2VC2H

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
221
structure length
219
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 219
sequence length 221
ec nomenclature
pdb deposition date 2007-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vc2H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vc2H02
3QZWA 5T3XD 5F9WC 2F5BH 5LWYL 3ILPB 1MCSA 3TBVA 4H1LH 4Z0XA 4KHTH 1MCWM 3BW9B 4MXQD 4PD4K 3O9WB 5TPWH 2IALB 1RVFH 1HQ4A 2VZ3A 2VITB 1GH7A 1YN7A 3MC0A 4N0CC 3V0VA 1DL7L 2KPNA 4Q58C 5JOPE 3LIZH 3STZA 3RZCD 4XVJL 4JVUA 1ZHKA 2ED7A 4CJ0A 4DN4H 2HTKC 5EORL 4ODUB 3VFTB 4FFZL 4NN7C 2YOCA 2DAVA 4PRIA 4H26A 1A1MA 5EOQL 1Y0LB 1YEGH 3GMNA 3PP3K 4RA3A 1MWAL 4PTTB 1TIUA 2Z92B 4NKOB 3HUJE 5EBWB 5J1SC 2GTWA 5IMKA 3MLZL 4JREB 3B9AA 3F6LA 3O2DL 2IG2L 3GMRA 3MLXL 4NQSB 1SYVA 4UAOB 5DRXA 4F15B 3WCYA 5C0RL 3NCJH 4WUUB 4PV8B 2AKRB 4PG2C 5EZIH 1NCDH 5CJ8A 4NRYB 3KR3L 3PWPA 1MCOH 3KYAA 4L9LB 2CR3A 2P24A 12E8H 4XB8A 3CH8A 1XGPA 4APQD 4XNUH 2X44D 3SDCA 3G5VA 4NNYB 3SE9H 1T04B 3QUXA 4ERSL 3JUZA 4U1MB 1A0QL 1BBDL 5DR5L 1QSFE 2PW1A 1NGXA 2EECA 1NGZB 1U8QA 3QJFA 3NVQA 1HCFX 3KXFB 4MCYA 4LFHG 1B88A 4DOHB 1KIQA 2A77L 4QRRA 2PYFB 3VD3A 1XR8A 1ZVSB 1CCZA 4P3DB 5CJBA 5GS1B 2YPLE 3PGFH 4QRTB 3JTSB 3TM6A 4LHQB 5ITFA 3ZE0F 4JFHD 1I7ZB 4KAQH 1GGIL 2HLAB 2PYED 4TSBH 2X4UA 5K9JH 3MRPB 5HD8C 1H0DA 2DMBA 2ZP0T 4X5WA 4FXLA 4M6NL 2PN5A 1CGSH 1AC0A 1WWAX 3ZHLA 3QJHA 4OUUA 4FQ1H 4NPYB 5CBEA 2NTFA 3SJVD 4DZBA 3CZJA 3C8KB 1EO8L 2SEBA 2CLRB 1A3QA 3I50H 3OXSB 1OGAA 4JQIL 1W2KT 1UH3A 4OGXH 3L5HA 4CMMA 1N26A 2F54D 1NSNH 1RJYA 1X3DA 3O4OB 4LOUC 4AMKH 1SJVA 4M6AA 2YA1A 4MS8D 4K9EC 1VB9A 5C07A 5SV4A 2P4AB 3ES6B 3IDGB 5IB2B 1EHLH 1Z9LA 1F97A 5BO1H 1DSFL 1NDGA 1SY6H 1H5BA 3KPSD 4P5TD 5GRXG 1JHKH 3OV6A 3B3IA 2ZUSA 3VD5A 4X9FA 3INUL 3H9SB 2W07A 3C60C 1G84A 1T1WA 2VDLL 1FZKA 1IGCH 3ZKNC 5I8OH 1NEZB 5F7EL 1A2YB 5C0BB 4GBXA 4QXWA 2BDNL 4M48H 5BQ7B 1MFBH 4YUEH 4G6AD 5GSRA 1JGUH 4X4YA 4DTGH 5I15L 3Q6GH 5C9JA 1UWEL 4P0DA 1HCVA 2DJ4A 1MFCL 1XH3A 3GMLA 4PRBB 5ACZB 4QWWD 2HMID 1B0WA 5FGCB 1FNSL 4Q9CA 4AJ0A 3VMNA 3X3GH 3MZGB 1KJ2H 2V5TA 3LH2L 3FHQA 5IOPB 3OGCB 4NNXA 5C0CA 4FFWC 3U30B 4LLMB 3S37L 1G9EA 2WP3O 3GSUA 4NKIL 2C9AA 1ZT1B 3O3BA 3MRMB 4PJBE 5F7FA 4JCLA 1IL1B 1I3UA 1AHWA 1T3FB 2R8SH 5JIHA 2NY3C 3D0LA 4AEHH 5F8RC 5HI5D 1EBPA 5DJ6A 4HUUB 5DF0A 4AK1A 1RAMA 3UPRB 4GFTB 4BM7A 1AY1H 4WU7A 1KT2A 3OQ3B 4JB9H 4U6HA 4BA8A 1YEFL 3MNWB 1G0YR 3DBXB 5ISZB 4LAQH 3NABH 1RIVL 3UTZB 1VADA 4JFFD 2JB6B 3V52L 2Q8BH 3MV01 3V5KB 4XVUC 4U7SA 2CDEA 2F9BT 4G9FE 4RFEB 5BV7H 3IJYB 4LLDA 3MUHL 5C0GA 1EGJH 2HA1A 4HH8A 2WLZA 3ULUH 2P43B 1P6AB 5TQ0L 1UENA 3GHBL 3NPSC 4F8TA 4R4FL 5KSVA 1U3JA 2R56L 3SGDH 2ITDA 4MQXD 4HS3B 1VCAA 3L6FB 4L8CB 3UTTA 5D1XA 4YZFF 2WBKA 1RIHH 3S3SA 1TJHL 4JO3H 3BKYL 1KTLA 4GRWB 4OLYH 4Z9KB 3T0XA 1CDHA 3U0TA 3MX0A 1PQZB 4TYUA 2BVQB 5DRZB 4OSUL 3EW3B 4WWID 2IGFH 2WK2A 4MYWB 4NQDB 2R2HB 4NUGL 3BZEA 2WNGA 3TFKC 3IFNH 3DV4A 4YXHL 5JUEL 4V2CB 1EEYB 5T1KA 4UV7L 1TJIH 2VDOH 2R69H 5E00B 4YE4H 2HVKA 1PX4A 3GI8L 3QUZD 3TIDB 5HVHB 1N64H 3UJJH 1BFSA 3EZJB 1OQOA 4G80B 3G5YB 5A3ID 4JPKH 1QYGL 1R3KB 2V5RA 3HMWH 5DO2C 1NCAH 1MVUA 3JV4A 4Q0XH 2BSSA 3CLFH 3PL6B 1MCIA 1I8MA 2P8PA 3UJTL 4F7TB 4OM0L 3RTQC 4OI7A 4K3EH 1IGJA 2W60A 5KANI 3IRZA 2JB5H 4H1LB 4UT6L 3TNMA 3VE0B 4RGMC 3QH3A 1W0YT 1FZJB 1A64A 4QXUH 3ULUF 4R0LC 1J87A 1O7VA 4DFHA 5DJXB 4WO4A 3UTSA 1ND0B 3GNMH 1RI8A 3BIKB 3QZWG 1HQRB 5L7XL 1OGTA 3VW3L 4LAJH 4NRXA 2O61A 4HFWA 3W5MA 5K33A 4QF1B 2ITCA 5GS2H 4PJ9A 4O02H 3MFFA 4UB0H 3HC4H 1CFVL 1KFAL 4UU9A 4EI6A 4OZFA 3P0YL 1RURH 2X4OA 3UDWA 5TDNA 1NMAH 5KJRH 5GISH 3GJFH 3O8XA 1H3PL 1I7RB 5K93A 3EO9H 4HJ0D 4N0YL 3ZT5A 5BVPH 4GAFB 2VABB 3AAZB 5B39B 2H9GB 5E56A 2HWZH 3PHSA 1JWUB 2DLIA 4G8GD 4LSPH 4YHZL 4TTDD 4XP5H 2VZUA 4HX1B 4H20H 4PLKC 3KXFE 4DOHE 1CVSC 4N0FA 3WDIA 8CGTA 1YMMB 5EBLB 1JP5A 1S78C 4J6RH 2Q7NA 4JKPL 4FP8L 1CDJA 1IKNA 3DURA 1HHGA 1NAML 4LCIL 3DRQB 3OL2A 4JJHA 4JQXA 3NZ8B 4KI1A 3MRIA 3CMOH 1JNNH 5IMMB 3RU8L 3ZTJG 3GMOA 4TQEH 4HJGA 1G6VK 4HIXH 1IQWH 4QHNB 4G42A 3V9FA 3K8KA 4OFKA 4YDVA 2FBJL 4FZEH 5JORB 3ARWA 3OKMA 4HH9A 3LQAC 1PG7H 5C2BH 1NGYB 5BJTA 2UVEA 4PBXA 2CK2A 5CINL 3G5ZB 3LKSA 3S3JA 1FCGA 4IRSA 5FGBC 1WISA 4JZJA 5CHNA 1YY9C 2IQAB 1FNHA 3EJZD 3QG6A 1XIWA 5ESQA 2MKWA 1PKOA 5KVGL 4X99A 4PY7B 4KKNA 3H9SE 5JR1L 1NANH 3RNKB 3H9HA 5FHBH 3SGEI 3V5DB 2PXYD 3VXPA 4BQ6A 1WZMA 3QCVL 4YHLH 3IF1B 1R5VA 1BJ8A 1FFOB 5C0BE 4U1LA 3DGGB 1F02I 4XAKD 3ESVF 1JHTB 2X40A 3DETD 1F6LL 4F3FB 4C56D 3CSBA 3HC3H 1HEZB 2VXSH 4FQ2L 4M6ML 4YX2H 5JOFA 3MREB 2QJDA 1AKJA 5DJYB 4UT7L 5FGCE 4KJQC 1NC2D 4WY7L 5TE6L 3S35X 5I66A 4HZAA 3QULB 2DKMA 4JFDB 3RGVC 2J8OA 1A21A 1J1PL 5IEHB 3EOYG 5I1KL 1OTUD 5HVWA 2FECI 1S7TB 4XCNB 4K3JH 5FO8A 2G2RB 4JFZL 3L3DA 1WEJL 2R1WB 3TNNA 2I24N 1UQSB 4KKBD 1T5WB 3GSWA 2VLJA 1A6WH 3MQIA 1IAMA 4DKEL 4FABL 3ROLA 3I75A 4XCCL 4U1SB 1DQTA 4WCYH 4L8BB 3B2VH 1V3KA 4J1UA 2V2TB 4H8WL 1KJ2B 4ZUUB 4LCYA 5GGSA 1KIPB 2GJZB 1I8KA 3ZDYE 4M7LL 2FZ3B 1RZIB 1CQKA 1RK0B 3HMXA 4LSVL 