2B9AA

Human transthyretin (ttr) complexed with diflunisal analogues- ttr.3',5'-difluorobiphenyl-4-carboxylic acid
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
108
Chain Sequence
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTARYTIAALLSPYSYSTTAVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title Diflunisal Analogues Stabilize the Native State of Transthyretin. Potent Inhibition of Amyloidogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 24
structure length 108
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2b9aA00
3QVAA 1KGIA 2PABA 5E4AA 3GS0A 3KGUA 4ACTA 1E4HA 4N86A 5BOJA 3NEXA 4IIZA 4Q14A 4WNSA 5DWPA 5JIMA 4DESA 1DVYA 1TTBA 5JIQA 4IKLA 3GRGA 5CNHA 3GRBA 3CFNA 3IMUA 3FC8A 3M1OA 4HIQA 4WNJA 1IIKA 4DEUA 5FW8A 1IE4A 5DEJA 5AKTA 1THCA 1TSHA 1TTCA 1F41A 3NG5A 4TNGA 3CN0A 3DIDA 4PWJA 3ESPA 2GPZA 3DGDA 3HJ0A 1BZDA 2QGEA 3CN2A 1TT6A 1GKEA 2B16A 3I9AA 1OO2A 3NEEA 3ESOA 5AKVA 2G4GA 2IGLA 2TRYA 5TTRA 3FCBA 1SN0A 2H6UA 4IK7A 4ABQA 2ROYA 5CN3A 1TYRA 1E3FA 5FO2A 5JIDA 3BSZA 2ROXA 4PWKA 3DJTA 3I9IA 4FI7A 3CXFA 4TLKA 4Y9FA 4DERA 4PWFA 4HJTA 4D7BA 4ABUA 3U2IA 1THAA 3DJRA 3GLZA 4MRCA 3P3UA 1SOKA 3IPEA 4TKWA 2QELA 1SN5A 1IJNA 3CN1A 4TLTA 4TL4A 1TZ8A 4DETA 4PWGA 1TLMA 4TQ8A 1TFPA 4IKKA 2B77A 2G2PA 5CLXA 4TL5A 5E23A 5L4FA 1KGJA 1RLBA 3GPSA 3IPBA 3DJZA 4DEWA 2G3XA 4FI6A 2F7IA 4PWHA 3A4EA 2G9KA 5CLYA 3DJSA 3IMVA 4QXVA 1X7TA 5HJGA 4QYAA 1Z7JA 4AC4A 4YDNA 2G5UA 3Q1EA 3IMTA 2H4EA 4WO0A 3BT0A 5FW6A 5A6IA 5E4OA 1DVTA 2H0FA 1QWHA 3KGTA 4I87A 3IMWA 4PWIA 5K1NA 1DVSA 3CFTA 3D7PA 3A4FA 2B14A 1ZCRA 2B15A 3OZKA 2B9AA 4ABVA 4Y9CA 4KY2A 3ESNA 4YDMA 2QPFA 1FHNA 1BZ8A 2G4EA 2G2NA 2GABA 4PM1A 5AYTA 3TCTA 1F86A 4TLSA 1Y1DA 4PMFA 5EZPA 3SSGA 4QRFA 3A4DA 1X7SA 5AL8A 1FH2A 3W3BA 2FBRA 4I89A 4L1SA 4PWEA 4MASA 5FW7A 5CR1A 3D2TA 1G1OA 4TNEA 4TQIA 5AKSA 5EN3A 3P3RA 2TRHA 2QGCA 1DVXA 3B56A 2H0JA 3GS4A 3I9PA 1DVQA 1E5AA 3OZLA 5CLZA 3IWUA 3CFMA 1TTAA 3NEOA 2F8IA 4TM9A 3CN4A 1U21A 4N87A 4PMEA 4ABWA 2WQAA 4TNFA 3KGSA 3GS7A 4TLUA 4AC2A 1ZD6A 1BM7A 3DK0A 3P3TA 4FI8A 1ETA1 1GKOA 4PVMA 1ICTA 1TTRA 4TQPA 4Y9BA 5L4JA 2H1XA 4HISA 2FLMA 4PVLA 2QGDA 4IK6A 4HJSA 2G3ZA 3CBRA 4TQHA 5AL0A 5CM1A 5L4IA 1BMZA 1IIIA 1SOQA 4I85A 4N85A 3P3SA 3DO4A 4Y9EA 4ANKA 3IMRA 1DVZA 3NESA 1SN2A 1DVUA 4MRBA 5K1JA 3CN3A 2NOYA 3DK2A 4IKIA 5L4MA 4IKJA 1QABA 3CFQA 3TFBA 4HJUA 4PVNA 3IMSA 4L1TA 4Y9GA 1BZEA 1ETB1 2H0EA 2QGBA 5IHHA 3U2JA 3IWVA
chains in the Genus database with same CATH superfamily
3K81A 2V9QA 3EFFB 2WXNA 2JNZA 3WELA 1HQRB 3PABB 4O51A 2W1NA 2XPGB 4K7PH 4OZHE 4PCKA 5ESQB 3RQ3A 2ADFH 3VQ2C 1FSKC 2HFEA 3BAJA 3U7AA 2E7HA 4KKPA 3BE1L 2YQGA 4I18B 4ZS7L 1NBVL 2A4EA 1BHGA 5FUZL 1CFSA 1AANA 3S2CA 5IHZA 2ADJA 2L7JA 2NUPA 1RFDL 2Z3FA 1PMYA 3QPXH 4W4OA 3VG0H 4RZKA 2F7QA 2BVQB 3NCCB 5HHNA 1NPNA 2ODHA 3L5XL 1BQUA 1YEHH 4I1NB 1WA1X 2D4DA 4KAQH 4OZGF 5IG7B 2NXZB 3LRGA 3UTPE 7FABH 4J8QA 4UBDC 3N1GC 4KTEH 3U82B 1P6AB 3FT4A 2XVKA 5DQDH 2GTWB 2KL6A 3DXAD 5GXBB 2F2HA 1LEIA 3IAPA 4GINA 4YLBA 2DPKA 2JMRA 2XN9A 2YC1B 1ZV5A 4JN2A 1HYSC 2BP8B 4OFIA 2R0LH 3FBQA 3UTPD 1R3JA 2K6WA 4OCYH 4WJG3 4WVRA 1OK0A 4N2EA 1T0NB 2YUZA 4A6YH 4G80A 2EH8L 5DR5L 3D18B 2JCWA 4E9YA 1IILE 2A6JB 5KBMA 1MCOL 3SYAA 4B6ZA 1JGLL 2Z93A 4K15A 2I5YL 1T7XA 4ALAC 5D1XD 5FDYA 5FUOL 3VI3E 4OAWA 2VLKB 4J8RB 1KCSH 3K6NA 3TYFB 5KYXB 4XMTA 4PJAB 3RWHB 3FHQA 1T4KB 4W9EC 3V0JA 1NOAA 2J5WA 5D7SL 1HXYA 3II1A 5FKPA 5IVXB 3QULA 4EZMA 4YVNA 4E0RA 1PS3A 2D7NA 3LXBA 2EXWD 3MLZL 1CICB 3MRRB 3KW7A 4ZSOB 4R96A 1RIVL 2DM4A 4N2KA 5JIHA 3W1ZA 1LK3H 4R9HA 5AALA 1A6VL 1ZHNB 4NUPA 1HXMB 4OZIA 2P8MB 3N40F 1DDTA 1EUTA 3CGTA 3AMKA 3DI2B 2JELH 3IFPB 3RDJA 5FO8A 2IVFC 1GW0A 1JNNL 1S9XA 2EECA 1DZ0A 5FA3B 3I6GB 2HWZL 4MCZB 1KB3A 4AOFA 1YQ2A 3D3VB 3ZTJH 3C6LC 2Q5BA 3NPSB 4HIXH 3RWIA 4Y9BA 1MY7A 3PHAA 3UGEA 3SBQA 3CSGA 4NZ8A 2YGNA 3AC0A 3FSVA 1PG7W 4XPHH 4CMHC 2CO3A 2WOBA 1J8HE 3NESA 3AAZA 3AS0A 1CFQB 1OPOA 3BPOC 3DIVA 3HN8A 5CD5D 3FCGA 4P2CG 1XB6A 5F6HJ 3U2SA 3GMOB 3EYQD 5JR1H 1WC7B 2DI9A 5TK4A 3VCLB 1WICA 3VWJD 5B7MA 5I73C 3FQNA 3SB3A 5I19H 2HKFL 1D3CA 1EDQA 4IIQB 2ZCHL 5D1ZC 3QUYB 4CU6A 2HH0H 3IDIB 1NM4A 2BS9A 4Y19D 1PL3A 3BP6A 2V4LA 2DWDA 2HG5A 4D8PB 5SV4A 4JFUA 1BBDH 4JFWA 4QXWA 5LBSH 2VDMB 5DEJA 1NSNH 5D9SB 5F3HB 1FVCB 3VDCA 1JXKA 3DGGB 1J8KA 3N2JA 4KBPA 1NDTA 2P44B 5EC1A 3SPCA 4EIGB 1HZKA 2P45B 4YSAA 3U46B 2ZF9A 5DS8A 5DI8B 1YEJH 1BA9A 4XB3A 5D7LB 4AYBA 2YAMA 3ETTA 4DP8X 5E7BA 1KTKE 2HT2C 2FB4H 5EBGA 1JZ7A 3ATEA 1PDKB 1TQVA 1MVFA 3A6BL 4WI2A 3MUZ1 2YS4A 3FMGL 3U6RB 2O72A 4IMLB 2Z31D 5JLZA 2IBZY 1Q0YH 1ES0A 4DGVL 4HQQH 4PRHD 1BEXA 5CUSH 1RPUA 3H4FA 2QKSA 3ZKQD 1BLNB 3MV7D 4N0RA 2GJ6B 3BD3A 2BP3A 1XBDA 4RSYA 2JTDA 2C7UA 3ZTDC 1XF2B 3NCBB 2P5EA 2ZD0A 1N2RA 2CA3A 3GMNA 2J2ZA 4P2RB 2OI9B 4LPXA 3TA3C 4DTGL 2UUDK 3IBEA 4UF7C 1CFMA 1N12A 3MCLH 3RIKA 3T71A 2O30A 4J4PA 4LSQL 5TF0A 1RY7B 1KCBA 2X9YA 3IRZA 4MMXA 1A9EA 4AIZB 4RFNC 4AI7A 4J3OF 3FOLA 3KPMB 1T5XA 3OKDA 1SQMA 4IRZH 4N2LA 1ZVNA 2BHFA 2Y1AA 3O6KH 2VXVL 5D93C 1N3NA 4R3SA 3QFJB 4B9PA 4AM0A 3FU5A 3H1ZA 