2B9AA

Human transthyretin (ttr) complexed with diflunisal analogues- ttr.3',5'-difluorobiphenyl-4-carboxylic acid
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
108
Chain Sequence
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTARYTIAALLSPYSYSTTAVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords Transthyretin
publication title Diflunisal Analogues Stabilize the Native State of Transthyretin. Potent Inhibition of Amyloidogenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 108
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2b9aA00
3DJSA 3A4DA 4MRBA 3GS7A 2G2PA 3ESOA 3I9PA 4MASA 4ABVA 3NG5A 5E4AA 1QWHA 3GS0A 4TNGA 4PWEA 1Y1DA 2QGCA 1KGIA 2B14A 4ABQA 2B16A 1SOQA 3IMSA 3A4EA 5A6IA 1TZ8A 1ETA1 4PWJA 1TLMA 3D2TA 4IKJA 3IPBA 5L4MA 2QPFA 2B9AA 4IKKA 3OZLA 5BOJA 4QRFA 2H4EA 5FW6A 4IK6A 5JIMA 3GPSA 1IIIA 2G4EA 1BZDA 2QGBA 2QGEA 3IMUA 4FI8A 1TT6A 2H1XA 3IMWA 2NOYA 4Y9CA 4FI6A 4L1SA 5AKTA 3W3BA 4ANKA 3D7PA 1BZEA 3IMTA 3KGTA 2B77A 3TFBA 4PMFA 3CN0A 3GRGA 2G5UA 4WNSA 5DEJA 3BSZA 3OZKA 4TQ8A 2ROXA 5L4IA 1TSHA 1SN0A 1THAA 4I89A 3KGSA 1DVYA 2QGDA 3IWUA 4IIZA 4D7BA 1TTAA 1E4HA 3DIDA 5TTRA 1BMZA 3A4FA 3DK0A 4IK7A 3NEEA 5K1NA 1DVTA 4I85A 2H6UA 4PWIA 2WQAA 4N85A 5CLXA 1ZD6A 1G1OA 5E4OA 2G3ZA 1TTRA 4TLSA 1SN5A 5CR1A 1X7SA 2IGLA 4ABUA 2G9KA 4TLUA 1E5AA 3IMRA 3U2JA 4TQIA 4ABWA 1DVXA 2TRYA 5AYTA 3NEOA 4FI7A 5IHHA 1IJNA 2G3XA 3CFMA 4HISA 1X7TA 4L1TA 5CNHA 4WO0A 4YDMA 3CFNA 4IKIA 4PVMA 3FCBA 2F7IA 5EN3A 3P3SA 2FBRA 1DVUA 2H0EA 2ROYA 4AC4A 1KGJA 3DJTA 3I9IA 5FW8A 4AC2A 1U21A 3CN1A 4Y9EA 2B15A 3BT0A 3KGUA 3DGDA 4MRCA 2H0JA 4PWGA 4PWKA 5CN3A 1DVZA 5L4FA 3CFTA 4DERA 4ACTA 3CXFA 1TTCA 1IE4A 3CN2A 5JIQA 3DJRA 1ICTA 3P3UA 1QABA 4TNFA 4DETA 4QXVA 4QYAA 4TKWA 4TLTA 4PM1A 3B56A 5HJGA 3GRBA 4PWFA 3DK2A 3NEXA 1Z7JA 4HJUA 5AKSA 3U2IA 1TFPA 3CN4A 3GLZA 4TNEA 4TM9A 1DVSA 1ZCRA 1OO2A 5L4JA 1FH2A 1SN2A 3M1OA 1ETB1 4IKLA 3ESPA 3IWVA 2G2NA 3IMVA 3NESA 4PMEA 3CFQA 4PWHA 4TLKA 2GPZA 4TL5A 4I87A 4DESA 1BZ8A 2GABA 4Y9GA 4DEWA 4HIQA 4Y9BA 4N87A 4HJTA 4N86A 2PABA 4PVLA 3FC8A 1RLBA 1TYRA 3HJ0A 3I9AA 5K1JA 5CM1A 3SSGA 3CBRA 5DWPA 5JIDA 5EZPA 2FLMA 3IPEA 3P3RA 1GKEA 1F41A 1SOKA 4TQHA 5FW7A 1BM7A 4WNJA 5FO2A 5E23A 4Q14A 3TCTA 5CLYA 4Y9FA 3GS4A 1THCA 3P3TA 3CN3A 5CLZA 5AL0A 2G4GA 1IIKA 1GKOA 3DJZA 1TTBA 4HJSA 1DVQA 5AL8A 2H0FA 1FHNA 1F86A 3DO4A 4DEUA 1E3FA 3ESNA 3Q1EA 3QVAA 4TQPA 4YDNA 2TRHA 4TL4A 4PVNA 2QELA 4KY2A 5AKVA 2F8IA
chains in the Genus database with same CATH superfamily
3GJEA 1U8JB 3FTUA 1MN4A 1NWOA 3NDZE 4JQVA 3IJHB 3THMH 3D3VD 1UH4A 1CQKA 4WKZB 4F37K 1ORSB 1NBYA 4X6EA 2QPEB 4HCRA 3C6LD 3MV8E 1E9QB 1BVKA 4XN4A 3BPNC 2NZIA 4KQ3L 4ENZA 3BZEB 5AVTB 4M1GL 3ZYJA 3QXWA 4UZUA 1KEGH 3FU3A 3K2IA 4XTRC 3EJQA 3Q2LA 4FI6A 3KNBA 4IOSD 4BK8A 4DQAA 3I6SA 3L5XH 1KXHA 2Q8BH 3G04B 1SGKA 4NQED 4GP4B 2OR8A 3HZKB 4J3OG 2J57A 2C3VB 2GFBB 1KENH 5J5EA 4ZUUA 1JHTA 2LVEA 4KROD 1RIUL 1XL4A 2GUOA 4LLDA 4EQ3A 4MS6A 4Z7QF 1U8LA 4X4YA 3LDBC 5T33H 1SFDA 3Q3GB 3NSCA 4PJ7A 3HE7C 2BFVL 3QW9A 2Y3NA 1BA9A 1CDYA 1WAEA 5J89A 5HYQB 5BCAA 1HQRA 2VZOA 4MA3B 3CZFA 4ZO7A 4YDVA 3FT2A 4J3VA 3RTQB 1EO7A 5HHOA 3WTYA 5ESVA 4RWHA 1Z9SB 3V0WH 4K7PL 3NJKA 4K8RD 4PFEA 4BZ1A 4TUOB 4U1JB 1OCOB 5ILTL 1CGTA 1PNDA 2AEWA 5D2NE 1HJCA 2RJMA 1NGYB 1P1VA 4HXBH 2CZNA 2F5BL 4MJJA 1B3JA 2HB0A 1IE4A 4MJ2A 4LRNL 2WCGA 4P2OD 4A7QA 4HHWA 1MRDH 4PTUB 4MTMA 4XI5D 2OBGA 3VXRE 2B1HH 3TO2B 4QMEA 3X14A 5LCVL 1HNYA 2HT2D 1NCWH 3ZKNC 2V9RA 2SEBA 1SHMA 1AGEA 1OSPL 2V2XA 3BSGA 3BX7C 3LZFH 4FLSA 1SN2A 2AQ2A 5I6OA 3TBTB 5DD1L 1OQXA 4X8XA 2GG1A 3H6JA 4O02B 1HCYA 3TJHC 3ARGA 1ZT4A 3EGDB 1G5AA 4M43L 2VERA 3DLQR 1P84J 4PJ8A 2LVCA 3L7FA 1LO4L 1G7JA 1EHAA 2VLRE 1I8KB 4IJ3B 4X9GA 3V55A 3BQVA 4U2YA 4G8GD 4YFEA 1M3JA 2WBJB 5EEYA 3THML 4F3FA 2NQDA 3IJ9A 4BZYA 3NZ8B 1BM7A 4FNSA 4RSVA 4WNJA 4ZFZB 2N59A 2WINB 3U4KA 4WWKB 4RISL 4KGLA 5IKCB 3CU1A 1U8NA 3E2HB 3NFSH 3RWCB 4E68A 2AXFA 1JVLA 1KEGL 1MH5B 1V3MA 3NZUA 4P46B 4YGVA 2Q8BL 3L5XL 2YQGA 4XN9A 3CPLA 3Q1SH 1TU2A 3G6AA 4EI6B 4ELDA 5DCCA 1KPRB 1SOXA 4J23A 4ZXBA 3NJGA 3L4VA 2H3NB 5HHME 1QO3A 3ZGIA 3VCLB 3EFFA 1X9RA 3T0EE 2ZUXA 5T33L 4FJYA 3LQMA 4LPCA 5DJ0A 1XFPA 1QR1A 4BCXA 2YWYA 2X4SB 4AYMC 1XEUA 5DDHB 3SZ6A 3Q9PA 4L3EB 1DSYA 4BFEA 3NPZB 1AQKH 2R8SL 4NKOB 1IGFH 2QQLL 3OKOA 1YEGH 3AROA 4GW4A 4K55A 2VKWA 3VG9B 2Y5TA 5KSBF 1KLUB 4W68A 3HZMB 1AS7A 1I1CA 2Z35B 5TDOB 3FQNB 4KXZH 2AABH 5B1CA 2HT3D 1S7SB 4ZFQA 1URIA 3H1ZA 5CO1A 4AGPA 3BHBB 4Q9QH 4HXBL 1HHIB 1WIOA 4J3OH 3OAZH 3UEZA 1E8XA 1T5WA 3RZCC 1XR9A 4PHXA 4YSEA 3N1QC 3X11B 2ICEB 1RPUA 1D6EA 2B1HL 4P5TC 3HZ3A 2VCOA 4BKLB 3AT8A 5MI0B 1MCPH 1NCWL 4JE0A 2BSRA 3LZFL 3QJQB 1JF5A 3MV7D 4MB1A 1ET7A 2X4TA 4E42B 4NFBA 4PJ5A 5FV2A 1E67A 2R1XB 5IQ9B 3RIFK 1HL8A 2YS4A 1CGWA 2C9XA 2CUHA 3CUPB 3FFDA 5PCYA 4UI2A 1MCCA 1DANT 1EGJA 3O3EA 4TVSa 4W6YB 1A6PA 3TVMD 5I2IB 2KZKA 1FJ1A 4PWFA 1XF2B 2CDEA 3OKEB 3DYOA 4YSQA 5H8DA 3HZVA 3GEWB 2LGNA 4N5ED 4Y2DA 5E1AA 2MSPA 4Z3HA 3O6FB 1ZJAA 4W9EC 1HHKA 1FNGA 2HRPH 4ONGH 2ADGA 3IXAA 3TYFB 3KPLB 4XNMB 5HI3D 5HYSG 4HKJA 