5FFLA

Crystal structure of mouse cd300lf at 1.6 angstroms resolution.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
b'MEDPVTGPEEVSGQEQGSLTVQCRYTSGWKDYKKYWCQGVPQRSCKTLVETDASEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGLDPMFKVTVNIGPVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD300 antigen-like family member F
publication title Discovery of a proteinaceous cellular receptor for a norovirus.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fflA00
3VFVB 1GGBH 4ODVH 2FEDC 3K3QA 4NQDD 2KUTA 2VLRA 5C0CE 1EFQA 5A2FA 2XIDA 1NGZA 2GQHA 4K23H 4S1QH 1IGIH 2EC9U 4XZUB 4PJDA 2D0HA 4U1NA 2PKDA 2BVOB 2P48B 3QEUB 4QHMB 4JDVA 3C8HA 3WJJA 4TNWK 3ZKNC 2QJDA 1RHHA 1CBVH 5I8KL 4KTEL 4WW2A 5FEBA 3VFPB 2VLMD 4LLWB 2BSTB 3KPRA 4IRSD 2PO6B 1MFCH 3DVNA 4XPAH 5EU5B 1JWMB 1RIVL 5I6XB 4WU5B 4K2UH 4IRJB 1NFDB 3DURA 3WDJA 4XCCL 4WTXA 5ILTL 1ONQB 1DQQB 4P2YA 3FHQA 3QEQA 3VRIB 3ZHDA 1XGUA 2F53A 4FQPA 1U3HB 1OVZA 4AENA 3GMNB 3BKJL 5SWSB 2OYPA 1T4KA 4C58B 2X1XR 3BXNA 2MPAH 4X7TB 4HG4K 3HZKB 1CDUA 4X6CF 1D9KA 4K3JH 1OL0A 5E5MB 2GY7B 2EDNA 4XHQA 3TBVB 3TIDA 4MJ5B 2GAZA 1MAML 3IETA 2F9BT 2QKIB 3LEYL 3V6FA 3B9VA 2B8OT 2OJEA 3X12B 3MV9A 3OB8A 1YC7A 1XF4B 4DGYH 3WFHB 3CIQA 5MI0B 4I77L 2JKXA 4XMPH 1OT1A 5D7IA 2R0WL 4N90D 4A2LA 4DAGH 3V0WH 2EDQA 1R5IA 3H9SE 4Q9RH 4TSAL 1RU9H 5TGBA 4F7CA 3HUJF 3KPQB 2DYPA 4IIQA 3T2PA 2H45A 2A77H 4X6BB 2OSLA 3SDYL 1UQSB 4PREA 4NHUB 4KKCC 4LSVL 4F9PA 3MRCA 5HHNA 5JMRA 1C16A 1PD6A 4PRBA 5JOFB 4J2XA 4NQEA 3OG6B 4P23B 5GPRA 4G7VL 4EUPA 1SVCP 3OAYK 4X0KB 5I16B 4OZGE 5I71B 5E2VL 2A9NL 4KRPD 5E00A 3CVHA 4NQDA 3S4SA 1E6OL 4GO6B 4GMTH 5C0RH 4NOBA 3TJEL 1JGLH 2QV2A 1J0HA 1X4XA 1KYOJ 4JM4H 4W4NA 3MBXH 1IKNA 2WLYA 5IB3A 5FHAH 1FBIL 4HQQL 4QRPB 1FNGA 5CIPH 1U42A 1R24B 3MUJA 3NCEB 3OR6B 2VIRA 2FL5B 3M1BB 2D7QA 1TZHB 3T2QA 4JDTL 2YD5A 25C8H 4RFOH 4JQXC 1PX3A 2DQDL 1A6AB 1JCKA 5CZXD 1P1ZB 3H6JA 4GSDL 1DTUA 2IMMA 3JV6A 2GK0B 3U0PB 5D6DC 2B1AH 2C3WA 1MCOL 2B5IC 2VSCA 4DZBB 3NGBC 2X42A 5DZOA 1OAYL 5DEGB 5IVZB 4LFHD 4MJID 3ZDZE 1FL5B 4YHOL 1BLNA 2AXJA 5CEYB 4UOW1 1K9TA 4P5TD 5C0GB 4RMWA 3STBA 3INUH 2R2EB 3NCMA 4NGHH 3THMH 4PLJD 1BQSA 2L0DA 2N7AA 5F8RC 2M26A 1SM3H 4HGWA 3DXAA 2A83A 2IFFH 3A6BL 1OAXL 4NUJB 3LPFA 3P9MA 2HLFC 5FM8A 1K4DA 4OLXL 1D5MA 4AYFA 3OKKA 2WIIA 4HJ0C 4K9EH 4S1SH 5J3HC 2IGFH 4P59H 3MLWH 5ITFA 4KH2A 2OI9B 5KSVA 1H9VA 5AUMB 1KIRA 4RFEA 1KCUH 1WZKA 1XIWC 1G9MC 1YECH 3KR3H 3N06B 4IHOB 5T3ZE 3VGGA 3AS3A 5FYLH 5TFSH 3LKOA 3MACH 5HHXL 1P9MC 4BYHA 4D0CA 5I1GH 2P5WE 3CFCH 4NJ9H 3PF2A 4JQIH 3ILQC 3G6AB 4EQ3A 2EYTA 4QRQB 4XPHL 1G7QA 1MRDH 3FAWA 1LO3H 2WLZA 3KJ4C 1E6JL 4JFYB 4Y4FD 3LS5L 4GRMA 3T0XA 5HHOD 3N50A 1BZ7B 4NWTL 1FVEA 2X4UA 3BQUD 1J0KA 3PL6B 5BCAA 3SDXB 3CC5B 5DUPL 1U91B 5HJ3A 4P48A 1Q9KB 2R39A 4YXHL 1ZGLM 3EO1B 3MRDB 1NCDH 1A6WH 1QSEB 2VDOH 4YZFE 1F58H 1CR9H 3IDYB 4MZ2A 3U0WH 3S4SG 4HMEA 4KDVA 2XNAB 1NAMH 2J88H 4CVWA 3SEPA 2V5RA 2V5MA 5KS9F 4JREC 4I3RH 5L7XL 4KFZC 2LAAA 4GLRI 4G43A 3HE6B 3QEGL 1M6OB 1HILB 4OCYH 2UY7A 4MQTB 2ENSA 2FHFA 3MODH 5CP3H 1G0DA 4Z7UE 3VMPA 1NUFA 3PWLA 3HR5A 3E8UH 35C8L 2FYYA 4AT6A 5K9KB 1YYLH 2AK1H 1NUNB 3QRGL 3D69B 1T0MA 43CAA 4GRWB 5D8JL 3HCVA 2EH8H 2ATKA 4ZYKB 3G6DL 1LEKB 2GI7A 5DVMA 2N7BA 1D5ZB 2ADJA 1T2XA 1MSPA 3S34L 4OGXL 4M1GH 4MJIA 3GRWH 2CUMA 2NZIA 3CSPA 1MJJB 3IFNL 2VXVH 2B2XH 3T3ME 4JN1H 1BIHA 2NY5L 3GJFA 3LHPH 1JHKL 4X98A 2IALA 4FABH 1MHCB 4NO5B 1D7FA 2IG2L 4EXKA 5KSBE 1IC7L 3D5OF 3FQUA 4KHXL 1N2RA 3X17A 5I18L 5CD3A 1WFTA 3I3DA 5FUOL 1KN4L 1JPFA 1KNOA 4NYLA 2QSCH 3EOTH 3EOAA 3VFOA 1WBYB 1WFUA 3WS6C 4ALAL 3P11L 5JA9A 4N9GA 4C59B 5CEZD 1BIIB 4PIRF 3JV0A 4L5FL 5D70L 1K3ZA 4GKNA 3B8SA 3EDFA 5D1XB 4DN3H 4XCEB 2FB4H 1FLRL 2ZZUT 1SY6H 3KJ6H 2HLAA 4PRIB 3E2HC 3LN4B 3L95B 4KI5F 4FQLL 5JORA 2NPLX 4XP4L 1T83C 3RPIA 3VXOA 2MQ3A 2J8UA 4J7RA 3MGOA 2NXYD 1QO3A 1Y18A 1F2XK 1YEIH 1KLGA 1DBKL 3UJTH 1FJ1A 5F9AC 3BQUA 5JHDD 1FO0H 4OD1H 1NGXB 4WWKC 3LKNA 5JXED 4RMTA 3UTPD 1Q72H 3ZT7A 1A47A 2ZNWA 3S36H 1G9EA 2ZOLA 4QXTB 2UVFA 4X99A 4M8QB 3FOLB 3MBEA 1QLRA 5CCKH 1D5BB 1A3RH 5DQJA 3V7MA 1C5BH 4XTRC 4R90L 4U4BA 4HIEB 3DUUB 4RAUA 4Y16A 1A14L 1H5BC 3BN9C 4JHWH 5FYJD 5KZCB 2XWTA 3VGBA 4G6MH 4HAFA 2XA8L 4I5BB 3RGVD 2R1WB 1QP1A 4JY4A 2ORBH 1FNSH 1IEBB 2VDKL 2VR9A 1NFIB 1X7QA 5HHME 2X4QA 4JFXB 3DYOA 2FX8L 2JJVA 1TTUA 4OD2A 2Z4QA 3VWKD 2IEPA 4MNQE 3ZDYE 4KQ3H 2X70A 3C6SB 1U3ZA 3IDNB 1YEKL 4K7PX 4CMHB 3CDGA 4JO1H 3KPSD 4EDWH 4RGNE 4XC3L 2XFXB 5DK0B 1IGTB 2YD9A 3EGSB 6CGTA 4WO4C 5H94A 3UTSD 4KZEH 4OUUB 4ZOAA 1UCTA 4HK3J 4G5ZL 4OD3L 4PJGB 1IC1A 3WNMA 1INQB 3HC0B 4HUXA 2A9ML 3IDMA 1L0QA 3SPVB 4IOFD 4U1LA 5I17A 4GRLD 3EZJB 4HC1A 4GW4B 3CXDH 1AHWC 2W65B 5KAQF 1N64H 1JYWA 1QEWB 5GGVH 4DQOH 4F7TA 1EV2E 4MA7L 3WIHA 5E1AA 5K9QG 3TNNB 3BD5A 2BMKB 1OAUH 3WCYA 3BWAB 5BOZG 2MHAB 2DLEA 5T5NG 4P9ML 1FYTA 3TO4C 4A6YL 3H9YA 3LVEA 5F70A 4AQ1B 5DJ6A 4LAQL 1BD2D 4N0UB 1RZJH 1BMGA 3DHJA 2NY0D 5IESL 4XNZB 5A2LH 4ODXA 1VGEH 3HFMH 1MWAA 3S7GA 1E27A 5ICYB 4UT7H 2Y9RT 1WF5A 2CMRH 1AI1H 5C08A 5I1JL 4IRZH 5JHDA 2AGJH 1P4BH 4GAJH 