1NA8A 2CLRB 1WS8A 1H3XA 3CQQA 3CZFA 3IBOA 5E00A 4GIAA 2X7LA 4GAYB 2YEZB 4RESB 1PZ5A 4O5LH 5GS1B 1HZHL 2YD7A 2DLTA 1AD0A 3K6IA 3LRSB 1U8CB 1P7BA 3U7WL 5GRJL 1ZLUK 4ZMVA 4U1IB 1GGTA 5DK0B 5MEPB 4F9LC 4M8VA 4JKMA 4X6EA 1JWUB 1MCEA 3G5XB 5I1LB 1G7MB 1EIBA 4UNTA 1TYEB 1TTUA 4MMZC 1EMTH 4PUBH 1HOCB 3OHXA 1Q90A 3T1FA 1ANUA 3BRFA 1EAPA 5C09B 1LL1A 5LN8A 3OPUA 2RD0A 1GMEA 2WKLA 3FTYA 2R56H 2YLKA 3ETBJ 1PBYA 1BQLH 1TKWB 2K3TA 4HS8L 3SOBL 3X11B 4BK4A 2VUYA 1B9KA 1NEPA 3ZY7A 4GBXD 4LPTA 4P49A 3GI8H 5DT1H 1N68A 4HS6A 4YS4A 2ZE0A 4ISVB 2QZQA 3QZBA 5ANME 5B39B 1P9MC 3SJVD 3EZJB 1Y7VA 4NC2B 3NJXA 1U8JB 5E7FA 3KG5A 3FC8A 3KHOA 4QRRB 4OFPA 4LP5A 1BQHB 2WZPA 1CE6A 2BVTA 1X9RA 5DJ2A 4X50A 5HI3D 1I1AA 4PV1C 4ERSL 6PCYA 4GRWH 1S7TA 5AUMB 4LVHC 3F5WA 4KROD 2TRYA 4JKNA 2MEJB 2X53A 1FYHB 4K3JL 1M7DB 4GRWE 4PRPE 2XZQH 2VN4A 3CXFA 4MNGA 3VXRB 2X42A 3L8QA 4QY8A 4OKVA 3B83A 5HPMA 2B4CC 4PJBF 4D0BB 4JFHD 4NQSA 1JPEA 4LXFA 2X4NB 4PRIB 2YSTA 5IJVA 4XP6L 3B9KA 3OQ3B 3DMMB 2CXKA 1ZGLM 3COOA 3ILEA 2GI7A 4CJ1A 2WKOA 4JFZH 5ICXA 4YR6A 3VH8A 4GP4B 3NCYP 3LXCA 4HJEA 5F7HA 4AE1A 2XBTA 4P23D 1TJIH 3C87A 2YOCA 3BT0A 3MLRH 1GCYA 5E4OA 1XBRA 1EBAA 4NWTH 2QSCL 1HOEA 4X0NA 4BH8B 2WBWB 4H88L 3A4FA 1PAZA 2H3KA 5K9QG 1NFIB 4PJIE 1YNKL 1SVZA 3K6SB 3IU3A 1DVFC 3QQ3B 4WNQB 3TZVC 1NGPL 3Q5YA 2OJZL 4UB0L 4G72B 4WUUB 1SF5A 5AEAA 3DV4A 3ESMA 1XMEB 5AB2A 4L1SA 1F4WH 1AHWC 4KK6C 4NKOA 2FDBP 3FUKA 3SKNB 2G2RA 4K7PY 5B3NA 3TCXA 1EX0A 2F8VA 4HF5H 1GS7A 1QPKA 5DMKA 3UTSB 3N1QC 4BD4A 3ULVH 2QKIA 1XF1A 4M6AA 4U05A 1P5UA 3VXUB 2FEEI 1I85C 3U9WA 2EO1A 4P3CH 2A6IA 1Q8MA 4P59L 3SDXE 3WJMB 4BSVB 2AV7B 4L4VE 5GHWL 1L9NA 4PVLA 1NPUA 5T1KA 4X4KA 5DJAA 3QHTC 3THML 1YEKH 1BIHA 2ICWA 3ARXA 3KWWB 4WY7L 4FQXA 4AL8L 5KJ7E 2RFXA 3VYNA 3MA7A 5GS0H 3ULVD 5K1VA 3KXFE 3TS8A 1QABA 1JPSL 4L4VD 4HJUA 1NCJA 3KJ6H 4NYLA 5F7YC 4CADA 1OP9A 1Z9SB 4U1GB 3QVAA 1PEZA 4AMKL 4OLZH 4EXKA 1DQLH 2BNRA 4WCYL 3IJYB 4Y5YC 1FYTB 3RVVD 3HR6A 4UOZA 3KXFD 2PYEE 3N43F 1BXXA 4PQXA 2FSEA 4LCUA 5EUKB 5FYKL 4K3HA 2ZG3A 1DEEA 3TBSA 3TF7C 5IQ7H 4F33B 1ZIBA 4L8CB 4JPIB 3H3BC 4XMPH 3TP4A 2CDFB 3OGOE 1LEKB 2J57A 2CR3A 1HZLA 2PYED 4AEEA 2FX7L 1OOAA 3TH3T 1AC0A 1CBJA 1FFPA 4JFEE 1UD5A 3KM2A 1FWXA 4ZYKA 2W5PA 1SYVA 1J1XH 3TJEH 1QLFA 5CJXA 3IFNL 5B1AB 1SXBA 3OGCA 2NZ9D 3IGAA 3QA3B 3EGSB 3ZVVA 2EICA 4K8RH 3QRLA 2YZ8A 3D8MA 4KHXL 3PP3K 2WJ5A 1HHJB 2ENQA 2PTTA 4X9FA 2L3BA 4JY4B 4Q6IA 2CLVA 3FFCE 5ICYB 2WUCH 5KBKA 3VXTB 3QXVA 1L5GA 4PJEF 4TUKH 4NCDA 4XE0A 5DRXB 3WEOA 3IVKA 4PJ9D 3FQTA 3LH8A 4R5XA 3K1KC 3QAZB 3UC2A 2EDDA 4NO0B 4K8RD 1KTJA 4XCNA 3WU1A 2GBVA 2W95A 4H8HA 1V3LA 5EZOL 4K4KA 3VRIA 3PWLA 5I1EL 1A4JB 1EGJL 3RVXC 1FRGH 3ZHFA 3ZR5A 2BSTA 4ESKA 4KY2A 3TBYA 3T0XA 5JPMC 1LD9A 2WYIA 1E6JL 1EVTC 3P9LB 1OTUD 4RZCB 4BCZA 4YUEH 2WQXA 3LPGA 4OR1A 3QJXA 2BX5A 3AXIA 3J07A 4OZFH 2ZWLT 3GUTB 3AXLA 4W1TA 2BERA 4XN8A 4PJCB 5KJRL 4NNYA 2BNQD 1GGIL 2J21A 5ERWB 4TSBH 3CHOA 1ZLDA 3S35X 5L88L 1IC4H 4BRVA 4WJKB 3HG2A 4NOFA 3VI4B 4UAOB 1RQ5A 2E9GA 4GQ9H 4I3RL 1ZD6A 5H37G 3WIHL 5AB0A 3DLQR 5E9NA 1L9OA 2VDPL 1S78C 3O3BB 5EA0H 3APFA 1AGCB 4LPUA 2EDQA 3LN5B 5E8DL 1CGYA 2YPKA 1DJZA 3D50A 5FX3A 5DLLA 4X4XA 1T80A 4RFOL 1ASPA 3RGVC 1KEGH 4JQIH 3V4PL 3KL0A 3LD8B 3DX2A 3H9SE 2F54D 5LNEA 4F8PA 4N26A 1JN6B 2N59A 1YEEH 2ZJSH 3JWOH 3NAAH 4XMWA 2RH0A 4XMLH 4YNYA 1Q72L 5DC4B 3W82A 4PSRA 4ELKA 1A3ZA 2H2SD 3JVFC 5IHHA 1BXVA 1MHCB 3PWPA 3QIBA 1HNGA 1NDGA 2WMPB 1IJ9A 1C7SA 1OXYA 5EZIL 3H9SD 5ADOL 4DQAA 4HUVB 2VJ0A 5IW1B 2IH9A 3RZCD 1BQHG 5DZNA 4KMTH 1EZLA 2YAQA 5LNDA 3CFDB 1K8IB 5LAPA 4PJDE 3P9MB 3V55A 4N5UA 3VWKD 1U2CA 3T2QA 1LNUB 2NSQA 1WCQA 3CDFA 4KGLA 2BXZA 4Z77A 2XPYA 5JOFA 2GT9A 2UZXB 3SDYL 1FG2B 2QPUA 5AW1B 3IGLA 15C8L 4FZ8H 3C60A 1HINH 2AAVA 1A4BA 1IEBA 3HNTH 5GJTL 5F7WC 5A2LH 5TJWK 1L0XA 2AI0H 2OL3A 1EEYB 4PTUB 4U6VH 2JH2A 4O02L 1FPTL 2A2QT 2VH5L 1JFQH 2QHRL 3V0WL 5IWLA 3JWDL 1G0YR 5DK2B 4DETA 4N28A 1LVEA 2OMVA 3FONA 4Z3IA 3JVGA 4O2FA 4ZUTB 3FYEB 3FU9A 3AG4B 1UD8A 2AXHA 3ARGD 2F7PA 3CK0H 2DQTH 1ZLWK 1U93A 4K2UH 1P6FA 2CDEA 3KLAB 1NCCL 1ODAA 3V0VA 1XXDC 5K59E 3OAZK 1U3NA 1A6TB 2J25A 2OXGA 4YAQA 5EFIA 5F6IC 1X5YA 4JPWH 2EP6A 4WV1A 1B4JH 4JQXA 3FHEA 2FL5B 5FFLA 4GUQA 3QDGB 3HS9A 1VADA 1YY8B 4IRJC 4XNUL 3DRQA 2WW8A 5KBPA 3L3OB 3M46A 3TXAA 1N67A 5E0FA 3BPLC 5SWZE 1IGMH 4AUJA 3LH2H 2XLLA 5A2BA 4IU3A 1CURA 5CJ8A 2BY1A 4G1MB 5C3LD 2EYTB 3MV8D 3RJQB 3M17B 1IE5A 3LKNB 2Y3NA 4XZ4A 5E2JA 3MX0A 1MOEA 1DJIA 5LJYH 4JKKA 4G5AA 4JGJA 1G43A 2CIIA 2R7EA 2FWOA 4RGOH 5SWZD 1S9KC 5IVZB 4UTBL 4WI8A 3L48A 4MS6A 2X4PB 4WFHE 5F89B 2GK2A 4NNPL 3E9UA 1T2QL 2P9RA 5AYQA 1CR9H 1KBPA 3VFSB 2WB7A 2WQSA 2XYCA 1P7QD 2R27A 3F7VB 2BC4B 3UTOA 5F0PB 2XNAB 3P73B 5HHQA 4PV9A 1NKOA 1QI5A 2ZIDA 4WFHD 1OCOB 3A24A 3T8XB 2MPAH 4DUXA 4WI6A 4MNQB 1HEHC 1WUZA 2UZYB 5ETUB 1L7TH 4G9FD 5I76A 4Y9GA 2V37A 2BNUB 32C2B 3EF7A 1CGVA 1FC1A 2F15A 2R1WB 3B5GA 3KPRE 3MO1B 1Z9NA 2JKSA 3QSKB 3MN8A 5FYJE 1I1FB 4KQ3H 5DD5L 1AQKH 2PCFA 5DWPA 2YZ1A 3BUPA 4P2OC 1B6UA 2PCPB 1UXWB 3L3IA 5DZVA 1YYCA 3SBPA 3KPRD 2N1KA 4U1JA 1H8LA 3CN0A 2CBQA 4KJPD 3B2VH 