1UXWA 4XMLH 4MHHI 5K9KA 2XRAH 2I26N 3HFMH 3SDDA 3QWQB 3QNYA 3HZVB 3ARGB 5EU6A 8FABA 5EOCJ 4R4NC 3QUYB 2XKNB 4UNUA 1BBJB 1CD0A 2Q86A 3DMMB 4L3EA 5EB9A 3KLAB 3NIDF 3QIBC 4X9IA 1UB5A 5FGRA 1D6VH 25C8L 1IM9B 3O11A 5EWIH 5IESH 1EPFA 1M05B 4A6YL 5D7JD 1I3GH 4HUXB 3W82A 3GKZA 4BYHA 2X10A 4IRZL 4NQEB 1JPST 2BNQA 3M8OH 1IM3B 1OAXL 3DX8A 4X7DC 3FRUB 3MXVH 4RQQA 3D85D 1QFWM 3MBEC 5IW1A 1KEGH 4X80L 2ICCA 4DGVH 1I8LA 5KANG 3QDMB 5MENE 1T21A 3HZKB 1T6VN 4BQBA 5BV7B 5I1GL 4UILH 5ENWA 3OJDA 5LXGH 3QG7H 4ESKA 2FB4H 5BRZA 2GK0A 2C4FT 4ZPTB 3VWKB 5HHVL 1FE8L 2GT9B 3V0WH 3VXMA 4RFNC 3GDBA 4NQDE 4J2XA 1CFQB 1MJ7H 1N7MH 3HAEA 2F5AH 4WI3A 2EE3A 5DA4A 5D1ZA 3UZQA 4WHCA 4BUGA 1AD0A 5J1AB 2NY7L 1T5XA 3KG5A 4ZFGL 5IF0B 2OTWA 3CZFB 4Y7MA 4PIRF 2GTZA 3WXWH 3X3FL 4JRYB 1IGIH 2EZ0D 3QO0A 1AD9A 2Y7QB 3MCKB 1KCVL 4UBDC 4XGZA 4R2GC 3JV6B 3QSKB 2XICA 2FDBP 1N8ZA 4KKAC 5IIEA 2CO7B 4L4VB 5J6HA 4P46A 1M1SA 3QHZL 4JDTH 1EVTC 4LCUA 2PCPA 3HR6A 1JRHI 1RULL 4K7PL 1GHFH 4UMGA 3DI3B 1A5FL 1JTTA 1I1YA 3K80A 4HUMB 3RX5A 2M2DA 2JLLA 2HFFA 7FABL 1S9WA 3W11C 5HYJA 3SKMA 3C60A 3ZE0E 2VO5A 2ICWB 1CL7L 1T1YA 4FZ8H 1YNLL 3VFSA 5DURD 5FO9A 3FO1A 2IFFL 4P2YA 3WYRA 4OZIB 1S9YB 3VXOA 3V4VH 1DJSA 4R90H 4KKLD 1K4CA 4PG9A 4I4WB 1GSMA 4QNPF 5LCVL 1PKQB 3ELAT 2W0KA 5E4EC 1T7XA 1CR9H 3BP4B 1OPGH 1T0PB 3T65B 4D9QD 3CSPA 4G43B 3OKKB 4FQCL 3X14B 3LDBB 5EUOF 3S96A 3SY0B 2QV2A 4WJ5A 4FXGB 3MR9A 5EU7E 3F7QA 3VJ6A 4YAQB 1WBYB 1IC5H 2DWDA 4PB9L 2Y23A 5DJDB 1QTYT 1T0MB 5FXCH 1M7DA 1YMME 2GCYA 4DKFL 1M71B 3TVMC 3QWOB 4X4MA 1YEHL 2VLMD 1N5YL 3ORJA 2YEZB 3BWAA 3D2UD 1BLNA 3F7YA 3GJFB 1KLGB 3FQUA 3NZHL 5KSAA 4WFHD 3K8LA 5C08D 4WGWB 5ADPL 2QHRL 1N6VA 3T4AB 3ARFD 4NC1E 5DD3L 3QDJA 5DVOA 1TETH 4OZFG 4NIKB 3CX2A 4UDUA 5FOBA 3ZHKA 4BJLA 1L6XA 4LKXA 3DSFL 1K5NB 1GAFL 4LARH 5A16B 2ZZUT 4GXVL 2R0KH 4Y5VC 1PLGH 4PRNA 3O0RL 2BVTA 4GRLC 4L1DA 4ZS6C 1F90L 2OTPA 1D9KB 2DTMH 2A0LD 3T2NL 3EFDL 5TF1L 2YUVA 1A3RH 4NM8H 4KTEL 1KUMA 2VISB 1MLCA 5DQJA 4WEBL 1GC1L 2UV3A 4YDIH 2I07B 1YEKL 4P99A 5L9DL 1IGTB 1KPRB 3MUY1 1EHXA 4APQA 1SHMA 3LS5H 5T5FL 3DSNA 1FJ1B 3QWRD 1AGCA 2IADA 3D6GA 4ZAKD 5AD0A 4AIZB 1XGUB 5HGGS 4PTUA 4MQTB 5D2LA 1T1XB 5EIQA 5EIIA 1U8MA 3CU1A 4MHHG 3RY6C 3DHMA 3WD5H 1DANU 1AGDA 2B2XL 3C5SB 4X6CA 3GBML 3EYSH 2XXMB 15C8L 4NZJA 1QSEB 2A6KB 1U8JA 3CDYA 3HI5H 2FJGB 2ICEA 1FYTD 1JGVH 2DYPD 1MCRA 4C83B 1JGDB 3O6FD 3UROR 4JFDE 2LV4A 4QYOB 4OZ4A 3V79C 4GAGL 3K2UL 2X4SB 1FLRL 1B9ZA 1AH1A 2ZG2A 5KW9H 4DUXA 1CVRA 1BVZA 2ZCKL 4HKJB 4LLUA 1JNJA 3G5XB 1YQ2A 2F54A 5KSBA 1T4KA 3BKJH 2E9BA 4JANA 4O00A 3O3AA 4P2OD 4F9PC 1KB9K 4YZFE 4ZO7A 1D5XB 4E5XA 4HWEH 5DHYA 1WV7T 2DTSA 1I1FB 1LK2B 4PJGA 3LN5B 5E2TL 2NXYD 2OZ4A 3LEVL 4R26H 5J06A 2JK5B 2OJZH 1OT1A 4HK3N 1F11A 4MVBD 4YWGH 4POZC 1TTUA 4XI5C 3BVNB 4YFEA 3IETA 1QOKA 1HH9A 2ATPA 4MSWA 1NGPL 3U4EB 1A7BA 3GB7A 1J05A 2AJUH 1UZ8B 3GKWL 4KROD 3S7GA 4JY6B 5IBUG 4D0DA 4QHUB 3RUGA 4BFIB 1G1CA 4S1QL 2E8ZA 5A2LH 3QNZB 1INEH 3MNVA 3DYMA 4KRPD 1B0GA 2R2BB 4NQEE 4QHLB 5SWQA 3N1FC 4GOSA 4Y19D 5H94A 1MRCL 9CGTA 5H35A 4Q74A 2FGZA 2AQ3A 3C09B 3F7VB 3O3EB 4NP4H 5LJYH 3L1OL 1WZKA 2ID5A 2NY0D 1X5FA 3RAJL 1A9EB 3QDME 5IEKA 2C1OA 1JL8A 4RGND 5DT1H 2A2QT 2YHGA 3TJEH 2BY1A 2VDPL 3QPXH 5L88L 3FKUS 4ELMF 4HPYH 3OKEA 2CD0A 2AEPL 1OTTC 3MRKB 4HWNA 1W0WA 2EDFA 3LRGA 3ULUE 4RZCA 3MLPA 2VDKL 3G04B 3MV7A 5DYOA 3PABB 4M7JL 2GITB 2I27N 4XVTH 5TE4L 1QPXA 3VXSD 2C1PA 1OSPH 3PWNA 5L6YL 3TYFB 4ZUTB 2G60L 3L7EA 5DJZA 3WNKA 2DQFA 5EZOL 2ZSVB 3SCMA 1FP5A 2D9CA 1U91B 1XGYH 2Y25A 4NQCA 1MFAL 5K9OA 5HYSA 43C9A 4Q2ZB 3PJSB 4JRYE 1U42A 5EZJA 1F3DH 1C16A 5EFIA 3D25B 1QRNB 1LMKA 3MYJA 4OF6A 2ZCLL 3L9RA 1NCNA 2W9DL 3RDTC 4XBEL 5GGUA 5GGVL 3BN9C 1OOAA 1TZIA 2DLTA 1LP9A 4L4VE 2C3VB 5EUOB 1TCRB 1DFBL 5D7IB 5DEGA 3IKKA 3KAAA 1DN0A 3RHWF 1HZHL 1I9IL 5DS8B 1S7RA 1YEIL 4HKXB 4HIEA 2F19H 4PS4L 3E3QC 4OFYA 3WO4B 5F1IB 2EO9A 1W0VA 1R5WA 2YXMA 4LHUA 4O5LL 1JN6B 2X4TB 4IOFD 2AS5M 4ZNCD 4ETYA 3RPIA 1AO7D 1I7TA 3FO2B 1NDMB 4KY1H 2YKLL 2HTKD 3DMMC 4EIGB 1ITBB 1C08A 4JFQA 5CS7A 4OZIE 4WHDA 3FQRA 3AY4C 1UWXK 3AREB 1B90A 1PKQE 3D39D 4MGXA 1EDQA 2BHUA 1RJCA 3WKML 32C2B 5D2NA 4XNMA 3DRTB 4RNRB 3ULVH 4ORGB 5CJ5A 3SDXA 3EYUH 5SX4H 3RGVA 1HHKA 1BREA 3QXDA 4Y1AB 3VI4F 4RX4A 4OCXH 4YBLC 3FB6B 4M4PA 5F89A 1T0NA 2VXQL 3IVKB 4HBQA 3CFDB 5FDWA 4JJ5A 2J8UA 1NFDF 4FQHA 3HC0A 5JQHC 4XPHH 3HG1A 3RWCA 1S7VB 3R8QA 4P9MH 1MJ8H 2X9YA 3CK0L 4CN6A 3P30L 4X8JA 3O45B 4KK9C 5SWSD 5FA4A 4CADB 4MD0A 1CLCA 4Y0GA 1MFEH 2PO6D 3PE9A 4Z7UA 1VFUA 5JXEC 5F88A 2Y5TA 4NM4H 4PJ7F 1CLOH 2R9HC 2YMXH 3L3GB 1MWAA 1HXYA 3P3YA 6FABH 3RNQA 3GRWH 1J8HA 1BGXH 5C3TA 1H3GA 4CUCA 1ADQL 3EYQC 1QFOA 3LQAL 3TT1L 3BUYA 4OLXH 4GT7A 3BXNB 4PRDA 3W9EB 2VLKA 5I1JL 2VC2L 4WIQA 3EJYD 2EYSB 1F3DJ 2AW2A 4WWKD 2AP2A 2LAAA 1VFAA 2W9EH 4G8GA 4HPOL 2VXUL 2F53B 2NY5H 3ULVF 1X5AA 4WI6A 2A38A 3CUPA 2DBLL 3BAEL 4PGDA 1YEEH 1ZWIB 3NACL 1A6TB 2D2OA 1OHQA 2YD4A 2FO4B 3D3VA 2G5BA 1QSEE 2VLLB 1OP3K 1G7LA 3AVEA 1MIMH 2EDEA 3LSOA 2UZIH 5D7KE 3QPQC 3MA7B 4KFZC 5CZXD 4XX1G 4J3UA 2B5IB 5E6ID 