4OGYL 1MREL 3GSUA 5KG9B 3MRIB 2ZSVB 5C09B 2B39A 5TDOB 2EYRB 3C6LD 1NCUA 3DIFA 4XPGL 2NX5E 4Z7VE 5IR1A 3AAZA 4NBXB 1QLFB 2CDFB 4N0FB 5C07D 2JK5B 2VLRE 3RUGB 3DBXB 2HFFB 1GOHA 4HH8A 1EMTH 2UZXB 3QIUB 1R3KA 3EYFB 3G04A 4TPRH 1XF5A 4PJDE 5FA4A 3RGVA 1PEZA 2F58H 3JV4A 4DK3A 2VZ3A 4KK9C 1IBGL 1WK0A 3SKJL 3VWKA 4HIJB 3N0PB 43C9B 4OI9A 5DRNA 1TVDA 4XGZB 3ARRA 5C0FB 1F4WL 2VLLA 1E4WH 3W9DA 1KELL 4HGMA 4HJJL 1A1OB 2DICA 2W9LA 3KPRE 1TNMA 4GAGH 1QFUH 4Z7QE 4P2OB 1FNFA 4NZUL 3U4EA 2DQJL 4LSSL 3S37H 4P9HL 5I1DA 2MKWA 1EO8H 2NY1B 3QEQE 4CN6A 2QHRH 1I9IL 2F53E 2ZUTA 3AREB 1U8QA 2NY5C 3O2DA 1K3IA 3VXNA 2Z8SA 3VFSB 3OKDB 4G9FE 1ZLSH 1QKZL 3DTXB 2DLFL 1A9EB 3GMMA 1HSBB 1X5HA 3TWCL 5D1QB 5IB2A 2HT2D 3NABL 1RZIA 3FMGL 3IDGB 1SYVB 2AK4A 1HXYA 7CGTA 1CL7L 4CGTA 3D39D 1GOGA 3QULB 1HCVA 5L9DL 3WD5L 1MCFA 5HVWA 4TULL 4X80H 2HFGL 5CJ5A 5JR1H 1DLFH 1W72H 4ZFOL 4RGOL 1G7MB 2VQ1A 4U3XA 3FO9B 1WC7A 1WT5C 2H8PB 1BD2A 4WI2A 3QUZC 4KTDL 1NANI 1PZ5B 5JW5A 1LVEA 5JNYA 4TSCL 5D72H 3MLRH 2AERT 3ULUC 3VD4A 4JDVB 1NGYB 1CZ8L 1VHPA 3SCMD 3O6FC 4LHUA 1IT9L 3HS0B 4NGHL 3NIFE 3WBDA 1J0IA 1OP5H 2BSRB 5I76A 3BH8A 5JW4M 5EBWA 4OZHB 2UZIH 4BUHA 1GH7A 1NMCC 4U6HB 3KPOA 5EWIH 2Y07L 5DJXB 3SKOA 4XNYH 4XVUC 5BQ7A 4C83A 4OAWA 5DYOB 1CD9B 4N0RA 1F4XH 2QQNH 3QXUA 5FYKD 1HHIA 3BH9B 4JHAH 3CFEA 4TNWF 5M95B 4YDJA 4IMLB 4NT6A 3A6CH 3C6LA 4MD4A 1RIUH 3QO0A 1OCWH 3JTTB 5DFWH 1RFDH 1DN0B 4PJAA 3GMPA 5C07A 5I8CB 1FSKB 2B1HH 3UJIL 4WEUD 5D5MF 2VC2H 3IU3B 2BK8A 2HWZL 5IK3A 3WJLC 1NGQH 2DKSA 3FQRA 4UB0L 1E4XL 2NW3A 1V7NH 3DMMC 2OBGA 5MP6L 1Q94A 1W2KT 2YPVH 1ZLUK 4M9OA 5FGBC 1HHJB 4ONFL 1ETZB 3JWDL 4GQPH 4BFIA 1N5AB 3D25A 3RI5K 5HI3D 1BZQK 5HYSB 4XX1G 4PJFA 3AS2A 2BVQB 4KKAC 1CR9L 1KPUB 3DUHA 2L7UA 5J4MA 3EBAA 2VL5B 2P46B 3RX8A 4PTUB 2QHLA 3OGCA 1J0ZA 1SEQH 4ZTOL 4PY7A 4F37F 5FK9A 1DBAL 1OW0C 4JGUA 2WP3T 3BVNA 4EN3D 1DZBA 5FB8A 2OSLB 1MCJA 2AP2A 4PREB 3PJSA 5C0BB 2X5PA 2DF3A 3RL1A 4O5LH 5ESVA 2KQNA 1GVIA 4R7DB 4YX2L 1II4E 3BP5A 1ZGLB 1PJ9A 1H3PL 4FQCH 4EUPB 3DXAE 4NNYA 4JPIB 2EE3A 2C1OB 4M48H 4YHLL 5FDWA 5K9OA 1FZJA 2IPUK 5TPWH 1C1EH 4F2MB 4HMCA 4ZTPL 5CJOH 3VDCA 5GGRA 3K2MC 1YEGH 3QDJB 2H26B 3ARZA 3O2VH 4ODTH 4OFKA 1YEJL 4NQVB 5J7CC 1NCCL 1UCBL 4W4OC 3CLFH 4Z0BL 4XP5L 4R4BB 5EBLA 3F7YA 2BCKB 2EDBA 4JG0L 3QNZA 4X8JB 5E6ZA 1J9CT 2MMXA 1FNLA 2XKNB 5L2KE 4LSPL 3ALXA 5HI5D 1T0NA 3A67L 3K80A 3DV6A 4IRSB 2CKBH 4PJ8A 3F8UB 4HWEL 2H32B 3KLHC 2CIKA 4GBXD 3UMTA 3U9UA 2Y72A 5E6ID 1HKLL 3B4NA 2DI8A 3G5ZA 4ORZC 4U1JA 1HSAB 1CLZH 3HNSL 4RGMB 4OCSH 3WO3B 4PGEA 1BWWA 5GRUL 4UOJA 1Q0YL 4XNUL 4YGVB 4IMKC 2UWEB 2Y06L 3S9DB 2O5XH 4U1GB 1BVLA 4H1LA 3QI9C 4HWBH 4MQ7A 1JRHI 2JJWA 1D6EB 4KUCD 7FABH 5GS1A 3BPOC 5AZ2H 2D4DA 3CFJB 4XH2B 1AP2A 3GGWB 4RSVA 1FH5H 1A5FH 5MHSE 3W0WE 1TVHA 3P9LB 4QTHB 2CRMA 4NUGH 3NOIA 5C0ND 1S8DA 1JF5A 3TPUA 1NC2A 4QY8A 8FABA 5TE4H 1F97A 1MUJA 5CJQH 2SEBB 3VXMA 4DTGL 4HUVA 1G84A 3QXTA 2DQFB 1I85A 4W6WB 4ZFZA 3W9EA 3RDTC 3T4YA 4EN3A 3W11D 5KVFH 4GXUM 3CFIC 1S9VB 1OTUC 4M1DL 3O6MH 4ZSOB 4LP4A 3CSYA 3AC0A 2YWZA 1FNSL 1QOKA 5DA4A 4UQ3B 1S78D 1CWVA 3ECBA 2R29H 4YXLH 4TTGA 3H0TB 4UQ2B 3R1GH 5DC9B 4KRPB 4JG1H 4BA8A 4PB0L 4UT9H 1XF1A 3EDJA 3WFEL 1NAKH 4PJEB 4XXCA 2DTSA 3UAJC 4TVPE 3QDMD 1I1AD 1MJ7H 1FV1A 1XR9A 4KVCL 4XCYA 1FL3A 2W0FA 5T1MA 4UAOC 3VG9C 5JTWA 3VXTA 5EORH 2APWA 3RWFA 1B3JA 4YHMH 4I2XB 3RY5A 5HYJD 3L3GB 3IB4A 3HI1A 4TUKL 5JOPE 4ZUTB 2C4FU 1MF2L 1WWBX 1M1SA 5CSZA 4DGVL 2J8UE 4WNQA 1AD9A 5DJCA 3P4MA 1B2WL 3R8QA 1T89A 3MZTA 5CBAB 1KXVC 3JV5A 4U6YB 3GHBH 3MRKA 1D5XB 5E9DE 5BJTB 4L8BB 4YEFA 1MLBB 3RZCA 1EZVY 2EH7H 4G8IA 4D8PA 2XA3A 4MJIB 3UTZB 2H2PD 3KWWB 3MGAA 2E7LC 1KENH 5I8OL 4U0RB 3RWGA 3MRFB 3C09B 3PDGA 3GJFB 4P5TB 5DDHB 4GG6B 4JVPA 3ISWA 1P4LB 1U8KB 5D2LE 4PRHA 4Q58C 2A6IA 3MROA 5E8NA 5F88B 3MV7A 3V0VA 5SX5K 3WFDH 4NHCH 3BJ91 4R97C 5JUEL 3QUMA 4Q2ZB 3SBWA 1KNOB 2AEPL 3EHBD 2CMRL 4H1LG 1IC5L 4OB5L 4Q6IC 2E8ZA 4L3ED 2EZ0D 4GAYA 3VCLA 3WO4C 4PRDA 4PB9L 1EXUB 2P8MA 2BNQA 1S9XB 2EO9A 3GUTB 1XGPA 4AMKH 4L29B 2XZCL 5DJ2A 3N1FC 4MB3A 3IXTB 4ZAKA 3QISA 3G6JF 4WI5A 4YAQB 5IMMB 3LH2L 4G6KL 5J6HA 1IAMA 1BVZA 1JHLL 1GZPA 3LMJH 1FG2B 5ENWA 3RPIB 2YPKB 4E0RA 3ZHLA 5CBEA 4Y4FB 3AU1A 5JMOC 3ETBF 4TPRL 3F12B 1KLGB 5HHOB 1ZWIB 1HYSC 2HVJB 1CD1B 4NO2B 1MAJA 2C1PB 3O41B 1WISA 1K8IA 1TJHH 4NOFA 5F3HB 3GSQA 2YUXA 3SGDI 2EDOA 3GBNL 5GSVB 4S0SD 4HFWA 5IV2B 3L3KA 4I18A 4JRYD 5EO9A 3CSGA 4KMTL 1J12A 1CG9A 4FQ1L 1OF2A 3UYOD 1PKOA 4HCRH 4H8WL 4BQ6A 3PG2A 3QCUH 4HS8L 1V3KA 3HZMB 4NNPL 1QFOA 3TFKD 4CVXA 4Y2DD 2YRLA 5C0EA 2M1KA 3H42H 4RAUB 4Y1AB 3B6SA 3T0EA 1FYTE 3HE7C 1PKQB 1FFQA 3OKOA 4IJ3C 4TOYH 1IM9D 3T3PE 5DHVB 2GTWB 4HBCL 5IEKA 4WW1A 4OUOA 5IHUH 3U9PL 3R06B 1DE4A 3DX6A 1XZ0B 3U7WH 4BK4A 2JJTA 5IQ7H 2X70B 2YKLL 2JELH 2DRUA 5C08E 5HTSA 3RWEA 5FGCE 4PLOB 3HAEA 2AEWA 3O3AB 3O0RL 4LCUA 4K7PY 1G7IA 2UY6A 1LE9B 2HT4D 3PWUB 1UWGL 4M7JL 3SE9H 4WDIB 1V7MH 3VGAC 2DQIL 3ULUH 3C5SA 3Q1SL 1TPXB 5FHBL 4J6RH 1PFCA 2CXGA 4DGIH 3L3HB 5GRWA 1YEDB 4RAVB 3MLRL 3LS4H 1XCTA 5I17B 1S5IL 1Z3GH 5FA3B 4F57L 3CVIL 1OPGH 1T1ZA 