4KJYB 4XCCL 1BFTA 1KC5H 4WNSA 3BH8A 1V05A 2ZAIA 2B2XL 3SKOA 1UWFA 4MBOA 3VFNA 2ADGB 1BVLB 3B43A 3NIDF 1TQBB 3DJTA 1D5IH 1VFUA 3DA0A 4XAWL 2HFTA 4JY6A 4V33A 4JL1A 2WXOA 2ORBL 3HS0B 4AT6B 1X9QA 3IFLH 4HULB 5CZXD 1GRWA 3TO4D 5HGHA 2E47A 4DVRL 1TQWA 4J6IA 5IJCC 4BFIB 1ID2A 1OAKH 1WT5A 2JKNA 1WLHA 4O2EA 3GZQA 5FIEA 4Z7NF 3FB8B 2DIJA 4I9WD 5D2NA 2YFNA 2BFGA 4E42A 2OMNA 2BVOA 5BS0B 2JF1A 2QQQA 3GEWB 3RDTC 1DE4A 5MP6H 1DANT 4ZUTA 5LN4A 2XA3A 4FXGA 1PG7X 5DJYB 3HR5A 3LQAC 2EIMB 5E5RB 3L9RA 1NC4D 3LH9A 4IHOB 1CFTA 3W11D 1A0QH 3S37L 1VESA 1SM3H 3MROA 1CN4A 4HDIB 1Z5LB 1HE8A 1NCUA 1IM3B 4PR5B 1MCCA 1CPUA 4WEMB 1QOKA 2J8HA 3EFDL 1JZJA 3M7FB 4YSCA 1V7NH 2DYPB 3C8KA 1J1PH 3S3DB 3UBXB 3FTZA 1UA6H 1BAFH 1S7XA 1WSST 2EC8A 1JZ5A 5DMGD 2Y6SC 4K07A 2HYMA 3HI6H 3DVNB 2VZTA 3PHQB 2AV1B 4G6JL 1GPOL 1FZJB 4CDHA 4YXHH 4OT1H 1U95A 4OTXL 3MOAL 3GHEL 1C1EL 3E3QE 4RBPK 4XN7A 1CL7L 3WE6A 4O51B 4POUB 2IBBA 5GGTL 2AJVH 1TR7A 3BLPX 4EN3A 3T0DA 2WNXA 3PHOA 2HFEB 5DUJA 4YX2L 1ETA1 1RU9L 2MQ0A 1F97A 1NFDE 3DBSA 2PUQT 3VNZA 3FTSA 4KZEL 1CFSB 4UAHA 2ADJB 2NUPB 3U48A 1RMFH 4WKZA 3V8OA 4DPAX 1MCHA 4KH2A 3BT2H 3DX7A 2NY5C 4JNXA 5FCUL 2YWYA 5HSFA 3CAFA 5I6XB 1Z3RA 4A2GA 1M53A 3KWTA 5AVYB 4X6BA 3SYCA 4X7CC 3KCPA 3FT4B 2VNCA 1LEIB 1T83A 5GS3A 4XO3A 2XN9B 4JN2B 3RAJL 3NQIA 2DQHL 4DN4L 1AXIB 1PNCA 1TJHL 2NY2D 5CZKA 5HPOA 3KWXA 2B1AH 1R3JB 1MRFH 2WBJA 3NG5A 4Z5RA 4FCAA 4LSTL 5EIQA 2AVGA 4XCEA 2HMID 4G80B 3ESOA 1ED3B 1LWJA 1FG9C 2XT1B 5TTRA 3MUY1 1T5WB 1AIFA 2Z93B 5DJ6A 1HL4A 1QRNE 1KGCE 1YRKA 2GJPA 3APNA 4I5BB 2KLSA 2OMXA 3AGWA 1SOXA 5DD1L 4HJJH 5EU6A 3KM1A 1KG0A 4OAWB 1BVZA 3BUTA 4AENA 1B2YA 3FTVA 4FNQA 1AQHA 1GS6X 1J7VR 4NQTA 2WWOA 2Z0BA 4Z95L 4XWGH 1HXYB 3FT3B 3GUFA 4JW3A 5FKPB 4XC3L 3QULB 4YHOH 3ILPA 3FFDA 4K3EH 3T09A 5FO7A 4E0RB 1SEQH 4JZNA 5ILTL 1OT1A 4R96B 5EBMA 1KN2H 1M9SA 2IADA 2QADB 4LE8A 4OZIB 1VLXA 5FO8B 1UD3A 1S8DB 1S9XB 2VZ3A 2VT0A 3MPCA 3GBNL 1RUAL 4OGXL 1UACH 1HSBA 1U0QA 3RWIB 4XMXA 4FD0A 3MLUH 1LE5A 2WXKA 1FH5L 4GXVH 1HX0A 3RA7H 4CA4A 5HYJD 3AAZB 3BMWA 5GQBA 2AQ3A 2VQ1B 4MQXD 3O6FD 5KS9A 4JRXB 2FRGP 3BIBX 3U2SB 1A4CA 1OSYA 1J8SA 4Q9RH 5EC2A 2MHAA 1UENA 1ZLVK 3HG4A 2GY5A 4DKEH 1K6QL 2KZ1B 3FQNB 1V5JA 1SBSL 3K2UH 2XG4A 2F8IA 3Q8FA 4V2BA 3BPNC 3L7FA 2ENJA 4TULH 1QLEL 3O9WD 4HAFA 3BP6B 4HV8A 3S88L 1A9VA 4YDVA 4LSSH 2HG5B 1OGAA 4FFWD 3UBHA 4KVCH 4Y4FA 1K4CA 5D1XC 4XVTH 3UAJA 3VA2C 3EYUH 3ML9A 3U6XS 4EZJA 5CM1A 4J3OD 4R4BB 2OYKA 3VG9B 4LGSB 2TSAA 1JI2A 5EC1B 5I1DA 3RU8H 3QFDA 2CHWA 3ZZSA 5DS8B 3ZE1F 3D5OF 5EO0A 3CFQA 2DAVA 1UT9A 2EXWC 1NCWH 4GMTL 1RZIA 4HH9A 4J2QA 4UMSA 1OSPL 2X2YA 2PPFA 5A2CA 4HHAA 4KQ4L 5AG8A 1E9QA 5JLZB 3CV5A 2GBTA 3AUVA 1ES0B 1DBAH 2VDLB 1PZ2A 1KTLA 4ZW3A 2QQLL 3L3DA 1NCHA 1L0YA 3CZLA 4DEPB 1Z0NA 1ONQB 5ENWB 2C7UB 3VO0A 2P5EB 1JYNA 1N2RB 1XSOA 2DQEH 3GMNB 5JW5A 2J2ZB 4YN3A 4U3SA 4FJ6A 4XNAA 2YUVA 5K39A 2UXVA 4FFYH 5CD5C 2HT3D 4JLRA 2EABA 2WIMA 4ZW6A 4FNPA 3G6DL 1L6ZA 3EYQC 4FG6D 2VSMB 4MMXB 1A9EB 2EINB 2P1YA 2NDFA 1N8ZA 3FOLB 4GKLA 1T5XB 2V5SA 2JCCB 1YHPA 2ZP0T 3OKDB 4LLQA 4M03A 1W0VA 1N3NB 1ZAGA 3K80A 4R3SB 3FUFA 2IQAA 3IEAA 4UM9A 4AM0B 2AJXH 4UT6L 1WWBX 3CZFB 5FM4A 1ZOXA 2VERA 1D7FA 2X7LB 2WSDA 3NCYS 1PZ5B 1F3DJ 4N8PA 3ZZQA 1AD0B 1USZA 1OZTG 4FMFA 3V6ZB 3OZKA 3RX8A 2UVFA 3MNZA 2Y1VA 5BV7B 5C0AA 2WC7A 5LXVA 2P5WB 4FTDA 4W9DC 4WUKH 5HGAA 3O4OB 3LXUX 5FHAH 2V9RA 1C5DA 3D05A 2DJMA 2FEJA 4XMKL 1HC1A 3OHXB 3LQZA 3CVIH 3T1FB 1EAPB 2WV3A 2WLMA 4LLYA 1LQBC 3BQUD 3ARDA 4TYUA 1FA4A 2B0SL 5FW7A 2Z31C 4YJZL 3WNIA 1NIAA 3I50L 3HBPA 1WA2X 4NJAL 4PIBA 4U7MA 5CJOH 3KLHD 2R0KL 3QIWD 3GMQA 2UV3A 4HS6B 2BW5A 1S7VA 4C4BA 2H32H 4LLAA 2L7EA 3QJVB 3TNMA 4E9TA 1AG6A 3EGXA 2NYZA 1W72H 3HCVA 4D0DB 2RACA 5CEZD 3P4OA 4OB5H 1EHNA 5KYWA 1CE6B 5KWYC 2XIDA 5DJ2B 1QSVA 1DQDH 1I1AB 4WGKA 3IMRA 3Q1SL 4OFYD 3HVNA 3PPEA 1S7TB 1SN2A 2DQCL 4QXGL 5D4QA 5K1JA 3F5WB 3UTTE 3DPDA 4UV4L 1L7IL 5ALBL 4JRLA 4M6MH 3EFOB 4FGMA 5GGSY 5JW4N 2PWFA 4XI5D 5INCA 4QY8B 3LHPH 4OKVB 5HPMB 2H1LM 2NYYD 4UMGA 1C16A 1G5AA 2R4SH 2YA1A 4NQSB 4NXKA 5IJVB 4A63A 3KAAA 3WKNA 3B9KB 4WNJA 3ZK0A 1PLAA 1KV7A 2HKHL 1F8TH 1TTCA 3WSQL 1CUOA 4K0OA 1U6AL 5ICXB 2DYRB 4YR6B 3VH8B 3FYIB 4QXUH 2XTJE 3G04A 3UL4A 3SGKA 3W0WE 4H40A 3MHZA 1U8HA 1CDGA 4LSUH 4G7RB 1KUMA 3T8MA 3OG4B 1MFVA 5F3BA 4Z7IA 5BMFL 2V5YA 4NM4L 4O9HH 2UWEA 3GZPA 5KUKA 3IU3B 4QLRA 3QUZD 5F9OH 5IMKA 2EIBA 2IOMA 3PQYE 3W0WD 5PAZA 1IJNA 4GBXC 1F58H 2Q8BH 3FUMA 1H6TA 3DV4B 4M56A 4NBYB 1EBPA 4IU2A 1QHOA 1JGEA 1OW0C 3DJZA 1E4XL 4B95C 3BQVA 2IDUA 4KKBC 2IQ9H 1R3LA 2GCYA 4NKOB 4YK4C 4H8PA 4AQEA 4QAWA 2G2RB 3ZU8A 4WW2F 2AFNA 3VSQA 4DFIA 5J12B 2BIPA 5HI3C 1LYQA 1VSCA 3V0GA 2QKIB 5KJ4A 4PWIA 4PLOB 1PYWA 1P5UB 4KROC 3QP3A 2O6CA 3WIHA 4HIEA 3ZN6A 2A6IB 4HGWB 1JZFA 2MPVA 5CCGE 2GY7B 3PP4H 5T1KB 1TJGH 1M7XA 4OLVH 2ICWB 5IT2H 1H0DA 1MZZA 4FQXB 5JDSA 2RFXB 4G8AC 3MA7B 3D85D 4G6FB 3IKCA 3V4PA 3DVIA 1K72A 1XGYL 1DVXA 4NYLB 4CADB 4RETB 2IEPA 4ZO8A 1NPJA 1PSKL 2W07A 3BZDA 3L1OH 5BCAA 3V0IA 1N59A 3HNSL 1ZIAA 3PG2A 5FYJU 2BNRB 5LQBH 1F3JB 3D51A 3VRJB 1JGDA 3L4UA 3MRGA 2FHCA 3MTRA 