1RZ7L 3JUYA 1CK0L 3MRBA 3D87B 5EO0A 3P4NB 5F7UA 3T09A 2Y06L 1Z0NA 3NIDE 3P4OA 1QHPA 2JIXA 3EYFB 4PR5A 3NGBB 2F15A 5T3ZH 3P9LB 3GO1L 3O6ML 3JWOH 1J0KA 4HWBL 4QTIH 4QCIA 3VFGL 1BECA 5IHZA 3D69B 4NKDB 4WUKL 2QADC 5IVXA 2P5WA 3SDAD 4JO2H 1YY8B 4L8DA 1QSFD 3ZKXB 2VLRD 1CU4H 3E6HB 4OGYH 4ELMB 2EDBA 2L0DA 1LGVA 4N0UA 3SE8L 2APTA 4CVZA 5I1CL 1PZUB 4PJEB 1N2RA 2YPLD 4D3CH 5HYEA 1N4XL 5T3XH 2NY3D 3V4UL 3A67L 1JPGA 2YSSB 1UC6A 2B7DT 4MDJA 5IHLB 2CXGA 2CJUL 2HJFB 3VWJD 5JA8B 4P59L 5IB4A 3W81A 1OB1A 3EYVA 3RWEB 4RAUA 5JXAH 1PBYA 4D94A 2EXYC 4XPGH 1HK6A 4LCWA 5CZVH 4HUVA 2FH6A 1KCKA 2R0ZL 5F1NA 3WNLA 3BH9A 2EDDA 5IK3B 4B7IA 4P23D 5D6CB 1FH5L 2MFNA 4R7DA 1JYWA 5CP7A 4XXCC 3ALPA 1RUAL 4NFCA 4XVUD 2YR3A 1C7SA 2DLEA 4FFYL 4PJ8C 4KI5C 3KPPB 1X5GA 5HGHB 1C5DA 4F80A 4N1EA 3BYTA 4P3WA 1FL5A 5I2IB 5GRUH 4M3JA 5DHXB 4XBGA 5KZCD 1BFOB 3FRPA 5GRZA 3QT2A 3TV3L 1ONQB 3E1F1 4S11A 4YHOL 1UM4H 3TVMA 4PJAA 4M8QB 1I8IB 1CICC 2NZIA 3HE7A 4AL8H 1E4XL 2Z8SA 4JM2F 4Z5RA 3U4AA 5FB8B 3N06B 1A1NB 4Z95L 2BJMH 4MA8H 4MD5B 5E9DA 2O26U 1ZHBA 2R1XB 1IGYB 3L3OB 1QRNE 3UAJC 4QNPE 4I0CC 2R0WH 2M1KA 3OF6D 3T0AA 3BDXA 5LAXA 3DJ9A 4Z7WA 1RZJH 4JRWA 1QQDB 3FQNB 1QFWH 5B38A 5I18L 2HJLA 3RIAK 5EUOE 4Y5VA 1I1AC 5D7IE 5D7JA 1JZ8A 3IKCB 5B3NA 3JWDH 1YECL 1MVFA 4JHZA 3GBNL 2CIKA 3N85L 5C0FB 3CFCH 3PGCB 5HTSA 5E5MA 4U1IB 1G9MC 1RIUH 3D85A 2AJXL 5C09B 4EI5C 4P48A 3O41B 4PGEA 3WLWD 4Y4KD 4JFED 1M7IA 4UT9H 4OLUL 3RTQD 2GFBA 4MCZB 4WU5A 5EBMB 2DBJA 2EICA 5JQ6L 5D6DC 3W2DH 2WBJA 4U1NB 5IBTL 2DM4A 1RV6X 4W68A 3FB7A 5D7LA 5DUBA 2NNAB 1BFTA 4QY8A 3MO1B 2MCG1 4PJ7B 2BERA 1A7PH 3HLAB 2IMMA 4G9FD 2Z91B 2J4WL 1GGCL 3DI2B 4NCC1 3LD8B 1LNUA 4NKQB 4Y1AE 4R7NA 3O6KL 4ZODA 1RZ8A 3S8WA 1HXMA 4X5XB 3OX8B 4O2CB 4ZO8A 3QHFL 2LVCA 3FOLB 4H5SA 5J13B 4QRPA 1RUQL 3C5ZD 4OZGA 3NFPA 1XF1A 2EH7H 1LO2H 1J8KA 3FZUC 2Z93A 1CDIA 3K1KC 1P7KA 1QLEH 4JHAH 3S4SB 2CIIA 1MUJB 4FS0A 4AG4L 2OL3H 5BW7C 1U3YA 3FO9A 2QEJA 4LPYA 3RWHA 4ALAH 1MAML 1DDHA 2XQBH 2ILLA 5C70A 4J8RA 1T89A 4F9PA 2FL5B 3EYOB 1PFCA 2XA8H 1UKQA 1UACH 3AS3A 5EC1B 4OV5B 3IDMA 1LEKA 1NMBL 1S8DA 1KSRA 3EOAA 4GMSL 3OKDA 1EHNA 1RZKH 1M6OA 4TPRH 5DVKA 5CZKA 4Y5XA 1QPPA 1JWSB 1PVHA 4KTDH 1BF2A 2X4RB 4NZUH 5FF6A 1BVKA 1WCQA 3OTTA 3BZFA 4OCWH 5I1DB 4OAWA 4JAMB 1U95A 1H8NA 2IJ0C 3MLTB 1ZGLA 4UQ2A 1DQJA 3OPZH 5FUCE 4IMKC 4A2LA 4S0SD 4NJAH 2O93L 2NZ9D 3BOVA 5C6WH 2F53E 4OZHA 5A40E 3I3DA 3Q5OA 2VR9A 3TZVB 2IC2A 1UB6B 3C2AH 2Y07H 4U7KA 3UPAA 1YY9D 3MBXH 4JLRB 1JFQH 2FRGP 4LASL 2J5LB 4GW5B 1NC4D 5ADOH 3LIZL 2CUIA 1AGEB 4LF3A 3RKDC 1BZ7B 1OF2A 3D2UA 2ZUUA 4KDVA 1CLYH 4YGVA 4L8SB 2B4CC 2D03H 2NY4B 3BRDA 3GJFK 2VERN 3CAFA 3V4PL 4MNQB 4Q9QH 1IZKA 1MCFA 4JRXA 4XAWH 3A0OA 1V3JA 1KN4H 1V3MA 4K71C 4X4XB 2HH0H 4WUUD 2CPCA 1NAMA 2OK0H 5E2WH 4Y2OA 1K8IA 2HJKB 4PRHE 4R97C 4LVHB 1U3HA 3VXUA 2ZOLA 1EXUB 3S37X 3L3HB 5J11B 4KJQD 5DJ8A 3EDFA 2XQYK 4XPAH 1EEQA 4KXZI 1HNGA 2VQ1B 2FX9H 4DVBA 1Q94B 2LFGA 3RL1B 4QOKD 3WEXB 1D5MA 1VPOH 5EZIL 1NCDL 5ACMA 2KDGA 4J4PC 3RDTA 1RZGB 1TENA 3QQ9C 4HKBA 1BAFL 3KGRA 4XCFH 1MCOL 3LS4H 1XF2A 4ELME 12E8L 3SOBL 3HPLB 1T22A 4EIZC 2C7UA 5JW3H 1ZAGA 4RSVA 1Q9OA 1HWGB 4LVOC 4PJEE 1LVEA 4YFLF 2HN7B 1LO4H 2A74B 2ZPKL 2CLZB 4ODWA 4ZAKA 4RDQF 3ECBB 2KH2B 2CH8A 2VZSA 4M62H 1CT8A 4J3WA 3VFUA 1WWCA 1F3JA 3X17A 2Q3ZA 4LVNB 2BNUA 3U46A 3LKOB 4JM2B 5I8CA 4KAQL 4KK6C 1RPQA 4Q7DA 5HGDB 4TSBL 2YPKB 2CKNA 4KK5C 4NYLB 1CGSL 3S5LB 4R4ND 5DVMA 1G7IA 5EZLA 3BO8B 4X5LA 3QIBD 4PBVC 5LGHH 3E6FB 1MF2H 5EORH 1FVDA 2BC4B 1NL0L 3ARUA 3H9SD 2ZNWA 5KG9B 5GSVB 1FGNL 5H2BB 5CBAB 5JDSB 3QI9C 5BO1L 5HHNB 5ETUA 4HC1H 3MBED 2N4IA 1JHKL 1S7UA 5CEXB 4YDJA 1KTKE 2BOBA 3BP6A 1IGCL 4ZUWB 3HS0A 1ORSA 2WZPD 4OFPA 5C8JB 1DVFA 4RGOH 3NGBC 2H8PA 5I76B 5DDHB 1AQKH 4M48L 3DVNB 2ZUTA 4YUEL 2X4NB 4LSRH 5C0DA 1JGUL 3QDGE 1WIUA 3LQZA 3Q6GL 4XHJD 1ZA6B 1JPTH 1J88A 1QFUH 5I74B 3ZKXC 5LG1A 5JNYB 5GHWH 1NAKH 3MUGB 4DZ8A 4ERSH 1AXSA 1YN6A 3VI4E 4OFIA 1BBDH 5DR5H 1U8KB 5H37G 3X3GL 2FYYB 1KJ2L 2OQJB 3CVHH 3IT8D 2Y5EA 4GXUM 2G75A 5BZWA 4A6YA 4EN3A 2DWEB 1RZFL 3OB8A 3F5WA 1RUKL 4K3GA 1FFRA 3DXAE 4KVCH 1OWWA 1XCQA 4KKAD 4PV9B 4Z6AT 4GG6A 2C3WA 3SGJA 4XNQA 5C2UB 1NUFA 5H8DA 4EUPH 1FFNB 1GGIH 1S5IH 4AT6B 5IR1B 5C0EA 5ISZD 1KCRL 1IZJA 3CXDH 4KHXH 5GGSY 4AEHL 4PJIA 5I73C 3UXFA 2ZWLT 3MRCB 5IV2B 6CGTA 4JG1H 3GZKA 2H32H 4PJ7E 2D31A 3HI6L 5B38G 3VXSA 5ANMB 2ARWA 2Q7YB 2Y72A 5CJQL 3IDYB 1AY1L 1DE4A 4POYA 3BRGC 4JB9L 3BZ4A 4ZPVA 4WTXA 2NX5B 4RMWA 4MX7B 3FQWA 3QQ3A 1A6VL 2ESVB 4LAQL 3PP4L 3IAGC 3NABL 4UOW0 4NQVB 3WIIH 2XWBB 5MERB 2Q8BL 5D5MF 2ARJB 5GGRA 1CDGA 2WWMC 2VQUA 3F12A 3QEQB 2HFEB 5F6IB 4G5ZH 4ZS7H 2YD2A 5I1IH 3IJSB 2CRMA 1LQSR 1ZLWH 1XR9A 1EGJL 4Y4HB 3VD4A 4R4BA 5KS9B 3FONB 2X9XA 1ZT4B 4NZTH 3LV3B 3UJIH 1BQHB 1R3JB 3I9GL 2ZSWA 3ULVE 1QBAA 3VRJA 1EFQA 4QRSA 3HB3C 3TA3B 2CDGB 3KPSB 2A6DA 4NO5B 3BT2L 3ESUF 3BPLB 3DVGB 1CGUA 1MH5B 3IS1X 3GSOA 3KDMA 5AUMB 2I9TB 4OCRL 5DSCA 3JV0A 2VZVA 4YC2C 4XRCA 1RIHL 4UDTA 4NQDD 2X7LA 1D3CA 4L3CA 4JO3L 3WS6C 4O4YH 4OLYL 1MRFL 2OL3B 3SBWC 1OAYH 4WFGE 1FNEA 1KJVB 