4Q6IB 4KJPC 2C4FU 3LKSB 3NMEA 3ZE2B 5GGRA 5JR1H 3SDDC 5C0CA 3Q1SL 1FLTX 4EIZC 5KVEE 2E76C 1MIEH 4NQUA 2AK4B 3TS8A 5AALA 1IBDA 4FA8A 1A4KA 4NC1E 3KYNB 3K7UA 1URLA 2CKBH 4U6HA 2YPLD 3O4LA 1ES0B 1EO5A 3JTSA 5AVQB 1W8OA 1I3UA 4FNLH 3ZMEA 1P7KA 2ENSA 2GK0B 3FT9A 5F7HA 1E4KC 4PREB 5K39B 4F93B 3E80A 3IU4H 3QIUD 4PTTB 5JLZA 1CGVA 5F3HA 4JFUA 4BCYA 3VFSB 1IGFL 5DRXB 1YEGL 2WMPA 5C9KA 4PJHA 2AZUA 2H32H 2WZAA 4APXA 3REWB 4L4VA 4TUKH 1G7QA 3VXMB 3DIVA 3UTZB 4IKJA 4Q9QL 3ZDZE 5DS8A 5DSCA 3D07A 3SDAB 3ZR5A 2RCSH 3IJSB 1KCUH 4U6XA 2E56A 4Z23A 5EIIA 4LLQA 4GPVA 4JZJC 4HVBA 2YD7A 1GCFA 3WIFA 1N8ZB 1AYOA 1NQBA 5SX5H 4MGXA 3ARBC 4MD0B 4JY4A 4JFYB 1AG6A 1OV8A 1AOHA 3MACL 3IDNA 3FSWA 1FZMA 1Q9LA 1N5AB 1ACCA 3A0OA 4ALAC 4D0BA 1G6RA 4KKCD 2PO6B 3QWOA 4K0OA 2JQZA 4U1MB 4Z7WA 4WUKL 3VFRB 1D6VH 4RWYH 3P4OA 4KKBC 3T1WA 2F7OA 3FUEA 3L45A 4YAQB 4XC1H 5AVRB 3GO1H 3OPUA 2WZPA 1OWRM 4NXSA 4P3DA 2ZONA 1U8MB 2D03H 4WO0A 5I17A 3W9EB 3QUMA 1OSEA 1BV8A 1JERA 3HG1B 4XB3A 1MI5E 2K70A 2V33A 2IC2A 2HRPL 3CVDA 4ONGL 3CSFA 1KJMB 1JZ3A 3KPMB 5K5YA 4NRZB 5L7XH 3RPIB 4X99A 2CBOA 1JWSB 3RVTC 2MHAA 5CGYD 3HCVB 2ESVE 1MVUB 2X70B 4KI5E 2Z8SA 1MIEL 1U30A 2NT0A 4XBGB 1MG3C 3MRGA 2NXYB 3UO8B 5LN4A 3EDEA 4QOKD 2CKBL 1CICD 2X1QA 2N01B 2MCG1 5IOKA 4WEBH 3MRKA 4FNLL 5FDWB 3MV8B 3ZGHA 2NY3D 3DO7A 2NSMA 3OXSA 3F83A 3IU4L 2YPVA 1TJHL 3K72B 4MNQD 3MREA 3I75B 1B90A 5D9SB 5IHBA 5D1XC 1YYLH 2IO5A 3C5XA 5ALCL 5A2IH 1CB4A 1LLAA 4QO1A 4TUKL 2IADB 4OVUA 2YK1H 1AHWC 1ZA3A 2WXFA 1GY2A 1RJLB 2B3IA 4R97C 2RCSL 4DFHA 1KCUL 1N18A 4YE4L 5JO5B 5F1NA 3KHQA 1NL0H 2EO9A 5ETUA 1MCJA 1NGXA 5AW0B 5F7UA 4BSWB 2O30A 5EU6E 3WD5L 5E9DA 5C86A 1ZOXA 4NQSB 4TPRH 4LL1A 2QL1A 2BC4A 1WC7A 4JRYE 5J9PB 3RA7H 3KS0J 3RL2B 5E94B 3LOWA 1AS6A 3CSGA 3O3DB 4HPOH 2B9AA 2GAZB 4KK8D 3VD9A 3RLSA 1UATA 5DMGC 1LWJA 2ZUVA 5GXBB 3B3IA 1P4IH 5ICYB 1R19A 1T1ZB 4JO3H 3KLQA 5D2NB 3UZQB 2ZWZA 4J27A 4WY7H 4XC1L 1BQ5A 3GO1L 4R0LB 4Y4KA 4A2FA 4OQTL 3LTVA 2MTAA 4MS8C 4TUJB 2D03L 2XQBH 1NIEA 4F8TA 2PPFA 3VXRB 3ZTJG 3WXWL 4JK0D 3L1OH 2O6FA 3VNYA 1O5DT 3QQ4B 5JQ6L 2ETWA 4PJ9A 2X9ZA 1DVTA 3QJRB 2P1YA 3MRPB 2YC1B 4NHCH 5BRZA 3GZPA 4LEOA 1FAIH 2VZTA 1QX1A 5L7XL 1MCWW 3OAUH 4JFSA 3S5YA 2YHGA 2BS71 5JIPA 1MREL 2X4UB 3PWVA 5HGAA 5C2BH 1MFBH 1YQ2A 4PRHA 1V7NH 4FAAB 2YKKA 4PVMA 1OALA 1PLCA 2HFFA 4DN3H 3ULUL 2VM3A 1FYTB 2V7HA 4GS7B 4LU5L 4OFYA 2H0EA 1FYHB 1YQVH 1U21A 4PYHA 1YG9A 2FYYA 4LEXH 4OY9A 3QPQD 2FB4H 4DGYH 1U3HD 2K8QA 4UTBA 1HHGB 5DHVH 4PJIE 1IBYA 1KDIA 1VFBA 1Z7JA 4P23C 3TBWB 4GUPA 2O5YH 3QBTB 4L37A 1YYLL 5IB5B 1R0AH 4N0CD 3Q8FA 3QZNA 1DLFH 2AQRA 5H37A 1ERNA 4C57C 2Y7MA 4O2FB 2YK1L 3CCHB 4UTCA 5MEQA 4F5CA 5JOFA 4DEPB 3CFQA 4OCRH 1IAIL 2QVTA 3P30H 3SY6A 5FX3A 5HHMB 5JNYB 3LKQA 3CQPA 2Y2TA 1ACYH 2QBWA 4YPGB 3RILA 2ERJB 3VX1A 1HHHA 3QYMA 1NL0L 1L6PA 1VZGA 4NKDA 1S7WA 3VW3H 5DF0A 2XXGA 4ONOA 4HUVA 4ZTOH 4ETQB 1YMHA 3H9SE 4XGZA 3ZRSA 3ZK0A 1PGRB 3NJHA 4TPRL 4Z7NE 3FOLB 2FT6A 2RBLA 3K81A 4I18A 5J56B 2F15A 3KD4A 3IFNH 3OR6A 4XXCC 3RA7L 3S8GB 5FYKU 4RBPH 4FADA 3WJJC 1NMAL 3MRRB 3UYRL 2ZNXA 1BQHA 1DN0B 4LVOC 2J1WA 4JO3L 2XKNA 4L9LB 3G5YB 5K59E 3DOSB 4UIKH 4P4KB 1ZT7A 5DUJA 4WY7L 1RUQH 4AV4A 3BKMH 1EFXB 3OVUB 4DGIL 5HVWA 1FH5L 1UTDA 2X7LA 3KVQA 4X6FB 3L1OL 4PB9H 4MSWA 2FIKA 4FJZA 4J1UA 3K91A 4PJEB 1PZUB 4YLBA 1G7HB 4MXQC 2ITCB 4RRPM 2V7NA 1FG2A 5EPMA 1FAIL 1UCTA 3OAUL 1ASQA 2PKDA 4I2XE 1G1CA 2DI7A 3WE1A 2QADB 2XUWA 1MFBL 1Q1PA 3T65A 4BFKA 5JQIB 1IFHH 3O3BB 3SCMD 1V7NL 4NDMA 3OWEA 1J18A 3PV7A 3KCPB 4DN3L 4BFFA 4LCWA 3FTSA 3S36L 4MCYB 4FCHA 4CMHC 4KRNA 1LK2A 1JL8A 1FFTB 2FB4L 3IRCA 2YOAA 2DQGH 3L3IA 4JKMA 4U3XA 4WUUE 4X4MA 3TN0C 1I1AD 2IGLA 3UO1H 4D9LH 4DGYL 3TZVB 1EQWA 4LF3B 3FSAA 4LSDA 2FSEA 5F9WB 5IESH 1BZQK 3KJ6H 3PG2A 3GTVA 1R0AL 1NJ9A 5HVGB 2KBGA 4LLUA 1LYQA 1TENA 5ICZA 4WFFE 4QF1B 4F7PB 3IAPA 1ZTXE 3D25B 3P30L 1QEXA 1SJMA 3GXUB 2BPBA 4NUGH 2QSQA 1O0VA 1S9WA 3UGUA 4U1NB 3QG6B 1J5DA 2XV3A 1RHHA 3D48R 3I3EA 3UOAB 3WEAA 4FLQA 3IU3B 4CDGC 2WGXA 1R5IA 5LXVA 4U31A 5EZJA 4G6KL 2DM2A 1TNMA 5DFAA 2NXZC 5KJ4A 2ZWNA 4NB7A 4JDZB 4P0DA 3IFNL 4NO0A 5DFVC 3WKNA 1KYDA 5DEGA 4P49A 4MJ5A 4RLDA 4HOWA 2N1TE 2YFNA 5J12B 1RZIB 1VB9A 1ZXQA 5KZCB 3O4OB 4KI5F 4JFED 4NPYA 1RIHH 4N20A 3ZDZB 4UIKL 4PV8A 3F7LA 3JT2A 5BW7C 2WC7A 1RUQL 4C4KO 1QZNA 3BKML 2DWEB 5ISZA 4LBAA 4RGMC 1GZQB 1UT1A 5KOMC 5C0NC 1UXSB 3G08A 3LQAC 4JQIL 4K3EH 5C0AE 3VD5A 4AZ8B 3BGFC 2L7EA 4PJAF 3HS9A 4PB9L 4JFDD 5FGRA 4N3UA 3NGBC 2BIPA 2EYRA 2GJ6D 3BEVA 1I1RA 2IDCA 3KM2A 3W0WE 2WLIB 4DKFH 1E27B 1H19A 4Y4FD 2RGSA 1ZIAA 1BYNA 2P5ED 3I6GA 4WI4A 2A83A 5GRVK 2PTTA 4LB8A 1IFHL 1OAYH 2WUCH 1WWAX 2A74B 3V9CA 4XAKE 4AW7A 2VLLB 4MJ6B 2TSBA 3AU1A 5DD6B 1NFDB 4OW6A 3U2SA 3CDGB 4KJWD 2GEEA 5D5MB 1RMFL 2DQGL 4PJDA 4S11A 4D9LL 3BYYA 1NDMA 1KYOJ 4JFXB 2VISA 1E5BA 3MGOB 4QXUL 4WW2A 3NQIA 1BZEA 2OP4H 3BN9C 3KJ6L 2QDWA 1RXLA 3VGAC 3WUWA 1KCRL 2PYEE 1EERB 4UBDC 3L16A 4HCRL 5AENA 5IJKA 2ESVB 3KGSA 4LOUC 5KW9L 1NCJA 3B9KA 3BE1L 2IPTH 4M8QA 2DQMA 2P8MA 2FR4B 2CA3A 3O9WB 1ROCA 5CR1A 1XF1A 4LCUB 2X0WA 1DCLA 3BGMA 3MV9B 5AW4B 5LJYH 5IW1B 2GSIB 