4JGUA 4OCWH 2FSEB 1OCRB 4LCUB 4ZTEA 4OD2A 4AYDC 1DEEB 1AR1B 5BRQA 1RK7A 3CQPA 3F8UB 2VQTA 3HS8A 4DP9X 4JBSA 1MIMH 1BCIA 1FFPB 4KRPD 4C83A 5I18L 4ZYKB 3C2SA 1SYVB 5M94B 4MKTA 5CGMA 5A2JH 1QLFB 4PBXA 5AOLA 3OGCB 2DIAA 3MV11 3B7TA 4PBVC 3RJOA 4O02A 4Y16D 3VD9A 2Y7OA 1V3JA 2PTTB 3F58H 5CNHA 1RV6X 4Q6IB 2CLVB 3CFNA 4JRYE 4OFQA 4AM0Q 5MENE 3D0AA 3BAEH 4WWKB 2OPCA 5T1LB 1SXSA 3AG2B 3C6LA 1L5GB 3FO9A 1KB9K 4ZX3A 3IVKB 3FQTB 3CN2A 2OSLA 5KVGH 4XCNB 1OKEA 3L6FA 4GY4A 2HLAA 4QRPA 4K9EH 3KPTA 3VRIB 3G7TA 3BUIA 1X9UA 3ULVC 2EUVA 5I9QB 5DHDA 2AJSL 5FK9B 2ZONA 3I6SA 1V10A 2BSTB 1WE5A 1UD6A 4X7DC 1BOYA 3TBYB 4BQBA 2WINA 1B2WH 4UI2A 5D1ZA 4DCQA 1LD9B 3FQXA 3RVVC 1ZKAA 4KTDL 2O61A 3ZUCA 4W9HC 3U4EA 4J27A 3WD5L 5KSVA 4NJ9H 4FABH 4NIKB 3SE8H 3SO5A 3MRDB 4AE0A 1MNUH 4NNYB 5B1JC 1OT2A 1USQA 1RSFA 4UTBA 1JZ4A 2VZSA 5F1IA 4PAZA 4IBLT 1N18A 1EZSA 1X4ZA 4OJFH 4XX1E 2YPLD 2NZ9C 1WZ1L 2YRPA 2Y23A 4Y1AB 4FQLH 1DP0A 1EO7A 2YPKB 4N1EA 4Y4KD 1BF5A 1AS7A 2WXJA 3T8VA 4X4XB 5LKNA 1OD7A 3VMOA 5EORL 1MZYA 2CE6A 1L9MA 5DUML 2ZOKA 5IFAL 1JSYA 4XNXH 4YNYB 4GUOA 1TZGH 1WBZA 4C58B 2CMRL 5IROC 4ELKB 2OMUA 2VDNB 5B1CA 3VQ1C 5DHVA 3PWPB 1KPUA 4NDMA 3KBPA 3QIBB 1NDGB 1V27A 1IC7L 4K8RC 1MCLA 5E2VH 2MCAA 4ABWA 4MJ5A 3TA3A 1XFPA 5FOBA 3WY4A 5K9JL 3QJFA 5J06A 4DP1X 3RHWK 4LOUD 2X89D 2HB0A 1P4IH 2UUDH 4B5ZA 1MJUH 1NJ9B 3V7MA 4Z78A 3K5RA 3WHE1 4JO3H 4K23H 4Z77B 4G1EA 3CE1A 5JOFB 2I9LA 1UXSB 2GT9B 2VLJE 4G71B 4X6DA 5AOJA 4YMPA 4IKIA 2DIEA 5IESL 1LP9F 5CP3H 3RBGA 3TBVA 4M5ZH 4L1TA 3C60B 1OTUC 2VWEE 1IEBB 4KJWD 2AMUA 5BRZD 1NBCA 1IUZA 4PB9L 2SEBA 5D5MA 2OL3B 2O5XH 2VLJD 4LZKA 4EKJA 4L8SA 3QDME 2J8OA 5DLML 1LO3L 2VXTL 3LPPA 4M1GH 3FONB 2OMVB 2ZUQB 2QMJA 4O2FB 2ZP9A 5B8CB 1Z0MA 4LO9A 3D25A 3VQLA 3GJFH 1U93B 4BJLA 5C0JA 1E5UI 5D2LF 2CDEB 1ZLUH 3WEXA 3V0VB 1IGIH 5FA4B 2OXGB 2WUBH 4YAQB 5EFIB 2ROYA 4XZUA 3APCA 4Q2ZA 5C0BD 2ROXA 5BZZA 4X5LA 2W65B 4QRSA 3OJMB 3F7QA 1YEHL 2VR7A 3UAFA 5D7IE 1VADB 1JMZA 1COBA 3DRQB 1ND0A 3D0LA 4KAQL 2EXSA 2MOVA 1NMAH 1HHKA 2YN5A 4K5NA 3LNIA 1AE6L 2Q7NA 1PZ3A 4LMQI 5DQDL 1TTGA 3MU3A 4MA7L 3GNMH 3NIDE 3N44B 1TO5A 4FFVD 2W0LA 3IPFA 2BSRA 2R0LL 4UOQA 3CVCA 4OCYL 3VWKC 4DPBX 2CIIB 2R7EB 2FWOB 3JWOC 5GGUA 1JF1A 2J8UF 2LHAA 4JREC 1N6QH 1XF4A 1KWGA 4PW3A 4Z7WA 3SPVA 4AG4H 3E9TA 1WFOA 3GSVB 1PLBA 3NSJA 4I2XA 3SO3C 1FCGA 2YD6A 5GZND 4MZ3A 4JK0D 2IAND 1BSIA 1W0WA 2B5IB 3CMGA 1KCSL 5HHQB 2JQMA 4PV9B 3I6KA 4GO8A 2M83A 4G8EA 3TH4T 5EU4A 4MCMA 1C8PA 5EU7E 4Z7OF 4Q4EA 5DQ9A 1RK1A 3B56A 3WN5A 1C7TA 2OA9A 1A6WH 2WM0A 3ARGC 5EDSA 4EPSA 5KANG 3AZUA 3N50A 4MQTB 1LK3L 3HAEH 4A04A 3WTSA 1CQKA 2PCFB 1VRSA 5KSAD 2ZUVA 3O8XD 2WXMA 1DUZA 2Y2WA 3VB8A 2BIIA 2JELL 1ZWIA 1CI3M 3L3IB 1FFOA 4MMYA 2ZCLH 1QBLH 2WYTA 3MJ7A 4NHCL 5ID1A 4GAGH 4U1JB 1G1YA 4J3BA 3HG1A 1NLDH 2CJSA 4HIXL 1WYJA 3B6SA 4LK4A 3NJKA 3BH8B 3O3DA 2AQRA 1AO7D 1KXQA 4MZRA 1E40A 5EWIH 3SKOB 3VFNB 1HH9A 1LEGA 3ZDYF 4F58H 4YL4A 3X1EA 2HRGA 3X2QB 3NJIA 3GO1L 2VMFA 3U36A 2VDRH 5E8NA 5B7EA 4LGPB 1QFWI 5CEYA 3BSGA 5HGHB 4MAYD 2YGOA 4HZLA 1MCWM 1NDMA 5ALCL 3FTXA 1J05A 4HG4K 3L5IA 1NAML 3NIGF 1YMMA 2Z4QA 4O2EB 2AEWA 4LNRA 5D2NB 2B1HL 3LNGA 1BBDL 4E42B 3S48A 2BVOB 1UT1A 3HW7A 5LBSL 4MNQE 4QRTA 4EBQH 1OAJA 5JXAH 4PYGA 1DE4B 3SDCC 1IRAY 2IGLA 2FO4A 2G4GA 1IC5L 3CFJA 3DIFA 1UEMA 3OF6A 2C9RA 3HRZC 4FXGB 3HR5B 4KKRA 4ABQA 3L9RB 4G6KL 3ZIYA 1CBVH 3BSHA 1CFTB 1ZLEA 1YEJL 4OF6A 3OB8A 2DQFA 6FABH 3MROB 4KDTC 1IAII 1TOXA 1PU0A 5DHMC 5F7LB 3E6FA 2QELA 1QWNA 2JSFA 1CGWA 3CN1A 3DX6A 3ZE0B 3D48R 5K33A 4G83A 4CSZA 4HXBL 2APTA 4KKAD 4UNVA 3VRLF 1BD2B 1WFTA 3C8KB 2F7IA 4P0DA 4MCNA 4U6TA 1E8ZA 1QKZL 1Q0YL 1SMDA 5HHOE 2UZIL 4IBUA 3O3EA 4HQQL 4X6CA 3D09A 3GM8A 1MRDL 2KBGA 3WKPA 2D2CC 4XP4L 4KJPC 1JMXA 2E9JA 3WE6B 3OB0K 4WHTA 4EN3B 2Q3ZA 2B9AA 3V5DA 3PHOB 5KZCB 3PXHA 1EA9C 2D3JA 3GDBA 3V6OE 4Z7QE 5IHUH 1AS6A 2ZWZA 3CH8A 3FB6A 3ULAB 5E4IA 4FKHA 5KYUB 5HDOA 5LLIC 3Q5OA 3EJQA 5L6YH 4X9YA 4WKZB 5CZXC 4AK1A 3WTUA 2FBJH 3DX7B 4IRZL 3MMEA 5J0BA 2V3EA 1KYOJ 4N2BA 3GBML 2TRHA 1D5ZA 2HCZX 4U3CA 4QHNB 5I30L 5EOTA 2BWQA 3CPLA 3KCPB 3NOIA 2AC0A 1RP8A 2IGTA 4CN4A 3S5LA 3T77A 4FI8A 1TVDA 1CU4H 3MJ9H 4AVHA 2DEXX 1EWHA 3C08H 5FDWA 3VAEA 1SJMA 5M95B 2DH2A 4Z5RB 5JPMA 1NC2D 4MB5A 4XAKE 1GY2A 3E8UL 1KGYE 4XCEB 4LMQE 2ITEA 4MLIA 1T1WA 5SWSD 4MA8H 2QQKH 2ZOWA 4S1SH 4KU1A 4RIRA 4QHKI 4PUBL 1AIFB 5DJ6B 2D3NA 5TK2A 2OMXB 2FX8H 4XAKD 1KGIA 5CP7A 5EU6B 1T66D 5DMGC 2R56L 1EEZA 3IJSA 2WP3O 4AENB 2QSVA 5JW4R 1I7UA 1WFUA 3BDXA 4TPRL 5D1QD 3QZWA 4JO5A 3GI8L 2JKIS 5DT1L 3C5JA 5EF0A 4WO4A 3KYAA 1MQKH 2X1OA 4JVWA 3ILPB 3HBGA 1DO6A 4N8CL 5FO7B 3WUWA 1Z9OA 1MCFA 5DJDA 1EK3A 4JZNB 2DV6A 3Q48A 5BNXD 2LABA 1XSJA 3FJTA 4UT6A 5DZ9A 2IADB 3BJLA 4UT7H 3UZVB 3W9DB 4NQDD 4ZXBD 3E3QC 5DWUL 1CF8L 4U2YA 3RGVA 1IZKA 2X41A 1B88A 1UWGL 2RMNA 2NY7H 5E9DA 4OF3A 3IYLW 1J0IA 1NMCB 1LWRA 2F61A 4IGBC 1HSBB 3V4VL 2XZQL 2J1XA 2YD0A 1M05A 1MAKA 4FFZL 4LCWD 1FIGH 1NH6A 3RTQD 2VKXA 4RA0C 2OS7A 4S10A 4JR9L 5K5YA 5LG6A 5GSRA 4GW4A 2BMKA 4V1DD 5KS9B 4L3FA 2FO1A 4LCYA 2FGWL 2NY2C 5DA0B 1JPTH 5HDQH 1T04A 1KJ3H 5EC2B 2MHAB 