2B9AA

Human transthyretin (ttr) complexed with diflunisal analogues- ttr.3',5'-difluorobiphenyl-4-carboxylic acid
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
108
Chain Sequence
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTARYTIAALLSPYSYSTTAVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diflunisal Analogues Stabilize the Native State of Transthyretin. Potent Inhibition of Amyloidogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
molecule keywords Transthyretin
total genus 24
structure length 108
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2b9aA00
2B15A 3P3SA 2B9AA 5A6IA 2F8IA 4D7BA 3D2TA 1Y1DA 3KGSA 1E3FA 2G2PA 1DVXA 4QYAA 1SOKA 1ZD6A 2GABA 1TLMA 4TLTA 4N87A 2H0FA 5L4IA 1BMZA 1KGJA 1KGIA 4PWKA 4TNEA 1TTBA 4IK6A 5E23A 3GS4A 4AC2A 4YDMA 1TTCA 4TL5A 2G4GA 5AL8A 4I89A 1BZDA 3DGDA 4TL4A 3I9PA 4L1SA 4DESA 1U21A 2G4EA 3ESPA 2ROYA 4IKLA 1SOQA 1SN0A 3CN2A 3NEEA 4TNGA 4Y9EA 5FW8A 3TFBA 3CFQA 5CN3A 3IPBA 3IWUA 3KGUA 1TYRA 3KGTA 4WO0A 3OZLA 4TQ8A 4Y9GA 1ICTA 3GLZA 3DK2A 4N85A 4QRFA 5CLXA 1F41A 1E4HA 3IPEA 1F86A 4FI7A 4L1TA 4N86A 3IMUA 3TCTA 3P3UA 3A4DA 3CFNA 4TKWA 5JIMA 4IIZA 3I9IA 4PMFA 3IMVA 4PMEA 3NEXA 1SN2A 4HJTA 5AKTA 4PVMA 1DVZA 1THAA 4WNJA 1BZ8A 1SN5A 4FI6A 2G2NA 3W3BA 2G9KA 5AL0A 4ABWA 3QVAA 3CN1A 4HJSA 2WQAA 5L4JA 1TZ8A 1ZCRA 4MASA 3GRBA 5IHHA 1IJNA 4PWIA 4I87A 3BT0A 2QGBA 3HJ0A 5BOJA 3NESA 3DJZA 4WNSA 5JIQA 1X7SA 3DJTA 2G5UA 3GRGA 3NG5A 3P3TA 4QXVA 3CXFA 3B56A 1FH2A 3DK0A 2G3XA 5E4OA 5CLYA 1IE4A 5CR1A 3CFTA 5DWPA 3IWVA 3CN0A 4ABVA 2H4EA 3A4EA 1X7TA 1ETB1 4IKKA 3U2IA 4ABUA 5CLZA 1DVYA 4AC4A 2FBRA 3GS7A 1QWHA 1DVQA 3CN4A 4TLSA 2H6UA 1TT6A 4IKJA 2B14A 2PABA 4PWGA 5AKVA 4TLUA 1BZEA 3DO4A 1BM7A 4FI8A 4Q14A 2H0EA 2QGDA 3Q1EA 3M1OA 4HISA 4TNFA 4Y9BA 5HJGA 3P3RA 4PWEA 4PVLA 2NOYA 1OO2A 2ROXA 3ESNA 2TRYA 4HJUA 3CBRA 4IK7A 4MRCA 4TQPA 5K1NA 1DVSA 4I85A 1QABA 5EN3A 5K1JA 4ABQA 3ESOA 5L4MA 4ACTA 3IMRA 1TTAA 1DVUA 5AYTA 5DEJA 3U2JA 4KY2A 5E4AA 5CM1A 4PVNA 3IMSA 5L4FA 2F7IA 4TQHA 3FC8A 3CN3A 2QPFA 4PM1A 1ETA1 4PWFA 4DETA 3IMWA 2TRHA 1FHNA 4MRBA 1GKEA 3CFMA 3DJRA 3OZKA 3NEOA 1TTRA 4Y9FA 4TQIA 3FCBA 4TLKA 2H0JA 1DVTA 2QELA 3D7PA 1IIKA 4DEWA 4PWHA 4DERA 5JIDA 2GPZA 2B16A 5AKSA 3IMTA 3BSZA 4YDNA 1G1OA 4HIQA 3A4FA 1RLBA 1TSHA 3GS0A 3I9AA 5FW6A 4ANKA 4DEUA 2G3ZA 5EZPA 5TTRA 1THCA 5CNHA 5FW7A 1E5AA 2QGCA 2QGEA 2B77A 2H1XA 1GKOA 4TM9A 4Y9CA 3SSGA 2IGLA 3DJSA 4IKIA 2FLMA 1IIIA 3DIDA 3GPSA 5FO2A 1Z7JA 4PWJA 1TFPA
chains in the Genus database with same CATH superfamily
3TNMA 4TF4A 4HIEA 5CEXA 3MUJA 4TUOA 4NQVB 3G6DL 3LQZA 4P46C 3SE8H 3SOBH 3VG9B 1COBA 4QJ3B 5I1IL 3KGSA 1MFDL 5DD0H 2W5PA 2JV6A 5F6HJ 4X7EC 1NCCL 4M61B 35C8H 4D9RD 3NQIA 4DPRA 3A23A 1BVZA 2IANE 3X13B 1VCBC 5CWSA 2J44A 4KO9A 4H1LA 3C9NB 5E8NB 4M1DH 2SEBA 4P2OB 4XWGL 1T21A 2YC1A 1H15B 4JFYA 5FA4A 4DK6A 4XOCA 4PRBB 4TMPA 2F0CA 3F01A 4YLBA 1A5FH 3VB9A 3MO1A 4M1GL 5FK9B 4KK8C 1RZGB 2XLLA 1O7DC 5H37G 4J8RB 4OJEH 4KXBA 4WTZG 4YSQA 2QKIA 4JDEB 4ZYKA 2Q3AA 4WTQA 1IX2A 1EZVY 4Y5XC 3TZVB 4JFHD 1BQRA 4U0RB 4YJZL 4ZUSA 1I1YA 1U92B 2D0GA 2VISB 3N40F 4X6CB 5IBUG 1SF5A 5H35A 3FBQA 3UC2A 3S4SA 1DFBH 1F42A 5C97A 2E5EA 1HHJA 4ZS7L 1PW3A 4QXVA 4R5VA 1WPCA 4PFEA 3IJEB 4Y19B 1IKNA 1FA4A 3GO1L 4CVXA 3CJJA 3GKZA 4YR6B 4XNDA 4K73A 4FQCH 1OM3L 4EIBA 3PHAA 2EIBA 4WWPA 3QQDA 5MEPB 1EVUA 1U3HA 4AMKH 5HGBA 1YMMD 3GWJA 2VERA 1GYWA 2A83A 2RB8A 5D2NB 3M1OA 3EW3B 2BS71 3LXAA 3L5XL 3VG0H 1TETL 1JVKA 1AIFA 4KJQD 1K5WA 4ZMQA 5LNGA 1T2XA 2QLYA 3VFOB 4LPCA 4Q9RL 5F7DA 2F74A 3IMRA 4QD2E 3RGHA 4QDGA 2CALA 2D7OA 3K6FA 2BP0B 1ZEAH 3EKCA 3NIFF 4XPGL 1FHGA 4OLEA 3V6ZA 3HUJE 4RLDA 4UDTB 5IVNA 3KDPB 4R3SA 2Z93B 3D09A 3E9UA 1CB4A 1HE7A 1FFOA 4UIKH 1ES0A 5FWRA 2XU9A 2WAQA 4WUUB 5GRXG 4F2MB 5CAYB 5TF1H 2XN9E 1G9NC 2DWDA 2OK0H 2PCFA 5G4NA 3N0PB 4LBEA 3RUGE 4NAMA 2EDJA 4GAGH 2X6VA 4V1DB 5J11B 3MGOB 3BAEL 4XVTH 1FRGH 1JL8A 4F80A 5KSAD 1KIPA 2X89D 4R4FL 1UXLA 4PJBE 4X80L 4KRMB 4ZMOA 3E2HC 4WHCA 4NJAH 5ICXA 2J6EH 3MBXL 1JHKL 3K4ZA 1JF1B 4IYKA 4NNPH 3U2SA 2L7JA 2BFVH 5HDBF 1SJXA 6TAAA 5EZJA 1B6DA 1XIWA 2I25N 3C2SA 4W70A 4MXWL 3AUWB 5KSBE 3EJRA 1T03H 3PHOA 4A2DA 5BO0D 2D8KA 2P7TA 5DLML 3EYUH 2VDML 4J6RL 5CCHE 1AFVL 1FZOB 4F8PA 3HZMB 5F44A 3TN0C 3NYKA 1MSPA 2LGNA 4PRHE 1RZJH 4GI8A 5FYJL 3CFKA 4Z7VE 4CU7A 1A65A 2GAZB 3MUUA 2ZOKB 2VZSA 2BW5A 3WKMH 1NC4B 3O6KL 4KV5F 1JF6A 2XZCL 3MGTA 4UM9B 3WYRA 1X5HA 3EDFA 3L6FA 3TEUA 5IQOA 1GRWA 1IBGL 3UADA 3K8MA 1S7WB 1KBGL 3AG2B 5KBNC 1QSZA 1VEMA 5EC1B 4NQEE 1QRNE 4AXWA 4R90L 2XVKA 1MCDA 4JPIB 1UENA 4KK6D 4UTAL 2NY7H 4NBZB 3C09C 5MERB 3CXFA 3HE6A 3HFFA 2DZEA 3O11B 2GHZA 5BQDA 5A2BA 4YDIL 5A3ID 4AGOA 3KPMB 2F15A 1GJWA 2VLRA 4KFMA 2NUPB 1OGAB 2HLFC 4PR5A 4YL9A 1SRDA 4O5LH 2B2XL 3Q1SL 4HLZG 2C3XA 1HNFA 4FQIL 1NA8A 1TQUA 5JDJA 2AJSL 1RJLA 3CZUB 3H53A 1Z5HA 3VD5A 1IGMH 4G8GE 5FGBA 5BXFB 2X1QA 2P8LB 1VF5C 4HMCA 3DV6A 4IOIA 4JM4H 3P0VL 2WIIB 2JXMB 5FHAH 4DP6X 2GEQA 2N7SA 1DDHA 1ADWA 2O6PA 3KJ6L 1HN1A 2JCCA 4QRQA 3UZQB 3WFDL 5EEYA 2C1OB 2AANA 4XPFH 2ADJA 1QW8A 4OZFH 2NPLX 4P5SA 1VSCA 1ROCA 