2VC2H

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
221
structure length
219
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 45
structure length 219
sequence length 221
ec nomenclature
pdb deposition date 2007-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vc2H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vc2H02
2Q7YB 3FB6A 3HKFA 3S4SB 3CIQA 5B8CB 4JM2D 2EXYC 3LB6D 5INDB 4F2MA 4AM0A 5DFWH 1QTYT 2P5ED 1N59B 2MTPA 3PG2A 2QR0A 3HUJB 3VXTA 2P46B 1IC4L 2QEJA 2YBRA 1MNUL 1A2YB 3UAJC 1Q0YL 3IGAA 3QHTC 3OGCA 3VFOA 2YWYA 3AMKA 3DV6B 1OP9A 2GJ6B 3SO5A 4Q9BA 2VDLL 1YEEH 5EUKB 3UZQA 5DK0A 3DOSA 3LKOA 1UADC 3MGAA 4Q58C 3OHXB 2OK0H 1CGSH 1I7ZA 4Y4FB 4C59B 1OTTD 1JF1A 5EU6B 3MRBB 3T3PE 3A67H 4LOUC 4NFCA 3MPCA 1MY5A 3OR6A 4Q6YA 1MCQA 4X0KB 4EI6B 4JAMB 2AABL 2X4OB 4DWHA 3BP7A 4YEEA 5EU5A 2ESVB 2EXYD 5AZEL 3R06B 4Q6IB 1I7UB 3UTSD 5GSRA 1KIPB 2ITDB 3ES6B 1QLEL 1E4WH 4XX1E 3FQUB 1HH9B 4F33B 4LLWB 3HHRB 4Y88A 3SGKC 1QKZH 2EDFA 2HRPL 1DBJL 3WO4B 5D1ZC 3S36X 3UAJD 5TFSH 1XF1A 1TQCB 3CK0H 5F7WC 2Y5EA 2EDOA 3ZHLA 4HWZA 4RISL 1ZOXA 4N0FB 4LVHB 2DN7A 1U8KB 4NFDA 3GSNL 1QBMH 4GRMA 4J6RL 4NNYA 4XPFL 1I8KA 3MMEA 4R7NB 3DECA 5HGBA 1BAFH 3GJFA 3O4OB 4PJ8D 4LOUD 4ELMF 2R69L 1G7QB 4FNLL 2ICES 2NY2B 4LRIC 4QTIH 5CZVH 1UWEL 4TYUA 5D70L 1KJVB 4QRSB 3JWOL 7FABH 2VL5A 2DQJH 1ZT7B 4XMKL 1E27A 3OKDB 3REVB 3N0PB 1AI1L 2B4CH 5T1KD 3QQ4B 2DLIA 4QHKI 3RGVB 5JW3H 1GGIH 3AB0B 3GHEH 1QVOA 3QIWC 4PJAF 1GIGL 4JFDE 1MUJB 5LBSL 4YHNA 2DLFL 4C57C 5D1ZD 1SJHA 2A74A 3U6RB 3QULB 2ZUVA 5L88H 4S10A 1JPTL 2NW3A 5DURD 5I1JH 4MWFB 1NCUA 4KZEL 1DANT 3LOWA 4CMMB 5HHOA 3ARZA 3MREB 5CBAB 2APVA 5I9QB 3RUGA 2VABA 3BVNB 4BJLA 4JVUA 3A0OA 1P7KA 3FQWB 4J3TA 2X09A 1X4ZA 4W6XB 3L5IA 4UIMA 4OQTH 5F44A 2E9JA 4FQPA 2RCSL 3BIBX 4XNZC 4PR5B 5T3ZH 2IPKB 4NJAH 3HZKA 4PJDF 1YEHL 5GGSY 5D7IB 2XA8L 1I85A 1Q9LA 2GY5A 3K74B 3QIWD 4HCRA 2VAAA 32C2A 3VXQB 5BW7C 2X4PB 1PZ5A 3M17A 3O3DB 4HWUA 5GRVL 2AK1L 1FRGL 1OWRM 1AGCA 2A83B 1U8NA 2VDPL 1QRNB 4L5FH 2HG5A 1HXYA 3OG6B 3WNMA 5HYFA 3ULUH 1BVKA 2X7LA 4X9HA 3BGFC 2A6JB 4PG9A 2AEWA 3W0WB 1ZVHA 2EDTA 3KLAB 1QHOA 1OSZB 3EKCA 5ICYA 2AJ3B 4XBEL 2X70A 1FSKB 4M5ZL 2EDXA 4DUVA 1BD2A 1UT9A 1S5HB 4OM1H 5IK3B 4LSSL 3OXRA 3AAZA 2DQTL 5LGHL 3VXOA 3B9AA 5E1HB 2Q86B 3W2DH 4H1LH 1S7VA 3MRKA 4ODSL 4AH2A 3MNZA 4P2QE 3VMOA 6FABL 3F65A 5EORL 3EYOA 2PXYA 3O41B 3UJJL 4JFQA 4J4PC 2O61B 4RGOH 4KJWC 5CSZB 5ANME 4RCAA 4HUUB 3LKSA 3CH1B 1TVHA 1BFSA 3C6SB 3I75A 5GRUL 1F4YL 3HE6B 4BSWB 1VFAA 2R0LL 3FONA 5JW4M 1QA9A 5C0BA 3FB8B 3REWB 2XTJB 5FF6B 2R23A 5E9DE 1Q72L 4MJIE 4NFBA 3C60C 5E2UH 5AYQA 4H8WH 4JE4B 4ZQKB 4D0BA 5F6IC 1MFDH 2FWOB 3MJ8A 1RULH 4KI5C 4P2CG 5H35A 1CU4H 1RIUH 3KYKH 2J8OA 2EIBA 2X1XR 2HRLA 5DTFA 1KV3A 1PX3A 4LSQL 4CW1B 4HKBB 4F58H 1MHCA 3C9NA 3QG7L 1YN7A 1HI6B 3KPMA 1N5AA 3G6DH 4NM8L 4J4PD 5IBTH 2CPCA 4KJWD 1BF2A 2EDYA 2P5EE 4G6KL 4XPHL 2OMBA 4TRPH 1AGDB 2A1WL 4JRXD 4P5TB 3DLQR 2H1PH 5HHVL 3GGWA 5EN2A 4HGMA 3TT3H 3ULVL 4F8TA 1OT2A 2YHGA 2XZZA 4YNYB 4ZXBB 4Y5YA 4PJ9A 4XP1L 5E2TH 1ZT1A 1KCSH 4IRSA 3C60D 3BN3B 1RUKL 3LEYH 4PJEA 2LV4A 4OZGB 5ALCH 4NRZA 5K9OA 4JCMA 4N1HB 1DJSA 2BY2A 2Y7QA 3NH7L 4MNQD 5DRWB 5E5UB 3T65A 4BFIB 3NZ8A 2DF3A 1JWMB 4H25A 4QGYA 5JTWA 3VFNA 4KI5D 3OGOE 2LTQB 1YMHA 1G7LB 3KPSB 1JWUB 4LAQL 2AK4D 3WIHL 5I1GH 4CNIB 2WWMC 4X98B 4DK6A 1KJ3H 15C8L 4WHTA 3SKJL 1K4DA 2V7NA 2DQFB 2D03L 2YS4A 1NDMA 3KJ4C 3UTSE 5IMMA 2YMXL 3G6AB 3M8OL 1KUMA 1I1RA 3NFSH 4PJXF 3SKOB 3TWCH 3P4NB 4OD2B 3GRWL 4JKMA 3D18B 4G8GD 4HC1H 4HKJB 5IMKB 1S5IL 3MROA 3PP4H 3MXVH 1ADQL 5GRXG 4FQ1L 4EUPB 4FQLH 1ZVSB 3QJFA 1MI5A 2PTUA 1INEH 3ARRA 3NCYS 5CP7A 3E2HB 5E8DL 1I3VA 1VCAA 4P99A 5FOBB 3K4DA 1FL3A 4DN4L 3QIBB 4Z78A 2ZUQB 5HI3C 4BKLB 1T7YA 1XR8A 4WV1A 2M8XA 4IIQA 4HUWB 3BDBA 3KLDA 4O4YH 4Y1AD 5EZLA 1IAIL 1J5OL 4L3ED 4Y19B 2ED8A 3PL6B 1NANH 1LVEA 3D3VB 1A14L 3ZKXB 4PJ7B 4DJMA 3MV9A 2WWMD 1U8PA 4DGIL 4KVNL 3WNNA 3C2SA 4HLJA 4N0UE 2HKFL 2P49B 1NCAH 5T1LA 4RNRA 5JLZB 1K3IA 4FQIL 3ZHKA 4ETYA 1V5JA 3H9YA 1BGXH 4U1KA 1WVZA 4POYA 1KTDA 1M7IA 3TIDA 1NUFA 1HINH 4TUJB 3BJ91 3UPRA 4Z7WA 3WN5C 4TNVK 5CP3A 2X40A 4FTVB 1XEDA 3ECBB 3TO4C 4CKVX 2IG2L 1TZGH 3D69B 5DD0H 5EZIH 3T2NH 1YEEL 2I07B 3HS0A 2ADIA 4HS3B 1LEKA 3QZWB 2OK0L 3CVIH 1CGSL 5IVNA 5D2LF 4WW2C 4YHIB 3SCMA 1XCTB 5D5MF 3A67L 5IVOA 2CIIA 5EUOE 3DSNA 3KYNB 4XPBH 1G7IB 5E8OA 2BZDA 4LLMA 4GKZA 4OFKA 5E6IA 3BXNA 4ETQB 3FT4A 5BVPH 1CN4A 3PWVA 3VCLB 1KB9K 3DJ9A 5I18H 1MHEA 5E4EB 3VXUB 3QB7C 3U0PB 1E4WL 2HJKA 1VB9A 3P30H 3TESA 3GSXA 3IJYA 4OF0A 3NPSC 4FQCL 4KJYA 1QKZL 1NSNL 3ARGB 5DJ8A 1MFNA 1J0HA 5TFSL 4TVSa 3TO4D 3CK0L 3FO1A 4YHPA 4YE4H 4JHZA 2UYLB 1X7QA 2X4NB 4RIRB 2F8OA 4S0SD 5EG6C 2UUDH 5FA3A 3LKPB 2CDGB 1QBML 4HH8A 1MCNA 1YPZE 1IFHH 2VH5H 5F3HA 3MX0A 4FQJH 2BVQA 1BAFL 2J6EH 2D31B 3VMNA 5CZVL 4MAUH 4ZTPH 3IDUA 3NBNA 3RNKA 1AXSA 3KJ6H 3H7LA 7FABL 2N56A 2DJ4A 5DF0A 2EO9A 4U1JA 5AG9A 4DUXA 1JPFB 2YN3A 3RRQA 4MSWB 3MRCA 4Y4HC 1JGLH 2B4CL 4AL8H 5IKCA 1NBYB 5CJXA 3QFJB 2JIXA 1EFXD 3GSNA 2YPVL 3P77B 5C0AA 1YC7A 