2B9AA

Human transthyretin (ttr) complexed with diflunisal analogues- ttr.3',5'-difluorobiphenyl-4-carboxylic acid
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
108
Chain Sequence
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTARYTIAALLSPYSYSTTAVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title Diflunisal Analogues Stabilize the Native State of Transthyretin. Potent Inhibition of Amyloidogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 24
structure length 108
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2b9aA00
4TL4A 1F41A 5JIQA 1DVSA 3OZKA 2GPZA 3Q1EA 3I9IA 1BM7A 4TLSA 5CLYA 3DJTA 2QGDA 3CFTA 2GABA 4DETA 5L4JA 3QVAA 4AC4A 2PABA 3CFNA 4TNFA 5A6IA 4I85A 3CBRA 3P3SA 4N85A 1TTAA 4QRFA 2G2NA 2G3XA 4IK7A 4QYAA 4TL5A 4ABWA 1IJNA 3ESOA 2FLMA 5FO2A 3NEOA 4PMEA 5CM1A 4QXVA 1DVZA 4TQHA 1THCA 4Y9BA 4ABVA 4ANKA 3U2IA 2QGCA 4WNJA 1U21A 5JIDA 4PVNA 4Y9FA 3IMWA 1BZEA 4WO0A 3KGTA 4PMFA 4DEUA 1F86A 4PVLA 1SN0A 3A4EA 4TNGA 5E4AA 2B15A 5E23A 3HJ0A 5IHHA 3KGUA 2F7IA 3A4DA 1SN5A 2H1XA 4PWIA 4PWGA 1ETA1 1BZDA 4IK6A 4N86A 1TSHA 5CNHA 5AKTA 1GKEA 4DESA 3FC8A 3KGSA 4FI7A 1SOKA 3DJZA 2B14A 5CLXA 4L1TA 2H6UA 2NOYA 4Y9GA 1G1OA 1SOQA 4TLTA 5JIMA 3DJRA 1BZ8A 4PWJA 3IMRA 4Y9EA 2TRHA 4YDNA 3DK2A 5EZPA 3ESPA 3DGDA 4DEWA 4HIQA 4TQPA 1TFPA 1SN2A 1E3FA 2QGBA 2G4EA 3CN4A 3NEXA 4ACTA 4PWHA 5L4MA 3ESNA 3CN2A 3P3UA 4AC2A 3DK0A 5L4IA 1QABA 4I89A 5FW8A 5AL8A 3CN1A 3NEEA 3D7PA 4PWKA 4PWEA 1TLMA 3TFBA 3NESA 2ROYA 1TTBA 2IGLA 3GLZA 2G4GA 3M1OA 3OZLA 4I87A 4IKKA 3IPEA 5AYTA 3NG5A 3A4FA 4MRBA 3FCBA 4TM9A 3D2TA 4WNSA 4HJSA 3P3RA 3U2JA 2FBRA 3CN3A 2QGEA 3IWVA 5CR1A 3GPSA 1X7SA 3IPBA 4FI6A 3GS0A 3I9PA 2H0FA 1TT6A 4Q14A 4TNEA 5TTRA 3GS7A 5DWPA 5L4FA 1DVUA 1FH2A 2G3ZA 2B77A 5CLZA 1BMZA 1KGIA 2B9AA 2WQAA 5HJGA 4IKLA 1DVYA 5FW7A 4MRCA 3GS4A 4TLUA 4ABUA 3SSGA 3DO4A 1THAA 5AKSA 1ZD6A 3W3BA 4MASA 4HJTA 1Y1DA 4N87A 5EN3A 4PWFA 2H0JA 2QELA 1DVQA 2G5UA 3B56A 4DERA 3IMUA 5FW6A 1ICTA 4L1SA 2H4EA 5DEJA 1DVXA 5K1NA 5K1JA 1TTRA 1QWHA 3GRGA 4FI8A 2ROXA 3I9AA 4YDMA 4HJUA 1E5AA 1Z7JA 4D7BA 2B16A 4HISA 1TTCA 5BOJA 2G9KA 1RLBA 1IIKA 5AL0A 3CFQA 2TRYA 3CXFA 3TCTA 4TQIA 4IKJA 1X7TA 3DJSA 4TKWA 4ABQA 1FHNA 3CN0A 3GRBA 3IMSA 1ETB1 4TLKA 4IKIA 5CN3A 2H0EA 4TQ8A 4Y9CA 5E4OA 1KGJA 2G2PA 3BT0A 3BSZA 3DIDA 4PM1A 4IIZA 4KY2A 3IMTA 1IE4A 3IMVA 1DVTA 1ZCRA 3IWUA 2F8IA 1IIIA 3P3TA 1GKOA 3CFMA 1TZ8A 1TYRA 1E4HA 4PVMA 2QPFA 5AKVA 1OO2A
chains in the Genus database with same CATH superfamily
4L1HA 3G6JA 4B7IA 2WMPA 4RCAA 4JFXA 5HHOA 2BOLA 3IGAB 3V52H 1AXIB 2HN7B 3LRMA 1KT2A 1U91A 4PG2C 1OAYL 5B4MD 2AXGA 3ZDZB 2XKUA 2BSCA 5SWSB 4NEHB 4ONHB 4MQ7B 1YEKH 4QXVA 2CA3A 5J13B 3KXFA 4TSCH 3MCG1 4M3HA 5MERA 1CWVA 1NCDH 2NNCA 3LZNA 1YZZA 4UNVA 5CEZE 3KYNB 5FYLH 1RP8A 3IGKA 2ITDB 4JO1H 1KTRL 3RGVB 1A9EA 1MW3A 2A6KB 4P57B 1VPOL 1RK1A 2YAQA 3K6DA 2B5IB 3FU0A 1UZGA 3H9ZA 4TUJB 3WFEL 3WN5A 1CL7H 3RYMA 4HALA 1WZ1H 4BSVA 4FQPA 4EBQH 5FA4B 1IGTB 3T1WA 4DEPB 3F7QA 4TVUA 1QYGL 3K71A 3VXTB 1XF1A 1U3HB 3L5XH 1XR8A 4UILL 4YHZL 1UKQA 3INOA 1KIUB 2CE6A 2NQCA 2X4UB 3LNFA 4X7CC 4AGNA 5CZXC 2X4QA 1SRDA 2DTSA 3WJMA 1HOEA 4P59H 4NB7A 3TT3H 4I89A 3T0VA 4PB9H 3UP1A 5BO0D 3STZA 1H3PL 1F6AB 1I1AD 1N0XL 4B60A 2YBRA 2OMBA 3ERXA 4YXHL 5C0DB 5KJ4A 2A4ZA 3QBTB 4HD5A 3KW8A 3E7JA 1DN0A 4TPRL 3WUZA 1JPST 5ANMB 2YOCA 3VNZA 2OJZH 3MBEA 5IMLA 3D48R 4NQSB 5E9NA 3UTSA 2F2HA 1JI1A 2V6HA 2W1NA 4MXWH 5HDRA 3T9WA 4Z3HA 1X5KA 1NFDA 3TBSB 2VMDA 4FE9A 4D3CL 3QDJE 2HVKB 4X8GA 1RZ8B 2WUCL 2ZUYA 1WA0X 1G7QA 2WO4A 2BIHA 4ODHH 2F54A 5D9SB 4GBXD 5I1LB 3QZBA 4UDTB 5C6WH 2O5YH 4FKKA 1FLRH 3HPJA 1T04B 4FQJH 1NGPH 2DLFL 4EDWH 2MH4A 2YD0A 3K2KA 7PAZA 2WQVA 3KPNB 5CEYB 3O3BA 4BE5A 1MVFA 4FFZA 4AVKA 1PL3A 1TTCA 1KIPA 3LIUA 4N5EC 5BOJA 4CU6A 3H0TA 2PO6D 1UXWA 3HLAA 4JRXD 1IEBA 3MRGB 4KTDL 1D5IH 4NZTH 5JIKA 3K6SB 1E7VA 3WJJA 1IC7H 5AZEL 3NH7H 4PV9B 1HEHC 2WXQA 1QSFA 3GJEB 1MIML 1XCQB 1KWGA 2XVGA 3KGRA 2EDQA 4N2KA 3VFGL 3LNGA 1PG7W 4QY8A 3LQAC 4F24A 5EA0H 3NA9H 5E1AB 5DURD 4KI5D 2IAMA 3SZKC 2IG2H 2DQDL 4PCSA 3NABH 5AAMA 1A9VA 4K4KA 4JKMA 4F57H 3T4YB 3MRLA 3LY6A 1HWHB 4PV8A 4U1IB 3ALWA 4ODVH 4K7PH 4YSUA 4QOKA 2Q8AH 3Q8CA 4IGBC 1W0YT 2JKLA 3BP7B 3HUJE 4OLVH 4XAKE 2EIEA 1A02N 3BP5B 1A6ZA 1G1CA 1YAZA 3HRZA 4FTVD 2B08A 1NCJA 5FCSH 3FQNB 1OAYH 5E5MB 2XV3A 4PCYA 1W72L 1C8QA 3RWJA 5AVXB 5F7MC 4YEFA 4O2CB 5E8PA 3T6ZA 1HXYA 4HGMA 5KSUB 1H9DA 5AVSB 3AWEA 2IQ9H 3TYFA 3N04A 5EBMA 1OIOA 2RMNA 2ZUQC 4X8JA 3L9BA 2WKOF 4RRPM 4BZ2A 2CNYA 3GMPB 1JPGB 4NRYB 3WFEH 2KI6A 3VXRD 3QORB 4DN3L 1O5DT 3UPCA 1EEUA 5GSRA 3DO7A 5IVZB 2CLZA 3S9DB 5CSZB 2CNZA 4WU7A 5DS8A 3VM7A 1UVQA 3A5VA 4JKPL 4FXKC 2HX9A 4X9BA 1QYGH 4YVNA 1AQHA 1CFTA 5C09D 1VLXA 1HIML 1LDSA 1V7ML 4UILH 4YHZH 3RWIA 3OB8A 3QQ3A 1Q0EA 3QXDB 3IDIA 4FC3E 1URIA 2FK9A 4JREB 3S4SA 5CEXB 3OJDB 1HX0A 3EH2A 4GRMB 3QDMA 4QJ5B 1U8NB 1RFDH 5JHDD 2WINA 5KYUB 3DDFA 1H3PH 1N0XH 4OV6F 4YXHH 4QTHB 3TPKA 3I9AA 1OAZL 5ESQB 3ETBF 1SNRA 4BEIA 2Z4TA 4NFBA 3W56A 3DXAA 2MFNA 3QUYB 4TPRH 3L4YA 4R0LC 3MNVA 3VXUB 4HBQA 2H1LM 4M7ZB 4X6BA 