4P5TB 4TQIA 5FOBB 4WI7A 1NUGA 5CGTA 1H3XA 1JZDC 4N2FA 3OJDB 2ED7A 5J4MA 2E9IA 5I1HH 1UXSB 3S37X 4H7VA 1WA0X 1IC4L 2QGCA 1XIWD 4O02L 1MREL 2EVIA 2Z3FA 3L4VA 3BQUC 3QI9D 3MJ7B 4H25A 1OAYH 3BPLC 3NVQA 3UZVB 3KWVA 5F7DB 4PJFA 3Q9QA 1FPTH 5INDB 3ARBB 5H94B 3KNBA 1J18A 1WUNT 3O3UN 2CBPA 3OAZH 1JYWA 3Q05A 2VLJD 2V7NA 4GAJL 4N9GA 2FSDA 4NQCB 3MRMA 4N9OB 1RPKA 5CINH 5CN1A 7FABL 5FOJA 5E4EB 3V4PB 4ES8A 1N0XH 2CIKA 1DQKA 2IGFL 1I9IH 3HBGA 4F33A 1KJMA 1KCUH 2NDGA 4MS8C 5SWQA 3QQDB 4YXKH 2AVFA 1EEZA 4D0BA 4F9LA 1EVTC 1SXSA 3N55A 5SWZA 1W0YT 3Q2LA 4MAUL 2MOVA 2LLLA 1K5NA 1JGIA 2V9UA 1XGQB 4Y7OC 1MCHA 3GLDA 1RY7B 4YBQD 3UMNA 2WQVA 1TZ8A 2GC4C 3FB6B 3ROLB 4EN3B 1UUNA 1PTZA 4OGXL 5DHYB 4WNSA 4KDWA 4LL9A 1L4IA 1JK8B 2VDNB 3OF6D 1FAIH 5LJYH 3NCJL 2JTDA 2D7TL 4WJG3 1CLYH 3VXPA 5GS0H 4FXGB 4JY5H 4F7CB 1FFRA 3PNWB 4XBEL 3RKPA 3A21A 4NZRH 2Y06H 4F2EA 1AR1D 3F65A 3OWEA 4GB9A 4PUBL 5IK3B 2VAAA 1SXBA 3X12A 2GTWA 4LESA 4NO0A 4NP4H 1KTDB 1LP9E 4Z7OF 2YPVL 4J23A 4LHUB 1OSYA 3T5WA 4OJFH 4L8SC 3ECQA 3D85D 5BQ7B 3DVGB 4C54A 4Y16B 4IRSC 2CLRA 4BV1A 1FN4A 4P4KB 3WIIH 2W0FA 1HXKA 2EE9A 1AXSB 3ESOA 4ODWB 3MCG1 4U31A 5EV7A 1BVNP 3R06A 3AY4C 4JE0A 3DUSB 1P2CB 4F20A 3HI5H 4ZJ9A 4EI5A 1ZLWH 3QFDA 2EH7H 4MJID 3CLWA 1JRHL 2E27L 4Q7DA 4EI6B 3QQNA 2XA8L 3L3GA 1L9SA 3MN8A 3NAAL 3PL6C 1PCXA 4JHWH 3QFJE 2WWOA 43CAB 3QQ4A 4JJHA 1WBZA 4WEMB 3HG1B 1ZT7A 4J6RH 4AH2B 2AXHA 2NQ3A 5EUOB 2WN2A 1Q4NX 1UVQB 2BC4A 2OSLB 2OJEA 4JFDE 3X3FH 2AV1A 5MEQB 1OCWL 5IFJB 1MWAA 2VMCA 4XP9L 2I7SA 2KT6A 2YQ3A 1IU1A 1PNCA 4MDJB 4JUTA 4HKJA 3C87A 4M3JA 4XPTL 1XZ0A 2GABA 4X6DF 1CF1A 5HHQB 5IWLC 3LHPL 3KJ6H 3QIBC 4ZAKB 1UD8A 5BVJA 4Y5YC 3SPHA 4NLAA 3CTTA 1Y0LA 4RQQB 3DWTA 1D5IH 4BGDA 1F13A 2XWEA 3TBTB 4I18A 1X7QB 2BVUA 1SN0A 5EH1A 4Y89A 4YDLB 1LP9F 3NSCA 4QRSA 3QUZA 5JHDA 1IAKB 2ZKMX 3UP1A 1BHGA 3TC9A 4KO6A 3ULVF 3VO0A 1E4HA 4M02A 3KZ8A 4YBLB 4LCCB 5AG8A 4PMFA 1L0PA 1X5KA 5GRUL 1HKLL 1P4IL 3HC0A 3K72A 4HJTA 5TE6L 3MRHB 5MHSD 5IJVB 4P23B 2WOBA 3JUYA 5GGSY 4KTGA 2GCYB 1UZGA 5HVHB 3G5ZA 2E6JA 2BCMA 4FL4C 3ZKMD 3GEFA 2OL3B 2JKWA 2YGVA 3C5ZC 4XN7A 4WGKA 2Q86A 3BO8A 3MV8E 3BKCL 4AUJA 4HJEA 4G6JH 4AMXA 4OCSH 3T0EB 3M8OL 5FOBA 4AMKL 5EO9A 3O2WL 1JUFB 1DUYA 1L3NA 3A4EA 2FWUA 3PY9A 3WJJC 2H9GA 4PI2A 5E8DL 3LNEA 4FQCL 3S36H 2HG0A 4GINA 1XB6A 4NP4L 2HMIC 4N2DA 1KSRA 1T7VA 4JY6B 1QLFB 2UXTA 2LABA 4NZRL 4J3OG 3AG1B 1NEZA 3LIZA 5GS1B 1CDJA 5BV7C 3TCXA 1YQVL 5FDWA 4XMWA 3I2CL 2FTAA 1MIMH 4HJUA 3OXRA 5H2BA 1IGYB 1WS7A 4JJ5B 3B3IB 1OWRM 1IC7H 2EIZB 1LM8V 2ATPB 3IDXL 1TEGA 3FULA 2LT9A 4P2RA 1HZKA 1OTTD 3P69A 1OGAD 1ZVSB 4PJEB 2I9TA 4UTBA 1MAML 1QZNA 3HKFA 3QNXA 2FBJH 4TS6A 2WN3A 2XKNA 4KOCA 2ZX9A 4FQ1H 4LP8A 3MJGX 3BZ4B 2AZUA 1NUFA 2IGFH 3A4FA 4IHBA 1TNNA 4OFKA 3NZSA 3P3YA 3QWRD 4OF6A 5D1XE 1QBMH 2OZ4A 3ZTJG 4F37K 1TENA 4FXTA 5I75C 4FG2A 3I6SA 2D0FA 4FLSA 1AS8A 2QVFB 4XN9A 2O4EA 3OHXC 3BQUA 4PGEA 4D2NA 1YPZE 3MNWB 3DX9B 2VZOA 3DMMB 5KAQG 2DF3A 2R69H 2HVJB 2O6DA 4UV4H 3CFUA 3ZY7A 4HK3J 1I85A 1B0IA 1MFAH 2XIIA 5D7SL 3DV4A 1AQMA 4MQ7B 1XAUA 4M5ZH 1CGXA 2KZ1B 1YEKL 2L4OA 2XETA 3F5WA 3D3VA 3HG2A 1MFMA 3QUZC 1QACA 2H32A 1BQHB 4TUJA 3EHBC 1A6WH 4OFQA 5I1HL 1RJYB 1Y6NR 4KK8D 2RH0A 4LIQL 4FI7A 1BD2A 3QNYB 4ZPTA 3REVB 3V4VL 3U1SL 3U7YH 1NKOA 1TF4A 3CPLA 3VI3B 4GG8A 4YSOA 2DL9A 4BHUA 2BOBA 1KCSH 3TA3D 3CGTA 4ABWA 3BMVA 4RGNC 3QXAA 5IEKB 3U79A 3FB8A 5KVFH 1L5GB 4GKOA 5JA8B 3NFPB 1QKZH 1ZCRA 4KZDH 3IGUA 4Q0XH 4CDHA 2IBZY 4NPKA 2J88L 1G94A 2PN5A 4X7CC 2HH0H 4Q9QH 5CLWA 5AALA 1SLUA 4F2ME 1E4WL 2CLZA 3RKDC 5A16B 3ISWA 1BP3B 5FWQA 4HCRH 1AC6A 1J10A 3GBML 2JH2A 1FDLL 4YVUA 5KZCD 2DLFH 5LVEA 1TPXB 3DVNA 1Q72H 2ZCKH 5FHBL 5FUCC 3OKOB 1KB5H 5DUML 3SDYL 1P7KA 2ICCA 3ZKND 2HLAA 2CQVA 2PTTB 5D7EA 3MBEC 1IC5L 4KTYA 4ABQA 1RZFL 2BS9A 2ZCKL 4GP4B 3NDYE 1AR1B 4PW3A 5DEFA 5C0JB 1KPUB 3GXDA 1LP9A 5HI5D 1G6RH 3MLVL 2NNCA 3ETSA 1AO7A 2F7RA 2H3NA 5LCVA 4L8SA 3UGEA 3W81A 2BRRL 3ARGB 4AIOA 3V79C 2RR3A 5AZUA 5D1XD 5DVLA 5IOPA 4E41D 4Q6YA 4Z3GA 3SDDA 2NLJA 5T5FA 5MENA 3EYSL 3K8KA 3DUUA 1G1OA 1HQ4A 4ILDA 5ICZA 4RFNB 5AVQB 1T83A 4OLVL 3D0AA 4R5XA 5LCVL 4EPSA 4XP6H 2OMBA 2G3ZA 4YHNB 2YOCA 5K9QI 5KVDE 2KLRA 3QWNA 5DTFB 5E03A 1S7QB 2HVKB 2NXYC 2QTVA 2XFGB 3MLZH 4PWJA 4WTZA 4ZTPL 5F96L 3B3IA 2WJ7A 3P3SA 4LLMB 4FXKB 1GJIA 3IB4A 2VT0A 1D3CA 4MDIB 2QMJA 2YPLA 3OMZA 3D2TA 4N0CC 3QEQD 4G9FA 3IJHB 1G7HA 1MFUA 3SGKC 2A6JA 5EBGA 1PJWA 3QDJE 4X5WB 3QIUA 1WFOA 2V9QA 1HH9A 1RVFL 4G8AC 5D72H 5EN2A 5HDQH 5EUKB 3SEPA 4F9LC 1BZDA 1Z9OA 4DN3H 1ACYL 5F9WB 1U21A 4CVZA 3IJ8A 4PJ8A 3BN9D 2VSKB 4X5LA 1IVLA 1J05B 5L6YL 4BWWA 4UV4L 4ODUB 4JY6A 2JB5H 4QRFA 3IXAB 1KPVB 4KVNH 5BOJA 3TCTA 4YS4A 3CQFA 3MV8D 5HI5C 1MNNA 5KSBA 1MJ7H 4AZ8A 4QOKB 4Z7UB 5AEAA 4LMQI 3UZEA 3W9EA 3OF6A 3TOPA 5DHMC 3MNVA 2GITA 4PJ7E 4LPXA 3MCKA 3RBSA 1IZKA 3ATDA 2CXGA 4P5TD 3GSVA 4I0PB 5D7IB 2H2PD 2V7NB 2K4WA 1OEZW 4XNUH 1F56A 2PXYB 1E65A 3NCBB 4XZUB 3IDGB 4ZQKB 5T5NF 1D2OA 1KXTB 3I3EA 2V7HA 2VRKA 1DSWA 1B4LA 1IKNC 2QR0B 2OCCB 2RIKA 4P46D 4RZCA 5IB3A 1HI6A 2JJTA 5I73C 4IBSA 4ZDHB 4NWTH 2CHWA 5E6UB 4K94H 1FZMA 5E00A 1BREA 