4M8UA 3FK3A 1FORH 4G2AA 4FXGB 4XPBL 3RU8H 1NCBL 4IRZA 1Q0EA 2CK2A 4JM2A 1G6VK 5T5NG 5A2BA 4YR6A 1CBVH 4HH9A 2NCEA 4FE9A 4XMLH 4UUJA 1PSKH 1QQDA 4JFZH 3BAYA 1AR2A 5I1HH 2AXGA 3C09B 1HJBC 2NPLX 5DJCA 3GSUB 5E8DH 2P5WB 1KELH 3RY5A 4GJTB 3BD5A 4K3EL 3B8SA 1ZANH 2FJHA 5ESQA 5EU5B 5H4ZA 1BXUA 1X4ZA 1CLOH 2VR7A 5FPIA 3NT0A 1CE6A 2XN0A 3QDGA 4IGBC 3ZBMA 4X0KA 5GSRB 4WFHE 1IKFH 4H26A 5CEZE 3ARDD 4YZFF 1NCGA 3D2UB 2QKIC 4FXLA 4O2CA 4QHKJ 4XWOD 4Y9BA 1BQUA 4AE1A 1F3DJ 3MUHL 1LEKB 2ZOLA 3FB5B 1LXMA 1OAYL 2CJUH 1J88A 2BWDA 2EEXA 2WQVA 4M6OL 3QIWA 1EWHA 1D5RA 1USZA 4IRJC 3BLBA 1CL7I 1LO2H 1S9YA 4WSGA 3BIKB 5FYKE 4Z7NF 1DQLL 1J8HB 1NOFA 4GRLB 1MJ7H 4RDQG 1D5IL 4KX8A 1CTMA 2MOVA 2OTWB 1A6VH 3BUTA 2OP4L 1JK8A 1T1YB 1NZRA 3SQBB 5E1HB 1ZK5A 5CFHA 4X7SH 1NCUA 5KYYA 1GIGH 1DVFC 3BLPX 3NPSB 4CN1A 1CJYA 1WAAA 1KF9B 1CK0H 1TZ8A 2OMBA 2IPTL 1LO5A 4GI9A 1N6UA 5AVUB 3RY4A 2LE9A 1XGYH 5LGYA 4PRAB 2BSDA 5DJ8A 1CF1A 4FI8A 4JGUA 1ZHKB 3BD4A 3LSOA 5CU9A 5IHZA 3UTTE 1IE5A 4J3OC 3VFOB 1OAQH 3RKPA 3MGTA 1HNGA 1QYGH 1FORL 3QORC 4PJIB 4CADA 3BVNB 1T5KA 2F7RA 2QTVA 1PIGA 3H3PH 4IK7A 3IJ7A 5ESAA 3BPOC 5HYIA 1CBVL 4OIIH 3QEQA 3BLKA 1KCLA 3QEHB 4NNXA 5CLXA 4XMLL 1AKPA 3LH2L 1KB5H 1PSKL 2WBXA 4JFZL 4MYWB 6PAZA 5I1HL 3DETD 3D06A 4CVWA 2JI2A 3L3HA 3BWZA 3IGUA 1VKXA 5E8DL 4Z7UA 1KGXA 4D9RE 1BFOA 4M3KB 5FA3B 3SYPA 1V10A 2Q5BA 3H9SB 1ZANL 4K5NA 1UEMA 5AW1B 4FG6D 5D93C 5F88B 1MWAB 5B8CB 2VDPB 3AS2A 2FWOA 3TNMB 3QWRA 3KGUA 2WP3T 1ZDQA 2DRUA 3U6XS 3JV0A 4JFVA 3PU7A 4WFGE 4L3ED 5I8KH 1LMIA 3O6MH 3ECBB 1D2OA 3N2JA 3ZOAA 1ZGLM 2XWBA 2FQEA 5BMFH 2CJUL 2JLPA 1ZLDA 1GGTA 4B7LA 4ODUA 1QRNB 2F1AA 1LO2L 3AQYA 3WTVA 4G9DB 5I71B 4N68A 4LDLB 1JPTL 4NQCD 4X5XB 5EN2B 3WBDA 3GB7A 4JZNA 5CM1A 1U8OA 4P2AA 1TO4A 4I2XB 4POZC 1GIGL 3VMOA 1RK0B 2XTJD 1R3LB 4J5VA 1GCYA 2AMGA 3T2OA 3DARA 5E1IA 1CK0L 3S36X 4EN3C 4O58H 4RQQB 3RY6C 2EJ1A 4A7UA 4RA3A 3QQ3A 1I3GH 2WVVB 4KXBA 1OB1B 3EOAB 2LU3A 3UMNA 5AD0A 1PQZB 4UM9B 2HT4D 3PWUB 2UZPA 3SDCB 1XF5A 1OAQL 1TCMA 3QDAA 1QYGL 1PZ2A 2YGNA 2APSA 4DQOH 3T0AA 2WXMA 1EEYB 2JKWA 2ZP0T 4OKVA 2DQDH 3CHQA 4MJIE 1DJZA 1MZZA 1S3KH 3SBPA 3H3PL 1HS6A 2DV6A 2H6PB 2EO1A 4QTIL 4RMTA 3GPSA 1KB5L 4E2OA 4Q9CA 5JORA 5IVXE 2A38A 3VXNB 3F5WA 1ADQH 3D34A 2YAPA 1A6AA 4YH6A 2X12A 5F9DC 4RFEB 2X4OB 3FO1A 4YXLH 3CLFH 4NP9A 5D1XE 1QP1A 2A9ML 5LBSH 1FP5A 3ARZA 4KXAA 2B2XL 1QG3A 3KWUA 2CO4A 4ZS7H 4PSPA 3HUJA 3F8UB 3UTSA 4HWEH 5I8KL 5EWIH 1X7SA 4PGEB 5LVEA 1ZGLA 3O6ML 3T6QC 1MCLA 2W92A 2NW3A 2GJZB 1OW0C 4FS0A 4U2ZA 3X3FH 5BMFL 3KW8A 5KSAB 1G6RL 1JRHH 3BWSA 1OCWH 3KWVA 1KXTB 4V1DA 3B7UX 3D39E 5D1QC 3FU7B 2NNFA 3IN0A 3ZDYF 2AJXH 2PP8A 4AIEA 2WO3B 1EV2E 3CFTA 3CWGA 3ULUC 3FCGA 1MPAH 2CIIB 4QRTA 3T1FA 5I76A 2WJ5A 3RX7A 3W0WB 3FFCD 3F7PC 3D0LA 3QJFA 1PZCA 3QUML 1AS8A 5IW6B 5AW5B 2A3TA 2NRDA 2B20A 2C4FT 3V5HB 1C08B 1XGTA 3ZL2A 2VDOH 1DJXA 4GUCA 1R3HA 1ZE3H 3SGJC 2JB5L 4O58L 4D0DB 4UDTB 4DN4L 4HG4K 2WXGA 3OKKB 3QJXA 3OWRA 3W39B 1GYCA 5C07E 4FRWA 2VMJA 1I3GL 5F3BB 2BY2A 4HW6A 4D2NA 1WS8A 2X42A 3TONA 5EO1A 1P0SE 3TEZA 1BOYA 1C16A 3P0YH 3RDTD 3L8QA 2H8PA 2GT9B 5GRJL 4U1LB 1S3KL 4Y5YB 1PG7W 5CEYB 4CVZA 5ADOL 2RB8A 4FQHA 4QUOA 2OMTA 5EC1A 1Z5HA 4G6AC 4PVNA 3GMOA 1JCVA 1YEDB 4H0GA 1JHKH 5K33A 4NO2B 5JUEH 1I1FA 3KW7A 3S2CA 3X1NA 4HOMA 2BZCA 4XHJD 4ZMZA 5KJRL 5IWLA 1I7RB 1KPUB 2NY5H 4YXLL 5MEND 5KVFH 4MKTA 1T1XA 3QHTC 5LBSL 3UAJC 2NY6C 1K9TA 1E4XH 3C6SB 1JV5B 2YFOA 3S3BB 4JDEA 5D7LA 4HWEL 2HTKD 3E1ZA 5EWIL 2VABB 3OTTA 2HZHA 1YYML 2Q3AA 4JFFB 2DL2A 1OCWL 2W65B 5FO7A 4DUVA 3ORJA 3Q8BA 4WSJA 4Y2OB 4G1MB 4JL2A 4XH2A 5DJAB 3QRGL 4PJGA 4CJ1A 4ZSOE 5A43C 4GAGH 3FQTA 1VFAB 1MPAL 4A66A 2CDGA 4FYTA 1SLUA 5T5FA 1U3JA 1D5MA 4J3SA 1VEMA 1MCIA 1TJIH 2VKXA 1J5IA 5CF3A 4OGXL 4YHKH 3HS8A 3EADA 2VDOL 4L0ZA 2JCCE 3WUWG 2IVFC 4P5TB 2H1PH 1RSYA 3RL1B 3KLDA 1G4MA 1F58H 1FVDA 4AKQA 4JFHE 4Y1AD 1BOGA 5D71H 1ZLWK 3RKDC 3MA9H 5T3XH 4BUGA 3EGXB 3DA0A 4N2KA 2HMIC 2HKFH 3PQYA 3BW9B 4OZFH 5E8EA 4YOKA 3LKNA 4GI6A 4TTDD 5C8JB 3U1SH 4PG2C 1WEJH 4MAYA 3IDYB 3P73A 4CRPA 4MHHI 4QXWA 4I0PB 4KRPC 4UTBL 2XBTA 3EH2A 1KTKE 3QZPA 1C8PA 3TIEA 3LHPL 4IRSC 1MHPH 1JHKL 4PHZA 4HALA 2O61B 3SSGA 5DHEA 2MCMA 1D2PA 2VLRD 4AH2B 3GJFH 43CAA 1HOCB 1T83C 2NY5L 3UTTB 3IXTA 2XWEA 1SLWA 3GUFA 5GS2D 1E4XL 5JHDB 2UVFA 3VFPA 1K3ZA 3DX9A 3BQUD 1F86A 3DUSA 4QR7A 1OP5K 3ROOB 3FO2A 1N3NA 1EH9A 1I3VA 1Y6KR 1T0OA 1X6LA 3GSWA 3L7EA 4LLVB 4LL4A 5CGMA 4DO6A 3LV3B 3MXWH 2JFCA 2WO2B 2XVGA 5C92A 1G9HA 4OFPA 5HHMD 4NS0A 5BOJA 2ZX9A 1WPCA 3H4HA 4QDGA 3T0ED 1LP9A 4GAGL 3QUZD 1P6WA 3WL9B 2FX9H 3QIBD 4JFQA 4BUHA 1KIRB 4LEBA 2N0MA 2OR7A 1KCSL 4Y16C 4ZQKB 2DQFB 3OKLB 3QH3A 3L5WA 4NUJA 3WCYA 1TJIL 1XAKA 3DUUB 2R56H 4JQVC 1E9OA 4YHKL 5FUOH 2VN4A 2Z34A 3MU3A 4QRBA 2XWDA 3ARBB 5C97A 1KT2A 3RWHB 3ATEA 2VLJA 4UAOC 1F58L 1G1OA 4W1TA 2Y7NA 2LTQC 5D71L 1GZPA 4JHWH 4OAWA 3NRFA 4IEFA 5T3XL 5G4OA 2HKFL 1EHNA 2XU9A 3MQIA 2W60A 1T2JA 3FF7A 3GMPB 3U82B 3IBOA 4AYBA 5IMOB 1WEJL 3C2SA 2F53D 4V2CB 5E8NB 4KFMA 4X6DE 3ASNB 5HDLA 1VERA 4P59L 3P3UA 4X9HA 4ZNEA 4P4RA 4OIAA 4YXHL 1WBZB 4Y1TA 1SLXA 2QADD 3WFHB 