5FFLA

Crystal structure of mouse cd300lf at 1.6 angstroms resolution.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
MEDPVTGPEEVSGQEQGSLTVQCRYTSGWKDYKKYWCQGVPQRSCKTLVETDASEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGLDPMFKVTVNIGPVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CD300 antigen-like family member F
publication title Discovery of a proteinaceous cellular receptor for a norovirus.
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fflA00
1S7SA 5DQ9B 2A74B 4YXKH 5DR5H 3RVVD 3HZYA 1FE8H 4W6WB 3U7YH 1BOGB 4QRTA 1GGBH 1ZLUH 4MS8C 3ARGC 1T03H 1AXIB 2DWEB 1CGYA 2Q3ZA 1CDJA 4NWTL 1QRNB 1J10A 4XMKL 4U3XA 4MWFA 4ZS6D 1OP3H 3DO7A 3AROA 1D5XA 3V0WH 2RCSH 2IFFL 3RWHB 2C1PA 1CFQA 4JN2B 4X98B 3F6IA 4NUGL 1HSBB 5FUZL 4DKEH 5CEYB 3TNMA 3F6LA 5B8CB 5DJ8B 4JKPL 1FYTB 3QDAA 2E27H 1UJTA 2RFXA 2DQTH 4P2RA 4NKDB 3RBSA 1DQTA 3FQXB 1KN2L 5DD6B 4WI7A 2Q87A 2Z91B 4QRRD 2AGJH 4TN9A 4UTBH 2GSGB 3L9RB 1G6VK 2NXZC 1CWVA 2NXYD 3RZCA 2UZXB 4G8GD 2P49B 4S10A 1J1PL 1FAKT 1B3JA 1HKLH 1IGJA 1YNKH 1H8SA 1TQBC 2NW3B 4NPYB 5DVMA 3MLWL 5LBSL 1DBBH 1FYHB 4GMSL 1BFTA 1G6RH 2VDRH 3IJYA 3ALPA 5FOBA 1UZ6F 5ESQB 5KSVA 3ISWA 3DUUA 1N6QL 2ENSA 2AXFA 2FECI 4Y4HD 3T3ME 5DVLA 4ODWA 2YRZA 3RIAF 2NY4B 4K3DH 1E4KA 3HLAB 5IF0B 4R2GB 2NY6C 3FQUB 3L3OA 2X4QA 3RGVC 4NO2A 4GG6A 3I6KB 4QTHB 5C0EA 3WHE0 5DA0B 2PO6D 5I8CA 5K33A 1N64H 1UYWL 4WVRA 3CU1A 3NFNB 3E6HA 3WFZA 1I1AC 1ULVA 2A0LD 5ISZE 1Z0NA 1FO0A 3L3JB 4N9GB 3JWNC 1J12A 5GGVL 5IVZA 3HC3H 1PLGH 3T0EA 3DVNB 1RIUH 4LGSB 1F3DH 3R1GH 1N5YL 3CSYA 4KDTC 3CVIL 2JIXA 4BFEA 2IH1A 2YA0A 2X4NB 2EKSA 2OK0L 2YD7A 1KPUA 4ZPVA 4HJGA 3QPXH 4BKLA 1NFDB 4P5TA 4E9LA 5ADPL 5I66B 1KN4L 3WLBA 2OP4H 3C60C 2VB5A 4FFYH 1XGQB 1ZSDB 1DQJA 1G9ML 5GGTL 4AL8L 1TVBA 4UI2A 3BKMH 4X5WB 2NY5C 1MVUA 3HC0A 3G6JA 4H8WH 5DTFA 2C3VA 5TE6H 1H5BA 1C16B 5DJYA 1TZHB 1ZHLB 4NYLB 4ZTOH 1X5XA 3DETC 2YD6A 4LLDB 5C9JB 5L2KB 1QLEL 4Z6AT 2FX9L 3MNVB 1S9YB 3MROA 4XZUA 4QO1A 3TIEA 1CGVA 3WLWC 2ORBH 4JRXA 3UTSA 3OX8B 2YWZA 4YHOH 3UEZA 3OPZH 1PY9A 3JUYA 4OLYH 1CBVH 2YEZB 2O5ZL 4U1KA 4UIMB 2PXYC 3GSNH 1RZIB 1D5IH 3T2QA 4G80A 2NXZB 5TDOB 1MWAA 3V7AE 4AMKH 4IMLB 4FQHB 3BKCL 4LHUG 1W72A 4RX4D 4UT7L 2Y25A 3P11L 3SOBH 3QNZA 5DRZB 5DA4A 1TQBB 2OSLB 1JGEB 1TTFA 3TF7C 1Q9OB 1C1EH 1GGUA 4O4YH 2H2PC 4PS4H 3W9DA 4XPAH 4M62L 4E41E 1OL0A 2A9ML 2HLFD 1HINL 4C55A 3TJEL 4QTIH 4OCYL 3L3KB 1PG7H 3OKNB 3S96A 2A73B 1A6AA 4YHPA 3QDJE 4NKIL 3BRDA 2ED7A 3SDDC 5IQ9A 5CLWA 2NY6B 3GZKA 2AK4D 2M2DA 5BOPA 3RGVB 5FA4B 4DVRH 5IFHH 1IMHC 3C2AH 1Q72L 5EU6E 5FGBA 3VRJA 4TVPH 1OQXA 4DQOH 3LPWA 1OP5H 1I1AB 3O3UN 4NZTL 1HWGB 4U1HB 5EU7C 1SBSH 1U8IB 4TNWF 3BMWA 4TSCL 1MHHB 3CXHK 1FDLL 5JHLH 4R4FL 3BAEH 2PR4H 1JWMB 2YD3A 4PJCF 2KL6A 1ZA3A 3Q1SL 4HS6A 4NHCH 4QT5A 4KWUA 2MCG1 5F6HJ 5MHSD 2CRZA 4KZEL 3NCBB 1VHPA 2ZUQB 5IG7B 1MIMH 4PLJD 1FFNB 4CMHC 1U8PA 4FOMA 3PWPA 3U0WL 2DB8A 2FWOB 2ZCHH 3O6ML 5ICZA 4XX1E 2AV7B 4Z7UE 1E6OL 3C60B 1NCAL 1TCRB 1INEH 3IDNB 4D0BA 5C0BD 2ZUTA 4BSVA 1FGVL 1E4XH 4EI5A 4R3SA 3TV3L 5DEZA 5B38G 1RURL 4HXBH 3L5IA 1QBLH 3VGDA 5AZEH 2EIEA 3U30C 4XB8A 4LCWD 3V52L 3WO3B 3THML 5CBAA 1T6VN 3DROA 2APVA 2Y07L 2X9YA 4LEOA 2J4WH 3WHE1 5DWUL 3QUYD 1H3VA 4M7LL 2HVKB 3LS4H 1QZ1A 2OTUB 5EA0H 1A8JH 2PXYB 4P57A 3VFMA 1KJ3L 5GPRA 1FFPA 1MCPH 2F53E 1INDH 1YMME 3QCVL 3VH8B 3QHFL 2Z92A 1RJCA 1FL6A 1F58L 1GZPA 1F3RB 2ICES 4LSVL 4XNUH 2FH6A 3SCMA 2R23B 1BQHA 3MGOA 2V5SA 5CINH 4O00A 4X8XA 2G2RB 4OZHE 1B4RA 2UYLA 4JPKH 1P6AB 2VLJE 5DLMH 5DMIH 4EVNB 4ZAKD 4F2MB 5K9KA 1AIFA 2VWEE 2I60L 4CKVX 1DANU 2BNQA 3SDDB 2OZ4A 3LKQA 4C57C 1A0QH 1P1ZB 3BD3A 4YAQB 3BDYL 3B3IB 4BH7B 4JVUA 3VXSE 5LJYH 2WSKA 3HZKA 4N0FA 4XT1C 5DUMH 2DBJA 4MQ7B 4NKOA 3N9GH 4YK4C 5IMKB 1RULL 1J1OL 4LHQB 4NQVA 3WJLA 1DQDH 2NW2B 1FC1A 3BI9X 4PJXF 5BVPH 5IMMA 4WO4C 3O3AB 1DDHA 3P3YA 4U1IA 4E41B 1JP5A 3BP7A 2P4AB 4PRHE 3GK8H 3QRGH 4U1SB 1DJSA 2EDJA 2ID5A 2RIKA 1F4XL 1LEKB 1QSEE 1X5HA 4WI4A 3IETA 1BFVL 2CXGA 5DRWB 1R5VA 4CMHB 4HHAB 1X4XA 1S9WB 3STZA 4RMUA 2IQAA 3H0TB 4U1JB 4FP8L 3MV7B 4NWTH 5F7DA 2DLTA 5GRJL 1JWUA 2P43B 2VUOA 4HV8B 4XMKH 5E7BA 3UBXG 4K3EL 4CADA 1MFCL 4ZOCA 5D1QC 5EBMB 5T3ZL 2IFFH 5GS1C 3BJ91 3G6DL 2O93L 5A40E 1RZ8A 3AY4C 4LLMA 1J8KA 1YEKL 2AQ2A 2J8UA 1MFBH 4WI6A 4NQXB 5BVJB 5F89A 1R5IA 1YY8A 3PGCA 4X5XB 1QEWA 3HAEG 5HD8C 1N7ML 3BVNA 1DP0A 1J8HA 4HAFA 4PP2A 3O41B 2I24N 3HUJA 4HPYL 3T4YA 3JUZA 5B22A 4OD1L 1S7XB 3F5WB 3QUKA 4TUJA 5K59F 3V6OE 1VPOL 4N0CD 4Z7UB 3TJHD 1IL1A 1WUNT 1OGTA 3MGTB 4FTVE 1J1PH 1FV1B 4B7LA 1H3WM 1KIPB 2VL4A 4LMQE 4OGXH 2IFGA 1EEQA 1RFDL 3M17A 4HD9A 4KI1A 5IW3A 4DKFH 5C6TH 4PJ9D 5C0AA 3MYJA 1P7QD 5GS0D 3QI9D 3AS0A 1QFWM 2MNUA 3CPLB 4NQUA 4DKAA 2HJFA 5JO5B 2BCKA 4FFVD 1XZ0A 1QSFE 4KMTL 3FOMA 5HSFA 5GS2D 4QRQA 4YK4B 1ITBB 1EBAA 3V6OC 2QKIA 3DURB 4OV5B 3PV6B 3QFDB 2MPAH 4PJIA 4M6OH 3QUXD 5T1LB 1U8NB 4XBEH 2EYSB 3GFUA 3FT2A 3U0PA 5D2LA 1X44A 4WO4B 1ZOXA 3VXTB 1T7WA 1DBML 5GGVH 5CJXA 4QRRE 5IFJA 5EFIA 3ULVE 1CL7I 4JFFB 5F7EL 3L5XL 1FYTD 1N5YH 4OT1L 3CVIH 5FO7A 1AGEA 1OTUD 3K1DA 5JXEC 3SQBA 5E5MB 