2JJWA 3QUXB 5FGCE 2YLKA 4YZWA 5HYQB 1K8DA 3KLAA 1I9EA 1TTGA 3C5SA 4NI3A 3UTZA 4ZS7H 3GMNB 1JP5A 3I2CH 1S3KH 4G8GA 4ONGL 2HB0A 4U1MA 4LPUA 3HVDA 1EHAA 2DQUH 5GRWA 1LEGA 4P46B 3BE1H 3EYFB 4BKSC 2J1YA 1TTAA 3D85A 5JIKA 2C3HA 4CAGA 2WWKT 3EH5B 25C8L 4YHZL 5AVSB 3MV7B 2Y1AA 3G04A 4KOBA 1MCNA 4PHZA 3N91A 2Z31C 3CMOH 2A9ML 4K3JH 4QIRA 4KPHL 1RIVL 4UQCA 4M1GH 1M7IB 4ZNEA 4GSDL 4OH2A 1U2CA 2OJ1A 2XN9A 2Z92A 2PPEA 2WMPA 4MDRA 4NOFA 4HIJA 3JUZA 3KCPA 5T1DH 4XWGH 6PCYA 1INEL 5HSFA 1GKOA 2VO5A 5SX4H 3U36B 2ZWSA 2PPAA 2VLME 3GMQB 1XH0A 2L04A 5DA0B 5FUCE 1B0GA 5B7EA 1NINA 5D1ZA 3CVHH 4X4ME 4NN6B 2OYLA 5I0WA 1AMXA 1IBDA 4KUCD 4OSUH 3O4LA 1KDIA 1SHXA 1SFDA 3ARRA 2FJFA 5BMFH 4J3XA 4O4YL 4M1CD 2EYRB 4NQSA 3G5YA 1PU0A 4XP1L 1T0NA 1ZA6B 2Y7MA 5C3LD 2FL5B 5E2WH 2OCJA 3VXRA 4HD9A 5JW4N 1F58L 5TGBB 4AITA 1J48A 1PL3A 1WBZB 2NR6A 2R29H 5IW3A 2AKRA 1NZRA 2AV7A 1ZHLA 1WWBX 1BAFL 1FI8C 4K5OA 2DN7A 4UT9A 1V3MA 2DQHL 1U8QA 1GA2A 1WISA 4AL8C 3RVXD 1XIWC 4RMSA 3L3KB 3UG4A 3N43B 5TQ2L 4ZFZA 1GW0A 3KLLA 4BIKA 1DJXA 2XJLA 1FYTA 4E9WA 3EG9B 2Y1VA 1T5XA 3MRFA 2NW2B 3RI5F 1IJNA 1FAKT 1HSBB 5IHUH 3BW9A 3FFCD 4F5CA 1JNNH 3ZIMA 4JQXA 4A2EA 3FHEA 4UCFA 3UBXG 5C0EB 2Y25A 3F05A 2BNUB 2I85A 1FO0H 4HOWA 3J27A 2X1OA 3LKNA 3HB3C 1KLUA 3VXSA 3AZUA 4YLQT 1AE6L 3ULVC 4NQQA 4Z95L 2CBOA 1C08A 1N67A 1YDPB 1AQHA 5D7LA 2QGDA 3UTPE 2ADGA 3JV4B 5DD5H 4APQC 2R69A 5KVEE 2JE8A 4BCYA 4TQEH 5I5MA 5HGHB 1QFWM 4F92B 1J8HD 3TT3L 3C5ZD 4ZO8A 1DL7L 2AK4D 4HIPA 2WQ8A 5EU6A 1R24A 3KYMB 3WHE0 2OR7A 1I8IA 1ZXKA 1G9ML 3VSTA 2YWYA 3CUPA 3RGBA 4BFRA 5FB8B 4ODXB 3T65B 3V5DB 3QQ9D 5ECGA 3VMOA 3QJHB 4J3OH 4TLKA 3ECVA 3LV3A 2JB5L 4IRSD 1GGUA 5MHSE 4U3XA 2Z31B 5E51A 1Q38A 3GB7B 2OXHA 3B6SA 4E5XA 5EF3A 2D7PA 1D6EA 1BZ7B 5ISZA 3K5SA 5E9NA 2YBRA 4KDVA 3ZE2E 1ITBB 1QZ1A 2B77A 1G0XA 2HJLB 5FYLD 2CO6A 3AAZA 1KNOB 2ZAIA 3IEAA 3O6ML 4U4IA 2ZOOA 3HHSB 3IRPX 4WAFA 5L9DH 2VDOL 3TH2T 2XICA 4JRXE 2FAUA 2M26A 3S5YA 3VXTA 5I0ZA 5DC0A 3BFQG 5HHMB 3FTZA 5JW3H 4LSUL 3OB0H 1XH1A 2DWDB 5IT2H 4RRPM 4X98B 1VDGA 3HN5A 3R18A 5D1ZI 1XGRA 4GRWE 1MPAL 2EDHA 5JPNC 1KB3A 2V17L 1V7NH 4N2BA 3L5WA 1TJIL 3C6LA 3QUYC 1T5WA 4R97B 2CDGB 1MJUL 2YGQA 3IFNH 2ICEA 3NCWA 2R39A 4HJGB 3RVXC 4I4WA 1FNHA 1BIHA 1U41A 5HHVL 1NFIA 1P6AB 2PXYC 1AI1H 5JTWA 3VXME 4XHJC 2NUTB 3H9YA 3T04D 3FO9A 4Z7IA 1XR8A 2X44D 1ZGLB 3GMNA 4Q6IA 3V0IA 4E9RA 4M4PA 4X6EB 5LGHH 1IAIM 3SY6A 2DY2A 1EPFA 1N26A 3OJMB 5I30H 1SHMA 2VW4A 4R7NA 4FAAB 2IXQA 2YMXH 4OR1A 1JZHA 2ZKHH 3HI6H 5IY5B 4LCWE 5I6KA 3HS0B 1SJHA 2Y6TE 4DQOL 3B2MA 1GGIH 2MFNA 3LH2H 3WAKA 1E4XL 1QSVA 1NCGA 3OGCB 2DM2A 3V6FB 4BM7A 4F7EB 1U8CA 3ILPB 3MRRA 4X8CA 5T1LD 4FYTA 3FU0A 2J71A 3WO4B 1QFUH 1JGDA 2R7EA 2RFXA 4QWWD 3WFDH 4GQ9H 1DDTA 4OM0H 4PJ6A 3S3JA 3FU6A 4QLRA 3KEDA 1SJMA 3FW6A 3VFMA 5EOTB 5HJDA 4JANB 1LDPH 2B3IA 2OTUA 2MOQA 4UBDC 4YEEA 3MXVH 1CG9A 1LJMA 1P84J 3L7EA 3IXTA 4QAMB 4Z78B 3ZUCA 3CBRA 4TSCH 4BH7B 1MHEB 1I4FB 3SJVE 4J12A 4F8NA 3IAGC 1LXMA 1BLIA 3MKKA 1OK0A 2FIRT 2VJ8A 4R2GD 5GIRA 1PZ5B 5HTSA 1NGZA 3T6VA 1WIPA 4AQZA 3D18A 2EVGA 4OAWA 1L7IL 3AU1A 4FA8A 1BF8A 3CK0H 5I0DA 2JJSA 1NBZA 1ONQA 4R7VA 3U48A 5CCKL 2H3KA 2P28B 4ELMF 2Y3AA 1QSFB 3WGUB 3C60A 3B9VA 4MBRA 1U8NB 3LPOA 3LZQA 3FJTA 1GS6X 2DBLH 2QELA 4IU2A 1F90L 5D7LE 5CFHA 2ZOUA 2YMXL 3BVNB 2ZKWA 4K5PA 3AT9A 4FCAA 4DGIL 4HIEB 5CEXB 2WGXA 3MBED 4HHGA 5D2LF 5BW7C 5CNHA 4HDIB 3S8GB 1IQDA 5I1DB 3GJEA 4M7KL 2ZXGA 1IQWH 2ZP0T 3CSGA 4PJHF 5E24E 1S7RA 2CU9A 4IKIA 1TEYA 3CHOA 3OX8A 2A9NL 5GGTL 4PIRF 1XQ4A 4KUCF 3VX0A 1E9QB 5I1LA 1IAII 2F8IA 1DUZA 3RE0A 1ZSDB 2IDFA 1CGTA 3NSXA 3CSPA 4JFQB 2BNQD 3U30C 1F6AB 1KYDA 2DRUA 5D2NC 3K0WA 3VJ6B 3CLFL 5FM5O 5I66B 2X9XA 4G1EB 5IOPB 4APXB 3QJQB 1BCIA 4YZFF 3EJZD 2ODIA 2ADFH 3QEQA 2ICES 1Z0MA 5KOVC 2MKWA 1CE1H 1A1MA 3UC0L 2M1KA 1M2OA 1FVDB 1HXMA 2WXGA 1TU2A 1S5IH 4K7PX 2VLJA 4KGJA 4JFZH 2XKUA 1I1YB 1U92A 4YIQA 4KAQH 4HH9A 1C5CL 4OGQC 5TDOB 1T0MB 1V3KA 1YZZA 1GSKA 2NY0C 5F1IA 5TPWL 3CDZB 3GC3A 2CKBL 1ZGLM 1OSEA 1U8LA 2EECA 5DZLA 5BUAA 1J0ZA 4JZOB 5K9JH 4M8QA 2ZCHL 4GAGL 4YPGA 4LCUB 5C0AB 4QRBA 2QFPA 5KJRH 4FYSA 4G6KH 3UAJD 5IB1B 3BUTA 3OKKB 5DMGD 5DJYB 3RY6C 3WN5C 4D0CA 5ITFB 3AT0A 1FL6A 4N0UE 3STZB 3WJJA 1NIDA 3GZPA 1E2WA 3P40A 4L29A 1V54B 5ADPH 5IR1A 1V27A 2XXCB 3UBFA 4QRRA 4JRLA 4X4YB 3O4OB 3FH8A 3EJPA 5HHNA 3TTYA 1LHZA 2Q8BL 1QI4A 1I7RB 2WSPA 4MA8H 1DBKH 3GXNA 3O2WH 4ZFFB 2EDLA 3PGCB 4HZLA 5D1QC 4KO7A 3BP5A 5C0CE 5T1MB 2AI0H 4LK4A 5D7IF 5FYJE 4G6JL 1G6RB 4HSCX 4IK7A 2ZUUA 1O6SA 1YY8A 3K74B 3UROR 1CGSL 1MCOL 4B9PA 4YFEA 3W38A 3ILEA 4PGBA 1F4AA 1Q8MA 2ED9A 1F97A 4P9HL 2N7BA 3MO1B 4CNIB 2QVIA 1XR9A 5E08L 2VXTH 1OM3H 4K3EH 2EVFA 2O61B 4BKLB 1YYCA 5IZ7A 3LVEA 2NT0A 2E7BA 1QRND 4FULA 1MUJB 3OGCA 2JI3A 2QTEA 5DS8B 2D9QB 2ORBH 3BXNB 4G7QB 4X9GA 1QLRB 3MJWA 2WQWA 4RAUA 4G6FD 1KG0A 15C8H 1X5AA 4J2XA 2VLKE 4PG9A 2Z9TA 5I9QC 1M4KA 2J20A 3MLTA 4P0DA 5TTRA 3DYOA 7PCYA 3BAJA 4DPAX 5E99L 4JFFE 4QF1A 3L7EB 4O2EB 4P3WA 3B1UA 1XR8B 4XCNA 4KROB 2GVYA 3MZGB 3S3CB 4ZMLA 3L3OA 3OLEA 1GYAA 1EO7A 4G3YL 2UVEA 4TOYH 2PO6D 4PP1C 5K9KA 1N9PA 4A7UA 4XMTA 4NUGH 