5CHNB 3UH8A 5BOZG 2ETWA 2XG4B 3SBWC 1AKJA 4NPJA 3D7PA 2R0WH 5J9PA 3L7FB 1TJIL 3MLRL 5I1HH 1MKFA 4HV8B 1QFWH 3WEMA 3U0PA 3FRPA 1OGAB 2HX9A 4RA3A 3WE1A 5EHFA 4Y4FB 1K4CB 1KLGB 1MHEA 1KB5H 3MXWL 3MUGA 2BH0A 2AS5M 3F05A 3ARFD 1SVCP 5FLUA 2DJ4A 3V9EA 4PV8A 4LDLB 5I1DB 3QFDB 2BSBA 3Q5TA 1G7HA 5EO0B 1HQ4A 2OTUA 3SKJH 1F4WL 3UJJH 1KCKA 1BFVL 1W2KT 2QMKA 4HH9B 4QYOB 1ZT7A 3ZRSA 2GAZB 1ZLWH 1RIUH 4PJXE 1IAIH 3HRPA 2CAKA 4HHAB 4HF5L 3D4YA 1E9QB 3OAZH 1OE3A 4FEMA 4RGNE 5IBUB 3AABA 2G3MA 4ODBD 1KTLB 2IAMA 3L3DB 2FJUB 5KYYA 3BKYL 8PAZA 3QI9A 3V2AR 4RGND 3WV0A 2ADYA 2FIKA 1YEKL 5JW5B 2W8CA 4F7KA 1ZK9A 2YFOA 4U3SB 1HIML 2H0EA 4S1QH 5GS0L 1CGSH 5K39B 2F8XC 4MQXC 3O6FC 4BSJA 4WSKA 1CLCA 2H6PA 3FOMA 5GRZA 3L3JA 4HAGA 3I85A 1N8ZB 4OLZL 3DSFL 5EDXA 4WEBL 4LLQB 2YK1H 4AEHH 4NKQB 1M6UA 3RHWF 1W0VB 3VD2A 4F5CA 5DRWA 4G11A 3O9WC 4UM9B 3VXME 2LV4A 3ASWA 2GPZA 4EDWH 4JCLA 3MREA 1IBHA 2KI6A 3MLWH 4XVOA 2CQVA 2GJJA 2VW6A 1UFGA 1J5OL 5FS5A 4Z3FA 5IFJA 4GH7B 2P80D 1TQCC 3H0TA 4L37A 3ZT7A 5LVEA 4ZOBA 3MNZB 3T0ED 2ED9A 1JZ2A 5C0AB 4JZJC 2VW4A 3WS6C 3EO0B 4WGWB 4HUCA 4HOMA 4PWGA 2EC9U 1C5DB 4CSSA 3V52H 2WNKA 3BHBA 4P2OA 5C0CD 4LLYB 2AXWA 3ARDB 2WUCL 2G9KA 4XH2A 3TC9A 2J6WA 1CXLA 4TUKL 4FXLA 3ZE2B 3TX4A 3WJJC 4LEOA 1BQKA 1IAOA 3EZ8A 3GMQB 3VTAA 4U0RB 1BWWA 4QRUB 3CFTA 3CXDH 2OZ4H 3QQDA 5IHBA 5IB3A 3DJ9A 3CLEL 5CFAA 4Y9CA 4NZTH 4Y88A 3TNMB 5IMMA 3EGXB 2H8PA 3ISYA 3KHQA 4P2QA 2QPFA 2Y07H 1FRGL 3FF7A 3HCVB 3HUJA 2QPEB 3EADA 3VB9A 3P4OB 2WO2B 3E2HC 4F7EA 2JCCE 3PDDA 4FG6C 2J4WL 4NO5A 5D8JH 2XWCA 3ALXA 4KO6A 2WOYA 3VFGH 3DVFA 1KJMA 4OLEA 5I74C 1MAMH 1UJTA 3QEQE 1N0XH 1LILA 1SYSA 4OIFA 1EEQA 2WTRA 2MTPA 5INCB 2GSMB 2FWUA 2WANA 2BP5M 3W56A 1I8MA 3S36H 3QISA 2NZ1A 2GJZA 3GT6A 4MWFA 3JT0A 1AFVH 4TSBL 3GB7A 3SDAC 1VGEH 1IC4L 2W81C 1ROWA 3LPFA 5F93C 4YHLL 2P5WE 4JFXB 2CU9A 3FF8A 1F42A 2JLLA 1Q0XH 4M6NH 3ZHLA 4JHZA 1Y07A 4LKXA 1FQ9C 1F0LA 3IJEA 3MV9E 4TUJA 2N7AA 4YLCA 4NN7C 4NZJA 4Z9KB 3VD5A 3G04B 4LASH 4MQSB 1XR8A 4XN2A 4B60A 3TEYA 1JNJA 4NQEE 4AQ8C 1U8HB 2YPVH 2WLYA 4CAGA 3GBLA 1OM3H 5F3BB 3BQUC 4JQIL 4JVPA 1KEGL 4PP2A 2UWEB 5KSUA 1IQWH 4FTVE 5C07A 5DHXB 3N6YA 1YEEL 2ZJSL 3JWOL 3IXAA 4PJGF 4RCAA 4XMLL 4ACTA 1HKFA 5IMKB 4JPVL 3KLHC 2OMZA 3QIWC 3QHZH 4HIQA 5E51A 4B9CA 4IU2B 4RBPH 4ENED 1FSKB 4FQHA 1JGEB 2ARWA 4NZFA 5IUSA 4HWEH 2BOBA 3H7LA 1R3LB 2IWFA 4ZO7A 2ZAGA 4AQEB 1MEXH 5AOZA 4PS4H 3CHPA 3H54A 2IBZX 1LJMA 4F15C 4IK7A 3NVQA 4DERA 2XN0A 1E65A 1JS4A 1PYWB 4NRYA 3US0A 4KRNA 2ZX7A 3TNNA 4OSUH 3RWFA 3P3UA 2ZX6A 1TEFA 4HIEB 5D4HA 3HNTL 1N7ML 3EJCA 4XI5C 5I1GL 2R69L 4RNRA 2EDYA 3EG9A 1LLAA 5CSZB 2VSDA 5E23A 2NYYC 1H0DB 1T03H 5JDSB 3OPZH 4AEIH 3V4PB 3IKCB 4OCSH 3QDJD 3BSZH 4HSQA 3VYPA 5HJGA 1ROCA 5B1BB 4D9RE 4M1DH 5PCYA 2W07B 1H3VA 4PJFB 1HWGB 1N59B 4K2UL 5DO2C 2WN2A 4FLRA 3RYMA 1EFXD 1JGDB 3MRGB 3AADB 3NJLA 4HBCL 1PJ9A 4JPWL 2VXQL 4NN5C 3KVQA 1A6AA 4WKXA 1O7DC 3FUEA 3T6XA 2PW1B 2XTJC 3T2NL 3QUZC 5AAMA 4L8BA 3WMPA 1W15A 4OIIH 5JW4M 2ITFA 3VXSE 1DJYA 1IGML 2P52A 3FT2A 2EH7H 4C83B 3LH2L 2VLRD 1LO0H 1PNDA 2DI7A 3NPZB 5DC2A 1E4WL 1S9WA 4BHUA 4M7ZC 4I9XA 5BXFA 4PJHB 4O02B 4UINH 4RGOL 5IBUG 4OZHA 4FYSA 4ADGA 3CVBA 1JK9A 1G7IA 5L2JB 1XT5A 3C6LB 1FAIH 3FO9B 3UZQA 1WGVA 4GO9A 2QTEA 1GS8A 4CMHB 4BV1A 2NX5E 2OSLB 3K8LA 4I88A 4XN5A 3L6FB 3EYOA 2HLAB 3BPOB 3N1MC 4QF1A 2H1PL 3MRKA 1E42A 4P46D 2R4RH 4M5YL 2C9UA 2FQEA 4MA3A 1UYWL 1F2QA 1PKQB 4X5WB 5FYJL 4HPYH 2NX5D 5I73B 1QLRA 2HX7A 3KZ8A 1O5PA 4P4RA 2YXVA 2WINB 5D1ZB 4DCQB 3WL9B 1ZLVH 3FQXB 2OTWA 4KQ3L 5HY9A 1TCRA 3QCVH 1AQKL 5JUEH 2O61B 3Q44A 3U4EB 2AANA 5LGYA 1MFDH 5KW9H 3ARZA 1XXFC 3N91A 4IOFD 3QJSB 2WD0A 3PXJA 2BY2A 3B2VL 5JIDA 3MFGB 2KMWA 5KG9A 1OARH 3VI3A 1MFCH 1PX8A 5F1IB 2Q3XA 1XGRA 4KRPC 4HGMA 3U0TA 4WHYG 3VD4A 2VDKL 4FG4A 2A9BA 4PJCF 3VFOA 3IFLL 4AYID 3EDEA 1ZA6A 2HPTA 4Y16C 3U0WH 4PVBA 4J3WA 4R2GD 1OAKL 3BP7A 3VI4F 4XB8A 3HE7D 2ZOKB 4LQ1A 4LSRH 4UUJA 4DN3H 1VCAA 5I1CL 2D3LA 4ELME 5HVHB 4F8OA 4S0HA 2FH6A 1WBZB 2FSDA 4XC1L 3RNKA 2OMUB 3DECA 5E5LA 4ADJA 5DHVB 1KPUB 3Q6GL 2A83A 4TUOA 3EDDA 4MJ5B 3TA3B 5FOBB 4EVNA 4CJ0A 1NEZA 4ZAKA 5AZEL 4ELDA 2MOGA 2E59A 1A0QL 1UXLA 3JV5A 4GPVA 1SM3L 1K5WA 5AL8A 1J8HA 2XVGA 2JV6A 4Z78B 2WSPA 4G1EB 2AMGA 3B1TA 3SDDD 2I9LB 5D93B 4X6DB 4LSPL 3HFMH 4UDTA 3UAAA 3TBVB 5JIIA 1V7NL 4FULA 4X7TA 1NZRA 1BAFL 4NFDA 4K9EC 5DMIL 3HI6L 3IWUA 3X1FA 2SEBB 1B3IA 5D5MB 1BBJA 2J5LB 4N87A 1HE7A 4L8SB 4OT1L 5K9QI 4AZ8A 2NY6B 4Y4HA 4YHYB 2W9EH 1NAMA 3GKWH 1QFUH 1ULVA 4W68A 5EF3A 4Z7OE 1NFAA 3N3EA 2LGNA 3C09C 4Y1AE 4FJYA 5AW8B 4FQ2H 3R1GH 4QHUA 5C0JB 4NKIH 5LBSA 1MDAA 3NDYE 3WJLC 2CKNA 3S4SA 3WEXB 5AD0A 3OSVA 1FVDA 1KJ2B 4KI5F 3WNOA 4Y4KC 1YECL 4WI5A 4XZUB 1JZGA 1KCVL 4Q2ZB 3RB7A 3ULSA 4KI1A 1DLFH 4KVNH 5F21B 2R1XA 4QRSB 1U8KA 5E6UB 35C8H 3V4LA 4OCNC 2FQFA 3D0LB 2AZUA 1EH9A 1GY1A 1HHKB 1U3HD 5DD3H 1UM5L 5AVUB 4YXKH 1KCUH 1YNLL 4PTTA 5JXEA 3LSOA 3ZDYE 1U41A 1E67A 2A77H 2CXGA 1BM3H 1X6NA 3SPIA 3HOGA 2BSRB 2B1AL 1MRFL 3C5SA 4LOUC 1CXKA 3SE6A 5ACZA 5C9KA 2G60H 5GGUB 1JF1B 4JMNA 4LVHB 1XF4B 2YKKA 1LMKA 1N26A 4Z7WB 1CFVH 3SPVB 3NIGE 