5ITFA 3B6SA 3NPZB 3UPRA 3ILPA 1ZVYA 3VXSB 4HUVB 1GXEA 1BZQK 5ADPH 3CK0H 1KN4H 4JO4H 1KC5H 4XPHL 3MLZH 1G9MH 5D1QB 5GGTH 4BQ9A 5H37G 5GS1B 1OLLA 3OHXA 3K3QA 1DCLA 3OJDB 2W9DL 2XV6B 4ACPA 1QLFA 1IC5L 1H8OA 3ZE1E 3ZT6A 2V9RA 4JJ5A 4YUEH 5HHXH 4POZC 1KJ2B 2XKSA 3DMMA 3D25B 3O3EB 1QSEB 5E70A 2B1AL 3LQZB 1X5IA 3TO2B 3V5KA 1NFDF 3IT8D 1FG2B 5E94B 3KLAB 2Q7YB 5IVNA 2PTTB 4X9HA 4Q97A 1LP9A 3OXSB 2NY4D 3QXDB 4G9FA 2LFGA 4GG8A 3PG2A 4U7SA 2V5MA 1MEXL 5E4EC 3CU7A 2ZJSH 4ETQA 1M7DB 3IDXL 2CDEB 3BKCH 2DWDA 4UT7H 3VRLE 2HFFA 2Z31A 1IRAY 3P11H 3LDBC 4PUBL 4PB9L 4XC3H 4XHJC 2VISA 3RTQD 4M62H 3UCRA 5BV7C 3WFEL 3LHPH 2A9MH 3VFPA 2Y1VA 2A83A 4PJ8A 3TJEH 2K7PA 3BT2L 1Y6KR 3LRHA 1NUFA 4OCYH 4KHTL 4UT9L 1ZLWK 3VMOA 1A3LH 1A7BA 3LN9A 4HWBA 2XOTA 4C4KT 2H32H 4MS8D 3ARGD 4I77H 5TQ2H 3D9AL 1BZ9A 4ESKA 3GB7A 4QXGL 3TFKC 1Q72H 2GK0B 4FTVB 5MI0C 2DIJA 2AJ3B 5HDOA 3VJ6A 3BXNB 4LNVA 5E1AA 3QZWB 5CSZB 2XRAL 1FDLH 3S98A 3U7AA 1V7NL 3RL2B 4YDJB 4JCMA 5FK9A 4L1HA 4QHNB 4M4RA 1KEML 3Q1SH 5MEOB 2QBWA 5FECB 1BX2B 5L2KD 2CKBA 4OD3L 4NQDB 5DD3H 3GSWA 1MLCB 1WWAX 3JSSA 4X0KA 4FQQB 1QSFB 1MCWM 3DECA 3SY0B 3TPKA 4PTUA 2ARJQ 2Z35A 3O6MH 3B9KA 4G8EA 1YEFL 4O5LL 2IJ0C 4Z7WE 4NKMA 2NXZD 3QBTB 5D7JA 1E6OH 3ZYIA 1NCAH 5JHDA 4IRSA 2AXJA 4FZ8H 4Z7OE 1NPUA 5IEKA 1FGVH 4LF3A 3KJ6L 4Q6YA 4RBPH 1X5KA 4NN6C 5IMOA 5IR1A 1RURH 2H3NB 4HUXA 1MRDL 3WBDA 3MV11 1QFPA 1AGBB 3EO0A 5IEHA 5IB4A 5ECJE 2GJ6E 1BWWA 5FCSH 3V52H 1O7SA 3NCEB 1MHCA 4KFZC 3THMH 3NTCL 1T20B 2Y07H 5DEFB 4RMRA 2EDQA 3BP5A 5HYJA 5JW5B 1FH5L 1NMBL 1NCTA 3C8KB 4PRIA 2NY6D 1T1WA 5E4EB 3RGVD 3UTQA 5BO1H 1B0RB 1KJ3H 4HWZA 1YJDL 1CGSL 1ZHBB 3ZKSD 3QCVH 1M71B 2J8HA 2CDFB 2H8PB 3QHFH 4Y1AB 2A6KA 3ARWA 1H0DA 3LDBB 1WZ1H 1F58H 4GBXD 4NBZB 3RAJH 5CS7A 4LSVH 4XNMB 2FGZA 3BN9C 5L2JA 2VITB 1I7UB 5BV7B 3LRSB 1P5UA 3B5HA 2X1XR 2X2YA 2ZOKA 5TDPB 4XCEB 2NY0D 5DS8A 4OZFH 5C0BE 1C5DA 4MCYB 5BRZA 1XCQB 2I60H 3C5SA 4NP4L 3FQTA 1LNUA 2C3GA 3MJ7B 3BDYH 2QHRL 3UTOA 1T2QL 2ZOLA 3BKJL 2HG5B 2YXMA 3U2SA 1SEQL 3VXPB 2EYTA 2WW8A 4LLWB 1JZ5A 4W4OA 3CFCL 5E5UB 3HI5L 3MLUL 2JJWA 3ARDB 1HI6B 2GI7A 1RULH 5I0DA 1BF8A 1CF8H 1CXKA 1CG9B 2Z4QA 4OQTA 1J1OH 5E6ID 1AO7D 1P84K 3L5WB 3MSPA 3RWDB 5JTWA 1OT2A 4Q74A 4YXHL 1XGRB 4ZNEA 3HR5B 3F7RA 4Y4FA 1UWXH 4E42B 3CFKB 3DETD 1EIBA 1ZHNB 4WHTB 2CUIA 3HPJB 1F4XH 5F9AC 1KOAA 3EZJB 3PWLA 4KTDL 4MA8L 3CFEB 1BFVH 2X4TB 3WLWD 2I9TA 4XTRD 5DDHB 1KIRA 3K2MC 4KDWA 1KIQA 4HK3J 3IF1A 5AD0B 4H1LG 2PXYD 3BHBA 3LEVL 3SBWC 3TO4C 1EGJL 1XGYL 2VE6A 1JZ7A 1KGCE 2HTLD 3WXWL 5D1ZC 3X13A 1DUYA 2XQBH 1G7QB 4JN1L 1I7TA 1HH6B 4JEGB 4K3EH 3W2DL 4NN6B 3REWA 1MFCH 2NR6C 3UC0L 1IAOA 3L95A 2YPLB 5T3ZH 4Z8FL 3JWDH 5CHNA 2H2PD 1YEKH 2MHAB 1HHJA 4D8PB 4ZFGL 3MBEB 5E6YA 5E8NB 5IWLC 2BRRL 3HG1A 4QHUB 4DUVA 5D1XC 4RSVA 4LCUB 3F7VA 3C6LC 4HIXH 5BS0A 1N7MH 4XCNB 3SDDD 2OXGA 1ZT1A 2CQVA 4GAYB 1A47A 2GSIA 4OCSH 3G5VA 5E8PB 2Q6WA 2QQLH 4KKLC 3MJ9A 4F7EA 3O81A 3I3EA 4HPOL 5GIRA 4FQJL 4OD1H 4U1LA 4HKBB 1VPOH 3LKRB 3ZTJH 3QXAB 2H9GB 4F7TB 1VFMA 2UY7A 1KB5L 4PJHA 1NBYB 4HUUA 4ZG1A 1PG7X 3TIDA 2BVOA 5BQ7B 2DLIA 2MJWA 3DBXA 3GJFK 3LB6C 4U2YA 2YBRA 5D6DC 1VB9A 1U2HA 5CZXC 5I1AB 3QG6B 2GJ6B 5IK3A 1RFDH 1DUZA 3U7WL 2DS4A 4K94L 3VFWA 1I1FA 1A1OB 3SPVA 4Z7UF 3GHBH 3K8MA 4L8BB 4RRPA 4I3RL 5KTEL 4TSBL 3MV8B 3S5LA 5F1NA 3IXAB 1RUAH 4AM0B 3VG0L 3QXUA 3EO1B 2DD8H 4IM8A 4OGAC 4J4PC 2E7BA 1OHQA 3DARA 1IBGL 3AS1A 3MV7D 1ZT4B 2CLRA 5DRNA 3G04A 3K8LA 1MHEB 1ZS8A 5EO0B 5ID0B 5J6GB 5AYUH 5HHMB 4XBGA 5DZOA 1B6DA 5LKNA 5DYOA 4GKSB 2ZCLL 5KSAC 1ZHKA 4G8FA 4ODUB 2C4FT 4PGDA 1NBZA 4B50A 3ARZA 2AJSL 1RZKL 4PRNA 5MENB 4A6YB 3LSOB 1DBMH 3DWTA 1U41A 2A9NL 5IUSA 5I0ZA 5KSBE 1UVQB 1KTRL 3T0XA 5LGJB 2XWBB 1I8IA 3EOTH 4I3GA 1JZ3A 3L5XH 5AUMB 1UACH 4OT1H 1PZUB 4MD5A 2CGRH 5HJ3B 4Z77B 4JFEE 4JANA 4Y5YA 3NCYP 1S7WA 3TO4B 1HOCB 3JVGC 5DHYB 3MRLB 2Y72A 1V7ML 2P7TA 1A1NB 1I4FA 3L7FA 5D1ZB 5TGBB 4AEFA 2XFXA 4HS8H 4IHOB 4PJFB 4OZHF 1PYWA 4Z7VA 3O0RL 2FIRT 4LLYA 2ED9A 4POYA 3BPCA 3KYAA 3QHZL 1G7JB 1LGVA 1JHLH 2DDQL 4XBPA 4UT6L 5D1XB 2OJEB 1M7XA 4K71C 3WHXB 3QFJA 3UTZA 3V2AR 3TA3C 1HCFX 3NPSC 1IKNA 2GTWB 4UQ3A 2ILLA 5JOPD 2GY5A 4MQSB 3ALWA 3OAZK 3ULVH 1OT1A 4HDIA 4AG4L 3MMEB 4M43L 4MNHA 3KYOA 3I84A 2QSCL 4EOWL 5I74C 1GYAA 1S5HA 1RUPL 3QIUA 2XZAL 4QRSA 5T1LD 1YN6A 4V1DB 3Q6GH 2FEEL 4XXDA 4J6RL 1RIVL 4XP6H 4PUBH 1VERA 4KKBC 3X17A 3FL7A 1KLUA 3ILQC 4QHKJ 5T1KB 3B8YA 5GS0L 1BEYH 2L4OA 2IANA 3PJSA 4XVSL 5IVXB 4JFFD 1WV7T 3BT2H 3EJYC 4KHTH 2BC4B 4UT9H 2VIRB 4X8JA 1KELH 3PDOB 3VFVB 4UAOC 5D7KD 4Q9QL 4P99A 3D9AH 2WP3T 3DX8A 4QXGH 1RK0B 4XMLL 4X6BB 5AYQA 4MJIB 1LE9A 5J8OA 2IADB 1EAPB 1RZJH 4P3DB 1UM4L 4LVEA 5KSAB 3FFDA 1MCBA 2I27N 5C08A 4APQA 1V7NH 1CVRA 3SDAD 4ZSOA 2Z9TA 5E8OB 3FQWB 1QFWI 3BFOA 2BOCB 2BSTA 3MRPA 3SE8L 3WXVH 4OD3H 2WIIB 2X4UB 3I75A 4KY1L 1Q0YL 1S78C 3QIWA 3FO9B 1AXSB 1LVEA 1FZKB 4PGEB 5EH1A 5SV3A 1JZ2A 1YEFH 4O5LH 4L8SB 5EB9A 4EUPA 3LD8C 1FRGL 3RUGE 1FPTH 2C4XA 5L7XH 1I8KB 3MLVL 2HLAB 2OS7A 3KJ6H 1UG9A 1NKOA 3BEVA 2V9TA 3VXUD 1T0PB 3KPPB 1MRDH 4P5KA 5IGXH 2FJGB 2E7MA 1O7VA 1BHGA 1DVFD 