3MLXL 3SBWA 2AC0A 4PS7A 1GGIL 5T3ZL 3BSHA 3EBAA 3AQXA 4QHNB 4LAQL 1L9NA 4LSVH 3IE4A 3HB3B 3FFDA 3VW3H 2EC9T 2ICWJ 1SHSA 3VGBA 5I1AA 4QRAA 1HHKA 4JEGB 2ZUXA 2BXZA 3PDDA 1R47A 2HJFA 2D3VA 2DBJA 3JWNG 4M62L 3CBKB 4N8CL 3D2UA 4YN3A 4JNXA 2QQKH 4PJAA 4UDTA 2VDRB 3ES6A 1Q9LA 1YEIH 2VDPH 1V3LA 2Z91B 4CC0A 1NEPA 4X8GA 2CJUL 1DVZA 1UM4H 1ZA3A 3EGSA 2XUWA 2EKSB 1OAUL 1P7HL 4K3DH 4PRIE 3FFCA 4B9CA 2V17H 2NXZB 4DFIA 4M29A 4YAQB 2Z8RA 5F7LB 4J27A 3RL2A 5HD8D 2DBLL 5CS7A 1DQIA 2EEAA 3MPCA 5CBEA 3WG7B 3IAQA 2VE6B 3D4GA 2VLKA 2FQFA 4P06A 4G71B 3NTCH 4AC4A 2AXGA 3BVNA 4JKKA 3DO7B 1RUML 5EO1A 2DQEL 3AITA 3K3QA 4JFDA 1B90A 3ZTDC 4UOW1 3GMRB 3VQMA 3G9VA 4OCLC 3ESNA 2HUHA 3SQOL 4KJPC 1MW2A 4AQAA 2VXQL 4FMKA 4G7RB 5D7LD 3ZE0E 4AIZA 3TNNB 4A6YH 3TWCH 1ZRUA 5GISL 3C8KB 5EOCL 3K5RA 4NN5B 4NWTL 1BZOA 1RK1B 4WWKB 1C9SA 4QOKE 2AABH 5HDLA 3VRJA 2VJ0A 4Q2ZA 4QY8B 3HS8A 1MFCL 3RP1A 1I3RA 3O9WD 2WLYA 4HK3N 5FKPB 4YXKL 1FLRL 1PG7H 3RDTB 3VDCA 3ZT5A 3RNKA 1QO3A 3UCRA 5I19L 3KPOA 3FO0H 2YLHA 5D2NE 3ZMEA 4CMHB 5DD5L 5GS1A 3D0VA 2VUKA 1BQHG 5I0VA 3V0AC 1YEHH 3D52A 5FYKL 5CD5C 3HFML 4ODVH 5D6DA 3WTTA 1N3NA 3MACL 1TFPA 1MVUA 4EVNA 3DTXB 2J4WL 3DJ9A 3KR3H 3NCYS 4P2RB 4A2GA 4DGUA 3NN8A 1Z9LA 3KE0A 1VGEH 3DPBA 1QTYT 1JXFA 3DHJA 3ZKNC 5FYJD 2PPFA 4MQXC 4AC2A 4PJGF 4JS7A 3D4ZA 2G4GA 3E7JA 4YHPA 1XSJA 1MPAH 1RHHB 4RSVA 4Z7QB 3FQTA 1DQML 3PQYA 2PO6B 1NC2B 1NGYB 5CBAA 1RVFH 5D72L 3IFLL 3J7HA 5TD4A 4G6FB 1IMHC 2H26A 3H9ZA 2JCCE 4PJDB 3L5IA 4CMMA 3BP6A 1I7RA 4BZYA 1QLFA 2CCVA 3EBGA 4GSRA 3IMUA 4IMKA 5J1AB 1AXTL 2MWCA 3I9IA 4PV9A 2YD3A 2QADC 1RURH 2X4OA 1JHLL 3INOA 4H8VA 4WRLA 5AAMC 1E43A 2C7UB 4ONHB 1DQJB 1JERA 4XC1H 4Q58C 4OZ4A 4WDIB 2L8AA 1F58H 3P2DA 2XWBB 3CZJA 4LRIC 1MEXH 3EADA 4LVHC 4PJ7B 5IHHA 3V6ZB 5A2KH 1EMTH 1F02I 1HIML 1XGZA 2MEJB 4QHNA 5DU7A 5IK3A 3TYFA 1OK8A 1SLWA 1IGML 5DS2A 3TBWB 4F7PA 1SYSA 4YHLH 3D9AL 3B9KB 3EO1A 3EDDA 3HE6C 3M45A 1ZK9A 3H4HA 3OZ9L 4FP8L 4XO5A 5D96C 2YAFA 4WI9A 2OTWB 1ODUA 1CD1B 4ODTL 2BINA 5EWIL 2BVOB 1MHHA 3JTSB 3PUUA 4TLUA 1N70A 3ARFC 1NOFA 2AERT 4FE9A 2X5PA 4LSSH 2KHAA 5ACZA 5AAWA 1JGVL 3EGSB 1M71B 4M6OH 3R19A 4QGYA 1CLZH 1O75A 2XPZA 4GW1A 4UOQA 3C8HA 4D3CH 3H9SB 2WXLA 4Z95H 4C56D 2DIEA 5ANMA 2FIKA 2IOMA 3IYLW 2N4IA 4PRHA 1J8HB 3APCA 4W9FC 2R1YA 3RHWK 4KNUA 4AUYA 2B59A 5G2NA 3PDOA 4M7LT 3TEZA 4F24A 3I6GB 4APQD 3C5JA 2X4TB 2BC4B 2KDGA 4MQTB 2DPKA 4WWNA 1AGFB 3F64A 3EJUA 3N41B 4H2AA 3ZL4L 2FH6A 4XNXL 2Y3NA 4ALAL 1NCAH 32C2B 1KENL 3AMKA 4NRXB 1WGOA 3EYUL 5F1NA 3QORD 3FQRB 3QEHB 4H5SB 2HFFB 2XZQH 1JFHA 3Q8EA 3T71A 2IGLA 2A74A 2COQA 2FE0A 3B34A 5KS9E 3A0OA 2W60B 3BCFA 3O4LE 3D3VD 1H3PL 2VXVH 1B88A 2N7AA 4PJIF 5DK2B 1ONQB 4QKXB 2G2PA 4R96B 1WO2A 4I18B 1WZAA 4MD4A 4PTTB 2MNJB 4NQXB 4X5XA 5CR8A 2FATL 1UD5A 3ZDXB 4GW4B 4N8VA 1U6AL 4QRTB 3BH9B 3MREB 5DXWA 4TL4A 5DYFA 2EEXA 2X6UA 3BAEH 4Q56A 4ANUA 4EIUA 2GSGA 2GJRA 1Z6JT 5E2TH 1JTPA 1SOQA 4G6AC 2OXGB 2VLKB 4LCIL 5FW8A 4YH6A 2Q7NA 2VUOA 1HXYA 2XZZA 4WEBL 1BAWA 4TN9A 2BERA 4RESB 1UM5H 4EXPX 1BJ1J 1QVOA 1XEDA 2J8UB 3HAEB 4IIQA 3D6GA 3JWDH 4ZOBA 5T1LB 1QNIA 2HVKA 1CD9B 2K45A 3KL3A 1AP2A 4LCWD 2N0MA 2RBLA 4HA1A 1CE6B 2IADA 3E9TA 4JJOA 4AT6A 4B7LA 1RXLA 2B4CH 5DURD 1SDDA 1RAMA 3NPSB 4H88L 2WLHA 5TDNA 2QADB 4JM2F 2DQTL 3FQ4A 2EIJB 4KBPA 2XZAH 5H4YA 5BS0D 4G1EA 1TYJA 1UOVA 3FTWA 4MXVE 3CQPA 3WKQA 2FBJL 1Z9MA 3LKOA 2DMHA 3MX0A 1VGKB 3TBYB 3MRQB 1J0JA 5I82A 3GRWA 1TZGL 5C7XL 5HHPB 1R0AH 4A2FA 1QFOA 4NAJA 2P52A 2C3VA 4P9MH 1FFPA 2VNCA 3P73A 4Z0XB 1UWEL 1N59B 2JKSA 4K8RH 4MJ6B 4M4RA 4U6VH 4PJBA 4FI8A 4JKLA 1OB0A 3L2NA 3AW5A 2ZX7A 3QORB 3MRBB 3TBTA 3FH7A 2A73A 2UWEF 3NJIA 3JWOH 3BWSA 3IKKA 3ULAB 4GG6B 5LGJB 4MSWB 2A6DA 1QHPA 1T66C 2R2HB 5H94A 5DQJB 1F1GA 1W16A 3O45B 3O3AA 1TCRB 3S36L 2BRRH 2OULB 3QYCA 5B38B 3DGGA 4UU9A 3SDXF 3T3ME 1MCLA 3FQTB 1QI3A 1ETZB 1FNAA 1OPOA 2QT6A 3BKCH 3CZSA 1IM9A 5GGSB 3WNNA 3DX4A 5HYQA 1MRCH 2Y9RT 3TVMC 5IEHA 4PJFF 1TSHA 4M6NL 3U2SB 5DQDL 3IXAA 5CGBA 4DAGH 4LDLB 1R3LA 4DO6A 1RP8A 4ZBJA 2Y5TB 3T08A 1HSAB 3RVUD 3ULUH 1EA9C 1WFTA 3N6YA 4LPWA 3KXFB 5MP6L 1PX4A 4HBCL 4MNQD 2P5WD 5GRJL 4EE2A 1J8HE 1E4WH 4FN0A 5DA4A 4LEOB 3RDTC 3NIGF 2O61A 1K85A 3L81A 5T3XE 5IJBC 4RMVA 4WI5A 5D7IA 2OMXA 1MQKH 3P9LA 4HFUL 5C08A 1XTLA 3B9KD 1NGQL 1AOHA 3GTVA 1HIMH 4ELMA 4MAYD 2O5XH 3EOBA 4D7PA 5GGUA 2AFNA 3SD2A 2O5YL 2XN2A 4WHYH 5D1ZD 3RGVC 2IJ0C 2VIRB 4WF7A 4N0UB 3QIBD 1F11A 1NAML 3N44F 3HUJB 1WS8A 2UWEA 1FFNA 1RZIA 4MX7B 1KLFA 4FTVB 4BFIA 4PREA 3ZZQA 1IFHL 3C5XA 1K4DB 2FYYA 3K80A 2ZCZA 3NZ8B 2CLRB 1NAMH 1AO7E 3RZCA 2B5IB 2AQ3A 4JLRA 4QMEA 3EO9L 1XX9C 2H6OA 4PRHD 3TBSA 3MYJA 1EDQA 5HYIA 4R96A 3WTVA 1KGXA 4IJTA 4ELDA 5BZDA 1AGEB 1RUKH 2VLRB 1EMTL 3K91A 1A7BA 4Z7QE 1CD8A 1EFQA 4HKXB 2EXYD 3QCTH 5AVTB 3OTTA 4K4KA 2ZOLA 3B56A 2H1PH 2A5UA 4WSJA 1BF5A 2ZX8A 3CFTA 3OKMB 2EH7L 4FKEA 4IMLB 3U0PB 5HYSA 5GRJH 3ZT6A 1KIUA 1MJJB 1XGPA 2H7WA 3ARGD 5F72S 1QHOA 1P7KB 1KJ2H 2BP8B 4ZPVA 3S3BB 4MB3A 3QZBA 3E1F1 4PLOB 3VM7A 4PJAE 1G7QB 3G5WA 3K4DA 4PWGA 2F54A 3DSFH 1G7MA 1PG7W 5KSBF 1IGIH 1IL1B 1ED3B 4MRCA 3D4CA 4NGHL 4MAYC 4FQ1L 1UM6L 