4PRID 1GGIL 3V4PH 5JW3L 3GHEL 3U4EA 4G9DB 3HRZA 5CUSH 4XCCH 1ZT4B 1ONQA 1HH6B 1JZ4A 3OPZH 2X42A 5T5NG 2ZCHH 2EICA 4FQHB 4FMKA 1X5JA 5L88L 1YEDA 5FO9B 5GS2H 5DQ9B 5I1JL 1IM9B 3P0YH 4IOFC 3IKCB 3QRGH 1MQKH 5DI8B 5C0CA 1XGUA 2WBJB 2GITA 4HLZH 1BIIA 3SDXB 3HC4H 4KJPD 1S9WB 3IRZA 4C56B 3C5ZA 3L3HB 2EEBA 1G84A 4OQTL 2DDQH 1MCEA 1LP9A 4ZFFB 3DHJA 1LHZA 3FQXA 3O2VH 5D4QA 4HULB 5E94A 2Y36H 4Y4HD 2J5LC 2H9GA 3NA9L 4NJAL 2VWEC 4NYLA 3BO8B 4PGBA 5E2JA 3FOMB 4AIXA 5T3XH 3SJVD 5BVJB 5KSAA 3GJEA 1JMZA 3OJDB 4FFYH 2H2PC 5EBLB 3U2SA 5D6DA 3GMNA 4YDJA 1N3NB 2YXMA 2COQA 4L5FL 3MRHA 4JRXE 1SJEA 2EEDA 5H2BA 1FJ1A 4U6HA 3ULUL 4LRNH 3JZ7A 1EMTH 4IOFD 2AJSH 1G0DA 5HHMB 4W6YB 1EA9C 1NH6A 3H0TA 3UBXA 2KBGA 3DURA 2G60H 2P8LB 2F53A 1T1ZA 4MNQE 1K4CA 5K9KB 4P4KA 4DGYH 3QUYB 2PR4H 3O11B 4JRYB 4M7ZB 1INDH 2I9LB 2NY1C 1IEAA 3CX2A 5BCAA 2AK4E 4X9GA 4S1DC 3RZCA 4JN1H 3W2DL 4NWTH 2H2PD 5CILL 3HPLB 4GG6A 1FDLH 4GXUN 3LKRA 4KQ4H 4LCUB 3ARBB 3TH2T 4RGOL 3CSYA 4MZ2A 4G8GE 4D9RD 5KBNC 4FXKB 1F42A 2JK5B 2ICEA 5DMIH 3WFDH 1RAMA 4U1MA 2D7TH 3RBSA 3T08A 2H26B 5LGKA 5FM4A 1ZHLB 2CO7B 3CC5B 2PKDA 3FAWA 4TSAH 4M9OA 4Y1AE 2DRUA 1BMGA 4H8WL 1R3IL 3LN5A 1PZUB 1MELA 1F13A 1MFDL 4L3EE 2EYRA 2NY1D 3S9DB 1RULL 5F93C 4RAVB 4ONFH 4NQCA 1CU4L 4S1DD 1RIUL 1ZLVH 3KYKL 5E8NA 1IKNA 5EC1A 3VFTA 4F58L 1ITBB 2KQNA 5BXFA 3B6SB 1I1AB 4GW5A 2YPKB 4QLRA 2FBOJ 1S8DB 1S7UB 3G6DL 1JJUA 1CFVH 3CUPA 5EH1A 5IBTL 5C71A 3GM8A 5I17B 5CJQH 3CAFA 5FO7B 4TRPL 5BQ7B 1A4JB 5C3TA 5IFJA 1G6RB 2PO6C 2J7LA 1PEZA 3KHQA 3RFZC 2H1PL 3LCYA 2C3HA 1MWAH 4NN7B 5DHVB 3TT3L 3RI5F 2FJFB 3KPPB 4PRDB 1RJYB 5E0QA 3PWUA 1QHPA 5E2TL 3SDYL 2J2ZA 2ZOKB 4JR9H 2Z92B 1KCSL 3BUYA 3BGMA 1XF2B 1T20B 4LLYB 3LEYL 2OXGA 2F54A 4X8JA 3FB6B 3WFEH 4F2MB 3CZJA 3NIDF 4AM0B 5DWUH 1OAXH 2QR0B 3V5DA 5I1GL 3VXTB 3OJ2C 1CGXA 3DNKA 2YBRB 4QRRA 1KJ3L 3IGAB 3EOAB 3OGCB 1DUZA 3WDIA 1DQQA 2CSPA 1JHLH 2GJZA 3NFSL 3TWCL 2PO6D 5DK0B 1M05A 4HC1L 4LPCA 3LKOB 1I9IL 3BKYH 2IAMB 3MXVL 1I7ZB 4QCIA 2WUBH 1FBIL 4GH7B 3T0EC 1INEL 2YOCA 4AY0A 4M7LL 4PJIE 4XPGL 3AU1A 3K0WA 3FFCD 3QO0A 2Z35A 3Q5YA 5EU5B 5D93C 3P9WB 4F9PC 1CFQA 1FNHA 4O4YL 1ACYL 4KMTH 4LPVA 5GSRB 4X6CA 3T0DA 5JXAH 2BNQD 5D8JH 1ZANH 1F97A 3RTQC 1NBQA 1NDGB 4Y4KC 1LQSR 2DMBA 2I9TA 2ITCA 1NCAL 3RY4A 1OD9A 4LLQB 5IQ7H 4PRIE 1RK1A 4N5EC 1J1OH 3S5LG 4GRMB 1BGXL 4NNYB 3MMEB 5FYLL 5HGBB 3GJFB 2VERN 3T0ED 1NUNB 4Z7OF 1HINL 2NTSP 3RP1A 7CGTA 1S7XA 3VFSA 2J88L 1HEZA 3CDGA 4L4VA 2VL5B 2E6QA 4G6FB 4JKWA 1E27B 4JZJA 2GW5A 1TZGL 5DD0L 5EZIL 3T2NL 1YY8A 4BFEA 1FIEA 1T1WB 4S1QH 3CVIL 3U7YH 1QVOB 2OJEA 3MRDA 4B41A 5HVFB 3BEVA 4NWUH 5C0RH 3RTQD 4YHNB 1SJHB 4XPBL 2VQTA 1BJ1H 2E6PA 4HXBH 4Y4KD 4JQXC 4NQDD 2NW3B 1K3ZA 2FH8A 3CLEH 2IAND 1NAKH 4N5ED 5HHOB 3T4AA 1KEMH 1RPQA 5CHNA 1MRCH 5IF0A 3RUGB 3SJVE 5I1DA 2VABB 2P8PA 3TC9A 1P7KB 1BQSA 3HMXH 2YEZA 3ALXA 4UIMB 4M3JA 5HHQA 2NR6D 4YE4L 1JNHA 1MJ7H 4UNUA 4F80A 1OTUC 3HZKB 4PJCE 3QEQD 2H6PB 3V0VA 2VH5L 4XP5H 2IF7A 1GYAA 1MCOH 1FG9C 2VAAB 4NN5C 32C2B 4JZOA 4HWNA 1W0WA 4B0MM 3O2WH 1WZLA 2F5AH 5J1AA 5FGBC 3M17B 3MLRH 5EDXA 5GGQH 4MAUL 4ZTPL 4X6BA 1AGCB 3KJ6L 5KN5A 5JA9A 2VWEE 1HXYB 1A6TA 3G08A 2VE6A 1WIPA 4PJGF 5DMKA 4RMVA 4HK3N 5IW1A 3LD8B 4HEME 1JGLL 4AL8L 1BVKB 2XG4A 5D7LA 2X7LB 4PG9B 3V4PL 4X6DE 2O5XH 1BQHA 4POZC 4XCCL 5D7SH 5JOFA 4G5ZH 3IB4A 2EE2A 2DKSA 4W4OC 5J11C 5EO1A 3OPZL 4ZG1A 2ZCHL 4CBPA 4D9RE 4I8DA 5DJ6A 4EN3A 1BD2B 5IEKA 2V5RA 4DGVH 5CIPH 5IVZA 4AEIH 1JI1A 2YD5A 4NZDA 1OTUD 4HXAH 2JF1A 4NBZB 3P0YL 3MUY1 1MQKL 5A2JH 3OXRB 3AAZB 4MA7H 4DKFL 2HJLB 3HC4L 2AP2A 1Z9OA 1N6UA 1KACB 1TVDA 3E3QC 1S7VB 3MRKB 3KPLA 5SWZD 4ZSOE 2DDQL 3H7BA 3MNZB 4AH2B 1F2QA 3ZE0F 1MHPH 4NGHH 3EYOB 2PXYB 1X5ZA 4JFQB 1F02I 4K9EC 2Y36L 1CTNA 1FVCA 1TTFA 2OI9C 3LKSB 5HI5C 4LCWD 1EK3A 3I75B 3QUKA 4KTDH 1GGBL 1VFAB 4JFXB 3E8UH 4PGCA 3WJJA 4POZD 1G9NH 5T3XL 4FQXC 4KKAC 4WHDA 2QSCL 4FFYL 3LDBB 3LQAH 4Z7VE 2R23B 4OQTA 1GH7A 2CXGA 3UTTA 3JBG7 3ARTA 1ORQA 4OLXH 4D0BB 2IH1A 4LRNL 1EMTL 3MJ8B 2AJSL 5T1MB 5H35B 1WJ3A 2YRZA 25C8H 2Y6SC 4BFGA 1QO3A 1TCMA 3SE4C 2G60L 2VJXA 1C16A 4M1GH 1BREA 1MHCB 1PDKA 3C9NB 1YN7B 1A5FH 2R0ZL 1RIHH 4NSKA 3KPMB 1N5AB 4DGYL 4RMQA 2PR4L 2NW2B 1INDL 2NY6D 5HI5D 3K8MA 1AR2A 1UACH 1MCCA 3GGWB 5EN2B 2YD6A 4WWKB 5CD5C 2IBZX 3C6LC 4FQXD 4KKAD 4JN1L 4KROB 4PJ9B 4NWTL 3JSSA 1ZT1B 3KXFD 4IRSB 5C92A 2X9WA 3QDMA 4KQ4L 4NRZB 5K9OB 5AUMA 4GRWH 4NKOA 2Y7QB 2WAHA 3T65B 3NZ8B 4U0RC 1TVBA 5DMIL 3WFDL 1AD0B 2Y9RT 3WHE1 1WQVT 4H25B 3K8KA 4CMHC 2WLZA 4OZHA 3GMPA 1UYWL 4PRBA 2D7TL 2Y6SD 1YMHB 4HX1A 1I3GH 3FFCE 4WENB 2EYSA 4H1LA 2HTLC 4I48A 1N5YL 4WHTB 5J57B 1TITA 3RIFK 1JGUH 1K4DB 3HAEG 3W5MA 4O51A 2V7NB 5IMMB 4KV5E 4XHQA 2CJUH 3PWPA 5GRJH 1XGYH 4L4TA 5GISH 1OHQA 2BNQE 3QDHA 5LCVH 5F97E 5CEXA 4P23A 4L8CA 1PEWA 4PJHF 3F7QA 5CD5D 3QJFB 3C6LD 4OCXH 3VWJA 3EYQC 3RY5A 4AQOA 3NGBC 3OR7A 3D39D 5CP7B 2HFGH 1N0LA 1U8HA 5DUBA 2Y1VA 3N06B 4N8CH 1FL3B 3MBEC 1ES0A 1XR8B 4WV1B 3WNKA 5CJQL 4IIQB 1UM5H 4XCFH 1FAIH 3OKLA 1B0GA 1CE6A 5CGMA 3GBMH 3O9WC 3T0EE 5GS0C 4AEHH 1MWAL 3PQYA 5HYQA 1BJMA 1MCSA 