3MRCB 4LVOC 1QNZL 5KSBB 5IBUG 4OF3A 1NCDL 3ZYZA 3EYUL 3MREB 3TA3B 1BIHA 1KT2B 3EDKA 3NPSB 3LKPB 2YA2A 3F7PC 3VRIA 4BELD 4MCZA 4RCAA 4WWKA 1FH5H 1WWCA 4I8DA 4G6JL 2I9LA 3DGGB 1NDMB 1SYSB 2HMIC 2F54A 2NX5A 4B41A 5DHVB 2YC1A 5KS9E 1YJDH 5I74B 3L3IA 4R96A 4KKCD 3DPBA 4OAWA 4U7MA 3ULVF 3CVHH 4NDMB 1BJ8A 3VXRB 3SGJC 2NMSA 4HF5L 4JZNB 5DO2C 4OM0L 3UZQA 2PTVA 1P69B 4CU8A 3T08A 3PF2A 1HZHL 2V5RA 5ESAB 1JPGA 5ID1B 1T83C 3MJ8A 4K55A 1LEIB 3QO1B 4M1DL 1WZKA 3QDGE 4GSDH 5JXED 3ZT7A 3EDFA 4GW1A 3RPKA 4NP4H 5IB1B 1TZIB 4O2FA 4UAOB 2QHRH 1FNSL 1T2QH 3BKJH 3MOAL 4LSQH 1FAIH 1SEQH 3O2WL 3AUVA 1OWWA 1XF3B 5ALBH 3CFCH 4DGIL 3HI5H 2IG2L 3CX2A 4QOKA 1GGTA 4BZ2H 5JPNB 4URTB 4LKXA 3SO3C 4TUOA 3CFDA 3WS6C 2X4SA 5GHWL 3S3JA 4POZD 3A0OA 5JORB 2XICA 1QFUL 1ORQB 1OTTC 2ESVB 4PJ8C 4D94A 3I02A 1A14H 3KYMB 4PJEA 4PY7B 3DUSA 4UNUA 3BZEA 15C8L 4L5FH 3QEHA 5GS3A 1JF1A 5IJKA 4QGTA 5JDSB 3LEVH 5I1LB 1XCTA 1KCUL 3QUZA 1XGYH 3C8HA 2QSQA 3LD8B 4NFCA 3WXWH 3VGAC 4S2SB 4BSWA 3O11A 5D72L 4JN1H 5EU5A 4CJ0A 3W2DH 3ES6B 3UC0H 3GSRA 5DK2B 4XHJD 2DYPA 2VSCA 4Z8FH 1TPXC 3BZFB 2OTWA 4JLRA 4NCC2 3CNKA 3CFJA 1ZGLM 1F5WA 4DZBB 2BSSA 4LVOB 4ZFGH 3QA3A 5HHQA 2BRRH 3GMPB 1AQKH 1OWRM 2FBJL 3FONA 2X6MA 3EOBA 3VI4E 4WFEE 4E5XB 1I85C 1CFTA 1SHMA 2PYEA 1CFVL 3PQYE 4P9HL 3TVMA 2UZYB 2VDNL 3B9KC 4X7TA 3FZUC 3VMNA 4RQQB 1U92A 4NUJB 2CIIB 4XPGL 4MA3B 1OTSD 4BZYA 2GW5A 2JCCA 3VFRA 5IMLB 2LAGB 3H7LA 1OARL 4S1RL 5CILL 3P40A 4KGJA 3WL9A 1JTOA 5HTSA 5FKAA 4LGRB 3OGOE 1JRHL 1CD1B 4MJ5A 3GMQA 4L3CB 3CCHB 4ZO6A 3D3VB 3B9VA 1HQRB 1PZ5A 3LVEA 2UWEE 4K94H 3WFHA 5EUOA 3U36A 1CU4L 1NGWA 2AVGA 3DRQA 1GZQA 5KTEH 4PJGB 4I3RH 1GGCL 4TSBH 3BE1L 2BHYA 1YC8A 5I17A 3KPOA 5INDA 3ZE0F 5J57B 1TFHA 1WTGT 5D70L 3DTXA 2IH3B 5DJXA 5KSUA 3RNQB 4PJDE 1W0WB 3MO1B 4XGZB 3WEXB 1EERB 1IBGH 1UENA 2Q1EA 4U1NB 2F9BT 1KXVC 1S5IL 5CSGA 3SO3B 1H15A 2FL5A 4OUUA 1N3NA 1XGUA 2ZCLH 2YPLD 3PXHA 1QFHA 2QQNL 2YD4A 3L3HB 4MJ4A 3NCJH 4HH9B 3T0ED 2XQYK 5E2WL 1S9VB 2WK2A 1ZANH 2JIXD 2L0DA 4OZIA 1QFOA 4NO3B 5HGDB 1KG0B 5F88A 4MHHG 1RJZA 2C3WA 4ODXB 4KJYB 3ZDZF 2RGSA 3RY6C 2Q86B 5EZLB 1HHIA 4P5TD 1LE5B 3LKOB 2AV1B 4GXVL 5LGHH 3VGAB 4KMLB 1V7MH 1A6WH 4YHLL 4DK3A 3GSUA 1JPFB 4LDOB 3JV0A 2CSPA 3CDGB 4L8CA 1T4KA 4YPGB 3O0RH 3EO9H 1EX0A 4J12A 4WENB 1BBJA 5F6HI 2ATPB 4NQCB 3IS1X 1TPXB 4PV8B 5F9JA 3KR3L 4O2EA 4D9QD 4IMKC 4GQPH 4XWGL 4PJBA 2P24B 1KCVL 5D5MA 5EIVA 1FFOB 3RBGA 1U8OA 4EJ1C 1PFCA 4PJFF 3X3FL 3BZ4B 1KPRB 4JRXD 3J8F7 3MV8D 3NIFE 4Z18A 1UKQA 1SEBA 3IXTB 4X5LA 1QPPA 3WS3B 5DJ6A 1A4JA 4Z0XB 5ENWA 3NFSL 4P59L 3VFTA 4M43H 3SGDH 3MJ6A 5CCKL 2APBA 3WNLA 3AMLA 4EOWH 1S7VA 2BY2A 3RX7A 2EEAA 1RUPH 2D7TH 1MQKH 3GJFB 5HHMD 3JV5A 4YDVA 4IRJC 1I3RA 4J6RH 1RIVH 5EN2A 4Z95L 3FMGL 4GLRI 3G08A 3LEYL 1BIIB 3IAPA 1QR4A 3H2WA 3S35L 5GS0H 2ARJA 4O58L 2MSPA 3OMZA 5JQ6L 3TZVA 4JCLA 4XVSH 5C09A 4UTAL 3SDYH 5DUPL 3KPRE 5B3JF 1WFOA 1GL4B 3PQYB 5E4IA 4B5EA 2P8MB 2N7BA 2YSSB 5HVWA 5F3HB 2X44D 5EBWA 4Q9QH 3TH4T 5D1ZD 4XMLH 4BFBD 5J9PB 1T1ZB 2ZSWA 1MCIA 3QP3A 3FO1A 5KW9L 1UM4H 4JY6B 1U8JA 3OAYK 3EYVB 1B9ZA 3MGAA 4YC2C 3PWUA 2GK2A 1OGAE 4AEIL 4FS0A 1D9KC 2A6IA 3UAJC 5I15H 1RQ5A 1WIOA 2D7QA 1CDBA 3P4OB 5D1XD 3RVTC 1CGXA 3C6LD 2OM5A 5IFAH 2OLDA 3U83A 5C0DB 1UKTA 3TYFA 3X14B 1F6AA 1NSNH 4QRUA 2NZIA 4JQXC 3RKPA 1KCRH 1Q0YH 1CICC 1HHGB 1M4KA 4KKLD 4ODBD 5ERWB 1D5ZB 3QUMH 4PIRF 3BUYB 4QYOB 3VXMA 5C8JA 1K5NB 3J7HA 5KVFH 5E6ZA 4QNPE 4P2QA 1FRGH 4EI5D 2OR7A 5FO9B 4LPXA 4L3EB 3MLVH 4V1DD 4NQEE 1C12B 3T77B 3HNTH 5H2BA 4WW2C 4WHCA 1LDPL 3AREC 3TGXA 4HIJB 3LB6D 3QEUB 3DV4B 4JQVA 1OSPL 1MFEL 5I1JL 5CZXD 4OJFL 5F21B 2HJLA 4O2CA 1NAMB 2EDEA 3EYUH 2CLZB 3WDHA 5HGAB 2ZNXA 4HXAH 1R3JB 1KTLA 2M8XA 3UDWC 4G6JH 5GRVK 4OGAD 2DTMH 4J4PD 5FA3B 1WISA 1F2QA 3RX5A 3FB6A 4F15C 2XACC 1AGFA 1T5WB 3L7EA 2FEDC 1QLRA 4TNVK 5DF0A 2DMCA 5KSBF 1IEBA 2AJZA 4KAQL 2VXTL 3GRWL 4IRJB 4MJID 5FYKE 1MELA 5EOCL 2LU7A 4RZCA 4HF5H 3SCMD 4D0DA 1NFKA 2AXGA 4OM0H 3B9DA 4F57L 1ZTXL 1WEJL 4ZDHA 5CJ5A 1DLFH 2ITDB 1A6ZA 4P23A 1NC2B 2Z93B 5CJQH 3OJVC 4M1DH 1GOGA 3JV6B 4HZLB 4ZUWA 3ESUF 3QXWA 2NLJA 3CDCA 4ONHA 1MF2L 3ZDXE 4BK4A 4J3SA 2C7UA 4NZUL 4NRZB 3VGEA 1KPVA 5C6WH 3WFDL 3VXUE 2VR5A 4TPRL 3MOAH 1HXMA 1SYVA 4E0RA 4LHUB 2LU4A 4DGIH 5D7LE 1H9VA 4J3UA 4PJAE 1XH3B 1CLCA 1B6UA 2SEBB 4UUJA 1V8HA 4F58L 4GAJH 4YC2B 1CFSB 4JRWA 4PRPE 5GHWH 1KJ2L 1D9KB 2HKFH 1EO8L 5D7IE 8FABB 3FO0H 1OAYL 2OQJB 5JW3L 4PGJA 1QFUH 4N0UE 1VADA 4I48B 5ICYA 4NNYA 4CNIB 3SGKA 5C0GA 5JNYB 3KPRB 2WINB 3WDJA 4OLUL 1K3ZA 2G5BA 1R3HA 1CICB 4Q2ZA 2NQCA 4JZJC 1U9KA 2K9UA 3NACH 5HVGB 4K2UL 2VABB 1KCUH 2KDGA 5FDWB 3K0WA 1A7PL 5DFVC 2OJZL 4KRNA 4ELME 3F65A 1DSFL 1P2CA 4G6AC 3P9LA 1VA9A 3I6LE 1I9RL 4WW2B 3VXRD 3MV9A 3AREB 4JAMA 3RWJA 3ESVF 4I4WB 4KRLB 4X6FA 1H3PH 3ILQD 3BW9A 3DVIA 1S7QB 2EE9A 2FBJH 4KKNA 4F7PA 2PCPB 2B7DT 2IALB 2R8SL 3IJHB 4CGTA 2CJUL 3V4PL 3U6RB 4LEXL 4OZ4A 3S88H 4L8DB 4L4VA 1CFVH 4P9HH 3IU3A 3AXLA 4F15B 2DQHL 2VDNH 4UDTB 1T0MB 2ATKA 1IILE 3WUWA 2EZ0C 4AK1A 1A4KB 3RWEB 4FABL 3U0TA 3BPNC 3IRPX 4XPGH 2VOTA 4PRAB 1HCVA 4I5BA 4DVBB 1S7UB 3O2DL 