2V5MA 2IGFL 1UG9A 3D39A 1JPFA 4M93C 3DX6A 2OJEB 3IFNL 4NBZB 4NKIH 4P9HC 1OLZA 1CE6B 1TQCC 4OF7A 2XN9B 2R69L 3PL6D 4YE4L 2XZCH 4GRLD 4AIXA 1INQB 3IU4H 3PWLA 1U93A 4EDXB 3UJJL 4KKCC 2R2CA 1A6UH 3VG0H 4OKVA 4GW4A 3QISA 3ULSA 5HGAB 2VDRH 4JPKL 1V8HA 3CFKB 3B6SB 1NCAL 4IJ3C 3K46A 3CLFL 5LBSL 2AJYL 5J57B 1T1ZA 5JMOC 3WIFB 1FFPB 4TVSa 1U8LA 1YEFH 5F9DC 5J9PB 1FO0A 4WW2B 4F2MB 3VFOB 4K3EL 4MNQE 4JE4B 5EU4A 1RIVH 4ZSOA 2JB5L 4QTHA 1G7MA 3KPRB 2A83A 4GKNB 4QXUL 2DLHA 5I1HH 3HZMB 5J56B 3FOMA 3S9DB 2GJJA 1FVCB 3GNML 2PO6A 4ZTPH 4X83A 4L3AA 4Y8AA 3WIHA 1CI5A 4OF3A 5C86A 1VERA 3IDIB 5TH2B 1I4FA 1NBZB 4JFFB 4LLQA 3UTOA 5TQ0H 4R4FH 2R56H 1RURL 1R5IA 2A73B 1NMAL 4U1HA 5GISL 2V2XB 2APXA 1K6QH 3Q5YA 3EO9L 4UIMA 5BVPL 1TJHH 1YMMD 3REVB 4WWKA 2AK1L 2ADGB 3T0EC 4LSPL 4NSKB 3MROB 2CRZA 4XP5L 3GGWA 5T3ZE 4IOIA 4P4KC 5DK0B 3RY4A 1BD2E 4H20L 1SJEA 3FN0L 1QO3A 4XTRC 5BVJB 1P4LA 2CO6B 3OZ9L 4NUGH 2AJ3A 2YBRA 3MLRH 5EPMA 3TBYA 3U4BH 4AH2B 4UTBH 4U31A 2J88L 1NBVL 1S9VA 1HI6B 3V6ZA 4YXHH 2IH3B 1BZ9B 3HUJA 1JIBA 3BQUC 2QL1A 3IXTB 2PW2A 3QFDB 4BH8B 4GS7C 3CIQA 3GJEB 5E6IA 2LU4A 3EIFA 1YMHA 5E70A 3VXRE 5DK3A 4XI5D 1JNNL 5T3XE 3RWIA 2APVA 4G9DB 1QYGH 4JFYB 4TQEL 2X89A 3H9YA 1LK3L 4HIXL 1IQWL 1OT2A 2E9JA 4HG4K 5DJ0B 3UJTH 4FZEL 4MNGB 3QUZB 5I75B 3F8UB 5C2BL 3LN9A 5AG8A 1VKXA 4PRPB 5FKPB 1NBQA 4R8WH 1I7UA 4C55A 2NW3B 3PHOA 1CIUA 4X6DB 4I0PC 3VFWA 2UYLB 4BSWA 4LK4A 1QSFA 5L7XH 5BW7A 2YUXA 3VW3H 4X6FB 3PV6B 3QXAB 1XGRA 5ILTL 3VMOA 2Y9RT 2V7HA 4JQVC 3E2HC 3BGMB 5HDLA 1DLFL 4YHLL 1XF5B 3I3EA 2Z35A 3LMJH 1VACA 4FG6C 4ZOBA 1YJDC 4Q6IA 4JFDD 3VWJA 1LEIA 5CGYC 3OR6B 1H3PH 3VXNB 3EGSA 3HC3L 2VXSL 4X7EC 4JY5H 1U58A 4MZ2A 1R3LB 4Y16B 5K9QI 2DLFL 4YHZH 4Z77A 3ILQC 3PIQB 1FL6B 4OBSA 1CFSB 4CVXB 1FNGA 3UP1A 2XWJB 5D5MB 3RVTC 1WCBB 2YD6A 5MEPB 4IMKA 2HRLA 2OI9B 4K7PX 3WHXA 1T83A 3EO1B 1VFBA 4G8EA 1J18A 1SJHA 2J3SA 4S1DC 4FP8H 1A6WL 4LVNC 2BRRH 1UEYA 4ZOEA 1WUNT 2NY2B 5I8EA 1RHHB 2ZOKB 3PQYB 3LN4A 3QUKA 3GUTA 3P4MB 2C3HA 2AXGA 3GIZL 1MHCA 4YDKH 3ARGD 1ORQA 1H15B 3OKOA 5ANME 3CVHB 1IQDA 2MMXA 4P5KB 3SKOA 5HYQB 3QUYD 3C6LC 5FUOH 3DMMD 1IBGL 2NX5E 4PJDF 4U1JA 4KQ3H 4XMLL 2ESVE 1IM9D 4S0TD 5C0IA 3K3QA 3HFML 4TSAH 1IGMH 2PTTA 3P11H 4MLSA 3SJVE 4EUPB 2GK2A 2GSGB 4KZDH 2VOTA 5A2FA 4TN9A 2EE6A 4NQED 1P7HL 5KVGH 3DO3A 3QEQE 2C4XA 2Z4QB 3TBVB 3DV6A 1IC4L 2H32B 5EWIL 5KS9E 4V1DB 5I19L 5SWZD 4OCLC 3SGEH 3KPSE 1HQ4B 4OGAC 4PJBA 1PYWA 2X41A 3M8OL 3V0VB 3VWKD 2H6PA 2UVFA 3MXVL 3NFNB 4N8VA 3VFNA 3QXTA 3FT4B 1G1YA 3KJ4B 5SX5K 1KEGL 2QSQA 4XPBL 1PZ5A 4Y4KA 5DEFA 2IEPA 1ZANH 1T66C 4W81A 3QFJB 4PD4J 5LXGL 3F7PC 3QG7L 2FB4L 4WY7H 5TE6H 3B2UD 4OUOA 4QHMB 4C59B 1XZ0B 4HLZH 3WS3A 4UV4H 1CFBA 2JELH 4PJHF 3MJ9L 4KK9D 2BRQA 3V0WL 4BK5A 2XPGA 4C56B 5I1KH 4AEIL 4ZUSA 5JIPA 5IKCB 4KPHL 5F71A 2XV6B 5IMKB 4M43H 3PGDB 4Y4FB 4M1GL 3MGTA 1CLZL 4JRYD 1MJ7L 4X98B 5JXED 1FVEA 2DI9A 2R4RH 2F5AL 2R9HD 1NC2B 5L8LB 3U9UA 4FQQA 4MJ5A 4DKEH 4FABH 1ZS8A 1NFIB 4XCCH 2BNRD 1Q9KB 4L4VD 4ZXBC 1G7PA 3RWFB 4J3SA 2GIYA 2R2EB 3EYQD 4DUVA 4NN5B 1FSKC 4H8WH 3ARBC 3R06B 4LDOB 4QT5A 3FTGA 1F6FB 1XGPB 1QSVA 1OCWH 3H42H 4LDEB 3O3UN 3QUXB 3T8XB 4Z7NE 5D1QB 3IDYC 4X7TB 2DJUA 3MRHA 2PW1B 4I3RH 5INCA 3KPRE 2FHBA 5DQDH 4MCYB 4TULL 2XNAB 2WIIA 5BXFA 1BQSA 1GHFL 1NEUA 1G9NC 2YPVH 4JM4L 3CMGA 4HS6A 3T1FA 1B3JA 3PWJA 43CAA 4NO0A 4Y89A 4FZ8L 4JFFE 1H0DB 4MXWL 1NBYB 3ILPA 1CGWA 4IRZH 4PJFF 3V4VL 4OUUB 5FGSA 5JPNB 4HIJA 3O9WA 4R90L 2NTFB 2RFXB 3GEWB 4DZBB 3HKFA 3WFBH 2IALA 5GS2D 4HT1L 4I8DA 3TGXA 3VFMB 1CR9L 2WUBL 3G9AB 1BOGB 1RJYB 1MIEH 1HILB 2H41A 5JZ7D 4ODUA 3UC0H 4KRNA 3MRGB 1IC5L 5HHVH 1EEUA 4D0CA 5C6PB 1FE8H 5LKNA 2N1KA 4PPTA 4Y5YB 4JKKA 1FIGH 3B3IB 1Y0LA 1YC8A 2ATKB 3UPCA 4MQ7B 4G6KL 4GKSA 4PTTA 4P3CL 2Z92A 5EBWA 1EV2E 3U7AA 3QIWC 4AQ1B 4AY0A 4L5FH 1QLRB 3X12B 3JTTB 4NQSA 2UZXB 4PJCF 4RRPA 2MCPH 2FIRT 4PJ5A 4Y2DB 3ZSTA 1D9KD 1KCVH 4XP1L 3K2MC 5K9QG 3P2TA 2AKRA 2CR6A 5KTEL 3V7MA 2EXYD 5F7LB 4MNGE 3MRJB 4NDMB 4L9LA 1RFDL 1PLGL 4WV1C 1ULVA 3QHZH 1NGQL 4LCCC 4ZFZB 1N0XL 4PRPE 3RWDA 3DX9A 1U0QA 1O0VA 3MUZ1 1RULH 2DTML 2HVJA 3BGFC 2V5SA 1A5FH 3ARYA 1A3RL 4X6DE 4U1MA 3HMXH 1YA5A 1VEMA 3GSUB 4ZQKA 7FABH 5K59E 4JKLA 3O3BB 2AJZA 1EK3A 3KXFA 1CL7H 1YNLH 3LS5L 5IQ9A 1ZVSA 4P3DA 4A2MA 5GS1A 1QSED 1I9JH 4U1KB 3JTSA 3D0LB 3GK8L 2IFGA 2Q6WA 4M1CC 1I7ZA 2HLAA 5DJ6B 5D7KD 2K7QA 2NXZB 1N6UA 1KT2B 3LHPH 5DURB 3WD5L 3OKLB 4NPYA 3EYSL 4PJDB 5E99H 3WS6A 4WFED 3HI5L 3C8KA 5E6YA 5EO1A 2CLRA 3OXSA 4GLRH 4IS6A 4FXKB 1CGXA 3T2QA 4PB9H 1YUHA 1MCQA 3KYMA 5D5ME 5EOTB 3UAJD 3GM0A 1VGEH 5IBLD 4MXVE 4BKLA 5IB2A 3ES6A 5KW9L 4LLDB 3BE1L 5C0GB 1YEHH 4PYHA 5ID1A 1I1AD 4M61B 2ENYA 1RD6A 1DBJH 1ACYL 5ADPH 4MA1B 3PQYE 2Q76B 3BKJL 3HAEH 4D8PB 1E6OH 3MODL 3KLHC 3MJ8B 1ERNA 3UTTB 1NEZA 5D1XB 4CRPA 1X6NA 5FV2A 3UTPE 1A6ZA 1A2YA 5C0BA 2B0SH 1GAFH 4HWEL 1EMTH 2V6HA 5BQ7A 3VGAC 4GXVH 5C08B 4LU5H 3WFEL 5J12C 2NQCA 3ARFB 1MCNA 4L4JA 4R26L 3HE6C 4F7EA 1EH9A 1KNOB 2OJZL 3MJ6A 4PJHB 4PRBA 4YWGL 2DB8A 4KTEH 4K7FB 4YDLC 2JJTA 3FCTB 3DV4B 4G8FA 1CF8L 1FLTX 1JZ4A 2P8LB 