4L3EA 3SE4C 4GW1B 3T2NH 5C0IB 1KEGH 1DQTA 4UNVA 1N8ZA 1BOGB 2RFXA 2NTSP 4RMRA 5EOCH 1U41A 3KXFD 2BY3A 2EYSB 4XVJL 4XX1E 4XT1C 5DMIH 5F7EL 3BYYA 4OZIF 3C5ZA 1NFDE 3NZ8B 3X11A 4F33A 3FJTA 4KZDH 4R4FH 3KPPA 3HHRB 4LNRA 5B38B 4JFQA 1HOCB 1G6RB 4RIRA 2PW2A 1A6VH 1SMAA 2Q87A 1S9WB 2NXYB 1F02I 1EBPA 2NY4C 3I6LE 3N1PC 1LP9A 4JHBA 1CQKA 2UYLA 4PBVC 1MPAH 2X9WA 3K8LA 4HUWA 3FQXB 3MC0A 4Y88A 3UYRL 1JGVL 4U6TA 1EHXA 3NVQA 1VDGA 1GC1L 2V9RA 4LL9A 4BZ1L 1EHLH 4KMQA 3B83A 4MA1B 4UT6L 3WKMH 5J56B 2AK4E 3VFGL 3MGTA 5GGTA 4S1RL 3O8XD 3RVVD 4LCIL 5F9OL 4RFNB 3RVWD 2OM5A 3WS3A 3E0GA 4YBQD 4NKOA 1V3JA 4M93C 4LEOA 3DVIA 1N4XL 4X8XA 3VW3L 4J1UB 1HIMH 4NFDA 4XB7A 4H20L 4MDJA 3MOAH 3QUYD 1QBML 1IC4L 3TZVC 2FDBP 1OB1B 3C60D 4HV8B 3TT1H 4FQCL 3T0BA 5LXGL 2W9DL 3KPSB 2I07A 4M1CC 4Z6AT 2AS5M 4G8EA 4JO4H 3QJFA 3QIBD 4GKSB 1N0LA 3GIZH 4HKXA 4MXQD 5F7KC 3VE0B 1C1EL 4H88L 4YDVA 3TNMB 1GAFL 3Q5OA 1LD9B 3MO1A 4QF1A 3UO1L 4DVBB 3UTSB 3GSVB 1MCIA 3OJDB 4PJAE 4NQCA 1FLTX 2VLJD 3QQ9C 3CZFA 4GXVH 2EXWC 5FAAA 5I1HH 1G9NH 4EVNA 4GRLB 4Z77A 3U36B 3GMMB 5LCVH 3B5TA 2F5BL 4ZOCA 4FQXD 2BJMH 1FFNB 1H8OA 1OAQL 1S7RA 4WHYH 2AKRA 3TCLB 4U1MB 4AH2B 2VQUA 1I7TB 5C7XH 1Z0MA 3ULUF 1QBLL 3KPMA 1KJ2L 5EUKB 4OTXL 1IAOB 1CE1L 3KXFA 5HHPA 1VENA 1PZUB 4O58L 1MHPL 1WC7B 4KJYB 2X4OB 5HYIA 1U8HA 4PJFE 2Z92B 4ZS6D 5C92A 3LQZB 3QIWD 2H3NA 3ME0A 5CFHA 4LKCA 4OCSL 3ZE0F 1S5HB 2AJYH 2YXMA 2BVPA 2X4TA 4YBLB 1MELA 5EBWB 4ZNCD 4WUKL 4GFTB 3FB8B 3CUPA 1HDMA 1N59B 2PXYA 5D2NC 5BQ7B 2AJSH 4NQUA 5B4MD 1S9YA 4WWID 5EO1A 4PD4K 3P73B 4I48A 3C6LB 3TVMA 4Z7NF 3BEVA 4PG9A 5TDPB 1FH5L 1KBGH 3D3VB 3MRJA 3QO0B 4R3SB 3O8XA 3ULVE 4XHJD 4GKOA 2X4RB 3JXAA 1N5YL 3L3JA 4OLYL 5D7LD 1EO7A 1JYNA 5HPMA 4V1DA 5LQBL 1I4FB 5AG9A 1JI1A 1MIEH 5DJ0A 2E5EA 3MV8A 4JJ5A 4I3GA 5J9PB 4XNXL 1TVBB 3EO0A 1NBZB 4XAKD 1P7KA 4AM0B 1S7UA 2VZVA 2VZ1A 2NW3B 1CT8B 3DARA 3IS1X 5ETUA 3X3FH 2FEEI 3LN5B 4D9QE 3IAPA 1NANH 4QYOB 1O0VA 4PJ9A 1UB6B 2MJWA 1UWEL 5JIIA 3VXRD 4PJIB 3FRUA 2X1OA 5KSAD 1KV3A 3W5NA 2HJKA 4XBEH 5DMKB 2YA0A 3R1GL 4KI5D 4F8QA 2ITDB 3QPQD 3X14A 3ARBC 5HI4D 1FIGH 4NRYB 3O9WD 1QSEE 4PJCA 5KVEH 2HJFA 3RI5F 4Z95L 5E5RB 1LNUA 3QXDB 5CILH 2XN9A 4HXAL 4QT5A 4XVTH 5L8KB 3KYKL 5T3ZH 3VH8B 2X4PB 3PJSB 1YUHA 2I5YL 4MAYD 4QCIB 5FYLD 3MRRA 5ELIA 1KGCE 5H37G 4KJQC 2Q3ZA 3BX7C 5CUSH 1IEAB 2WW8A 3VGHA 1MJ8L 2HA1A 1G1CA 3FL7A 4BH8B 5KS9A 1KUMA 3D39B 4HKJB 4ELMB 2M8XA 3QDHA 1I7RB 4F7EA 1R0AL 3QQ4A 1RUKH 4XAWL 5EZIL 3K81A 2VR4A 4X4YB 1XCQB 2JCCA 2BVEA 4NKIL 4WGWB 4XVSL 1PVHA 2B7DT 4M43H 3H3KA 5I1CL 5B8CA 4YK4B 4HH9A 1XR8A 4E5XB 1LILA 3V0AC 3QIWA 1T04B 2W07A 3V4PH 2XTJC 4AG4L 4LOUD 4Y5XC 4FRWA 3UPCA 3KYNA 3SCMB 3P4NA 3TH2T 1BX2B 3SKMB 1HHKA 1O7SA 4QHNB 4D9LL 5EBGA 4KPHL 1YNLL 2VOTA 5GS2H 1KCKA 2R69L 3MJ9A 5CIPA 4O2CA 4APQA 1F42A 3LB6C 4LIQL 4Q0XL 2WBJD 5TH2B 5FIEA 2CH8A 4CN1A 1QSFA 3DO3A 3RVUC 1GC1C 5LVEA 4OZGF 2IPTL 5HYQB 1QPPA 3QEHB 1MY7A 2X4SA 2ICCA 1VFAA 1YDPB 3CAFA 1F00I 5SX5H 4KC3B 4MSWA 3VXPB 3FN0H 4U1JB 4QOKA 4JDZB 3KPNA 1WCBB 5AZEL 2R8SH 1A1MA 2FGWL 3G5YA 3EJYC 5T1KB 3SDAD 1R3IH 4LF3A 4OGZA 4G80A 1DSFL 2WNGA 3IJYA 4ONGH 4P57B 1U8LB 4JKMA 3UBXG 5D1ZC 4GMSL 3WN5A 1UXSA 3CX5J 3PGDA 3LQAC 2YK1L 4HLZH 1XGQA 4HUKB 4I0PD 1TQCC 5BVPL 5KSAA 4WHDA 4C57C 4EI5B 1J86A 2AAVA 3SOBL 3RA7H 1EGJL 4X9FA 5HPOA 1T5XA 5ACMA 2CLRA 3RTQA 4H5SA 4LSQH 3TPUB 2EDHA 3O9WA 4N5UA 4XP9H 1JZ5A 3FONB 4FQ2H 5IM7B 3Q6FA 4JFOA 2WMPA 1HHHB 3BZEA 3FO2A 4ZFZB 3SGKA 3O45B 4NZTL 2ZUQB 1P5UA 2V9QA 4GG8A 3IFLH 3VGFA 1NGWB 2MCPH 3PQYD 2ADIA 4B0MM 3RVXD 5T1LB 2GIYA 4OCRH 4MMXC 4ETQA 4ZUSA 4PRHE 4YQXH 2HRLA 3UC0H 3V95A 5IHUL 3MV7E 2OK0H 1JNHA 1YQVL 3WUZA 5E7FA 3STLA 2QSTA 3HNVH 4NJAH 4P3CL 5EU4A 3MJ7B 1AC6A 1I8MB 1S7WA 3ZE1F 4ZUVB 4BZ2H 3L7EB 1YPZA 2EIZA 3M17A 5IT2H 4I3SL 4OZ4B 1JRHH 3C8KA 3QHZL 2BNQE 4F58L 3GJFK 4YHIA 3K4AA 1A0QL 4PTTA 3PABA 3C8DA 3PWVB 4PJHA 4OV5A 1QFWH 2ZUUA 4O02H 5CD5C 1UJ3A 4NN5C 1EUUA 3GSNA 3MRGB 1W0WB 3QO1A 1FAIH 3QNYA 3WL9B 1M7IB 1AQKH 1TQBC 1YYML 3BDYH 5EU6A 4J4PD 4NN6B 2VDRH 4OQTH 5J8OA 5DD0H 5ESQB 4R96A 1AJ7H 4IDJL 1D6VH 4GBXB 3QNXA 4DZ8B 4YZFF 1ZS8A 3WLWD 4MAUH 5E6IB 3QCTH 2FEDD 2OP4H 3RWGB 1L7IH 3T65B 5DWUL 3UDWC 3CK0L 3RIAK 2V2XA 5BV7H 4Y5YA 1BM3H 1I7UA 4AL8H 3ULSB 1JGUH 3U7YH 1CI5A 3RL2A 5D93C 4XP6L 2A6IB 4N0UE 2ADGA 1ZGLP 1A22B 3T1FB 1JWSB 3IDXH 1ORSA 1U95B 3I3EA 4X7SH 3T0EE 2WBWB 5IQ9B 1QFHA 3PP4H 3ALPA 5DFVC 5D7SL 5HY9A 2DLGA 5J11C 3QCVH 5TQ2L 5CZVH 1EHLL 1I1YA 4YPGA 1ZLWK 1ZLVK 5B39B 5ID0A 4ZOEA 1XF3A 2DJSA 5C09E 4HS3A 1A9BA 1KB5H 4YE4H 3T3MF 1Y6KR 4OV6F 2DL9A 1XGTA 1ERNA 5CBEB 3AU1B 2R1XB 1K5NA 5KSBF 2X1PA 2W9EL 3HNTH 1K8IB 2OZ4L 2PTTA 4WI8A 4ZS7H 1CDGA 1CDHA 4QRTB 4KVNL 1BFVL 3L3KB 3UPRA 1S9KC 3BISA 1OARH 4I18B 3TO2B 3K2UL 5SWZA 3STZB 3MNVB 2ZJSH 3VG0H 1N6UA 4RX4D 3ZL4H 1YJDL 3GI8L 4PJ7A 1FO0A 3BPNB 2Z35A 4N0YH 1AFVL 2GCYA 3ROLA 4CUCA 3QDMB 1JZ2A 1I1AB 5JW3H 4OKDA 1MVUA 2NLJA 2YSSA 1ORQB 3RWDB 2AABL 5CEXB 2YA2A 1AKJA 3QXAB 4HG4J 4JFHE 1W0VB 5HYJB 3CPLA 4NKMA 4ACPA 1B6DA 4P2RA 2F8XC 4PBWD 3ORJA 1KEML 2L7JA 5BZDB 4L9LB 2ZUWA 2WINA 2IBBA 