1FG2A 2AXGA 2VR4A 3MV9B 5CZXC 1U8PB 4JR9L 2HTLD 3GKZA 1JVKA 5BZDA 1T7VA 2BNUA 2VDRL 4KRNA 1HHGA 2P48B 3R4DA 5T1LB 3WFEL 5FDWA 3N1FC 4RNRB 3SQOH 3I85A 2NX5D 3FTGA 4DTGH 4Y0GA 1NC4A 4U1KB 5DWUL 1OAXL 2G9HA 1KTDB 2O93L 2CIKB 3EYQD 4DZBB 1M7IB 3TIDB 4NQDE 4DN3H 4JO3H 1MCWM 4KGLA 3CFEA 3SGDI 2IANE 3UPRB 3MBED 4Z7WB 2X4TB 1YYLH 4XVTH 5C8JA 5I6XC 3SO3C 1B9ZA 4HUKB 2HN7A 3BQUC 1ZK9A 3CX5K 3HS0B 2ADIB 3IDYC 3O9WD 1LEKB 5GS0D 3BKYL 2D7QA 1YMMD 3SCMB 2WUBL 1IL1A 5CZXD 3T0BA 5F1OB 2CIIB 1A3RH 5IMLA 3Q48A 4LLMB 5J6HA 4GKZB 1DVFC 3BXNB 5E6IB 5C0BE 1FL6A 1U8MB 3FT4B 3QEQE 1H3PH 2QSQA 4DFHA 2BHZA 1I1CA 2WBWB 4KMTL 2IWGA 5DVLA 1MHEB 1QSFE 4BZ2H 2HJKB 43CAA 5JXAL 1A1MA 1ZANL 3GSXB 3VGAC 5C2UB 3GFUA 4KJYB 4D9LH 1DFBH 4X4MA 4MD4A 4TUKH 3FMGH 3MA9H 5DJ8B 4WFED 5CGTA 3FO1B 4MDIA 4YHPB 1QBAA 3EFFA 3ARFD 3GBLA 1X7QB 5DQDL 5IQ7L 3BQUD 1J1OL 4HIEA 5FA3B 4X4YA 3ZYIA 4Y2DC 2ZCLH 1R3HA 5F3HB 1T80A 2DYPD 4OCRH 4WUUD 2EE3A 3VGFA 3BZDA 3VXMD 5KW9H 1REIA 4Q7DA 4OCWH 3S34L 3RNKB 1AXSB 3MRPB 1DVFD 4Z7QF 4YFDB 4F8QA 2Q8AH 4JKLA 3FQNA 3MRCB 4QHKJ 5IKCB 1CGWA 2QQNH 2JCCF 4GRLC 2JIXB 3STZA 5C0AB 1IZJA 4WRLA 3U7YL 5SWSD 2YA2A 1P7QA 5SWZE 1Z5LA 3U4EB 4NWUL 4PJFF 1WBYA 3LEXA 1OQXA 5C0RL 2QSVA 5C07D 4MA1B 1WAAE 1MVUB 1CD0A 4TQEH 4OLVH 1RQ5A 3V52H 4HHAA 3CLEL 4LCWE 4MYWB 1KEML 4ODHH 3ZT6A 4Y2DD 3L3OB 1MRCL 5C0CB 3UX9B 1XGUB 2GITB 4ZFOL 1GOFA 1BBJB 1BIIB 2WWKT 4ODWA 3ZDZF 4PRNB 1UXWA 2PN5A 2LVEA 3A6CH 3C5ZB 5F9DC 1IKFL 4JKPL 5FHAH 3VW3H 3O6KH 1LP9B 4B7IA 3S7GA 1BJ1J 1WLHA 4U3XA 1J1XL 1F6AA 2DIJA 5E94B 1MJ7L 1W0YT 3WFBL 5HYJA 2H9GB 4NYLB 2NYYC 1PJ9A 4GRLD 1T2XA 3RKDC 4PGBB 1U2CA 4HSQA 2FECI 4XP5L 4JKKA 3E3QE 1MCOL 4Z8FH 1J8KA 1I8MA 3O2WL 5I16A 5KSAB 3GJEB 3MLRL 4NZUL 4WTXA 4EBQL 4AG4H 1DQLH 1KCVH 3U2SB 5A43C 1DEEA 2ZPKH 3GMNB 3F12A 1U3ZA 2WQ8A 4YDJB 5FHBH 5LAXA 3MRHB 4HJ0C 5H2BB 1FJ1B 4U6HB 2FHFA 3RWGB 3Q0HA 3UMTA 3H0TB 3UBXB 1Q38A 2O5XL 3GDBA 3DURB 2J6EA 2OXHA 5D7SL 2F53B 1T1ZB 3CU1A 5I0DA 1K4CB 3LH2H 2DB8A 4NO0D 4I3SH 4P4KB 4DGVL 1Z3GH 4AEIL 3QEUA 4D3CH 3EOBA 4HIXH 3QWOB 2NY0C 4HXAL 2NYYD 1YJDC 1IEAB 1SEBB 2XOTA 5DK3A 1F11A 2EIEA 4LEXH 4MA7L 4B5EA 1D5XA 2X1QA 2VLJD 3MV7D 1D5BA 3OL2A 4XVJH 3HR5A 1MHPL 4NGHL 3LKRB 1CFSA 5I8KH 2PYEA 3CSYB 1AGEA 3VFWA 4FN0A 4BK5A 1BBDH 2ICEB 1BQLH 3VFUA 4U1MB 1ZWIA 5JW5B 4KTDL 3EJYC 3PXJA 3D39E 3E8UL 1JNJA 5IG7A 5BZWA 1B4JH 4GXVH 1G9NL 1W2KT 1RZJH 4PJBF 3LQAL 2CK2A 3ZTNH 1H5BC 5E2VH 2R9HC 3TN0A 2HT2C 1ACZA 3C87A 4OLXL 3LN5B 3G6JA 3MFGB 3RBGA 3U30C 2EYRB 4JQIH 4PTTA 4LFHD 2LU4A 4LASH 1A8JH 25C8L 4MLIA 5E8NB 3CFJB 3VFTB 1T0NA 4M4RA 4M1GL 4QHMA 5BXFB 5DURB 1KYOJ 1A5FL 4GW5B 3P3YA 3C5SA 1IRAY 1RIHL 4MHHG 3CUPB 2NX5E 5DRXA 4CN4A 1JCKA 5BV7H 1OOAA 1U8IA 3MLSH 1OT1A 5IFJB 1PYWA 4G8IA 5I1CH 1UACL 4J23A 1CDHA 3EJYD 1AXIB 1TPXC 5DD1L 3KGRA 1KXVC 3MUZ1 1FNLA 4FXGA 5LGJB 5C2BH 2R9HD 5GGRA 3BUYB 3BGMB 2HT2D 3MRRA 5ITFA 3DROA 1WV7T 4A2LA 2F54B 4X8JB 4M8QA 3ZDXF 1EAPA 4OAWA 4HPOL 3QIWB 1QPXA 1PD6A 1CDUA 1YMME 3WLBB 3BPLC 2LABA 1T03H 3BKMH 1NLBH 2MSPA 3V5DB 2VO5A 4IRJC 3PABA 2DKMA 2FEEI 4WTWA 5DHYB 4YFEA 4RRPG 5TF0A 1IC5H 4J3VA 1KCLA 5D1XA 1JGUL 1DUZB 3SE3A 3VI3F 1DQQB 2IPUK 3D85D 1Q0XH 5GRJL 1XGYL 1RZKH 5LCVL 1QBBA 4J3XA 3SKMA 1U91A 3J8F7 3EO9H 4OCXL 2WSKA 4QCIB 5BS0D 4WFEE 1SQ2N 5INCA 2HFGL 2CLRA 3AU1B 4Z7UE 4N8CL 4GOSA 4XC3H 3QO0B 5J1SC 1KB5L 2Z35B 3EUUA 4DVBA 1S7QA 4EXPX 4WFHD 1V3LA 3KWWA 1CFQB 4WIQA 3BE1H 4XCFL 2X4SA 2BDNH 4WUUE 4X6CB 3GBML 5HPMA 4AEHL 3MV11 1G6VK 3AREA 3VXME 4IRJD 1BVLA 1RMFH 4OGXH 4PV8B 1FZJA 3BP6A 2FBJH 2ITCB 3SQOL 1A22B 5ACMA 1RK1B 2VB5A 4DTGL 2OBGA 5E5RB 4W4OA 3O6FA 3QO1A 2GK2A 5C07E 5DD3H 4P0DA 2HVJA 2ADJA 4GW1B 5C0JA 3ZZ1A 1YEGH 2VUOA 4DN3L 4LAJH 1S7XB 5FGSA 1HEZB 3CDGB 4L4VB 4PB0H 3DETC 5M94B 3GJFK 4XVTL 4ODVH 2W0FA 4WU7A 3DARA 2AEPL 1YY8B 1VFMA 5J12C 5KZCB 4P3WA 2H2SC 3KS0H 5GGTH 4YXLH 4JREC 4JFEA 2OJEB 3MRDB 5EC2A 3BEVB 2V7HA 2D3VA 4POUB 3RHWK 3OAUH 1EHLH 3S36H 1H3PL 3O0RH 3T4AB 3WXVH 3M07A 3QNXB 5IF0B 1QLFA 4BZ2L 5I1DB 1LO2H 4FFWC 2P8PB 1WICA 1VADA 3SY0A 4D9LL 2Q6WA 5ISZA 4ORGA 1OVZA 4J8RB 2YEZB 4TUKL 3FMGL 3MA9L 5KSBA 5BMFH 5HHQB 3D1MC 3DETD 3QDAA 2ICCA 4ENEC 1JNHB 5DA4A 2VSDA 3V6FA 4ELME 5HGHA 5E4IA 3V0VB 2H2SD 2EYTB 4JZOB 4OCRL 1W0WB 2P8MA 1QEWA 1IMHC 4AZ8A 1Z9LA 4PGEB 2E3VA 5IEHA 4X6BB 3QNYA 3O45A 2X4UA 5KN5B 1FN4A 4W68A 1A6TB 3G08B 2VE6B 1KFAH 3VD9A 5DMKB 4PJAE 5IW1B 2Q8AL 3HI1B 1E4XI 4YZFF 3KNBA 3C6LA 2QQNL 4IHOA 1LK3H 2HH0H 3GI9H 2VLJE 4FFWD 4ODBD 3MV7E 1JTOA 5DEGA 4JHWH 2HLFC 1BQHB 4APQC 5TH2A 5JOFB 3EDJA 3V6ZA 1LO4L 3L3JA 5EO1B 1N64H 4TQEL 4OLVL 3V52L 3ULVE 5DJ6B 4EN3B 5IEKB 4KTYA 1OGTA 1ZXQA 1YECH 4ODHL 3CJJA 4GAGL 2PW2A 3BZEA 3RWFA 1MFEH 1YEKH 4L3CB 1DP0A 3A6CL 4LCCA 1DL7H 4PJDE 3KPLB 3VW3L 5FHAL 1VFBB 4X80H 3O6KL 3DMMC 1L7IL 3V6OC 4FA8A 4QRPA 4KDTA 3MJGX 1A1NA 4PLOB 4UNVA 1FVCB 1LO0H 1JK8A 3WUWG 4ZFOA 1FFOA 4PGCB 5DLMH 3MJ9H 2HLFD 2MQCA 4UOW1 3DVNA 4APQD 4NKDA 4Z8FL 3T4YA 5DJ2A 2XN9D 3HMXA 1AC0A 5F1NA 3OKEA 4AG4L 1DQLL 1KCVL 2ZPKL 3UTTB 5FHBL 2ZJSH 1ORQB 1TDQA 4IDJH 3N9GH 2CKBB 2IH1B 