3ZMRA 3D18B 1P4LB 1HDMB 4HV8B 2FT8A 5I1LB 2VDMH 5HXMA 2BIMA 5EG6C 1S7VB 3ECVA 5INDA 1N10A 5CD3B 4CGTA 2EDHA 4AEEA 3FQ1A 4MD5A 2B4CC 3EO9L 1AR1C 3OJDB 4XR8C 5DK2A 3TOPA 5HHQB 4X6CE 2DLHA 2YR3A 4H8HA 4R96B 5HVFB 4MJIB 4JFEA 3QR1A 4H25A 1J5OH 2Z7ZA 4PRPB 2KPWA 3BP6A 2L0DA 2AVGA 4MB4A 5HHNB 2XQYK 4IDJH 2FL5A 3BC9A 4Y5VB 5IVXB 1MJJA 2F2HA 1PJWA 1NOLA 4K8RH 3MXWL 4Q97A 5JHBA 1AGFB 3M86A 3DBXB 2XKUA 1CT8A 4HUWB 2NX5E 4L2YA 2V2TB 4LMQE 3V4VH 5D1XB 1Y0LB 1FHNA 4NSKB 1R1CA 3ARGC 2FX9L 3NUKA 3N0PB 4PJ8C 3A4DA 1MFCH 3OBAA 4R97B 3RGVD 2WQWA 1OIOA 1F4HA 3B9EA 2W95A 1XXFC 3LPGA 4LHUB 1G0YR 4H20H 3CBJB 3FAWA 4M93C 3ZYOA 3OZLA 1OTTC 3ES6A 3HHRB 5ANMB 3FULA 5ELIA 1RUMH 4UQIM 4AYDC 1Z0NA 1T7ZA 4JHWL 2DMBA 4FKHA 5IJBC 4BWUA 1CDIA 2HX8A 1CGSH 4KK5C 3SPHA 4ORGA 4AEIH 3T3MF 3MBWB 4JVUA 3L5JA 5EORL 1AXIB 4W9KC 2W0FB 4ZXBC 2EE9A 2Q20A 3BAIA 4K73A 3WEXA 4J3WA 4A7TA 2DICA 1NCAL 5BUAA 3WFBL 4PJCE 5E4OA 1R5WA 3H0TB 4Z0XB 2J2ZB 4HFWB 4Q4IA 4YDKH 4S1RL 3HAEB 3UC0H 3OAWA 4W70A 2Y6TE 2DJUA 1TYJA 2VDML 3PHOB 4XP5L 2J71A 5JHMA 1LDPH 1E9PA 2CJTA 2EDYA 3W5NA 4S2SB 4OCLC 3SKMA 4F7CB 1AXTH 1IGCH 2XA3A 4E9QA 1UVQB 1TQSA 1KY6A 3FQUA 4K71B 4OZHA 3CFCH 1MI5D 3L2MA 5IBLD 1ZSDA 1K4DB 2J8UE 3TP4A 1J5OL 2ZUTA 1LEGA 2PXYD 4HFUH 3SDXB 4DSYA 4U7SA 5CSGA 1HKLL 4AQ1A 4R7VA 4CSPA 1S5HA 2JCCF 1NMCC 4OZGE 4X5LA 3WI9A 1FZKB 1FNHA 4IDJL 4JFOB 2ESVD 3TO4D 3MRCA 4K8RL 4KI5D 1G87A 1JCKA 5K9KA 5E8OB 2Y07L 3Q13A 2IMNA 3WNNA 35C8H 4U1HA 1BXVA 1FNSH 1KTLA 2VTFA 3AM8A 3BUBA 4NNPH 5JPNA 2IAMD 3MRJB 3MKKA 1ETZB 4YDZA 4HT1H 3OHXA 1ZS8A 4GXVH 2BCKB 1I9JH 1TZHA 3MRHA 1FDLH 4XO9A 1MLBB 3FT3A 2AV7B 1MFCL 1DBML 3PWPE 5LLIC 4PS8A 1WCBA 1M9SA 2DMKA 3LXAA 2FD6H 5HPMA 3S98A 4UIMA 1F2QA 1F41A 2C1PB 3VXSB 2Y7OA 2A9DA 3EBIA 5EO0B 5IMMB 1GMIA 4Y2DC 4ZMYA 4Y19E 4GG6E 2C9RA 3DJZA 4UT9A 3DRQA 5FF6B 4XNBA 3ZJAA 3D85B 1RUML 1PU0A 3R0NA 4LNRA 1O7SA 3NIFB 2PWHA 1ZSHA 2IANA 4MNGE 4HSAC 2JE8A 1QKZL 2AJZA 4Y5XB 2YA0A 2IH1B 1CF8H 2NSXA 2JJTA 5EU6D 4MBRA 5AW8B 3VWKD 2BVQB 4AV5A 3WEOA 2UWEE 3MBED 5DEFB 3IMSA 3MLVH 3KPRA 5B3JF 3L2NA 4LSPL 3SODB 2IDTA 4JRYD 3CVHB 2R15A 2HLEB 2QVKA 4PRNB 2PW1B 5INCA 4BFRA 5HDQH 1MW2A 3BP5B 3WNJA 1UZ8B 1BAWA 1AIZA 2Q7AA 5C0FB 4WWPA 4YDKL 4K94H 1T0NB 3AWEA 3CFEA 2VQTA 1YN7A 2ZOUA 3JTTA 3TBSA 5ITBH 1TEGA 1LDPL 3QWQB 2VC2H 3GTTA 5L4IA 3JYBA 4LSRH 1IGCL 1WISA 5CS7A 4ZBJA 5IJVB 4A63A 5DFTA 4ZUVB 5K9OB 2X4PB 3DXAE 3BSZH 3KL5A 5TE7H 4X9IA 2YRPA 5HGHA 2CCWA 3D50A 1DUZA 5HY9B 4DZBA 2W0KA 1AKJB 2WJ7A 1BFVH 5FLUA 5C7XH 1GOHA 3HPLB 1DL7L 4ZTPL 1A65A 1C12A 3CSBA 1X7QA 4JHVA 4NRXA 3TN0B 1RULH 5D7IE 3ZDWA 3E6FB 3A6BH 3BT0A 4NNPL 2H0JA 5HYJE 1BD2A 4PD4J 3OMIB 2E9GA 1L9PA 1FA4A 4HT1L 4NNYA 1TF4A 5J1AA 3QDJE 1FFPB 3QK0A 4XXDB 1GJIA 1I9JL 1KWKA 4AW4A 2XN9E 5GRZA 5EU7C 1V05A 2WKOF 4WI8A 5CJQH 3U7WL 5CIPB 1U9KA 4FQQA 2B39A 1ED3A 4F33B 5GZOD 2AEOA 3H8NA 2EACA 4LPVA 1XL6A 1I4FA 2EYTA 2J55A 3EJYD 4KHXL 4YNYB 3PNRB 3ZE2F 3DYPA 4DEWA 4ATTA 5C0DB 4XXWA 2XV2A 3ARFA 2LLNA 3APMA 3SKJH 1W91A 1CF8L 4JFTA 1A7RH 1JE6A 2HTLD 1RV6X 5KG9B 1P7QA 3L1GA 4GIAA 4GW1A 5AZ2H 4GT7A 2HYMA 4UOW1 3ZPDA 3DRTA 5D1QE 2OULB 5I1DA 4X4XA 4Y2NA 1GKOA 3SYOA 2AEQH 2OZ4H 4HAGA 5HDQL 2VW4A 4UU9B 1J9SA 1G7LA 1SQMA 3EGSA 2VDRL 4NERA 4UZSA 1ONQB 4XWGH 5CSZB 4Z0BL 4M4PA 4XHQA 5I1CH 4ZX6A 3S88L 3ULUE 1KBKA 2Y36H 4WK0B 5ITBL 4AZUA 5ENWB 3MV01 2VC2L 2HVKB 1EJFA 1VCAA 1JYVA 4LSRL 5C09E 4H88L 4WJG3 1YNTF 4LP4A 4ZYKA 2W9DH 3GQFA 1IM3B 4EOWH 5CZVL 3L9YA 4ESKA 2PNDA 3FQWB 4P2YA 1OLLA 4U1KB 3IE9A 1A6ZA 2F74A 5TE7L 2VH5L 3BSZL 4UILH 3RRQA 2XJLA 3IMWA 4X6DB 1OTUC 1T04B 1BFVL 2J1YA 5E03A 1F0LA 5C7XL 3B9DA 3WHE0 2IQ9H 3LQZB 1VADB 2VNCA 4IS6B 1XH3A 4LL9A 3FH7A 5F7EL 2E7HA 1RULL 2HCZX 5EC2B 3A6BL 1AY1H 4Z5RB 3VGAB 2VMDA 5LNGA 3PXJA 5DZOA 3M1CA 3VVWA 3QO0B 3AG4B 1FBIH 3U36A 4X6CB 4F7TA 5CGBA 5DZLA 5F89A 4WUUD 1DP0A 1YPZE 4S1QH 2Q8AH 4F9PA 2LW3A 3QAZC 2PYFA 4AKPA 3EH3B 4W9IC 4Y4KC 3QRBA 4PJCF 3VG0H 1L5GA 3ZLQC 1PZ5B 5FYJL 4PN6A 1WF5A 1EO8L 2E75C 5L2KE 4YWGH 4F8NA 1QTPA 15C8H 1T80A 4UAHA 5M7QA 4WFFD 3IM1A 4PJ9C 5K9JH 2X6AA 2NX5B 1RHFA 1S7QA 1B4LA 2H9GB 3IDJA 2CUMA 4C56D 4L18A 4FFZA 3U4AA 2L7JA 2QLVB 3V5DA 1J05A 1XX9C 1NPNA 3AS1A 1A7RL 3T77A 5D1ZA 1JN6A 3ASOB 5JIIA 1JBJA 2J8UF 4N8VB 1JGIA 2WQUA 3FHQA 4U4IA 1OM3L 5AZ2L 3IFPB 4NWTH 5TDNB 2I9LB 4TLKA 2J6EA 4TL5A 3GRWH 2OZ4L 4ZW3A 3GFUA 2AGJH 5EIVA 3C9NA 3T9WA 4L8CB 5I1CL 1HQ4B 1T21B 2Y36L 4MBOA 2K4AA 3BRFA 3QFJB 4IGBB 3HE7D 4OTXH 4B3VA 4H8WL 3V4LA 5DEZA 1AGBA 1MKFA 4NQXA 1NIBA 3KPSE 5FO2A 4BH8A 1XCWA 1UKTA 2W9DL 4JJ5B 5C0AD 3RUGB 3VFUB 1X44A 3CN3A 4EOWL 2NY5C 5E6ZA 1SJEA 4TYUA 4UILL 3SO5A 4GSUA 1N26A 3U0PB 1A1MA 4JPWH 3NABH 1NC2B 3E7JA 1TQVA 3VQLA 3I9PA 2Z31A 3K3QA 4H8PA 2IQ9L 2FZ3B 4IRJB 2WWKO 4GG6F 5F72S 1C1EL 4DVBB 1QI4A 2P7TB 3L4CA 4ZPTB 4ABQA 5HVHC 4L5FH 1ZIBA 4XPAH 4FEIA 4I18C 3VFGH 2UZYA 5J1TC 4JM0A 3GBEA 4XAKD 1JPSH 4ENED 2BZDA 1AY1L 1R3IL 3MJ9H 4ELKB 1DDHA 1OCRB 4AOFA 5TK4A 3V9FA 3ZKND 1GC1H 1BYPA 1DVFB 1FBIL 1JV2B 2R2EB 2VN6A 2FEEI 2UWEF 2UX6A 1IVTA 4P9HL 3NIGF 3KPTA 3WFEH 1D5ZA 2VITA 3TJHD 4BV1A 4G42A 4S1QL 1X5FA 2Q8AL 