 3CMOH 1HXYB 3MZGB 2I60H 3QQ3A 4M5YL 3KXFB 4LK4A 5MENB 4NKOA 5BVJB 4MNHA 1MPAL 1V3KA 1AGBB 4E9LA 4X6FA 2APFA 4DWHA 4OF5A 3G6AB 1A3RH 3PP4H 4WENB 4RAVB 1S9YA 5JQHC 5JO5A 2GY7B 5A16B 2EIEA 5GS1C 3I6LE 3DRQB 1DQQB 2DQUL 5ESAA 3KVQA 1Q94B 2PR4L 5JDJA 4HUKB 1VEPA 4J2XA 1NUDA 2V5MA 4H88L 3DGCR 4Y8DC 3IFLH 3LHPH 4WVRA 4X99B 4PLKD 4Z76B 4KI5C 1E4XH 3VXMA 5GGUA 3F12B 4LEXL 3GSNB 5M94B 5EULV 2DYPB 4WWKA 1CXFA 2VDOH 4PJ5E 5DA0B 5C08D 2VH5H 4M1GL 1N6UA 4JANA 1ZLUK 4EXPX 4ONHA 3FFCB 4LSQH 3QULB 2Y5EA 4LQFL 1SMAA 4MVBC 4CN4A 1JWUB 4L4VE 1PQZB 4FRWA 1AC0A 1K8DA 4HWEH 3JV5A 1CQKA 4TSAH 1HQRB 3B9DA 5ALCL 3D85A 4G8FA 3STZA 5F6HJ 1Z0NA 2Y5TB 3RY6C 3WIHL 4GRLB 1AGDA 3S4SB 3KJ6H 2XQYK 3UTTB 5CD3B 4OCXL 5E2TH 2DQJL 2CLVA 3QDGE 3FTGA 4F7EA 4O4YH 2QV2A 3HAEH 5TGBB 2VLLB 2EDOA 1XIWB 1DQDL 25C8H 3SQOH 1O7SA 4XPFL 1Q9KA 3SE9H 1BREA 1YEJH 5C3TA 1L6ZA 3S3SA 4Q58C 4HS3A 3QEUA 4RAUA 4HV8B 3NN8B 3B2VL 4QXUL 3VFSB 5I1JL 2ESVE 1EJOL 3IKCB 4NQEE 1A4KB 1G7HA 3RRQA 1U0QA 2AJXH 1ZHBB 4LEOB 5E7FA 3BX7C 3VDCA 4N9OB 1JWSB 2FLRT 2NY0B 4UT6L 3L5JA 3DWTA 1GGBL 4LCWD 3WD5L 4F7CA 3GJFH 1D6EB 3B3IA 3CK0H 5DS8B 3BP6B 1KCUH 4NM4H 5DA4A 1DANU 5ENWB 4C55A 1F8TH 4N9GB 1MLCB 4MXWL 1XR9A 5GS3A 4YGVB 1HSBA 1FLRL 5BMFH 4JPVL 2UUDH 1EHLL 3QAZB 4N8CL 5SX4I 3DROA 3DX7A 3Q48A 5CIPB 3V5HB 1FV1A 3S36X 15C8L 2XWBA 1U8KB 4OM0L 3ORJA 3GBMH 4P9HH 2X4RB 4U1KB 3DJ9A 4XPAL 2DOCA 3AXLA 3K8KA 4GXUM 4QTIL 1OM3H 5L2JB 1H5BA 4YQXH 2OR9L 4PJEE 1KTLB 5D93C 1RUKH 4XCYB 1YMMA 3RL2B 3UAJD 2FX9L 4PLKC 4JZJC 5CEXA 5FUOL 4CW1B 5TQ0H 3O2VL 4XHJD 3H9HA 4M61A 1J0IA 4Z7WB 3T0EB 5AUMB 2LAGB 1ITBB 5F7DA 2BOBA 5DJDA 1DBAH 4MHHG 4PJEF 1KJ2A 2OSLB 4BH8A 5JTWA 2WM0A 3HS0A 4OGYL 3H7LA 1SEQL 4NNYB 2FZ3A 5DRXB 4PPTA 3R1GL 3RX5A 3KPSD 