4P2QE 1BLIA 5GHWL 2EDFA 2IANB 1JZ3A 4GG6B 5FKPA 4WW2A 2D9QB 2FQDA 2J43A 3FQXB 3NSYA 2IALA 1PX3A 2WUCH 3N1MC 5LBSL 4A2MA 4BHUA 3FO1A 4J6IA 2GPZA 5KSAD 1T5WA 4ZMQA 3ZGIA 4PGBB 4TOYL 5DRNB 2H1PH 2E8ZA 3SD2A 3WHXB 4AZUA 3SODB 3LH2L 2DLFH 3CFEB 2J8UA 3HAEG 1YEJL 3EJPA 4OUUA 5DR5L 1MRDL 2K8QA 1KEGL 2H26A 3B2UC 3WFCL 1GYAA 3GZPA 4XMXA 1WBXB 1HFUA 3K7UA 4N0FA 4GY4A 2CDGA 2YR3A 1IAOA 1PW3A 3TEWA 4PMFA 1SBBA 1QQDB 1HHJA 5I75C 4F9PC 5A7BA 1MFUA 1UUSA 1UXSB 4KTDH 2YC1A 3O0RL 3SKUD 1O7VA 2EACA 1FWXA 2RGSA 1RULL 1CB4A 4KJPC 1IKNC 5AZEH 4EQ3A 3AY4A 2GCYB 2JB5L 1YN7B 1SOSA 3TN0A 2HT2D 3FSAA 5ETUB 5LGHL 3M8OL 3MV7D 4MBOA 2BCKB 3VFGH 4PPTA 1FGNL 3MJ9L 1BBJB 2OTWB 2Q7YA 3IU3B 3DK2A 1W0WA 5TDPA 2DQDH 5B1JA 1HI6A 3IXTA 1KJMB 1PD6A 4BSWA 4XGZA 4PRAB 1PCSA 3UDWA 4HK0A 1GXEA 1X5GA 3BKJH 4PRIE 1KF9B 4JDZB 2BNUB 3LPWA 4HT1L 1ZLUH 1BOGB 4M1CC 1FVDB 3VSVA 4B9GA 3NG5A 1NEUA 3RNKB 4LP8A 4YBHA 3UYPA 5KVEL 1R5VA 3K4ZA 4Y4FA 1H8OA 3RFZB 3FRPG 4MJHA 4PU2A 1QVOB 1YJDH 1CLOL 2WQUA 4G43A 2BZDA 1TQUA 1ZHBA 4OIFA 4IIQA 1BEXA 1W72H 2CXGA 4I4WA 1XBDA 4G80B 2XG5B 4LOEA 4ZD3L 3L7FB 1F11B 3GF8A 2X1OA 1WD8A 5HHME 4TN9A 5HY9A 4ANWA 4XH2B 1WUZA 2J7LA 4YO0B 3LQZB 3T0EA 1UKTA 3SKNA 4FFVD 2XIIA 3POHA 4HS8L 4Y5XC 4DN3H 5BW7A 4POZC 2VZ3A 4EZKA 3BKYH 5D5MA 1OP3H 4DKFL 4UZUA 5ESAB 4MJ5A 3OKOB 4JKPH 4PSPA 5ECGA 3QFJE 3F12A 3TJHC 5C7XL 3FL7A 5K9JL 4ELKB 2DBJA 1HIMH 1DVTA 1V7MH 2QL1A 3UMNA 5CD5C 1MY5A 1T20B 2UWEF 2ZXGA 3DYOA 3JT2A 1B4TA 3JWDC 4GQPH 4XHJD 3HE6D 5K93A 1LLAA 4HOXA 5IQOA 1PKQA 1SJEA 1A4CA 4GI6A 5I1AB 1TTGA 1E40A 2JCWA 3ESOA 4GAJL 1OAZH 5DJZB 4NCC2 1INQA 1VGEH 2A6JA 3KPRA 1INDL 5KZCB 4F1ZA 3PGDA 5D1QC 4XMUA 1SY6H 3B3IA 1CMOA 5E2VL 1H3UA 2XJKA 3K1KC 1Z0MA 5G4OA 2EUVA 5GHWH 3AS1A 1GRWA 1W72B 3LD8C 3NGBC 4YGAB 4D94A 4PJ9D 2OTUA 5CAYB 1R3JA 1VCBC 4GUPA 2CBPA 5LBSH 3ULVL 4B53A 3LKQA 3MV11 3QS2A 1KBGH 4Z7OE 2BVQB 4TOYH 4WU5A 5B7EA 4Z7VB 3LH2H 5B8CC 2ZJSL 4TVPD 4XN1A 5C07A 1YEJH 1X5ZA 4EVNA 5DR5H 1MRDH 2EO9A 5SX4H 2A9AA 4FG2A 2R8SL 3WFCH 4LEXL 4J3SA 3VQMA 2MRYA 1U36A 2K6WA 2HUEA 3TCLA 1QRKA 1TLKA 2VTFA 3CSFA 1TQCC 5GRJH 4PTTB 4AYFA 3O0RH 1RULH 1HH6B 4HIPA 4PR5A 3T71A 1DZBA 1XZ0B 2JB5H 4E9VA 1OGPA 4DOHE 1S7TB 3R06B 4UI2A 1MCPH 1XV8A 2ZWLT 3M8OH 4OCRH 5LGHH 3GTNA 1FGNH 5K59E 2X9WA 4PJIB 1VADB 3MJ9H 2JI1A 1NEZG 4HU2A 3OF6A 1WAAF 4XWOC 3N55A 2PUQT 3T65A 3PL6A 5BO1L 4YAQB 4IMKC 3OWEA 5MEQA 4HWUA 2OJEB 1NKRA 1NUDA 1H5BB 4HT1H 2VXVL 1R24A 5B3SB 1RZQA 3AB0C 4HJUA 2B16A 1T4WA 1U8LA 3TO2A 5F88B 1SHSA 3CU7A 5JZ7C 4AEHL 5KVEH 1XF5B 5M95B 4K94C 4FG6D 1UB6A 2NX5B 3CDFA 1YEGH 1CLOH 3K6FA 3OMIB 2K4AA 1UD6A 4AM0A 3P3TA 2YPLE 4RESB 4ZD3H 4LEOA 1B88A 4KY1L 3FB5A 2EICA 1LMKA 3L4TA 1EJ8A 1LEKB 4QRUB 1PJ9A 3BXNB 4IK7A 4XTRD 4RAUA 3UIZA 3F64A 4NENA 2XCMC 2WQRA 3LX9A 3EAKA 3B2XA 4WFHD 2FHFA 3GMQB 5I74C 5J89A 4HS8H 2J5WA 3AGVA 2ZF8A 2VLKE 1IBGL 3C60D 4PGJA 1KBPA 3B7RL 4DKFH 1JTTA 2F0CA 3QIWB 1H3WM 3F7PC 4KVNL 5DZ9A 4YLCA 3TEXA 1A7OL 1J8SA 5C7XH 5FO9B 1TSHA 1COBA 4N0YL 3FSZA 2WLHA 5GGUA 3HBGA 4LSQL 2H6UA 4PRPA 4ZMOA 3BLKA 2NY3C 2PNDA 2R0LL 3I2CL 2D7MA 3CCHA 3Q9PA 3S3SA 3TYGL 3V5HB 3UZVB 5J6HA 1JZ2A 4NZUL 4U6XA 4Y7MA 4GAJH 4M43L 3OAUL 3HKZA 1NUNB 1WDAA 1INDH 1D6EA 3ATFA 5LGJB 1MCOL 4NQDE 1EEZB 5EZLA 3ARDA 1J0JA 2OMWB 1F45A 3EYOB 5E2VH 4IEFB 3T4AB 5F6IB 3SE3C 2VUKA 2H2SD 4F3FB 1FNFA 3RWFB 4PBWD 1V10A 3FCBA 3UTZA 1XL4A 3HC0B 4NM8L 2WZAA 2X9ZA 3EBHA 3B8YA 4LLVB 4Y2NA 3ULVH 1IQWL 5GS3A 3B5TA 4PJEF 4N0CC 1E9PA 4GFTB 3ZKSD 4BFBD 1Q0XL 1JZ4A 3SYOA 2ZJSH 4KQ3L 2D0HA 4MMZC 1CD1A 1DBJL 1A9BA 2V2XB 1ZWIB 5I0YA 3IM1A 4CBZA 3DVNA 2WXJA 1X4ZA 2R8SH 5BRZA 4MMXA 2P5WB 2ICEC 4X8XA 4LEXH 5CUSL 2WCSA 4XWGH 3RL1B 2FECI 1A21A 3FK3A 5SWZA 3BZDA 4QXTB 2XXGA 5C0AE 2VSMB 3DIFA 3QWRA 2XQ0A 4Q0XL 4PJXE 1JZ7A 4PRNA 1FVCA 4PRDB 2GSIB 2OSLB 2OSXA 1XSKA 2EO1A 4LEBA 1IIKA 3WKMH 4WNQB 2R15A 1CXIA 2Y7LA 2XQYG 4OF7A 1QOKA 1R75A 3EFFA 3O45A 1N6UA 3CPUA 5LNGA 5I2IA 3MYZA 2FJGB 2HJFA 3PREA 4RGND 2CUMA 2K6ZA 4LRNL 4ZG1A 4PVMA 3EZJB 5T1KD 3UG5A 4Z76A 3QR0A 5E4EB 3U9PL 4AQ1C 4QT5B 1N18A 5FCUL 2VR3A 4TLSA 2QGDA 1C9SA 1TJGL 2UXVA 2R0WL 3CZGA 1H6TA 5BO1H 5D7JD 2QV4A 4AVHA 3VFUA 4JJOA 2CHXA 1EVUA 2WQWA 1NFAA 1F4XL 3DLQR 4JFSA 4HUMB 1U9KA 1E9OA 3GXIA 4P9HL 4XPBL 4MS8D 3AREB 3SBQA 5A2JH 5I73B 3EJQA 5T1LA 4BFOA 5ID1B 3MRKB 4JFEB 4APXB 1OGAE 1FYTA 3FQRB 3M17A 4PWGA 4WFGE 2CKBL 1W8NA 4L4TE 1AG0A 1XMWA 1DEDA 1I3VA 3V9CA 2CA4A 4V1DA 3V10A 3O2WL 4Z5RA 3O8XA 3ZX1A 3V8OA 3UMTA 5BNXD 1JOIA 4XZUB 4LU5L 4TS6A 3B2DC 5TE6L 4LLMA 2KDGA 4FQHB 2K7PA 2VN6A 4L4VE 1ZT1B 4Y2DA 2EYRA 3FOMB 3RZWA 4YR6B 3X2QB 4XP9L 5K9KB 5ID0B 2ADIA 3OG6B 3MRIB 2HTKD 1A4KB 1IBGH 2CM5A 2PCPA 1NMBL 4XXDB 3FTGA 5IB4B 3FT3B 4NO0B 4O02A 4KVNH 4TTDD 1A7OH 3OKLB 4LCWA 3QEQD 3T8XB 3LMJL 4JO8A 4N0YH 2L7EA 2COVD 5AW5B 2HRPL 1F3JA 2FWLB 2JF1A 3FB7A 4KI1A 4KUZL 4N2FA 1URZA 4LSQH 2DPKA 1JNHA 1I4FB 1BDYA 3B5HA 1N10A 4LSUL 2R0LH 4YBLC 2DB8A 2Y72A 5EPMB 3I2CH 5CHNB 4NC1E 3TYGH 4ISVA 2P28B 3CVHL 3AC0A 5A43C 4NZUH 3MV8D 1QNIA 3BGMB 4M43H 2NYKA 5FM8A 2X89D 1ZHNB 3GQFA 2YAPA 4Z7QF 1EH9A 1MCOH 1YPZA 1AZUA 2YOAA 4KDVA 