2DD8L 1DQJB 5E99L 2B5IC 2BNRA 1OQOA 3N1MC 2NY4C 3VMPA 3GNMH 3QG6B 1QO3B 2DQIH 5B21A 1C16B 3FQTA 2NZ9C 3QT2A 3LH2L 4NSKB 4I3SL 5C6PB 1MCIA 4JHAH 3S98A 1UCBH 4Q2ZA 3VDAA 1Z3GL 5CJ8A 4D3CL 4HIXL 5JO5A 3HNSH 4F15C 4DEPB 5K9QG 4KMLB 1I3UA 4PBVC 1XF4A 1U2HA 4MJ6A 4R2GB 1AKJA 1P69B 3WN5B 4XNQA 1J8HD 4XVJL 5F9WB 1R3LA 3AXLA 2ZZUT 3QDMB 1TZHB 5I8KL 5CIPA 1FNEB 5AUMB 4NKOB 2DIBA 5ACLA 1BBDL 1OARH 1TVBB 1BQLL 1L0XA 3IETA 1T66C 5EOQH 5BS0E 4OZHB 3GMPB 2NY4D 4PG2A 4PRBB 1B4JL 1GRWA 1SM3H 4HX1B 3JTTA 4U1NA 1RZJL 3BAEL 2EYSB 4H1LB 3ZTNL 5E2VL 2C1PA 2NZ9D 4WFHE 4I48B 4O51B 4WI4A 1S7TA 3PWPB 5SWSA 4JQIL 4L4TB 1J0KA 1SMAA 5CEXB 4P23B 5MENA 4LASL 4L8CB 2RIKA 4WI7A 4LHUA 1LE5A 1GOHA 5F7EH 3VWJB 4PJ5D 1U8HB 5DUBB 2FSEA 1ES0B 1BLNA 2W9DH 3T0WA 3TT1H 1LWRA 4N90D 3DRQA 4L8SC 3MLSL 1T66D 4K71B 4I0PD 1B0GB 5I1CL 1NFKA 3SE9H 4X6EA 4KK5C 4MCZA 1FG2B 2AXGB 1IAIM 5D7LE 5GGVY 5C2BL 2Z8RA 5DHXB 5IWLC 2BNUB 2FX8H 2RB8A 1HHGB 4K94C 5FDWB 5KVEH 2PW1A 2AV7A 2YD1A 1ZHKB 2EC8A 2ZSWA 3FTGB 4NDMA 4U3HA 1NC4B 5F1IA 1PY9A 1T03L 2KL6A 2G9HB 4BZ1H 5K9JL 4P3CL 1NLBL 5IW6B 3CSBA 2LAAA 4PJXE 3CFEB 1IC5L 1S9XB 5I75C 4LQFH 3FHQA 2Z4QA 3QEGH 5C8JB 3BRFA 1Q0XL 2HN7B 5FYLD 4PJCB 4ODXA 5HYEA 4KK5D 5I2IA 3EO9L 1NGZA 3H3KA 3QXUA 1HHJA 1JV5A 5IMLB 3MOAH 4XCEA 4XC3L 3S37H 3QCTH 4EKXA 5J6HB 1UKTA 5CS7A 5CWSA 4GG8A 1FL6B 3U48A 1NFIA 5CJ5A 4NQED 1QG3A 5JIHA 3BE1L 4WI2A 2R2EA 2EH8H 4HZLA 2BDNL 2FGZA 4KKBC 43CAB 5ID1A 5TDNA 1A1MB 5JIIA 1BHGA 1RMFL 4OGXL 4QRUA 2VZOA 3FB5A 3VWKA 2CQVA 3RVUC 4YHYB 4MD4B 3VDCA 3IRPX 4X7SH 5IM7A 1Z0NA 4Y5VC 1GXEA 2FBJL 1MJ8H 4RFNC 4MDIB 3EFFB 1A6ZA 1M4KA 4XVUC 5FYKD 3SEPA 5IHLB 4X4YB 2VXQH 1JZ3A 1YEJH 5C70A 3AGVA 1GOGA 4RGNC 4M6NH 2MHAA 3CXHK 1ND0A 2C3GA 2A38A 3B9KD 4MMZC 5DD3L 4TSBH 1YEGL 2EO1A 1A9EA 5C09D 2BERA 4ONHA 4QOKD 5C0FA 3H3BC 3QQ3A 5D2LE 5EOTA 4ODVL 3TO2A 5D5ME 3FQNB 5FK9A 3U1SH 1DN0A 3STZB 4KKBD 1G7JA 3FN9A 5GGTL 4YXLL 5BOPA 1LDPH 5JHDA 1P7QB 1DTUA 2ZG3A 1WBYB 1LILA 4RA0C 4LLAA 4P2RA 4HLZG 4LLDA 1LEIA 3QUZD 1EHLL 3S36L 4HHAB 3WFZA 4XVUD 3O0RL 3LRHA 3MUJA 4I3RH 1L9NA 3U9PH 4P3DA 4RWYH 4YXHH 3WXVL 2E5EA 2XN9E 2P44B 1LO2L 1H5BA 2J3SA 3U7AA 4ODWB 4HUNB 3KS0J 3P4OA 2NXYB 3WFHA 3WDJA 2NY3C 4PV9A 5H37G 1N8ZA 5BMFL 2H8PA 5E00A 1QFWH 4MCYA 1F6AB 1JFQH 4R0LA 2JJTA 3INUH 1P6FA 3K8LA 4FQQA 4NZRH 3FAXA 3D2UA 2CRZA 3P2TA 2NXZC 3TZVC 1I8MB 1J1PH 3ZSTA 4OZGF 3SDDC 2BVPA 1PLGH 1B6DA 1XGPA 1HQRB 1P5UA 4K7FA 3V6OE 1RJCA 1DEEB 3PQYE 1KOAA 4TPRH 4XXDA 2PO6B 1KFAL 4LSPH 1NGQH 3RIFF 2CLVA 1T83C 1LK3L 2HH0L 3FCTA 1J8HE 1P1ZA 4JHWL 3AVEA 4U1HA 5D7JC 2NY3D 3G5XA 5F7FA 1N64L 5KSVA 3QCVH 2ARJQ 3IXTA 4X99A 3TV3L 1G7PA 3QEUB 4JGMA 1YECL 5I74C 1PX4A 3PXHA 1F11B 2NXZD 3OB0H 3PJSA 5DYOA 4OJFH 2CK0H 4RSVA 1I9EA 3P4MB 1MFEL 1YEKL 3T2OA 4C54A 1CFBA 5I1HH 1ED3A 3SDDD 1T89A 1DL7L 1D5BB 1XIWC 3V79C 3HR5B 4X80L 4NUGH 4HFWA 1CFSB 2A2QT 2PYEB 3TA3A 5DJDA 2GY7B 5I30H 1AGEB 1CS6A 3VFWB 4YH6A 4S11A 1LO0L 3VFUB 1JZ2A 1ZWIB 2VZVA 4PJ7F 3W39A 4PJ5E 5DLML 5IG7B 1RUMH 3UBXI 5D7JD 2A9MH 4PRHA 3NOIA 2GT9A 1AGFA 4NO2A 4N90E 3TN0B 2EIDA 2ZJSL 4XC1L 4IDJL 3MLWH 4W6WB 3N9GL 5C7XH 2OX5A 3G6JB 1TFHA 2YC1B 2A6IA 4PTTB 5EO9B 3S3PA 3H9SD 1X44A 4JO2H 2RFXA 3GNML 2BHUA 2F9BT 2DQIL 4DOHE 4F37K 4GBXA 4AIZA 3BKJL 5GGSA 1AQKH 4QHMB 3WD5H 1XIWD 2IANB 3C5SB 4PGDA 3VD7A 1OPGH 1UCBL 5DRXB 2N7AA 4OCMC 1T4KA 3HNSL 5DVKA 3VXRD 1U8IB 4YHKH 1L6XA 4G8IB 4K3DH 1FNSL 3MGTB 1A7NH 3QHZH 1FO0H 3KPRD 3P9LA 3B3IA 4U1IA 2AXFA 4E9LA 4FXGB 3S3JA 2FHBA 5HJ3A 3BH8A 5GGRB 1F8TH 4Q74A 4U1GC 3ALWA 3MRRB 5ITFB 5FYLE 3QEQB 1LK2A 4M8QB 2FX9H 3BWAA 1G6RH 4YBLB 4OAWB 1OARL 2AGJL 2I26N 3JWDL 1SYSA 5DHVH 1DUYA 2I60L 3DUUA 5EOQL 1MFCH 4CRPA 5IGXH 4LEOA 1U6AH 5I1KH 1SM3L 3I84A 3PABB 4ZAKC 3GMMA 2DAVA 4BQ8A 2HWZH 5D1XB 4NQEE 4L9LA 3NABH 5L0QC 1YNLL 4M1DH 4OIAA 5IVXA 4WO4D 1V7MH 3WDHA 4LLVA 1NEZA 5DT1H 4LMQI 2HT4C 1CXLA 4KKNA 5JUEH 3SKMB 1U91B 5AYUH 3I3BA 5F7EL 4KY1H 3QA3A 5TE4H 5INCB 2CLRB 2ICWJ 4EJ1C 5FYKE 4QEGA 2ERJC 4DVBB 1XF3B 1S7QB 2W9DL 3VFPA 1G9MH 3KWWB 2IEPA 2VLKD 2X4SB 1WBZB 2D9QB 2FJGA 4OZIB 5HPMB 3WJLC 3AREB 5C09E 1B3JA 2W65B 4ZAKD 4XNMA 1BVLB 4MX7B 4QOKE 4XI5C 2YK1H 1FZJB 3NIDE 4PBWD 5EFIA 2DLGA 5JOEA 3BP6B 1CICA 1NKOA 1CK0H 2J1KA 2FX8L 3TBVA 3HZMA 5KVEL 4WCYH 2YD4A 3I6LD 3MLTB 4GKOA 1H15A 2HT4D 5ENWA 1YQVH 2RAMA 2GI7A 3BDYH 1UFUA 4QRTA 3QO1B 5F7KC 1MOEA 1WZ1H 4BZ1L 2FHCA 5HVHB 2YD9A 4N8VA 5KOMC 4AENB 2HVJB 2ADJB 5C0JB 1ZLUH 4ZOCA 4XXCC 4G43A 1U8JA 3TYFA 5FCUL 4LQFL 2HP4A 4NPYA 1X5FA 3CSGA 4PJIF 5DQJB 3S97C 5CJOL 4PRPA 3E1F1 1KIQA 3MV8D 3QEGL 4EI5C 3LKQB 3QDGD 1AHWC 2W0FB 3B8SA 4WU7B 1LO5A 3B2UC 4R97B 5CLTA 3EHBC 3VXSA 1OD7A 2R0WH 4JFEB 5DJAA 4YDLB 4HW6A 1PKQA 4XI5D 5JW4Q 2V7HB 3DMMA 4JGUA 3BISA 1X4XA 1MAMH 3AY4C 2VXUH 3KDMA 3MOAL 3DX9A 2L7UA 3S37L 4HV8A 4DQOH 1DANU 2OI9B 4LCIH 2KPNA 1CLOL 4R4FH 4WFGD 4P9HH 2EH8L 4F7MA 5J8OA 1QLFB 5JHLH 2AERT 5HHPB 3DX8A 3KXFB 5KS9A 3O8XC 1VADB 3U4AA 3SY0B 1OGAA 1WFOA 1K8DB 2Q6WB 5ISZB 1E4KA 4ORGB 4X7SL 4YFLI 2GJ6A 5IW3A 4P2YA 1E4XH 1MJ8L 4IMKC 5HGDA 3B83A 4EI5D 3UTQA 3V6FB 