1P1ZB 4RMVA 3D5OF 4E5XA 5FUZL 2PYED 2AHIA 4OZGB 4UYQA 3VG0L 5F6HI 3T6ZA 3QHFL 5GGSB 1HEZB 4WZ9A 4Z7VE 4YWGL 3UBXA 3GINA 3MLTA 4DP6X 15C8L 1H6UA 3ABGA 1AZRA 2C34A 3CE1A 3NFPB 5FO8A 5K9JL 3VI3B 1MFAL 4IU3B 4YDJA 1S7UA 4QHNB 3LH8A 3VXUE 3GXPA 3BESR 5H2BB 1ZY9A 3NN8B 3O41B 4QRPE 4R2GB 1ZLUK 5GZNA 3UTQA 4DP8X 2F6AA 4Z95H 32C2A 1L0XA 2AEPH 3PWPB 2JWYA 4P2QA 4NWTL 1EDHA 1A14H 2B15A 2FWLB 5TH2A 1OSZA 4DO5A 2EUZA 2CDFA 2Z6FA 3NRPA 5T5FL 3ZT7A 1J1OL 2BSSB 4NQDA 5DJ2B 3LRSB 4Y19B 4XODA 4OSUH 1VFUA 5D7IF 1QBLH 1FN4A 3VD2A 4RAHA 4RGND 4GXFA 3BAXA 5IB1B 2UZXB 3L3DA 2QLYA 2EDRA 4MNGB 1FLRH 5L4JA 1FH2A 3MJ8A 4D0CA 4YDLC 3BPLB 2X6UA 1T03L 1W80A 1ULVA 1CO1A 1SXNA 4FYSA 4HGWB 4UV7H 2EH8L 4FZEH 4NENA 5ICXB 5GRXG 5KSUA 4RMUA 1IQDB 4WFHD 3DHMA 1RFDH 3Q5TA 5CEZD 2APFA 3NABL 4PLKC 1OAXH 4NPKA 1RJZB 5ERWB 2FUQA 3WTUA 4HCGA 2JKTM 4IDLA 3RZCD 3P3RA 2CBQA 2CKBB 1KLFB 3O81A 4KVNH 4XOEA 4XPAL 3WMSA 4NOFA 4W6XB 1XHHA 5LQBH 2BIOA 2VR9A 3UJIH 1JPSL 1I75A 3MJ9L 4DPAX 2NY0C 4M4RB 4XN5A 2H0FA 1BQRA 2P52A 1GC1L 1ZA6B 1N2RA 3ATBA 1GS6X 1C5CL 2NR6D 2C26A 3IGAB 5FYKD 1V55B 3MJ7B 3WFEL 4G6MH 3QZWA 4EN3B 3V0HA 2EE2A 4CVXB 1T22A 1IC1A 1KGYE 2FK9A 1WFUA 3EG9B 2NNAA 4NGHL 3WHXA 5CLTA 1PEWA 1Z0MA 3IN2A 3DX3A 3J27A 3MN8A 2QHRL 3S4SB 5HHOE 1SY6H 1EUTA 5ITFB 1JGVL 4YE0A 3MRBA 4CC1A 4HK3J 3BCDA 3VI4B 3LRHA 5DQDH 3TCLA 2WVSA 1HSBA 1MCOH 3QDJB 3BZ4A 5C08A 3UTTD 2ZICA 4BINA 4XMPH 1OAKH 4KJPD 5GS3A 1AQ8A 2XN9B 3K2UH 4Z95L 4FXKC 2AEPL 1YEIH 4U3SB 1WFOA 1H6TA 4G72B 3SDDD 1DLHB 3ILQC 3UCRA 3GSRB 1QNIA 4K5PA 3QULA 1KB9K 4WO4A 3RPBA 4XRCA 1PCXA 2UXGA 1OOWA 4PUBH 3X1EA 2A73A 4OSUL 3U2JA 2JH2A 4HU8A 3KPPA 3SEPA 4DGUA 5FAAA 2YKLH 2OI9C 1FLRL 2X53A 3VQ1C 1J0KA 3LNGA 1FZOA 5IJKC 5IFJA 2F53A 4KXZI 4PRDB 4ZODA 3B9KC 4YX2L 5E1QA 3NBNA 5DZAA 3BJ91 4UV7L 4FZEL 2YPKA 2JB6A 4BHUI 2E9WA 1RFDL 4WFGD 2ED6A 4R4BB 1N59B 2H2SC 5AWNL 2ZUSA 3QE5A 4BFIA 4O4YH 2G5BB 4DP1X 1BFTA 4KH2A 4KXDA 1G9MH 4KVNL 5KANG 3V0IA 1ZCRA 3DMMA 1ND0B 4KNSA 3ARBD 3VGGA 5LQBL 1ET5A 5IQ7H 4DPBX 2OSXA 4N2DA 5FECA 1GGIH 2I07B 4JM2C 4K8RC 1MUJB 5C09B 4DESA 5CUSL 4LLMA 4YHYC 3WXVH 4N87A 1B0RA 1HEHC 1UD3A 1OLZA 1AXSA 3B5GA 4G6ML 3UBFA 5HYSB 2FGZA 4KKBD 1H3TA 2IBBA 1EAPB 3ZIMA 1EZVX 2ZT9C 4M62H 1ORQB 4WW1A 5B1JC 3U0TA 3K1DA 3UL4A 5HPOA 3RJQB 4AQOA 3TJPA 3ARVA 3RBSA 4PB0H 3QJSB 1QWNA 2MQ3A 1PG7H 1HAWA 2VLME 3SGEI 5ID1B 4MRBA 5DQDL 3W38A 4N0FB 3TM6A 3VFVA 1MCOL 4HDIA 1ZWIB 3NYKA 3OF6A 4XMPL 1Y1DA 1F11A 5LN8A 1UT9A 3K2UL 3RVTD 3DSNB 3QUGA 5IB4B 4NN6C 2FO4A 1YPZB 1AO7D 1UB5A 3GXMA 3QIWC 2GK2A 4MJID 4A1RA 2WO4A 2BNUA 4PUBL 5GS1C 1F6FB 5L2KB 4PQXA 4Y9CA 3PUCA 2Q10A 3TURA 1CLZH 2BMKB 2NY6B 2BHFA 3G5ZA 3NP4A 5FCSH 3WV0A 1X5MA 1XO8A 1ZAGA 1TVBA 1NEZG 3FAXA 4I0CC 4U6YB 3ARXA 2Z91A 2J5LC 1NWPA 4G43A 5D1XD 5EH1A 2FJUB 1DUYB 3L6FA 2VLKE 1BJMA 5D70H 3BPCB 1G7IB 5F9JB 1HL5A 5JMRA 4XAWL 1Z6JT 2VR4A 3MUY1 3QNYB 1RVFH 2DYPA 5FM5M 1AIFA 4L4TA 4V33A 5HGDB 4Z7VF 5LXGH 5H4YA 3FW6A 2FBJH 3BYTA 2CO7B 3PHAA 1LEIA 3HI5H 4LHUD 5F7MC 4O02H 3OGCB 1DBBL 4B9CA 4D8PA 5B1KA 5C0CE 3UJJL 2YXWA 3CMGA 3D39D 1GGIL 2EDOA 3KPSB 4NQTA 1NDGA 1U8QB 3FQRB 4R26H 5B21A 2G9HB 2CO6B 4GKNA 3WXVL 3O4LE 5DHVB 5BUPA 1TQCB 2WKLA 1CC3A 3C5JA 2BS8A 4J3TA 4U3CA 4N25A 4TNWF 5AKSA 5DMGD 2YEZA 2E6PA 3RGBA 2BP8A 2E0PA 4NLAA 4XT1C 5EUOF 3TA3A 4KOCA 3B1UA 2QVIA 3VFWB 4E41B 1IZJA 4JY6A 4M62L 5DK0A 2O6EA 3O3AA 4PJHE 4MS8D 4YSDA 2NUPA 2OL3H 1M2OA 4L4VE 1CXKA 2XXMB 3MTXA 1V54B 3MX0A 4PB0L 4XNQB 4YHIA 5C07D 3WNPA 1QHQA 1PG7L 5AYUH 3RFZA 4OUUB 3WE6A 4KI1A 4PJAA 3TVMC 3FSOA 5KSVA 3VU2A 1MCWM 3IPEA 4G3YL 1QBMH 5BZWA 4KRPB 2QSCH 3I3BA 1EEQA 4HQQH 5FB8A 3B2MA 4FTVB 3W2DH 5BS0B 4PY7B 3V4PA 2J25A 4Q14A 4IRSB 4WU7B 5I8CB 1JF1B 3WN6A 3LCYA 4M6NH 2A9NH 1TTBA 5DZPA 2FHFA 4M5TA 5E6YA 4NZJA 5AVWB 5B38A 5BVPL 5DHYB 5HI3C 3PJSB 3PL6A 1XH0A 3PIQA 4P57B 4PVBA 1R24A 3WO3B 4Z7WE 4G8EA 3ZKMC 2WIIB 3FCSB 2QGCA 3VXUB 4R4FH 4AL8C 2OMWA 4HUXA 1LD9A 2DEYX 3QISA 4X8JB 2OJEB 5EU7E 4QRPB 4DPCX 3A21A 1NUGA 2BNQA 2FX7H 3QA3A 4P23D 3E8UL 3DDGA 5E2VH 1OGAB 2ITDA 4PJ7F 1XF3B 1IM9B 5D70L 3HI6L 4YHOL 5IB2B 2OW7A 3HFMH 4I5BB 2BO0A 1UQSA 4JLRA 5G4MA 1RVFL 4PV9A 3GHBL 3VFNB 4DTGH 1KV7A 2WYHA 3L4YA 4RVBA 2YSSB 3AC0A 2HPTA 4AVIA 3ZXAC 2FBJL 3BZFA 4GINA 3HI5L 4B41A 4N2HA 2CIKB 3CFKB 1JGLL 2N7SA 1ADWA 4Y16B 3DK0A 2X89A 3JV6A 3D85D 5T1MA 3NCCB 3DOIA 1A4CA 5BO1L 1C5DA 1VDGA 2BSTB 4H5SB 1XCTB 1KTDA 3MYJA 3BO8B 3FUKA 3AAZB 4OLEA 2IH3A 5GGQH 3EZJB 2JCWA 2VN5A 4B9IA 2FGWH 1KIUB 2LTQB 4N8CL 1GYUA 4ZFOL 1OWWA 1TVHB 4E5XG 1INDL 4ICWA 2OL3L 4HXAL 4IBQA 4PGDA 3QUYA 4BK5A 3GTNA 2KL6A 2K7QA 5EBWA 3BAJA 1SBBA 4K3DH 1IEBA 3QYNA 4JFHD 5JW4R 4DOHE 1WBXA 5A1AA 1JHTB 2NY1C 4MXQD 2GUOB 2YQ3A 3RWFA 4X4YB 1U8LB 1QBML 3FH8A 2QSCL 1JFQH 4HQQL 4UQ2A 1TZIA 5D4HA 3VWJA 3W2DL 4X42A 5DRNA 5E9DE 3CSPA 2DEXX 4M6NL 1M7DA 4JRXB 1HQRB 4LLWA 2AQSA 3KMDA 3FT2B 1CXFA 3MOBH 5F7YC 5HHOB 1AKJD 1XQ4A 5KVMC 1AR1B 2JXMB 1K4CA 5JDSA 4OZIE 3HKZA 5EOCJ 3SJVA 4FC3E 1XGQA 4Z7OB 4HGKC 1F8TH 1TMCB 4WGWB 5E00A 5LGJB 4OF3A 1IKNA 1PDKB 1FHGA 1A5FL 4H8WC 1FVCA 5DZJA 7TAAA 5DJ6A 2V0AA 4R7DB 4K9JA 