5B38B 2R0KH 4JO3L 3HE7C 4NQEB 5EZIH 4S1RH 5CILH 1NDGB 1URLA 5I19H 3KNBB 3VFSA 4WU5B 1EK3A 1JRHH 1QYGL 3T65A 2YWYA 5C0AD 5I1IH 4KI5C 3KYKH 4YEEA 2ESVD 4NIKB 3OKMB 5DJCA 3PHOA 2VAAB 3WIHL 4NO5A 4LCCC 1GGCH 5K9OA 3WFBH 3PDGA 4R97C 4NNXA 4I3SL 5HYQB 3B5TA 2VDLL 4NC2B 4U3CA 2W0PA 1D6EB 2FB4L 5B39G 3EYQC 4NC0B 4PJ7E 4KK6D 4LCIL 1DLHA 1CTOA 4LRIA 1QBML 1CQKA 4P2RE 4PJGF 3OKOB 2DLFH 3TT3L 2QQNH 2OI9C 1I3GH 3QSKB 1FVCA 1QQDA 5SWQB 4X6CB 3EYOA 1A9BB 5E2WH 3L1OL 3QULB 3T0AA 4MDJA 2R2EA 4NSKA 3BH9A 3IDGB 3MLTA 4HJ0C 1I7ZB 2DM3A 3LEXA 2R56H 4JZJB 2Q8AL 3FB8A 3BIBX 2HMID 5F7KC 3O4LA 4OGYH 1G0XA 4JM2C 4QWWC 3GMLA 3QDME 4ZTPL 4EIZC 4GXVH 3B4NA 3UYRH 1F4HA 3CLFH 1S7TB 3FRPG 4YHLH 3CFIC 6FABL 5D7LB 1UADC 4WI2A 3WUZA 2K7QA 4ZQKB 5DUBB 3KPNA 3VD3A 3QO0A 2V6HA 3PGDA 3ROLB 4N8CL 1ERNA 1OCWL 5CIPB 5BV7L 3MLSH 1ZVHA 4TRPL 4XWGH 3DMMD 2FJFA 2A77H 5F1KC 1VKXA 1JHTB 3D3VD 4GW5B 1KCVH 1RPQA 4L4TA 1F3JA 4GG6E 5GGRB 2XWTB 4JFDB 4N0UB 3W39B 3GO1H 4U1MA 2E7HA 1B4JL 3SDXA 3V4VH 3X11B 3X3FH 3VGBA 4C56A 9CGTA 5I1DB 5DK0A 3GHEH 4Z7NE 3GSOB 1WSST 4Y2DC 4ENED 2FYYA 4G7YL 3NFSH 1OAQH 1H3GA 3BPNB 3T0EE 2DQIL 3BYYA 3UBXB 5L8JB 3QG7L 5CCKH 3NCFB 5HHNB 1UXSB 2CRYA 4G9DB 1X5ZA 5F1IA 1PG7W 1VEPA 2Z31D 3BIKA 5JDJA 4OM1L 2PO6A 1JGDA 1T0NA 3HE7B 1AGDA 3INUH 3JTSA 4JFPB 3FMGH 4WI5A 3LEYH 3G5XB 4QF1B 5TFSL 4PJ8D 1EXUB 1OTTD 4P9ML 1IJ9A 3OR7B 4O58H 3HAEB 4I2XB 3LQAL 4XVJL 4LAQH 3G5YB 2A1WL 1MHPL 2HVJA 2YPKB 3SKOA 4UTAH 4LCCB 1D5MB 2DOCA 5FKPB 2WIMA 3AS2A 2G5RA 1JHKL 4OCMC 1WBYB 4QRPB 2GIYA 5CD5D 4D9QE 1SVZA 3U4EB 3X3GH 3IAQA 3RL1A 3HNVL 3WNMA 5C6PB 4WTZG 4CN6A 4UBDC 1W0VB 3QDHA 4I1NB 3WMSA 2CRIA 2HT3C 3S3PA 1GHFL 3L3GA 2P8PB 3SKJL 3TESA 4NQCD 1OAXL 3UTSE 5JIPA 2FHBA 2OI9B 4S11A 1U3JA 4U6TA 2X05A 3BWAA 4P0DA 3HCVA 5TH2A 4X6EB 4JGUA 4AEIH 3U9PL 3MRNB 1K4CA 2FO4B 1M05A 2FSEA 4NZRH 4JR9H 4YHIB 2XTJC 4Q6IC 2H26B 1CFQB 5EOTB 4GQ9L 5CP3H 3B9KD 3BH8B 3FZUD 4JM2B 2HKHL 3HI1A 4DGYL 2ADGA 1U3HB 5GISL 3D48R 5JHDD 4IRSD 1U3ZA 4PJ7B 4JDVA 4YBQC 3GKZA 1HSAA 3V7AG 4PRDA 4RX4A 1U93A 4NC1C 1MUJB 4MXQC 4MX7B 1X7QA 3SKUD 1LDPH 2GEEA 43C9B 5D2NA 4LU5H 1OSPH 1MFEH 4HX1A 4JJHA 3MRBB 4OJFH 3RWIB 4AH2A 2AABL 3ZKQD 4Y19A 5H35B 5HYJD 2FGWL 2VLRA 2Z8RA 3JWOC 2F8OA 4JFXA 2D3VA 4Y2DB 1ZWIA 3ARBC 1NUDA 2HRPL 3WNKA 3OBAA 4LFHD 1HIML 3QDMB 2E8ZA 5KSVB 1JYXA 4J23A 2J1KA 3KYNA 1E4XI 3VW3L 1YMHA 5JZ7C 4MD4B 3GRWH 4OIBA 2PETA 1HHKB 5EOCH 3R0NA 5SX4H 1ONQA 2HTKC 4PYGA 3PWPE 2IGFL 1AD0B 1ZTXH 2BOBA 1CT8A 3IS0X 4M93C 1LO5B 1WEJH 4L9DA 1LWRA 4IOIA 3GMRB 4JFYA 4P5MB 5GGQL 1T80A 1MLBB 3IDIA 3ETBF 3C6SA 2MTPA 5BRZD 4ZXBA 1FZOA 5HDBE 1MF2H 1IAMA 2PYFB 4YFDB 4JE4B 2WBJC 1UB5A 1C5CL 3WFDH 5LGKA 2DI7A 2DLHA 5FGCE 3E0GA 1A2YA 4TPRH 4R4NC 1NCNA 4X7SL 4XX1G 3V5HA 1WAAF 4DEPB 1C7TA 2KZ1B 3EFFA 3P9MB 3V6ZA 4ZFOA 2ADJA 1CD8A 1EGJA 3GBNH 1RK1B 1BD2E 4UQ2B 2GUOA 3X12B 3NIFF 4Y4FD 3ARUA 5D71L 3ZKMD 2AKRA 4OZFG 2X4PB 3FB7A 1DBAL 1OAYH 3K4DA 5JW3H 2MFNA 1JGVH 5FYKH 2LAAA 5A16B 2P5WB 4F7CA 4F9PC 3ELAT 2XTJB 4Q6IB 4ZODA 5MEPB 1TVBB 1OVZA 3MNZB 5EZOL 4PTTB 4PJ5A 35C8L 4OLUH 3I3BA 2C3VB 5FV2A 1IFHL 4IOSD 4PJCA 5C2UB 3O6LH 1F11B 3QXVA 1NLDL 2EDDA 3DGCR 2NCMA 1A6TA 2BX5A 1W8OA 3DRTA 3O6FC 5KVMC 1F00I 1NC4B 3VFUA 1T66D 2AW2A 1I9RH 2BNQE 5IM7B 5F7FA 5IB3A 2I07B 2B1HL 3RIAK 1KB5A 3WFCL 3HG1D 3SJVB 4OLVL 3C09C 2R0WL 3NABL 4YQXH 4ZFFB 1LO0L 5BS0D 4LL9A 1NC2D 1KTDB 3KHQA 4EEEA 1S9XB 3BP4A 1IQWL 2R8SH 2FJHA 4YDIL 2CJUH 3ARBB 4WU7B 3CX5J 1T04A 4WW2F 3HMXA 1BZ7A 2NTFA 3FTGB 4WDIA 2R2CA 4KHXL 4HULB 2DKUA 3IDUA 5AAMA 1CFNB 2EIZB 4MXWL 1JNHA 4FQXA 4LHUD 3VFOA 4N1CA 3U4BH 4FABH 1KEGL 3MRHB 4OGZA 3V6FA 1K4DB 5T1DH 5H94B 3TYGH 4XXCA 5JLZB 4FXLA 1FL3A 1HHHB 4PPTA 2DLGA 2BNRA 5A2FA 1Q94A 4NWUL 3U4AA 4JO3H 4ZPTB 2NY2B 4DKDC 2R0LL 3VXOB 2CDGB 1PKQA 4YHNA 4B53A 4FFWC 4PFEA 3D85B 1ADQL 5I75C 2CO6B 1QYGH 2V2TA 3UAJD 1JUFB 3H6JA 3CLEL 3O9WA 2YMXL 5TPWH 4X9FA 3VGFA 5J0BA 3RVTD 2PN5A 3DX9B 4O9HH 1ZVSA 2OZ4L 3DV6B 5J13B 4CU6A 4UILL 2WM0A 1ZLUK 3NA4A 4MZ2A 2WBJB 3ZTJG 4CMMB 1I8MB 3R06A 2BNUB 1FZJA 2J8UE 4H26A 2WUBH 3FN3A 4NHUB 4FQ2L 4M03A 2VDLH 1OP3K 2JELL 4QT5B 4U6HB 1A22B 1U95B 2EDXA 4Y4KC 5DEGB 3PIQB 4QHKI 2ZUSA 2FR4A 4LCIH 2G9HB 1HK6A 1A21A 3PXJA 4U4BA 2VL5A 3N1QC 4RFEB 2FZ3B 1J8HE 5A2JH 1QBMH 4G8IA 4ONGL 3DIFB 4EZMA 5JMOC 3HUJE 4OI9A 1B0GB 3TBWA 3MUZ1 2AQ1A 5I1CL 4IS6B 1T21B 4NOFA 2B4CH 1ES0A 1Y18A 3L1OH 4ODVH 3GIZL 3OSKA 1ED3B 4M1GL 5C0CA 2UZIL 4L29A 1PQZB 2FHCA 4JGJA 4PJXA 4WUUB 1SJXA 1X4ZA 3SDCA 4RMTA 4CU7A 1J7VR 4ZTPH 2JB5L 3QCUL 5C0AE 3O6FB 4X6CF 2E7LC 3OV6A 6FABH 1BD2B 3U48A 3UTTB 3DSFH 4TTDD 4YLQT 4GJTB 3TWCL 5HHPA 2GT9B 5F7YC 5C3TA 2APFA 4PY8J 4P2OA 3C09B 1RMFH 3DX6A 1A6VL 1RV6X 5EO9A 4ZYKA 4PJIE 1F13A 1B4JH 2Y36H 2OL3B 5DQ9A 2ZWLT 4MYWB 1OPGL 1PDKA 2A74A 3MACH 4H1LB 5D2LE 4KXZH 1LO3L 2YR3A 3Q6FB 1BOGA 3RX8A 3DI3B 4TNWK 3KXFD 1BQUA 1K8IB 4NQTA 2VLKB 4KVNL 2DQIH 2NY3D 3QIUD 2DWEA 1XF5B 1PD6A 4NFDA 1QRNA 4OM1H 5LAXB 2RJMA 1KLFA 3W0WE 5J3HC 4XVTH 3RWHA 5I75B 4EQ3A 4JN2A 2HT4C 2EDYA 1HSBA 4NKOB 1WT5C 5DD5L 5TFSH 4P9MH 3RDTC 5CEYA 4HUKB 3LQAH 2CR6A 