4Z7OE 5HGHB 2VXQL 3BHBA 3B2UD 4WI6A 1WT5C 5AZ2H 3EHBD 5J7CC 1CCZA 1FYTD 4M6NL 5D2NC 5DS8A 1N0XH 3F8UB 1T3FA 2P8MB 1QEWB 1WWBX 4TSBL 5DJYA 5KJRH 1HILA 3C09C 4K3EH 5IEHB 3TF7C 3QNYB 3O45B 2F74A 1FN4B 1NCCH 4CVZA 4UIKH 1PW3A 1B2WH 1VGEH 5T5NF 2D0GA 1KC5H 2X2YA 3KNBB 3U1SL 3C6LB 4F33A 4LLWA 4IHOB 2ED9A 1J0YA 4WGVB 1HSBB 2D0HA 2ZUUA 4UU9B 4K07A 1ZA3A 5TE7H 5IESH 1NMCB 4U0RB 1FYHB 4JFFA 4I18C 2XKNA 3AM8A 4N0FA 4I3RL 3RDTA 2FECL 3U9PL 4MJ5A 4RWYL 4EQ3A 4YXHL 1CXFA 3V0WH 2VDOH 1NAMA 4K3HA 5GGTA 2PW2B 3ZKQD 2V5YA 3BZEB 1OW0C 3RWFB 2P5WD 2LU7A 4PLJC 4LCCB 3ELAT 5IB5A 3T1WA 4RAUA 4BSVA 3FO0H 1TZIB 2NX5B 3REVA 1QFWL 3ETBF 4QRPB 1JFQL 1A7QH 3INUL 1A1NB 3H9SE 5IR1B 3RGVA 4NZRL 4Z95H 3VD3A 1JK8B 3FN0L 4LKXA 4ZFOB 1J0ZA 1FFOB 1HOCA 3TBSB 1OSPH 3HMWH 4NKDB 1J1PL 5HHNA 3T4YB 1PLGL 5F1NB 3OKEB 5ADOH 3MTRA 4TPRL 3AS3A 3VXRE 3LS4H 4LSPL 2YUWA 1NGQL 4Y7MA 3KPRE 2B2XH 3U0TA 1EAJA 1CG9A 2BNRB 1QUNA 1CQYA 2GSGA 3U46A 2AEIT 3DX6A 4PLJD 1CF8H 1TETH 1UVQA 3IJHA 3MR9B 1U8LA 4PR5A 1Z6JT 1QFOA 5JO5B 5D7IA 1JP5A 2BJMH 2HVKB 1XF4B 5EIQA 4MJ6B 4HK3J 3ZE0E 1AKJB 2X4PA 3RL2B 4EZMA 5KVGH 4GUPB 3S3SA 5I1HL 1NCWH 3C5ZD 4PRAA 1QRNA 2APBA 3SO3B 1CD1A 1R3LB 2XYCA 1KT2A 4NUGL 3MRIA 5C08A 4R7DA 5I30L 1KXTB 3IETB 2DYPB 3C2AH 3C5JA 4UV7H 1D9KA 3NACH 3AFLA 5MP6H 4CVXA 3BPNB 3VXMB 4JPWH 2AJ3A 4U1NB 1J0IA 3JTTB 5CD3A 5J89A 2A9ML 1VFOA 1NC2D 2C1PB 3U82B 1G0YR 1M6OA 4OGAC 2VLKE 1JYXA 3L6FA 1S7TB 5SWSB 1HKLH 4MQSB 1C5BH 3BEWA 3MRMA 1TJHH 5MENB 2Q86A 4JO2L 1J87A 3MJ9A 2IQ9H 4LHUB 1LE5B 3BJLA 4F9LA 5IHZA 3UEZA 1AQKL 4NQSA 3O41A 3WD5L 1R3JB 2FSEB 3ZT5A 3IDXH 4ZYKB 1BLNB 1OPGL 3I6LE 1QR4A 3CH1A 3QUXC 4QRQB 5MI0B 2APTA 1A9BA 3C6SA 3DRQB 3MODH 4P2OC 3HE6A 4WHCA 4YHKL 2B20A 4QY8A 4K3DL 3HA0A 3QHZL 1A7NL 3FFDA 4X6EB 1FO0L 5FF6A 1FZKA 4MCZB 3MUHL 3HG1D 5EBGA 5GRWA 4AEEA 5DJXB 1F8TL 3MV8E 3B4NA 4OGAD 3QDGE 3NFNB 1R0AH 4OZ4A 4V1DD 2ZOLB 2FX9L 1G6RL 2PW1B 3DV4A 2AV7B 1HZHH 1CLYH 2ZSWB 4KV5F 4NDMB 2YN5A 3W5NA 1MFCL 1Q1JH 5F1IB 5IGXL 1U6AL 4HKBA 3ARDA 5I1KL 1RD6A 3VFGL 1U9KA 2ZNXA 3B9VA 3QXWA 1INQA 4LCYB 1AH1A 3RWJA 2AJYL 2HWZL 3BIKA 4WFGE 4NHCH 1S7SA 3HFMH 3QUXD 2Z4QB 4M1DL 4NCC1 4ELMB 4P2OD 1ERNA 3O4LD 1V7ML 4I2XE 4GAJH 4ODXB 5EWIH 5I1IH 3RY6C 4E41D 1U58A 4LARH 5JUEL 1BF8A 5BO1H 2UZXB 3P4LA 5F96H 5AYUL 5I2IB 5IFHH 4F7PA 2BC4B 1NGZB 1HHJB 1JV5B 2ICWA 4YPGA 3ULSB 5TE4L 5J0BA 4XCEB 3CPLA 5CWSB 3SDAC 4GG8B 4RGMC 1G9ML 4BK4A 2DTSA 1FYTE 2G5RA 3TZVA 2R2EB 1JYWA 4HZLB 4OFYD 1G7LA 3SGJC 3DX7A 1JWUA 1IC7H 2VLJB 3MV7B 4CNIA 5KTEH 1OP3H 5TDNB 3HE7C 2VXVH 2KZ1B 4QRUB 2YK1L 3ZKNC 3FB5B 3VWKB 1CVRA 2DQFA 2ZSVB 4S0TD 5IM7B 5K9QI 1CK0L 5GS3A 1ZLWK 3P4NA 1A6ZB 1H8SA 3F5WB 5KVDL 2NTFA 4HKJA 3PWLA 2YRPA 1NJ9A 4WCYL 4WNQA 4EIGB 1DE4A 4R8WH 1MCWW 1YQVL 2F5BH 3V5KA 3VRIA 1PFCA 2MHAB 3TP4A 5GRZA 1ND0B 5EZOH 1P7HL 4TSCH 3X13A 5FOBA 4OLWH 2A6DB 3IAQA 4MB5A 1A9EB 3VGEA 2NY0B 4ONHB 4WHYH 5C0FB 4HUWA 3SDAD 3QQ3B 3RVWC 5EOTB 4TNWK 2YPLD 5E6ZA 5D2NE 5FK9B 2VISB 1DN0B 3MUGA 4OLYH 1ETZA 2P5WE 1S78C 3EYUH 2R0WL 3HE7D 4LSRH 5JHDB 2Z9TA 3I02A 4HS8H 4PJGA 4BQ9A 3D0VA 4FOMA 1U8OA 3ZKND 2ZUSA 5A1AA 3VE0A 2WP3O 1MAML 4P2RB 2GTZA 5GGUA 4LLDB 3K46A 3H9ZA 2DQDL 1P9MA 2XNAA 4DQOL 4LCIL 3L95B 1G1YA 2I27N 3K3QA 3QXAA 4KDWA 4MNGE 4CJ1A 4P9HL 1HKFA 4P3DB 4RMUA 1MREH 4WEMB 5JHLL 1PVHA 1H5BB 3ZL4L 4KQ3H 1JZ6A 4E0RA 4TUJA 3GSUA 3P4OB 1EJ6A 5FYJH 3WFHB 3SE8H 1KN2L 5D1QD 4JCLA 4FTVA 4PV9B 4PFEA 2H8PB 1KLGB 5E00B 3U30B 1MLBA 2CMRH 1E4XL 5HXMA 3RVWD 1F6FB 3QQ9C 3JVGA 3IDGA 4R0LB 1NL0H 4HS3A 1G0XA 4N9GA 2BXZA 1UJTA 3QZWA 5DVNA 1UH4A 3HZYB 3WHE0 2E7LA 5E24E 4MZ3A 3DGGA 1S78D 5AZ2L 1Z0MA 3QWRD 4Z7QE 1FIGL 5KJRL 4PJEF 2WV3A 2BVPB 4K3EL 1XGPB 4K7FB 1SBBA 4FXLA 2JCCE 1L7TL 3CCHA 3KLSA 4XXDB 1NCCL 2WINA 5IB2A 4UIKL 1B2WL 1VGEL 3T0XA 5ID0A 1KC5L 3U0PA 2B1AH 2KDGA 1FLRH 5EU4A 3UYPA 3ET9F 4G9FD 3FCTB 1P1ZB 2WK2A 1LD9A 4BH7A 3LN4A 4U1HB 3PWJA 3GK8L 2HJFA 2UUDK 3G5XB 4J3OC 5TE7L 3IJSA 5KSVB 4ZOAA 2GUOB 1T6WA 4OCNC 4OIIH 3QQ9D 4X99B 3SBWA 3LKPA 5FIEA 2LE9A 3NCBB 3ZDZE 3MA7A 1M1SA 3F6IA 3UTZA 5TGBA 2YKLH 2XWTA 5M7QA 3V0WL 2VDOL 3PJSB 4GRWE 3PDOA 2GKIA 4L4JA 1ED3B 5A40E 2MOVA 1BX2A 3LMJH 3X11A 43C9A 3FO0L 4HFWB 3TA3B 3NCYP 1H8OA 2Z31C 1A7QL 1EPFA 3U4BH 1XH3A 4Z95L 4XP6H 3N50A 4ZODA 3W39B 4G6JH 2CXKA 4I4WB 2CRIA 1OSPL 3HMWL 4NC0B 4PRHB 4XB8A 4PD4J 2GT9B 4YC2C 5ADOL 1AGFB 2O5ZH 4NO2B 2DL2A 5B39G 1XGRB 2XQYK 3NN8A 1WCBA 1GZPB 1CTOA 1K6QH 2ZCKH 3QDJA 2EC9T 4R4BA 2WBJA 4RMTA 2B2XL 3SDXA 2BFVH 3HG1E 3EO1A 2RFXB 1HHKB 3L3HA 4Z7WF 4GBXB 1CF8L 4AIZB 5GGSB 1WEJH 2LFGA 4V1DE 4TVPH 3QIUA 4JG0H 4MB3A 5AWNL 2QLVB 4F57H 4PGDB 4PJHA 4UINH 4H20H 1KJ2H 3ZKXC 2Z31D 1QSEA 1T4KB 3FOMA 4WU5A 2BJML 1JF5A 1JMXA 3FT2A 4JJ5A 3DRTA 5BVJA 3OJDA 4NBYB 3VDBA 3P9LB 3B3IB 4JPIA 5KVGL 1NCWL 5B8CC 2C1OA 2AV1A 2F19H 5HJ3B 1WZMA 3O4LE 4CVUA 4I0KA 1LK2B 4E41E 3BWAB 3HR6A 4PJBE 4NNXB 3T1FB 2JJWA 1SYSB 4GKSA 4KAQL 2FGWH 2J8UA 3S4SG 4UV7L 3NACL 5MP6L 4JPWL 1QSVA 4NQXB 2WIMA 1OAQH 4K23H 3GMMB 3E6HA 4MNHA 4KZDH 1CI5A 1JGVH 3QI9A 1EXUB 4EOWL 4L9LB 4KFZC 5B22A 4Y16A 4Y4FC 1Y6NR 