2O93L 4MXWL 5A16B 4J4PA 1RHFA 2E6JA 3RWEB 4WEMB 1RK0B 1K6QH 2DBLH 3RVTC 1MAKA 5DQ9A 3H9HB 4O00A 3UCRA 1DBML 3IFOB 4CADA 1T5WB 5I1LB 3SGDH 5T3XE 3L3OA 4OZFB 4L8SB 3O2WL 3TYFB 2ZWLT 2HH0H 2K7QA 4WRLA 1T1XB 1T66C 4LEXL 4O51A 1WZ1H 1IGYB 2BP3A 4R6UA 5C0AB 4X5LA 1RIHH 3FTGA 1X3DA 2MFNA 1ZHLB 4O2FA 4XCFL 4Y7MA 1P7QD 2HKFL 3I75A 4AIOA 4G8FB 1DVFB 1KC5H 5I1EH 4KI1A 2WWKO 1MCPL 1EHAA 4Y4KC 1QLEL 3ZDYF 3KPTA 2BDNL 2NYYC 1G7PA 4HUUB 5C9JB 4DEPB 1U6AL 3F7VA 4FXGB 5GGRY 3QFJA 4LCWA 4LSRH 1NBYA 4LAJH 1BQLH 4RCAA 1RULH 4GS7C 1VFUA 4Z7WA 2EO1A 2AJ3B 4L3CA 1RMFH 5C71A 4D9RD 4M7KH 4PJXA 4ODSH 2Q86A 1B9ZA 5DQDL 5T5FL 2Q76B 1YNKL 1TJGH 2G9HB 2P43B 3L5WA 2A74A 4PGDB 3BD4A 2AJVL 1GGIL 4K7PH 2NW2A 5MERA 3C2AH 5EZOL 4F3FA 2NNAA 4BSVB 3BAEH 3O6LL 1FAKT 4JRYB 4YUEL 2FSEA 2XWJA 5F96L 2HLFD 5CWSA 2Q8BL 2P5EB 4WCYH 4CN4A 4YO0A 4HJ0D 5J3HD 4JRXD 3P0GB 1HNFA 3IJSB 3DSFH 4X6CB 2EICA 3QA3B 4PGBB 4Y2DB 1I75A 4QHUB 3HI5H 5H2BA 4WUUD 5B38G 4PV9B 1TITA 4RZCA 2A6DB 2V5TA 1GIGH 4JFZL 2VDQL 4LEOB 3WHE0 2IQ9H 3ILQD 1B0WA 3O3UN 1IM9B 1MFBH 1WBZA 2M2DA 3CVHH 5LGJB 3QB7C 1LEIA 5C70A 4QRSA 1JGEB 1IL1A 1MHHB 4PJ5D 5CUSL 1MQKH 2BC4B 4IRJC 1SEBB 1U92A 1J1XL 4LMQI 5DUBA 4QHLA 4LDLB 3SDCA 3L6FB 4K8RC 2I9TA 3HUJB 3L1OH 1XGRA 5C3TA 1U3HC 4PS4L 5IOPA 1QD0A 3V5KB 3S8WA 1P84K 2NR6C 3RNKA 1RZFL 1I3RA 3EYVA 5MEND 3GSOB 3PV6A 1LO0H 3BD3A 4LLUA 1TETL 2GTZB 4JFDB 3QDJE 4Z5RA 1FZOA 3T0AA 4V1DE 4UIMB 5J13B 5JA8B 3BW9A 3MV8E 4PJDF 5EIIB 1HXMA 4JQXA 4FA8A 2DQHL 1MFDH 3Q6GH 3WHXA 1INEH 5EPMA 3L5JA 2R0ZL 2K7PA 3IRPX 2E8YA 2IQAB 5ERWB 2QBWA 1F90L 3BSZH 3B2UC 5D6DA 4WW2F 5C9KA 4HPYH 4UTAL 3G5XA 1IGCL 2R56L 4M5YH 3HI6H 2YMXH 1JMZA 2ZG3A 2OL3B 4PRAB 4QEGA 2WWMC 5CJBA 4W6YB 3OF6A 4PJCE 4JRWA 4X7CC 3V5DA 5I8EB 4WEBH 1HQ4A 1GGUA 3LQAH 4HS6B 2XN9E 3TCXA 5FOBB 1ZHKB 2UWEE 1DQML 3HLAA 3TGXA 4AEHL 4X9HA 3H9ZA 1P5VA 4XXDB 1OQXA 5EO1B 5DTFA 1KULA 4PRPD 2YD3A 5JQ6H 2GEEA 1DANT 3QUXA 4X6EB 4EI6B 4U1HA 4DKEH 4ZPTA 4PG9B 3MRJB 5DD5L 4JPWH 3O8XB 1YJDC 1ZANH 2ICEA 1NKRA 1YY8A 1XIWA 4WUUA 2JCCE 1NCWH 2WQRA 4U7MA 5E99H 4GUPA 5IBUG 4NWUH 5F3BA 1IGFH 3HPLA 4HBQA 5FKAB 2XG4A 3QUYB 4I13B 3TH3T 2ZCHL 1WFNA 3MLSL 3C60B 1UA6H 1YN6A 3MRQB 1AGEB 2OTUB 4W70A 5B22A 5JPNB 4U6XB 3R4DA 4WWKD 5I2IB 4ERSH 4HXBH 1HN1A 3AXLB 3ARXA 4Z0XB 1M7DB 3QIBB 1AE6H 3WFBH 1QNZH 5FYKU 1UADC 2VXTH 3ZYZA 1QSFE 1B4JL 3OKMB 5E4EB 2HJFB 1S3KL 1NLBH 4UINH 2D31A 3QDAA 1NSNH 2YN3A 2IANB 4P4KB 4PJEE 4TUJA 5E08H 4L8DB 4XCNA 3ARDB 1FRGH 1UH2A 4QT5B 2VLJB 4XTRD 4FTVA 4QOKE 3UZQA 4XBPA 1UM6H 4G3YL 1JE6A 4JKPH 1CVRA 4QGTA 5J6GB 2L4OA 3ULVC 1DCLA 5CGMA 4FP8L 3TM6A 5E6YA 2AXFA 1X5LA 3KDMA 1KN2L 4FQXB 1ZMYA 2OI9C 4LCCB 1AXSB 1A3LL 1KCSH 1Q9OA 2C3GA 4N8VB 1KIQB 2A73B 1FN4A 2XY1A 4WFGE 2BNRD 4NSKA 3RHWK 3HC3H 5INCA 1KB9J 4PR5B 3FB5A 3F6IA 1U8PA 5AG8A 1FIEA 1CD0A 2YD4A 4L1DA 4ZNEE 3OPZL 1IAII 4MCZB 4CVUA 2Y5EA 2EE2A 2EDDA 4LASL 1A7BA 5T33L 5E8OB 2V7HA 5DMYA 3VGDA 1FDLH 2EDXA 4ISVB 5KTEL 1JNLL 2VXQH 3H8NA 3R0NA 3HMXH 2XQBL 4TVPH 3U30B 1F8TH 4YHPA 3GIVB 3I02B 3WIIL 1N26A 4PJ8C 3DX7A 5C6TL 5K9JL 2CK0L 4E41D 1SBSL 2GJZB 5DS8B 4XNMB 1OD9A 3H7LA 1KPRB 2CLZB 1RZGA 2FX7L 3H3BC 3BPCB 1N3NA 1JL8A 2X89D 5GGSB 2Y7QA 4X4XA 3O3EB 3DLQR 3LEXA 3ROOA 3WS6A 1N6QH 3GMOB 5FUCE 4PUBL 2CGRH 3HE6C 2R2CA 3DHMA 4X6DA 1MJUH 1WBXA 1CIDA 5D7LB 3DNKA 3S3JA 4S1DC 3TO4D 3WFCL 1H8SA 1CK0L 4DOHB 1YPZE 1KPVA 1ND0B 5IGXL 3EKCA 1F13A 3PWPD 3CH1A 4PJBE 2FWOA 1ZLWH 1T83A 5CHNB 2R9HD 1Y0LB 2I9LA 2YRPA 3IKKA 4PJHE 4L4VD 2DQGH 3GSRB 3TN0A 1S7QA 3VXRB 3WXWH 1OP3K 3RWJA 5KSAB 4B7LA 3FQWB 4MYWB 1MRFH 1UVQB 4X7DC 1VADA 2VKWA 5EU6E 1J8HD 3LEVH 3NTCL 1UWXK 2LTQB 1DR9A 4FZEL 1IM3A 2OX5A 4L4TE 4NP4H 1S7SB 3MRBB 3IVKA 2R4SH 1MH5A 3WUWB 1MRCL 4JB9H 5IW3A 3QP3A 3MOBH 2ADIB 2DMKA 4CMMA 4MAYB 3UTQB 3LRSA 5EFIB 1H5BA 1NPUA 4Y1AE 5H35B 3S97C 2V2WA 3FB7A 1WVZA 1KCRL 2XZQL 5T3XL 5HGDA 2EDYA 5D71H 4KK9D 3UTTA 5F9JB 1CFTB 1FP5A 2Z91A 2O5YH 4EIZC 5EA0H 2BNRA 2E6QA 4ELKB 5ALBH 3CFBA 5BXFB 1ZHBB 1KTDA 4HLJA 5BRZD 3RWIB 2R2HB 12E8H 3QQ3B 2BRRL 1CGYA 2W38A 2CO6B 5GGQH 3AMLA 2HRPH 1FL6A 5FCUL 2DQEH 4G6FD 2YEZA 3O3BB 3WIHH 5AD0A 4WO4A 1NAMB 5EOTA 4JVWA 3OAUL 1KTKE 4JY5H 3VXUD 1T89C 1VKXA 2X41A 4NZRH 3EYQD 5GISL 3BGMB 2NZ9C 4ZDHA 2YR3A 1CFBA 5ADOL 2GFBA 3RZCC 2WBJB 5GRVL 2X89A 1AHWA 4WJ5B 3L7FA 2G5BA 1ROWA 1MWAH 1A7PL 2FIKA 2NY7H 1PG7X 3QNXB 4LRIA 4XPTL 3ZTJG 2I60L 3PWJB 5SWZE 2DLIA 1BFOA 32C2B 3CDYA 5DGRA 1FE8H 3TO4A 2R0LH 2V2XB 4PJ7E 4LLQA 2DI7A 1P53A 2VITB 1RULL 2DB8A 3BT2L 5T5NF 3SBWC 4ZUUB 4PFEA 4ZPVB 1ODAA 5IB5B 5IHZB 4BFBD 3SDAB 3ZKQD 2JIXD 5LWYH 1UKQA 2CRYA 2OQJB 3ULUD 1QBAA 3L3IB 3RIAF 4CMHC 3O6FD 4L4VA 5LJYH 2ZCKH 4XPFL 2YZ8A 2J8UF 4I0PB 4OZIA 4P2RE 1BBDH 4KRMB 3BESR 1I1YB 4DN4L 1UH3A 4WV1B 4XVUD 5ID0B 1J8HA 2IH3A 4NRXA 3KAAA 4KKBC 2WUCL 3VWJD 5GS0L 5L2JB 2BSED 3QUKA 4MD5B 4AIZB 4F7PA 2ZUXA 1U8OA 2C3HA 2HKHL 1C08A 5EOCJ 1F4HA 1U3YA 3S96B 3SDDB 4XWGH 1CE6A 3PQYB 4LCYA 2W60A 2ENYA 4WU7A 4Q9QH 1FZMB 1RUQH 3KLSA 1C5DB 4MJ6A 3WNLA 3ZZ1A 4YFDB 1YMMD 4GW5B 1NDGA 3RFZC 4MA3B 3DMMD 4LQFL 1YNTB 1OM3L 4DKFL 5C0CD 1XT5A 