1YEKH 4K9EH 5IOPA 3F6IA 3TO4C 2AJUL 2BSTA 1SBSH 3OGCA 5AZEL 2IPTL 1WFUA 4GAJL 2W0PA 4V1DE 4FQXC 1UM5H 1MELA 4ODHH 3TP4A 1ZT1A 3F65A 2C4FU 5T5NG 3DUUA 4IRJB 1LHZA 1T3FA 4UTAL 1MVUB 4DN3H 4NP4L 2IAND 4IIQB 4OT1H 1IAKB 1F4WL 15C8H 3MRDA 4HUUA 5DT1L 4KDWA 3TJEL 3QFJE 3QPXL 2W60B 5GRJL 4HPYL 2NW2A 4XAKE 3TNMB 4Y16C 4J3VA 4C56E 3AGVA 3DBXA 4ZFOA 1FBIH 3UYRH 4YR6A 3WUWB 1JCKA 1KB5A 4RAVB 4XVTL 4NRXB 2O61B 3V5KA 2DYPB 4DKDC 2XTJC 4ONGH 5HGBB 1F13A 3O6FB 4RFEA 1UJ3A 4YHNB 4UU9B 1KIRA 3IJYA 3NIFF 3IXAB 5ITBH 4MA3A 1K4DB 3KHQA 4OZFB 4EI6B 2X4OB 3V6OE 3ZKMC 5JO5B 4PJFB 4DGYH 1X5LA 3SQOH 4P9HL 5CILH 5FYLL 4OJFH 3L6FA 4L8CA 2R15A 3B9KB 1PG7W 4P2OB 1JGLH 5MENA 1JI1A 5TDPB 3VDBA 4N0FB 4I0PA 1NGPH 2GJ6D 1CYGA 2AEIT 2BVQA 5DRZA 1DQDH 1IAOB 2UUDK 5EU3A 1IEHA 1QUNA 3ARED 1E4XI 4PJXF 4P4RA 4NQDA 5HI4C 5E2VH 4KY1L 5E8EB 4JQVA 2IQ9L 4I2XA 4NHCH 7CGTA 4BZ2L 1EEYA 3VG9B 4PJCB 2RB8A 5E00A 4OLVH 3FQXB 3GMOB 4DEPC 1CXLA 3MZTA 3TIDA 4AM0A 3GIVB 4Y1AD 3ME0A 2DQIH 2FHCA 3G5YA 4G80A 3OKNB 5C0NC 1R3KA 2EDWA 4KRPB 1MLBB 5BJTB 4E0RA 1FC1A 3ULVL 2YD9A 2AEPH 3DWTA 4IMLB 5ID0B 5I30H 3TC9A 3EYUL 1P7QD 4F7TA 4C58B 1PJ9A 1MCLA 2DQHH 1XIWB 5ESQB 4U0QB 4H1LA 3SKNB 3AMKA 4X99B 2P7TA 3QQ9D 1FZJA 2BCKB 3FN3A 1JJUA 1X9QA 2X5PA 1ND0A 1WC7A 5EZOH 3UZVB 5CWSB 4XPHL 4JEGB 3BIKA 4P9ML 1MJ8L 3KPQA 3GSRA 4QF1A 4X7SH 1TVHB 4HMEA 1A7QL 4LQFL 4OB5L 2ZCLH 3NH7H 4XBEH 1MFEL 3C6LA 5JOFB 2QQQA 1MHEB 4NM4L 1CLOL 1INDH 4U1GC 3RJDA 3S36H 3TBSB 2BFVH 2E9WA 3SDCC 2YMXL 6FABL 1I7RA 1DFBH 4OFVA 4GKZA 1AR1D 2VABA 1BGXL 4U3HA 1HZHH 5B39A 1I9IH 2H9GA 2V2WA 1KJMA 2F53D 5FO8B 4LRNH 3VGEA 1YNTB 4HX1A 5F9WB 1IAII 4JN2B 4BFBD 3OBAA 4O5LH 3V7AE 5E8NA 4OLXL 3G6AA 1WBZB 3ROLB 3BPOC 3WE6B 4DJMA 1YMMA 2LTQC 4LQ1A 5EBLA 3WUZA 3QCUH 2W9EL 5DI8B 4I5BB 4XCEA 1HINH 2VJXA 2MKLC 4F7CB 5T5NF 2X1QA 3CH1B 3ISWA 4RRPG 4U3XA 3QI9D 1EA9C 3GMPA 1FNAA 4LCYB 3W0WD 3NZ8A 4YBHA 1AO7B 2VL5B 3RVXC 4GAYB 1YEEL 1N6QH 5IMMA 3QEGH 3WKMH 1BZQK 4NN7B 4PJDE 3ZHDA 2FLRT 1UXWB 5FM8A 1MHHA 2BMKB 5K9KB 4ODSH 4I18A 2MJWA 1MIML 3SDDB 2UZIL 3QNYB 1CE1L 2YA0A 3BMWA 5GRWA 5JORA 5EU6B 2R4SL 8FABB 2GQHA 2F74A 4ONHA 3LVEA 3ARXA 1NGYA 2BXZA 2VXQH 4EKXA 3G5ZA 1H5BC 1UB5B 5F9AC 2IQAA 2VAAA 1TLKA 1I1CA 1J11A 5C71A 4HSQA 5EN2A 5I9QC 3LEYH 4TUJA 3OAUH 1J1OH 3CK0H 2UY7A 3RNKA 3NAAL 3V5DA 4QTIL 3QQNA 4HEPG 4RQQB 3BKMH 4GBXC 5IW1B 1FNFA 3ZT7A 5ELIA 3SKJL 3DGGA 1LD9B 1T21B 5C08E 1CU4L 4LLWA 2X4PB 4OGYL 3OJDB 5ENWB 4F3FA 1CG9B 2GK0B 4X0KA 4J23A 1FQ9C 2F8XC 4X7FC 1OSZB 1SY6A 3MRLA 2JJSA 3MREA 4PJHE 4D3CL 5SWSB 5DJYA 4OF5A 3LQAH 1RU9H 2FEEL 1JZ6A 4HUKB 3HAEB 3QULA 3H8NA 3I2CH 3KYKH 2WBWB 2NY6C 3OAYH 4YGAB 4YXKL 5JXAL 1PEZA 1S7TA 1GOHA 4XCNA 4XPGL 3SE3C 4BQ9A 4OQTH 5CZVL 3OGOE 4QRUB 2R1WA 1UQSA 2VXUH 1T5WA 1AHWC 1AD9B 4M7ZC 1NEZG 5IT2L 1VSCA 3BAEH 3MYZA 3Q6FA 4L8BA 3IFLH 1QA9B 5IIEB 4XT1C 2V2TA 4P5MB 2XA3A 5J6HB 1KJ2A 1UCBH 4ZUUA 1KIPA 2GJZA 3RFZC 2FZ3A 3O2WH 2PCPB 1RK0A 1D5BA 4D2NA 1OLLA 1RZ7H 5DC4B 5GRUL 1HKLH 2DL9A 4XWOD 5IB3B 5DRNB 4HWUA 3TCLA 1S9WB 3G6DH 5HYJB 3HZVA 3SKMB 5JOEA 3C60B 1FYTE 4PJXB 1T1YB 3BPNC 3QUYA 2JJUA 2KUTA 2XKNA 5FO9B 1BBJA 3FO1B 1TITA 4AL8L 4M5YH 5JLZB 3NFSL 3O6MH 2HKHH 4PJFE 1IM9A 4L4TD 1ZXQA 4HWBH 1K4CB 4PG9B 3VFGH 2ZUQC 2V17H 3DVFA 3PDOA 3UCRA 3V2AR 3ZYZA 2X1XR 2R0WL 4OI8A 4NKMB 1RZJL 1IM3A 3OMZA 4JY4A 1H3XA 1F00I 2AGJH 2VMFA 3FRUA 3RVWD 3U79A 5C09D 3MR9B 4K2UH 5FYLD 3GBLA 3SE8H 5T1MB 2QKIB 3QDMA 4F37K 2H2PC 3JWDL 1X7QB 4JFPA 3A67H 2CDFA 4KKCD 3CFCL 1W72L 2CJUH 2VLRB 5IMLB 2GCYB 1EGJA 4ZPTA 3VWKA 2DQUH 4P59H 1KOAA 1RIUL 3KPTA 3GSVA 4KUCD 1B2WH 5CJOH 1CFQA 4YNYB 1G9NL 2R0ZH 4UT9L 3QDJB 4PJCE 3T77A 2IBBA 1OAZH 2BY3A 5IF0A 5C0AB 3CZFA 3W2DL 1MJJA 4S1SH 1ZLWK 2AXHA 5FCUH 3T2OA 5KVFL 4FQLH 4JRYA 1G7HA 4FFYH 4UNTA 3BX7C 1A7PL 2Y7QA 3MCKA 2O5XH 3I3BA 3JV6A 1A1OB 3L95B 4Y19E 3OR7B 3QIUA 3BMVA 4XBPB 5GRVL 1MLCB 5GGRY 1QFHA 2ADIB 4YFDB 1ZLSH 1X5XA 3ULVD 5E94B 4YHOH 4WO4C 5I6XB 1LO2L 3U83A 2YWZA 5I8KH 3NN8A 1QLEL 1KTRL 2OL3L 3HI1A 1ROWA 2XWTA 4OIIL 3NPSB 2ORBH 1AGCB 3T0ED 4PJ9C 5I1LA 4LPXA 4PBWD 4P4KD 2GY7B 3FJTA 4U49A 4LDLB 3O81A 4NC0B 2OP4H 2VUOA 5EIIB 1S9YA 4XTRD 1AXIB 3UDWC 2XA8L 1UACL 4X6CB 3DO7B 4K7PY 3N1PC 3O8XC 3P77A 2YUWA 4I4WA 4NN6C 3VGFA 1U8IA 1A3LH 2W9LA 5E8PA 3BQUD 3T65A 3HE6A 4G43A 3OKKA 35C8H 1LEGB 1IT9H 3AS2A 4TPRL 3SY0A 3S88H 3MRFB 4KTDL 2FX7H 5GZOC 1SVCP 4J3OC 4H1LG 3WO3B 4OCWL 1NKRA 4GRMA 4CW1B 1T0MA 3ARDA 4OQ1A 2EXWC 2ARJQ 1JWMB 4JDZA 1OAQH 4C4KO 3RVVC 2HT3D 3VFRA 1YPZF 2FJHB 4FQXA 4JANB 3QWOA 1IKNC 2YEZA 5DVNA 4DKAA 1KLGA 5DMKB 3SGDI 1U8OB 4JQXC 1Z9MA 2NY4D 3C2AL 3ZT6A 5IBTH 2Y07L 1AO7E 4E5XB 1S9KC 3BP7B 5DHYB 4MNQD 3T4AA 3MBXL 1JFQL 4H0GA 4PJGB 4JFEB 1MRDH 2FEDC 4BELD 1I3RA 1IC7L 4I48B 3RTQB 1RUMH 5ADOL 2EKSA 3L5IA 1NCBH 3OJ2C 1K5NA 1CLYL 1GGCH 4S2SB 4RGMB 1F11B 5FM5M 3W9DB 5BS0B 1HE7A 4R0LB 1V3LA 3MSPA 5B39G 3O6KH 1WTLA 3ZDXF 1Q0XH 2ATPB 4XAWL 1Z2KA 1KB9J 1KN4L 4IRSC 2OTUB 1D9KA 4JZJC 4L1HA 5I1AA 2OK0L 1WSST 4TUOB 1CGTA 2VISA 3RUGB 4AG4H 1UWXH 2I07A 4MJ6A 1B0GB 5ICXA 2UWEF 2UZYB 1IGTA 5SWQB 