5IVXB 3IDJA 3DVGB 4JJHA 4DVRH 3O8XA 1MCKA 1C5BL 1V05A 3EYSH 1NEZB 3Q5TA 4LLVB 4KDVA 2RJMA 1TJHL 4JFPA 4JDTH 2Q8BH 1ZHNA 2IQ9L 1KCRH 3QA3B 4IMKA 3QPXL 2Y25A 1O7VA 2XV6B 5F9OH 3IDXL 3ARUA 4PYHA 3VFPB 4NOFA 3MODL 1SJVA 5DUMH 3WO4C 4M00A 2FJGB 3OZ9L 2BXYA 2HAZA 1FVEA 1TQCC 4P59H 1F4WH 3CC5A 4XNMB 4HMCA 4KHTH 1RZFH 4U2ZA 3ZDXE 3PV6B 3CVHB 4QGTA 4LVHC 2YA1A 2YPLE 2CR6A 1R0AL 1CICB 4Y4FD 5FXCH 3CFIC 3TBVB 3HZMB 3O4OC 2NY5L 1KF9B 5EU6D 5GGVH 5BV7B 3GSVA 1CLYL 1H15B 5ENWB 4Y5XA 2ZUTA 1Q1JL 1U3HC 4QRTB 1FO0A 1SVZA 2ESVD 4N8VB 3RA7H 2XXCB 3SHSA 1LP9F 3WL9A 1S8DA 1EH9A 1UEMA 4G43B 4MDJA 1U8JB 3TYFB 1NFDA 4NPYB 4UUJA 2FX7H 5JMRA 1Y6MR 3AB0C 3HFML 1NKRA 4P46A 4WTZG 4PRPB 1GAFH 5JORA 1KIQB 1G6RA 1BFVH 3WNLA 4GAJL 5EWIL 5DHVA 5I1IL 1LO5B 1RJYA 3D25A 3VXSB 5F96L 5DJAB 3GB7A 4GMTH 3WKMH 1PKQB 3MRLA 4YQXH 5K59E 3DMMB 4U6VH 3T0VA 3DX9B 3T09A 1DR9A 4LVOB 5I9QC 1NCNA 4HV8B 3R8BB 3OKMA 4CU8A 3K1KC 1QFUH 3WIFA 3RX5A 5CMAA 2HTKD 4PJFA 3UYRH 4F7MB 4R3SA 3RNQA 1IC7L 1U3HD 1ITCA 3GMQB 1CD8A 4JFHD 5KTEL 3TNMA 3DX8B 4GW4A 1P4LB 5SV3A 3UJIH 5KS9B 1OGAB 4NQVA 1OY3B 4JFOA 4FRWA 4MGXA 1U92A 3EOAA 4D0CB 2OTPA 1HNGA 3VH8A 1ZSDA 1BVZA 5HGDB 4CDGC 1ZVYA 3UTQB 4G9FE 1RUAH 2UWEA 4WVRA 2IAMA 3L9RA 2IFFH 3BHBB 1TNMA 4R8WL 2F5BL 4X7EC 2JKXA 4PJ8C 2H45A 5DS8B 5EZOL 1A6UH 4GG6F 1T3FB 3RU8H 4BSJA 1TIUA 4TSCL 5DJYB 1HILB 4ZNEE 5EOCH 3UCRA 1FNFA 4OLWL 1QQDA 5ADPH 1AFVL 2F74B 2FLRT 5IB3A 1JRHI 4J1UA 1F2XK 4CVZB 3HC3H 4U6YA 5FAAA 1DSFH 1H3VA 1G1CA 4OLYL 4LPXA 2PNDA 3EYUL 4JRWA 4LSRL 4HS8L 4BA8A 1NDGA 2BSRA 3MCLH 2AKRA 4I0CC 4PUBL 2VZSA 4M62H 2YSSB 2ATPA 1ZA3B 1JE6A 3I9GH 3ZLQC 3P0VH 4F37F 4LLQA 4JFFB 2ZG1A 3CXHJ 2XKNB 3H9HA 2X9XA 3RDTB 4L9DA 2QADB 1NMAH 4MJ5B 1GCFA 5I71B 1I8LC 1NAMB 1T2JA 3WYRA 4KQ3L 1V3KA 1MCDA 5FYJL 4IJ3B 3SE8L 5B3NA 5HHXH 5IB5B 2AJZA 1A7PH 4RAUB 4BSVB 2AXJA 4KVCH 1RJZA 3U79A 3W0WD 1T1WA 1NL0L 2XFXA 3NCJH 4OF5A 4G6MH 3TEUA 4LKXB 1IAOB 2OR9H 5GJSH 1HOCB 3LS5L 1R5VA 3BESR 5HHNB 2X41A 1ORSA 3GMRA 4YZFE 3OF6A 2VLRA 1FHGA 2E8ZA 2M2DA 1JGDA 3H42H 2JJUA 1X5YA 3ULVF 2B1AL 4Z0BH 3NCCB 5IFAH 3U0TB 1FLRL 1CG9B 2GSGB 5JA8B 2EKJA 1AO7A 1TLKA 2DQEH 3U46B 1VFUA 3BP4A 3DX6B 3LSOB 3BH9A 2O5YH 1UVQB 5C86A 2JJSA 5HPOA 4J12A 3IJHB 2PTTB 4P5TC 3D87B 3HTLX 2CKBH 3JWDC 1U8LB 1HHHA 4C83A 4NNPH 4OIIL 9CGTA 2H6PA 2FD6H 5B4MC 3B43A 4ZXBC 5DMYA 2YKLL 3VU2A 1FQ9C 4XP4H 2ORBH 3K4ZA 2ARJA 1GC1L 5I1EH 4PRAB 1DDHA 3LMJL 5L2KA 1OAKH 1CD1B 1KT2B 4JLRA 2LTQC 3MRIB 5C08B 3BPOB 5D96B 3TH3T 4R7DB 4X6CF 5T33H 3U4BL 4XP6L 5E6YA 3C5JB 5HYSA 2ILLA 1D9KB 1R5IA 4G6JL 4CVXB 4M61B 1UM6H 1ZGLA 4CL7A 3CSPA 4QOKB 5CD3B 5EA0H 2Z91A 5JXEA 3DPBA 1AE6H 1RU9H 4NZTH 3HUJE 4P5TD 1M6OB 2O5ZL 5DJCA 3DYMA 4BUGA 3D5OF 3L6FB 1K6QL 2ZCKL 5B4MD 4OV6F 1A64A 3CLFL 4ZXBD 5ETUA 5JOPD 5JR1H 3RVTC 3BEWB 3MRMB 2BFVL 2HJLA 2W9EL 1DBAH 4KXZH 3QIBC 4YFLF 4XH2A 2ZUQC 3L3GA 5IHZB 4RFNB 2D2OA 1YZZA 4NQSB 1WEJL 4EUPG 4TVPL 4JG0L 3GKWH 4YR6A 2HLAA 5EU6E 5I15L 3PL6C 5L9DH 1L0YA 3DXAA 3KPSD 1ZA6B 4UINL 1KJ2L 3SKUD 1KYOK 2V17H 4NP4L 1A9BB 4RGNB 1V7NH 2ESVE 4JFXA 3GHBH 5I1AB 4YK4B 4QY8B 5DSCB 4OB5H 3FFDB 1UJ3A 2D7PA 3WIIH 4HIJA 1FZKB 4HBQA 3H6JA 2F19L 4GS7B 1CFTA 1TTGA 3MZGB 1E6JH 4K3GA 4XNUL 4OZ4B 4P57B 1T0PB 2B1HH 3ABZA 5T1MA 2IC2A 3DV4B 3F62A 4JO4H 2Z0BA 3RVTD 2FGWL 1Q94A 5HTSA 4TTGA 3O6MH 3QIBD 3MLVL 3TVMA 3ARDB 4OD3H 4HAGA 4KZDL 1INQB 3WFCH 4JB9H 1CL7H 1JGVL 3RWJB 5D7KD 4CVWA 3UZEA 3BIKB 2NW2A 2E9WA 4Y19D 3PL6D 1U95A 1S7SB 3D3VD 4LIQH 4ZPVA 3EOYG 5F88A 3NIFF 4DVRL 4JFHE 3EYSL 2YA0A 4WWKA 1U58B 2FJHA 2L7JA 3PDGA 2Z8WC 2Q8BL 1MRFH 3NA4A 4JDTL 4TULH 1RFDH 4F7PB 1KCRL 3QZWG 4YPGB 2ICWB 4U1SB 5BRZD 4WW1B 1EVUA 5F9OL 5L7XH 4U31A 1IGTA 5E4EC 4QHUB 4D0DA 3CPLB 1AD0A 3GZKA 3H2WA 2NXZB 3C8KA 4OSUH 5EULV 1QLRA 3TZVB 5DUPH 5DUML 3OAYH 4RBPH 3ARGC 1FLTX 3DX7B 3K2UH 5TE6H 4M48L 4D9QD 4YXKH 4KTEH 4P59L 1XF5A 1RZFL 4FHBD 5I66B 4UT9L 1CDIA 2ARWA 4ODTH 3NZHL 3OV6A 5I19H 4JO1H 2NTFB 5GGVL 3PWLB 1NJ9B 2AW2A 4WNQB 4OF3A 1DE4B 1ZLWH 4JQVC 3V5KB 3VRIB 4UOW0 2IPTH 4RMRA 4Q0XH 4RDQG 3RA7L 5A16A 5D7IE 3BT2H 3X13B 3KR3H 4XAWH 3VXUD 4XAKD 1SBSH 5E7BA 5I74B 2FX7L 2Q3AA 3EDDA 2XY2A 3D48R 1GAFL 5ACZA 2CUHA 1BFVL 1QBLH 2FIKA 2AJUH 3L3DA 4M9PA 5HSFA 3ARGD 2XACC 3MUGB 4JFDA 1ETZB 4GQ9L 4FMFA 3T2QA 3S37X 3I02B 4PJGB 4GMTL 4HZAA 3WKML 2A77H 2ZKHH 3D0VB 5ITBH 1U8OB 4K2UH 4YQXL 3CD4A 1D5ZA 3VE0B 3WS3B 4U6VL 1RUPH 3W0WE 2GTZB 5GGUB 2GAZA 1QPPA 2XNAB 1R6VA 1RJLA 5IROA 1QFUL 3F7PC 3QXAB 4BQCA 3KPRB 3UYRL 1KBGH 3W82A 1JBJA 3DO3A 3BZFB 2CIKA 4DZBA 1C7SA 3BMVA 4E0RB 3GSUB 3UJIL 3QXDA 4MQTB 1FPTH 5HDOA 2X4TA 3MRFA 3QFJD 3BD5A 4XNXH 1DLFH 2F15A 1MLBB 2GK0A 3ULUF 1GZQA 2EH7H 3IDGB 5H8DA 1OF2A 4N9GB 1RUAL 5JIPA 5IT2H 2IFFL 3MNVA 5A3IC 1EUUA 3DGGB 5DZOA 3FRPA 3RU8L 3AUVA 1IM9D 5EOCL 2ZP0T 3JV0A 3HC0A 4X6FA 5ADPL 1U8MA 4UAOC 3ROOA 2XTJE 4P9MH 3CCHB 2VXTH 2WINB 5IB2B 4ZOBA 1JTTA 3HC3L 4OZHF 2BY1A 5ID0B 4C56D 4FFZH 4YO0A 5EU4B 5DMJB 1C08A 1H0DA 4X7FC 1RK0A 3QUYC 1LD9B 4BH7B 3GUTB 3LN4B 3PWJB 3BDXA 5DC0A 4M62L 4M7ZC 2HJFB 3I9GL 5EOCJ 3P0VL 3HNTH 3IJSB 2E8YA 