3UPRB 3VFTA 3GK8H 2ILLA 1FNEA 3OXSB 4XNQB 2PCPA 3P4OA 4NM8L 4ZFFA 4PP2A 5E94A 4Y8DC 4ONHB 3O2DH 3UPAA 5BRZA 4BH7A 3IDIB 3D9AH 2E27H 2GCYB 3F5WB 4XC1L 3NFSH 4XNZC 2EDJA 1HQRB 1M71A 4KKAD 4HWNA 3GMRB 2R4RL 2OMBA 3QFJE 1E28A 5JW4N 4ZUWA 5IVXA 1KJVB 1INDH 5E2UH 1AGFA 4LLYA 5F1SA 4BKLA 1EVTC 4Z7WE 4OKVA 3VRLE 4Y19A 5IBTH 5I74B 5BMFL 1QG3A 4QRRB 4U6VL 4PJXE 2YUVA 4KK6C 5INDA 3V8OA 3BZFB 2Z31D 4M61A 2CO7B 5DSCB 4TUOA 2VXUL 4YC2B 4ZG1A 2D03L 1EO5A 2DWDB 1X4ZA 2DWEA 5FUZH 3H7BA 3K8KA 3QIUC 5E56A 1A7RH 2VLKB 4DW2L 1QA9A 2AV7B 2D4FA 4FXKB 5A3IC 3QUZA 3FT4B 2RCSH 3VFUB 1ADQH 2F5AL 1CU4H 2VH5L 4QXGL 3T3PF 3QJHB 3MREA 4AEIH 2ICWA 5B3NA 1NCBL 3CU1A 3O6FA 4M7LL 5ITBL 3OZ9H 2GITB 4J3TA 1S7TA 2ESVA 4RNRB 5IG7A 1UYWL 3CXHK 1JZ7A 1MFEL 1JF6A 4N68A 4KUZH 5DHYA 2IWGA 3H9SD 3DO7A 3C5ZC 4QNPE 2OJZL 2NY1C 1JUFA 1HH6A 4KY1H 3KLHD 3AREC 4K3GA 3D3VE 3OKLB 4OZFG 3RNQB 3A6OA 5IMLA 3SJVA 1P4IH 1W0YT 1KT2A 1T03L 2HMIC 1LO4H 2WANA 4UMGA 3T0VA 5D1QC 5GIRB 2XZAL 2LU4A 3D2UB 3WJLA 3OGOE 3O81A 4NDMB 1T1WB 3U0TB 3IKCB 1IGFL 1P2CB 4LARL 3DMMA 3TYGH 5BVJA 3RPKA 5C0CA 4OF0A 1ZVSA 5FGBA 3QI9D 1OHQA 5SV4A 1JN6B 3KLAB 1UM4H 1F6FB 1R5WB 4LKXA 2Y5TB 2NTFA 3REWA 5HYEA 5D5MB 1G0YR 3G08A 4YO0B 1T6WA 4ZXBC 1BQHB 4PJIE 5DD1H 5SX4H 4X5XB 2CRZA 3VFWA 2VXTL 2PYED 1U58B 1ZA6A 3K4ZA 3B9EA 1VPOL 1ZTXL 3S35H 4OFDA 1QQDA 1K4CB 2BVUA 3ULVH 1FRGL 4OGAC 3GSXA 4LNVA 3RDTD 3FN9A 4ZODA 3KYOA 3ZT6A 5DD3H 5E2TL 1OTUD 3IFPA 1JHTB 3T09A 2E7BA 2GUOB 5E7BA 1LK3L 1JMXA 1ZHNA 4ODWA 5L88H 3DRTA 3F58H 1A1NA 3DI2B 4RQQB 3DUSA 4EXPX 4LLMB 3AB0B 3JWOH 2WUBH 1AIFA 3MSPA 2I9TB 5EZLA 3WLBA 4MX7B 5IFHL 1J1OH 2OTWA 3D39E 1FSKC 3FOMB 1ZT7A 4C56B 2G75B 4OFYA 1HI6B 5KVDL 5HVFB 1A7NH 2IJ0C 3PIQB 3EYVB 4ODUA 4IS6B 5GGUB 4FZ8L 1A6UH 5F89B 3LSOB 1KCLA 5EUOA 4A6YA 4JN2B 3CCHA 4NM4L 5FYKH 4U49A 4KJPD 4M6NL 4P46D 1QR1B 4W4OA 1XH3B 1CLOL 2IF7A 4DKDC 1P7QB 4KMLB 1HXMB 5IMKB 4HIIA 2FATH 5HD8C 3I9GL 3UZVB 3EJZC 1KACB 5T3ZD 4P2QA 4HUMB 5F21B 2ARJQ 1JK8A 5IEHB 4YWGL 3VA2C 4BFEA 2P5WD 2D3VA 3BGFB 4C4KO 5IFAH 4FQQB 1UJTA 1GZQB 1D5IH 5EZJA 3MX0A 4R7NA 3HZYA 3FT2A 1QVOA 4UBDC 1AGDA 4H1LH 3ILPA 2IC2A 4GXUN 4CU6A 3FFDB 3JTSA 3GI9L 4NFCA 4HKBA 1PLGH 4Y4HC 1X5AA 2AXGB 4MD0A 4OSUH 2GJ6A 3C9NA 5C8JA 4PJAF 1W72B 5JLZB 2X44D 2PXYC 1ZSDA 4K94L 4OZGA 1QUNA 2CIIB 4HGKC 4OT1H 4FTVE 3W39A 1F4AA 3U4BH 1A6ZB 3HLAB 1JPGB 3TVMC 3BUYB 2Z8WC 3GSWA 3GJEB 2RGSA 5DTFB 1KJ3H 1AR2A 1A6PA 1FG9C 3O3DB 1WIPA 2AEIT 3E1F1 4ZD3L 4D3CH 3MRMB 4N8CL 4JRXB 1MCEA 5GS2D 5HDLA 2H9GA 2P49B 4X6FB 3I50L 5KOMC 4FFZL 3S88H 5T1DH 3BKMH 4WUUB 2R2BA 3JVGC 3HG1A 2MNUA 3MUHL 2V2TA 4PJFF 3MR9B 3MXWL 5DURD 1ITCA 4OCXL 1K2DB 3FO1B 1BBJA 3RAJH 1AY1H 4UUJA 5DJAB 2HVKA 4JAMB 4PJ9C 1MNUH 2A6JB 2FZ3B 1PSKH 5J89A 3KJ4B 3IU4L 4UIKL 3ZTNH 3CFKA 4PJ5B 4M3JA 5ADPH 3AGVA 1HYSD 3RY6C 2HTLD 1UT9A 5JOEA 4EQ2A 5E8DL 5K93A 1LO5A 4RGMC 1NFKA 3CDFA 3OKNB 4NKDA 4Q6YA 3ZLQC 3ULVF 3GO1H 1KFAH 4JVUA 5CP7B 1UXWA 2VDNH 4UI2A 1P69B 4TUJB 5EB9A 3MRLA 5MENB 4HC1L 4X6DE 5JXAL 1FORL 4OCMC 4U1GC 3KNBB 4ZFOA 1JGDB 1I8IA 2WQ8A 3D18B 1DQJB 1Z9LA 2ZPKH 3WIHL 6FABL 1T1YB 5CEZL 2IAMD 3MLVL 4U0QB 1B6UA 3HE7D 4BSWA 2APFA 3DETC 4JKWA 1QYGL 5BS0B 2XQYK 1I8LC 2YPLB 2E9WA 3DI3B 5IW1A 2J4WL 2P5WA 3NZHL 5DD6A 1CFQB 1G6RL 1MHEB 4FMKA 4K3HA 1AXTH 4O2EB 4ODHH 5DR5L 3U6RB 1TZGH 4LLDB 4YNYA 5GJTH 3QUMH 1KTLB 2ERJB 4CBPA 3BIAX 1OTSC 5D96B 2E7LA 4KV5E 3NN8B 3ES6A 1NEZA 3CMOL 3P30H 4OCWH 1NC4A 3TBSB 1WZLA 5L8LB 1EUTA 2FJGB 2V7NB 4OLVL 3NCJH 4APQC 4UTBH 3QWQB 3QWRA 2DTML 1NBQA 3ARWA 4P3DB 1NDMB 5TE6H 4KRPC 4YDKH 3BEWA 4XPBL 4HEPG 1EFXA 4QHKI 2NY2C 4PRPB 4AK1A 2PYFB 1CS6A 4X4XB 4KXZI 1WITA 4Q6IA 4N8VG 3KS0H 3TESA 4LU5L 3UTTE 5FYJL 3TBTA 4JGMA 2Q8AL 3DROB 2KQMA 5FO9A 3K74B 3MYJB 1MCCA 2CKBB 4MNHA 2V5SA 4Z7UA 3RIFF 3OX8A 3SQOH 1KPVB 5HHMD 5DEFA 3FO0H 1RAMA 4PGCA 4P5MA 1F11A 3OL2A 4MNQD 4LQ1A 2AV1B 4O9HH 3QZWA 2FJFA 4G7YL 3TLRA 1FHGA 4R8WH 2YD8A 5I19H 1IAIH 2NY4D 2YBRA 4P0DA 4RGND 2VISB 5GJSL 3SKNA 1LEGA 2ZOKA 5D7JD 3G6JB 5EOQH 5DJZB 3REVB 3RWJB 4WWKB 4KAQL 5E2JA 4Z78A 2FNBA 3DX8B 2CLVA 1J5OL 3R0MA 4K07A 4KHTL 3C09C 3W2DH 3ARGD 4P4RA 1HEZB 4XWOD 5I1IL 4QXUH 2F74A 1HZHL 3M8OH 5LGHL 4AJ0A 3FQTA 1RK1A 1U0QA 3RX5A 2XXMB 3C5JB 3MXVL 2J6EL 4MCYB 3B9KC 1MH5B 1WEJL 1WCQA 1DQDL 1A02N 5B21A 3C08L 2WSKA 1VACA 4KQ4H 3VFRA 5FUCC 4H25A 1X5IA 5DZLA 3T0DA 3B9DA 1KLFA 4AZ8A 5E2WH 1T22B 3V52L 1U8MB 1AQDA 5DRWA 1PBYA 4M5ZL 5LBSH 5JO5A 2QQLH 2QQKH 5DLML 2DQTL 2OMNA 3LY6A 4M1CD 4C4KT 3V79C 2A6KA 2VRAA 2CJUH 3LAFA 5IB1B 4Y4FC 1R3LB 3NACH 3MLUH 2FBJL 1NEZG 3WUWG 4ZO8A 3TT3H 4M6OL 3BZ4A 5JHLH 5EC1A 1ED3A 4CKVX 4JEGB 1CF8H 4CNIB 3BN3B 3F7PC 4G6JH 4CL7A 3QQ9D 2EXWD 4E41B 3CFDA 5C0AE 4K94C 1OAZL 5J1SC 3CX5K 1DUYB 2NX5D 4JPVH 5DJ8B 1UZ8A 3NFPA 2RJMA 3RRQA 2D7TL 3P77A 1EIBA 2G60H 3SE4A 1ZV5A 1KG0B 2VLRD 1Z5LB 4YJZL 1I3GH 4M00A 4O4YH 3GMQA 1BFOB 3V6ZA 1A6TB 3L3DB 2BSSA 1MIMH 5FM5M 2CK2A 2GT9B 4LBEB 4YR6B 3PWPB 2ED7A 4G8GB 4UDUB 4UU9A 3NFNA 4LGSB 4MQXC 3MLYH 5EBMB 2W0PA 1LO4L 3DGGA 4JFFA 4ZOBA 2O61A 1KJMA 5GGTH 5IVXE 1AGBB 2JJSC 5CS7A 1Z6JT 2C3VB 3KPRD 