3BVDB 2V9RA 4MBRA 4ONGH 1L6ZA 2O5NA 1MHHB 1ZT7B 5IBUB 3G5ZB 3AQXA 1U92B 3B9KC 4HJEA 2MCPL 3UERA 3VFSB 5MEOA 2AS5M 1IQWH 3C75A 5HGDB 4ODSL 2YA2A 2IPKA 3TIDB 3ZE0F 4JS7A 4HS6A 4XB8A 4PM1A 5GGSY 4H1LA 1Q0XH 3V4VA 4H25B 3Q2LA 1UZ6F 4KQ3H 1PIFA 1CE6A 1DBJH 4OZFA 3HI5L 3QR2A 1NC4A 3O3AA 3TBYA 3WKQA 4GSDL 3WNIA 4CW1A 2X1WL 3H56A 4IOSD 4C59B 4DFHA 1M7UA 2J8OA 3O6ML 3UTQA 1BM3L 5H37A 3LRSB 5LKNA 3QVAA 3O3DB 4M7LL 4OM1L 1DEEA 4C4UA 4Q0XH 5D6CB 4E41A 2WIMA 4CVUA 3SDDA 3PWNB 4Q6IC 4ZS7L 4JZOA 3PP4L 2X2JA 1PYWA 2NPLX 4WNJA 4ANKA 5AUMA 2VIRA 1NFDE 1LEGA 5BOPA 2D2CC 1DVFC 2CALA 3GNML 3KWVA 3QRGL 1AXSB 1KIRA 3MBXL 4I18C 4WQOA 3VE0A 5JQHC 1QO3A 5E6IA 2XPGB 4KX7A 2F54E 5I75B 4LRNH 3S88L 4PJ6A 4ZTOL 3DJZA 4GKSA 1S9WB 3U9PH 3IFNH 4EIZC 4KK5D 4BQ8A 5FCUH 3MLSL 4D9RD 1C7SA 4H8WL 1R0AL 2FWOB 2R0WH 1P4UA 5ESVA 3ZT6A 15C8H 4WWKB 1IFHL 2WWKO 4X5LA 2NXYD 1F4XH 2E46A 3E2HC 2Z7UA 4JBSA 1HQ4B 1X5MA 3P3UA 4P9HH 32C2B 3F7YB 3JVGA 4XPBH 4TRPL 2BNRE 2VE6A 5SX5K 3ZE1E 3E1F1 2ZSVB 4H4NA 3L16A 4Y5YA 1S3RA 2Q3AA 3KPMA 1BYOA 1LE9B 2R29A 3P77A 5FA3B 4AT6B 2Q6WB 1QSFE 3FU7B 2R0ZH 4OFIA 4HMDA 4G8GA 5K39B 1HHKB 3L3IA 5CJBA 5DZPA 3O2WH 3GBNL 4AYID 2JJSC 3K6NA 3I85A 5ECJE 5HDBE 1S9VB 2R56L 2H45A 5ICYB 4HUVB 3P30L 2L7JA 2R9HD 4LU5H 4UWQB 4PJGA 5TE6H 3WMPA 2RB8A 3UPRB 2F74A 4HHAB 3PYCA 5ABDE 1UOWA 3FYEB 4WEMB 4HXAL 3PJSB 4XC3L 3BQUB 2WANA 3MRJB 3G7TA 3QHFL 4RETB 5ITFB 1S7UA 2C9VA 4XP9H 5D2NC 1HC1A 5DK2B 5GSVA 5GISL 4O9HL 1CBVL 4F8QA 1X6LA 2NY7H 2DLHA 3ZDYE 4YSEA 1LO0L 3PJLA 4XN7A 2PCYA 4AL8L 1NIAA 2WY3B 3LMJH 3T1FA 1QPKA 4HISA 5DYOA 3CH1A 3FFCD 4PP2A 1DJHA 4FDWA 4KTEL 4BELD 4Y5XB 5I82A 2WGXA 1EV2E 4LSUH 3K5SA 4GKZA 3GI9L 4HJ1A 5EBLA 4RMVA 2WWKT 5KTEH 3RVTD 3QYNA 3CVHH 3WLWD 3QEUB 2YIHA 4UU9A 1ZPUA 5I8EA 4EN3D 3S36L 4WEBL 4PIBA 5AKVA 3RIAK 1OEZW 4AM0Q 3V6ZA 5LG6A 3EXJA 2FUTA 1HOCB 1NBZB 2YQBA 5B1AB 3MRCB 4HXBH 4PJ5A 2CKBB 1QSEB 1Q0YL 5EB9A 5C0GB 5IQ9B 2J88H 5IHZA 2AGJL 4IRSC 5E5RB 1PF3A 4QPEA 4Y2OA 4P5KB 4ODSH 1ZVYA 2MPVA 4QKTA 2DI7A 1T2XA 5JOFA 4OTXL 5C0EA 1OSZA 3HVDA 1G87A 3S97C 4KZDL 3HI5H 1K3IA 4ZX5A 5FECB 3QDME 1GYCA 4GSDH 2RR3A 1M56B 2Z0UA 3L3HB 1JGDA 2UZXB 3PF2A 3ZJAA 4DZ8A 3QIUA 4TYUA 1NGZA 1BM3H 2EXWC 3O3UN 4M8QB 4M7LH 4OM1H 3VRJA 3MRRB 4LIQL 3DUUB 5D1ZD 1MNUL 1JBJA 1ET8A 5C0NC 1JGUL 3C12A 2NUTB 4ZS7H 3BVWA 5CEZD 3PP4H 1FVEA 2EE3A 2X0UA 5D1ZI 4PW4A 4GQRA 4WI3A 2ITFA 3DVGA 3GNMH 3QRGH 4A38A 2I7OA 1MWAH 2X12A 3MBXH 4A2HA 3U4KA 3CVHB 4TXVB 1C5DA 4Y0GA 1A5FL 3GRWA 3DV6B 3S88H 4TUOB 4ZTOH 4G11A 5DJ6B 1VIWA 3DECA 4PJFA 4YK4B 5EO9A 5C0BB 4A2FA 4U3SA 3RY6C 1IGFL 2J8UE 3L3OC 3QDGA 4H8WH 2YMXL 1R0AH 4K3DL 3RWHB 3QJXA 5HJGA 4JDEA 3HE7B 3QSKB 5F89A 2BVYA 1IFHH 5IR1A 2P8LB 1P1ZB 3BWUF 1P0SE 2CSPA 4MA3B 4CC4C 3TFKD 2KZBA 3HBZA 4TRPH 3OD3A 4MJ4A 3NIDF 4K7FB 4M02A 4BFIA 2HB0A 1YNTB 2WXKA 2XTJE 1QI4A 1K4DB 2XV0A 4XNZC 5DVKA 5KYYB 4X9YA 5DRXB 3X12B 1BVZA 4BK8A 3O6FB 3GBNH 1VHPA 3P2BA 4G6FD 5DEFA 4PJBB 5EBGA 4JMXA 2R56H 3P30H 3ARFC 5J57B 5T3XE 1FFNA 3BSZA 2LAAA 3QDJD 2BOBA 3PWUA 5CP3A 1KDIA 1R5WA 3OWRA 1KEMH 2O6PA 5KW9H 1DQQA 3PFQA 3Q0HA 4HXAH 4OIBA 4UQ2A 5AAPA 3QHFH 3VFRB 4LPXA 1XR9A 2DKSA 4O9HH 1CBVH 2B1AL 3SBPA 2KLSA 3MJ8A 3US0A 4H0HB 3U1QA 1U8JA 3H9HA 5ADOL 2FLMA 1LO0H 2OZ4H 4OZGB 4AL8H 2Q3XA 2VDML 2WBJA 1BW8A 1MW2A 1ID2A 2BRRL 1GMIA 5DTFA 5CINL 3RPIA 3ZE1F 1SXNA 4KTEH 3FQTB 3O4LB 4NQCA 3F7RA 2Y7SA 5EIIA 2DY2A 3GI9H 3WEXB 3M7FB 2R1YA 1P2CA 4NKDB 4ZAKB 5TK4A 3UZEA 4FA6A 5A1AA 1RZGB 2P43B 3UTTE 3WDIA 3ESUF 3L5JA 2FL5A 3AQYA 3S36H 4WEBH 3QNZB 1HDMA 2AANA 3SCMC 5DUML 2CAKA 3KS0J 4EUPA 3HAEH 3L6FA 2WVUA 3QJTB 4TLTA 3T0EE 2L0DA 5AB1A 3CDYA 3E8UL 2GBAA 4BXVA 1OP5K 1UADC 2E4TA 1Q0YH 2HRGA 3BHBB 3K3QA 3PGCA 1VFBA 1SN2A 4OZIB 1P84J 1J0YA 2ZKHH 2AGJH 3CZFB 5D7LA 5MP6H 4NIYE 2FDBP 5GGRY 2JVUA 5FM5M 1QPXA 3U6RB 4PD4K 2ZOKA 5DJXB 1UWFA 1Q9WB 3SGEH 1JZDC 4GP4B 4OTXH 3UL4A 1IX2A 1XSIA 1Z5LA 3P0GB 1Y6MR 4MMYB 1U93A 2MWCA 4XAKD 4LFHD 4KZDH 4M6ML 1S7SB 1A8ZA 1FJ1B 1PKQE 5L2JB 3L48A 1XH0A 3IJHB 2A83A 2P5EA 5BUGA 4K8RD 4ETYA 2KLRA 4IKLA 5F9AC 4OFPA 1FL3A 4N68A 4LDEB 4LIQH 2OW6A 1MNUH 1QI3A 2IBZX 2WYTA 3FF8A 4FNLL 1JGUH 1OALA 1VACB 5C86A 4O2EA 1EEQA 2CIIA 3U79A 5I16B 1BV8A 1F13A 5ABZA 4ZMVA 4OZ4B 3S5LA 3WIFB 2X5PA 1N12A 5DJYA 2D3JA 1A5FH 2ENYA 2ICWI 1DSYA 2PTTB 5DVNA 2F68X 2YSTA 1I7ZA 4XBGA 3HAEB 4BQBA 2VLME 4JN1L 1IGFH 2XVKA 4TLKA 43C9B 2YMXH 2X6AA 2ZP8A 3QC6X 3QUKB 4K3DH 2BWDA 2VMFA 3PIQB 4YHOL 4XE0A 1IE4A 5TE4L 1XIWD 1P1VA 1KYFA 1Y6NR 5DMYA 1FORL 5IJBC 4U1NB 2Y4SA 3NCEB 1U8CA 1KTKE 3WEBA 4HKXB 5BJTA 1CT8B 4LASL 3OHXB 2W8CA 5L2KA 3GMRB 1YNKL 4ICWA 1JV2A 1GJWA 4CU7A 3UZQB 2QSCL 3SKOA 1OANA 4HKJB 1I31A 4B9FA 2XICA 1NMCB 1OLLA 4YIQB 4YDVB 4W4OA 2X3AA 1JWSA 1S5HB 2GSMB 4FFYA 2LABA 1N8ZA 1NCCL 3Q48A 1OHQA 2BX5A 4UNUA 4NFDA 5F7YC 3U4EB 4ZMWA 4MAYB 3LYRA 1KJ2L 4MCMA 3CZKA 4U1GB 3EDJA 2OFQA 3QO1A 2X44D 4KQ0A 5ICXA 1NC2D 4G1EB 1Z9PA 3B43A 4A7GA 2PWDA 1OSPL 2JE8A 1MAML 2W94A 1AYRA 5IB1A 3PU7A 1W9XA 2NNAA 1QTYT 2Z91B 4JZJC 5F7KC 3L1EA 4KITB 4WV1C 2FGWL 2B1AH 2GJ6D 4XVSL 1CGUA 2FYYA 4G83A 2B0SL 4B9YA 3QYMA 5C0CA 