2JE8A 4XVJH 5B8CA 5DJ8A 2ZUUA 1FYTA 3LY6A 1MHPH 1Q38A 5JW4R 1T1YB 1ZT7B 1XF2B 2BVEA 1PBYA 4MAYC 4OFVA 1JHKH 4X99B 5DQJB 3CJJA 5ANMB 2BVTA 4NKDA 5IT2L 5JPMB 3FQXA 1J18A 4CW1B 5DD6A 3AAZB 3M1BB 2Z91A 1FBIH 3BP7B 2CO7B 5DFVD 2GSGA 3HNVH 3L9RA 4Y4KB 5CZKA 4KI5F 4Q0XH 3CXDH 1FO0H 1DBKL 2VZVA 5A2LH 1GSMA 32C2B 4WIQA 5C08D 1GHFH 2NY1C 3OGCB 3WNOA 3TM6A 1BAFL 1OAXH 1LP9E 3TEUA 4KTEL 1U8MB 1EFQA 4G9FE 2XZZA 4NPYA 2NW3A 1AGCB 1Q1JL 1FP5A 2VQTA 1BVZA 5F9DC 1TNNA 2GITB 5ESQA 2XN9B 4JFDD 4EDXB 1PX3A 4M9PA 4G5ZL 4JO1H 3MCG1 3RA7L 1II4E 1MI5E 4IIQC 2FD6L 2HKHH 1WBZB 4DGYH 3HLAA 5IF0A 3ZTNL 2EZ0D 3FQUA 2MMXA 1R3IH 4TTGA 5GISH 4GAGL 1B88A 2HYMA 4NO0B 3I6KA 4QTHA 3NAAH 5B4MC 2PKDA 4JFQB 5HPOA 1AY1H 2R39A 3WJJA 3GDBA 5CBEB 4HKZB 3NFNA 2QADC 3EJZC 4KK8D 1RUKL 4IDLA 3L3JA 4N9GA 3NIGE 3VCLB 4LLUB 4KQ3L 4RAVB 4JM2F 2LU3A 1VFAB 1XEDA 2AABH 3DVNA 1BVLB 2Q7NA 4JO2L 4ODHL 4PJ7F 4UDUB 1YEIH 2EDBA 5HDQL 5AWNH 2X4NA 3T4AB 4JVWA 5EBLB 4QRPD 1MWAH 2NX5D 1W72H 1HIMH 1QHOA 1WICA 3EYQD 4WFHD 4K7FB 1NFDA 2UV3A 3MLRL 5I66A 5C07E 1Y0LB 2JJSC 3IKCB 3VD4A 3SEPA 1XGQA 1ZSDA 3VWJC 1L0XA 1RZFL 4LLQB 4X5WA 2CK0H 4KU1A 5HY9B 3VI3F 1UGNA 4OKVA 2IGFH 1B2WL 1C16A 1TZHA 1ZHLA 2AJYL 4NYLA 3RDTB 4EN3C 5T5FL 4LLDA 5GGQH 4HWBL 5C9JA 3Q3GB 5JHDE 3KJ4C 5L2KA 3MNVA 1S9YA 4HJ0D 3SE4C 2XA8L 4MAYB 3NCYS 4LP5A 5D2LB 3OKLB 5IP4A 3OX8A 5JOFB 1QSZA 5I1GH 1C5CH 2YEZA 2IBZX 5F7MC 1IZKA 4UIMA 1JV5A 1RZIA 3D18B 5EFIB 3T2PA 3P0GB 5GSVB 3WD5L 1FGNL 4XNQB 4IMLA 2IF7A 2NY1B 4FQHA 3W0WB 3VXQB 1J5OL 4PRIE 1HDMB 2X7LB 5D71H 4PGCB 1Q9KB 1Q9OA 1LO2L 1MCCA 1DBAH 2XTLA 3WKML 4K8RC 4QXTB 4CVXB 1MCOH 2OXHA 1NCUA 4HBCH 3L3KA 3MC0A 4KK9C 3OKNA 3R0MA 2A73A 5EG6C 5SX5H 2H2SC 4IIQB 4YEFA 3W5MA 1WF5A 3LH2L 2CK2A 1U91B 3H3PH 3RGVA 1P4LA 2ADIB 5FA4A 2IMMA 2N4IA 1JNNL 1YEEL 3T1WA 4WHYG 2QLVB 3DJ9A 2QADB 2DYPD 4M8QB 4U6YB 1P4BL 4QKXB 4N0RA 1I1AA 5FUCE 4U1HA 3B5GA 4KQ4H 3MLYL 3F58H 1U8IA 4Y8AA 1MHHA 2B1HH 1N26A 3GIVB 3WFCH 4OLVH 1JWMA 3N1GC 1Z9OA 2J88L 3ROOB 4FQ1L 1LO0H 4HFWB 3SKMB 1F4WH 4U33A 1O0VA 1L9MA 4KROC 2EO9A 1IQWH 3N1MC 4MQXC 4FG6D 5IG7A 1GPOL 1MI5B 1NEUA 1FFNA 1HQ4B 4F8TA 3RU8L 2HFGL 4KHXH 4WFFD 2FWOA 3P9WB 2DIAA 5D4QA 3QISA 4UBDD 2A83B 1UCTA 2AV7A 3QH3B 1KEGH 1V05A 3CH8A 3OXRA 5IB2B 4DN4L 3C60A 1Z5LB 3IDNA 3VWJB 4OTXL 2MOVA 4NWUH 1M6OA 1BJ1H 4RDQG 2IPTL 3FT4B 4X7DC 2R0LH 3UP1A 5IBUB 1ADQH 4EN3B 5C86A 3CLEH 5AZ2L 1OAKH 3ARVA 3M8OH 2YMXH 4EQ2A 3HFML 1N8ZB 1KFAL 2P5WD 3KJ4B 2OZ4H 2M26A 2EDNA 3SE3C 1JPSH 4UILH 3ULSB 3I50L 2C3HA 4H88L 3MCLL 1SQ2N 5ITBL 2NZ9C 1T22B 5L8KB 1EAJA 4X4YB 4YJZL 2HVKA 4IEFB 2PXYA 4OQTL 5I8EB 3HG1E 3JZ7A 5JUEH 2JELH 4YBQD 1ZEAL 4QHMB 5C07B 4L3AA 2AERT 3VH8A 4MD0B 5BS0E 4MXQD 4X4XB 1CL7L 2UVFA 2BHUA 2R23A 3DOSA 1NAML 3SJVD 1BGXL 4M6ML 2HJKB 3SO5A 1QBAA 2VXUL 2G2RA 4S0TD 3GIZH 3BWUC 4Y5VC 4ZXBC 2EDWA 5F1OB 2ZP0T 3IDYB 5HI3C 4HK0B 2VDQL 4PJHE 4EVNA 4F2MA 1AJ7H 4OLXL 2X70B 1JNJA 3ARBD 3KPSB 5LCVH 3SDDA 3U79A 2ENYA 3BP6B 2GKIA 1P1ZA 4YAQA 1YY9C 2XY1A 3B3IA 3EOAB 1Z3GL 4I9WE 1MHCB 4MQ7A 2JB5H 3QCUH 5IMKA 5IW6B 5SWSB 4F9LC 4EXKA 5JZ7D 1TQCC 1NL0H 4NCC1 3TWCH 4U1GC 3ECBB 1CQYA 4LARL 5DVNA 4KJPC 3BUTA 2NW2A 1U3YA 3D85D 4YGVB 3AM8C 4HEPG 3O3AA 4GKZB 4KH2A 1NAKL 1MFNA 3QAZC 1U6AL 5CWSB 4U1SA 4BSJA 1LEKA 3T2NL 4KROB 4GRLC 4I13B 4JPIB 3MJ9L 3V0AC 5JW4Q 5DRWA 3B43A 2V5TA 4IOFC 3V5DB 4HHAA 1YEHL 1J0HA 2GYSA 1S9WA 2WNGA 4WUKL 4KVNH 1AHWC 3H0TA 3QQ4B 4U1JA 1LILA 3MV7A 3ULUE 5HGBB 4HV8A 5CZVL 1J88A 3MXWL 4MA1C 2MQ3A 4DWHA 4R7DB 1DN2A 4JY5H 3TN0C 4GO6B 1X5AA 5EBMA 1HN1A 1RSFA 4R90L 4WJ5B 5FYJU 1V3MA 2B8OT 5DD5H 3LZFH 4NQXA 4EKXA 3NH7L 4RIRB 5J7CC 4Z7VE 2YK1H 1NH6A 3WO4C 1UM5L 4X5XA 5GZOC 1R24A 5J1TC 3N50A 2DM7A 1WTLA 3EOYG 3O41A 4YHKL 4OLWL 4WUUD 5IT2H 3DHJA 4QY8B 1DQLL 4H8WC 1S7XA 3F5WA 4HEME 2O61B 3O6FD 1DBKH 4Z7UA 2DQGL 3QFJE 2KQNA 4NT6B 3UTTD 3MGTA 1DN0B 1FV1A 1KIPA 1BAFH 4JRYB 1RZGB 2P5EB 4KTEH 2HT2D 2VR4A 2Q76B 5FUOH 4Z9KB 4LOUC 1Q1JH 3B2VL 4TULL 5HI5D 4YBLC 3OF6A 3MA9L 4Y5VB 2P44B 1G7LB 3VD7A 3NA9L 1JIBA 3Q5TA 4G5ZH 4ONFL 3CPLA 4BUHA 5JO5A 3RA7H 4LNRB 4TVPE 1OY3B 5EZJB 2JJVA 5CHNB 3IDJB 3VXMD 3D39B 1I8LC 4X80L 5KAQG 3ZDYE 4UOJA 2WAHA 1S3KH 2IANE 3FT3B 4HS3B 1G6RB 4GAGH 1TQCB 4P46B 4OV5A 3PV6A 1FL5B 3QFDA 4ZUSB 4U1GB 5T1LA 4D2NA 1JI1A 1U8NA 2EYSA 5BJTB 3CDYA 3BDXA 3U46B 2YZ1A 1RUKH 3EIFA 5C92A 4FFWD 3K81A 4WO4A 3VXTA 2ZKHL 2JJTC 3QAZB 4RGMC 3H42L 1H3TA 2GHWB 3RPIB 3IYLW 2F58L 4GRLB 3STBA 5J11C 2OR9L 4JFFA 2BFVL 4JPWL 4H5SB 4JO2H 4NZJA 4ODHH 4U6VL 1QR1B 3TCLB 4W68A 5HDQH 1FG9C 3FRUB 1IARB 3MOBL 5E5MA 2G60H 4KZDH 3RVXC 8CGTA 4LP4A 3STLB 1G7MB 1BM3L 3VXSA 1AHWB 4D9RD 3DXAE 5HHOB 4Y4KD 2X40A 3NIDE 2MKLC 4MJ2A 1LK2B 1MRCH 3MLRH 1WFNA 4MA1B 4GMTL 1FNEB 2X9XA 1N6UA 4OFKA 2C1OB 3TN0B 5DI8B 1HKFA 5D1QA 5EIIB 3D0VB 1YNTB 5E2JA 5GS1A 3AY4A 5GGUB 3OJDA 5I8KH 3W9EB 3S34L 1VGEL 4P23D 4JGMA 2AJYH 5T3XE 5T5FH 1YNLL 1KJ2A 1MFDL 3ZHKA 2XN9D 3HC4L 3WO4B 3D25A 3O3EA 1QSEA 4RMWA 4HWBH 3LQZA 3TO2A 2YOCA 2EKJA 1NCCL 5HI4C 5DYOB 1FG2A 5E94A 2XA8H 2XPGB 2AJVL 3KLAA 2Q7YA 2PTTA 3V79C 3OXSA 3QXDA 4M1CC 1NEZG 4JG1H 