3VGDA 3TPKA 5F9JA 3ROLA 3MA7B 3UTZB 1OL0A 4EEEA 1NMAL 5TGBB 2XWTB 1N6VA 5A3ID 4ZAKB 1WSST 2XWJB 3OB8A 5CEYA 4KJPC 1X5AA 3F7RA 4QTIL 4GLRH 4P2QA 3PDOB 3IU3A 3U9UA 3MRPA 5HHXL 1BX2B 4J2XA 3X11B 2DQJL 5IJKA 1EO8H 1A7PL 1IAKA 5HHMD 43C9B 5JOPE 5ANMA 1MPAH 4YGVA 2EDLA 1TTUA 5MEPA 2WW8A 4OZGE 1XH3B 1WTLA 1KNOA 4IS6A 2OR9L 1I9RH 4GAFB 1B0RA 5GJSL 3QCUH 3QUYD 5E9DA 2X1PA 4JRYD 4MJIA 4NBXB 1HHIA 1MVUA 4HJGA 2ERJB 3KPSE 4LL9A 4HKXA 3QDGB 3MV01 2X89D 3Q1SH 3NN8B 1WCBB 3L3OA 3TJEH 3QDJB 4GKNA 4R4BB 2Y5TA 4Z0BL 3BD3A 5IFAL 1BBJA 4PRNA 3VFMA 3EO1B 2X05A 5FFLA 3ARBD 2DQEL 3SDCC 2D7MA 4JM2A 2O5YL 2RBLA 3QIUB 3C8HA 1O0VA 2P5EA 1JPGA 3VI4F 1OB1A 2CKBL 4NN7C 4NNPL 5T3ZL 4PJHB 1QSEB 4P48A 3SPVB 4WU5B 2M26A 3FT2B 3RJDA 4JJ5B 3DRTB 2OZ4H 5FM8A 4XP4L 4HH9B 4JPIB 5D7KE 2ORBL 2C1OB 1DCLA 5I1EL 2AV1B 4Y19E 1MCJA 3VG9C 2XIDA 4EI5B 5GS1A 1Y0LA 3MQIA 1OAKL 3D3VE 4KH2A 4HT1H 4PJ7E 2VUYA 3PGDA 1KLFA 3RWGA 5T33L 4QXGH 1FYTB 3GSRA 1GJIA 3GI8H 4GKSB 2MJWA 3UDWA 2R1XA 1I1AD 2J8UB 4R96A 1UM6L 5BRZE 4GXUM 3HN3A 3SDCD 5EA0L 5AD0A 3E6HB 2VDQH 4MNHB 1AE6L 1RU9L 5GZNC 5J06A 2V2XA 4NZTL 3UTSA 2IPUG 3QI9B 4OM1L 3BYTA 3QWOA 4XPTH 4Y16B 1ULVA 2DQUH 1F90H 1SEBA 3IDJB 5MHSD 1K5NA 4ZUTA 5JR1L 1DEDA 3O8XB 4D9QE 4O58H 1DBAL 2W60A 4LDOB 2XPGA 1JTPA 4JFPB 1ZHNB 2VIRA 4Y8DC 1IILE 5F6HJ 3GKWL 3OKOA 3UTPD 5L9DL 4PJ8A 2V17L 3T8XA 5JW5A 1V7NL 3GHBL 3LPFA 4ZDHA 3C09B 4KK6C 3L1OH 4OB5L 5DA0B 1FVEB 3WIIL 3VXUE 4XAKE 4N0UA 5GZND 5T1KA 1ZTXH 5E2UL 1E6JL 1N4XH 4UDUA 1DQDH 1IGJA 2Q3ZA 2YZ1A 4HMEA 1KJ2A 2B1HL 5FV1L 3SGKA 3OQ3B 4JO4L 3GSVB 2AS5M 1CZ8H 5D1ZA 4EQ2A 4Y5XB 3O6ML 3TCLB 5FGCB 3CFJA 1FO0B 2EDDA 4WI3A 4HUVB 2IQAA 5LG1A 4OD3L 5FKAB 3VRJA 4I18B 3WL9B 1VPOH 2XY1A 4JB9L 4UV4H 4MDJB 1NFDB 4UUJB 4P9HC 3H8NA 4P46B 4LIQL 5JORB 1A6AB 1BZ9B 2APXA 3PHQA 4LRIA 3TBWA 1A3LH 4ZO8A 4KK6D 1C8PA 1P84J 3D25B 5LGJA 5J13B 1MRFL 5EUOA 3GB7B 2E7MA 1RFDL 3QFJE 3MRLB 4LGPB 4M1CC 4RMSA 4OLEA 5T1DH 5ALCL 5L7XL 2C4FT 3OKMB 5DJ0A 5IB4A 3QIWA 1LO3H 2VLMD 3MJ6A 2P43B 3G5YA 4OSUL 4YLQT 3WIFB 5CMAB 3CDFA 2K7QA 4PJFB 3WLBA 5DUPL 3G04A 4R3SB 3RNQB 1J12A 3K2UL 2CDEA 5TE6L 2IALA 3VA6A 3CNKA 5DHYA 4YXKL 4KTEL 2Y72A 3TNMB 4GW4B 3CFKA 1X3DA 4K9EH 4NQVB 1X5XA 3TIEA 4JFOB 5E70A 1U92B 1JRHH 4OFIA 3DI2B 1PG7H 1FGVH 3VH8B 4C56E 4ODTL 1ZSDB 5SX4I 3HNVH 2X1OA 3V4UH 5I19L 4JO1L 1YPZA 4IM8A 2UWEB 1OAUH 3PP4L 2KQMA 3L9RB 4FQLL 2DM3A 1TJIH 2IPTL 4Q0XL 3EZJB 1CBVH 4M1CD 4H26A 3BT2L 5HHOD 3LD8C 4ZO7A 4AMKH 1QQDB 4LK4A 3KR3L 5I8OH 3FO9A 1SBSL 4U33A 5IB3B 4J1UB 1GL4B 3KG5A 2VXSH 4M4PA 2YD2A 5BW7A 4U6YB 1WITA 2V2TA 1QBLL 3N1QC 2AJUL 1K8IB 4XGZA 1YN6A 4PV8A 2JB6A 2DQHH 2A77L 2BSRB 2ZKHL 5HHME 2AKRB 5ITBL 4N0CC 2ATPB 1RUPL 5DRZA 3OAZH 3G9AB 4M3KB 1IC4H 3EIFA 1VACA 3H9HB 2ZUYA 4PGJA 2E7BA 2P45B 2GJJA 4JRYE 2AAVA 2B8OT 3HG1B 4GW1A 1B88A 2Y4SA 2VDLH 1I4FA 3DGCR 4XCYA 2R2BA 4U1LB 4WY7H 1FZOB 1FPTL 3QAZB 3CFCH 3HAEH 2NR6C 4XCNA 5E5MA 2AJZB 3IFPA 4XNXL 1DLFL 1RJZB 4RQQA 2AJVH 4G7VH 2EH7L 2XFXB 5IT2L 3DI3B 1A3QA 4TUOB 2R8SH 1TQBC 1QFWM 1BD2D 1S3KH 5I73B 2W91A 1R5VB 3H3PH 4J4PA 4X9FA 2X6MA 2P47B 5HDLA 4N0CD 4YDVA 2AXHA 1ORSB 3GMRB 4H5SA 4JRXA 2VLRB 5IBUB 2GSIA 1CLZH 5BVPL 5FB8A 4P9ML 1QACA 2VXTL 5C9KA 5I18L 5J4MA 1JGDB 3P11H 4PJBB 3QNXA 3LQZA 4FFZL 3RIAF 3JUZA 2HYMA 3C60A 3P30L 1CGYA 3MO1A 8FABA 3DBXA 5EU3A 1IGMH 4CUCA 1AO7B 4J8RA 2C3VB 4MNQA 2KH2B 3BP4B 5F3BA 3MLZH 3BH9B 1R24B 4JHBA 5GS0H 3MXWH 4JDZA 1HHHB 4C83B 3V8CA 4X5WA 5C0BD 3GIZH 2DMCA 2AK4A 2VDMH 2EYTA 1IFHL 1WC7A 4HGWA 3O6LH 1L4IA 4PJ9C 1U42A 4Y5YC 4FQJL 4IRSC 1W72B 3MYJB 1QSFD 2J6EL 4K8RC 5HGAA 2XZQH 3RWEA 3HI5H 2VYRE 4PGEA 3TYGH 4YUEH 1Y6KR 2ARJB 4TTDC 3F58H 1DDHB 5F8QC 5L2KB 3EFDH 2EDEA 1EO8L 3UXFA 3STBA 4G8GA 4GFTB 5LBSH 1ZKAA 4JLRB 5MHSE 2PUQT 1MPAL 3HI1A 1HE7A 3KPOA 1NGXA 1RV6X 3MGOA 1X5IA 3Q6FA 1JPTH 5IB1B 2DS4A 5HYSB 1ZMYA 1I9RL 2YD8A 5CUSL 1R5IB 3QCUL 1ZGLB 3RI5K 3DYPA 2Z91B 4RGMB 4Y1AA 3UTPE 1UZ6E 1FP5A 5DJCB 3Q1SL 4L3EA 3TJEL 3QRGL 2JTDA 4KROD 4PJ9D 5ETUB 3HE7B 4IRSD 3NCEB 4K8RD 4YPJA 4L3CA 2V9TA 3L5JA 4Z7NE 1YEHH 2X4RA 2UY6A 4XH2B 3L3GB 4WV1C 4IIQC 4QYOB 1VFBA 4TTDD 3S88H 4Q9QH 1TJGH 2OTWA 3CXDH 4YR6B 2NY5C 3O2VL 2HLAB 4ESKA 5SX5K 2OCFD 1FRGH 2NY6C 3DXAB 4EVNA 4IRZH 3X14A 2VDPH 2VR9A 4CU6A 3P40A 4V2BA 5DVOA 2OZ4L 5DD6A 1UJ3B 4HIJB 1C5DA 2VITB 1BEYH 1CFTB 2IFGA 3KPTA 1BWWA 4HT1L 2CKBA 1DQJA 1HWGB 5C3LD 4QXGL 1MI5D 2CUMA 3ZTJH 1FAKT 3QG6A 1Q94B 2P1YA 4HUMB 5D71H 3TVMB 5KSBF 3WE6A 3R0NA 1T1XA 2WWKO 4MD5A 2VDQL 4O2FB 2VLME 1YNKH 4AJ0A 1MQ8A 2K7PA 3FZUC 4XWGH 4XPTL 4ODSH 3HB3C 1U95B 1VKXA 1A4KA 2DQUL 1F90L 4ZPVB 4JN2A 5LXGH 5F88B 4GJTB 3OSKA 3SCMC 5FO8A 4O58L 2FJHB 3WN5A 3I6GA 3TO4A 2XKSA 1HYSC 4OQ1A 4DKEH 5T1LD 2NQCA 1FDLL 2BVUA 2I25N 1TZHA 4O2EA 3IXAA 1CIDA 1FNEA 4D0DB 1IGTB 1Q72H 5FECA 4WW2A 1H3XA 3C8KB 1AXTH 1QLRB 3V7AG 1KJMA 3O81A 4OT1H 3L1OL 5HHOE 1IQDA 4FFVC 1XF5B 2L0DA 1N2RA 2YUVA 3RUGE 4TSAL 1ZTXL 4DKDC 1EFXA 4W4NA 1N4XL 3FZUD 1C1EH 1DQDL 3ESUF 3HB3D 4PRIA 3IF1A 4PLNC 4IMLA 3SCMD 1JZ7A 1O5DT 2BSTA 2MCPH 4ONFL 1BFOA 3Q5OA 1HQ4A 1HNFA 1MFBH 4WHYG 