4MJIA 1P7BA 2QVFB 2BOCA 3BZFB 1SUHA 3VI4E 1EAJA 2VDMH 1E5CA 4D0BB 4ZDHB 2BRRH 1JPSL 3UH8A 5CINH 1DANT 1EQWA 1NPNA 3MHZA 3ZMRA 4L8BB 4L8DA 1O6TA 1I7RA 3ILPA 2ROYA 1GS8A 2V3DA 3HBQA 5DO8A 1NGQL 4BK5A 2EVGA 2HFFA 3QUML 1GW6A 1X5LA 3GGWB 2APWA 4B97A 2X2HA 2R2CA 5G5DB 3A6CH 5DUMH 2H0FA 1WEJL 2BNQA 1G0DA 3D33A 3N40P 4IGBA 1X9LA 2YEZB 2G3MA 2YSSA 3ZIYA 3E8UH 3CDGA 2CHWA 3ZPDA 4U1HB 4JCLA 2YA1A 1YJDC 4J3OF 3UBXI 2CDEB 3IJSA 3QZWB 4GXFA 1XSOA 4LP4A 3SE8L 4PRID 2HPTA 2X4OB 2VLLB 5K9QI 1KLUB 1MVUB 1I82A 4ORGA 4AIOA 3FB6A 3ABKB 4Q52A 3ZKMC 4U3CA 5DWUL 3H6JA 4JM2F 3TF4A 4PRPE 4H26A 1CDYA 2GITA 1OKEA 2WLLA 2TRYA 4HEPA 4M6MH 2ZZUT 4H8HA 1MCDA 3LN4B 2O93L 1FHNA 1U8IB 4DN4L 2ZXBA 1CFMA 3VFPB 3OAYH 3WN6A 4I2XB 3VAEA 2AFNA 4U6YB 3SBWC 3FRUB 1NCHA 2XBTA 5HPMB 3ZDZE 2JK5B 1NBYB 1NCAH 5DK0B 2IDUA 1FHGA 4YFDB 4FNLH 5IKCB 3WG7B 1DJZA 5HHMD 4FXKA 1AOZA 1DLFH 3ARXA 4YBQC 4FMVA 3P4NB 3NOIA 1LWHA 3LS4H 5KBDA 1AG6A 3EF4A 4ABWA 4U1SA 4JLRA 3M1BA 5LAXB 4LARL 2VL5B 3BUIA 2F7OA 2JKNA 2ZAIA 4IYKA 4B9KC 2B39A 5IJVB 4QF1B 1NCUA 3QFJD 4JN1H 5B1CA 5D70L 3SJVB 3I75A 2ZX8A 3AABA 4YHOH 3C6LC 5GJSL 5BRZE 4RZCB 4ZTEA 4MWFA 3FC8A 3DX9A 4Y1AA 1CXLA 5TE4H 1OZUA 2BW5A 2NUPA 4R0LA 1KN2L 3L9RB 3ULSA 1FORH 1Q4NX 5HSFA 1XB8A 4UINH 1G1OA 3CFJA 4LASH 5I0DA 3DGCR 5DMGD 3LPFA 1YNKH 3KWWA 4HWBH 2QSCH 4KROC 2W80C 3ARPA 4NC2B 1V05A 4F27A 4E0RB 1KJVA 3VTMA 1GPOL 2H47C 4JCMA 4BZ1L 1GA2A 2XLLA 2PO6B 4E5XA 2CK0L 1NEZB 5ANME 3I6KB 1NCCH 5F3BB 2ZX5A 2YWYA 4MDJB 5F7HA 3CLFH 4Y4HD 1J0ZA 3OKNA 4YSTA 1HTYA 1OAJA 1KJ2H 3BZ4A 4PRHA 1KTDB 1N0LB 3QJFB 4X99A 1SYSB 5A3ID 4CDGC 1GY2A 4QUOA 1OSPH 1SDDB 2CUIA 1JV5A 1Z9SB 4FNUA 4WTZA 2AK4A 4F15B 4F9PA 3VCLA 1A7BA 1NGWB 3VXSA 2A9CA 2FGWH 1JHTB 2UZPA 4WDIB 5CLWA 2YLKA 4XVSH 3FW6A 2X05A 5DURB 1NGXB 2HG0A 1IKNA 1MCKA 5JR1L 3ET9F 2H8PA 5KYWB 2HH0L 2JB6B 4QRTB 5AKSA 4GIAA 4DVBA 4P9ML 4N8VG 3RL2B 1E42A 1A6AB 1FYTE 1R6VA 2QELA 2GHWB 1JPSH 1UA6L 4XVOA 3WDJA 4L1SA 3RE0A 4N2BA 4OFKA 2VQUA 4V1DE 4E68A 3HC2A 2HVJB 4R2GD 2V7HA 2MJWA 3QUMH 4HZAA 3MKKA 5HD8C 1LGVA 3CXFA 5FOBB 5EORH 1XEDA 4PY7A 4IKJA 3GSRA 4KTGA 1WEJH 4FTVB 2XWBB 1FRGH 1UCTA 1A1MB 4QNPF 4JHWL 3MFGB 3P11L 1U8MB 2GT9A 3MRQB 2V5RA 5HGGS 3VJ6B 4C83A 5DHMC 4L3FA 4N9GB 4RMQA 4KKAC 2ZICA 5CLYA 3J7HA 2X9YA 3SE8H 1DUYA 3A22A 4L9DA 1DFBL 2N7BA 4K0OA 5E1IA 3ZRCC 4ZXBB 1O6SA 3ZDXB 4QRFA 1KJ2B 2V7NB 5DQJB 3U83A 3QCUH 3D39B 1YSOA 3H9SA 2UV3A 4MCYA 5DWUH 1T0MB 1ZLVH 5DZLA 3P4MB 3VI4F 1OW0C 1ZHKB 1YY8A 1M7IA 4UDUB 3V6FB 3BW9A 3QI9C 1A4BA 2WLIA 1EXUB 2H32A 4NO5B 3MMEB 1JPFA 3APCA 3CJJA 4ZX6A 2QV2A 1KDJA 5C09B 2YPLD 4JAMB 4RSYA 1K3ZA 4EDXA 4R5VA 3VWJD 2Y5TB 1YPZE 3GKWL 4OZHF 4PJCF 3FT2B 3FB8A 4P07A 4R96A 4KV5F 2IC2A 5DT1H 3ROOB 1OD9A 5EH1A 4LFHG 5JHDB 4ZUTA 4JCWA 2AXJA 1AS6A 2TRHA 4HHGA 3DX1A 4JHZA 1Q38A 4P06A 1SMAA 1OZTG 2EILB 1IT9L 5ICUA 1AIFA 2ODIA 1M57B 2GY7B 3QUMB 1DQKA 4IHOA 4LARH 4PAZA 3IE9A 3OKEA 4ZYKB 4NT6B 4WSGA 3NSCA 3KVPA 3EJYC 3QUXC 4AYEC 3L4VA 4FQ1H 5D70H 1OLZA 2BC4A 3T09A 3V0VB 4PWEA 3B9DA 3GSNA 2XY1A 2HLAA 3RTLA 5I1CL 3EO9L 3QG6A 5GJSH 4NDMB 2ZKXA 4LHUA 1QP1A 5B7MA 1CDBA 1REIA 2WJ5A 1KN2H 4JN2B 5D1QA 2APFA 5KSAB 4HUXA 1H3VA 3P9LB 1QR1A 2MIZA 3FCSB 4Y16A 2Z6FA 4TNEA 1TKWA 1B9KA 1VCAA 1GYWA 2GFBB 3BUBA 5D4HA 5DEGA 3S8FB 3KDMB 3MR9B 3DX6B 2EDOA 3WO3B 3ZDZF 2QPUA 2B4CC 5CMAA 4AQOA 5L0QB 3ZL1A 4ZFFA 3D18B 1GPOH 4NQDD 3CQPA 2QSTA 4JY6A 5EF0A 3X11A 2VO5A 1L4IA 1I8MA 3UJJL 2W60B 1DCEA 3SY0A 2IADA 3DVFA 2WXLA 4QHNB 3VXUE 5B8CA 1KPUB 2E7DA 2X0WA 2IANE 1VGKB 2AJSL 3RFRA 1J8HB 4WENB 1QTSA 4BK4A 4WTXA 4Y19A 3FU3A 4M93B 3WEMA 5E1QA 3NJGA 5IQLA 2YEVB 3MV7B 4J28A 1T5KA 4X98B 1VFAA 1WSST 3VRLF 2OMZA 3PDGA 1ZCRA 1VFMA 4A68A 1IGYB 4PQXA 3FQ4A 5DHVB 2HH0H 1D5BA 4P9MH 1N5YL 4LBEB 1UWXH 4DNLA 3HI6L 1UA6H 1SXSA 1QRND 1UJTA 2CLVA 3C6SA 4FQXC 5C0AD 3B6SA 4F8NA 1MCBA 2WNKA 4AH2B 3GSVB 2W88A 1FAIL 3IPFA 1GGBH 4NYLA 4X5WA 4M5ZL 3IVKA 1PIGA 1P5UC 3IXAB 2Y5QA 4IMKA 4RNRB 1G5AA 1AQDA 2VSDA 3MLTB 4KFMA 4PWIA 5AG8A 4ELMB 3RVXC 3C5JA 4JHWH 2BSSB 3P11H 2IFGA 2KKQA 1CIDA 1FO0A 1F6LL 2HJLA 1UOKA 2CD0A 1AGCA 1G7LA 4GW5B 3VX0A 1B0RA 4OGAD 3V95A 4HKBA 1FDLL 1F4AA 1T3FA 1DFBH 4KJYA 5IM7B 1OP3K 1P6FA 4AWJC 1LEIA 3CBJB 3FHAA 2XZCH 1JDDA 4TVPH 3UBXG 2FECL 5AOJA 4L8SB 3DC0A 5BZDA 3BT2H 3CFBA 4GUQA 1CI5A 2VWEC 4B9JA 2JMRA 3L54A 4NRXA 3MREB 3WFHA 4DK6A 3ULUL 1OGAD 1ZLWK 5AL8A 2NSQA 1FG2A 4F7EA 5K9QG 3FOLB 5HVFB 3K8KA 4WFGD 4JJHA 4HIHB 1DE4A 1OTTD 4XB7A 4TQEL 2P24B 1F56A 1L6XA 5JHDA 1FE8H 1U41A 3GKWH 4PJ5E 3RX8A 1YCSA 5DRWB 2LFGA 1RXLA 1ZTXE 3DRTA 4XVUD 1WWCA 4L4VD 1RY7B 2HKHL 3OKKA 4AIZB 2XIBA 1IT9H 4D8PA 3JTSA 2HSIA 4DIXA 5E95B 2OSWA 5GS1B 3BZEB 3M6DA 4HPYL 3IU4L 4WO4C 4XVTH 5FW6A 4M00A 4AE1A 1KNOB 1P7KB 4NHUB 2QFRA 4JQXC 4OLZL 1FAKT 4P2OD 1XGUA 4E9TA 3T3PE 4PJ9B 5IF0B 5I1CH 3EO9H 3OMNB 4KO7A 5E4IA 3LB6D 1IC1A 2Y1VA 1JNJA 1KB9K 3SPGA 1CZ8L 5EFIB 3FSOA 3UBFA 5IVXB 4LLWB 3SE3A 2D7OA 4HX1A 5A6LA 2W0PA 2DQFA 2WZPA 5FV2A 2DQIL 3QULB 4YE4H 1BQRA 2WO3B 4G5ZL 3WS6C 1P7QA 1I53A 4NNPL 1BECA 3ZR5A 1JDCA 1L3WA 1BAGA 6FABL 4G6MH 1ZSHA 2NW2B 2HMIC 2ZNXA 4MMZA 1TETL 