1NCWH 1RV6X 5ACLA 5GGSB 4M3KB 1S9VA 3W9DB 3KR3H 1KGCE 3QDJE 4MSWB 4N8PA 3FQUA 2CDGA 4NKMA 2XXCB 1H0DB 5T3ZH 1NCAH 1ZLWH 4PBWD 3TA3D 2Y7QB 3KYOA 4K7PY 4NSKB 4NOFA 2F58L 1C5CL 4UNTA 4DN3H 1UQSB 3LRGA 3SGKC 1BZQK 1D9KB 3P9MB 1IKFH 1DBJL 5DJAB 3ULVH 1KYOJ 1FH5L 5JA9A 3OKEA 3MNWA 5IJKC 3MBEA 3KS0H 1T1YA 2NX5B 4DVRH 1UH4A 3M17A 4M62L 4XHQA 4ZFOA 2W1NA 4JR9L 1NCBL 1JPGA 2ED7A 1RHHB 3SKMA 2BP3A 5IJVA 1IBGH 3N85L 3N1MC 4FQQB 2Z93B 3IDXL 2FECL 2RJMA 3KWWB 4HCRH 4OFVA 5D1XD 1FVCB 1PD6A 2YUXA 1WFOA 3MUY1 4X9GA 1MCBA 2HT3D 3HC4H 1MWAB 1I4FB 5IBUB 3HI5L 1F2XK 4X9FA 3ZE0E 1JF1B 5EG6C 4WUUD 4Y4HD 6FABH 1RZIA 4G42A 4X5LA 2W9DH 2XTJB 2UZIL 1FFOB 1BZ9A 4IOIA 3QBTB 5CJQL 2AEPH 1A02N 1DQTA 1FGVH 5CUSL 4BZ2L 1KPRB 3IDYB 2NNAA 3QDGA 3QI9B 2B2XL 1OD7A 1GC1L 2IBZY 3LEVH 4ORZC 3ZE0F 1QSED 5GGRY 1I9RL 3PL6A 4OIBA 1YECL 2UVEA 5AWNL 3RPKA 3RI5F 3SY0A 5HHOD 4WEBH 1Z6JT 4A6YL 5DT1L 4S10A 2GJ6E 1DQLH 4OLXL 2ZJSH 4I5BA 2WSKA 3KYNB 4KHTL 3QPQD 4XHJC 1CU4L 3AB0C 4NQEA 2VZOA 5DEFA 3O6FA 5BV7L 4M93C 3BH9A 3HE6A 1P4LB 1ONQB 3L6FB 4JFEB 4PJCE 5E4EB 4AT6A 1QHPA 1EAPA 5IVZB 1T4KA 1CI5A 4N1EA 4NQCD 1F3JA 3WKNA 3P4OA 3OKNB 4OD3H 4GMSH 5DJZB 3SKUD 1XGYL 1GAFH 2V7NB 1U8QB 4X5WA 1HILB 2AK4B 4M00A 1FN4A 1DANT 1YEGH 4PJCF 1X5LA 4RRPG 1BLNB 1S7RB 1R3KA 1KLGB 5BCAA 5K9QI 3HMXL 5A2LH 5D1QD 4FQ1L 3HC3L 1G7JA 3TA3C 4PJEA 1QFOA 1B4RA 1DN0B 2I9LA 2V5TA 3BDYH 2A77H 2Q87A 4JKPL 1KF9B 1WC7B 2AXJA 4X7SH 1SBBA 3OL2A 3GMRB 1MFDL 1YYLH 3LQZB 3V0VB 4WW2B 1J1XL 1CTOA 2AXGB 2QKIB 5D7IB 3RL1A 43C9A 4P5KB 1ZWIB 1CDBA 4HZLB 1SY6H 1MH5B 3MFFA 4NHCH 5INDB 5C7XL 2YRZA 5AAMA 3QCTH 3MLVH 5KVDH 5DWUH 2VZ1A 4KVCL 1AGFA 1MJJA 1UFUA 3QXVA 4PRHE 3O6KL 1TJHH 5D1XC 4NRYB 4DCQA 4R96B 3X12A 1KJ3H 3KPRE 2VIRB 3MRFA 4TRPH 