1F3DH 4Y19E 4OZIB 2X9XA 5JDSA 4JCMA 1RZ8A 3NAAL 1IFHL 4NQXA 4RWYL 4YIQA 5FV1L 3BRGC 1U8NB 3Q2CA 1TPXC 4DFHA 3QEQD 1U8IB 4U1SB 1MCQA 2F53D 5FGSA 4LVNB 3DRQB 1RUPL 5E8PA 2P5EE 2HFEB 3NH7H 1MLCB 4IM8A 1OGAA 5DI8A 4OLUH 4G9FD 5DZNA 3VMOA 3WNPA 1I8KA 3MLZL 4P49A 3S35L 5KAQG 1RURH 1RJYB 4TRPL 1P7HL 2Y6SC 4MMZC 1YEHL 1ZE3C 3BKYL 5ID1A 1D9KD 2BOBA 1YEEL 4R26L 3U48A 1NMBL 4EOWH 1LE5A 3RWHA 5IW6B 3TF7C 5GSRA 4NQSB 4D0BB 4FQHA 3BP6A 3MV9D 2ADFL 1NEUA 3DV4B 3TZVA 1OGTA 1CFSB 5BZWB 2PCPB 1FVDB 3P4OB 5F9WB 2WUBL 3QG6A 4PGZA 3MLTB 3QPXL 2DKMA 5EO0B 2ESVE 5KANG 3PDOA 1Q1JL 4HF5H 5IMOB 1BGXL 5C0DB 1I7ZA 1FFOB 3ARBD 3HB3C 5HGHB 3P0VH 2LQRA 1NMAL 3OQ3B 2NXYC 3HRPA 4U1IB 5I15L 4N1CA 4QXWA 2X1WL 5IFJA 4S0TD 3PHQA 2GSIB 3QR2A 3VD7A 5DEZA 5F97E 1EEUA 3IJHA 2D0FA 5JXEC 2VDPH 5TE7L 5FYKL 3SJVE 3VXUB 5KJRH 1XF2A 3VMNA 2NY3D 1ZOXA 5AYUH 4ORGB 1FPTH 1TJIH 4JFDE 4MA1C 4I4WA 2VDLH 4KJQD 4MA8L 2R0KL 5DRXA 1C5CH 1R3HA 5C1MB 3MRHA 4Z7VA 5DC4B 3Q3GA 3D1MC 4RFNC 3EFDL 1QFWM 2JB5H 1EK3A 2G2RB 1I9JL 4IOIB 5I66B 2P24B 1UB5B 1FZKA 3FQNB 4YDLB 3GBMH 5BO1L 2H6PB 1ES0A 5DT1L 3BO8A 1CXHA 1JPSL 4OBRA 2P8PB 4L4JA 2JIXB 2XWBA 5TDNA 1AGCA 1NBVH 3HTLX 3GDBA 1EJ6A 3O6FB 1TTFA 3UXFA 4HX1A 3RU8H 2FJHA 1CLYH 2FO4A 5IROC 5HVHC 2YS4A 1PX4A 2VO5A 3QH3B 4MWFB 1LP9F 3OKEB 5D2NA 1NL0L 2HAZA 3WEXB 2ITCB 1F4YH 3KPLB 15C8L 3VWJB 2P7TA 3LV3B 3SY0B 3WXVH 1JUFB 3RVUD 4Z8FH 1IGMH 2ED8A 1IGJB 1FVCB 2FX9H 4ZFGL 2GYSA 4G9FA 4JM2A 3L5IA 1SJEB 1DQLH 1DUZA 3FFCA 4LPXA 3T8XB 1CN4A 2F19H 1I9RH 2X10A 1UM5H 3LN9A 4J3VA 3DXAD 1EEYB 3TV3H 1YMMB 2AJUL 5EUOE 3EJYD 5C0JB 4Y8AA 3SE8L 2R1YB 1GGCL 4FFYH 3IXAA 4WY7L 3QDGE 1FGNL 4YHYB 5C0CB 1JWUB 4DVRL 2JB6B 2X7LA 1IQWH 2FO1A 3H3PH 2D9QB 4F37K 1JNNL 1N7MH 4FQJH 5HDBE 2VAAA 4P2QE 4UILL 3BYTA 5IKCA 3OHXA 3X13A 1LDPH 5KSUB 3TEUA 2HJLA 3NCCB 3ARBA 3U1SH 4XI5D 4X4MA 3O6KH 3VRJA 2DD8L 1KF9B 3NMEA 4YBLC 5HDQL 1F45A 5L2KD 3V4VH 5FECA 1N6VA 2IANE 3D0VA 3LIZL 3G5VB 4GJTB 4E42B 3SDCC 2GJ6E 5CJXC 3LZFL 5A1AA 5FF6B 3MA9H 4HW6A 2Z31B 1DL7L 1QRNB 1U8JA 3DUSB 4LLVB 1TIUA 4M9PA 3EIFA 1U93B 5TF1H 3LKSA 3TBYA 3FB6B 3CDCA 4QWWC 5IIEA 5B3JE 4HPOL 1BQHG 4UV4L 3PNWB 4ZQKA 3GB7A 1BFTA 1DBJL 2CR3A 4PRNB 3GHEH 1T2QH 1A7OL 3TH4T 3QHFH 2CDGA 1HINH 3V5HA 1MCSA 2BOCB 5FKPA 3MJ9H 1ACZA 1FGVH 1AD0A 3MOQA 3O4OC 2AQ1A 3X3GL 4MNGA 4OCWL 5C2UB 5DJYB 3HG1E 4HT1H 5ANMA 5ICZA 2VABB 4Y5XA 3MNWB 5CD5D 5MHSD 5EC2B 3W0WD 4KDWA 3MJ8B 5CINL 5AWNL 2PR4L 2XTLA 3IF1A 1OP5K 3H9SB 4U7KA 4J8RA 3WSQL 5IF0A 2IH1B 1RJLB 2BXZA 5TQ0H 3NA4A 4JANA 3ZKMC 5SWQB 5F7DA 1JFQH 3BKCH 3DGCR 1A7QH 3S5LA 4WFEE 1UEMA 3V4UL 4XRCA 4G9DA 3B2VH 4CW1B 1EX0A 1UACH 2XRAH 3VXSE 1OTTD 2BNUB 4O9HL 4LSTH 2H2SC 3QUXC 4U1KB 4ESKA 2R23B 3QI9B 1TCRB 5CJ8A 3CU7A 5D1ZA 3VU2A 4TVPD 2EC8A 4JZJB 3P0YL 1N0XL 2B4CC 1B4RA 2DQUL 4YK4C 3T4AB 4JKKA 4MDIB 5ACZB 1CIUA 3DSNA 5E70A 3BHBB 2PYEB 3SCMC 1NCAL 1AR1D 2VAJA 4JZNA 5GRJL 5ISZA 5JOPD 3HMWL 4FNLH 5L2KA 4LSUL 5FV2A 2B0SH 4UUJB 4L8CA 4PJCF 3RDTB 4V2BA 3T77A 4PV8B 4TQEH 4OLZH 3FT3B 1JP5A 5CZKA 5E9DD 4NO3B 2OXHA 3LKRA 1WSST 1GHFL 2WK2A 4FQIL 4YH6A 3GMLB 2UWEF 1MFAL 1WZMA 4AQOA 3B5HA 1MI5A 1H3TA 5IWLA 2IADB 4UDTA 4H0GA 1ZA3B 2HT3C 5D7KE 1EH9A 2P8LA 3MBED 4K3EH 1LO2L 2PW1A 2AI0H 2W92A 3GSNH 2F54B 3KGRA 3MLXH 3MRLB 1KJ2A 4NPYA 4MVBD 4Y16D 5JPMB 5F1IA 4JFPA 1LMKA 2JCCF 1T3FA 5I30L 4UAOB 4P46B 3RKDD 2K3TA 4BSWB 1R5VB 4GH7B 3HZVB 3AY4C 3ZDXE 4FFVC 1IMHC 4EI5C 1G7LB 4OIIH 2Q6WA 5J1AB 3W0WA 4HFUH 3MRPB 3MNZB 4G42B 2YD2A 3WIFB 5HHVL 1LK2B 3E6FA 3U2SB 1Q9LA 1M4KA 1F6AB 1RUMH 5DD6B 2UZYB 3RWCB 5GHWH 3GKWL 1KLUA 1NLDL 3RVTD 4YXKL 2ZUQC 1E0OB 4JO3L 3MA7A 4XBGB 4HZLA 4HIXL 4BQCA 3L9RB 3S5LG 1B0RA 1BHGA 4S2SB 3UDWA 1BF8A 1R3JB 3MCLL 3MRNB 5JW4Q 4L9DA 4NRZA 2QTEA 1T66D 2XV6B 4P5KA 4HJGB 4R97B 3BP4A 4OM1H 4BSJA 1WV7T 2ARJB 5AEAA 3HMXA 4XMLL 4Q6IB 1OSPH 5HGBB 4CVZA 1IKFL 1L7TH 3GM8A 2EXYC 1M05A 3PWNA 3FCTA 4JPKH 4Y4KD 2V5YA 3WO4B 1YN7A 1ZT1B 1Q0XH 1FYTD 2NYYD 1VGKB 4YHZL 1H15A 4OJFH 1RV6X 2GY5A 4QRUB 5E8EA 4GKZA 4MNHB 4K7FA 1NGPH 4IDLA 3OX8B 4HKZA 1F3JB 4XMKL 5DEFB 1J1PL 5F72S 3VXQB 3TIEB 4NO0A 1S7XA 1IQDA 4M62L 3UJJH 5DK2A 1OSZB 1ZT4A 3TN0C 3VFMB 4BZYA 5C08D 2AJXL 1SJHB 5E9DA 5I75C 2C7UA 1RZKH 2ICWI 4EOWL 1XGYL 2ZCLL 4GBXC 5ECJE 4JLRA 4CDGC 5E6IC 1CFVL 1VFBB 2XT1B 3EYOB 3EO9L 1G7HB 1TFHA 1HHGB 3HPJA 2BHUA 5HGAA 1KB9K 4EDXB 5D2LA 4B41A 3WNNA 4OLWL 5IB4A 5IJVB 2FR4A 5KSBB 5DJDA 3I6KB 5C2BH 2AEQH 1CICC 4KXZH 3VFNB 3B8YA 4DCQB 1YPZF 1JNJA 2OXGA 4HIHB 5I1KL 1TZIB 1JPTH 2YC1A 1DFBH 2IAMB 5FO8B 2VE6A 3HE7B 3QWOB 4MXVE 4PJBF 5KW9L 2OR9L 1TJIL 4PJHF 3TA3A 4JFFE 4UV7L 5D9SA 4LPVA 1ZEAH 3NA9H 4QRRE 3EYSL 3VGEA 3O4LA 4GQ9L 1T21B 2BFVH 3OR7A 3N9GL 2OL3L 2HN7A 1WAAE 1GGBL 4ODVL 4R0LB 2GW5A 1J88A 3ARFB 4K8RD 2KZ1B 5EN2A 1A4KB 4DKAA 1Z0NA 1WJ3A 1U3HD 4K23L 4S1QL 1IGIL 2QL1A 3I6LD 4LDOB 2NR6D 3VGAB 2E7MA 4G6AC 3MMEB 4F15B 1DEEA 1ED3B 2VLKE 3NPSB 4OQ1A 1OGAE 2IPKB 5F1NB 3IAGC 5ICXB 4HMDA 1KIPA 3MCKA 1YMHB 2KZWA 1Q9WB 2EDLA 1CBVL 3QFDA 2MQCA 2AK4D 3MJGX 3DX9A 3NFPB 2YHGA 2BY0A 4M6MH 2X4NA 4LRIC 2DI9A 5CGYD 3LKQB 2Z93A 1MFCL 3BPNC 