2ZG3A 5SV4A 1XGPA 4IU2A 3BIKB 2ICEA 2AJSH 4G70B 1N5AB 3QDGE 1SVBA 5EZOL 2WLKA 5BS0A 1MLBB 2BY3A 3QW9A 1L5GA 1U33A 5C6TH 4ENZA 1IL1B 3RVWC 2G2RA 3ULAB 1TZIA 4X5XB 2Y6SC 1SVCP 3FT4A 4Z7VE 1JZ5A 5EUKA 4Z77B 1NM4A 4J27A 4YC2B 2IWEA 5EOQL 2UXTA 4G71B 2KQNA 5JUEL 1KTLA 1N5YH 1BQUA 1FSKB 4XCNB 2W65B 3V5DA 3HI6H 4F9LA 3OZ9H 5JXAH 3R7QA 3ARTA 4KC3B 4HZ1A 5FC9A 4PGEB 1O9ZA 3NRQA 3SDAC 3OTTA 4PLOB 1EEYA 2YGPA 3L95A 4AQ1A 1M2VB 7PCYA 4JFDB 1FAIH 4XNXH 4C54A 3D69A 1E28A 1G7JA 2H3XC 5KJ7E 4M5ZH 3WYRA 5EF3A 5E99L 3S8GB 4N2OA 3A47A 2ADGA 2CIKA 4KVCH 1SEBA 3ELQA 4PGZA 3DOSA 3GLZA 4FHJA 3DHJA 3WXWL 2NT0A 4U2ZA 1EAPA 2VKWA 5EG6C 1I75A 3LTVA 5E2TL 1I8UA 1ULVA 1B4JL 5IBTL 3OB0K 4DCQA 5CBAA 3JV6A 3SKJH 3Q7JA 3EDEA 5DWPA 2IPTL 4WLCA 5I18L 1YEWA 1DVYA 3ZTCC 3DROA 1BP3B 2WB7A 4Z7WB 1GZPA 1VZGA 2BHFA 1GL4B 2BNRD 5E7BA 5HI4C 2MMXA 4XPFH 1YAIA 2W07A 4Z3GA 3LKRA 3RWEA 5LLIC 3ULUH 4IJ3C 2PW2B 2HKFL 4LSVL 1D9KC 1YEDB 3E9UA 4BJLA 2HA1A 5J1SC 1R33A 1WWBX 1TU2A 2NX5E 3MN8A 5FO7A 4U0RB 3SE4A 4FJ6A 4TQEH 1F8TL 5IHUL 4P2CG 2BMKB 2AITA 1FIEA 4U4IA 3V6OA 1YEEL 3MA7B 5DI8A 4IKIA 4XMLL 3KBFA 4ES9A 1RCYA 1Z9LA 1HCVA 5LHDA 1T66D 4R26L 1EDHA 5D7LE 3V5KB 2HKHH 4KMTL 1TZHA 1OO2A 1XH1A 1EBAA 5KN5B 5HTSA 4XNQB 3U36A 4P05A 3S3DB 4M29A 3IU4H 3C5ZD 3V8CA 5IW3A 3RZCA 3UJTL 3OR7B 4JG9A 4OLZH 1JERA 5BUPA 2VXTL 1CIUA 5DUJA 1BX2B 2YEQA 3T77A 4ZOAA 2P5EE 4G8FB 4KOBA 4OFYA 3DHUA 1CICA 3BO8A 1CZ8H 3DBXA 4Y4KD 1Z66A 2FO4A 1AHWC 4LLDA 2OL3A 3H85A 3DOIA 3D09A 4IK6A 2IEPA 4FQ2L 4OF8A 1C5CL 4QRSB 3B9KA 4G5ZH 2CJSA 2JNZA 4DUVA 1R3LB 5IGXL 5CILL 2ODHA 4Z7UB 1JFQL 1RK0B 1OTSC 2EKSB 4NNPH 5ACZB 4JR9H 2A9ML 6FABH 1INEL 3RLSA 5T8IA 2WNXA 1TETH 1LDPL 3KD4A 2R2EA 2ZOLB 1U8PB 5EU3A 4L9LC 5FOJA 2NY1C 1BIIA 3TVMC 5EZOH 1JS4A 1F2XK 3KCPB 4OIIL 2CWRA 3TO4C 3U6XS 4HIEB 2BS8A 1UD2A 4LCCC 4CMMA 2YD3A 3REVB 4JQIL 1M6OB 3GMNB 2P5PA 2Z8WC 4XN8A 5GZND 4Q6IA 5JDJA 3MVSA 3T3PF 4K3EH 1TJMA 3WCYA 4YHLL 2HT4D 3QDMD 3SPHA 4DKAA 5L2KE 5EOQH 4ZT1A 1PLBA 5JUEH 1SYVB 2IXQA 2K78A 1DVFA 4S1DD 5GGTA 4I18A 2P5WE 3FO9B 2NRDA 2XSKA 2XWJA 3G5XB 4PUBL 1OPGL 5IW6A 4PS4H 4FQQA 3PWPB 4LNVA 3BIAX 4F20A 5ISZB 1CGTA 1KBWA 1J8RA 3JSSA 4NUJB 5JHBA 3ILEA 4G7SB 3L3KA 3D50A 2IDTA 4IOFC 1QA9A 5CIPH 2YRZA 4DGIL 5E99H 5H94B 1JF5A 1S7WB 1U8OA 1XF4B 3O41A 3DMMC 2WXRA 1E6OL 1Z7JA 1YN6B 2V3FA 2IH1B 3WXWH 1EMTL 2XWRA 1HXMA 4BHUI 5E2TH 3P1VA 5AB0A 1DJGA 3DVIA 4Q4IA 1A7QL 1B4JH 1GCYA 2GJRA 1WIPA 5IBTH 2ENQA 2Y24A 4XNDA 5C0CE 5AOZA 4MJIE 2A73B 5IFJA 4JFUA 3HHSB 2HN7A 1AANA 2IPTH 2K1MA 5I18H 4OGZA 4Z7VF 3A21A 5K9OB 5J5EA 5HDLA 3MX0A 2V17L 2JJSA 3RKDD 3TA3C 1NBCA 3MJ7A 5BCAA 1CYXA 4F1SA 3IS0X 1TVDA 3R19A 2XTJD 2HKFH 1MJ7L 4R4NC 3FZUC 1QFWI 4N85A 2Q86B 4JFEE 3TN0D 2V9QA 3VSQA 3KR3L 2VRAA 3TPUA 3QEQB 1AR1D 5GGSB 5D2NA 4IRJC 4TQHA 1JVLA 1F8TH 2YPKB 4R6UA 2BNQE 4TUJA 5IHUH 3UTPE 2V2WB 2R0KH 2XWTA 3CHSA 1VDGA 2WHVA 4IRZL 1YEEH 1UQSA 1KLFB 2XC8A 3HZYA 5T3XD 2CGYA 3QI9B 2Y9RT 1EVTC 4J3OD 5DJ8A 1MQKL 1G7MA 1L9NA 4PJIF 1T7YA 3RUGB 4BFEA 1MJJA 1T5XA 4KMTH 4POYA 3EOAB 3DV4A 3ARBC 2OYKA 1MH5B 1KCBA 4L1TA 1UB5A 5I9QC 1ORQA 3SOBL 3QEHB 5AYUL 2Z3FA 1RIUL 1NAML 3UJTH 2DYPA 4P4KB 2DQTL 2V37A 2YD1A 4MHHI 4W4NA 4Y4FD 3SDXA 2VXTH 3VTAA 3QO0A 1QW8A 3D6GA 3UGUA 4F8TA 5FR3A 4HLZG 2X28A 3NPSC 1CGYA 1WGVA 1DQLL 4OM0L 1IAMA 4TV3A 1KULA 3L8QA 3QUHA 5F1NB 3L3JA 5D2LB 3QGVA 4AUUA 3UTTD 1EO7A 4IKKA 5DD1L 1T21B 3G3LA 1C5CH 1FN4A 4IRSA 5HDQL 1RZIA 4AYGA 4M7JL 1KIQA 4ACPA 4PVBA 4GW1A 4MD0A 5IGXH 5CILH 3SYPA 2PPDA 4L3EB 1JFQH 3ILDA 3ES6B 3GFUA 1W8OA 1SPDA 2A9MH 2NY6D 4UT6L 5FF6B 4KO6A 2PYFA 5D6DC 4X4YA 2XZAL 1LDPH 5EU5A 4H7VA 5T1MA 2AC0A 1RUQL 4PY8I 4NQEA 4HWNA 3TZVC 3LH8A 3WNJA 4X6CB 4Y1AE 2OXHB 3AU1B 1NDGB 1J0HA 4JPWH 4ZNCD 3GRGA 4JQIH 3ZRSA 2CHZA 1SXCA 1C08A 3D07A 1JVOA 5HHPB 4YHLH 3PWLA 2EYSB 3S3BB 1NGYB 5CD3A 4D9QE 1TQWA 1HVXA 4ABQA 4PUBH 3CN0A 3NTCL 2A6IA 4R3SB 1OPGH 1YQVL 3II3A 4XT1C 2D03L 4LLAA 1RIVL 3AITA 5JXEC 4C56A 1ETZB 2NXYB 3DSFL 3RY6A 4JL1A 3ISRA 3L3OA 4P48A 2PPEA 3G5YB 5I1GL 1TPXB 5AW9B 4XO8A 3VFWA 4ZW3A 5AZUA 3QARA 4PRHE 4PJHA 3STLA 2XDHA 4DGIH 3ECQA 4DQOL 4CC4A 3W39B 3MU3A 5IMKA 1E6OH 5J11C 2R1WB 4BKLA 2AK4E 1M9WA 5PAZA 4UMSA 3PY9A 5I6KA 3VXSE 2VLMD 1A7QH 2COQA 2X4TA 3RRQA 3F6LA 1M3IA 4WUUA 4KRMB 4OY9A 5LJYH 4N86A 4HMEA 5CXPA 5E1GA 3LEXA 4JFFA 1NFKA 3BJLA 3HMWL 2XN9B 3LNHA 2MNUA 2B14A 1S8DA 2V17H 3PNWA 3B9AA 3WFBH 2EVHA 3SD5A 1S3KL 2FJFA 1HE7A 2GSGB 3IDNB 2XX0A 2J44A 5E5UB 2X4PA 3ARFA 5FKAB 3HS9A 4PWJA 1MJ7H 2YPVA 4PGCA 4K8RL 3IRZA 4XXWC 4A2EA 4YDNA 2DLTA 3VGAB 3KR3H 4MCNA 5C0JB 3BIBX 4Z0XB 5D1XA 4YDKL 3CSYA 1A3RL 3FFCB 4FXGC 3KYOA 1HWWA 4HAGA 3TNMA 3KPPA 3VA6A 5CEZH 2JJTC 4KGLA 4IRZH 3FTUA 5KAQG 1BJ1H 2O6FA 3X3FL 2BVOA 1KXVC 5IBLD 2F8VA 3P9MB 1MQKH 1UEMA 2J5LC 4M62L 4RAHA 4UOW1 3VFOB 3ZHFA 3B7UX 1BZ9B 3BPOC 3VFVA 1CG9B 5AVRB 1PQZA 1EFQA 2GYSA 3CFKB 3OR6B 4M8VA 5CKGA 4G8EB 2F1BA 3H9SE 2R2HB 3HFML 1RIUH 4WIQA 2YRPA 3H2PA 2B9AA 4X4XB 5D7IB 2JCCA 4JJ5B 3N6YA 2XKNA 2EO7A 2XXCB 3GS4A 3GTTA 3DO4A 2DQTH 3SCMA 2XYCA 1NDMA 1SF3A 3DRQA 1G6RL 3H3KA 3TURA 1YDPB 4WGKA 3ZDWA 3ULVF 