1ZGLB 3GI9L 4NO0D 1FGNH 1UH3A 1M7DA 3T8XB 2CDEA 1A9EA 3MRQB 1L0YA 3KGRA 4P49A 1J5OH 3MRJB 2NNAA 4WTWA 4U2ZA 5D2LF 5GGSB 2LQRA 5DRXB 2CKBH 1LO2H 2F54E 2IQ9L 2NX5E 4GS7C 4HGWB 2Y23A 3WKMH 2DQFB 5L88L 3HB3D 3GSNB 5LG1A 3K8KA 3REVB 5T1MB 3FQRB 2QR0B 3QQ3B 1ODAA 3FFCE 4OI7A 2KH2B 3LH2H 4XBPB 2RB8A 1Z9MA 1ORSB 3V6OA 1JNNH 3VGHA 3C8DA 1YEEH 3BEWB 3QFJB 2GK0A 3FN9A 4FTVA 5KANG 2AJ3A 5GJTL 3RVUC 1A7QL 2XXMB 3BYTA 3MLYH 3ARFC 2HT4D 3O2DA 3QZWA 4WTXA 5DGQA 1RUQL 5CSZA 3WV0A 1GC1H 3T3PE 3RL2A 4RGMB 3HE6C 4YDJA 3RDTD 4QHNA 2J88H 2XT1B 1E6JH 4FQ1H 5J11B 5MEOA 5CSBA 3RVWC 5FECA 4QOKE 1BX2A 4PYHA 4NQDA 5JXEA 4L4VD 4MAYD 1MLCA 4FQQA 1QSFA 3ARPA 3WIHA 1CIUA 1LP9F 4FRWA 3SY0A 4JQIL 3RU8H 1A7RH 4HUNB 4GUPB 1N4XH 4HC1A 2B5IC 3ABZA 5HYSG 1N59B 3H7BB 2Y5EA 4Y5XC 1MH5B 2NY7H 4PJEE 2NY1D 5DJ2B 4OTXH 1UWXK 4HBQA 5F7HA 5DC9B 1WWWX 1IM9B 2B2XL 2D4FA 2H3NA 1F42A 4RFOL 4ZO7A 1AGBA 1J86A 5AZ2H 1RAMA 5HGHB 3HFMH 4XRCB 1ND0B 5FGRA 4YFEA 1LE9B 5LQBH 1T20A 4XP4L 3BD4A 5DEFA 3I50H 3GSVB 3MRKB 2YD2A 4H88H 4APQB 2BP3A 5JW5A 5ITBH 3C8KA 5C0ND 1A7OH 3MPCA 3OB0K 3WE6B 1BFOB 3JXAA 1EFXB 1I9JL 3DXAB 4OQTH 1E4JA 1WCBB 4CDHA 1B0RA 2AAVA 4IRZH 4PR5B 5CP7B 1ZHBA 5B4MD 4XCFL 1ZEAH 4O02L 1M71A 3WN5C 2CDFA 2IAMC 2H8PA 2VXQL 4Y1AA 1CL7H 3H8NA 3I75B 5E2VL 2PYEE 1FLTX 2MCPL 4GS7B 1UFUA 4XNMA 2BJML 5ILTL 2VITA 5L6YL 1RIHL 1I7UA 2DBLL 3LRSA 3G5ZB 1MCJA 4EUPB 2KUTA 2VXUH 1BREA 2DKSA 5TDPA 4TVSa 4XCEA 2YZ8A 4L1DA 5KVDL 3TNNB 4PLOB 1CDYA 2VDQH 3E3QE 4OLXH 3A6OA 4UB0L 4X6DB 4RGND 1T89C 1FJ1B 2YN3A 3IFOB 4MCYA 1XCQA 2EICA 3H9SB 2UVEA 4RISL 3O4LD 3NMEA 4FNLL 3MJ7A 3ZE2E 2WUCL 1Z3GH 5E8EB 2HG5A 3VXPA 2R1YB 4ALAL 5EUOE 4LLWA 4IJ3C 3UJIL 3ARDA 1HI6A 3M07A 4CVZB 2YHGA 4CRPA 3VWJD 1CG9A 3A6BH 2JTDA 5KZCB 3L5WA 1M7IB 3RWDA 3ARFB 4H0HB 4FXKB 5E08L 3HE6B 4L4TD 1XGRA 4JB9L 3HR5A 4EN3D 3CFKA 4MNGE 3OKDB 1ZHNA 4WHTA 1KCSH 4C56D 3HPJA 4XVUD 3VMPA 4K23H 2AI0L 3MJ9H 2EO1A 3CFEA 2X4TA 3E3QC 3FFCB 3MRFB 5DDHA 1NJ9B 3BOVA 1YEHH 4H25B 3KLHD 1EZVX 4MLSA 5AD0A 2B5IB 1JPGB 2WLYA 4WUKH 5E5RB 4Y5XB 4OZIE 1W0YT 3ZL4H 3CH1B 4L9LC 5F3BB 3S36H 5CZVH 1G7QA 1HH6A 2GQHA 1J0IA 2YPLA 4Z5RB 2XKNB 4F8QA 2WMPA 4R90H 2MHAA 1WIUA 1NKRA 5EUKB 4D8PA 4YE4L 1BJ1J 2LV4A 3NH7H 5E8NA 5HVFB 4K8RD 2WV3A 2CPCA 1I3VA 2H1PH 4LCUA 3ZHDA 2R1WB 2ZUQC 3Q48A 1LK3L 1NGZB 2R29L 4FQCL 3KPSD 4XCNA 4N0YL 2Y4SA 3O6KL 4YHKH 1G9MC 4GAYA 5E8PA 4J8RB 3VDBA 1CFBA 4N5ED 4PJBE 3C9NB 5GRXG 1R5WB 4HKBA 2AEPL 3PHQB 5SWSD 3LKRA 1IVLA 2BXYA 3WN5B 4PJEB 1QFWL 2GAZB 2DQGH 2IAMB 2FEEI 5J89A 3QXAA 4F7TA 1ZLSL 1NBYA 1P9MA 4PLKC 4BFIB 5FYLD 1F90H 5BQ7A 3ULUH 4RMSA 1FNFA 5I1AA 2GJ6A 5GRVL 3GNML 2IC2A 4I0PC 4RAUB 3JWOL 5BZWB 3MA9H 2CMRL 3BESR 4GW4B 1A1OA 5F44A 3NA9H 5FV1L 4ONFH 4L8BA 3MV8A 4DZ8B 5F1SA 4CJ1A 3IXAA 4AM0A 5IV2B 3EO1A 4DW2L 1O5DT 3ZT5A 4X80H 5B39B 2FLBT 3QIBC 4YNYB 3N06B 1IM3B 2ZCKL 1H8NA 1TIUA 4IJ3B 1JMZA 5C09E 1ZT4A 3MLXH 3PP3H 4YGAB 1MHEA 5BW7C 5EO0A 5ID0A 5J6GA 5E95B 3HZMB 4XAWH 5AAWA 4YIQB 5DMGD 4GKSA 3UZEA 3IFNL 1TJGH 2VDOL 5CEZD 4ODUA 2E5EA 1KJVB 5MENA 4A6YA 1JGLL 3LSOA 4GRMB 3L6FB 3EHBD 4HJJH 4Y19D 3AB0C 1UVQA 3CD4A 3QPQD 1R0AL 2VLRD 2XWBA 4G43B 5LGJA 3RI5F 2EXWC 2OR9H 1DEEB 3V4UL 2BFVH 5AUMA 1YYLL 1CI5A 4U6VH 3ZMRA 1KULA 2GJZB 3MRRB 3MOBH 5HJ3A 4Z77A 1TVHB 3TO4A 3SBWA 1HOCA 2X4RB 5DHYA 3BRGC 2VC2L 3RQ3A 3MRLA 1HNFA 2YA1A 3CC5B 4NRYB 3WFHB 2AEWA 5TGBA 1A1NA 5D1ZA 4L9LB 4PJFA 4IHOA 4MB4A 4GMTH 3GMOB 4TUKH 2R0ZH 1QG3A 2Y06H 3KPOB 3GMMB 1IGYA 2JLLA 4K9EL 3DTXB 2ZNWA 1IAIL 1UH2A 1J9CT 4NM4L 3MRDB 1G7JA 5IB5B 4MNGB 3VXME 4U49A 5EC1B 5IWLA 4YO0B 2WZPD 1YNLH 2VDML 4ZXBD 3MR9B 5D1XA 4P2QE 2OJEA 4L4JA 2KKQA 2D7OA 3C6LA 1MREL 3IFLL 3WHXA 1NCCH 3KPLB 3PGFL 1JGUL 2AJVH 2GTWA 1DZBA 4M5YL 4XPBL 1YY9D 1FN4B 4KJQC 4PREB 4HUWB 1S7RB 3MMEA 3UYOD 4MAUL 2X9WA 3GI9H 2AEQH 5ISZB 5J1SC 3ARXA 3FN0L 1TJIL 4V1DA 5GGRY 4KJPD 1U8LB 4DGVH 5CGYC 3LS5H 2HWZH 5D6DA 4UV7L 2IQ9H 3D2UB 3GSXB 2RQ8A 2FX8L 4I0PB 5T1KA 2DJUA 2OL3L 5L88H 3CMOL 1I1YB 4GRLD 5IVXA 4PJ5D 5D9SB 3PL6C 1IGIL 2BC4A 4IOFD 2VIRA 3I6GB 3MUGB 2DQDH 1UB6A 4K3HA 1WJ3A 5T3XH 3PDOA 4EUPH 3QIBB 4J4PA 1IT9H 4LQFH 3VFVA 5BZDB 5E9DE 1WQVT 2P46B 3C5ZC 4HGMA 1RK0A 5CJOL 4X6BA 2E6QA 4MJIA 1VENA 2IADA 3TN0D 1EAPA 4P3DA 5KSAA 1A7QH 1BLNB 4UNVA 5DJ6B 5KANI 5I9QC 3MFFB 1RUQH 2DQJH 2Y7QB 1SY6A 2H32B 3QEGH 1UJ3B 4MGXA 3AB0B 1DE4B 5E8OA 4ZNCD 5BOZG 3FQWA 1ADQA 5EPMB 2BOCA 1HH9A 2E6PA 1OLZA 2HRLA 2WIIA 4LHJB 1I3RB 2AP2A 4N8VG 2X4UA 4KKAC 3C08L 1CLZH 3FO9A 3G08B 3JVGA 5DURB 4HMCA 4FQXD 1AXSA 5T3ZE 2VTFA 4PY8I 1FZKA 4PGEA 2ITCB 4XPTL 3NBNA 3FQNB 4FHBD 4L8SA 3O8XC 4LSSL 2BNRD 4JY4B 4NGHL 4PP1D 2VNCA 1U58B 1U8HB 1I8KA 2HLAA 3FAWA 5GRUL 1SJHB 1KENH 4LOUD 3O9WD 3KPPA 1JNLL 4W70A 2FJGA 4Z76B 4RWHA 2DJSA 3ZDYF 1UWGL 3MRCA 4UNTA 5KSBA 5IHBA 5C70A 1HILB 3SKNB 1I3UA 3TP4A 3OZ9L 5SWZE 3MREA 1P4IL 1KT2A 2VWEC 3A6CL 3QDJB 3LKPA 3TA3A 2X5PA 3MV9E 1NFIB 4HCRA 5CUSL 4HH8A 2R9HC 4IDJL 5E00B 2EH8L 3DGGA 4CBPA 4HWNA 1SYSA 2QTEA 4JFHD 4S0SD 2DL9A 1I9JH 2YN5A 3JWDC 5EU6B 2VKXA 1OAZL 5DHVA 3AVEA 5KVGL 1Z9SA 2W91A 4O02H 5GZNC 3IGAB 5I73C 5E2VH 