3G08A 1ID5I 3AW5A 4I2XB 4APQA 2NXYB 4NUMA 1G6RH 4KJWC 1U33A 4HJJL 1W0WB 1TLMA 2YLHA 1P1VA 3I6KB 2OR9H 3QORC 3PL6D 5EUOF 5EU4B 4XWGL 4G7VL 4IRZA 3I6LD 3MVSA 3O4LB 1YZZA 5DQ9B 4IBTA 4K3EL 3FBKA 4EIZC 1RK1B 5ISZE 1DSFL 5LGJA 2CNYA 2ZXQA 4XP5H 1NCDH 4KXCA 4WGVB 5IB2B 2ZSWA 1B0GA 3CU1A 1KN2L 4NI6A 4YDIH 1QTSA 5DYFA 3GLDA 3POHA 3MLYL 1DUZB 1ZWIB 3MOQA 4AGPA 1FFOB 4MMYB 4RAUB 3MJ7B 4PJ8D 1YPZB 4DKDC 4TOYH 3V6FA 1URIA 3UROR 4L1LA 5ID1B 1S7UA 3JBG7 3HG1B 3ILDA 4D9QE 1WBYA 3K5SA 2EDEA 3QH3A 3B6SB 5DEFA 2IWEA 5HDBB 3O3DB 3J8F7 1OW0A 1QW8A 2ICEC 1D5MA 3IFOA 3N42B 4HKBA 1E8YA 1HH9B 4B9KC 1F00I 1LEGB 2FNWA 3AQZA 5A16A 2QTVA 4D9QD 2EIZA 5F7AA 4FFVC 1PCSA 1NBQA 5I8KL 7TAAA 4CC4C 3U36B 1QZ1A 5E8NB 1YN7A 1Z3GH 3LKSA 1KIRB 5ANMA 5TQ2H 3GTNA 4DKEL 5CEYB 1IQDA 3BUBA 4KOCA 1UJ3C 5KYNA 4G6ML 1J05B 3UYRH 1YMMB 3ARYA 1UCBL 4LT7A 2D7MA 2JJTA 4IK6A 4LNRB 2AK4D 4LSSL 3N5AA 2SODB 1OB1A 5GZNC 3NCMA 4KVCL 5GRUH 4OIAA 1LMIA 4FYTA 3EYUL 4QRTB 1B4RA 3CFJB 2FO4B 3DIFB 5CN1A 2J20A 4X7SH 3S9DB 2CGRL 3NT0A 2ZX5A 3QE5A 4PRPA 3RVUD 2G5BA 4JFQA 3ABLB 1F1GA 4KUCF 4H20L 4HXAH 2DQFB 3LRHA 1BJ1H 3V4VA 3DTXA 2XG5A 3E6FB 2PWDA 4ODXA 4FFZA 1NCWL 4R4FH 3DX6B 4Y5YB 2NNAB 3NGBC 2DQJH 3DHJA 1KTDA 2A9MH 4EUPB 2VYRE 3IN2A 2OCCB 1DTUA 4IRSA 4GT7A 4R90L 5EU7C 4JJOA 3EUDA 1BZOA 3MXVH 5KSAC 1J8RA 3H9HA 2VN5A 3O8XC 1NIEA 2HVJA 3ROOA 3S34H 3O3EB 1JZHA 1LO4L 4X6CB 3WXWL 4M7JH 4NN6C 1YVLA 4LBAA 2WLZA 4YXLH 3T1WA 4Y9FA 1AZNA 2JB6A 4FFTA 4S1DD 3D9AL 4PJIA 1QLEB 4B7IA 2LOEA 4WFEE 3V5DB 2CO1A 3CFBA 2MRYA 4OLUH 4UQBA 4FFYL 2EIEA 3FB6B 3G5WA 4FCHA 3NCEB 3II3A 4YFLF 5J1AA 4MAYC 4KC3B 2ZSVA 4WFED 3TIEA 4AIOA 4U6HA 3EYSH 1EZVX 1SEBA 3MMEB 2VLKD 1D5ZB 3CG8A 3T3PE 2B1OA 4WO0A 2AJXL 5A6IA 5EOTB 3H6JA 5E1IA 3CPLB 1N70A 3P02A 4W6XB 1I3RA 5IY5B 3T77B 2BW4A 1YMHA 3ECWA 3SDXA 1GJUA 2DBLL 4GKOA 4L4VA 4GS7C 2PP8A 2DJSA 5FDWB 4YPGA 4DK5A 4AZUA 2VABA 2OJEA 4DT2A 5JPMB 1FNEA 3QEGH 5EOQL 1BD2E 3U4AA 3PHSA 4WUKL 3FNKA 1AXTH 1T1WB 2K8QA 4AQAA 3LRLA 3BN9C 1ILUA 3K3QA 3PUCA 4DW2H 3KXFA 4CDGC 3D2TA 4RIRB 4KX7A 3D3VD 2CUHA 4LGRB 4XO5A 3CVIL 2JK5A 3D2UA 2GSGA 5JHDE 2F8OA 2JIXA 4Q0XH 1EEZB 3IJSB 3KNBA 4X83A 3Q9QA 5B1JA 2V5RA 4JM2C 2IXQA 5CJOL 3S3PA 5J6HA 3ZTCC 5IREA 3HHRB 3C5JB 4WO4B 5AW7B 4B96A 5DHYA 3WUWB 3MGAA 4XVUD 3RUGE 5DJDB 2XU9A 1W72L 4GW1A 5HYFA 3EH5B 2DMGA 3KS0H 3NFNA 3ET9F 3QUYD 1KJVA 3DOSB 4JFEA 1UA7A 3RGVB 4YSPA 4AH2A 5I0VA 2XFGB 1U2HA 2DQDH 2QPDB 5LCVH 1VJSA 5E9DB 3V6OC 1XZWA 3MBED 3W37A 3NFSH 2Y2YA 4HP5A 5IROA 1RUQH 2LU4A 4M6ML 1EERB 1W8OA 3J2PA 1M05B 1NTDA 5HGDB 3FFCA 2QVKA 3POCA 4BUQA 3RFZA 5INDA 2R4SL 1HHGA 3R06B 4PHZA 5D7LD 5GSRB 1FO0H 2VIRA 4GW4B 4ZDHA 5E70A 4BQCA 4C4KO 4LCYB 4NCC2 4PLNC 4NOBA 4RWHA 1T04B 1F8TL 3Q06A 4U1SB 3K0YA 3EJSA 3R8QA 4W6YB 4Q9QL 2G30A 3QPQD 4QXUL 3QUKA 4PCTA 4LF3A 2X6MA 5J9PB 1GC1H 4B53A 4LRIC 5JHLH 3U0PB 1KCRH 3FRPB 2H45A 1M3JA 2EIKB 3OXSA 4FMVA 4LVOC 3WHE0 1MN4A 3OD3A 1KGXA 2GJ6D 2RA1A 1MHEB 3LTVA 4O9HL 3MUGB 1C5BH 5F9OL 1DL7H 4XO9A 4JG0L 4P2RD 4PV8B 3GSRA 1F58L 3DETD 5D1QC 2QVMA 2Q8BL 2VW7A 2EEXA 2IIJA 2DI8A 1AJ7L 4DVBA 1HQ4B 4MKMA 2OTUB 4HIPA 3FH7A 4NWUL 2IQ9L 4JQVC 1V7ML 2GJRA 3LZQA 5D6CB 3GXMA 3MLSH 1AH1A 2LAGB 1ZT7B 3GK8L 4CBPA 3O6LL 3US1A 4JFFE 1A1MB 4EF3A 4ZXBC 1WA0X 3QFJD 1A6PA 2O93L 1DQML 2ZT9C 3RNQA 1ZY9A 3LEVH 2OYPA 4WK4B 2IAMB 2JB5H 3QZLA 4E36A 1T22A 2KZBA 4U1NA 3PP4L 3BPLB 5KYYB 2CK2A 3QI9B 2FIKB 2DKMA 3H9SA 4OLVL 5IT2L 2EDWA 3O3AA 1WBXA 5T5FL 3ULUF 3OR6A 4X8JA 4JQIA 5EBWA 2EYSA 2H6PB 3FKUS 3MLXL 3OMNB 2ATKA 1FE8H 1RJCA 3FOMB 1JGVH 3L3JB 4FZEH 3SE4A 1XCXA 1BFOA 5DUBA 3ZTNH 2VCOA 1CDHA 5T3ZE 2ZXCA 4PJDA 4OCWL 3FSOA 5DRWB 4YE4L 5GJSH 1TSRA 1JIBA 4GRLD 2NY3B 3DO3A 1N5AA 4HFWA 5F3FA 3MREB 1WWWX 2K7PA 3OC5A 4GP8B 4CKVX 3ARFC 4GKZA 5IFJB 4KOBA 5T5NG 4XN1A 5E8PB 5I8OH 2W94A 4QRRD 3ZDXB 3H0TB 4L37B 1PIFA 4E41B 4MA1C 3VU2A 2ZXAA 4N2MA 4ZTPH 4RDQG 3WIIH 1U9KA 5HVFB 3A6OA 2R69A 2V8LA 2WXLA 4EZKA 2XCMC 4R6UA 3BHBB 4P2OB 3TVMA 1DJGA 3VXRD 4XH2B 4Z3GA 3IDGA 4QPEA 4MJIE 1RIHL 2JI2A 5LBVA 1QBBA 4PJGE 4OCXL 4OGYH 2QSTA 4MX7A 3X12A 4LEOB 4PRID 1IAOB 1P6WA 3SPJA 1UVQA 4HPOH 4YFEA 3QQDB 3DMMD 4RGNC 2NR6D 5AB1A 4CVZA 4K9EL 5IMMB 2H8PB 2VXQA 3IXTA 3QQ4A 4O58H 4P2QB 5DURB 1OP5K 3HUJB 4PB0L 1J5CA 4HK0A 4F7EB 3TBBA 3VFWA 4YBHA 2F53D 5SWZA 2KLRA 1KYUA 4NO5B 1SUJA 3F7LA 1NUFA 5JNYB 1D7BA 2PWGA 1KJMB 4M48H 5TPWL 5GISH 4PRNA 4AVIA 1C5CH 1SYSB 3K2MC 5F0LB 1GAFL 3RDTB 3S5LG 4WUUD 1X5IA 3SDCA 4F2EA 4FABL 5I0DA 2B39A 1IT9H 1I8MB 4YIQA 1J0YA 1WIPA 2GJZB 2Z8WC 1URZA 3BWAA 3CLFL 4MWFB 4F9LA 3GB7B 2EE0A 4C59B 3UJIH 3EYFA 3VQMA 3VTMA 1XF5A 4AJWA 4TQEH 3T0EC 1X7SA 4OCMC 3UTSD 5T3XE 3IJEB 4OJFL 4TTDD 4FQLL 1XR8B 3VXUD 2VXUL 4Q7DA 2WWNA 2Y36L 4JPSA 4HUWA 2ZXBA 3HZ3A 2VM9A 2XUWA 2XQYA 3KPRA 1A1NA 4PP2B 5KSUB 5C07B 3QZWG 3Q8EA 3IXAB 5CEXA 2WWMD 5JW3H 2ZNWA 2OMZB 3WUWG 1E0OB 5HHXH 1K3ZA 2NLJB 4FQHB 4UU9A 4POYA 3UJTH 3OB0H 1WAPA 2BOBB 2OMTA 3WTTA 4FQIH 4MXWH 5E99L 3FFOA 2UY6A 1QRKA 3AQDA 3RKDD 1FYTD 4ZT1A 4IBWA 5DZPA 1P4IL 3OKNA 4NZDA 4R7XA 1MJUL 4ODTL 3L2LA 1F5WA 2V33A 4JO3L 4DFHA 1X9LA 4G8GB 5BJTA 1Y6NR 