2OM5A 4G59C 1R3KB 1MI5B 3F58L 5JW4Q 4GBXC 1HEZA 2YAEA 1SQ2N 4WO4B 1DQLH 4OM0H 3MCYA 4FAAB 1T22B 4GG6A 4P5TC 5DD1H 5AOMA 1E27A 1EFXA 2TAAA 4M7JH 4N2GA 1S7QA 1DJWA 1A3ZA 1A6TA 4CADA 1LHZA 1BREA 1HEJC 5EU7C 3H3PH 4PD4J 1XAKA 4N2CA 1LP9B 3OJMB 4UT6H 4UOQA 5AOKA 1F3DH 5GGVH 2XZAH 2YUZA 3QPQD 5D1ZB 1QSEE 1RUQH 4TF4A 1JHLL 3I9IA 5HGHA 3W9DB 1UD8A 3HCVB 3FCUB 2B9BA 4OCWL 1I85C 3QAZC 1IC4L 4JPIB 2GUOA 4I85A 3WY2A 2B59A 2WC7A 3OC8A 4GAGL 4HPHA 3FONA 3GHEL 5D1QE 3P2DA 3D85D 4XX1E 1UZ8A 1JGVL 1UJ3C 4BQ9A 4WWID 3FFDB 2MNJB 4KI5C 1I8KB 1DQML 1OK8A 4G82A 5EEYA 2IPUK 5IQNA 4WI7A 5F0JB 1NAMB 3I02A 3KPSA 5E6UB 4AEFA 1U95B 2VDPH 1XH3A 2ZXCA 3NTCH 1CF8L 1YQVH 1TZGL 2D03H 1RIVH 3GUTB 9PCYA 5IY5B 3VTTA 1PX4A 3DSFH 5LUMA 4Y1TA 5MENA 3SQOL 2J3SA 1SDAB 2KPNA 2Z34A 3S4SG 5I1GH 2XXMB 5KS9B 1QFUL 3V0FA 1J5CA 3BDBA 2EYTB 1NINA 4EKJA 3RGVD 5KBKA 3BGAA 2ENPA 4Y19E 4DQOH 4U1JB 5JHLA 1EJOL 5DS2A 1XL6A 4ZFGL 2CH8A 3WHE1 1TITA 3OLDA 3PWJA 3LSOB 5J1AA 1U0QA 2J1ZA 4WI0A 4KK9D 4UAOC 4Z3FA 3QDJB 2WZ5A 4I1PA 4F7CA 5BPPA 5E2WL 1TO4A 3TEZA 2EVJA 3QWRD 2R69A 3OJVC 2VXQL 3EOTL 3GD1C 1S3KH 3BRGC 2ZQKA 2X4SA 1BZ7B 3VNYA 5DD0L 1VFOA 5DJDA 5I6MA 2W0LA 5GGRB 1DLHA 4K8RH 3FKUS 5BVPL 1GOGA 3FUEA 4OAWA 4MASA 2QPEB 5E1HB 4JZJA 1ZEAL 4ZK8A 3WL9A 4YDKH 1A3RH 1RERA 4MKMA 1CLZL 2DQJL 4HFWA 4WV1A 2FEEI 5HYSB 3IMBA 1WFJA 3VX1A 3LKSA 2E3VA 2WBKA 2YN3A 3D2UA 3FQ1A 4IS6A 5K1JA 1LM8V 4OJAA 3OKDB 3WTUA 3AXHA 3MGTA 2MPAL 4OJEH 5HHQB 4M62H 4MJ2A 4UV7L 1UH3A 5DO2D 3LDBC 2LLLA 4TMPA 1QMUA 4QHLA 1NFIA 2WWMD 3TESA 2FD6L 2IV8A 3HFMH 1YNLL 1D7FA 4NN7C 4F7KA 5T1LD 4JFQA 3LXBA 3G5WA 3PLYA 3WLBB 4XOCA 3II1A 2HFTA 2I9LA 1FYTD 2YD4A 3B7TA 2WB1A 3JTBA 3CSPA 1G6RH 1LD9B 4J3OG 4XPHL 3L2NA 3MRBB 4FL4C 4N3UA 4ZPTB 2IV9A 2X6CA 4HUWB 4JFOA 5SWQA 1HL9A 3O8XD 3BVNA 4L18A 1KCUH 1AKPA 5FYJE 1G9NL 4CGUB 3MROA 4DPRA 3HUJB 4WCYH 1O6VA 3GBML 4FA8A 5KG9B 3CC5B 4OLEA 3W0WA 1U4EA 2AEPH 3KYMA 4J4PD 3TBWA 4Y2DD 3LKPB 1Z5YD 2W59A 3KGUA 4JRYB 3TBVA 3U46A 4S2SB 4P3DB 3RIFK 5EOCJ 3GB7A 2APSA 4FYRA 1V54B 4P46C 2NTFA 2CJTA 1ESOA 1MZYA 3RWCB 4F37F 4UBDC 1S4IA 4OCWH 4PJDA 3SBWA 1IC4H 3EUDA 4K71B 2HT2C 4GAGH 3VWKB 4Q9BA 3DGDA 4NSKA 3GHEH 3VO0A 3VRIA 4ZFZB 4UTAA 1JSYA 4K5PA 3VI3A 1AVAA 1JGVH 1RJZA 2XXFA 3PAVA 2AV1A 2H9GA 3FUHA 1U4FA 1TQSA 1DQMH 1ZV9A 1XB3A 2YGOA 4PREB 4XNMB 3TO4B 1B0GB 1T2QL 5EUOA 3DX7A 3NESA 1EXHA 3Q9QA 2RFXB 1FPTL 2R1XA 1XIWB 1G6RB 4HIJA 1WH0A 1S9XA 4HV8A 3SQOH 3IFLL 3FH8A 5DC2A 5C97A 1QFUH 4PP1D 1DBMH 2ADJB 4R4BB 1E6JL 1M1XB 1SY6A 3VVWA 3KPLB 3C6LA 3Q5YA 2NY0B 2QTEA 1KCSL 5BS0E 2DDQL 3VG9B 1EJOH 4ZFGH 4JFVA 2AQ2A 3QORD 3L5WA 4GS7C 3NFPA 4J8RA 1T83C 2OZNA 3WTSA 4P2QB 5IESL 3PXLA 3GZOA 1GH7A 2OMTA 3ZOAA 2D0GA 5JLZA 4NO2A 1GZHC 5DHYA 1YEHH 2AJ3B 4O51B 1VKXA 1NC2B 5E2WH 3KPQA 3BAIA 3K0WA 5J6GB 2VXQH 3EOTH 4FFVC 3V0WL 3ABLB 5ADPL 1NLDL 1WBYA 2PW1B 4W9LC 3ESMA 1ND0A 2J1WA 3P73B 2AQPA 1RAMA 4A2LA 2ZOUA 5BV7L 5BVPH 5TH2A 3S7GA 5EO0A 2ZYSA 3EG9A 5E6ID 5BXFB 4YNYB 1FZJA 4LB8A 1CLZH 4YN3A 2DQJH 3VXUD 5GRYA 2RAMA 3HPLB 4JPVL 3OMZA 1GVIA 1C16A 4XHJC 1JPTL 2DKMA 2IAND 2Z4QA 1Y0LA 5L8LB 2MPAH 1F4YL 2EXSA 3HE6C 1ORSB 3BWAB 3FQWB 1T7VA 3K8LA 2ED7A 1F0LA 4UV7H 1CFQA 2C1OA 1BLNB 2Z31C 5F9DC 1BFOA 3ASWA 5F1OB 1FL6B 5IHHA 1YUHB 2Q76A 2FD6H 2X4NA 1YNLH 5AKTA 3ZLQC 3KZ8A 4YGVB 4GKNA 2IDCA 4Q8BA 4A6YA 3FFOA 3RI5F 2J2ZA 3WGUB 1DJIA 2QQQA 3ZU8A 5IB2B 3WO4B 1ES0A 2H3NB 2OXGA 3NJXA 4XPHH 3E6FB 4M9OA 3O4OB 3CZUB 4PSRA 4DGVL 3U7WL 2YZ1A 3VSTA 1ZA3A 3T4AA 3EGDB 4BFNA 4X9FA 5ABAA 1YNTF 2Q20A 4EI5C 2WIIB 1G9NH 3GBMH 2IAMC 5CGMA 4AC2A 1U30A 5KSVB 3RTQB 4HDIA 2E6QA 2XRAL 2NDFA 3NPSB 1TOXA 3Q2VA 4PJBF 2DQ6A 2YFOA 2VMEA 5C9JB 4X0KB 2I9TB 1OW0A 4RRPG 3UBHA 1N7ML 2ESVA 3ZGHA 1RUAH 2JQMA 4N1EA 1ZVHA 5HHMB 3RA7L 3T3MB 1J9CT 4W1TA 2UY6B 4RMUA 2JI3A 4YSDA 1UFGA 3NIGE 4ZFOA 2XWXA 1OAUL 1WGOA 2BP0B 1G7PA 3LXAA 5I0XA 1UKSA 1QX1A 4UT9L 1XCTA 2OX5B 5I1DB 5IW1B 1HQRA 5D96C 5I5MA 4URKA 1QSVA 3H7BA 1HXKA 5CWSA 4GRLA 3QFJB 1TEYA 4B9CA 1E9QA 3MA9H 2ITCB 3MRFB 1T2QH 4QO1A 4KKQA 3AROA 4I2XE 2R2BA 3LXUX 3LIZH 1FPTH 3LKNA 4U31A 3QAQA 4NKOA 4YL4A 3RDTB 2WNWA 4PJ5D 1LO4L 3ZTDC 1FNEB 3IFLH 3QUXA 3AU0A 4L3CB 3O6KL 2QPDB 1E6JH 1XSJA 3PGFL 1AGDB 2F08A 2FEDD 3HG1A 2D2OA 1MHCA 3MCKB 3ILQC 3S2CA 3UJIL 2DDQH 3MUGA 4B6ZA 3IETB 5KYXA 1IVTA 4MXVF 2C3VB 4X9IA 1CCZA 4C57C 4FLSA 4GFXA 2K45A 5E6YA 3SBRA 4OZIF 1ETJA 1BA9A 4BUQA 3UG3A 5DJCB 4PJ8C 3BPLB 3CFNA 5IESH 5F1IA 1AP2B 1TTAA 3SJVE 4Y4HB 3US1A 4S1SL 3GSWB 5FO2A 1PD0A 5AVWB 4G6KL 1TMCB 3QIUD 4WAFA 3JV4A 3D06A 2QGCA 5I5RA 1FV1A 1ZXKA 1R5IA 4Z3EA 4D0DB 4Z7OB 5H8DA 3V0WH 1SN0A 2VO8A 3FULA 1NLDH 3EYFA 5FK9B 2ZNWA 5ADPH 1HAWA 4NKQB 5DUBA 3T6QC 2ZXEB 3PDOA 4WTWA 5BZWB 3C60C 4N2LA 3U25A 4WW2C 2HFEB 5BV7H 1XF3B 1XCXA 4JDVA 2VAAB 5KZCD 4DUXA 4HH9B 2ZCZA 5DC0A 4G9FA 4ZX3A 1D5MA 1I7UA 1X6NA 1P4IL 4JPVH 4X6DA 3WY4A 3WNKA 5B38A 1ECYA 4DP5X 1JPTH 2DJMA 4A67A 3K72A 4ESKA 5IEHB 1F4YH 5MI0B 3QDGD 3D0LB 4DOHB 4FMKA 4FQXA 3BD5A 4CVWA 2D4DA 1F97A 2LGNA 3L3DB 4NQXA 2H6PB 3RWDB 3SN6N 3UG4A 3X14B 1IARB 2G4GA 3BMVA 3WJLC 5M94B 1P5UA 3ME0A 2XQYK 3QJHA 4K07A 