1N0XL 3WYRA 4NDMA 3VXRA 4RA3A 4JZNA 3EBAA 4NUGH 3IFPB 4K7PY 5FUZH 2ZG1A 4P4KB 2BJMH 4MNQE 5ILTH 3QEQE 3TBTB 1RIHH 5L6YH 2KBGA 2HFEB 2D2OA 4MVBC 1YN7A 4JKPH 4LPVA 5ESAA 5EWIL 5C0CD 5ID1A 2ADFL 4OF6A 1LEIA 2E9BA 3QO1A 3B2UC 3PL6B 3W81A 1CXEA 5KVDH 3AC0A 5GRWA 1A1MB 2Y5TB 4UB0H 5K9QG 3E2HC 4R26L 3CZFB 1KN2H 4X9GA 3RVXD 3SDCD 4RISH 5IB1A 4JZOB 1TZIA 4Z78B 1QACA 4BUGA 2WUCH 4ZOAA 3C5ZB 2X4OB 2N7AA 4LLVB 4ODSL 5E2UL 4EIGB 5MERB 4AIZB 1XF3A 3UJIH 2R4RL 2VZUA 2J12B 4YX2L 2C9AA 3SGEI 5JPNA 1MOEA 2Q3AA 4OZFB 4NBXB 4P2OD 3MLWH 4N1EA 4X6DF 1MVFA 4M6AA 5I9QB 5LBSH 4GMSH 3LN4B 2HP4A 5E08H 5MP6L 5FYJD 4JB9H 1D7FA 1C5BL 1N6QH 5JORA 4JKKA 3O3BB 3TC9A 4M6NL 1ORQA 2ESVA 1CR9L 5C0FB 5E1HB 3KYMA 4MMZC 3MTRA 3P0YL 3PNWB 5KOVC 4PY7A 2AJUL 2VYRE 4M7ZC 1SMAA 4X9BA 4OF0A 2D7PA 2VZSA 2DLEA 1TLKA 2F53B 1CDHA 5E9DB 5JDSA 1YMMB 3A67L 1KSRA 1A6ZB 5I1LA 1QRND 3O8XB 2CIKB 3T1FB 1UYWH 2Q8BL 4S2SA 5KJRL 2NLJB 4ONHB 3ES6A 5DK2A 4RGNE 4M5ZL 3QHTC 3BZFA 3LPGA 3O4LE 5DJ0B 1K8DA 4OZHB 4DZBA 4UMGA 4YE4H 2VLJB 4Y16C 3GMPA 4H0IA 4G8GE 2WWMD 4ZUUB 3ZLQC 2B39A 2PNDA 4XNYL 2OK0H 4E5XA 5CFHA 4FQCH 3F12B 4N0YH 2D31B 3O6KH 2PW1B 3D0LB 2JB6B 2EH7L 5E2TL 4L4TE 1G9NC 4DOHE 2AEPH 1KF9B 4NUJA 2CIIA 3SDXE 2BDNL 5I73B 4MA3A 4AL8H 4C56E 5IMLA 3SGJA 3CSGA 5ETUB 1ZLSH 2KPNA 3ARFD 3HE6D 4PRHB 5EULV 5FF6B 1CD1A 1E4WL 4L3CA 3CCHA 3OKKB 3D3VA 1T83A 3HRZB 1QLEH 1HQRA 3GNMH 4XNXL 2FX9H 3ULVC 3RVWD 3MJGX 2WQ8A 5IIEB 3HMWL 1EZVY 3F7YB 2VXSL 5SWZB 4PJEF 3E2HB 4HKJB 4PJGA 4YDLB 1MPAL 1CXFA 3K1KC 2O5ZH 4HT1L 2ERJC 2IH3A 4R2GD 3L3DB 4OLEA 4XCYB 5I2IB 2ZCKH 3RNQA 1W0WA 3MO1A 3QQ9D 4HMDA 4XGZA 3WEXA 3BO8B 3UO1L 4JHAL 4U1NA 1AKJB 4Y4HC 4BQCA 4YDKL 3WS6A 4AZ8A 2BVQB 2VDOH 1T7VA 4ODTL 2J6EA 2Z0BA 1TETL 4MNQB 3L3HA 3QEQB 4HH9A 4LCYB 1HINH 3GSQA 1OD9A 1S9VA 3RNKB 1R0AH 4I5BB 3V95A 3V4UH 1YYLH 4JDTL 1CN4A 1CZ8L 4NO3A 1KG0A 5HGDA 4NKIH 4M7ZB 3LPFA 4ODXA 4C4KO 4KJYA 2EDTA 2Q86A 1RZJC 3T65B 1MFAL 5EZLA 1DBJL 3W11C 2VC2H 2VLMD 1LE5A 3LKOA 2AV1A 1C08B 1I9IL 3RKDC 5GQBA 1EHLL 3ARDC 2YD5A 4G42B 3L5JA 1JPFA 2IAMD 3CDGA 1JCKA 4XAKD 4YPGA 1T3FA 4NZTH 2BY1A 4TSCH 2Y6SC 2OCFD 4K9EH 2ATPA 4NQCA 5CGMA 4PV9B 4R4FH 4PV8A 1IAIH 1ETZB 4NM4H 4K8RL 5TF0A 3ZE2F 4Y16B 2P24A 4G7VL 1FFOA 2VDMH 4ORGB 5EO1B 4KZEH 2Y9RT 4HGKC 5EUOF 4Z0BL 4OZGE 1CK0L 1MREH 3IFLH 3BZ4A 1I85A 1KPRA 3PGFH 1JGUH 1F3DJ 3GMNB 1A5FL 4M5YH 3U0WH 4XPBH 5D2NE 3RY4A 3IXTA 4QCIB 4PB0L 3BQUC 3WS3A 5CEZE 4CDGC 4ERSL 1E28B 4Z0XA 4MAUH 3LN5B 3VG9C 1AQDB 1U8KB 5DMKB 5FB8B 3T3MF 3GJFA 3TV3H 5FYLL 4U6XB 1UH4A 5FDYA 1U36A 5A3IC 3CX5K 4WY7L 3K74B 4QRRB 3OR6B 2AK4E 4UV7H 2JK5B 3MBEC 1BIIA 5I1KL 2FX8H 1T7YA 4G8GB 3I2CL 2NYYC 1YJDC 1OOAA 1IGIH 2MQCA 3BDBA 5DWUH 4M7LH 4PD4J 1MRFL 2ERJB 3PQYA 2R2HB 2P8MA 2ICWB 2YSSA 4OD2B 5ABDE 4XMPL 5F3HA 4MSWB 1AD9B 2HLFC 3PP4L 4U1MB 3SDXB 5MHSE 1I1AD 4Y4HB 5CJOH 1OW0C 2QV2A 3MCKB 5J9PA 1T1ZA 1FE8L 5CEZL 4AT6B 2R2BB 1P9MC 4JY6A 3EYVA 2V2WB 4LQ1A 3D6GA 1BVKB 2YRPA 1P5VA 5CGTA 5LVEA 3P4OA 1F2XK 5C0DA 3X14A 3UXFA 2RCSL 4LPYA 3DX7A 3PABB 3C08H 3RY6A 2GCYB 3S36X 3H9HA 1HHGA 2EEBA 5CMAB 5ERWA 1D5ZA 4LCWE 3BUYA 4QYOA 3C60D 4GFTB 1K5NA 3EGSB 4M48L 2QL1A 4LSSH 4NGHH 1EHXA 2E27L 1ZKAA 3U9UB 1F6FB 2BY3A 5DJDB 5FO9A 4L3EA 1C12A 3T77A 4PLJC 4PLKD 5GRUH 4IMKA 1X5YA 4HIJA 4PJCE 3QEUA 3DV4A 3D2UD 3KPQB 3PWNB 4I0PD 1IGML 1NAMA 1GOHA 1MJ8L 1YC7A 1YDPB 2CLZA 1JN6B 3A6CH 5HGAA 1YNKL 1R3JA 3IDMB 1KV3A 2IEPA 5CUSH 3BQUB 1DBBL 4IDJH 4OCNC 4ZFOL 4R4BB 2EH8H 4Z7QE 1JWSB 5FA3A 4OF8A 1IE5A 2DMBA 4FP8H 4OFYD 4HFUL 4KTYA 1T5WA 5GRJH 3TBYB 3VG9B 1OAZH 3KAAA 5KVGH 1KUMA 5J1AB 4IRJA 3UBXI 1N0XH 3G6DH 5F7UA 4K3DL 3QUYC 1CDIA 1WAAA 2ITDA 4LPTA 3K2UL 5EWIH 3C87A 3MYZA 2ADFH 2CR3A 4NRXB 1NC2A 2Z93A 4OZGB 1N64L 2BNRE 2VDKL 3JV6A 4HZLA 3KWWB 2VLLB 3CVHB 2VERN 1PKQE 4HPYH 5GJSL 4HIEB 5DURD 4NRZA 4G6ML 5K9QI 1OP9A 4Z7WB 1NMAL 4H20L 2COQA 3HC3L 1QO3B 4LHUA 4ODSH 3R1GL 1BBDL 1XH3A 1P7HL 4ZAKC 1T5XB 4K94C 4YX2H 1S9KC 1XIWC 1KTKE 4FA8A 4D0CB 2AK4B 1CFSA 4E41D 1D9KA 8FABA 2OQJA 1C5BH 3QPXL 1SJEB 3KYNB 4LVNC 1MIEL 3S4SB 2XWJB 3HMXL 4I48A 5FO8B 3ARRA 3P0YH 2VO5A 4CNIA 4KMTH 5JNYA 3KPRA 1YPZE 3BKML 2WINA 3QDJD 2AJUH 4ZS7L 4JQXA 1CICA 4H8WL 5C71A 1MCKA 5TE6L 4KJQD 4ZTOL 1GRWA 1IAKB 3P4NB 1K2DB 1OB1B 2PTUA 3A67H 4GLRH 1D6VL 2VABA 5FDWA 3C5JB 4NQSB 1KYOJ 5C0CE 5I1HL 2Q8BH 5CD3B 2APXA 3G9AB 5KJRH 4WW2A 4PJXE 4YHOL 3AREA 1IZJA 3OPZL 4I4WA 4OLYL 2V7HB 4M5ZH 2BVPB 1A2YB 1D5IL 3TBSB 1G7PB 1S7QA 5F7EH 5C0BB 3PL6D 2EEDA 2PCPA 4KXZI 2IALA 4XI5C 3SOBL 2YS4A 4XNYH 3IJHA 4FZEL 3U6RA 5EU3B 4L8DA 3UDWA 3ZKXC 4O4YL 1C7SA 4PS4L 2EH7H 4UDTA 2AQ3A 4HMEA 4LCWB 1T0MA 5FYJE 4L8SC 2E9JA 3C5ZD 2D9QB 1A4KA 3RWEA 1KXTB 2O5XL 3MRGB 1BECA 1FCCA 1IEAB 2BDNH 4PRAA 4XPHH 3FO2B 3EYFB 4DVBA 1S7UA 2N56A 5B38A 1YEGL 1DR9A 2W9DH 4NQEA 1V5JA 4OUOA 1NDGA 3QUYB 5CLTA 1IC5H 1U8QB 4EXPX 4WU5A 3CUPB 3MUJA 3OF6D 1E4WH 1IGFL 5HYEA 2B1AH 3C2AL 3DRTB 3VGGA 4N0CC 2DTSA 3OKMA 4FMFA 1EEZB 3HMWH 5ACZB 3AU1B 2VAAA 2VXSH 1WC7B 4UU9B 2V7NB 4S1DC 4KKAD 5I18L 1MPAH 5C0IB 5JHLL 2FNBA 4HT1H 3KXFA 1MEXH 5K59E 3E6FB 5HYQA 2OX5A 1YMMD 