3ZTNH 3BIAX 1P53A 4XPAL 5TQ2H 5IJVB 1R3HA 4NHUB 1A4KB 1FJ1A 1LO5B 2ICWI 5B4MC 3PHQB 1EAPA 5IEKB 3ZL4H 3QQ4B 1XGUA 4XCFL 3GSNH 1T1XA 5JW3L 4S1DD 4LGPB 5DMIL 3C5SA 1UH4A 4RZCB 5SWSE 1QSEA 1LO4L 4JM2D 3MV7B 2FJGA 1FPTH 3H3KA 3ARVA 3EO0A 4C83A 3QDHA 1JGDA 4HDIB 3K7UA 1U92B 2W59A 4QYOA 1BJ1H 4M62L 3AS1A 3L7EB 2BVPB 5EU5B 1JNLH 2DL2A 2XYCA 4OCYL 5DMGC 5JIKA 3SCMB 4NFBA 1K8DB 1TVBB 4NQCB 5F1KC 3NIFE 5K9OB 5HYSB 4HKJA 1MI5B 1ZLVK 3G5XA 5HJ3B 1C16B 4EBQL 5DC0A 3GHEH 5T1LD 1CTNA 4NZDA 3V6FA 1EHAA 3L9RB 4NUJB 4LASH 5EULV 3OKYA 2I9LB 1I85A 1LP9B 1MSPA 5LGHL 1IC1A 1D5XA 1MF2L 2K1MA 4HZLB 5J3HD 5DEGB 5DJ2A 1IRAY 1I1FA 1LK2A 3M17B 2EDYA 1UWGL 1S7RB 5F9OH 3LN5A 4GRWF 3V4PH 4WHTA 3L3KB 4FRWA 4OGAD 3SDDC 3T3PF 1HHJB 3IDNB 1NC4B 2JK5A 3P73B 4LHUB 1DQLL 3CX5K 4LKCA 5GJTH 1EFXB 4HC1L 1AGFB 4PJXE 3BVNA 5E5RB 2AEQL 1C08B 1CXKA 3U4EA 4JFQB 1T66D 1DLHA 1X5ZA 4YJZL 4MJ4A 4JY6A 1II4E 3MOAH 3QXWA 4OF8A 4RGOL 2ZUVA 4BFIA 4NQXB 1OP3H 2P44B 3QNZA 3IGAB 3TO2B 4EVNA 2HKFH 1D5ZB 1KEMH 4YO0A 1UH2A 1AQKL 4DW2H 2R2BA 2E7LA 2W38A 3TH2T 4N5UA 1BAFH 5DGQA 3C8DA 4LSRL 2WUCH 1BPVA 5MEOA 3SOBH 2D7OA 1CGYA 1I8LC 4X8XA 2D7PA 1JPTL 4YHYC 1QFUL 5GHWL 3RGVB 4RMVA 3SE4A 1NAKL 4Z78B 4CNIB 3CFIC 2MHAA 4QOKB 5CKGA 3TT3H 2ZPKH 5IQ7H 2VLRE 1JK8B 3CVHL 3MRKA 4CBPA 2FJFB 5IHBA 4KWUA 2J8UB 2DICA 3O3DB 1NKOA 4FQHB 5I71C 1NANI 3G04A 3WFZA 4KVCL 3HG1B 3RWCB 2GITA 4RMRA 4KK8C 5D1ZC 4OCMC 3QDJE 3TYFA 4ZUTA 1KBGH 1MNUH 1S5IL 2D7MA 2PKDA 2NX5D 5C0AE 4ACPA 1NCUA 4FFVD 4KRLB 5F7DB 1U91A 3BWUC 1LO3H 2BY2A 2ESVD 3QBTB 3CXDL 4KHXL 1GGYA 1QKZH 3DTXA 3PJSA 4JG1L 2PNDA 4QEGA 1L4IA 3KVQA 1F58H 4ZNEA 1CD1B 1QRNA 2KBGA 2VXVH 1J8HB 1HYSD 1NL0H 3QEQD 2XI9A 1BJ1J 2HAZA 5EUOA 2C3VA 4MA7H 4P46C 1E4KA 1FGNH 1MQKH 4Y4HD 4QRQB 3MNZB 4Y88A 1N5AB 3WIIL 2WQRA 2Z31A 3QIBB 3TA3D 5DS8A 2VLKB 1VEOA 4MLIA 3RRQA 4G5ZL 1VFAB 4ZS7L 1YPZB 5I1IL 1JN6A 2X4TA 1IEAB 3FO2A 2R29H 4LPUA 3CSYB 3NCFB 4LPWA 4NZTL 3UJIL 5F7HA 3STBA 1W8NA 3BFOA 3CUPB 3MBEB 1UFUA 3C6SA 3H7BB 5F72S 4X6CE 3D3VB 4MAYA 2G5BB 4XNXH 4JO4H 3TIEA 1EERB 5DJCA 1SJXA 5TDOA 4U6XA 4N68A 3MOQA 2P8MB 4O4YL 32C2A 2HG5B 3MRBB 4MXQC 4RFNB 3MOBL 4U0RB 4CAGA 1G7JA 3DRTA 2XN9D 5T33L 4JGUA 1OAYL 2RBLA 1PG7X 2ADJB 4AEFA 2BVOB 1J0ZA 3HR5B 3C9NB 4F7MA 3P4OB 1RZFH 3PDGA 1RUKH 3RL2B 1NH6A 3FB6A 4PR5B 3SE3A 2VUYA 1AJ7H 3R1GH 1DBAL 4KDTA 4QGYA 2UWEB 3CFDA 2E9IA 3N0PB 3LQMA 5KSAC 1X4ZA 2XZCL 5HVGB 5F1OB 2J2ZA 4DQOH 1U8NB 1KCRH 3IU4L 1S7VA 4R2GB 1A6UL 5T1DH 4M1DH 3VG0L 2DRUA 3FFCD 4PJGE 4JFEE 2WWKT 2K9UA 1OL0A 2VDRL 3KPRD 4Z76B 4LVEA 3WLBA 3HI6H 3S6CA 2YRLA 2QSTA 5CJQH 1E6JH 1TPXC 4N0UB 3I02B 4CVZB 1CFNB 4CU8A 5BS0E 1A6VH 2G9HB 3K4ZA 3PP4H 4N9GB 4MDJB 1FORH 1ODAA 4EOWH 5DFTA 3O2VL 4JVWA 3PG2A 4RAUB 4PREB 5I1HL 5ACLA 3RUGE 2YD1A 4LCWB 4ONFH 3D18B 4ZTPL 3SPVA 3BH9B 3MLUL 1ED3B 5I6XC 3IU3B 4APQC 4JVPA 3BXNA 3W9EA 3HNVH 4WNQA 4KQ4H 4R7DB 3I9GH 3C08H 1P9MA 4U6YB 2EYSA 3LRSB 3BT2H 4HWZB 5E4EB 4CU7A 4HIIB 2F53A 1J7VR 4OCRH 3L7FB 1K6QL 1C5DB 1A6TA 1FL5B 3STLB 3K4AA 5HHXH 4KRMB 2VLLA 4XBGB 1MRFH 4NOFA 3MV7E 5F7YC 5F9JB 3KLHD 4LIQH 3MA7A 4KV5E 5I0DA 3TVMB 3RIAF 1NCCL 3HE7B 3MLRL 3PXJA 3U4BL 4UTBL 2IBGA 4FTVB 5MI0C 5E08L 5KOMC 4BSVB 4Z5RB 1ZVYA 4LNRB 1MI5E 3AXLA 3HZYA 3GSNB 3BJ91 4PRHA 3EYFA 2EC9T 1KXVC 3S97C 4MS8C 3P9LA 4X6EA 2FD6H 4PRPD 3MGAA 3FB8B 3IFOB 1LP9E 4MDIB 4Y5VB 3OAZH 4P5TC 4YEEA 4NKDA 5LBSH 2AJYH 1JYVA 4XVSH 4GRLB 4Z7VF 1YY8A 5ALBH 3E6HA 1JGEB 4ELMA 5FHAH 3ZE2F 2FR4A 1A7OH 3VFPB 4R8WL 4NO3B 5CJXA 2YD8A 2Q8AH 4G6AC 3PXHA 4HHAA 1E27B 1M7IB 3BDBA 2HJFA 4N1CA 3IDXH 1YEJL 3A6OA 2GFBB 4WU5B 2EEBA 3RWEA 1FGVL 3MV8B 4RIRB 1U36A 4QWWC 4Y16D 2HMIC 2WBJB 1DUYB 3WNNA 5B22A 2AI0H 4WUUE 5D7LB 3LMJL 5DUBB 5IK3A 4BH7B 4QY8B 1KELL 1HOCB 3U1SH 5D6CA 4RMUA 2N56A 1ZA3B 2PTVA 3MLSH 4F7PA 3JV5A 2XTJD 4JY5L 2Q3AA 4PLNC 2AK1H 1WITA 1QR1A 2C5DC 4QOKE 1UYWL 2DD8L 2V9QA 3SO3C 3KPPA 5HGHA 3NFPB 2NY2D 3PQYD 3FN0H 3EBAA 3U82B 4NO2B 2J8UE 1S9XA 3OZ9H 2Z93B 4LSSL 2CIIB 5DK2B 3HG1E 2J88H 1NBVH 1BFOA 2X70B 5GS0C 1ONQA 3H2WA 3UTPD 4M8QA 1I8IA 1DDHB 3OSKA 3SCMC 4FMKA 1CIDA 2BRRL 5IG7B 4J8RB 5MHSE 2JCCF 4RMQA 4OZIF 5ERWB 3DYPA 4CKVX 2RJMA 3TEUA 5FB8A 5J7CC 3IDMB 3WJJA 1A1NA 1BX2A 4YDKL 2H3NA 1LK3H 5HHOA 2EDHA 2R1XA 2M8XA 1IGYA 3L3OA 2DF3A 1AE6L 1XEDA 5HI4D 1J8HE 3EAKA 5FUOL 1HHHB 4LMQI 1QQDA 1M6OB 3FQNA 4KQ3L 3QDGA 4XC3H 4NWTH 3FQTB 4YHKH 4TSAL 1IGML 2MPAH 3P11L 4OAWB 2W1NA 4V1DD 3IKCA 2BVUA 4KZDL 5GPRA 5M7QA 4UQ2B 1DQJB 1KTDA 2IPUG 1FO0H 5C0FA 3PGCA 2D7TL 4AENA 1YPZE 5C0ND 1J0IA 4U1IA 5ILTH 2YC1A 4CDGC 3O41A 5F96H 1NFDA 3IFPB 3DXAA 1DLFH 3H3BC 2ICWJ 2VDMH 4H0IA 2J12B 3QFJD 4K07A 4MCZA 3D0VB 5EBMA 2HFGL 3KHOA 4HLJA 1S7WB 2AXFB 2I25N 1A22B 4LF3B 4R3SB 2CXKA 4U1NA 3RWGA 4Y4FD 4GG8B 3BKCL 1ZANL 4PJ7A 1SBBA 2DLFH 3MACL 5D2NC 2F8VA 3LEXB 5CIPH 2FX8H 4WI8A 3ZDXE 1DCLA 4HS8L 2Z91A 4OD3H 4UV4L 1X5YA 2JELL 2WV3A 4WHYH 3ARRA 3LPGA 1K8IB 4TNWK 4M43L 5FUZL 3B9EA 2O5ZH 2VIRB 2WIMA 4X5XA 5HI3D 3RIFK 4O2CA 5A3IC 3AS0A 3VXUB 4G7VL 2C3XA 3PWPD 2ZOLB 1T80A 2R4RL 2KZWA 4JFOB 5DLMH 2UWEE 3SDCD 5E1HB 4IDLA 