2KERA 1XD0A 2OPCA 4J39A 2VITA 3DX0A 5FLUA 1KBBA 1KGIA 4DGVH 5D2NE 4ZW5A 3WTXA 3MNWB 2CBMA 1XX9C 3I3DA 3AJ7A 3F5WA 4PLJD 2G75B 8FABA 4I3SH 3PV6B 4ODXA 5KUMA 2ATAA 4YUEL 3FUIA 1AI1H 2FHCA 4L1DA 1Q1JL 4XP5L 4CILA 2BSEA 1RSYA 3QA3A 2XRAH 3U2SA 4PG9B 2VR5A 3BN9D 3TIDA 2WD0A 2YPLB 4YDIL 4M9PA 5BV7B 3HB3B 3TH4T 4CC0A 4HS3A 1WO2A 1IGML 3GSUA 4U6TA 3VWJB 3WXVL 4JGUA 1DYZA 1N7MH 1X44A 4FKHA 4HJ0D 4F2MA 1NKOA 3RA7H 2FZ3A 1XXFC 1F58L 1IBDA 2X4RB 1ACCA 3MGOB 3SDXE 4AJYV 1OAUH 3HR5A 2KS0A 5FDYA 3WTWA 3C08L 4LVNC 3DWTA 2NYYD 2NY4C 1QZNA 4RBPH 3GSOB 1TQTA 4ZUVB 3PABB 3MFFB 4AQAB 1ZJAA 4GRWE 2BLFA 3IT8D 4RGNC 1GIGL 2VLKB 4UUJB 2FATH 2QLVB 3W81A 4PGDA 2VUYA 2GG1A 2PABA 3LKOB 2DM2A 1ZSDA 2ZSWB 4PJAA 2NX5D 5ES4B 3NCCB 3QNXB 3N85L 4JDTL 4U1KB 1U3JA 3T2NH 1A1NB 1JTPA 5DCCA 2XVLA 1RZKH 1A66A 3RAJL 4J3WA 5JW5A 1LO4H 4HBCL 1H0DA 4MJ6B 3ML8A 1GY1A 4JQXA 4UOZA 3NJIA 3FMGL 1LK2A 2NLJA 3NJHA 4RGMC 5DJ2B 3OSKA 2ED6A 3T2LA 5D7LD 1UM6L 1ZHLB 3K4AA 3DUSB 3UJIH 1AGBA 4MVBD 5AOIA 1O0VA 1BWMA 4ECNA 4NQDB 1KB9J 2Y1YA 2V33A 1Q9LB 4HZLA 4LMQE 4Y9GA 1JGEB 3IJEB 4I5BA 5LDSA 1AHMA 4WKZA 3MUY1 4FFZL 3OGCA 4XMPL 2CLRB 4S1SH 2OMXB 4IW4C 3WS6A 4G6KH 3FN9A 4BINA 4ACTA 2P5ED 4ZS6D 2LT9A 1QUNB 3SOTA 4DKDC 2BSTA 4IBUA 1BF8A 5CU9A 4P4RB 3ECUA 5GZOA 4C56E 2OW7A 2C1PA 2WVVA 4IBWA 2HTKC 4UYQA 4QYOA 2EDJA 1FG9C 1T1ZA 5AYQA 1WZMA 4TTDC 4Q2ZA 5EC1B 4PCKA 5EOTA 4YQXL 5KBMA 2VERA 3THMH 5C0AB 1JCKA 4KHTL 2J20A 2YGNA 4MA8L 5DK2A 5E9AA 5H37G 5KANI 3ALXA 4PJXB 1YLBB 2ZWZA 4R4FL 1P4IH 5BVJA 1Q9KB 3KBEA 3ARGC 2C7UB 4BUHA 3EJZD 4M4PA 5TGBB 4ABUA 4DH2A 3W3BA 4HLZH 3PHOA 3L45A 1KCWA 4WUUE 1JG9A 3N1GC 3S3JA 3KMDA 3SDAA 3EO1B 4XB3A 2DEYX 3BWSA 1E8YA 3VD9A 1KCRL 4Z3JA 2EDWA 1UT2A 5C7ZA 3OKMA 1DSWA 2Y5EA 1NWPA 5L2KD 3BVTA 3HJEA 2P5WD 3C9NA 2PR9A 5LAPA 1GR7A 3QUZA 3VXPA 3GIVB 4JPKL 5DSCB 1OWRM 4ATWA 4J1UB 4P99A 4KK8C 2K7QA 1EZVX 2O6CA 4CNIA 2QKIC 5IHLB 3HHMA 2QDVA 2Z93A 3MRNA 4HLEA 1IEAA 4YUEH 1ED3A 4N5ED 1OGAB 1Q1JH 4U1LB 4XP5H 2CO7B 4AC4A 4OD2B 3IKCB 1UD5A 3PL6C 1VEOA 2AABL 2D7QA 4L4TB 5L8JB 3NFNA 1T0PB 2DL9A 4N4YB 4YDIH 2WKGA 1M05A 5IB3A 1IGMH 3DUHA 5EBWB 4RMWA 1A65A 1OK0A 1D9KA 1S9YA 3TH2T 5C0CD 4I3RL 4U7SA 2PPCA 3SGJC 4EIUA 3SO3C 2H1XA 5JIPA 1RLWA 4M8QA 5DK3A 4JFPB 4L4VB 3C08H 5INDB 4PTUA 3T0AA 3M86A 1SOQA 5DZJA 1BF5A 3GSQA 4RIRA 4WEEA 4JFED 1OY3B 4KK5C 3G6JB 1BJ8A 2WMPB 4JFXB 5HHOB 2E6JA 2BNQD 4WI6A 3UTPD 1KT2B 1U91B 4IGBD 2BSDA 4ZO9A 2ZP0T 2AXGB 4JG1L 1XGYL 1IAKA 5CGTA 4JY4A 4IU3A 2ALAA 3FMGH 4NAJA 4WWNA 3KXFB 1TEGA 5MERB 3QQNA 4EF3A 2FT6A 1M1SA 4NN6B 2CJ3A 1A9EB 2VZUA 1KGYE 1RK1B 4Z95L 1BGXL 3BUDA 2E47A 1AHWA 3WN5B 2YXWA 2A0LD 4PJ7A 2FJHA 5A16A 3GBEA 3K6IA 5DF0A 3MV01 5AAWC 4FFZH 4BSVB 4XMPH 4JFHE 4P2YA 3RU8H 3OXRA 1TCRA 3ZDXF 1EAOA 4MA1C 4MNQA 4GRWF 3K71B 1CXEA 3KPSE 4PN6A 2V2TA 1XR8B 4WFFD 1ONQA 3MOAH 3AMLA 3HNVL 1TQBB 4K9EC 2CHNA 4YH6A 5F7DA 2X4QB 2I07A 5MENE 4H2CA 3BH8A 3WJMB 4JNXA 1T1YA 4L9LA 1AKJA 3H2QA 4R97C 1LE5A 3TVMA 3UAJD 2W92A 1FFOA 3STZB 1IVLA 3H53A 5AW7B 2AJYH 2YBRB 3F85A 1XF2A 4DP9X 4JVPA 4LCCA 4QHMA 2DIJA 4YQXH 5JIHA 3EOBA 4YPGA 2ZKMX 4MA8H 1MWAA 4XVJL 2C3XA 1DN0B 1JNLL 4R4FH 3KYAA 5T3XL 2FNBA 2CGZA 4KPHH 2F8IA 3MBEB 2PXYA 4LP5A 4XMKL 5IMLB 2V9TA 3ENEA 3UTSB 3TBBA 3QJQB 5B1BB 2WAQA 1NFDB 3RVTC 3WLWC 1FQ9C 5FDWA 3RIKA 3FN3A 3ZXAC 4EN3C 1G7QB 1HINL 2F54B 1IE5A 4EO5A 4NJAL 2BSBA 1KCRH 3QNYA 4FZEH 1JXGA 4GSXA 5AZ2L 2L3BA 5GXBB 2OK0L 4KK6C 2WXHA 3HPJB 3GXNA 1VZIA 3ARWA 4D9QD 1FNSL 5C0RL 4KXCA 3POCA 3VG0L 1N9PA 4DHLA 4GT7A 3O3BB 3DMMA 1F1DA 2VDRL 4MCZA 1KIPB 4JPKH 3ZKNC 4GINA 3CZJA 2DMHA 3H0TB 1RJYA 1UXWB 3N91A 1UA7A 3HLAB 4LVHC 3KH4A 1AXTL 1IEBB 3ZTJG 2YUXA 1N8OE 2EDKA 4GQQA 4PRHD 1N3NA 3ZQWA 1QSFB 1TTFA 3HC4L 1CXKA 2AABH 4E9XA 3TA3A 2JJUA 3TNNA 2P8MA 3CN2A 4QY8B 3CXDH 2YARA 4YEEA 4ZQKA 5IQMA 3NT0A 1ZDQA 4HAKA 5HDBB 4KJPD 1S7SA 2IAMB 4UYPA 4LE8A 3QR1A 3MRLB 4X7DC 2DWTA 4ZRGA 2APBA 4WWKD 4PV8B 4IRJA 4OCYL 1KXTA 5DZNA 5T33H 3ZO9A 2OZ4A 1RZFH 4GUOA 1IBFA 3QHZH 2WXIA 1FFRA 2PR4L 4Z7WE 1HWGB 4RWYL 4QOKB 2NY5L 5TTRA 4I0PA 2DZEA 1R46A 4WJG3 4ENEC 1IB5A 3ZDYB 2MKWA 1J5HA 1UUNA 3DARA 3DYMA 4QLRA 1A6ZB 3W0WE 1MIEL 3AS3A 3ARBA 3C8DA 3HRZB 3GEWB 4J2QA 4M1CD 3IN0A 1ANUA 5I1JL 3RVUC 1XGYH 2Q2EB 4L29A 4FG0A 3WE6A 3RWJB 1BXVA 1PD1A 2BXZA 2MQCA 5GS0C 1U3ZA 2X2YA 2XIDA 5E8PB 2ROXA 1HXYB 5DRZA 3TYFB 5EBMB 2A74A 4ELMF 1L9QA 4X8JB 1Z2KA 1WF5A 4LNRA 1FL5A 4F58L 2L7UA 4PJDE 4Z95H 3S37L 1BGXH 3WFDL 1QSZA 4JFWA 2VRQA 1YYCA 3H9SD 4EUPG 3ETSA 3EYQC 1UCBL 5D7HA 1EO8L 4BCXA 2EIDA 3K2MC 5DFWH 5FEBA 1KPVA 3SGKC 3VI3E 5GSRB 5DQDL 3DO7B 2CLZB 1FZMA 3GJFH 4WU7B 3U9WA 2MHAA 5DS8B 3VACA 5EEUA 1UVQB 4D8OA 4XHQA 4LBAA 2Z0BA 2VDNL 2MQGA 3NZUA 1CFTB 2AK1L 1QFWH 4DETA 3RWIB 1LO5A 3AUWB 4POZD 5D6DA 3HNVH 4DSYA 3QQ3B 1EXGA 3IDIB 1JD9A 3S4SB 4R7NA 4ZNEA 1OQOA 2ZF9A 1KLGA 4QRPA 3QDMB 3TJHD 3TZVA 3BP6A 2WINB 4BA0A 2GC4C 3QJOA 1ACXA 1E3ZA 2KUTA 3MJWA 3FO0L 5BUAA 1FI8C 1JL8A 1E7UA 1WISA 1A7NL 4P23C 3GEFA 1J7VR 3DXAB 4XVJH 5CJQL 1CGXA 5T3XH 1V7NL 3MNVB 1QSED 2IDSA 2Q2LA 1MELA 4X6BB 1TTUA 3Q6FA 3FRPA 5FKPB 4WW2B 5JDSA 2ZAGA 4D0BA 2D9CA 