3JUYA 2Z35A 1AXIB 2EH7H 4HQQH 4LSPH 3QDJA 4RGOH 1FYTD 4GJTB 4L9LC 4OZGE 1RK0B 1L7TL 4W81A 4LDOB 4Y4HC 3BPLC 5ESQB 3U82B 2C9AA 2OJEA 3TZVB 3GMLA 3ZLQC 5J11B 5BV7C 4JY5L 1VKXA 5E8PA 3L3JB 1F5WA 1VFUA 3O8XA 3VXSD 3SGDH 1F90H 3DV6B 4OZGF 4I3RH 2PKDA 1N0XL 2HFFA 4OV5A 3LMJL 4P3WA 3P9LB 3HAEG 4F9LA 4C4KO 1OTUD 2MNUA 3FQNA 5I19L 1HSAA 3HI6H 2X4NA 1Z9MA 2B1AL 2GT9B 4QOKE 3QPQC 5FO9A 4I0KA 1F3RB 2H1PH 1K2DA 3G9VA 3PV7A 1V3JA 1NBZB 5JOPD 2CGRH 2VSDA 4X4YA 1C1EH 5E1AA 4CKVX 2F19L 5HVHB 1OLZA 4N0RA 4HWUA 5T5NF 4HJGA 1V7NL 5CJBA 3WXWH 2D03H 3VXNA 3NIGE 4H20H 2AV7A 3S3PA 3QFJE 1U8OB 3BRFA 2MJWA 1FO0A 4FFVD 2V2XB 5HD8D 4HIXH 3BFOA 4MNQB 1N2RA 3VA6A 3QQ9D 5I15H 4Z7VA 4PRDB 2D31B 2F53E 1QKZH 3MOBH 3NIGF 4WHDA 1XR8A 5E94A 3CSPA 3DX8B 1OPGL 3TVMA 3DUSB 3BYTA 4J4PD 2P5WD 3F6LA 2GJ6A 3Q1SH 1UCBH 4NHUA 1IM9A 5KSBE 2HVJB 1YEKL 1EZVY 1M4KA 1JPTL 2AJUL 5TE6L 3RWJA 5IVOA 4EI6A 3HC0A 3FQXA 2C3GA 3GK8H 3LQAH 3MCKA 5KOVC 1GGCH 5GRUL 3M07A 2DWEA 4LF3B 3ARBA 1SJVA 3IDIB 4G3YL 4PJCA 4DGIL 2ORBH 4PJ7B 2HLAA 3T2PA 3MV8B 5C07D 1KN2L 3QO0B 5KSBF 5CHNB 3TBTA 4ETQB 5HI3D 5IHZB 2RCSH 3X13A 2XZAH 4M8QA 2MHAA 4FZ8H 5F1KC 5C0JA 4LHUG 3PWPE 3FT2B 3U4EA 4UQ2B 4OAWB 4OD1L 4U2YA 1J8HA 5KSUB 2ZSVA 1P7QD 4O51A 4NC2B 3MRHB 5EOTB 3NGBC 2NW3B 3HLAB 5BO1L 5J12B 3P77B 4HWZA 4YEFA 1KN4L 4UT9H 4N0UE 1LNUA 4O5LL 3RGVA 1M05B 1SJXA 1XMWA 4HK0B 2J6EL 3V6ZA 2J5LC 3L7EB 3TF7C 2VWEE 3MRJB 1PW3A 1T3FB 3FN0H 4WFED 5KN5A 1CVRA 3WMSA 1A3LH 4O00A 3N9GH 5F7EH 4YAQA 4AENA 4BQ8A 5HGHA 5C6WH 5IG7B 5K9OB 2GYSA 1OTUC 43CAB 2AI0L 4FQLH 3KPLB 1YNLH 2XT1B 3WS3B 1BD2E 4FABL 2A6JB 3FO2A 1C5BH 4U6HA 1LK3L 1J0HA 3QIBA 3BPNB 4PJXE 1KXVC 4LCIL 2ZPKH 1HXMB 4KQ4H 3WFCL 4NPYB 1LP9E 2D7TL 3VXQB 3LH2L 3EYUH 4LLMA 4P2QE 4JO1H 4R3SA 