1N0LA 1P5UA 1XF3B 1G9MH 5ICZA 3S4SA 1MUJA 4HD9A 4HUWA 3QUXD 1P1ZA 1I9RH 1ZTXH 3BEWA 1KPUB 1D5MB 5D1QD 3RA7H 1F5WA 1RUPL 3RDTB 1T7VA 2Z8VC 3GIZH 1JF1B 1XF2B 1UCTA 5IM7B 5DEZA 1T22B 4GQ9H 2C7UB 3K0WA 4QRRD 1OCWL 3H42L 1IBGH 4OV5A 5FIEA 1KXQE 3MJ7B 5ISZE 1BIIB 4I3RL 4ODWB 2WWKO 5F3HB 2QSCH 5DQDL 4E41B 2E7BA 1CT8B 1EO5A 4UZGA 3EKCA 3LPFA 1JWSA 2YPVL 2X4RA 1L7IH 1F6AB 5HHMB 1IC4H 4I13B 5I1DA 3SQBA 5D9SA 1OGAD 5I8CB 1RK1B 2EE9A 4HJ0C 3QRFM 2K7PA 5I19H 4TTDC 3Q1SH 1NMCC 3OB0H 3KS0H 4JPVH 5A2JH 1FHGA 5DZLA 3REWB 3EHBD 3WFBL 1AGBA 3TZVA 1UB6A 3GRWA 2P5EA 1FVDB 1R3IH 4XPBH 4JLRA 2H26A 3WN5C 4Z7VB 4GW5A 3U48A 5SWZB 3CNKA 4GRWE 1MIEL 1IE5A 1AGEA 3CD4A 1FNLA 3AB0C 3VXQB 1BZ7A 4YBLB 5TGBB 3T3PE 1GGBH 1EO7A 5FDYA 3UC0L 4L8SA 2JJWA 3MJ9H 1DUZA 2BHYA 4HJJL 3RWJB 4AEIH 1VHPA 4GBXD 4KPHH 4U0RC 1S7UB 1FIGL 4DCQB 4MNQA 3IYLW 4M1GH 1DQMH 1CLZH 2EYRB 1AFVH 1G7QB 2L7UA 4Y2DD 1V7NH 4YLQT 4G7YH 4FTVE 5CGMA 1U8HA 3D1MC 1DVFB 2IAMA 2HJKA 3T3MF 4NZRH 2H8PB 3A6BL 4L5FL 5C9KA 4H25A 1EXUA 4MMZC 1MPAH 5LQBL 5A2IH 1VESA 3IRPX 2MCPL 4P2RB 3GSXB 1Q94A 3RL1A 3WEXA 4ZTOL 2BNRB 1RZGA 2VE6A 5E7BA 1YN6B 3T08A 5SX4I 3HPLA 3VD9A 3QEUB 5KVDH 1TQBC 2D4FA 4TULH 2G75B 1TVDA 2HN7A 2B4CH 3TN0A 2A74A 4E42B 3F5WB 4JM4H 3HMXL 2P49B 3HTLX 1WAAF 3VCLB 1UZ6E 1XCQB 1BD2A 3DETC 4GG6B 3T0VA 4YBQC 2NXZD 5IVZB 1HWHB 3MV8E 3WHE0 4MXWH 4O2FB 4YHIA 5C0EB 2JCCB 4W4OA 1I9JL 5IVOA 1WWWX 5JPMB 4JM2A 2JE8A 2EDXA 4MJIA 5I1EL 2D31B 4HT1H 2GUOA 1NUDA 1OTUC 2A9NL 5D72H 1DE4B 4NYLA 2WUBH 3LHPL 3VXRA 2CRIA 4ZPVB 1BEYH 4N8CH 3FQWB 5E99L 3QQ3B 3BO8A 4ENEC 1ZVHA 1JI2A 3EOTH 5B3JF 3E6FA 5D7IF 4L9DA 2MQCA 1QEWB 1B6DA 2D0FA 4O58H 5GGRB 1VGEL 1P2CB 5GSVA 5H2BA 3U0PB 3F12B 5JDSA 1E4WH 5D1XD 3UTTD 1A47A 4G6KH 5ABDE 4P3CH 3RZCA 3GMQB 2C26A 1P84K 5JTWA 3HE7C 5CEXA 1MFNA 1DBJL 1RJLB 5C3LD 2A6DB 1RJZB 2H2PD 3KYOB 3OAYK 2QADB 1E6OL 2XTLA 3CDCA 1VGKB 3VRIB 5AAWA 4I77H 1TTGA 3CU7A 4XP1H 1IVLA 2X7LB 2B0SL 1ZHNA 5DDHA 5KTEH 1EMTL 3DVNA 5E2JA 3VDCA 4LU5L 3U9PH 3QXVA 4N0RA 2WSKA 1RFDH 1CGVA 1NGQH 4EZMA 3CCHB 4HW6A 1N0XH 1ZA6A 4ODBD 5D7JC 1FNEB 3ZKQD 3MUGA 1H8SA 4OLZH 3NCMA 4AZ8A 3TPUB 5IROA 2FYYA 5JW5B 4IRJD 4K9EL 2VDQH 1SBSL 2EDTA 2XG4A 4Z7OE 2AXJA 1KGCD 1UM5L 3MCLH 4JDVB 4PV9A 2APFA 2WINB 4ODHL 3GK8H 1EEZB 1E28B 1FFNA 3B9VA 3BHBB 4AT6A 2EYTB 2WBJC 3FT3B 1N3NB 1HSBB 4LBEB 3AU1B 4DN3L 1CTOA 4PJ8B 4K3HA 5F6HJ 2DIAA 4I1NB 4OT1L 1U8LB 2R23B 3BI9X 3MRCA 2GSIB 1FO0B 2N7AA 4PP2A 2HFTA 5ANMA 2Q7YA 1GJIA 4ZSOB 1T03H 4QTHB 2PYEA 4GUPB 4MX7A 3BPCA 1NFKA 3FOMB 4MWFB 1FBIL 2ESVA 5D70L 4UI2A 3UYRL 1CICB 2A9ML 2OS7A 3N9GL 2E27H 2EZ0C 3BE1H 1CXFA 4NQVA 3SJVA 3U7YL 5E24E 1J0JA 3O6LH 5IMOB 4ONGL 1I4FB 5L0QC 1ACYH 1NPUA 3EJJX 3QEQA 5INDB 3CFJB 3MRQB 3WSQL 5GGTH 3LKRA 3IJSA 5ITBL 1R5IB 4Y4HA 4DGYL 3B9KD 3SQOL 3FONA 3MODH 1ZT4A 4AIOA 5CIPB 1WFNA 3LV3A 1BQHA 1T89C 1R3JA 4U1HB 5CILL 1GOFA 4ETQB 5GZOD 2GY5A 4XWGL 3TA3A 2L7JA 2CDGA 1I1AB 3KPSA 4P5TA 4NO5A 1KN2H 4ZDHB 4OJFL 3G6JF 2DM2A 3WFEH 1MH5A 3NTCH 5AUMA 2I9TA 1Q72H 1KC5L 2OMBA 3E3QE 4F33B 1VFMA 2DLGA 3KYNA 1DQQB 1AXTH 2Y6SD 4E41E 1JGLL 4TSCL 4Y5XC 4IDJL 1FRGL 4EI5B 1CS6A 2OL3A 2AJ3B 3K74B 2YBRB 5EPMB 4KKLC 1NLBH 5HHME 1CF8H 2FEDD 1DQDL 1KJVA 3BEVB 2XG5A 4K94C 4DGIL 3ZE1F 5AZEH 5E2VL 2IPTH 4GAJH 5C92A 2PW2B 4WW1A 4NHCL 2OJEA 3S4SG 1YMHB 1MJUH 1CE6A 1ETZA 3KPLB 5DC9B 4OLVL 4UTAH 4IRSD 4XC1L 3VU2A 5JA9A 1QFWI 2CK0H 1XIWD 3NPZB 2DQIL 4Z7VE 1F4WH 5HGAA 5SWZE 2J6EH 3B6SA 4LPCA 4HV8A 5GRJH 1VKXB 2NLJA 3BP5B 3ZE2E 5C6TL 1I7UB 3WIFA 1FFPA 1S7SB 2DQJH 5I30L 4PJEF 3QDAA 3P9WB 2VXTH 3MMEA 1V05A 2IANB 3VFWB 2NMSA 1ZK9A 3VFOA 2DQHL 5B4MD 1DEEB 3JSSA 3KPRA 4GKNA 5CEYB 3MA9H 4WI5A 4HG4J 2YS4A 3HZMA 2V7HB 1N59B 1U3HC 1AKJD 5SX5H 5DD6B 5D93C 3TBWA 5FOJA 4P9HH 4X7SL 2XZQH 3R0NA 5TH2A 3LOWA 4JFFA 5FYLH 3ET9F 4P2RE 2IH1A 3EGSB 4LIQE 2W0FB 3NH7L 4DUWA 1U58B 3QNXB 2APBA 4ZD3H 2BNRE 4FQIL 5DMGD 3LAFA 2A73A 1INDL 4KJPC 2DKSA 3S36L 4Z77B 2BFVL 2VLJD 2V2XA 4ZOCA 1FNGB 3GI9L 1FZOA 3HCVA 4ELKA 4NSKA 5DA0B 2QTEA 3MROA 4MNHB 4ZAKC 5JW4Q 4LRNL 1UVQB 5DK0A 1OQXA 3SDYL 4N0CD 1F4YL 1Z9OA 3L5XH 1F3RB 3Q3GB 2EIDA 2IQ9H 4AH2A 4BZ2H 2JCCE 1QBML 1HI6A 3QCUL 1JPSL 2IH3A 1BZ9A 1HINL 2XY1A 1V7ML 3SDDD 1HSAA 2GJ6B 3F7RA 4OM1H 5EU6D 3QFDA 4BH8A 3GJEA 3B9DA 5KSUA 1N6QL 4IHOA 5E8OB 3LPWA 3QEGL 4L3ED 4G9DA 4PGBA 4JFYA 4JPWL 1PSKH 1EZVX 4ODSL 1FV1B 2BOCB 4K71B 1FYHB 3QUZA 4BFGA 1J10A 5FM4A 4PB0L 3TLRA 4B53A 4LSUH 2BNQD 4R97B 5FKPA 3W5NA 1CD9B 2VB5A 2J7LA 4YFLI 4WTZG 1OARH 1EJOH 5HHPB 2UYLA 2W65A 3I6KA 3ZZ1A 1P7QB 3LEYL 2NXYC 1KB5H 3OAUL 4X6FA 1J1OL 3PV6A 3QXAA 5BRZD 2ED8A 5GS0L 1DVFC 4B50A 2E8YA 2H6PB 1A7QH 4LQFH 5CFHA 3BGMA 1UXSB 4N8VB 2YZ1A 5FKAB 4OB5H 3BKML 4KUCF 2VR5A 1XF5A 1PZ5B 4V2BA 5DEFB 1ZSDA 4LVOB 5IB1B 4KK8D 3OR6A 5D1ZD 3VXNA 4HC1A 3LKQB 3X13B 5AAMA 5HD8D 4ZUSB 2N7BA 3MPCA 5MP6H 4PYGA 3IS0X 3RBSA 3O2DA 1JZ7A 3WNMA 4JKMA 3MGTB 3PIQA 1RU9L 5GZNC 1FVEB 2OCFD 1CFSA 3I2CL 4CVXA 3KYKL 3B5GA 4EN3C 5D5MA 3U9UB 4FQQB 4MJ5B 3EOBB 1WCBA 4U3CA 3ARQA 1ZS8B 2NY0C 3HRZA 5MEPA 5MEQB 4OQTL 4RGNC 4JZNA 1C12B 4LOUD 