3WS6C 2WNGA 4G6KH 2AQ3A 2OS7A 5JZ7C 1HYSD 2A1WH 4J3UA 2CD0A 3GBNH 5A16B 12E8H 1EEZB 2DWEA 3P9MA 1VPOL 2ICWI 1KXQE 4HKZB 4UV4L 5F7MC 1CFVL 3PWNA 3BP5A 5CJXC 3N1PC 1NGPH 1LE9A 5ACZB 2UVEA 2FIKB 3L3DB 4PP1C 4FABH 1A3LL 1T2QH 4MA1C 4JFDB 5EZJB 3JWOC 5KAQF 3NMEA 4FFVD 3TPUA 2BSSA 4X9BA 4NIKB 1D5ZB 4Y4HA 5T1DL 2FLBT 1YJDH 4X7TA 4NKMA 1J10A 3WIHH 2GAZB 4D8PA 1RJLB 1LO3L 4ZPTA 1UKQA 1ZHKA 3SJVA 4D2NA 3IU4H 1BD2E 3U0WH 3LRGA 3VXNA 1QNZH 5JZ7D 4YC2B 5IW6A 1V8HA 3MRGA 1FFNB 3TCXA 4B7LA 4NJ9H 5EBWA 4D94A 4K9EL 1S9XA 3QXDB 1JRHL 1I7RB 4JY5H 3MRFB 5FYJU 2JIXD 5C0AD 1PG7L 1FGVL 3ARFC 2GK0B 3UO1H 1JHLL 4YDIH 5CKAA 4PJCA 3HNVL 1P4IH 1GZQB 4G8EA 1OF2B 5KSAC 4PP1D 1OAUL 2E7CA 4LVNB 1J18A 4Z18A 4ONGH 3MNVB 5FDYA 1RZGA 1TJIL 1AP2A 4XBGA 1YEIH 1CBVL 1II4E 4K7PY 2O26U 4AMKL 1OLLA 2ENYA 3HC0B 4X6FB 5I8OL 1A14H 3ROOB 5C0CD 4X7CC 1UKSA 1X9QA 4MLSA 2V5TA 4X6DA 4YO0B 5D8JL 1GC1C 5JNYA 1RY7B 1C08B 1H0DB 4P4KC 1VEPA 1RK0B 5B3JE 4FQIH 2DQHL 3JTSA 2HFEA 2C26A 3QBTB 1MLCA 3UBXG 4Z77A 1EBPA 5FV2A 1J0JA 8CGTA 5F9JB 2Q1EA 2BRRH 3ROLB 5KSAD 1EX0A 4L29A 1ZAGA 2HFFB 3RZCC 5F7LB 2IG2H 5CEYB 4UOJA 4QXUH 4ZSOA 4WY7L 4P2QB 3IU3B 3U9UB 3CFCL 2D4DA 1Q8MA 1IAKB 2N7BA 5D9SA 3NIGE 5FGRA 1ZGLM 2VR5A 1F45A 5ANMB 3VD5A 2AJVL 4G7VL 4YGVB 5IBLC 4S1QL 5MEPB 1VESA 4UT7H 4YHZH 4PJEE 2Z8SA 1U8QA 1KNOB 2F53D 3IFOA 4IS6B 4XP9H 2R8SL 1PAMA 2XI9A 5HGGS 2QJDA 1B0RB 4P4KD 1S3KL 1LNUA 1BOYA 2DI8A 2YUZA 4Z7VA 3H3PL 4KRPB 5E9DB 3JXAA 4MJIB 4PB9H 3GMOB 1HHIB 4HJGB 4HXBL 5BOZG 4FQCH 1J05A 4HKXB 1CLZL 5L8JB 1X5LA 1NAKL 2FYYB 1NSNH 4LKCA 4Y8AA 1IKNC 3P11L 5FOJA 3RZCD 1BECA 4GKNB 4MQXC 2Y5TB 1MCHA 4I1NB 4NO3A 3VFMB 1IGML 3HMXL 5AEAA 2R1YB 3ZYJA 3ILQC 1F4XH 3MLZL 4JM2B 4OV5B 1XMWA 4GRWF 5IHUH 5HY9A 3T77A 1T7WA 2P5EB 1JPGB 4PY8J 3MXWL 1OB1B 5GS0L 1MI5E 3VGHA 5IBLD 3GIZL 5MEQA 1U3HB 4M7JH 2VDML 2H32H 3O6LL 2FR4A 4P49A 3ARQA 3LQMA 2XZQL 4TVPD 2F5AL 3F6LA 3MBXH 1ZS8A 3HI5L 1SEQH 1HQRA 2YPVH 5GGQL 3TYGL 4YUEL 2DLHA 3F58L 3BI9X 3EFDL 5GS1B 1Y0LB 2PO6A 1RZ7H 4M02A 4NQCD 3MV9E 1KPRA 1UXSA 3PGDB 2R0KH 3ULVC 2A9NH 1QFWI 2D7NA 1D6EA 5C0DA 1UWGH 35C8H 3GSRB 4MQXD 2BVOA 2R1XB 2ZWLT 3IVKA 3FFCA 4R96B 2NPLX 4KC3B 4G5ZL 3T3MF 3BX7C 3ILQD 1RURH 5AD0B 1YY9C 2V2XB 3UTSB 3V5HB 3OB0K 3OJVC 5DK2A 4YWGH 2BNQA 5EU7C 2JB5H 4Z7WE 2EZ0C 1HCFX 1K5NB 2UZYB 4WWID 4ZUTB 3P4MA 2W60B 3WSQH 3NA9H 2XPGB 2F54D 2VIRB 4GO6B 3LVEA 1LDSA 1RZIB 3S88L 4Q9QL 2EDRA 1TJGL 1T21B 3CXDL 3OKOB 3ULVD 2D9CA 4IRZL 4PJ8B 1WWWX 3T8XB 3T0EA 1ZEAH 4PREA 3V7AE 1EEYB 4ZDHB 4QRRD 4XMPH 2Y07H 3HLAA 4YHOH 4F9PA 4N0UB 3PGFH 1BEYL 1YY9D 1DBBH 5T1KB 3MCKA 3W9DA 3O2DH 3ESVF 4UDUB 1IGJB 4TNVF 4X7DC 1KJ2B 2YC1A 4KGJA 3S5LA 3ARWA 2EZ0D 5EO9A 1P6AB 3RTQA 5D1ZB 4MXQC 4Z0XA 1EZVY 4NQDA 4Y4KA 1AIFA 1K2DA 2AJXH 2OZ4A 4ACPA 5D71L 3CVHH 1U0QA 2IQAB 2IANA 3VRJB 4JZJC 4XNYH 2VSCA 3JUYA 1YNKL 5FEBA 3AS1A 3MCG1 5CILH 4XWGL 4Y89A 5JIKA 4U49A 2PTVA 5LXGL 3PHQB 3MGTA 3TBWB 3ZDYF 5F9AC 1C12A 2C7UB 5L2JA 3CFDB 3TH4T 3WUZA 5EUOB 4DKEL 4CN6A 5AG8A 5C0AE 1JZ8A 5KVFH 1D5MA 3QEQA 5SX4H 3V0AC 4NT6A 5CJBA 5DJ0B 5IB4B 2BVEA 5AAWA 3G5YB 2LQRA 5FYJE 1QSFA 1AQDB 1AXTL 4NHUA 1FV1A 3G04B 1R3IH 1YDPA 4OBSA 4MXQD 2CDEB 4OT1L 2IALB 4JQXA 1I3GL 2AI0H 2BVTA 2UVFA 4L4VD 5EO0A 4AEFA 3CFKB 2CGRH 1XAUA 5C0CE 3TIEB 1A02N 4WJ5A 5E8EA 2WZPD 5KZCD 3FOLA 5JW4N 2CJUL 1CE1H 1C1EL 1B4RA 2FDBP 5GISL 1BOGA 2CH8A 2MCPL 1YPZB 1LP9E 3MRNA 1MFBL 3VJ6A 2V5SA 1JZ5A 4U3CA 1JGEA 5HDBF 4XNZB 3GBNL 2J8HA 12E8L 4H26B 4S1SH 3UP1A 3MRQA 4YGAB 1XF3A 4CU7A 3FO9B 4DUWA 5C0EA 1EJOH 5E8PA 1NGPL 3SDYH 5K59F 1UM5L 3PE9A 1FAIL 4MXVF 1WBZA 3MLUH 5MEOA 2V2TB 4OZIA 3ME0A 5FGBA 4FABL 1T2QL 5SWZA 5GJTH 4XGZB 1YN6B 2OTUA 2W65A 4MX7A 1CR9H 5D6CB 4EN3C 2J4WH 3K80A 1WAAA 2JB6B 3B5GA 2IH3A 4QXTA 4KMQA 5DRZB 1YJDL 2B4CC 2FIRT 1BQHG 4LCWA 4BQ6A 3BGFB 1PGRB 5C6WH 2F53E 1VACB 3MLTA 1XR9A 1Z9SA 2VDKH 1OLZA 5A2KH 3IU4L 1ZLUK 3U0WL 3VGGA 5F7DA 3DWTA 4AENA 1QNZL 3KVQA 4XHJC 1I4FB 4XCYB 4JO3L 2R2BB 1J86A 4NJ9L 5CSGA 1F3JA 1I9IH 4M5YH 3QJHA 4XMLH 4JY5L 3W9EA 4XCNB 5E5MB 1YYLL 3IFPB 5D7LD 5DVMA 5DQJA 1JYNA 1FBIH 3CMOH 3UO1L 3LKQA 4M7LH 4XPGH 4RQQB 4YDIL 4NC2B 1P4IL 3WJJC 4GG6E 1L6ZA 3T2PA 1NAMH 5J56B 4ONGL 3QUMH 4LGSB 1S7RA 1ACYH 4EN3D 4EXKA 4BH8A 1O7SA 1A3RL 1YEIL 4DKAA 3IFNH 4YDVB 3G5VA 4P5MA 4H5SB 4JRXB 2MKLC 2GSIB 5FB8B 1IE5A 2V6HA 4M8VA 3O3BA 2Q7NA 4FQXA 2A73A 3LQZB 4TVPE 5HHPA 2X5PA 3S96A 3KXFA 3C60B 5SWQA 2XKUA 4XHJD 3MO1B 5BRZB 8FABB 4DAGH 1K8DA 3DBXB 2JE8A 5EU3B 1DFBL 2R4RH 3AMLA 1Q9KB 5CZKA 4MNQB 4Z76A 5F6IB 5F3BB 4NQCE 1RUQH 5FYLH 3ULUC 4DEPC 4O00A 3KYOA 5IVXF 3EDFA 4C4KO 2OJZH 4JDZB 4KUCF 4R2GC 4OGZA 4X5WB 2Q76A 2J88H 5ALBH 3MACH 2BRRL 3SE4A 5F7YC 2AK4B 3IKKA 2ZCLL 4G3YH 5FKPA 4HGWB 1WC7B 5HI3D 2BVYA 3UTTD 5F9WC 4JY6A 3RWEB 5HGAB 4QXUL 4LMQE 5KW9L 4K94H 3RVVC 4OCWL 4L3AA 5T3ZD 2XICA 4KU1A 1EO7A 4G8GB 4I9WD 3K81A 3P73A 3KPOB 4UQ2A 4X5XA 2QSTA 1NGXB 1KLUB 4UT7L 3MGOB 4N0YH 4F7EA 2J12B 3Q6FB 3QISA 4Z5RA 4YHZL 3D39A 1HSBA 2F54E 2OR8A 2VZ1A 2SEBA 4XP9L 4UU9A 1HIMH 4PB9L 5J9PA 5FYKH 3ULUD 3HAEA 4Y1AB 1F5WA 1BZQK 1WTGT 4R2GD