3AM8C 4ACTA 1MHCA 4F2FA 3R1GH 2YAHA 4XMPH 3SJVB 2HA1A 1F4XH 2FH8A 2NRDA 2WXKA 3OAUH 3GBMH 4UOW0 3OZ9H 3ELAT 4CBZA 2FHFA 4WWOA 1A0QH 4LHJB 4MKMA 2TRHA 4XBEH 4ICWA 3BH9A 3MREA 1FNSL 4MAYB 4S2SB 3FCBA 3A67L 3FUKA 3GKWL 3QXAB 5IEKA 3IETB 3IDNA 1TVBB 2WLMA 1T89A 3FTYA 3OLDA 1VIWA 2WXQA 4Q0XL 4L3FA 2P5WA 3O3EB 5F88B 2OFQA 3GMOB 4BINA 3JWDC 1BBJA 2DQCL 3JZYA 2ICWA 5CCGE 2YARA 4M56A 3HC0B 4ZG1A 5E8DH 2DYRB 4WGWB 4Y4KB 1P9MC 5D6CB 2B4CC 1B9KA 3ZDZB 1J0IA 2BWIA 3MV7D 4LIQH 4Q52A 4QRQB 3UDWC 3UZQA 4WSKA 4N0CD 1CICA 1NM4A 1I9IL 1LWRA 4QRPE 4OGYL 5KVGE 4P23D 3QUXC 3QJUB 5AL8A 3DGDA 3KPLA 3NJJA 5D1XA 4BFBD 1U91A 3PF2A 3KBPA 2BHFA 1AS6A 1F3JA 4ZT1A 3FCTA 1DDHB 3Q6GH 5FFOA 2EAEA 1WT5C 4K8RC 1MCSA 1DE4B 3MCKB 2XWTA 3PYCA 2WNWA 4NBYB 3SGJA 4DW2L 3VGDA 1THAA 1FYHB 2GYSA 3C6LD 2VZVA 1J1XH 1HZLA 3R4RA 2BIPA 1IC4H 1WC7B 1E6JH 1GZHA 2EKJA 3PWLB 4HCIA 5E2TL 3OVUB 4AW7A 1DCEA 4LT7A 1XH3A 4MCYA 3TLRA 2IBBA 3NIDB 3QEUA 3CSTA 3VW3L 5I19H 1WAAA 3GZQA 4UQ3B 1FZMB 2VM3A 4G9FD 3T4YB 2W9DH 3BKYH 1INQA 3DHUA 3LHPH 8PAZA 1IGFL 4QCIA 4QTIL 4LVNC 2E6QA 2J2ZB 3ZDWA 2VMDA 4H8WL 1UM4L 4ZSOB 1X7TA 2R4RL 3SKNB 1MCWW 3VFWB 2QADD 1ADQH 2BNRB 3UTOA 3QI9A 2IPTL 2AK4A 3TVMB 3MOBL 1PFCA 2B14A 4XC3L 1S2EA 2I60L 3I6LD 1XSIA 1E28A 4PW4A 3T4AC 3P9MB 1QTSA 1C5BL 1SXZA 2AJ3B 4F8QA 4PJ8B 4RFOH 3UTSE 3ULUC 4O9HH 1N5AA 3QZOA 2OX5B 2GSIB 3GSWA 3SYQA 1VB9A 4PW9A 1I3GH 3O4LD 1V55B 4I5BA 3D06A 2BSEA 1EEZB 3EZJB 3BT2L 3FQYA 1XTMA 1KYUA 4Z3FA 3RTQB 1T0OA 1OTSD 1QQDA 4Z0BH 2RAMA 4V1DD 1ETA1 3HN3A 2MCPL 1QFWH 2OW6A 4G70B 1I1FA 4EUPB 3QORC 5F2FA 1OAKL 1RSYA 1PF3A 4HUUB 3LEVL 3S3PA 4XO8A 4M6OL 4WW1A 5C0DB 3WIIL 4HJGA 1NGPH 4N5EC 5E56A 4AEEA 5IIEA 3TEYA 1B2YA 5JXED 5I6LA 3OHMB 15C8L 2IWKA 4BFIB 1R5VB 3QIWB 2C8NA 5D4QA 4NT6B 2UZXA 4ISVA 4TVPL 2YD6A 4X8JA 3O6KH 4EQ2A 3VD1A 3X11B 4IBQA 4DP4X 2BDNL 1L9TA 2ITFA 4OZFG 4JFXA 1KULA 4XN5A 3SDAA 4POZC 3WL9A 4L8DA 2RQ8A 4GI6A 4G6KL 3I6GA 1VEPA 5AZ2L 2X10A 3CVIL 3ZKXC 2W07A 5I1GH 4ZTOL 4L3ED 3I50H 2YGNA 2XG5B 3WIFB 5JLZA 1U58A 2NCEA 1M7DB 3LN4B 4FLRA 4BBWA 1JZ8A 4GSUA 4UQ9A 2R1XB 2H8PA 3QQ3A 3HG5A 2EDWA 1DBKL 2IFFH 1CF8L 3TPUA 1OAXH 4IBLT 4IGBD 1KCUL 3VWJC 2EE0A 3DX3A 1JMZA 2ADIA 5HJ3B 1FRGL 3LEXB 1CYXA 4PV8B 2ZZUT 7FABH 1MFEH 1EDYA 4PGZA 3U30B 3HOGA 5BUGA 1VFOA 1QR1A 1UXSA 1YSOA 1PFOA 1DSFL 4LLAA 4A66A 1NDMA 4JFFB 5F7AA 3KVPA 1EEYB 3WFCH 3VM5A 4BUGA 4AEHH 1ETB1 5TPWH 3ZHKA 1O9WA 2VR5A 5I71C 2KBGA 2X9YA 4LARL 2X89A 3RUGB 4YHNA 2IDUA 4TVPD 3W0WB 4IJ3C 4QHKJ 4Q9RH 1N8OE 5KYWA 1IQDB 4HXBH 2WY3B 2V4LA 4K2UL 4KGLA 2ISDA 4K55A 1OO2A 2VABB 3ABGA 3QHFH 4QRRD 5L2JB 4MZ3A 1QABA 3HPLA 5KBLA 1BQSA 4OJFL 3RLSA 3CVIH 3VRIA 5I1GL 3NABH 2A6IA 4PJAF 3CLFH 4XCFL 3RU8H 4HWZA 2E7CA 2F7IA 4WFFD 2A7BA 4H8PA 4TSAH 4DPCX 1HINL 5IB2B 5ADPL 2N59A 2ALWA 3L3KA 3OKLA 4ONFH 3VRLE 5B4MC 4U1KB 3FQ2A 5FYKD 2H9GB 2NNAA 1A3RL 3ALPA 4FOMA 5GGTH 4C57C 3GMPA 4CVZB 5FLVA 5I1JH 1TVHA 4A7VA 4FQ2H 4U1SB 4V1DE 4M7KH 2B16A 4Z3EA 2BNRD 4ZX6A 2R9HD 2V2XA 3CXDH 2PWEA 3KM2A 4Z7OE 2R0ZH 3KDMB 4GG6F 2VCOA 1IEHA 2DDQL 5DVOA 5J8OA 4UQ2A 3WV0A 4JCMA 3UX9B 2V3FA 3ZL2A 5DR5L 4FXGA 3ZT7A 2YAQA 4Z76A 2GY7B 3P30L 2XNAB 1XCWA 4P2YA 1QSEE 3K4AA 4PRAA 3UYOD 3I84A 2OYPA 1E4XH 1CBVH 4MZ2A 2DLIA 2EXTA 3C6LB 1E8WA 3W39A 2FEJA 5DS8A 2K1MA 3FOLA 4YLCA 4KJPD 4PJFB 1I3GL 1PZ3A 2GBVA 2IWFA 3L2LA 3FMGH 1LVEA 4FFVC 3RX5A 3FS9A 1A3QA 1AKPA 5C08D 1LYQA 4DN4H 3SPIA 4MVBC 5K1VA 1PCSA 1S7XA 2APVA 2Z35B 1BGXH 1HEZA 3HNTL 4X99B 2QQNL 5CHNB 4F57L 4KDTA 4R97C 3WKML 2NY5H 1ZVHA 3ATBA 4ONFL 3BIAX 5LQBL 5GJTH 3NUKA 2VLLA 2CLVB 2VN6A 3IFNL 3QRGH 3QT2A 3U9PL 2WKLA 1A21A 1VZGA 2CMRH 4HJSA 2Y6SC 1V7NL 2FNWA 4K7FA 4LCWB 4DP2X 2EO1A 1D6EB 4W9LC 4OZFB 2XFXB 1INDL 5KYNA 1M3JA 2A9AA 3MV7A 3WNJA 3HG1A 3L7FA 2JTYA 3BPOC 2VLJE 2EYSB 4Y4KC 3WFEL 1TDQA 2AQSA 2BNQE 4W9EC 4ZMZA 4G42B 1K4CA 1U8JB 4RNRB 1DLHA 3QXVA 2Y07L 3IU3B 3N40P 3GS7A 3QNYA 4ZPTB 5T3XH 2DWSA 1YN6B 3QDMB 2RGSA 3GBEA 1AD0A 3QDJB 4OFYD 4PS3A 3HNTH 5INCA 1FIGH 3BKMH 3TPUB 3FFOA 4NN6C 3Q6GL 1U93A 3EGDA 5FO7A 5F3HB 1R5VA 3O3BA 2UUDK 3QIWA 5DK0A 1IUZA 1EZUA 3EF7A 3H0TA 1VRSA 1TSRA 4PY8J 4BZ2A 4ZFOB 1XT5A 2Y1ZA 3LZLA 3FUFA 2M8XA 1JWSB 1QFPA 3U7AA 3LKQB 1S7UB 3BUPA 5HHXH 1RP9A 1U30A 1P5VA 1IAKA 1NMBH 4PLKC 4GQ9L 4OM0L 3CHPA 5T1KB 1H0DB 1E4KA 4TSAL 1T6BX 5E9AA 2E74C 5AOKA 2PPDA 2FL5A 3BIBX 4V2BA 4GP5B 3MRNA 2DQIH 2NY7L 1WAPA 5E6ID 5CZVH 2D0HA 3WLBA 4R2GC 4FX5A 4YDNA 4U7MA 1URZA 2VISA 4NKDB 5H35B 5EIVA 2ZSWA 1IO4C 1YMHA 1KXVC 4O02A 2D4DA 3C2AL 1I8LC 2AJYL 4XZ4A 3V6FA 3AC0A 4F7EA 3DVFA 3ZMRA 4MCZA 2IH8A 1JZ2A 5DEFB 2O6CA 1N8ZA 3QIUB 4X0NA 2ZAHA 3ELQA 1ZT7B 2Y69B 4JE4B 5EO9B 4UQEA 1YA5A 4NXSA 5HHVH 3ZZSA 1UG9A 5AW9B 3RPIB 4JY4B 1BMZA 1LO5A 2E47A 2BSED 2Y7LA 1CMOA 2NW3B 1KZQA 4HWNA 3IJ9A 4CSPA 4HCFA 4G9FE 1I3RB 2B20A 2JELH 2VB5A 3GZOA 4LRNH 5FKPA 2Q9OA 4K8RD 1ZWIB 3BQUD 1MFEL 4POUB 5CEYA 3BVVA 4U6YB 4HUXA 4UAHA 4WV1C 2E7LC 3BUIA 1JXGA 5E0QA 2F5AH 1OT1A 4JDVB 4KY1H 4QXTB 1D7CA 2VXUL 3TO4D 4C4KT 1F41A 5GRVL 5CJQL 1AE6H 3HC4L 4NC0B 3WNKA 3RWCA 1N0LA 5DUPL 4HUVA 2OA9A 4FFYA 1YCSA 4BGLA 2HRPH 4WNQB 3ARPA 1PLCA 