4PLNC 4K3HA 2DQTH 3WEXA 4S1QH 1A6UL 2BRRL 4G6AD 5SX4H 1FCCA 2JF1A 3VG0H 1QR4A 4JQVA 4BJLA 2D7MA 1W72B 1A1OA 5HD8C 4PJXF 4XP5L 3V4PL 1FPTL 1U3HA 4BFBD 5DD5L 1LP9F 4MDIA 1HZHL 3VRLE 2DL9A 2WBWB 5BRZA 4L9DA 3W39A 2P8MA 5BJTB 4TNVK 4L4TE 3GSNH 4PIRF 2N7AA 1E4WH 5JA8B 1LO3H 1RZJL 1TNMA 4HUXA 2FO4B 2GAZA 2QQNH 2YK1H 1ZOXA 1I1CA 4XPBH 4YWGL 2GJZB 1CLOL 2CMRL 2WK2A 1A2YA 5D7SH 4PJIE 4O2CB 4JN2B 3VRLF 5MERA 4XNZB 4QOKA 3OJMB 4FQXD 3RAJL 2VDRL 2VISA 4XX1G 5J1AB 3NACH 4EDWH 4HDIB 3DGGA 1JNHA 3LEXB 5KANG 3ARPA 2Q8AH 5I8CA 5D96B 1V05A 2AV1B 4GRWE 1GGTA 2BX5A 3X3GL 1BBJA 4PJIF 3MYJB 5CP7A 3UYRH 2A1WH 3O9WD 4MAYD 5FECA 3OG4B 5KG9B 4NYLB 2HKHH 3TJHC 3W2DH 3STLA 2ZG1A 3T0VA 1T04B 2JKXA 4LHQB 4NWTL 5HHXH 4D0DB 3WNKA 4P5TB 1IC4L 4GRWF 1EMTL 3OX8A 2F53A 5F7HA 4P4KD 1MJUH 1OB1A 5DEZA 3GMQA 4M6NH 1I3GL 2R4RL 3ULSB 3MRPA 2A9ML 1WAAE 2ZNXA 3JTTA 1HDMB 1FVDA 4Z95H 2RHEA 4PP2B 3T1WA 2MPAL 5KSBA 1RZKL 1T1WB 4Q2ZB 2BVOB 1NH6A 2E27H 2O5YL 1EUUA 1FZMB 1MRFL 4HUVA 3WL9A 2WUCL 3LCYA 1Y18B 4WDIB 3T2NL 1WAAF 5E70A 2ED9A 3MXVH 2GK0B 2AJVH 1IRAY 3QIWC 4HXAH 2WWKT 3MV7E 1CR9L 3TGXA 3KLAB 3KYKH 4OCRH 2IANE 4PBVC 4B7LA 2H2PC 4P9MH 3WE6B 4PJ9B 3S34H 5TE4L 1W0VB 4QHUB 1MHPH 4G6FB 4Y5XA 5ADOL 4XMKH 3PGFL 4NO2A 1BZ7B 3RY4A 4DAGH 4QEGA 3PWPA 1J10A 3JBG7 1RZJC 4OI8A 1C08B 2EDNA 5EO1B 2B20A 1X4ZA 5FM5O 5K93A 1MF2H 2ID5A 5I8EB 4AIXA 3K2UH 4JG0H 4G6AC 1I1AB 3PIQA 1T0MB 2FJGB 4JRXE 4TN9A 3F7YA 3IS1X 1RIVL 3CX5K 4L8DA 5EUOE 5DXWA 3G04B 5KS9A 3SOBL 1NLBL 3F6IA 1BQHG 4PJHB 4X7DC 1IAII 4WTZG 3DVNB 1A7PL 5DVOA 3QUXA 2P5EB 4L1HA 1DFBL 4P3DB 5DVLA 3BIAX 3UPRA 4U1NB 4UDUA 4FOMA 1TENA 4XP1L 3P30H 1IQWL 5B39A 1HNGA 5J57B 3D3VB 4M1DH 2DBJA 2D4DA 4CN1A 5EUOF 4UOW1 3SKJH 3U36A 3EDDA 1MVUB 1KIRA 1YEFL 