4HF5L

Crystal structure of fab 8f8 in complex a h2n2 influenza virus hemagglutinin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
212
structure length
196
Chain Sequence
VLTQSPSASGTPGQAITISCSGSSSNIGSNPVNWYQQLPGAAPKLLIYADEHRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLSGPAVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQLVCLISDFYPGAVTVGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1
publication title A recurring motif for antibody recognition of the receptor-binding site of influenza hemagglutinin.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 23
structure length 196
sequence length 212
ec nomenclature
pdb deposition date 2012-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hf5L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hf5L01
5FUZH 3F12A 4KMTH 4V1DE 5IFJA 4GAJH 1RK0B 3O3AB 4MJID 4FQXA 3VFSB 4K2UH 5CFHA 4GAFB 3E6HB 4RMQA 3MGTB 3RZCC 3OKLA 4DKDC 2FX9H 2G5BB 5EB9A 3KJ6L 2XWBA 4PJ9B 1IM9D 4QCIA 3HE7D 4LSSH 1BM3L 4IM8A 2X5PA 2YRLA 1CD1B 1BJ1J 1IE5A 4UILL 1KLFA 3O6MH 4L29B 1GC1L 4WI6A 5H94A 2A74A 2J6EL 4LPCA 4HIHA 3BZEB 1WZMA 4Z7WF 4LPVA 4S2SA 3IB4A 1T1XA 2X1XR 2RGSA 1U3HB 3L7FB 1MFDL 4PJEB 2R2EB 5DS8B 5MHSD 3DTXA 1UJ3B 4FTVB 2WK2A 3WO3B 1NCBH 3C60A 3EOBB 4YZFE 4CMMB 2XWJB 5DRZA 3ARBD 4FOMA 5CZVL 3C6LA 3BRFA 2YMXL 4OBSA 4UINL 3DO7A 3NIGF 1XFPA 3TWCL 2UZIH 2WUCL 4QHMB 7FABH 1G7PA 3AXLA 2JF1A 3K46A 5I17B 1TTFA 3QIBA 3SQBA 1WF5A 3LS5L 3DYOA 4JANA 3THMH 4M7KL 4ZSOB 1MRCL 1QSEB 4U6TA 3BP4A 3BPLC 2V2WA 3VI4F 4TOYH 4U0RB 2XQYG 4EN3A 5JXEA 3CDGB 2VH5L 2QHLA 1BP3B 5DD6B 1GGBL 1KXVC 3X13A 3X11B 1ZVHA 1BOYA 5IM7A 4WGVB 1U6AH 2AXGA 2IBGA 1TVBB 2EYSA 2R4SL 4JM2F 4ZYKB 2DWEA 3BGAA 3TVMB 4HBQA 4IOSD 2ITDB 2NW2A 1A14H 4LIQH 4PJBF 5FV2A 3ZKSD 4J3WA 3ARDB 2DICA 1FSKC 4QXGL 1RJYA 3T2PA 5CGYC 2DI8A 4ZXBC 5GZOC 3CDCA 3PNWA 2YXMA 4D0DA 1IGML 1CXFA 4YGAB 1NEZB 3VFMB 1Z5LB 3QWQB 3UMTA 3MC0A 1HKLL 3IFPA 3HI5L 4H25A 4G8EB 3FT3A 4KQ4H 3M17B 1JF6A 3V5KB 2CKBB 1XCTB 5T3XL 1NSNH 3M8OL 1W8OA 4BSWA 3IFLH 3BEWA 1IC5L 1WBZB 4FS0A 2IQ9H 3VE0B 1T7ZA 2VLMD 2DQJH 2P48B 1X4ZA 3KPOB 5J1SC 2IGFH 