5FYKE 1YEJH 4I3RL 3BHBB 3VDBA 5DS1A 1H8OA 3KYOA 2XV0A 5AZ2H 2NNFA 5DFTA 5LNDA 3TIDB 3SE6A 4QRPD 3PGDA 2CIKB 1RK7A 1I1CA 3N1QC 3JBG7 3ZKMC 4LHUD 3W56A 3K2KA 3SZKC 5JNYA 5I6OA 5LN8A 4WUUD 1TKWA 4DIXA 2I7OA 2X09A 4OD2A 3H8NA 4L5FE 4PJGA 2CO7A 2G0KA 5AVYB 3A22A 1BAFH 3NIDF 2WBJA 4OJYA 1NWPA 2NY4D 2GJ6B 1SUJA 3OJVC 1NIAA 1Q94B 4UT9L 4EN3D 4M7ZC 2CIIB 4PGDB 4AM0A 1ES0B 1WWWX 5L88H 1K6QL 4F2MA 2WTRB 4JQIA 1JNHA 4KK6C 3T3MF 6FABL 1TU2B 1YEDA 1R3IH 4AYEC 5EO0A 5IB4A 4MMXA 1F45A 1JPEA 3MV7E 4JDTH 3WTUA 1YAZA 1KCVL 4C58B 3UAJA 3FYEB 2WLJA 3F6LA 5CJXC 5E6SB 2G0LA 2ESVD 4KQ4L 3IFOA 2GUOA 3HZKA 3QDME 2PYFA 3UYRL 1JNNL 4TVPH 4C56A 1AD9A 3LRHA 4TPRH 2UZIL 1Z0NA 2OTWA 3OLIA 2X28A 4LLVB 4RFEA 3ARGC 1KLGB 1B4RA 2AK1H 2WKOF 2NXYB 1EAQA 3BP6B 5T1DL 2ARWA 5ACZB 1XD0A 4ZS6D 2EDBA 1MRCL 1FGNL 3ZE2F 5B39B 1JBJA 3FQUA 5KZCB 1JPGA 1JHTB 1Z7JA 4YHKH 3AREA 5T8IA 4P5KB 4ZFOA 5L8JB 5LLIC 2Q76A 2B9AA 3OKEA 2CRZA 5D7KE 3RWEA 4EI5B 2XWBA 3HBQA 1IGFH 2Z64C 4S1QH 4L8BA 1MWOA 1PX3A 4UF7C 2XBTA 2Z0BA 4NKOA 1I1FB 2HG5A 2WZ5A 3CFKB 1AIFB 3NPSC 1S8DA 4DESA 3VD7A 1JNJA 1U8QB 4IOSD 2F2HA 2OI9C 4O9HL 1HH6B 1FNGA 1NMCC 2CO3A 4GUPB 4GW5A 1TZHB 4JK0D 1UWXH 3PHOB 1G84A 5I8OH 4ZUUB 4JZNA 2L7EA 2F53A 2P8PA 3V6OC 4K8RL 3NP4A 5F1SA 1E42A 5FCUL 4EDXA 2G60H 3ULVD 4KKQA 3KL5A 3U7WL 5DFWH 2XVBA 1IAIL 1ZLDA 4BZ1H 5MERA 4N8PA 2B08A 2HX7A 1MFBL 1UOLA 1LO4H 1PZ5A 4XBPB 4AUUA 4PRNB 3OC5A 3Q3GA 3UJTL 1FE8L 4K23L 4WJ5A 4X5RA 2ZWZA 3RY4A 1OGAA 2OTPA 3O8XB 1U8OB 2NT1A 2R2BA 2WXRA 4R7XA 5DTFA 2B59B 4ZS6C 2K0RA 4NQDA 4S11A 4QRSB 3Q48A 5K59E 4OIIH 1W72B 3UBXB 1ODAA 4JPIA 3GMRA 3FRPG 3VXRE 3NCCB 4CADB 4L48A 5EF1A 3E80A 4JHVA 4RFNC 5JPMC 2OMTB 1E90A 5AKVA 3SN6N 1WVZA 3HVNA 4UQDA 1PX8A 4HV8A 4NKMB 1K3ZA 3LXCA 4PWEA 1MF2L 4KTDL 3TA4D 1U95A 2YD0A 2VAJA 1QFWI 5SWSA 3K0YA 1F0LA 3JYBA 4LNRA 4CW1B 1QI5A 5GHWL 1IRAY 2AVGA 1WTLA 4X6DB 2NY2B 3FCSB 3NCMA 5KUMA 3B3BA 4QY8A 3AABA 3F7YA 3KGRA 3NK4A 5I75B 3LQZB 5F3BB 4F15B 1A22B 4U6XB 1AR1C 3BWAA 5ABDE 1I3VA 4MNQE 5DJDA 4CSSA 1F4XL 3KWUA 1LP9B 1F3RB 3QJFB 4OCYH 4U33A 3VFTA 5AUMB 4A7GA 1UM6H 4AENB 2XZQL 4M4RB 4UNTA 4FQLH 5DVKA 1YYLH 2V3EA 1XMEB 4J4PA 3VX1A 1BWMA 1EHKB 3FK3A 4RETB 3TBBA 3LRSB 2NTFB 3EYOB 1J86A 3IE9A 1MJ7L 4PJXA 1GC1H 2ZXWB 4KQ3L 5EDXA 2QBWA 3PWNA 3A3YB 1GY2A 3BHBA 5LG6A 2P26A 1AHKA 4JPQA 4ETQB 5HVWA 1SJEA 2W65B 5EORH 3WEXA 3WUWG 3TIDA 3LRKA 1JV2B 3UTZB 5HGHA 3G6JA 2G4EA 1EJ6A 2ZTBA 1OE3A 5DUBA 5FUOH 3FO2B 1MCIA 1TKWB 1E27A 3QUMB 3T1FB 1DQJA 2G75B 2XN1A 4PTUA 3ARZA 4N86A 2D73A 3SDCB 1OPGH 3V4VH 2MKLC 2VDLL 1GGCL 4ODXA 3T65A 4ZO6A 3VXMB 2PO6C 1KTCA 1JV5A 3HE6D 1SN5A 4FG4A 5T5FL 4PRAB 1WA2X 2P47B 4BK5A 4HT1L 4GLRH 4WQOA 1AO7D 3QDHA 2O5XL 3T0EC 4M5ZL 3B7SA 4NS0A 2YQGA 1I7TA 1BQUA 3GJFB 4UAOB 1S8DB 2WUBL 1DVFD 3MFFA 1PS3A 1UA6L 3MLSH 4FL4B 3AACA 2EXWD 5B22A 3R8QA 4AQ8C 4EKXA 4U3SB 1UWEH 3JWNH 4C83B 1QLRA 3HZVA 3DTUB 1EAPA 2FBRA 4ZUWB 1DEEB 1EHNA 1P84K 5HDOA 3MSPA 3JTTB 3W9DB 4DKEH 2ZYRA 4OIIL 4WHTA 3H6JA 5E1GA 4YHPB 5BNXD 4HUNB 2WBXA 3M7OA 4YBLC 1DLFL 1M1XA 4XAKE 2VKXA 3DUSA 4R84A 4EBQH 5EN3A 3T3PB 3AS1A 4HPYL 2XV2A 1A4BA 5BZDB 1QP1A 3HMXL 1GTFA 3UABA 4YDLC 3RVWD 4F27A 3BVTA 4E9SA 3O9WC 3GHEH 3TZVD 1IAIH 1L3WA 3O8XA 3QEQE 3BVXA 3LCYA 1UJ3C 2ZXAA 4NKOB 3T6QC 3W11D 5IF0B 1PZBA 1XGQA 2ERJC 2HKFL 3QZWG 4R2GB 3ILDA 3AWEA 1UM5L 2HH0L 2ZX5A 4C56E 3HPJA 1RQ5A 2AXFA 4JPSA 4PJ5A 4L8CB 4XRCB 2IXQB 3MNZB 2QMKA 1R3KB 2QEJA 4HFWB 2ID5A 4TUOB 1HKFA 1FCGA 4WENB 5F7BA 2P8PB 1D6VL 4EN2A 3FO0L 3PP3K 3RWIB 4WFEE 1DSYA 4LLYA 4AVIA 3RIKA 1W0WA 4X5QA 1NPUA 5DC2A 5LXGH 4HSAC 2VJXA 5K59F 4K94L 4KRLB 1HT6A 3RPKA 5EU5B 5EUOA 5TFSL 1D5BA 3IJ7A 2CUMA 4TLTA 4WI6A 4KI5C 4DEPB 1GMIA 1WG3A 3RX9A 4KKLD 5DJXA 5E9DA 2VO8A 1QPKA 3VB8A 3HS9A 5IMLB 3AQZA 5I5IA 1T80A 4CU6A 3QXTA 2FJSA 2WO3B 1WV7T 1ZJAA 2Q3ZA 3SPGA 4BDVA 3G08A 2WPGA 1X4ZA 5BVJB 1O7SA 5ITBH 1BZQK 2WBWB 1YAIA 3GXFA 1NEUA 2R9HC 2IEPA 1XL6A 1X7QA 2BFGA 2DM3A 3CXHJ 5E1HB 3WS6C 2YZ1A 5C9JB 4OV5A 1SEBB 1NC2D 4WUUE 3PREA 4WI0B 1X5GA 2BOCB 5JXAH 4AK1A 1IL1A 1I31A 1XF4A 4KRPD 4R7LA 3RVVC 3WELA 3IGAA 5FPIA 5KW9L 2SODB 1QOKA 5I5JA 4U1JA 2DYSB 1AY1H 1QWUA 4ZAKC 3NZHL 4JB9H 2OXHB 3B6SB 4E5XB 3WTSA 1CLZL 1CFBA 4Y19A 4QEGA 4C59B 1QPXA 1RIUL 1TR7A 4FFZA 2JF1A 2DMCA 4QO1A 4W9CC 2JKLA 4PJBB 5CP3H 3MRIA 5C0FB 2LU7A 4EXKA 4RBPH 1QATA 4B53A 3OGOE 4GRWF 1T2JA 4AENA 3FUMA 3L3HA 4M6ML 1I8KA 3IDXH 4WZ9A 5I74C 1YEIL 4FG6C 3MLSL 4GNKB 4PGBB 1A4KA 1GYUA 3TEWA 1FNLA 1DHKA 2VSMB 1BBJB 2WUBH 2BHZA 4XNXH 4JCWA 3RVWC 4OV6F 1TCRA 2YXVA 4WU5B 2FHBA 4PJCA 4BH8A 3CG8A 4WO4A 2W9EH 4G8EB 2QPDB 4MFHA 4MD0B 5C9KA 4O51A 3T4YA 4HIXL 3TCLA 3ASOB 1WFJA 3VGFA 4LU5L 3COOA 4U6TA 1CGVA 4FFWC 3EIFA 4R7DB 3ZK0A 3RA7H 3ZTEA 3FN9A 1JHLH 2X6CA 4RRPA 3HC4H 3H85A 1ETJA 4Q6IB 1JXDA 4XBGA 3HEIB 5GGTA 2WXPA 3GXPA 4KZEH 1BBDH 4FNLL 1PKQA 3D4YA 2BSRA 3US1A 1JE6A 1J5OL 4KK9D 3BQUB 4PGEB 4ANKA 1G6RA 2J1WA 2XQ0A 5DF0A 5LG1A 4UT7L 2CXKA 3II1A 4P4KD 5J1AA 4HULB 1AGDB 5ELIA 3KPNB 4MNGB 4UB0L 3VVWA 4E9YA 3PIQB 2WLKA 3U6RA 2CNZA 2Y5QA 2CCLA 2ZWYA 5HHNB 2J1XA 1NUDA 4JHUA 1WC7A 4G83A 1KCVH 1SHWA 3D51A 