4XPAL 2BERA 4PBXA 1NCNA 1NKOA 1F3RB 1I1AC 4K2UL 4JR9H 4Y4KA 1P84J 2QEJA 1MCRA 4FG6D 1EGJA 1YEFH 1G7JA 3D0LA 1PQZB 1VSCA 4JY6B 4XP1H 1IARB 3KYMB 1HWHB 1B0GA 4D0DA 4JFEA 5KVGH 4MNQB 1WWCA 4L9LC 4LHUD 2MPAL 4FS0A 3MFFA 4JZOA 4ZO6A 4YHKH 1NJ9A 4K3JL 1LQSR 4YHNB 2NY4B 3I6GB 5BV7B 4RGNB 1UEYA 5DVNA 1RVFH 1ZVYA 3MUGA 5D7JB 5DRZA 3WE6A 3VFVA 3ABZA 1SQ2N 4QTIH 2V17H 3GNMH 4DGYL 5J06A 4L8SC 3VI3E 3ARGB 5HHQB 2NXZD 4XMPL 4XZUA 2LFGA 1S7VA 2C9AA 5D5ME 4DAGL 3V0WL 2AJZB 2X05A 4Q9RL 5DI8B 1J05B 2RB8A 1RU9L 2BVOA 3QEUA 4PJ7F 3EHBC 3RGHA 4QHMA 2A77L 2DN7A 1DVFC 2EZ0C 1H0DB 3LDBB 3EOBB 1KB5B 3VFPA 4LLWA 3RWHB 2FLBT 2BSTA 5GSRB 2PO6A 1GJIA 5EU5A 1PG7H 2VXSH 1JWMA 4WI6A 1KCVH 4WU5A 3PGCB 4IRJA 2A1WH 1NFDA 1TMCB 1EJOH 1CFNA 2CUHA 3DWTA 1ONQA 1DQQA 3VRIA 1FFPB 1PYWB 4GMTL 1SYSB 5C0RL 3QAZB 1JGLL 1I7ZB 5ESAB 5F8QC 3DVGB 5D2NE 4JM4L 1UENA 3IRZA 5DUMH 1U3HA 3MBXL 4YGAB 5MEPB 3GMNA 5SWSA 4C56E 2JTDA 2BVYA 3CH8A 4HSQA 4GAFB 5FHAL 3SQBA 3E6HB 5JDJA 4X7TA 3HZKA 4F7MB 2XPGB 3CLEH 5E5MA 25C8L 4RFOL 3TBVA 3VJ6B 3ZSSA 3UEZA 3FFCE 5ALCH 3PUCA 2QKIA 1RJZB 4HWZB 2NX5B 3X12A 2DQCH 3LKPB 4ODBD 3ULVD 1JV5B 3HRZB 2B1AL 4H26B 4B50A 1XF4A 2UVEA 3N85H 1BREA 3WFHA 4Y2DC 1FNAA 2VLRB 1WWWX 3EYUH 4EBQH 1RZ7H 1NGZB 5F7UA 4PJDB 1CGTA 1CL7I 3BE1H 4U1NB 4D9QD 1X6NA 4YDIH 4X6BA 3ARYA 1GGYA 1DBBH 3ESUF 1UQSA 4X4ME 3INUL 4NHUA 3THML 1CXEA 1X5XA 1RHHB 1GPOH 1SM3L 4Z7WF 3VRLF 4WW2B 1X5YA 4AEFA 5JOFA 2IFFL 3SGJC 1RUAH 2B4CH 4P23A 3KPRB 3QG7H 3DVNB 4PJXF 3KHQA 4KTYA 1G9MH 1IAKA 4X0KA 5I16A 1ZVHA 3OG4B 4PJ8D 1K85A 2FRGP 4K9EL 4S1SL 3DURB 1ADQA 2OZ4A 2IGFL 4P59L 3MLWL 4UNTA 3QEQB 1XGUB 2F53B 1KCUL 3HC4H 1CGSH 1YECL 3KR3L 4KROD 4FFWC 4HAGA 5FYLL 5TFSL 3MACL 4I1NB 3AM8C 4QRPA 2RR3A 4AENB 5I1GL 4G9FB 2JJUA 3CFCL 4NJ9L 1KGCD 5F7MC 1R24A 1T4KB 4JQIL 3OR6A 5D6CA 3BXNB 2FL5A 3M1BA 5DGQA 1MRDL 4FNLL 1TZHA 4NFBA 1LO3L 4WFHE 5E95B 1D9KB 5A43C 4DJMA 1A6AA 1P1ZA 3TIDB 4NZJA 2GAZB 2DKUA 3IETB 4MNGE 2MCG1 3V6FB 2XTJE 3U0PA 3AVEA 2OJEB 4PG2C 5TF0A 3MV9B 5ANME 4DZBA 5ABDE 5JIHA 5DEGA 5IVZA 1NCDL 1A6WL 2J8OA 2VDOL 1F58L 1FL5A 3U0WL 5D7IB 1NC2D 4F9LA 1NAML 2J88L 1A64A 1R5IB 3VXMD 4I3RL 5CEYA 5TGBB 4F7CB 1AO7E 2DYPB 5C0GA 4IIQB 2I24N 4OCYL 2Q1EA 5I8KH 4MLSA 3MRCB 4KTEH 2NY3B 3LOWA 5HHNB 3MODL 5GZOC 4CU8A 1C16B 2YD7A 4PRBB 1IVLA 4NUJA 3E8UL 4NQEB 1YYLL 1RIVH 2AK1L 2ZKHH 4HDIA 4XCCH 5ILTH 5E00B 3LD8C 2EH8L 3RVWC 3CVHB 4NQDB 3S4SB 5BS0E 3GB7B 4IHOA 4YBQC 2YPLE 3LRGA 4R4ND 4M1GL 3GRWL 3BKJH 3QRFM 5IB3B 1RPQA 3G6AA 3T04D 1FNGB 2VXVL 4QRQA 2B2XL 4JN1L 3LHPL 2VIRB 4S11A 3QUYC 4JFYA 4FABL 4MJ4A 5ISZE 5D4QA 1MAMH 3C60C 3LEYH 3PL6A 3JV6B 3SDXA 3CC5A 2QSCL 4PY8I 2DMBA 1C12A 1U91A 3EOTL 3QIBC 1Q9KA 3IF1B 1CLCA 2X09A 2IBGA 3MRDA 4I77H 1QSEA 4MXQC 3RZCD 5E4EC 1QHPA 2XNAA 4P4KC 4JPKL 4TSAH 5KANI 1MI5E 2VL4A 3ARDC 1BLNB 4DN3L 2FB4L 3HE6A 1H3UA 3AUVA 1SY6L 3KJ6L 4WVRA 1M6OA 1HILA 3SDYH 5KZCD 1PGRB 4NQTA 4PRHD 4LSVH 5CLWA 1V3MA 1CDIA 2PN5A 3OWEA 3MV7D 5DO2C 4HGWB 3DXAB 1BPVA 2A83B 2EE9A 2ZUVA 1I9EA 4LCCC 1YEIL 5K9KA 3UJTL 3P9MB 1K4DB 3D69A 4M3KB 1FO0L 1D5MB 4OD1L 5E2VH 2A9NH 5C3LD 3OKKB 2WIIB 1Q72L 4ZYKA 1E6OH 1LEKA 3ZO0A 3CD4A 5ITFB 3TJEH 1D5ZA 2BNQD 1JZ3A 5KSVB 1QFWI 1KIRB 1TQCB 2IPUG 4RFEB 3G6JE 4ZS6C 3S36L 4N1EA 1MJJA 3LKOB 1FBIH 4HQQH 4ZAKD 2VDMH 4D0CB 5CCKL 3I85A 1A3RL 4KKBD 3KS0J 1C5BL 1T7XA 3U30C 2EYTB 4P9HC 2PF6A 2APTA 1G7QB 5F71A 4JDTH 5L2KB 1MHCA 4NO5A 3BDBA 4JHWL 2DQDH 2UV3A 4GSDH 4GRMB 4G6ML 3T77B 1X5JA 1FVEB 2X4UB 2ORBL 3FRPG 4JE4B 1MCOH 1WBYA 4JQVC 3LRHA 4OFPA 4L1HA 3S98A 5HJ3B 4N0CC 4KQ3L 1OAYH 2WIMA 4JO1L 1J7VR 1WLHA 3QSKB 4UDTB 4YHOH 4EDWL 5D1XA 4XCEA 3IS0X 2D7PA 4RBPK 5HSFA 1MCDA 4PP1D 4G43B 4PRIA 3LN4A 3L95A 3T0ED 1QSVA 5F6HI 4KZEL 5ACLA 3A6BH 3PWLB 1OAXH 4W81A 3HR5B 4AT6B 2FYYB 4OLXH 3K46A 3WMSA 1NGXA 1T0MB 4NN7B 43CAB 4KI5C 3CXDL 3QPQC 5HI4C 4LRNH 1N64L 3HCVB 5GGVL 2ATKB 4DQOL 4KK6D 2LTQC 5C09D 1TQBB 2ADJB 4KU1A 4LLAA 4F80A 5HHXH 1OAUL 4M8QA 3FOLA 1D5BA 2W1NA 4XPHH 4HIEA 4DWHA 3DUUA 1RZJL 5MEOA 4X98B 5IBLC 3QIUD 1E6JH 2IALB 3LS5H 4X6DF 1VGEL 3HFML 3FQUB 4I5BA 1FCGA 4NWTH 1N2RB 2QR0A 4HHAA 1IEBA 1BVKA 5CD3B 4UT7L 5JW4R 1JPFB 4JFXA 4NYLB 3JUYA 5DUPH 4G8GE 1AI1L 3EOAB 3VFOB 4IRZL 4YXHH 2AGJL 1P4BL 3C6SA 3IDNA 2VR5A 4GAJL 4N9GB 3JWDC 2XICA 2DM4A 4LGPB 1KXTB 3WHE1 4FOMA 3PWNB 4GKNB 5L7XH 2J12B 5DK0A 1IGTA 3O4LE 4HEME 3C5ZD 4LOUC 3LPWA 3QEGH 4JFHD 3EGSA 2HLAB 4BUGA 2APBA 4JO2H 5GXBB 5JORB 4HKZB 4LIQE 4OUUA 1QBBA 4PJGA 3F6LA 3VXOB 1EMTL 1ZK9A 2J8UB 3MGOB 1INQA 3HC0A 5CSGA 4GT7A 1QO3B 35C8H 1Y18B 1U3JA 3SPVA 2F58L 2HMID 1FJ1B 2WBJC 3BQUB 3QRGH 4GW4A 5E9DB 4K71B 5D8JH 2W65A 3LKNB 2EEAA 1QEWA 5DA0B 3G6DH 4LDEB 5F7YC 3CXHJ 3MUY1 3S34H 3TNNA 2BMKA 1E4WL 3BWAA 2ZOLB 1VFOA 4MJ2A 2MHAA 3BZDA 4OF5A 4GAGL 3MBEB 4X99B 1F3DJ 1QFUL 1QLRB 3IFNH 5IB4B 4KK8D 5DQJB 2NY5H 4N0UA 4ZXBD 1JHKH 1V3LA 5DJDB 1C7SA 3SDAC 3S37L 4Y16B 2MSPA 2IG2H 1EO8L 1IC7H 1OQOA 2XWTB 4KHXH 4CJ1A 1U36A 2HTKC 2QHRL 5I18H 5ICYA 2A38A 5FUOH 1KN4H 4JY4B 3S3SA 1X7QB 2X4QB 4I0PC 4OD2B 2Z4QB 1ZLSL 4OGAD 2Y23A 4JFEE 4ALAH 3P11H 3P4LA 2WAHA 4WV1C 