4M7JH 3DXAD 5KTEL 1WK0A 4RAVB 4CU7A 1I4FA 3PF2A 3Q1SH 2DKMA 1YYML 3AGVA 3IFNH 3ETBF 3S96A 4L3EB 3BKML 2Q87A 4HUKB 3QT2A 3SEPA 5FO7A 3GM0A 5J8OA 2JLLA 3TN0B 25C8L 4NO0D 4NP4H 4OLZL 5JHDE 4WUUE 3EGSB 5HHVL 1KLGA 4L3AA 5HI5D 2APBA 3JV5A 5DRXA 1JUFB 3GFUA 5DD3H 1S7SA 4YBQD 3NCYP 1MCBA 4FNLL 1XCQB 4P2YA 2J8OA 3JV6B 1AGEA 2HTLD 4YDJA 4LARL 4G6FD 4QRPE 5C8JB 5HSFA 1JPSH 4X6DA 4RA0C 5T1DH 5I1HH 2EDWA 5JOEA 4DZ8B 1SJEB 1HSAB 2K9UA 2FATH 3QUXA 3KDMB 5TDOB 4RCAA 3GBMH 5HHMB 1W0WA 3G5VA 3O6FD 1OW0C 3ZL4H 2ADGB 1DQTA 1IGJA 1QVOA 32C2B 4OQ1A 1JGLL 5CKAA 4KTEL 4TUOB 4JAMA 4O58H 1V3MA 2AEQL 2AK4D 4LVNC 4U6HB 4I4WA 4P49A 1VFBA 4JFZH 3GUTB 2HKFH 4PLNC 2B2XH 4JO2H 1DBBH 5TE4H 4UU9A 2XV6B 5F7KC 4TVPD 5FHBL 1WWBX 2C5DC 3TFKC 3QDAA 3PQYE 3IT8D 1NCUA 3NFSL 5DQ9A 1H5BC 3JWOL 1C1EH 3BN3B 4NC1C 3TBWA 3BHBB 4F8TA 5FKAA 1CLYH 1JNHB 4AT6B 5CP7A 1MWAB 5B38B 3VXRE 4RWYH 5BJTA 1MQ8A 4FQCL 3MUHL 4KH2A 4HWBL 5GS2D 4HUUB 3I9GH 3HZKA 4GRWE 4C54A 1VENA 3B3IA 1TPXC 2HG5B 4KHXH 2ZUSA 5C0ND 4N0FB 1BX2A 2P4AB 4PJ7A 4GO6B 3RP1A 2YKLL 4PRNB 3BOVA 1KIPB 4Y4KA 3B2UC 1FFOA 4G43B 1J0YA 2BY3A 5ICXA 3BT2H 4HF5H 1NCWL 3GIZH 1H8NA 3O6KH 1R3HA 2Y7QB 1ZWIA 4O4YH 4GQ9H 3INUL 2GTWA 3D18B 3WCYA 5DT1H 1NAMA 4KVCH 1BFVL 2YSSA 4HMEA 4KFZC 2ADFL 4K23L 4NM8L 3WFBH 1MQKH 1R3IL 5GGUA 2L7UA 3T0EA 1UWEH 1YPZF 3RIAK 2B1HH 5F6IB 4GKSB 2GSIA 1VFMA 5D7LE 4NKIL 1N3NB 4NQCA 1RUMH 4PY8I 3PXJA 3STLA 3SGKC 4FFWC 1WQVT 3LV3B 1CICB 4TUJA 4YHPA 4PG9B 4XB8A 5E00B 5E08L 1AGDB 4XBGA 3QAZB 2WBJD 1WIUA 3PWPA 2HWZL 4LLDB 4J3XA 3MJ9A 4KRPB 5IHLB 4UOW1 3DRQB 3L3OB 1MJJB 3ORJA 2JCCF 3RTQA 3FN3A 4ZFGL 4WW1B 1XR8B 5I66A 2YD4A 3K3QA 4IMLA 4NQXA 1I1YA 3O41B 4BYHA 1EGJA 5GGSB 5KSAC 3VD7A 3WFHA 5GZOD 5I18H 3LKRB 5LBSH 5I1JH 1G1YA 3RI5F 3MLRL 5D2NC 5L2JA 2ICWJ 4N1EA 1OGAA 1GIGH 4HEME 1BVKB 3SDXB 1T4KA 2IAMC 2E9BA 2LE9A 4LCCC 5DRWB 3PABA 5DMYA 2BC4A 4X4ZA 4BZ1L 4XP5H 2CQVA 3RHWF 1OCWL 1EA9C 3EYFB 4QTHB 1AP2B 3LN5A 1QBBA 2DQHH 2IBZX 4PRPE 3E6FA 2Q20A 5B39B 4XCNB 4W4OC 4U6VL 1T66C 1RUKL 2Y36L 3CFDA 4YHIB 4NM4L 5C0GB 2W0FB 4ZO9A 1QFUL 3MFFB 1FIEA 2NXZC 5GSVB 2JIXD 5F7DB 5HYJB 3W5NA 4Z6AT 5FA3B 3UTQA 