3HI5L 3NCJH 4I0PC 1ZTXE 5KN5A 2CPCA 2RQEA 1OKEA 3BQVA 3LS4H 3KPPA 1INQB 2GY5A 4TV3A 3GJFA 1J9RA 1QRKA 5DHYA 5IP4A 3L4WA 5SX5K 4XWOD 4HH8A 1IILE 4R5TA 1BFOA 1SMDA 4TRPL 1YYLL 4PYGA 2Z7UA 2BNQA 1KPUA 2WYHA 4D9QE 1IBZA 4PRPD 5AW6B 3FFCB 3HTLX 1HQRB 2WXJA 1D5MB 5IHZB 1F2QA 1EEQA 2AGJH 2WYTA 3ZZLA 2I07B 3CXHK 4LSQL 3ULUE 1PG7X 1W0VA 1FVCA 2ATAA 2X4UB 2P46B 3SDAB 3SE9L 3GMMB 1DQMH 2W0PA 4RVBA 3H7BB 1IGCH 5I0YA 5DZNA 4ZFQA 5A16A 3AGWA 3VGAB 3DSNB 3DURB 3ARBC 3TXAA 4CN1A 1MHPH 1WJ3A 1I8MB 4XCNB 3UP6A 3L9BA 4NZFA 5JXEC 3OKDB 4JPVL 1JD9A 3QQ3B 3GBLA 5DEZA 3QJRB 2OI9B 2JJVA 2VSDA 5EB9A 3RI5K 3KLSA 2AS5M 3ZKXB 2BXYA 3WNIA 3GXMA 3DV6B 3L3JB 2JXMA 1ZA3B 2E7DA 3WOVA 3KPSB 1L7TL 4H1LB 4I3SH 2CR6A 2COVD 2IIJA 1FLRH 1PG7L 2JQMA 3GGWA 4LHUG 4I0KA 1G4RA 4N25A 4PY8I 4JRWA 3TN0B 4B9YA 3O0LA 3WKYA 3IGKA 3KPQB 1TJGH 1T1XA 3LKRA 3OLGA 3TASA 2V5SA 4ODUA 1D5XA 1HHIB 1MCCA 3G6AB 3ML8A 4BH7A 1ZV9A 1XWVA 4HIIB 5EOCH 3VFRB 3F62A 4QYOA 4KKBD 5FCUH 3NEOA 4JLRB 3HG3A 3BVDB 1JPTL 4I48B 3AU1B 1BJ1H 3QAZC 4R0LC 1OARH 2C3WA 2XG5A 3F85A 1H6TA 1MCRA 1ZIAA 2NYYC 3L3HB 1N5YH 1IGCL 4HIQA 3GBNH 4AXWB 1YNTA 1QSFA 1UJTA 3PGFH 3DTXA 4PJXE 2D7NA 5IW1A 3O11A 1N19A 1UZ8B 1AP2B 2F54D 4XB3A 5DVPA 1YN7A 1AHMA 3ABMB 4IDJH 4KJYB 2OYMA 4E9LA 3FAWA 4MJIE 4MD0A 4OZGA 5C6TH 1VZIA 2HZHA 3M6DA 1FORL 4EO5A 4ZNEE 1E67A 2Y23A 4BCXA 3FT2B 1KZYA 5L4IA 4ACPA 3APFA 2Z4QA 2CD0A 3T4AB 2AJVH 3GSQA 5E23A 2NNAB 4CRPA 4NQEB 3S9DB 3TYGL 1XAKA 2IWEA 2GIMA 5FC9A 3TO2A 1C8QA 2F7OA 2YUVA 1CR9H 4G9FB 4U3HA 2P80D 1BQKA 2C9AA 2R59A 3O0RH 3QUMH 3SQOH 5KS9A 5CCJA 3K2UL 1TYRA 4OTXL 5ESAA 1EHXA 1OF2B 4OQTA 2WTOA 1ZLVK 3KLHC 2O1AA 5H8DA 5A2FA 3I3BA 3BD3A 3KH4A 1G7PB 3CFNA 3EF4A 1NCBL 3QUXD 3SO3C 3VRJB 3L9EA 1C12A 3PIQA 3K81A 4QWWC 5JPNB 1LE9A 3V8OA 1HILA 1MN4A 4MMZB 2W65A 3QDMD 4L9LB 1IBHA 4LBEB 3IFPA 3S34H 1IEBB 4DP5X 4NCC1 3O3AB 4PWIA 1JGLH 2D9CA 4GT7A 4ZO7A 5DJCB 4BXVA 4FKKA 2OYKA 4UT9H 3RIFK 5B1JA 1T6WA 3V55A 1Z9NA 5B21A 1BM3L 1SY6L 4OD3L 3U36A 4IRJB 2BPBA 4G59C 4LCUA 1A2YA 4YEFA 2ICEB 3BDXA 4LARH 4YDZA 3ETTA 4DHLA 2GIXA 4GXUN 4Q8BA 3LN9A 1ECZA 5ABAA 4Z18A 3PNRB 1ZIBA 4YC2C 2WTPA 1R5IB 4Z7WA 1OAZH 1HC1A 1SXCA 3II2A 1CXLA 5D7KD 1R3LB 4HWBA 5E00B 2XACC 4N2OA 2KQNA 2NOYA 3Q5TA 2OMVA 4ELME 3VXQA 1LD9B 2XV6B 4TULH 4WWKC 5CUSL 5GSVB 1D9KB 2A83B 4P48A 4Z7UF 2A0LD 2FSEA 5EG6C 3Q1SH 3UTTA 4NN7B 1VPOL 2J8UE 1ZPUA 4XPBL 3DURA 3LQAL 1E5ZA 2A77H 5LGYA 43CAA 4NENB 3F8UB 1RZ7H 3KPPB 4QOKA 1E3ZA 3CSBA 4HP5A 4CMHC 1P6FA 5EF2A 3FT9A 3MBXH 4DNLA 3NK3A 4XPAL 3SYOA 2MQCA 2NQCA 4KY1L 1CVSC 3TM6A 2BVPA 3MCYA 3KPSE 4MJ4A 4HALA 3SE4A 5FUZH 2X4PB 4OKDA 3BEVB 1KCRL 4JFEE 2QR0A 4RZCB 5DJAB 5HYEA 4LSDA 5IB3B 1BZ9B 3CPLB 1AR2A 4ZAKA 4XAKD 4XX1E 2CHXA 4B3EA 3M17B 4FTVD 3ESMA 1WIUA 4K7FB 4NDMA 4PJ9D 3WMQA 2ITEA 1RUAH 3WEMA 1BV8A 4WCYH 1ZT1B 1MHHB 4K3EL 3QWOB 5AVRB 4BELD 2NY4C 1RI8A 4ENZA 2XT1B 1ZEAL 5D7LB 4KKCC 1JF1A 4P9HH 3V9EA 1J12A 4HVBA 4U0RC 3D3VE 2JI1A 4MXWH 1DFXA 4S1SH 1M9SA 3KGTA 1CE6A 2IADB 1O0VA 3BLKA 1OAKH 5I1AB 2CKBB 4ZZFA 3VXRB 3JT0A 4MNQB 4OZIB 3NEXA 3IN0A 5KSAA 1RZ8A 3FXIC 1MCPL 5IKCA 3LQAH 2DS4A 4EUPH 4GQZA 3CSFA 3ZOAA 1ILSA 4WW1B 5GZNA 3ISYA 4HS8H 2HFGH 3TBYA 5M94B 4QRPB 3QIBB 4N0YL 1AOZA 4L1BA 3D0LA 1OY3B 2KZBA 3TONA 3ZBMA 1DUYB 4NQED 1H8SA 3H9HA 3GRGA 2ZKYA 1P5UA 2JVUA 3U9WA 2I60H 2F58L 3ZVVA 5FX3A 1K2DB 1N2RA 3V5HA 3MROB 4A04A 1AQKH 5TQ2H 4GFTB 1RZJC 3P77A 4AV5A 2O30A 4BQ9A 4ZX4A 1RZKL 1IQWL 5LXVA 3VMNA 3BWUC 4GRMA 4N2MA 4WO4D 2BOCA 2FQGA 3CHRA 2XX1A 3V0DA 4N2KA 5IW1B 3CDZA 4YWGL 3SB3A 4HMEA 1Z2KA 1NCWH 2ZIDA 2ICWB 4P57A 3WMPA 3S35L 1WD8A 2C4XA 3BYYA 3L5XH 3VG0L 1L6ZA 2VH5L 2OXGA 4J1UB 5B8CC 1H6EA 4U05A 2WVTA 2J5WA 5FDYA 3QIUD 5ERWA 5JW5A 1P69B 1JWUA 3EFDL 4FJYA 3S5LA 2R0WH 1T5WB 4PVNA 1NWOA 2X12A 1PQZB 3HE7B 3MOAL 3PPSA 1RHFA 5AW1B 4BQ6A 4D9LH 2W9LA 2XTJB 4QO1B 5A3IC 3IDUA 2YEQA 5EIIG 1RMFH 3EJYC 2MPVA 2QQNH 4K9JA 4DQAA 2Y72A 1OT2A 5IJKA 1MJ8L 4LCYB 2GJPA 3SKJL 1MJUH 1JPSH 2V2TB 3LKSB 3GJFK 3ZTCC 4EOWL 3SODB 3Q44A 4QXTA 5CIPB 3MRBA 2AJSH 1IAOB 4B0MM 3LV3B 4DP9X 3HBZA 3SKMB 2XWTB 2CNYA 1D9KC 4QHMB 1T1WB 1SM3L 1LK2B 3DIDA 5F0PB 3U1QA 2E9JA 3N85H 2R2HA 2UY7B 1D9KA 3PV6B 2NTSP 1KJ2B 3D39E 1Y1DA 2PP9A 3JVFC 1CLOL 5T1KD 4DKDC 5IMKB 1IM3D 3UZVA 3E0GA 1TTCA 4YDMA 2XWCA 3QHTC 2EEDA 4R9HA 3BXNA 3IDGA 4L1SA 2DDQH 4K7PL 4URKA 3IXTB 5HDRA 3VXTB 1O6TA 4KVCL 3BGFB 4TSCL 1A2YB 2IH3B 2ZJSH 3GBNL 4HOXA 5IVXB 3TFBA 4X6FA 2FHCA 5A40E 4LEBA 3FTVA 4W6YB 5GZND 3W5MA 2WJ5A 4JFDD 2BNRA 2MQGA 3TBSB 3G6DH 1KY6A 2KMWA 3SYAA 2FJHA 1NGYA 4P3DA 3CZFA 5DFVC 3CFCH 3UYPA 5B8CA 4GKZA 3DDGA 3GINA 2HYMA 4Y16A 3TVMD 5DRZB 1XXDC 4HETA 1RUQL 1G9MC 2R2CA 1NCHA 4H4NA 3OMNB 4OW6A 4I5BB 4LFHD 5JOFA 4MVBD 4KJWC 3RB5A 5IBLD 1SNRA 3WXWL 1F3DH 4B41A 1HL8A 5I6PA 4TQEL 3RWDB 4OCYL 2LQRA 4FXKC 4MD5A 1TQWA 2RCSH 2VW6A 3EAKA 4J4PC 4CBPA 3NDZE 5MI0C 1TZHA 4EN3A 4NFCA 3HS0A 1U93B 3GSNL 2QSCL 4IBZA 3UJJL 4JN1L 3S7GA 1HCFX 1U8CB 1WP6A 2YA1A 4ZMXA 2F5BH 4L3AA 4NKQB 4MNQA 1BAGA 3P4OA 1X5XA 1HTYA 4BWUA 5BJTA 1NBZB 4FMFA 1LILA 2HT2D 1T7ZA 4KI5E 1YUHB 1M42A 2ZUSA 2F54E 4FNRA 43C9A 3HC3H 2JIXA 