1JXDA 3WENA 4FQPA 4ZPTA 4NRYB 3AWGA 4AUUA 1SJEA 3TNNB 3RWFB 1RURL 4YDJA 3BZ4A 4JPKL 5IJBC 1FGVL 3L4WA 3L3KB 4WW2C 4JPQA 3EG9B 3B7YA 3G6JE 3ZHNA 3K6FA 4P9HH 1OAYH 3ILQD 4DO5A 5GGSA 5DMYA 5B3JF 4GUPA 4GSQA 3MBWA 4HFUH 1SY6H 2XWXA 4ZUVB 1KSRA 4WWPA 4BKSC 3IK2A 3GHBL 1YQVH 3AUWB 3GTTA 5E08H 7PCYA 1LO2H 1XH0A 3FRPG 4HVBA 3DARA 2WUBL 3AT8A 4L05A 2IMNA 4XPFH 4ZOEA 2DTMH 3IPEA 4M7LH 1U8MA 1A6AB 4BBWA 4ONFH 4R7LA 3B7UX 1K2DB 2MJWA 4NO0D 1MFEL 5TE7L 1RSYA 1Q9WA 2OYLA 2AEPH 2APSA 3GPEA 3LXAA 4L8BB 1NMAL 1PEWA 1IGJA 2A4CA 5C1MB 4L0YA 3OAYK 2ZCKL 3FT2B 4U6XA 1CB4A 2X0UA 4ENEC 3WLWD 2KQNA 3TONA 2LQRA 3EW3B 4L3CA 1S9WB 1IKNC 1ADQH 4QJ3B 5DK3A 1A4AA 1CXEA 1HFUA 2FJSA 2ZXWB 4WQOA 5BXFB 4HK3J 4OZHB 1EJOH 4GQPH 5SWQA 1JK9B 5FGCE 1G7IB 1NFDA 1UZ6E 3O41A 4IGBA 3VFTA 2CH8A 2FNBA 4KQ0A 3ROLA 3UZQB 1MPAL 3H3PL 4WDIB 1ZT4A 1ZTXL 1H3WM 1J12A 3KPSE 2DKUA 1KBGL 3VM5A 5F7KC 3DXAB 2Z91A 1RPQA 4QF1B 3MRKB 1P53A 4MA3B 1Q38A 3M8OH 3TBTA 4DN3L 4PMEA 4P4RB 4PW4A 1A6WL 4Y5VA 5FV1L 2OTWB 1PY4A 5HY9B 1TCRB 5F9WC 2MIZA 1P84K 5AZ2L 3WO3B 4IYKA 3U4BH 3VFVA 5FWRA 3BVVA 2ZCLL 4JZOA 1MAJA 1XL6A 4FLQA 3GSNH 4MD5A 3NJJA 4N2OA 2M8XA 1NLDL 1OPGH 1R34A 1QRNA 5E1QA 4OQTL 5KG9B 3DURB 4YFLI 3VI3B 2I25N 5EWIL 1HQRA 4F24A 4PJHE 4OBRA 4XVJH 1S7QA 3V9CA 3MGOA 5ESQA 5KTEH 4B9ZA 2OMWA 4JN1L 3VFOB 5L7XL 2YAOA 5E2TH 1JG9A 4UUJB 4JMXA 3P2BA 5D96C 4F7CA 2Z92A 3P4NA 1XTLA 4XTRD 4KI5D 3RNKB 5ADPL 4WFFD 3D39E 4EBQL 5IG7A 5EF2A 5JXAL 2EO9A 3K2IA 4XE5B 1ZGLA 4TUOB 1PKQE 5JHMA 1QWUA 4YQXH 3OMAB 2NQDA 4JUSA 4EVNB 1U8QA 3O6FA 4TVPH 1OCCB 3SCMC 4B9JA 1CBVL 4P46C 4ZAKB 3EBAA 4PCSA 4HEME 4RLDA 2VAAA 4UOJA 2G3NA 1RJYB 2YC1A 3TT1H 5EF1A 2A9AA 5GPRA 5GGVH 1ZVSA 2JKRM 2IPUG 1J8HB 4TVPE 1TQTA 3GMPA 3GPSA 5LXGH 4D9LH 4DH2A 5KBNC 4H2AA 4Z0BH 3QDGD 4UDTB 3O9WA 2X6CA 2BVUA 1Z7JA 1ZVHA 3N40P 3PREA 4X7TB 1A7QH 4TVPD 3ATBA 3V6BR 4F37K 4IOFC 1IGCH 1YAIA 2O5NA 4AZ8B 4J8RA 4WTZA 1QSEE 2FYVA 4Y4HB 5EUOE 4NQCE 3L3HA 1FZMA 3G3LA 1F6LL 1X5HA 3WS6A 1PW3A 5JQ6H 4Q58C 3KPLA 2R51A 4QHUB 3IDUA 5EMYA 1QSED 4EI5D 1CICA 1FNHA 4MJHA 3S4SB 5AD0B 1FVDB 4KK5D 4J7RA 1WAAE 4DP7X 4NC0B 5DYOA 5FCSH 3ULSB 4AV5A 4DKFL 5L6YL 1HXMA 2Z31B 5C6WH 2P8MA 5A3ID 1MJ8H 2R1XB 1U8KB 5IGXH 4YHKL 2PP9A 3HE7C 1S9VA 1KFAH 1CLYL 4PLJC 3SGEI 3WJJA 2HRPH 4N5ED 1TMQA 1FBIL 1SFHA 3MV7B 4KWUA 3BDBA 5IOPA 1OANA 1NL0H 2Q86B 4N2FA 3MRIA 5HHVH 3IDMA 2EDNA 4PTTB 5L2KE 3BC9A 3LSOB 4LQFH 4LFHG 1ZMYA 1CU4L 3MJ9L 1DBBH 3C08L 3WTWA 3DK2A 5ACZB 3EIFA 1EHLH 3GMOA 1WC7A 4JHBA 1OAZH 4C8XA 4MA8L 2QQKL 1RZJC 2D0HA 4S1SL 3L5JA 3ECBA 3G08B 4CU7A 3HN5A 4PJ7F 4YOKA 1SMOA 1JYVA 4LHJB 3IDIA 4APQB 2VZ1A 4XNBA 4FFYA 5H8DA 5C7XH 3U9PL 1DCLA 1I8UA 1ZGLP 1HWWA 1PZCA 2PKDA 1MLBA 3SDAA 2HG0A 1DQIA 3NSYA 4MYWB 2IFFH 2ENYA 1JPGA 3GXFA 1I9RH 1A7PH 1MQKL 3B37A 5GRVK 3CIQA 5LGJB 3R7QA 2ZSWB 1B0GB 3P4LA 4NUGH 1OK8A 4LIQH 3F04A 5F7BA 3TV3L 4UT7L 2JTYA 4RAVA 5F1OB 4TMPA 4KUCD 1WEJH 4PI2A 1NLBH 4KNUA 1PDKA 4I0PA 4LIQE 3CSFA 4HALA 3STZA 3ZT5A 1WCBA 4J3SA 5BS0D 1CT8A 2NY7L 3V6FB 3U6RA 2G9HB 2P7TA 1S7UB 3UDWC 1WBYB 2CHNA 3QH3B 4UT9H 3WNJA 5DEFB 3W38A 3NN8A 4BE6A 2RCSL 1BIIA 1U3HC 3WFEH 1D5MB 2EC9T 2AEOA 4HKBB 5BQDA 4A2DA 1PZDA 4YK4B 2YWZA 2EIZB 3Q01A 1IM3D 2AXGA 1M6OA 1WTGT 2K6ZA 1UM4H 1JPTL 2EKSA 1YN7B 3GM0A 1YYLH 4JFPA 1KJ3L 3LKSB 5D4JA 2J73A 2W60A 4QNPF 5ANMB 2FTAA 4A2EA 4OFYA 1IQDB 5EBLB 4UM8A 2ZTBA 3ESNA 4KROB 4WENB 1G9NH 4M62H 5I1HL 2CM5A 5I71B 5B3SB 1W72A 4ZS6D 5I6PA 1OB1B 2EXYD 2ITCA 3OKMA 3FW6A 5DCCA 3AFLA 3F12A 3OVUB 3UTTA 5E2WL 2CLRA 3O4LE 1PJWA 4LEBA 4GRWB 4R0LC 3PL6C 2G5BB 4JFQB 1VA9A 1XSKA 2FUQA 2BRRH 4JDZA 2R15A 4ZD3L 3SKJL 2OXHA 2VO8A 4PLKD 4KFMA 3V4VB 3DTXB 2XG5B 4ODXB 2BSDA 4ODSH 12E8H 2BM3A 1VF5C 1OV8A 1Z2KA 1DQTA 1KTDB 4U1IA 4ODHL 4BQ8A 5DK0A 4IW4C 4IRSB 1YPZE 5DZJA 4IJ3B 1N64H 1G7MA 3H9HB 5TDOA 3NRFA 2BHYA 2HVJB 4E9SA 4GI6A 2CBPA 3ROOB 4WWOA 4PJ8C 4E9RA 4LRNH 1HH6A 1E4KC 3W0WA 3ZE0F 3L95B 1FI8C 2DKSA 3FU3A 3TCLB 2XN9D 2KPNA 4F1ZA 2ZOUA 3ZKMD 1T5KA 1U30A 2JB6B 2WWKO 2ED6A 4PJIB 1B4LA 4Y2DD 5D71L 3V9FA 1FP5A 5B39A 3PQYA 4FXKA 3LPWA 1CGSL 4OUUA 3ATFA 2GSIB 1EAQA 1X5LA 2XZCH 3T6QC 2H9GA 5J1AB 3TIEB 2HP4A 2ZSVB 1U3YA 4U6HB 4G70B 1T6VN 2VLME 1OWWA 2YK1L 1SEBB 5E03A 2YKLH 5DFAA 2ATPA 5J13C 1AOHA 1ZVYA 4U7KA 3C5XA 4K3GA 1M7DA 3I9IA 1XHHA 3IU4L 4LLMA 1U91A 3SGEH 4EDWL 1NEZG 1ITCA 1BW8A 3F7YA 2PF6A 8FABA 2O4EA 2WQVA 1YMHB 5F97E 1NCIA 4L4TE 2MKLC 4X7EC 3RVUC 3SDXB 1F4YL 3ZTJG 4L4VB 2QADD 4AGNA 2F19H 2X6VA 4YPGB 2OJEB 4UZUA 1FNEB 1UKSA 1FVEA 2NNCA 1KYFA 4AQAB 3Q8BA 3B9EA 3KXFB 3BIKA 1FORH 3CFKA 5I8EA 4CN1A 2FGZA 5T5FA 2JK5B 2KZWA 3HZVB 3D2UB 2L7UA 4FERA 2GSGB 1W6WA 1WHOA 4FNTA 2JIXB 1T89C 5ANHA 2HVBA 1A6UH 3HNVH 3KNBB 4ORZC 2NY4C 5FPIA 1E9OA 8CGTA 2IXQB 2PYEB 5FYKU 5J6HB 3K6SA 1PFCA 2EYRA 1MI5E 4PY7A 5CO1A 2JI1A 2DLEA 4R4ND 4MTMA 5DHYB 3CXDL 4S1DC 4WAFA 5AYTA 3FS9A 2ESVE 5AQ0A 4PI0A 2XA8L 3NZHH 4OM1H 5D7JD 5IR1B 5JIKA 3P30H 3S4SG 4YHML 2Y07L 3GBDA 3BKCH 1KJVB 4WJ5A 4MASA 4JFEB 5DC0A 5MHSE 3L08A 3MJ8A 1TJXA 2NDGA 2A5UA 2GTQA 4AH2B 4MZIA 4NC1C 5FGRA 4YZFE 2ALWA 1TNMA 1QO3A 1RZKH 3EOAA 3CHRA 2J1WA 