3SGJC 2QQKH 3EO1A 1TCMA 5E03A 1T2QH 1FG9C 1LDPH 3V95A 3WDJA 1O7SA 4QT5B 2IWGA 3DX7B 1RHHA 2ZOKA 3PQYA 1BFVH 4KI5E 2NY1C 3G6JB 1ZOXA 3IFLL 3P4MA 3WN5A 1GZPB 2MQ0A 3CC5B 5HYJD 3ALXA 3C60D 5CLWA 1YJDH 1UCBL 3CVHA 1P5VA 4ZSOE 4XH2B 4P5KA 3ZKND 5HYQA 3O2WL 4Z7QF 1CE1H 5CEZH 3QI9B 4XXDB 4TOYH 2R4SH 3W0WB 5BXFB 1HKLL 4WDIA 1LE5B 4WFEE 3G6DL 3T1FB 4EUPA 3L3IB 1K2DB 4NO0B 3T0BA 2V7NB 5I17A 1Y6NR 4ODVH 3G9VA 5CMAA 1Z5LA 3CLEH 2Z4QA 3VGBA 4M5YL 2K3TA 2HKHL 4HIJB 2H32A 3NAAH 4JN1H 1KPVA 2CKBH 2V17L 4HIHA 4V1DA 3SKJH 4FFWD 2DQGH 3QAZC 2VWEC 1X5IA 4X6BB 2AGJL 4IOFC 3NFNA 3DROA 4EDWH 3FT4A 3IDJB 4K2UL 5KSAD 1ZT7B 4D0CB 2PXYA 2D7NA 5CD3B 5L8KB 3M1BB 3TYGL 5IGXL 3QFJA 3QDJD 3B8YA 1TJGL 2BVYA 4NQUA 1JHLH 4LLVA 5IFJA 2NYYC 4QHMA 1XZ0A 2DQUL 5C0AD 3FL7A 4GKSB 4YXKH 4C56A 5IFAH 5IKCA 3TWCH 1B2WL 4LEOA 3PGDA 4Y4FA 3T3ME 5CJOL 5BZDA 4X98A 5B8CA 4KMQA 4XMKH 3MGOB 4NGHL 1FZMB 1NC2A 5I73B 4Q9BA 2XZZA 4PJ5B 3S98A 1OAZL 4KMTL 4X7CC 1NFIA 1BQHG 5IT2H 1Q9KA 5DD0L 1KJ3L 4S1SL 1UKTA 1MREH 1ZLUH 3RWFA 2R2EA 3V6OA 4WTWA 1FG2B 3U6RB 2RHEA 5FCUL 1S7XA 4FQLL 2VSDA 3T0DA 1X6LA 3R06A 4P2QB 2O5XL 2Q87A 3RWDB 4ZO9A 3J8F7 3DX9B 3PWVA 2HVJB 3I6GA 3T8XA 2IANE 1WIOA 5D1QA 5AYUL 1HDMB 4X7TA 1WAAE 1ZLSL 1IFHH 4ZQKB 2AJZB 2OXGA 1OWRM 2XNAA 1MHPH 2RAMA 3WL9B 5I16B 5C0JA 2PO6C 3M45A 3M07A 5I8KL 1ACZA 5IQ9B 4ODTH 3CSGA 4G3YH 1WIPA 1CDCA 5FYKU 1JNHA 2ORBL 3NFSH 1OP5K 4CL7A 2Q6WB 1QLFA 2E7MA 1NQBA 4H88H 4LP4A 5IVNA 2AK4B 1T7WA 4G6MH 4QXGL 1NBYA 4YC2B 2OP4L 5IW6B 1G0DA 5JPNA 3TFKD 2RFXA 5KAQF 1MCKA 5EO1B 4HXBL 1U8PB 4JR9L 1A3LL 4L4TB 5B3JE 3VFMA 4IS6B 5FEBA 3EJYC 4M7LT 5HHQB 1BOGA 1YUHB 3KYMB 4WWKC 1FAKT 35C8L 1IT9L 1GC1C 3DLQR 1HILA 2WW8A 3Q2CA 4BKLB 3S88L 1H3WM 1W72H 4M93B 1FDLH 2JTDA 4Q9RH 2FX7L 4ZUVB 3MRGA 1W8OA 1A4JA 2OXHA 4RDQG 5DO2D 3MRNB 5ID1B 1TQCB 4Y5YA 4EJ1C 3QUMH 1X5JA 2MSPA 3AUVA 1OAQL 4LRIA 2ATKA 1VA9A 2ENSA 1A7NH 1G9NH 2FLBT 4MQ7A 1XF4B 4XPTL 5GGQH 3L5WB 3SN6N 2B39A 2GJ6E 5CZXC 5BS0D 5E6IC 1P4IL 3KPOB 5EA0L 1A6ZB 4IJ3B 1QLRA 3X12A 3JTTA 3BRFA 1CZ8H 1XGQB 3KPMB 2AERT 4B0MM 5KVFH 1MRDL 1U9KA 4KMLB 3OG4B 4DAGH 2H1PH 4OBRA 4Y2DA 1RUML 3RKPA 4WEMB 5FO7B 1NCBL 4OCNC 1YQVH 1OD9A 4F7EB 4Z8FH 4WGVB 1DZBA 2UUDH 3UBXB 2NTSP 1ZGLP 3MRJA 4NDMA 4PGCB 5HPOA 1Q0XL 3LKPB 2PR4L 4TVPH 4DVRH 4Z0BH 4G8FB 4XNZC 4ZFZA 1R6VA 2BSTB 1YNKH 3VH8A 4OD1L 3SDAC 1RMFL 4F8QA 2XOTA 4F57L 1UM6L 4OIIH 5KBNC 4IM8A 3ZTNL 1JUFA 5J6GB 3DUUB 5TQ2L 4PLKD 5IHUH 5DHVH 1OP9A 1GZQA 4YHMH 1T20B 4U1KA 4UUJA 3PNWA 3MV7D 5HPMA 2RIKA 2Y1VA 4Q6IC 3VWJC 3MRDB 3ZL4L 5GS0D 5ESAB 3T0WA 3B43A 1WTGT 1ZHLB 3GSNL 1S78D 2OR8A 2NW2B 5FCSH 3T0EB 3JVGA 3WV0A 3O4LB 4P4KB 2GEEA 3OKLA 3SCMD 4CMHC 4UOW1 1O5DT 4PJDA 4NQCD 4ZFOB 3OAZK 5EO9B 4YR6B 3LB6C 3S34L 1FL3B 1FPTL 4P23C 1KB5B 1MI5D 3EFFB 1Q9LA 4FXKA 4GO6B 3CDGB 4FNLL 5AZ2H 5EOTA 2QQNH 1JNLL 1UJ3B 3BQUB 1T83C 1OW0A 1KIRB 4GS7B 4G6FD 4MA3B 3P9MA 4U33A 5FK9A 2BSRB 5KS9F 1MCCA 4M61A 5IJKA 3UTQA 5HDQH 3GHEL 5J1TC 4XZUA 4XCYB 2Q76A 4OFYD 4D8PA 3G6JE 1IC7H 5FA3B 2HT2C 3MJ8A 4LHUD 3RI5K 1EFXD 3MTRA 4I0KA 4JO1H 4MB5A 5MENB 5C08A 1R24A 3W0WE 3HHRB 5F9OL 1FCCA 2BHZA 3C8HA 1J1XH 3ARFA 4I0PB 4JFXA 4EQ2A 1Q0YH 3WBDA 1Q1JH 3CFEA 4NT6A 3I6LE 4JG0H 1KNOA 5EU3B 3P4LA 1BMGA 1DBML 4PJHA 5GJTL 4P4RB 3GSQA 1S5HB 4IOSD 3ZE1E 2GI7A 4K7FA 1WBXB 4HGKC 1WJ3A 3E2HB 4I2XB 3FCTA 3DECA 2P8LA 4HKZA 3VXTA 1AP2B 1WT5A 5E7FA 4PY8J 5IWLA 3UEZA 3MOAL 4PRAB 4FQPA 3RGVD 4AM0B 1JF5A 2NR6C 2FGWH 4I3SH 1OY3B 4RX4D 2HKFL 1KEML 4O51B 4DW2L 5FYKH 1AC6A 1BHGA 3FT2B 4IRJA 4L29B 2CLVA 2WUCL 4E0RB 4W70A 3WLWC 2ERJC 2E6PA 4IIQA 4Y4KC 1XGTB 5DMIH 1IAKA 1Y6KR 4M3KB 3HG1D 3CFBA 4WW2F 3MV9B 3X11B 4Z7NF 3QEHB 3QWRA 5L2KB 3TT3L 4M9PA 5IQ7L 2P7TB 2Y36H 5MHSD 4M5ZH 1S7QB 4EUPG 4Q6YA 5DWUH 2CKBB 1WC7B 4HCRH 3WUWA 1JV5A 4KU1A 4OCYH 2HYMA 2ADFH 4RAVA 1A6AA 3GSRB 3KPQB 1FYTA 4F9LA 4Q97A 4DK3A 2DYPA 1QACA 1J8HD 1KBGL 1MNUL 4PJ5E 5HGBA 2AV1B 3O6FA 4UINH 4K94L 4EBQH 4YHNA 3IXAA 5A1AA 1K4DA 1LO3L 4K55A 3C6LB 5JO5A 4PJFA 1QKZL 1FAIH 5D96C 3C5ZC 5KN5A 2VR4A 4OTXH 1F58L 3GMMA 5EUKB 4P2QE 2VLKD 1SEBB 4GKZB 2VXVL 1KG0A 1HKFA 2V2WB 3ROOA 1UWGH 5T1LB 1KJMB 2WLYA 4M03A 4MA7L 3VMPA 1MQKL 5ECJE 3U0WL 3VD7A 1NLDH 2FHFA 3B9KA 2MQ3A 3AROA 2MWCA 4DWHA 4P2OA 1DQLH 5E8NB 1JTOA 5TDPA 3G6AB 2Z9TA 2AEQH 1G6RH 4XPFH 3D3VD 3KWWB 1SEQH 1IAOA 4XCEB 1JE6A 3K8MA 3RVUC 5EOCH 1I9EA 2R29L 5E8EA 3SGKA 4NJ9L 3GMPB 3H0TB 4HXAH 2AK4E 4JPIB 5DFVC 3O9WC 5EC2B 4PJCA 1XT5A 3FQXA 3N1QC 4XNXL 4JO4L 2A6IA 1MHHB 2DDQL 3QCTL 1OTSC 4I18B 4K23L 3GIVA 4L4TE 1D6EB 3KJ6H 2IMNA 2JIXD 3WFHB 2NZ9C 3Q5TA 1FN4B 4LEXH 4ZYKA 3OKNA 2F74B 1Q9WB 4ONHB 5GJSH 1QSZA 2FATH 1MLBA 2EH8H 1M4KA 2XZAL 4PGJA 4IMLA 1KLUA 4Y19A 5ID0A 1T2XA 3ZLQC 4AQOA 5C09E 2AEWA 4UBDD 4X6DF 2VAAB 2P5WD 4R2GD 5FYLE 4CN4A 5D7SH 3NIGF 1MCPH 1IJ9A 3CXHK 5EN2B 4BZ1H 3SKNA 4KZEH 5K59F 1QVOA 1AJ7L 4TUJB 3FFDA 3R1GL 3NA4A 2BCKA 4ZXBB 3K81A 4UIKH 1U3ZA 4XHQA 4JREC 1FSKB 5CWSA 4DQOL 5ICYA 3RX8A 3ARBB 5E0QA 1A14H 4UAOC 4F15C 2UY6A 1L9MA 5T1DL 1MQ8A 4M1DL 5DUPL 4PUBL 1TVHA 3MCG1 4YHPA 4LLWB 1W72B 1KLFA 3W11D