2IALB 5KANG 3X1NA 4LHUD 3QXAA 3S5LG 5JXEA 3FO1B 5D1QD 4NJAH 4HFUL 1T5WB 2IOIA 1IU1A 3QQDA 2J12B 1SLWA 2QGBA 2OK0H 2E9IA 2C34A 2BY2A 1QLEL 5JORB 5HYJA 1FNSH 3ZMNA 4XMTA 3SDDC 2J8UB 5C0RH 3GGWA 3VG0H 4OUUB 4DFIA 3L9EA 5KOVC 2H26B 3U1SH 4LOFA 4N0FB 3KEHA 1F4HA 4OUOA 4M1GH 5IVXF 1BQHG 5GRXG 2CDGB 1IAOB 4ODUA 4Z78A 1HHJB 4BFGA 1OT4A 1X3DA 1AXTH 2ZCLL 2R4RL 2YC1B 3MPCA 2E6PA 2AQRA 2NMSA 1AD9A 4WI4A 2XTJB 4JB9L 1I1CA 4N9OB 1G9ML 1B6UA 1O75A 5F7UA 3HC4H 3TN0B 3BWZA 1QUPA 2AJUL 1AR1B 3P0YL 1LXMA 1XTMA 5E8NA 4TTGA 4JO2L 4TNWF 5C0BD 2Q7YB 2R27A 3UPAA 1W0WB 2BIOA 3GSXA 1CK0L 4LKCA 2A38A 2NR6C 2Z8SA 5TDPB 4Z7NE 1HI6B 1MHPL 3IXTB 4BSWB 1IGJA 4WZ9A 1D5XA 4Y5YC 4XGZB 2MNWA 4XZ4A 1SHXA 2BIQA 4ZUUB 4IQHA 4HK0B 4OCYH 3LRLA 3VXQB 4OI7A 4FXGA 3SDCC 4NPYA 2JJTA 1Z5HA 2PR4H 1R19A 4RWYH 5AEAA 4AJWA 2BIMA 4K23L 4I0CC 4WJ5A 2NY5H 2QZ5A 5HYFA 1KXVA 1A4JA 3LS5L 5I26A 3U4BL 1BQSA 1I1AA 3UYPB 4R7VA 1R5VB 4Y4FB 1MCWW 1MIEH 2BVEA 1BZQK 1E5BA 1D3CA 2LQRA 1GAFH 4G42B 4G43B 3WIHA 3LOWA 3O6FD 1ZHBB 3GBLA 5I1JH 4IIQB 4I4WB 2VDRB 1J05A 5JZ7D 3D12B 1L6PA 4G1MA 2OJ1A 2DQMA 1GYVA 1MCEA 5CZRA 2ESVE 2F6AA 1UA3A 5JTWA 1K5WA 5HY9B 3X1GA 2G5BA 4F58H 3LQMA 3RUGE 1G7HA 4DTGL 2QHRL 4GBXA 3S37H 3R1GL 4MFHA 3WFDH 1M7XA 3T0EB 5LNDA 4BH8A 2F7IA 3BAEL 1UCBH 1EO8H 3GC3A 1H6UA 3NQKA 2WTOA 5GRVL 5DQDH 4P5TA 3WI9A 4RGMB 5D5MB 1KOAA 4LL1A 4ZMYA 1QEXA 3QXTA 4MJ5B 3F12B 1V55B 1ZAGA 2VDNH 4Z7WF 2PN5A 5HJBA 4B3VA 1SOXA 1ZV5A 2AK1H 5HXMA 4M03A 4QKXB 3CVCA 5CBEA 2IH3A 4JRXA 3V0GA 3HN5A 3NBNA 4ZAKD 2UZIL 2X41A 1RV6X 1JVKA 2C9PA 5D2LE 5D8JL 1PKQB 1SJEB 5A2IH 1I3RA 2ERJB 1I85A 2EEDA 4LKXA 2GBUA 3HG1E 1KFGA 2OTPA 3KWTA 1INQB 4K3JL 2ADYA 3BEWA 2A6JB 4L3EE 3MRPA 1A7NH 3KPRB 3T2PA 5CJQH 3OZLA 1UJ3A 3PGDB 1IAII 4L37A 3B3IB 1KPRA 1AC6A 1MLCA 1GC1C 2Z92A 4CGTA 4GO8A 5BMFL 2OTUB 1R3JB 3APFA 1VESA 3EYUL 4Z0BL 6CGTA 4X6CE 2OMUA 3LKQB 4HAFA 4RVBA 4CN1A 4HFUH 5JA8B 3N43B 4WU5B 3CUPA 5GPRA 5C07B 4YZWA 1BSIA 4EVNB 3S6CA 1MFVA 1KN4L 2K6YA 4BDVA 4B9ZA 4HWBA 4UQIM 3WEAA 4N0CD 1YEFL 2C9SA 2JKWA 2VDNB 3TCLB 5FGCE 3V4UL 3JWOL 3KLKA 1ZLDA 2FSEA 4D7PA 2ZCLH 2R4RH 4X6DE 2IJ0C 4LPWA 4AYFB 1L0YA 2BSRA 4P2RA 4EI6A 5C71A 4DGYL 5I6XB 5CN3A 5ITBL 2DS4A 3MXVL 4PR5B 3ULUF 2VABA 4Z7UF 4JB9H 1EHXA 3BRDA 1S7VA 1G9MH 4C58B 1TZOA 2AJVH 2VQ4A 2AJUH 2BJML 4LSRL 3TWCH 2JXMA 3JV5A 3P0YH 1E67A 4MXQC 3TA4D 3VXRA 2CJUL 4J6RL 2OI9B 4JO2H 4KH2A 1JCVA 3ATBA 1DUZA 1CK0H 1OSYA 2F1EA 3MV9A 4WGVB 1MHPH 1J1OL 1KBVA 3D4CA 3T65B 3DJ9A 4J7RA 3AT9A 3PL6B 3PNRB 2VDLL 3KLHC 5MEQB 4ZUSA 3MBWB 4K23H 1R24B 4TNGA 1NIEA 1WQVT 1U8LB 2VN5A 4FQIL 4U6HA 3TO2B 4ZMXA 1AH1A 4BBWA 4UM8A 3TJEH 2CO1A 1AJ7L 2OYMA 4YHNA 3U4BH 4LLQA 5F7BA 5JMOC 1QLEB 4A2GA 3ZT5A 5FUOL 3IRPX 2J71A 4PCTA 2DLGA 2HT3C 3IDYB 4AZ8A 1UB6B 3DX8A 4L3AA 5CGYC 1RZJL 2LFEA 4MDRA 4AM0B 3HA0A 3N0PB 5E8EA 1FC2D 1BZOA 1NQBA 3Q3GA 1NBVL 4LEOB 3UCRA 4OF6A 2VWEE 4XODA 3FB5B 2E8YA 4F2ME 3FUFA 2PCFA 3OHMB 4DTGH 1NWOA 4YZFF 3ZT7A 2QHRH 4RAUB 4NENB 2WBJC 3V4VL 3R1GH 5KUKA 1DQIA 4A55A 3P9LA 1PEZA 4FQLL 5J12B 4UQ3A 1NIDA 1JWUA 2XQYA 4M1DL 1T03L 3FHQA 2PF6A 2HLFD 4H8QA 3PS6A 4ADIA 2ATKA 3L9YA 4ODWA 2RIKA 4PJAE 3V9FA 5A3IC 4UIKL 4LF3A 2W60A 4RX4D 1MI5E 3BCFA 3Q2WA 4PHXA 5GGUB 4GKLA 4PRPB 4P46A 1DN2A 2UZIH 2C9QA 2FYVA 4PFEA 4XCCL 3CCHB 5HJ3A 3VGFA 5E0FA 2HTLC 3SKMA 3IFOA 2WYHA 1T89C 3K2UL 5J6HB 4JE4B 4DERA 1IFRA 4U6XB 1D5ZA 2BZ7A 2ZPKL 3CK0L 4K3JH 2XZQH 3I6LD 4N6RA 2SEBA 3N0AA 1D6EB 2B8OT 4APQC 5EZLB 4MAUL 1LP9E 2EVFA 3ARDB 4KZEL 2QVMA 1YG9A 2EINB 4X7EC 3WS3A 3W5MA 3RUGF 2LTQB 4MNGA 2KZWA 1TJIL 4R2GC 1OF0A 5BMFH 2X88A 2L04A 3EYUH 4NQVA 3UTZB 4QDGA 1H3XA 4Z0BH 3R0MA 4NHCL 4B27A 4X0NA 4XNUL 1F41A 3HS0C 1E9PB 1H19A 4WSKA 2MQ3A 2R29L 4QR7A 5DUPH 5C08A 4BV1A 5E9DA 1EK3A 1KTCA 2H0PA 1CD1B 1A9BB 1HL5A 5DMIL 4EOWL 1C7TA 2DYSB 3B9KD 3IXAA 3DVNB 3LNDA 5C3IA 1ILSA 5BRZB 1KN4H 4GO9A 2OMNA 1F2QA 2VW7A 4MMXB 5EEWA 5D4JA 1LNUA 4IDJL 3O3EA 2FBJH 1YEFH 4LHUG 5SWZB 4AQZA 1THCA 4EEEA 5D2LF 3BEVA 3V4UH 2Y36L 3DIFB 1T83A 4PRNB 4XX1G 2NSXA 3LVEA 1FVCB 1GZQA 1PZSA 1CXHA 5ITBH 5KS9E 3A4DA 3MLXH 1GZHA 3MXVH 2VRKA 4YDLB 5J1TC 4R83A 1WIUA 2DM3A 3EFFB 2BJMH 3O45B 4LSRH 5I2IB 5EU4A 2HJFB 2CJUH 4J6RH 4W9GC 2E7LC 4HCRA 4ZJ9A 4PI2A 3U82B 1T7XA 1RHHA 4A7QA 3LEYL 5F7WC 5L6YL 3SJVD 4AEIL 2KQMA 1VEMA 5T5NF 2A6DA 1TUPA 1J1OH 2QHLA 5C0IB 5CF3A 4X6CF 4I0KA 4YOKA 4QTIL 4WUKL 5IMOA 3NRPA 4MDIA 2F1AA 2VDLH 5FV1L 2FH8A 2OCFD 3VFUB 1CFSB 1QFPA 4B96A 4NAQA 4PS8A 4W4OC 4WHCA 3DOHA 1HE8A 2PYEA 4FQIH 4FRWA 3MACL 4RDBA 2ILLA 3HE6A 3CFUA 5T1LB 1UH4A 4HQQL 2PWGA 3A4FA 2BIIA 2BP3A 4A66A 1FYTB 5FUOH 2VUOA 2Z31A 2VMJA 5TK2A 3M17B 4AJ0A 1Y18A 5IZ7A 1HL4A 1RZJH 3PCYA 1TT6A 4ALAL 4M5SA 1ZTXL 4V1DB 1NBVH 3L1FA 3ZY7A 4NX0A 3O8XB 1BOYA 3BH9A 4Z5RB 3KS0H 4I88A 4NCC1 3L4UA 4JQVA 2KYIA 5ACLA 1TDQA 2QT6A 4LLMB 3AVEA 4EI0A 5KEZA 4Y2DB 1OCCB 2EYRB 3QWOA 3V4VH 5C2UB 2BW4A 1B6DA 5K1NA 4LQ1A 1LVEA 4YL9A 4OZFH 4EI5A 3DX4A 2ADIB 2QQKL 4GEJA 4FQLH 1JWMA 5FB8A 2XG4A 2PCPB 5HYQA 5JW3L 4M1DH 1T03H 4X7SL 3FTGB 3NCJL 5H37H 4NCDA 4BK5C 1EHNA 2VZOA 3QRLA 4O02B 1CFVL 1ZE3H 3MUUA 4LCWB 5HVHB