3MRCA 4OCYL 4E41B 4UU9B 2EEDA 5T3XL 1NKRA 4FQXC 3TNMB 3BD3A 3U2SB 4KXZI 1BD2A 2V2WA 4OIAA 3PF2A 4GW4A 4Y16C 1EX0A 1Q0YH 4CMMB 4P5MB 4PJXA 1G7MA 2VAAB 3WO4B 3JV0A 2YPVH 5ACZB 3MLZL 3W5MA 2X7LA 1I7ZA 2WBJA 3PWUA 4P2QA 3FQRA 4WI9A 3K4AA 3FONA 2VNCA 4K23L 1UM6H 2R56H 4XT1C 1B6DA 4G7YL 3JVGC 1RZKC 2BNRD 3FB7B 4YFDB 3O9WC 1W0WB 5HYQB 4PV8A 4MAYC 4HFUL 4ZDHA 1NC4D 2HMID 3SDCA 2QQKH 5CEYA 5TDNA 1U42A 3L95B 1YEHL 3H3PL 4HIJB 1FFNA 3EYQD 3MLXL 4TSCH 1XF3B 4P4KC 1CGVA 4L4TA 5F7LB 4XCNB 3HFMH 1N64H 1OAZH 2C1OB 3KLDA 4YC2B 1I7UB 1ZT4B 3IJHA 1K6QH 3BP4B 1KC5L 4NJAL 1HKLH 1NFDE 5JNYB 3MRIA 4E0RB 1UM4L 1VPOL 2EH8L 5DUMH 4PJIA 3CGTA 1WZKA 4P2OB 4W68A 4DZ8B 3HPLA 2AEWA 3VWJB 3ZYIA 3MLWH 4XNUL 4NZJA 1RIUL 1BM3L 1OF2A 3EO1A 2DBLH 2EDFA 2ITDA 1NFDF 3PP3K 3QUZA 3SE4C 3RVTC 1LGVA 4KDWA 1S7WA 1AKJA 4WI6A 3LKSB 2Z92B 3WFHA 2VITB 1W8OA 2APTA 4KWUA 3FZUD 2CKNA 5SWZE 5EU5A 5DQ9B 4XBEL 2AK1L 2ZNWA 4ODUA 2JB6A 1N4XH 1OSPH 5I66A 1WAAA 5D7JD 4CVZA 3O0RH 3HNVL 1UADC 5IESL 3OKMA 3OKKA 4X4XA 1U8HB 2FX8H 3O2WL 3ULUL 3F58H 5HGDB 1J05B 3WFDL 2I9TA 4KVNL 3QQNA 2C7UB 4F57H 3GJEB 4OCMC 2XZQH 2VXUL 3MODL 2Q76B 3B2UC 1AHWA 4XC1L 2ICEA 2Y9RT 4DVBA 5J1SC 3VXUD 1MIML 2N4IA 5FYLH 4MNGA 1MHEA 5DC9B 2IFFH 1EGJL 3ZKMC 2Y4SA 3SDDB 5EDXA 1HWGB 5J0BA 2IANA 1FVEB 3HZMA 2Z4QB 5CZVH 4TUJA 3O3EB 3WV0A 1WEJL 3CJJA 1KEML 2FR4A 4WJ5B 3VFTB 4L8CA 5FK9A 3H8NA 4HJ0C 4N8VG 5GPRA 1WSST 1YN7B 1S5HB 3ZT6A 2LV4A 4I8DA 1HE7A 1NGWB 3AC0A 3N1PC 1ORQA 4JFXA 3U7WH 4LHUD 3BW9B 3KPOB 1AIFA 2MOVA 3MV9D 1GZQA 2F5AH 4Y1AD 2Y6SD 2ADJB 2B1HH 4AL8L 4JRXA 1UZ8B 1CICA 3QWOA 2HG5B 3FB6B 1ZANH 4KU1A 1CDCA 3IU3A 4TUKL 5I1HH 2DQFA 1WFNA 1GXEA 4JREC 4LSTL 5J4MA 3MO1A 1T7YA 1CXHA 3O45B 3EYQC 4M5ZH 4KTDL 3QWRD 1D5ZB 1KV3A 2XKSA 