2YRZA 4KKLD 3CDGB 4L5FH 5D70H 5KG9A 5TDOA 5C09A 2EYRA 2MKLC 2PTUA 1FLRH 4X80L 3U79A 1QLFA 4YLQT 5JR1L 1DLFL 3EYUL 2CDFA 4N0FA 1W72L 2JK5A 4FQLH 4HLZG 3SDDC 2D7MA 3DBXA 4XP4H 5H94B 2HFFA 1CYGA 3QIUA 1DDHA 2QLVB 4NQCD 3EYFA 5HGGS 5D72L 1DBKH 4HUXB 3IDMB 4EJ1C 1KIPB 4U1LB 3OJMB 2APVA 5FM4A 2UZIL 4HIJA 5EWIL 43C9A 4XGZA 4F7TB 4XNYL 5C0FA 1YC8A 5M7QA 5E1AB 4KGLA 5F7LB 5HD8D 1A1OA 3K0WA 2X6MA 3ZHKA 1F4XL 2BVTA 2QQNL 1MVFA 3EJZD 1JF1A 4JHAL 4ETYA 3BGAA 3A6CL 1RIUL 1FYTB 4WFFE 1OCWL 4TNVF 5DJ6B 1RFDL 5I73B 1A14H 3HC4L 2C26A 2DS4A 1B88A 4OF3A 4OF8A 4ODXB 2B1HL 1CDJA 1MWAB 2FGZA 2XA8H 3AREA 2FH6A 2VC2L 4BELD 1E27B 2VDKH 2Y36H 3DYPA 3ZE2F 2FX8H 3VFSA 1NGQL 3MFFB 5SWSE 2ID5A 4Y4HD 4WHTA 5C08B 3DTXA 1V7NL 3C87A 5JHDB 1A9EA 2JF1A 1HSBA 1I3VA 4OIBA 5FGCB 5D1QA 2YPVL 4Y5VC 3IDGA 1SYVA 3U82B 2PXYD 5K59E 3GSUB 3QULA 3NCYP 4Z7NE 4KDTC 1TENA 3WLWC 1RY7B 4R2GD 3TVMD 4XC3H 3DIFB 3TJHC 2J1KA 1BJ1H 1DEDA 5IR1B 2B20A 3AAZB 1G7MA 3FO9A 2H8PA 1ZAGA 1S7VB 4ZXBA 2VYRE 3QDJD 4JKLA 1IAIM 4V1DD 1PZ5A 4G5ZH 4OD3H 1SEQL 3MV8D 1R3KB 2A9MH 4W68A 3G04B 1XF5B 1NGYA 5FA4B 3RGVB 3JV4B 2OS7A 3HS0A 3BMVA 2BSRA 4BJLA 4OZHA 4U6HA 5DJXA 3VWKB 4PYHA 4O5LL 4PJ9D 4MA7H 5DRNB 5IVXF 1CTOA 2P42B 5DYOA 3W9DB 2VLLB 2F8OA 2ZKHL 3BH9A 4WTWA 4IMLA 4M48L 3V6OA 3IGAA 1CFNB 4P9MH 4A6YH 5M94B 1QRNE 1AC0A 3JTTA 4LAQH 1DN0A 4KJWC 4Q9BA 5TPWL 4Z76A 3U4EB 5I8CA 5I1DB 5IESH 4CU7A 5CJOL 1YEGL 2LVCA 2XN9D 3O2VL 3IU3A 4ODTL 4WI7A 5CKGA 1U8QB 5L0QB 2EDWA 1RZJC 3VXNB 4QRPE 3CLFL 5I1JH 1HHJA 4OGYH 5IB2B 1ETZA 1RZIB 1MREH 2AK4B 1HXYB 1CDCA 1N5AA 3DYMA 4N5ED 2QSVA 3DETD 1G1YA 4FXLA 4XPGH 4OFIA 1BP3B 5HYSA 2CKBL 1PEWA 1BJMA 2BVQA 1KPUA 2LV4A 2VQ1B 2VL5A 4PTUA 1BD2B 3Q0HA 3ET9F 5JW5B 2NY0B 5JNYB 1CLZL 1OTSD 2VNCA 4JGJA 4LHUB 5C0BA 1IBGH 2VZUA 5HBBA 5I76B 3BH8B 3SKJH 4Y4HA 3RBSA 2O5XL 3KPOB 1T2JA 4R7DA 3SKOB 1VA9A 3AB0C 4RISH 1ZGLA 1F4WH 4HWBL 4APQD 4C83B 2EC9T 1KELH 4OAWB 5EH1A 4HJJH 1IAKB 3PV7A 4JPIA 2C1OA 7FABL 1HHIB 1QSFD 3CFEB 5AZ2L 4YDJB 4NT6B 4MD4B 2E3VA 4NZUH 1A5FL 2DQJH 1J18A 2NY2D 4LSSH 4P9HH 4F2MA 3BRFA 4PJAB 2NXZB 4JM2C 4H8WC 4NUGL 3GMPB 5C07B 4QOKD 3QDJA 2H26A 5TE4L 1I9IH 2VDML 5CJQL 4TVSa 1ACYH 4NQVA 5D6CB 5IK3B 2PYEE 3FQRB 4Q97A 4R4BA 1QKZH 5KVFL 1L6XA 3JVGA 2BCKA 2DLFH 2ZUYA 4X8JA 4OI7A 1Q94B 3TWCH 3O6ML 3NABH 3FMGH 2XKNA 3LCYA 3UBXA 2N1KA 1CL7H 1DP0A 4WFGD 2XACC 4IRSA 5L9DH 4BFIB 3D25B 3BGFC 3WD5H 2R29L 4YXLL 4TULH 1QRKA 2HFGH 3SDXE 1OLLA 2H32A 5K9QI 4RGOH 4JG1L 3RY6A 4PJFB 3RTQD 4UT9L 3CSBA 2KDGA 2FCBA 1NAKL 4KTDH 2FD6H 4NCDA 3OGCB 5J12B 1HSAA 4TSCH 3FKUS 4PY7B 1MJ7L 5FK9B 2YZ1A 3BVNB 1CZ8H 1IT9H 2PUQT 2F54E 5FB8B 5EORL 3FZUC 4YGVA 3AS0A 2UWEA 3B9KD 4YHML 2Y07H 3RL1B 2EKSA 5ESVB 3FN3A 5AAWA 3BP5B 3WNOA 5EUOF 1D6EA 4RBPH 1BOYA 4HDIB 4NNYB 5FDWB 3CFJA 5K9OB 4LRNL 4XH2A 1FZJB 5CGTA 3GGWA 3ZE1E 5HYSG 3GHBL 2O5ZH 3P9LA 1I1FA 4QTHA 4GRWE 1I8LA 3MV11 2EH7L 5HDBF 5GGRB 2SEBA 3UJIH 3NPZB 1KENL 2YWYA 2DQFA 2HWZH 3V9FA 3OXRA 4UB0H 1E4XH 1S9VA 1WTLA 4Y0GA 5MP6H 4YFLF 3F7YB 5EBLB 3QNZB 4ONFH 4ZSOA 3WFDL 4NHCL 3JWDH 4UQ3A 1T0NB 3IDUA 1C12B 3DV6B 4U2YA 5EU6D 3H0TA 5I1AA 4UQ2A 4POZC 4EUPG 1WIOA 4PJ8B 3ZYJA 4J3SA 4X9IA 2CIKB 4L4TD 4PJEA 3U9UB 4NNXA 2J5LB 4AMKL 4ZTOH 5B3JF 2IBZX 4KROB 3G5ZB 1PY4A 5E4IA 1DBAH 4Y1AD 2GJJA 4PGEB 4JO2L 1KOAA 4I2XA 4PRIE 3L3GA 2PNDA 3LMJL 2UUDH 1BVLB 4YX2H 4ZUTA 1X5GA 4H1LB 1H3PH 4HD9A 4MQXD 4MQ7B 5A2IH 5GQBA 1BECA 1TJHL 4YHLH 5GS1B 5CBAA 1EZVX 4U6YA 1EEZA 1AP2B 1D5XA 4RMQA 5BJTA 4L8BA 1MLBA 2ERJC 1TVHB 4ZNEA 4ZTPH 2AQ3A 2DBJA 1S8DB 3UTZA 4HCRL 5D96C 3KWWA 1NC2B 4QY8B 8FABB 1MUJB 2N4IA 3QCUL 3ZDZF 3VXMB 1YEJH 4AY0A 1UKSA 4HUVB 2C4XA 3MRFA 1GRWA 4P5TA 4GG6A 5DDHA 1NCCH 1UCBH 2J2ZA 3MPCA 1WICA 3W9EB 1P4LA 1U8KA 4Z0BH 4XP5H 3H42L 3T4YB 4EN3B 4JG0H 1GYAA 5F88A 2A0LC 3B9KA 3CSYB 5F7WC 4LSPH 4Q2ZA 3IDJA 4TOYL 3A67H 2Y6SD 3ECBB 3UROR 4HWEH 5IWLC 3U7WL 5IQ7L 2WZPD 2JELL 1EXUA 5SWZD 3RKPA 4P3WA 1S9XA 3GUTA 2G5RA 1HKLH 1PY9A 4L29A 3IXTA 3HNSH 4YAQA 2NY6C 5IMMA 1XR9B 1FV1B 4XCYB 3SE9L 1V7ML 1FL3B 2W0FB 3ULUL 5T1MB 5GRUH 1IILE 3VXTB 4J6RL 4PJBA 1Q0YH 4XNUH 1QFPA 1AKJD 3BPLB 3HB3D 4DGIL 1FG2A 2Y06H 2YPKA 3RWFB 4M7ZB 4Y4FA 3HI1B 3F12A 5HHOA 3LS4L 1ZWIA 4B53A 2HVJA 1CD1A 4NO2A 4P2RD 2C1PA 5CSZB 3O41A 4PJGE 3O11A 4QHKJ 5F3HA 4WNQB 1AD9B 5GSVA 5DJCB 1Z3GL 3P4MB 5GRZA 5IV2A 2XKSA 1CGUA 1OPGL 2P4AB 3MRKB 3T2NL 3RZCB 1KEGL 4G8IB 4L4TA 1W8OA 4D8PB 3V6BR 4OFVA 5EOCL 1MCWW 3HZMA 4DTGH 1GSMA 5LG1A 5DMIL 2HYMA 4Y1AA 5MEOB 4KZDL 3ARTA 4R4FL 4MQSB 4M02A 4PRHB 4M1DH 3MROB 1PKQA 5E8NB 4KK5C 1A6VL 3MV7B 3V0VB 2QR0B 5DHVA 2GTWA 3NCYS 1BVKB 4HHAB 2Y36L 3QUMB 3R06A 2XI9A 4Z7UF 3E3QE 1XZ0A 3BDXA 5AAMA 3ZKND 3T0WA 1MPAL 4GAYB 3ZDXF 3VCLB 4PB0H 1L6ZA 4PRDB 2JJSA 3WFEH 2P8MB 2BNQB 2OTPA 2VN7A 3O3AA 1XGPB 4LFHG 3WKML 1JJUA 1LE9A 3PWUA 4KVCH 1CXFA 3OB0H 5DJ2B 3QFJD 4WDIA 4ZAKB 4LCWD 3NCBB 2WP3O 5J6HB 3L3HA 2CQVA 1GZPB 3R8BB 1YEDA 4RAVA 5ENWB 4E0RB 1H3WM 4TUKH 3RUGE 1O7VA 4F8TA 1MF2H 4DGVH 1B2WH 1HIML 5FA3A 3GSQB 3MOAL 1I3UA 4HFWB 2QADC 4GW1A 3UZEA 3WDHA 5C0IA 1UH4A 5EO9B 3TT1L 1BJ8A 5DFTA 1CG9B 1OF2B