1RJYA 3I3DA 4RX4A 1W6WA 4Z18A 2SEBB 4K2UH 1ODAA 2R4SH 5BRZE 4ODXA 2A0LC 2GITB 1Z9LA 5KUMA 3ARGB 2B59B 3ETSA 2NXZD 3BCFA 3B4NA 4PRHE 1UOWA 5E9NA 3S5LG 5DFVD 3FO9B 3Q8EA 2VN7A 3E0GA 3F7YB 2DQHH 4G8IB 3PGCA 5TPWH 5GGVH 4M93B 4DCQA 2FGWL 2K45A 5F7LB 3SZKC 2NY4B 1AHKA 5IG7B 4P9HC 3O8XB 1Z9MA 3HZYA 5IWLC 2JNZA 2DWTA 2WAQA 4WNQA 5C0ND 1OGTA 4L2LA 5E2TH 5JPMA 3HA0A 5E8PA 1XIWB 4NOBA 4WFED 4B96A 5I5MA 1CXIA 3CPLB 4FZ8H 3VRIB 3G6AB 4KDVA 5KYNA 4ZXBB 4K3DL 2IWFA 3L3KA 1MHEA 1VACA 2A99A 4JAMB 5H35B 5EOTA 1XVSA 3EFFB 5CN1A 1ZGLP 2ZXCA 1JFQL 3BVTA 5D7HA 4GRMB 1GYWA 1O6VA 5FIEA 4BIKA 4J3BA 1OGSA 2Y72A 1PY0A 4EI0A 4R5XA 3V0FA 3OAYH 1QSFA 3KDMA 3V52H 1LDSA 4AENB 1LWRA 2FH6A 3OKOB 4GW4B 2HVJA 3SY0B 4A6YA 1Q72H 2PR4H 1Z5LA 3S3CB 1CPUA 3DVGA 4LOVA 3CZEA 3FL7A 3RGHA 2AJYL 5FCUH 5DMKA 5FV1L 5BZDA 4Z78A 1CIUA 3G6JF 1DVSA 1S7RA 3T4AB 3MMEA 2Q6WA 5DO8A 2EDLA 1M7XA 2WXPA 5FUCC 3BN9D 1T5WB 1ZT1A 1NMCB 4UBDD 3FT1A 2R29H 4LKCA 3QFGA 3ILPA 4FFZL 1MLCA 1MW0A 4LOUD 4JREC 4WI0A 4APQB 1U58A 5TD4A 4N9GB 1JYNA 1Q90A 4K2UL 4GXUM 4H2AA 1A7NH 4GG8A 2R4SL 4BXVA 4PJHF 1XSJA 1U3HC 1QVOB 2VRQA 3N1FC 3HB3B 3LKRA 4IU2B 2YRBA 5I5IA 4TQHA 1O7DC 1HE7A 4AYSA 2R4RL 1MCRA 3EZ8A 3GS4A 3O3EB 1OL0A 4AXWA 5T3XE 1DVQA 3M8OL 4MAYC 1JZ5A 1AZBA 1UKQA 5GIRB 3MA7B 1QACA 1JGUH 2CDEB 3MCYA 3PWJB 3WJMB 1MW1A 1ZK9A 2DQHL 3VSVA 1H9VA 4I77H 5TE6H 1YDPB 2VLKB 5DT1L 5IEKA 1CYWA 5TPWL 4Z3EA 2V4LA 5JW5B 4UINL 1FNGB 2ADGB 3HRZB 1SNRA 1JGEB 1CFBA 1SPDA 4X7DC 3VNZA 3L81A 4YDIL 3RWGB 4HKJB 1A7PH 1SEQL 2Z1PA 4B9ZA 5E2TL 4JO4H 1I3RA 1DO6A 5GGRB 2R1WB 3TEWA 2GSMB 1QFWI 2BNRD 3QSKB 4FZ8L 2HFGL 2X1XR 3W3BA 1L7TH 4IGBD 1DQQA 4UTAH 1MFEH 5D6CB 1HXYB 1RZ8B 3R8QA 3KBFA 3S96A 4FEMA 4H0IA 3JTSB 2WV3A 3Q8AA 1UXWB 5GS2H 5HGBA 3MNMA 1R75A 2ENPA 1RP8A 4Y88A 1AMYA 2ZCLH 1ZLWH 1P7KB 4BWTA 4MCMA 4ZQTA 1Z2KA 4ZX4A 4HHAB 2FEDC 1KB5B 3RX9A 1NC4A 1CLVA 3L3JA 4QHMB 4Z3JA 1QEWB 4HCFA 5DS1A 2WMPB 1NFIB 3UADA 5C0GB 2PR4L 1PZBA 2VMCA 4WTQA 4CKVX 3FONA 1ID2A 4LGSB 4ZMAT 5FCUL 2EIZB 5IHHA 4Z7IA 5ACLA 2XQYG 5A2JH 4YO0A 1ECYA 1JPFB 5DTFA 4JANB 1U8IA 4LLQB 5BJTA 2ZWSA 3A24A 1KJVA 4RDQF 3V79C 2G75B 4I48B 3TNNB 4JVWA 3WIFB 4FFVC 4HS3B 2DWXA 4PWKA 1DVFD 1EPFA 1NPJA 2QSVA 1L9MA 2ICWA 5SWZA 2OTUB 4JY4B 4OJAA 2QQNH 4UM8A 1BX2B 2F5AH 4TNFA 4AT6A 5I1IL 2EUXA 5GSVB 2EICA 4TKWA 2WLJA 3TZVD 1WE5A 2KLRA 1A7NL 2ZX6A 4QJ3B 4WDIA 4D0BB 1G6RB 3HC0B 2IV8A 3L5HA 5EBLB 2Y0SA 2Q87A 1ZLVK 1Q0XH 2DDQH 3BXNB 5EOQH 1OP5H 4Z7WB 5IMKB 2WBWB 4J3OD 4CMMB 5ADPH 3ULSB 5DJXB 1BLIA 1K72A 2OMVA 3WG7B 2DBLL 3QORD 1KLGB 4XNZC 5T1LA 1UOLA 1JGUL 4Y9GA 3KPOA 1GA2A 3CTTA 4I77L 2PABA 1DSFH 3QUMB 1B4JL 4C54A 1NUDA 3L4WA 1PKQA 1QFPA 3QS3A 4AYFB 3HN8A 5IMLB 4R90H 4PJDE 4LXFA 2C7UA 1TQUA 3TPKA 5MEPA 1AZZC 3CMOH 1FL5B 3E3QC 2JLLA 5DGQA 1A7PL 2PUQT 1AQDB 4NQEE 5D8JH 1HAUA 2DQUL 3K0YA 5CU5A 4MDJA 1X3DA 4Y19D 5FYJU 3NJFA 2G2RA 1XMEB 2BSEA 2NY7H 3RE0A 2P42B 5HBBA 3PDDA 5EZOL 3I84A 1L7TL 2OKMA 4L8BB 2DF3A 4F7MB 4AQ8A 2FH8A 4GBXB 1MFEL 1U8PA 2ARJA 2E9BA 5ID0A 3CFIC 3FB6B 1VHPA 3SPIA 3VQ2C 4GXUN 3EYFA 1RK1B 3LRLA 2XWRA 3ZTNL 3PHQA 3HPJB 5T1KB 5IOPB 4R3SA 4M7JH 2MIZA 1KV3A 4QCIA 3HMWH 1D7BA 4AIZA 3AT9A 2YQ2A 2ATKA 5HDWA 4H44C 4LARL 4YLCA 4TSAL 1BWMA 4QO1B 3SDYH 2QJDA 1AANA 1ZA3B 4AE0A 3QO1A 3V4UH 5I23A 5KVEH 1EAOA 4L9DA 3WKYA 1A3LL 1BREA 4GO9A 2L8AA 1YEEH 2CHNA 5C7ZA 4D8OA 4NKMA 2OX5A 3NZHH 1NCNA 1KYUA 1OVZA 3KYMA 3OX8A 4P5MB 2NSQA 1C8QA 4PLOB 4POZD 4IHBA 1QW9A 4S1SL 1EBPA 5KS9B 1A8ZA 1FAKT 1H0DB 1L9TA 1K5WA 2QQNL 3C8KB 2C4XA 2F5AL 1KIPA 3IF1A 2F7PA 3DXAD 3VQMA 4EN3D 4X9FA 3QDGE 4Y2LA 1PX4A 3KG5A 4HAFA 1IUZA 1GYVA 2DLIA 1KCKA 4PGBA 4YDMA 1Q0XL 2DDQL 5E7BA 5EOQL 5EN3A 5F7WC 3C60A 4OZIB 3B3IB 3VXQA 5ADPL 1QFUH 5FO9A 4G8GE 3FZUC 4DIXA 1RJCA 1AHMA 2IH8A 3QAZB 4XO3A 4ZAKB 1WFIA 5SWQA 4G9FA 5L2JB 3WTXA 1AD0A 5HYJD 3QXAA 2R0KL 1YN6A 3FTGB 4M00A 1M2VA 1UM4H 3VXOA 3F7QA 4JO2H 4YFLI 1FL3A 5CZXC 1CFQB 4PG9B 4XZUA 3T71A 3NTCH 3AABA 5C0BD 2CGZA 1A3QA 2VDOB 4UYPA 3PDGA 3CMOL 1J8KA 4M29A 4M56A 1HN1A 2N7BA 3FNKA 5B7FA 25C8L 3MNZA 3QUKA 1B3IA 2AXHA 5D1ZI 5I16A 2HSIA 1UJ3B 4K5MA 1JZGA 1WAAE 1TTUA 4HPYH 1ZV2A 2NY7L 5F1IA 1PZAA 4A04A 3P40A 3P4MB 3U4BH 1KCWA 1SLVA 4X8GA 2V7HB 4AQ1C 1CVSC 3ME0A 1MY7A 1GKEA 2E47A 3PGDA 5FM5O 8CGTA 5J6HA 4N5UA 1DBKL 1OK8A 3SOBH 3VTMA 2V5SA 4M7JL 4JO5A 3BDYL 5SWSA 4BZ2H 4MQXC 4TNVK 3R19A 1M71A 1IC4H 3HMWL 2BOBA 1GZHA 2XWCA 4FJ6A 3SPVB 3QUXA 5D1QD 3ZHKA 3AM8C 2IPKA 1BEYL 3D9AH 3GBLA 5JPNC 4L37B 5AKVA 1GYAA 1T7YA 1PY9A 4WV1C 1O6SA 2LAGB 1OGPA 1T4WA 3OHXC 4NZFA 1Y18A 3QEQE 2JVUA 4M9PA 3ULUD 2MQ0A 2MEJB 4WK4B 3V4UL 5KVEL 1OXYA 4X7TB 4NZDA 1P5UA 4PWJA 3IGFA 4CU6A 1IL1A 1FFOB 1AMXA 1HHHB 3B2XA 3BVUA 3KH3A 4HBCH 4Z7UE 5TDPA 1S7WB 4KO7A 3NZHL 2CD0A 4AJWA 5B7MA 1BGXH 3DV4B 2AI0H 2KH2B 4JCWA 3QP3A 4XGZB 2J5WA 3KLKA 4JB9H 1RL1A 3BH8A 3C5ZA 4M8RA 3SKOB 5HVHB 1TT6A 1L4IA 3MRMB 2IG2H 2B77A 2GSGB 3OR6B 1D5BA 4HUMB 5EUKA 5CHNA 3JBG7 2EXYC 2AJ3A 2G0LA 1SVBA 2JJTC 3MR9A 5ABZA 1YMMB 2OMZA 1R4XA 3HC4H 2FX8H 2WLHA 3LXCA 2ISDA 1GL4B 2OYLA 1Q9OA 1ZT7B 5H94A 5CEXA 1W15A 2ZAHA 2DEWX 5E4EC 2RH0A 5DUPH 2C9UA 