2NSQA 3T2PA 3ROOB 2YKKA 4I4WB 4JKNA 4OT1L 1OE2A 3ETBF 5D1ZB 1M71A 1OVZA 5AB2A 3FO9B 2ED6A 4I77L 4P9HC 2RCSL 5BRZD 2OSYA 4NQSB 4HBQA 1MH5B 1UZ6E 2FIKB 4NC1C 3PJSA 3Q2WA 3DO7A 5FFLA 2BZDA 2DW5A 2C9QA 3NIDE 4BSVB 2JKJA 1KUMA 4PP2B 4ZTOH 1WFMA 2OMNA 2E75C 1NFDE 5JORA 2APFA 1A47A 5I18L 5I26A 3TF7C 3FHAA 4M6AA 3WHXB 3L1GA 5B1KA 5A2LH 1QSFD 3G3LA 1VZHA 4P5MA 1A6AA 1ZKAA 4Y4HA 3T2OA 3C09B 2CUIA 2ATKB 2DWXA 3MUHL 3SPCA 1PKOA 5I8OL 3QEHA 3UJIH 3KXFD 4N87A 2H6PB 3QJXA 4FLHA 1HYRC 1J9CT 4JQIL 4I2XB 5IFJA 4UB0H 4XCYA 1KC5H 5L8LB 4R6UA 2OL3A 5CU9A 5DGRA 3VH8A 2QPSA 3GM0A 1M05B 3P4NA 3DPDA 1F6AA 2ZWLT 3OPZL 1Q9KB 1NGPL 4KKAC 3QS2A 1WCQA 4Y16D 5EBWB 4WSGA 5HHOE 4ZMYA 3K6SB 1ICTA 5KVEH 5M95B 1HVXA 4NCDA 3LRSA 1AS7A 1M7UA 2HPOA 1AZVA 1FWXA 1S7VA 4XN1A 5GZOC 4YPGB 1Q0YL 1Z1WA 1SN2A 4HWEH 3OR6A 4PRPB 4K7PY 5E94A 5BRPA 1RCYA 5CJ8A 3SD5A 4RMWA 1BYOA 1JMXA 4H20H 2J8UA 3HAEA 1ETZA 2UX7A 3VSVA 5IESL 4LNRB 5CJOH 4CW1A 3B9AA 3FSVA 4J8RA 4PJHB 2HN7B 3BZ4A 3BUYA 1DJSA 4MMYA 1R1CA 5DMJB 3FT3B 5BS0E 2DQDL 3CWGA 4AJ0A 3TO2B 3ZW3A 1C5BH 1GCYA 2FUQA 1NAKH 1FVEA 5EFIA 3X1GA 2PCPA 5LAPA 1ZV2A 2LU5A 3IWVA 5IROC 2H4EA 2AQTA 4BE5A 1DUZB 5JUEL 4C47A 3AB0C 4JM2A 4G8GD 2XKNB 4ERSH 3SQBA 2FZ3A 2HT2C 1TZGH 3B2UC 4OZIE 2PWGA 3KAAA 4NM8H 4FFZH 4U1LA 4UQ2B 1Z66A 2KL6A 2DTMH 1KIRB 3DV4B 2LOEA 4X4YA 3BSGA 4MMXC 3S35H 1KBBA 1DVSA 4ZW3A 3T3PF 3PP4H 2RJMA 2A38A 2OR9L 2A9MH 1DBMH 4JPKL 4K3JL 4O4YH 4Z7VB 3FFCE 5H2BB 2XQYA 1T0PB 1YECL 3Q8AA 2KKQA 5HYSG 1PLGH 2QKSA 2ZF9A 4DW2H 1IV8A 2BCKB 2R8SL 1IBFA 4P05A 1XF2B 5EU4A 1GZQA 3DBXA 5LBSA 2BP3A 4UQIM 3QI9B 4RGNE 1ET8A 1YY9D 2JSFA 5IFHL 4YOKA 1JPGB 3F7KA 4N90E 3HIZA 2I9TB 5HDBB 5L7XL 4NN5C 5GGRA 3HE7C 2F5BL 5DFVD 1IM9B 3ERXA 5EZOL 1FL6B 1GGBH 3SSGA 4OLUL 1U33A 3A6BH 2NUTA 2LTQC 5ENWA 4MNGE 1MZZA 3V0VA 4F58L 5GZNC 2A1WH 3VFWA 1UT9A 3EJTA 2XTJE 4NOBA 4NWUL 3OWRA 2IWGA 4APQB 2L7QA 1VFBA 1QA9B 4GO6B 4E0RB 5IGXH 4NO3A 1YG9A 1FV1A 5K33A 4YSEA 1D6VH 2X05A 5C09E 4ONGH 3VFGH 4TNVF 2NXZD 2FB4H 3MLPA 4JRYD 5JA9A 1AZNA 2DL2A 1ZOXA 4W9KC 5AQ0A 1N68A 2ARJB 5L2KD 2GQHA 3S37H 4OZHF 5I18H 4PB9L 2Y7NA 2FLRT 4L9DA 1WTGT 4NFDA 4PJ5E 1X9UA 4DCQB 4YGVA 4LLVA 4RFEB 1I82A 4XO4A 2JKRM 5MENB 1TQVA 2Z7ZA 5AVUB 1WDAA 4Z7WE 4KV5E 4MASA 5FUZL 3WSQH 2P4AB 5H37H 5AG9A 8FABB 2A3TA 1NGZB 4J3UA 1MY7A 3VG9C 1W8NA 3N5AA 1AGBB 4M48L 5I28A 5SX5H 1FSKB 2NZ9D 4OI8A 2WINA 4I77H 1RUPL 4ODTH 1OCCB 5F7KC 1N64H 1MCKA 4R26L 4V11A 4XPBH 4FP8H 5D6CA 4XRCA 3NN8B 3GD1C 2F6AA 1ZXQA 3KCWA 3ZE1B 2DQJL 4PRPE 2Q7YB 2PABA 5HHME 4FF9A 2YAEA 5GSRA 1OM9A 1UWXK 4ZW6A 2XQBH 3BESR 4I9XA 5F3BA 4WW2B 4MJIA 4A7QA 3SY0B 1U58B 3KD4A 3FTXA 1B4TA 1JTTA 4QHUA 1ZE3C 1P7QA 3EJYD 4XMXA 4M43H 4PEEA 1RMFL 2BZCA 4D8PB 1P53A 4BKTC 3L4ZA 3EH1A 3BH8B 4UIMA 3CIAA 3WDHA 4JFQA 2NW3A 1X44A 3TL5A 3NA4A 3P77B 4ZXBD 4XP9H 4PHXA 3WUWB 1GGYA 5CWSB 2JK5A 5A7BA 4CU8A 1TTUA 3IN2A 4GLRI 1BMGA 4WFFE 1N3NB 3PWPA 1VERA 1NCWL 4ES9A 3UIZA 4XXDB 1UB5B 1N7ML 4GAYB 3HW7A 1HCZA 3VI3F 1KIRA 1CN4A 3SDDB 3IM1A 5A43C 5K5YA 4JQVC 5DJZB 1L6PA 4O58H 1BOYA 2P42B 4PY7B 1DJGA 3FUHA 2PMZA 3B37A 5FXCH 3D0VB 4Z5RA 5E1IA 4KKLC 3VXSB 5KG9A 1JRHH 2E27H 3KWWA 3RDTD 4MA1C 1H9VA 2F53E 3W9EB 3D2UD 5BO1L 3EJSA 5MP6H 4IJ3B 4ODVL 5KYWB 4KNSA 3NA9H 2QQQA 4QTHA 4NC1E 3SDCA 2CGRL 2CWRA 4JMXA 2OX5A 2ZXBA 3RGVD 2V5MA 3V0HA 3VD4A 1ANUA 5DRNA 3QH3A 1KYAA 3H3PL 3QRLA 2WXOA 4JPWL 5GS0D 1T4WA 1T3FB 3HRPA 4LSTH 1CDBA 3U1SH 3HR6A 2VZ1A 4KRNA 2OQJB 3WCYA 1A7QL 1GHFL 1F8TH 1U4FA 4L4VE 2Y06L 5SWQB 4EKJA 5JQ6H 3UOAB 3HLKA 1QO3B 2D7TH 5GS0L 1M7IA 1IEAA 4QHKI 5EZJB 1EBAA 4X9BA 1K4CB 3CXDL 1JI1A 4H1LG 1JPSL 3QNFA 5IVXF 4PS4H 4PJCE 4JHBA 3EOBB 2BP0A 5HI3C 1WIOA 1NDGA 1ZS2A 3T8XB 3NMEA 4WDIA 4GEJA 3DRTB 1AZZC 2DI7A 3PFUA 1CD1A 3BEWA 4N0UA 1UQSA 4Y2DA 5DRXB 5IQNA 2BNQB 1FO0B 4F93B 2V5RA 2KC0A 2KQMA 1DVYA 4KHTL 2XSKA 4R0LA 1JZ6A 4Y2OA 2E59A 1AXTH 1KTKE 1KFAL 4MDJA 2ARJA 3RILA 4DTGH 4OB5L 2GT9A 2H0EA 1KPRA 5AOMA 4CKQA 1XF5A 1WLHA 3MGOA 3RFZA 1EIBA 1Y0LB 5EZIH 1A6TB 1E40A 3I85A 2OP4L 3GMMA 4E42B 3BZ5A 4YK4B 4LCWA 4Z3JA 4DK5A 3H7BA 2DOCA 3P54A 2NYYD 3BPNC 5EZLA 1CICD 3QUZB 5KVDL 2F18A 4GI9A 5JHDB 2VN3A 3DMMD 2EYSA 3IMSA 3ZXAC 3RWHA 1J9SA 5I76A 1QSED 1VGEL 3OSVA 4PV9B 2CAKA 2W88A 4E0RA 4KXZI 5PAZA 3RWJB 1FHNA 3KR3L 3T6XA 3PS6A 4NCC2 4A7GF 2NY2D 1IIKA 2Y22A 3VXOA 1G7QA 1OTTC 1BFOB 2GCYA 2BIOA 4LLYB 4WEBH 2PCYA 3SDXA 1Q9WA 4N8CH 4XE0A 3L4TA 1S9WA 4TVUA 3V4PL 5C0BA 2M2DA 1JGUH 1ZHLB 4U6HB 2GHWB 5E6RB 1U6AH 5GRVK 1Q9LB 3E1ZA 1LO5B 3LS5L 3DX7A 4BZ2H 4C83A 2VR8A 4N6RA 2WIIA 5KOMC 5F1NB 2C3VB 4JRXA 3M8OH 1GCFA 2IG2H 3ZDYE 3QJZA 2IV9A 1FL3A 1KGIA 1RJCA 3G5XA 3L3IB 4KRPB 4DUVA 3APNA 4RGNB 5E99H 1MDTA 1DBAH 4ECNA 2AK1L 3CLEH 3EBHA 3KPMA 3BN3B 2ATPA 2UZIH 3O8XC 4TPRL 4HJJH 2A9DA 2ICWI 1LQBC 2GSGB 3KEHA 5FS5A 4P3CH 3E8VA 4IDLA 1EJOH 1ZVSA 3RWGA 3SDAC 2VTFA 4N0FA 3HMWH 4OM1L 2ZQKA 3UPRA 2VERN 4D0DA 1L6XA 5EU6E 5HPOA 1CR9L 3Q8BA 3O81A 4Q97A 4NX0A 5HYJD 1E9OA 1DR9A 4N2CA 1GJUA 4HHAA 1KWKA 1M05A 1NUNB 2YOAA 1A6VL 1Q1PA 2IG2L 1QFHA 2XG4A 4HK0B 3ZDXF 4LDCA 5HHMD 4ABVA 1A1NA 5GRUH 1O6SB 1YY8B 2UXVA 3PWPB 3OJD