3QCUH 1W8EA 2PO6A 3D4ZA 4KRMB 3X13B 5BV7L 2EACA 3FFCB 4JRYA 3VJ6B 2X4OA 5MENA 3ULUH 3RI5K 4P57A 3D69A 2PPAA 3MOBH 4H26A 4KKCD 3S36L 5INDB 1HHGB 2CHDA 2H1XA 3T3ME 3C12A 1J0HA 1DN2A 2F18A 2VIRB 4ZDHB 3ULUE 3JWNG 1DVUA 3X3FL 4M6NL 4KY1H 5IBTH 2OW6A 3L5WA 3QUKB 4LF3B 2VB5A 4LASL 3ULUD 2Z6FA 1M57B 1HJBC 4WI7A 5KANI 3TYGH 5KS9F 3OXSB 2YPVL 4QAMB 1A7NH 1OM3L 1IQWL 3OTTA 2P5ED 2BNQB 2PR4H 2D9QB 3BUDA 3GSRB 3QRGH 3ZIMA 3HLKA 5JOEA 4DVBB 4J4PD 2XZAL 3BDYH 5KVFH 5IUCA 4XVUC 4ATWA 1SN0A 2F1BA 4OZFB 2QLYA 3HG5A 3W39B 3MRCA 1OGSA 2IF7A 5KVFE 3QA3A 3G5ZB 3CMOH 3KBFA 4HEPA 2YR3A 4NRZA 1L6PA 3E1ZA 3RNQB 1QYGH 2AZAA 2G0KA 4FLOA 2AQSA 4F92B 4JY4A 3MBEC 3EOTL 3KYMA 1T22B 1GJWA 4OM0H 4U1NB 3VYOA 2K0RA 1T3FA 3I74A 4L9LC 1G9MC 4OQ1A 3H9SB 5TQ0L 3MBXH 5HHMB 4HGKC 3EGDA 3OPZL 3O3AB 4AEIL 1JWMB 3CBJB 4FXTA 2PMZA 3OR6B 4X8JB 4OCSL 1A7BA 2EYSB 3BSZL 1MCSA 1Q9LA 1DVSA 2BVEA 5C6PB 4JREB 4Z7UF 4UNUA 1GOHA 5D7KE 2LU3A 4UCFA 3AS2A 3QPQC 1BFOB 5DUBB 4DJMA 3FTGA 3P40A 4PM1A 1GH7A 1R5WA 4PJDB 3PPSA 2K9UA 4NZUH 3NFPA 3P9LA 4ZMAT 2R9HC 5I6LA 2Q0ZX 5IQOA 3KLLA 1N5AB 2VLJA 2BIOA 5I5RA 3QORA 3F7KA 2P4AB 4R26H 5EN3A 4GKZB 3UABA 4OIIL 1F2XK 2A1WL 2OI9C 3DETC 1RHFA 3LKQA 4MJ6A 4F37F 2APXA 4I13B 5CP3A 5LB1A 1KIPA 2WZPD 1LO0L 3PAZA 1GC1C 3ARGB 3QDMA 4DAGL 4Z1PA 3KGSA 3DK0A 3L2MA 2DW5A 4MDRA 2YD9A 3TVMB 2WIIA 3LN5A 3OKLA 4KDVA 5CGBA 1WZLA 1AY1L 2CG9X 3DO4A 2EE6A 3IDGB 1I8LA 1FAIL 1HCVA 4N1HB 3TLRA 5JYMA 4JX0A 1IBZA 1JVLA 1XGTB 2W0KA 1Y18A 1OHZA 3NRQA 1DJWA 3GJFA 1KPVA 1Q9OA 4MX7B 3ZKSD 4DP5X 5GS1C 3B9KD 4BA8A 1UVQB 3WXVH 3CX5K 5D7IA 4L8DA 4CVZB 1RXLA 4HMCA 3QQ4B 3IXTB 1I3VA 1MWOA 4YHIA 4HA1A 4CC4A 1LO5A 3ZE2F 2R0ZH 4HK0B 5C3TA 3VFWB 5SWZB 1MW2A 2IH8A 1UJ3A 5I15L 3D6GA 1M1SA 1TSHA 2E6JA 4QD2E 5I75B 1E8WA 3WYRA 1A22B 4GKNA 3VD0A 2UZXA 4PRNB 4HU2A 5AVVB 2ERJB 4PGEB 1MFDL 4OJYA 2AJYL 4OFDA 4LARL 5KW9L 2WGNB 4GRLC 4LLVA 5CMAA 5FYLL 3SDCB 1BPVA 1BJ1J 2IWGA 3HRZB 1S5IH 5KOMC 4E41E 1HTYA 4ODWA 4MRCA 1I1YA 1R24A 3S0PA 5K69A 4L0ZA 1E6OH 1HILA 1OARL 1SN5A 2LVEA 2YMXH 1MFCL 3QWRA 4HKZA 3ZQXA 3TJHD 4LCIL 1MCPH 1XF5B 2H2PD 2DLGA 4UQCA 4AMWA 5BO1L 1L9TA 4LAQH 5H94B 3IB4A 1ZEAH 4MB1A 2FWSA 4P4KD 1IBFA 2WO3B 3EJJX 4PH8A 5KSAA 2HLEB 2HTKD 3G5VA 3O8XA 4HUWB 4MD4A 3ES6B 5ESAA 2YJQA 4JUTA 3ZTEA 5EEWA 2OMBA 1TETH 5CINL 3KPRB 4W9LC 2X2IA 5FGBA 1A1NB 3S35H 1G94A 3PJSA 4RMQA 5CEXB 3HA0A 5LGHL 2YA0A 4FQXD 5DZAA 1OAQL 2FO8A 4NLHA 2K3HA 3WDHA 1EO8H 3L3OA 4PJ5E 5C0RL 3MR9A 3OR7A 4KK8D 3DMMC 4UU9B 1X5GA 2NR6C 2ZOOA 3GXIA 1SGKA 2NSMA 4W9IC 1H15A 3JTTA 5FWQA 3LIZH 2UWEF 1F1AA 1TDQA 2YJLA 2Z1KA 4MFHA 2UY6B 4BA0A 1YCSA 4KNTA 3MNDA 5JA8B 3OKNB 2HT4C 1SLXA 4MAYA 1KB9J 5DVKA 3EBGA 1DCEA 4R97B 1VIWA 4OQTA 4BINA 4C56E 5BJTB 3UIYA 4ZPTB 4W9JC 3RLSA 4ZMPA 5AB9A 1SJEB 3WKQA 1J18A 3TURA 4UILH 4TM9A 1CDYA 4YDJB 3BZ4B 3SGJC 2Z0UA 3H2WA 3AG1B 3MZGB 2OQJA 4P9MH 3ESVF 2YMOA 3LKOA 4KNSA 4J23A 4B5EA 5GGSB 4OLYL 4P5TA 4GUPB 3MBWB 4HD9A 1XEDA 2IFGA 3KJ4C 2ZG1A 4MNQA 4H8WL 4U33A 5KSBE 3GZKA 1FHGA 3H6AA 5ETUA 4GG6A 3R1GL 3UZEC 1IKFL 4NKIL 4RX4A 1CXIA 4TTDC 3V0AC 1ZS2A 3L54A 3T0AA 4CVWA 4B9FA 1FNSH 1U8MB 2EUWA 4MAUH 1J0JA 1QSFE 4KTYA 1MCWW 3GRBA 2PP7A 4JM2A 1IGTA 1Q9WB 1JE6A 4YWGL 3BLBA 3KS0J 2WWMC 5AKTA 4FC3E 3VUAA 4C57C 3RVWC 1IGJB 5I8KH 5DD3L 3EJUA 4KJYA 4WFGD 5HHOA 3P4MA 4U6XB 5KN5B 5C08E 5TF1H 1A47A 4CGUB 1T0MA 2AEQH 2ARJA 5EIIA 1BVLA 4L3CB 5IQMA 4G8GE 4YDZA 3JYCA 4JG1H 3X1BA 3NUKA 3DDGA 1TIUA 5I5MA 5SWQB 1Q94A 1OLZA 3WKML 3V6OA 2XFXA 4X4ZA 4TSCH 1NFDB 3O41B 2ZYRA 4IGBB 4N0CD 3VFTB 1DBML 4M93C 2JKJA 3ROLB 3Q0HA 3IPBA 1XGQA 1ZT4B 1G6RL 1FCCA 1H3PL 1J9TA 2GYSA 3ME0A 4HCRL 4UIKH 4AWJC 1S3KH 4A66A 5I1IL 4HUMB 1WRFA 1SMAA 2Z91B 4AW7A 3OMZA 2OR9L 5I6NA 3STLA 3ILQC 4L29A 2VDNH 2X9ZA 4K5LA 5DJYA 3BI9X 1UM6H 4OZ4A 4XO4A 1AYRA 1SLVA 3OAUH 4IHOA 4KZ0A 3D0VA 4Y8DC 4AKPA 3ZPDA 3C2AL 3IRCA 5F7DB 3TBTB 1NCDL 4P3WA 4BKTC 4HDIA 5CKAA 2WVTA 3HPLB 4YDIL 3GSWB 5CZRA 5J3HD 2X4QA 1F90L 3KH3A 4P9HC 4UYPA 1GZQB 3MJ9A 3VFVB 2DYPA 4YEEA 1G1KA 4TOYL 4P99A 4JZOB 3QIBD 4MD5B 3QAZC 3Q3GA 5J1TC 4JAMB 4PP1D 2QGCA 4HMEA 1BQSA 2EIJB 3OZLA 1CD1B 3QNXA 2MCPH 1NEUA 4GUCA 4QTHA 1AACA 1UOWA 4JQVA 1U21A 3WLWC 2IGFL 1S7QB 2VDQL 3MGOB 3CD4A 4G2AA 3SOTA 5LDUA 2OMWB 4ONHA 1MRCH 4ZXBA 5IIEA 3BLKA 1Z3GL 3MLVH 4OI7A 2CHZA 3NCXA 3C60D 3ZDZE 5EEVA 5IFHH 1CE1H 5L9DH 5ELIA 3VGHA 3UYRL 1SXNA 4F7CB 5EOCL 2Z92B 3HC3H 3ARQA 3P4NB 3DXAE 4X80H 4G82A 5GRUL 3CVHH 4ZFOL 2E4FA 5DO8A 5E2UL 1ZGLB 4X7SL 2IG2L 3KGUA 4UAOC 4URKA 3T2OA 3M45A 1U8QB 3O6FB 1AOZA 1QVOA 1B90A 2VAAB 4HXAL 3RI5F 2QV2A 1ZVSB 4I77H 3GMPB 2H5UA 4JDVB 4M7KL 3GMRA 4R4FL 5BOPA 4QKXB 5D1XE 5EO9B 2XACC 1NBYA 1RJLA 2A9ML 5KBDA 2APVA 4M6OH 4AYSA 1SDDB 3O9WB 3LD8C 2C4FU 4IKNA 4PJ7E 1ED3A 4YBQD 2J6EH 4BXVA 1BDYA 1T5WA 1PG7H 2HFFB 4A55A 1T1XA 3AM8A 3CZKA 4KZCA 3RKPA 3S34L 1ET5A 4I5BA 1OP3K 3FQUB 3LX9A 1X5ZA 2BSCA 1A14L 1YUKB 4X6DF 4XPTH 2NY1D 3BAKA 3BE1H 4AEFA 3L3HB 4ZS7H 1KYAA 1FZMB 4PRDA 3FT3A 4S0TD 3H4HA 4J28A 2BJMH 5CU9A 1RFDH 2G2PA 3HEIB 4OLUL 2XWRA 3VSUA 3KPLB 5D5MF 5CJQH 4RDBA 3L5XH 4FQQA 4JKPL 5HD8D 5BW7C 5DYOB 3LV3A