4NJ9H 4Q2ZA 5GJTH 3MCKA 1U95A 1NLBH 3UBXI 4JO2L 1FE8L 4ELMA 1WWBX 1WCQA 1HCVA 5FK9A 2F1EA 4MSWB 1N64L 1EJ8A 2WWMC 4G6AD 4JZOA 4KQ4H 5ACZB 4WF7A 4N3TA 1MVFA 1FG2B 3VH8A 1MCDA 4WIQA 2AQQA 3OR7B 4P2RA 4MA1C 4RA0C 4HPYL 3S35H 5GS0C 5FOBA 5B3NA 4GKOA 3NJXA 3UAJD 2YPLE 4OI9A 1U33A 3KWWB 1T20B 3U4BL 3WS3A 3ZTCC 3MFFA 4HJUA 4LCYB 1A3ZA 1IBHA 2I5YL 1YNKH 3DETC 1TTFA 4OZFB 4HIHB 1E6JL 1IVLA 1X5HA 1AC6A 2JKIS 4B0MB 3MNWA 2VL5A 3QZOA 3HJEA 2LAAA 1HXMA 3SOBL 3CVBA 1JRHI 3NA4A 2YWZA 4OUOA 4TULH 2IF7A 3V7MA 2BJMH 3ZZLA 2XWTA 2GPZA 2ZNWA 2OMXA 3AJ7A 1SBSL 3RG1C 3R0MA 3D9AL 3U30C 1LVEA 1T7XA 1MDTA 3M1BB 3PUUA 1NJ9B 2E27H 2LV4A 4YDLB 1A7QH 5DK3A 4M61B 3WTSA 2JKRM 4EI5A 5ICZB 2W59A 2RR3A 2JV6A 3N91A 4HF5H 4ZUTB 2WNGA 4EQ2A 1JI1A 3KYAA 1I8MA 3EJUA 2CA4A 5EBMB 2PPDA 3TCTA 1XB3A 1S9WB 1BBJA 4HBCL 1RHHB 1B2YA 2X6BA 4FG4A 3KPSD 2AJUH 1BGXL 1U8JA 1R5IB 3DURA 2AI0L 1I7UA 1RZJC 3KS0H 3IJHA 4JY5L 4FQXA 2P80D 1EXGA 3VGHA 4A7SA 5DQ9B 1ZVSB 2JIXD 2IG2L 4WW2F 4X83A 1ORSA 1J9RA 3KXFB 2IPUK 1E9QA 5FYJE 3HUJE 4XXWC 3L4ZA 1DO5A 3ARFC 3UTSE 2NY0B 3CHSA 3FTWA 4LPWA 3BZEA 2CRYA 5ANHA 3D4YA 3HC4L 1RD6A 1WZKA 2XTJC 2Y1VA 3H9HB 4JJOA 4Q0XH 4U1GB 3GSXA 2HMID 3G04A 2UZIH 1OP3K 4V1DE 3HZKA 2ADIA 4L29B 5D7JA 5CJXA 2C3VA 2YGOA 4XC3L 5GJTL 1NLBL 5I1GL 3G08B 1WH0A 4TNWK 1A7OH 4OLVL 4KRPD 1D7FA 1MWAH 1WAPA 3LB6C 1JWMB 4B5EA 2VB5A 4KQ4L 1TG8A 1EZLA 4PRIB 5E6IA 5BRQA 3QQNA 1R3JB 5HYQA 2B5IC 3N41F 4MA3A 2CUAA 3CDYA 3BFOA 1UD5A 3RTQA 2IV9A 3I6GB 4OJEH 4N24A 4RCAA 1E4XI 2G3ZA 1Z9SA 3S35L 4FXKB 3VTAA 3HRPA 3CPUA 4LAQH 2Z0UA 4TUOA 1JF6A 3N3EA 1NGYA 3VXUD 2I25N 1NGPH 3FO0L 4L05A 3NACH 4GKSB 3RVUC 3U2SB 4ODSH 4I1PA 1TJXA 3BP7B 5B7EA 3U1QA 3HG3A 4KKZA 1A6UH 4PTUA 4N2FA 4PJDB 4TULL 2BJML 2WOBA 1BG1A 3TO2A 2VISB 1H5BB 2CHDA 1E5ZA 3UG3A 1EK3A 3K5RA 3WDIA 4ZDHB 3U9WA 3C8DA 4NQEB 2WCSA 4QYAA 2E27L 3NIDF 1MZYA 2VDMB 3TBTA 4UDUA 1XGUA 4KROB 1KWGA 4HF5L 2WK2A 4F9PC 3K8MA 4PJBE 4O2EB 3D1MC 1I8KA 4N2MA 4XPHH 1CFTA 1A21A 1G84A 2ZKXA 3VAEA 2WLMA 1BVZA 4XPFH 1HH9A 1NCTA 3NZ8A 3WNIA 2XZCH 4ZFZA 5I1EH 2UY6B 5D7LE 4WWKA 2ILLA 3V0AC 3MRFB 3QWNA 5IKCA 4WI6A 1WAAF 3HBGA 5A2FA 3RWCA 1WIUA 3WEMA 1S9VA 4UUJB 1MFDH 1MH5A 2J8OA 4Q0XL 3REVB 3ATAA 4P46A 4ZMWA 4P2OB 1ZTXH 4A6YH 3F85A 3FCTB 4EI6A 1KPRA 4XMTA 2YIHA 4JVPA 2H3NA 2E7BA 2I27N 4R7NB 4TUUA 4PJGE 2XNAA 1Q4NX 5FYLL 2FO1A 4ZOEA 1MVYA 5CINH 5F93C 4BFJA 2C3XA 2NMSA 3DNKA 4TSBH 5ALBL 4O2CB 5E2UL 4NKOA 4XBMA 1E30A 5FUCE 2MFNA 2KZBA 5GJSH 2WPGA 5IVOA 5HHOD 2OSWA 1KLUA 2ZXWB 3HZMA 2ZXEB 4G8GB 2YBRB 5TDOA 1CZ8H 3FQNA 4NN6B 4DGVH 3B8YA 2YRLA 5GGUA 3QIWB 1S7SA 4X9YA 3UPRB 5IR1A 1SEBA 1NGPL 1HHIA 4MLIA 2Z31C 4NZUL 4EIBA 4NWUH 1QI5A 5GS1B 4ODSL 1VFOA 2ICEA 1O7DE 3CV5A 3PQYE 5HDRA 2WWNA 2EIEA 4BKLA 2F58H 5I9QB 3LIZA 3S48A 1B2WL 5KYYB 1DJWA 3UZEA 4EVNB 2OR9H 4N6RB 3QG7H 4PJFE 5F0JB 5IQ9A 4L1TA 3HLAA 1MXGA 4JG1L 3QFDB 3ARGD 3CFNA 1OANA 3CUPA 3RWIB 5IFHH 4ZS6C 2DTMH 4PBVC 5EV7A 4PJ8D 1HU8A 5I2IA 4ZW5A 1FZJB 4W9DC 1XF2A 2E3VA 3NA9H 4XPFL 1WTLA 4F2FA 3VDBA 3MGTB 2DM3A 2EEFA 3OKDA 2XZCL 3JVGC 4GI8A 5I1EL 1U4FA 3O6FA 1OTTD 1CGUA 2YBGA 1YNLH 1F4WH 3TYFA 2P8PB 3GLZA 2XKSA 3QI9A 1HWGB 5L9DH 5ESAB 4OLWH 1DTUA 4CN6A 4BDVB 3OSVA 5GZNC 3FB7B 4AQAB 2Z7UA 3LKSA 1NLDH 5KAQF 2DQ6A 4KK9C 3L1EA 4KK5D 4URKA 3BWUF 5EA0L 1MCKA 4L1LA 4A6YL 3IGKA 1RZFH 1R46A 3L3HB 1FC2D 5DZNA 2AK4A 4ICXA 1UZ6F 4KZEH 4XNUL 4Z7UB 4ZXBD 1UENA 1U3NA 2DKSA 1E90A 3AS0A 3KYNA 4JPIA 5I8EB 2ZUQC 1YY8A 1ES0A 3NJIA 3IAGC 3MV7B 2FWOB 5F7FA 1DBJH 1FUNA 1FG9C 5CINL 3JWOL 5K39A 4PREA 5BV7C 1AACA 2YOCA 3IDGB 3QXVA 4JS7A 2CM6A 3VFSA 3TVMB 3WO4C 5DRXA 3LS5H 4XVOA 3QNZB 4NBZB 4BELD 1JIBA 3CK0H 4N2NA 2K78A 3REWA 1CZ8L 4DGVL 4CA4A 3VXMA 2K6YA 5DVOA 2NQ3A 1PIFA 4WHYG 5DVLA 4F9LA 1YNTA 3IDXH 1V5JA 5E51A 2P47B 3EFOA 3IJSA 3SDAA 5L0QC 2B14A 2D31B 4NHUA 4QRSB 4NWUL 1SOQA 3CX2A 3GSVB 2VUOA 3MUGA 3SBWA 1I1YA 3ASWA 4MD0A 3WFCH 3HUJF 1F4YH 1PLGL 2GY7B 4HBQA 2VDRB 5FGBA 4HLEA 3GM8A 5CEZH 1N5AA 2F68X 3BQUC 4HS6A 1NGQH 1NANI 2OR9L 3QG7L 2PO6A 4PJ5D 2HFTA 2VC2B 3SBQA 1WYJA 2FJGA 2NW2B 4U1MA 5DZVA 2XWJB 1BVLA 2YPLB 3VFRA 3AG3B 3BKCL 3ZE0B 3EDKA 1K5NB 1UWEL 5DD0L 2WAHA 4KV5E 5GGVY 4CSSA 4YAQA 2I24N 5AD0B 2N7AA 3QIUB 3E3QE 5D2LF 1U8MA 1XF5B 2Z93B 5FYKH 2DLGA 1VA9A 2Y9RT 2X3CA 3NA9L 4JMXA 3W9EA 1GS7A 4Y2DD 3HG1A 4AQEB 1BMGA 4H4NA 5CBAB 3GDCA 4BD4A 4UOZA 4JFEE 5EEXA 3VRJB 1KJMA 2UXFA 3KPMA 1R5VA 3JVFC 4M3JA 4ODHH 4OH2A 4NRZA 5L9DL 1JWSA 3GBNH 1ZRUA 1NLDL 2RQEA 2IOOA 2BVTA 4Z76A 2MNJB 1PLAA 1MVUA 3S3PA 2X70A 3QDMA 1RZFL 1ZEAH 2NDFA 3STZB 5C0CD 5K69A 4XBGA 1DQVA 2LR4A 3QZBA 4KZEL 1LGVA 5CJOH 1A6AB 4WO4C 2VR8A 4X5WB 4F27A 2A9CA 5HJGA 1OP9A 3OXRB 3P54A 3O4LD 4B9KC 2GJ6E 5I19H 2G60L 5FDWA 1F3DH 3K80A 1ETB1 3WKMH 2P5EE 3K72A 3O2WH 4N2AA 2ZD0A 1MY5A 3CNKA 3H7BB 2NY1B 3S34L 3I75A 3GGWA 5D9SA 2R0ZL 4KNUA 4HJGB 5JIHA 3VH8G 2VN3A 4L4VD 1RLBA 2IADA 4NO5B 1JXJA 1QTYT 2KZ1B 4ZOCA 4BE5A 3OMZA 2H7WA 3UMTA 2ZSVA 4OLXH 3K2KA 1OY3B 5FM4A 5JO5A 3HKFA 4B3EA 5C1MB 5E0QA 1B9ZA 3QEUA 1MG2C 3DMMC 4BSWA 1HKFA 2G4GA 4QRTB 5HDBB 4FDWA 2VQ4A 5DD5L 1J9QA 4NQSA 4OCXH 1JSYA 4PJXE 