4MDIA 3NFPB 3CMGA 4PJ9C 3NVQA 1D6EA 3IDXH 1LMKA 1FYTE 3QI9C 4ZAKB 1XIWB 4PB9H 1MIML 3PUCA 4YDKH 4WO4D 5ACMA 5FYJL 3MOQA 4ODTH 1TETH 3WFEH 3RIFF 1MCRA 2WWKT 5SWQA 4LVNB 5DSCB 4X6CA 4WW1B 3V0VB 2VLJD 1TZGL 4LBEB 1A9BA 4AIOA 4KUCF 3RWCB 4DUXA 1INEL 3QULA 1FL3B 1UXWB 1LD9B 4ISVB 3QUXC 4EI6B 3IDGA 1E4XL 4JDTH 1MCNA 2A38A 1I7ZA 5TDNB 3VXSD 5ESVB 3P30L 4JZJA 5A1AA 1MFAH 3WIFB 4A2LA 1P6FA 1ZLVH 1GH7A 5JOEA 1WITA 1S7TA 4DFIA 1EHLH 25C8L 5D1QD 4QLRA 4ZQKA 5DUBA 2XRAH 2DF3A 3LKSB 3ROLA 5EA0L 5CIPA 4PRHD 4K8RH 1A3QA 1KEMH 1MCPL 1QSED 1JHTA 4GW5A 1INDL 4B7IA 5GGRA 3KLSA 5HD8D 2XWTA 4MB5A 4JFDA 4N0UA 5DHXB 4YR6A 3W39A 1YEDB 4Z0BH 3MZGB 1CK0H 3X11A 1YPZB 2F74B 5I1DA 2HN7B 4MZ3A 3ZKXB 3GSOA 4PB0H 1XR9B 2DM4A 3CAFA 4CL7A 3UBXA 3LIZL 1Q8MA 1HXYB 1UXSA 4G9DA 5HHNA 2BK8A 1I7RB 1FVEB 3HE7A 1N5AB 1RHFA 2XNAB 4JPVL 4JFPA 3RHWF 5AEAA 3P4MB 1NGQL 5I1KH 4QF1A 4N5UA 5D96C 1EXUA 1JTTA 1NFDE 3NTCH 3OR7A 3HAEA 4I2XA 3GBML 3K7UA 3G5YA 3I2CH 2X89A 2YPKA 4JFEB 4LCCA 1NMBH 1D5MA 5FKPA 3P77B 2HA1A 2X10A 3G6AB 5HPMB 1WBYA 4QRPA 3QNXB 4D3CL 3K4ZA 3RTQC 1CGSH 4XMPH 1QPXA 3U4EA 4PJ9B 4WEMB 1J11A 5DJZB 1P7QB 2BSRB 3PP4H 1KNOB 1W0VA 3O45B 3QI9B 4FTVD 4X9IA 5L2KE 4N1HB 5FM5O 1JBJA 6CGTA 1E27B 5CEZH 2P8PA 7CGTA 3FB5B 1CTNA 4GT7A 1KXQE 4ZUVA 1FNGB 4X6EA 4DCQB 3O2VL 5BXFB 4XP5L 4Y16D 3MRNA 2FO4A 4NQDD 4NBYB 4LKCB 1QVOB 3QUXB 4NN5C 1QSVA 1CGTA 2EE3A 3SDXF 1QSFD 4F37F 1FIGL 4YHIA 1BOYA 1WBXB 2H26A 5EOTA 5C0JB 2PW2B 1MFBL 3ZE1F 2VQ1B 3BH8A 4JM2A 4Y8DC 2BRQA 5IW1B 1U3HA 3MLUH 2RBLA 4M48H 3RWFB 4WV1C 4PJ7A 1MCWW 3TPUB 5J4MA 1NMCC 3DNKA 1MUJA 4RNRB 2E7CA 1EJ6A 2DMKA 4MX7A 5C0RL 5TJWK 2EYRA 2VH5L 4YXHH 3V6BR 2VN7A 43C9A 3MRBA 4LFHG 1R3KB 1XR8A 3ULVD 3RWIA 1IGMH 3QUMB 4HIHB 3OKEB 5B21A 4KTDH 1L9NA 1HE7A 2W9EL 4MA8H 2FX7L 1MJ8H 3VRLF 5H35A 1NCWL 4OGXL 4MJ6A 2W0LA 4XP9L 5DFTA 4HIIA 1CLOL 4Y2DA 5DJAB 1EGJH 2LVCA 4XH2B 3S97C 4DKFL 5C6TL 4HFUH 3QDMA 4U05A 4Y1AD 3LV3B 4LAJH 4ZD3L 4MD4A 1HHKA 1EVTC 5EDXA 3DO3A 2V2XB 4G6KL 4ELKA 1AD0A 1ZGLP 4DK6A 5D96B 1LO5A 1MCEA 4M61B 4P9HC 1Q9LB 3K2UH 3GMRA 1CE1L 4P5MA 2MPAL 4M6OL 1MLBA 4G6FB 4XBEL 3SQOL 4HW6A 2VDKH 2ZSVB 1AO7E 1MAJA 4OQ1A 4F3FB 1NEZB 2FRGP 4GBXC 5F7WC 2PYFA 4WWID 4QHLB 5GJSH 4HPOH 3RTQB 1K9TA 4FQJH 3W11D 1NBVL 1XF4A 4G6MH 1NMAH 1VESA 3TFKD 4NJ9L 4H20H 3GM8A 3RKDD 4R6UA 3RUGB 1LDSA 3ARDD 3OJ2C 5DFWH 2R69L 3D69B 3P9MA 4JVPA 2NY0C 1RK1A 1BBDH 1KB5H 4UQ2A 2Y6SD 4OZGF 3VXNB 3I9GL 1PY4A 2DQCL 1XGPB 3X12A 5F72S 4OKDA 1J05A 3NZHL 3GJEB 3ARGB 2ZUXA 3MRMB 1G7IB 3U7WH 2X4PA 1WIPA 4Z7WF 1MIEH 5A16A 2P5WA 3CK0L 1FHGA 4NN5B 4JO4L 3HMXH 1KC5L 4Z7OF 1GCFA 3MLZL 4Q6IA 5MEPA 3MNZA 1G1YA 4HAGA 5E6IC 4PTTA 1NANH 4ZS7H 2N1KA 3VG0H 1D5BB 2W59A 3MXVL 4OKVB 3BQUD 1CDGA 4LDEB 5KS9B 3I3DA 43CAB 2GJJA 4ZUTB 4YUEL 5HHXL 1F11A 1VACB 1D6VH 4WV1B 2NY5L 1JL8A 2Z8WC 2XKUA 5GGSY 1QRKA 4YWGL 5I1HH 1NMCB 1VGKB 4P4RB 3RWGB 1LEGB 1NC4A 4XTRC 5A3ID 4WEUD 5IM7A 2AJSH 1RZKH 1A6UL 4WCYL 2I07A 2A9NH 3MBED 5CJ8A 3PWJB 5I16B 3SJVA 1JV5B 2ZJSL 2HTLC 4ZFFA 3QDGB 1WCQA 2NYYD 4FQIL 1KTDA 5INCB 1S9XA 5EU7E 4FZEH 1H3XA 1BP3B 5FGSA 3ARBA 4XC3L 4WU7A 2F5AL 5D8JL 2FIKB 4CAGA 5CEXB 4RA0C 5HYSB 1F02I 3FTGA 2C4FU 3LHPL 1CFNA 2EIZA 2Z8VC 1PKOA 4U7KA 2MKWA 2O5XH 3MRHA 5KG9B 1K4DA 5H94A 4N8PA 3UPAA 5JLZA 2OMNA 4RRPG 1HHHA 1A3LL 4GXUM 3UJTL 1YEGH 3S5LG 5J6HB 2ZPKL 3BN9D 4ZPTA 3QHZH 4O51B 3KPMB 2EDOA 3VXOA 5A43C 2CDGA 2W60B 4I77L 2DDQH 2GJ6D 2X1PA 3D85A 3QWOB 4UT6H 5TQ2L 1P4LB 1IGFH 1JUFA 4NM8L 3MV7E 3JTTB 3DX9A 4LSDA 1JVKA 3DV6A 1UT9A 4RDQF 4GBXB 5I18H 4N68A 1WFTA 3EDEA 1XAUA 2WBJA 4CMMA 1I8MA 2BNUA 3FKUS 4AG4H 5E7FA 2V17L 2QSCH 1EBPA 4LDLB 4NHUA 1CE6B 2XZAH 4U6HA 1U95A 5DEGA 2NY0B 3MZTA 3PIQA 5DD3L 5IOPB 2G9HA 1XFPA 2E9IA 4PRBB 4RFEA 3OL2A 2FZ3A 4FN0A 3TH3T 4HZAA 5FYJH 5MEND 5IHZB 3DIFA 4AENB 2ARWA 2XZCL 1B0GA 2EECA 3BPLC 4Z7QF 3VE0B 2XG5A 1DFBL 1SM3L 3OXRB 2W92A 4IS6A 1TZGH 1T21A 4F9PA 1INQB 5FM4A 3SN6N 4FZ8L 3DYPA 5KVEL 1ED3A 4OCWL 3P73B 4FMKA 1M6OB 5E6IB 1AO7B 5C2BL 5GS2H 1PQZA 3DLQR 4PG2C 1RJYB 5FM5M 3TO4D 1QOKA 4WUUA 5T5NG 3P30H 3V9FA 3S9DB 2YD1A 2EC9T 3O6FA 5FYKU 2NR6D 1Q9WB 1OAUL 5TQ0L 25C8H 1BD2A 3PE9A 5TE7L 3UTTA 4C83B 1UZ8B 3JV4B 5JOPE 1YA5A 3FCTB 3O3DB 2GT9A 1EDQA 2A6JB 5BO1L 1JPTL 2UWEB 4AEEA 3SE8H 1WVZA 1HEZB 2ZZUT 1NGYB 2EDKA 2DIBA 3NZ8B 1WZ1L 2OL3A 3IJSB 4KY1H 3RAJL 2EDHA 1EJOL 4H1LA 3Q6FA 4GH7B 2IPKB 1WK0A 4PJDB 1KGCD 3OTTA 2D03L 1K8IA 2VLKA 3LIZH 1XF5A 1DQML 4JFFE 3S37L 4JDZB 3QXTA 5LAXA 1XIWD 1FZMB 3NGBC 3LAFA 1YPZF 5ACLA 1A3RL 4M7JL 2P42B 1S8DB 4JPVH 1IGTA 5T1KD 5D7KE 5J12C 3N1PC 1NGQH 4LRNL 1QNZH 3IKKA 1J1XL 1NCDH 3MNWB 1BMGA 1JPST 3QJFB 3GBMH 1AC6A 1CF8L 1RJLB 1T1YA 1JF6A 2YUZA 1ZT7A 1XF2A 4X99A 5ANMA 5DQJA 4Y88A 4LVHC 4D3CH 5JPMA 4CW1A 3AAZA 3EDJA 3M1BA 1BFSA 4CVUA 1EHAA 5EU4B 3MRIB 4YHYC 4Y4KA 4HK3N 4PG9A 3C2SA 5DC0A 5KSAD 3QJHB 32C2A 3VFNB 4I18C 3AFLA 2F8VA 3OGCA 1KIUA 4PBXA 1U8MA 3BPLB 1HZHH 2GFBB 1IEHA 1AGCA 4HG4J 2VAJA 1CXIA 2BMKA 2ICWJ 4HKXB 3O2VH 4XP5H 3LKNB 5M95B 2GITA 2R15A 2XN9A 4EUPG 4OFDA 4EDXA 2XQBL 4GRWE 4XI5D 5ICXB 1FIGH 2G75B 5I76B 2W0FB 3JBG7