1FIGH 5K9KA 2E9BA 1XGTB 2X2YA 5I30L 1KPVB 3NCJL 3UJIH 4XBGB 3BIKB 2R1WB 3IETB 2H3NB 1A4JA 1A6ZB 2X4OB 5GSRA 2FX7L 4L3AA 4P2RB 1P1ZA 1WUNT 4OCWH 1E0OB 3VRJA 3I02A 3EYVB 3OB0K 1VGEL 4J3WA 4WHYH 1BVLA 1CLCA 4QHLA 2VXTL 2Y07H 4LLUA 2YEZB 4CNIA 4Z6AT 4HBCL 2CXKA 4OI9A 1N5AA 1MFEL 1RUQH 3L3OB 2DQEL 1AXTL 3KXFE 3HKFA 3RDTA 2GCYA 1QSFB 4YDLB 5IOPB 5KW9L 4BQ9A 1CK0L 3V52H 4PRBB 1UWGL 4LPWA 4JHAL 1UC6A 1IILE 2DIAA 3REVA 3TNNB 3P11L 1EERB 3VFGH 4GO6B 4BZ1H 2ZCKH 4JB9H 2GUOB 2ZZUT 3AUVA 4XVSL 5ILTL 2MCG1 4KKNA 3I84A 5FYKL 4QXGH 3DRTA 3IJYB 5D7JC 2R2EA 4MA7L 3BKYL 1NFDA 5FOBA 4LOUD 3CSYB 1P2CB 4ERSL 1XF4A 4MD5B 1LEKA 2EYSA 1CF8L 2E6PA 3MR9B 2HVKB 4WU5A 4L8SC 3TIDA 1T03L 3FFCE 3VMNA 1JHLL 3MRBA 5HHPB 1K9TA 3QQ4B 5EZLA 1RUAH 2VXSL 1G7QA 2HWZH 3HNTL 3OQ3B 4WFGD 5DFWH 2AXFB 3FRUA 3PWVA 1NPUA 2CQVA 1JP5A 2AJ3A 4LIQH 3EYSL 3UTZA 4Q7DA 1C16A 5AEAA 5ID0A 3T04D 5BZWA 1I8LC 5I8KL 2VQTA 5HVGB 1AY1L 2FNBA 1FSKB 3C08L 5CEZD 3FO9A 1JTTA 5SWZA 2GSIB 3QHTC 4ELKB 3N06B 2OXGA 5J3HD 2DF3A 5IB1A 3LRSB 1DBBL 4F7PA 2V6HA 2KUTA 2IPKB 3SDAA 5E99L 4JFHD 3PXJA 3DIFA 1JTPA 4YDIH 2PN5A 1R24B 1FFPB 5TQ2L 5DD3L 5D70L 2JIXB 2VR4A 4U1GC 1A6VL 5DRNA 3CVHA 5EC1B 5C0BB 4YXKL 5CEZL 4X98A 3D25A 3QXAA 3UYOD 3JWDL 4X6DA 3EOBA 4ISVA 1SJEA 2CDFA 4WO4C 4HIEA 4CUCA 2AQ3A 4QT5A 1QPPA 1FRGL 2VZVA 4L3EE 1T66C 2KH2B 2ADFL 4ZUSB 3D0VB 3BZ4B 5A40E 5FO7A 3HUJB 5EOQL 3LIZL 1JGDA 2NY2B 3TT3H 1HHIA 4CDHA 3O3DA 3OKOB 4FTVA 3GMPB 3O4LB 4Y4KA 3QIUB 5L0QB 4R90L 1KIQA 4LSUH 4RWYH 2XA3A 3FT3B 4WU7A 4ZXBD 3D69A 4K7PL 4WFFE 5EB9A 12E8L 3SDXB 4HXBL 5DZLA 3HE7A 1FLTX 2DQGL 2A6KB 1UJ3C 3NFSH 3OAZH 5HVWA 4YBHA 3WHXB 3EW3B 2D7QA 1D5BB 1UZ6E 4PD4K 2GTZA 5BS0B 1JRHI 3D39A 3HG1E 4ODTH 4IJ3B 4DK3A 4D9RD 2NY1B 4PS4H 4LOUC 4Z7WE