5HHVH 1F1DA 4AEHH 1OEZW 1RH8A 5J9PA 3RL2A 5E94A 3EFDH 4QOKB 1JZ6A 1XGTB 4IM8A 1CICB 5EDXA 1R3HB 3T8MA 5KUKA 1U6AL 3R06B 4HJIA 1S6NA 1T1ZA 2MH4A 5ICYA 3N55A 3UZQA 1F6LL 4WHYH 3IJ8A 1CLCA 2NY3B 1A6WH 3VX0A 5C0IA 1SF5A 2WZPD 1T2QH 4R0LA 3UBGA 4ALAH 5FYKL 1FI8C 2X4NB 2EDMA 2JELH 4HX1B 4RZCB 5EO1B 3WNOA 4OZHE 1NBZA 3HBZA 1DEDA 1I8UA 4FYQA 4QNPE 1L6ZA 1JVOA 1K2DA 2VE6B 3BUPA 4GNKB 2H8PB 3MRPA 4B7IA 2XX0A 4PAZA 1CXLA 4PRBA 2DQIH 5C6WH 3GBNL 2PTUA 4AI7A 8PAZA 2X4UA 3N5AA 4U4BA 3GMOB 3FRPG 5AFAA 3KLAB 3EUUA 4ECNA 1I1FB 3B9AA 4PJBB 2YXVA 4OCWH 5CJOL 2C1OA 4QD2E 2BRQA 1FYTA 3OD3A 3KAAA 2EO7A 5I19L 2D73A 1KN2L 4MDIB 3N9GH 3Q6FA 4W9FC 4IYKA 1ZHBB 4KO9A 3FH5A 1NIFA 3MFGB 3WKML 3KM1A 3WN5B 3TBCA 3GSNH 3O2WL 4ZK8A 1EXUB 3AU0A 1A7BA 1UG9A 4MRCA 1VZIA 3TBWA 4AJ0A 1IC7L 4DVRL 2GY5A 1S9XB 4AITA 5IB5A 2NDGA 3ILEA 1JAEA 3CCHA 1A9BB 3LZLA 4B27A 1KACB 5TF0A 3CDFA 3LH9A 4CW1B 1E5CA 5DQJA 5JNYA 4XH2B 4TM9A 4YPGA 4XN8A 4PJGB 1AH1A 5D96C 2IANE 1E8YA 3VXPB 1OTUD 4LT7A 4B9FA 2NNCA 4ETQA 5E9DD 4YC2B 1D5MB 3CFJA 2XSKA 3FOLA 3KPRE 1YEKL 3LD8B 5HHVL 4AEHL 5IBLC 3FQYA 4UT6A 1VAHA 2XG5B 3EFDL 2DQJH 5IK3B 2ZWKA 3MRRA 2PXYC 2FLMA 4N0YH 4HOZA 3FKUS 2OYMA 4L9LA 4PH8A 4JREB 3G5YA 4YHZH 3TA3C 3DOSA 5HI5C 4P4KA 5FDYA 5FKAB 2HA1A 4UT7H 7FABH 1EFXA 1BIHA 1CXHA 1U3HB 1T2QL 5CR8A 1RUPH 1LP9F 4Y4KD 4ALAL 4XO8A 2FATH 5I6LA 2UYLB 3V6ZB 3NCEB 2I60H 2KUTA 2PCFB 5JHLA 5EEVA 4K3JL 5E8EB 1E5YA 4X6FA 1RAMA 1EHKB 3S97C 3VO0A 2XZAH 3H2WA 3H7LA 4PJEA 4LEEA 4PJ9D 3RFZC 1G7HA 1DN2A 1L3WA 1JWUB 2ITCA 3VYNA 5BRZD 4ES8A 3RAJH 3V0VB 4WI2A 2XWXA 4F2MA 4PJFB 4OV5B 1SXCA 3BT2H 2WSKA 3NZSA 1B0WA 3P77B 2HKHL 3O3BA 5JIMA 4PRHD 5C9JB 5AKTA 2H5UA 4L1SA 1BIIB 4AUUA 2JTDA 4D9QE 4OFYD 1BD2E 3PL6C 4LOFA 2JSFA 1E0OB 4MCYA 1CYXA 2WVTA 1SN0A 3WS6A 1NFAA 4UOW0 4WTZG 3W37A 3DIDA 3GSNL 3TZVA 3FN3A 4LF3A 4RMRA 1UEYA 5DLLA 1DFXA 1JTOA 3L7EB 4UANA 4LKXB 2QDVA 4KV5F 3H56A 4XCFH 2VXQA 4QF1A 4F7PA 3D25A 4FP8L 2ODHA 5F8QC 3ECQA 3W9DB 1OAUH 3QG6A 4OFIA 3ZDXF 3RNQA 5GGTH 1IKOP 3IU3A 1DZ0A 3BMVA 4H1LA 4UNUA 1ZHLA 5K9QI 4JFQB 4OD2A 1X6NA 3ISWA 2XYCA 3KPNB 1CFSA 2XTJE 1MIML 2XN2A 4LZKA 2BVUA 2HG5A 3QH3B 2ZKMX 3L5WB 1QBAA 4QYOA 1XSIA 3SCMB 2ZX8A 2H26A 4DKDC 1CD8A 3NSJA 2DQJL 4XNAA 4EUPH 2ICWI 4N0YL 3KVDD 1MCBA 1UXLA 3W81A 1AGCB 5J4MA 4DFIA 4UT7L 7FABL 5F9OH 5IB3B 1I1AB 4PWHA 2EVJA 3F12B 3KLSA 1GZQA 3VSTA 2WNWA 1INEH 1OK0A 2RACA 2APVA 4HMEA 4AV0A 3GMRA 4AZ8A 1MRCH 4BK5C 2EVGA 4WI5A 2F1BA 5KVGH 1A3RL 2RD0A 4WJ5A 1QLFB 2NQCA 2XZAL 1JNLH 4XNZB 4Z1PA 5KSBE 2WLIA 3RAJL 4KY1L 1MRFL 1QLEH 3BT2L 2ADFH 4OCYL 1M3IA 3GBDA 1INQB 3GSOB 4MNHA 2ENQA 2YLKA 1I31A 5AL8A 4A37A 1WD8A 1I9RH 2ZYSA 3KPQB 2A74A 3Q44A 2VJ0A 3DI3B 3ZRFC 2HWZL 2K0RA 1CURA 2JIXA 2IGTA 2VLLA 1WGVA 3CQFA 4MJ6A 5INDB 4LCWD 3U0WH 5DD6A 5AOIA 1BFSA 4U1IA 2EADA 2D2OA 1NFDA 1EEZB 3CDGA 5D5MA 4L1HA 3X12B 4UCFA 4F7EB 4JFEB 4HUUB 4JFXA 1C7TA 1T3FB 3T6VA 1F3JB 3MGOA 3OQ3B 3ZZ1A 3O3UN 4EF3A 1IKNC 1OT2A 1KJ2H 5FW6A 3T3PB 2AEIT 1EBAA 4LE8A 3MRLA 4QHLB 1XH2A 4F15B 4X5QA 4OM0L 4XCFL 3MRIB 1KUMA 2WXHA 2NLJA 2DW5A 5DD3H 5DLMH 3H6AA 3P11L 4JFDB 1JHLH 3O9WA 1JDAA 2BFVH 4HG4J 4PLKD 1CVRA 2GJ6B 1NTDA 4LCUA 4YGAB 4ZRGA 5F6IC 1IGMH 5CBEB 3MV9A 4OBSA 4Y4FB 5E5MA 2IWKA 4QNPF 4R7XA 1MF2L 2GTQA 2ITEA 4PIRF 2P5EB 1TJMA 4J8RB 3CC1A 4FXGA 3V6OA 3BVXA 4NO0D 4ABWA 1CFVH 4OLUH 1WK0A 1D5XB 2FT7A 5CIPH 5E2WH 1U4EA 2V9TA 2CG9X 2OFQA 1HI6B 3PJNA 2F5BH 3I9IA 1AG0A 5F9OL 5ISZD 2EYSA 3G5XB 3GSUA 2MCAA 2P5WA 3MV11 1T6WA 1INEL 2PWDA 4PY8J 4G83A 3B5HA 2Y3AA 3P02A 4RNRB 5LCVH 5JPMC 3U6RA 5EU5A 1H6EA 1MRCL 1V8HA 2XZQL 1OSPH 4ERSH 5KVGL 3CX5K 4PJXB 3HFFA 1JNLL 5GSRA 3T8XB 1UACH 3VD0A 4M43H 1QLEL 3D2UA 1BJ1H 4GQ9H 3IWVA 4IBUA 2ADFL 1BAFL 1P2CB 1LO4H 3LQAH 4L8DB 1LEKA 4FQPA 3UGEA 4IOFC 2VSCA 1I9RL 1H6FA 2EH7H 3D51A 5MENE 4IW4C 3ILQD 4LDOB 4EZKA 2VO5A 2NY2C 3U0WL 1SDDA 4Z7OF 2V17L 3ZSTA 4RISH 4BQ8A 3U7YH 3BIKA 2KT6A 2ENYA 4X9BA 1J8HA 3NCWA 1LK3H 2PETA 4GRLA 3MCLL 2W0PA 4RMWA 5T1DL 3SE8H 1LEGB 3D08A 1T1YA 1X5AA 3HNSH 1KJ2L 3WGUB 3SQBA 2VW6A 3JWOC 4GKZB 3EO1B 8FABB 5JW3H 2GIYA 3DDFA 3B9KD 2G2PA 3ESOA 1LNUA 3IFOB 2IXQB 3RJDA 3HNTH 3G9VA 4MKMA 5DD3L 5DLML 4MFHA 4HLZG 1JHLL 3C5SB 3GZOA 4PRAA 2IQAB 4WV1B 1IFRA 1DEEB 1ZHKA 2H2SD 3ARDB 2AAAA 4GRWF 1IGML 3VFOA 3MRHB 3TC9A 2R8SH 1RURH 1WJ3A 2QQLH 2WY3B 4J12A 2Y1AA 1BBDL 1BVNP 3MJGX 4P2QE 5IJDC 3BVNA 3POCA 4YPJA 5DJYB 1CFVL 4OLUL 2EE3A 4JM2D 1FNLA 1JGDA 5E2WL 2V9QA 4NQDE 5KBNC 1GGUA 4Y1AE 2YUZA 1P5VB 2LFEA 2ZUUA 5I6MA 1JS4A 3FU0A 3GXFA 3BI9X 1J7VR 5J0BA 2CR3A 2WLNA 1MXDA 4YMPA 4GO6B 1N5YH 4ENEC 5FA3A 1MW3A 1IAOB 2YGPA 2G9KA 2BW5A 3EJZC 1N9PA 2VM9A 4Z3GA 5F88A 5B8CA 2WN3A 3ZE1F 4ERSL 1FWXA 3GZQA 1IBGL 2D4DA 1O7VA 3QDGD 4MYPA 2DWSA 2WXIA 3QEGH 3CHOA 1GJWA 1UACL 2EABA 4GQ9L 3DJTA 1M05B 1SM3H 3ECBA 4NYLB 2BSBA 2AC0A 3LQAL 3U79A 4LRIA 1BZ7B 3ARQA 3TH4T 2EH7L 3JTTB 4R5TA 3TBSB 1MNUL 3KWXA 4Z7QB 3QIWD 4IMLB 3OKMB 4FFYH 1QRNA 2AQNA 4MA1B 4M02A 5DMIH 3X3GH 3U7YL 4G9DA 4ZFOB 4X5XA 1NCCL 1NAMH 2LLGA 1LK3L 4PMEA 3SE8L 3IFLL 2OL3B 4Q9RL 1KBGL 3HNSL 1FO0H 1M9WA 4I2XA 3MLRH 3J7HA 1TQBC 1RK0A 1PMYA