1TNNA 3QCUL 4F7TA 3UYPA 5EZJB 5EZOH 3QJHB 4P3WA 1FFRA 3MLUH 1MLCB 1U91A 3C5ZB 1HIMH 4JPKH 4X5XB 2B5IC 5BS0D 1JZ7A 4V2BA 4F2MB 2WQ8A 1T7XA 4NDMB 2WBKA 4NZTL 1B4RA 5JDJA 4FQIH 5IGXL 4HUMB 3GBLA 1E27A 1YNTB 4N1CA 2G2RA 3RWEA 3H3KA 4NWUH 3O3DB 3FQRB 3HA0A 2R1XA 1JPFB 1L0QA 4WFFD 2DTMH 2IC2A 1U8PA 4DUWA 2ZOLB 2A73B 3ULUL 4PB0L 2O5YL 3BKYH 2D7OA 3NH7L 1RVFH 4IHOA 4LASL 5C2UB 5KSVB 4GLRI 4ZFFA 3S3SA 4YQXL 3L3HB 5I30L 5D2LB 2AJZB 1RZKL 2YPLD 3VXME 1S9WA 5GHWL 5IB1B 1U8NB 4WHTA 2H2PC 4LVHC 2GJJA 1NUFA 5GS1B 2E7CA 5I8EB 1L6ZA 3TFKD 1RAMA 1RK1A 1GGYA 3G5ZA 1KPVB 1PEZA 1FV1A 4DCQA 2ZUXA 2OL3A 3P30H 4GRMB 3D0LA 5C0FB 1DN0B 1SHMA 2JJUA 2DBJA 4P0DA 1SJVA 1XH3B 2HKHH 2AEPH 4G8GA 1XMWA 4JRYA 1ETZB 4HUXB 1MFCH 5DD0L 3D3VD 1IFHL 5AZ2H 4K7PY 3HHRB 5GJSL 4HT1H 1MHHB 2W59A 3T2OA 5ID1B 5I8CB 5IR1A 1XGYH 5M7QA 3TIEB 1U2CA 1F8TH 5DJAB 4IEFB 5CEZH 5EBLB 5L6YL 4LIQE 3ULVD 1LEIA 1JWMA 3V95A 3F5WA 1M6OA 3UAJC 1FNGA 3BH8B 5JW3H 1A6TA 3QDMD 2PETA 4CRPA 3QDJD 5DXWA 3D1MC 2F15A 1J1OH 5FIEA 1CLOL 3FT4B 3U0WL 1IM9B 1IAII 4JKWA 3HE7B 3SDDD 2CUHA 1KB5A 2P7TB 3DMMA 3QUMB 4M61A 2FGZA 5GJTL 2I07B 4JJ5A 3KXFE 4LLAA 4YXKH 5DFTA 4XVJH 3SE4A 5ALBL 2YC1A 1CIUA 4JHAH 4DOHB 4CUCA 3LIZH 1GRWA 1ZT7A 3HI1A 4OCLC 5CILH 1XR9A 4QLRA 2JK5A 4UTBL 4JHWH 4JFHD 2AQ2A 2GKIA 1PYWB 5CINH 1B0RA 4XHQA 2ZCKH 3RX7A 3VXTB 2EE6A 3ARBB 3QUYD 1N0XH 4OCXH 3GNMH 5FF6A 1NAML 4JFEA 1OTTC 3ZTJH 3BXNB 4UQ2A 3S4SB 4AL8L 3SKMB 5EU6D 2GAZA 3V6OC 4M1CC 2LU4A 4YNYA 3QFJE 4MSWA 1H3PL 4NC2B 1KC5L 1RUQH 3S34L 2Z0BA 3AFLA 4KROC 4YHYC 3I75A 1JN6A 2DKUA 3GSRA 2G9HB 3RPIB 3SDCD 4QNPE 1HOCB 3ZT5A 4O2FA 4FP8L 1ZANH 3HC0A 2CUMA 4HIXL 1JZ3A 4KXZI 4I2XA 2OP4H 4KY1H 3MJ9L 5EZIH 4BKLB 2EXYD 1FP5A 2VLRE 2IAMD 2NY2B 5DTFA 2E8YA 3WL9B 5CBAB 1V05A 4PJGA 1CDYA 3HLAB 1T1YB 2VERN 4HCRA 5HGBB 1XAUA 1FFPA 2JTDA 1VACA 3ARGC 4M93B 4U1MB 5L88H 4JZJA 2Z93B 4U0QB 1XEDA 2EICA 2XN9E 2X1PA 5KVMC 3BPCB 4XZUA 1T66D 3ELAT 1NBVH 3MRHA 2D4FA 3FOMA 5HHQB 1QG3A 3P11H 2NXZD 3I2CL 2FX8L 1P2CA 5IOPA 3I6LE 4IRJD 1KG0B 1PKQA 1A5FH 4M6OH 3S9DB 1E4KA 3O9WC 4JY6A 1IL1A 2VABB 3KAAA 4QF1A 1WT5A 5C9JA 1QFOA 4XP9L 4NGHL 3V7AG 3WIFA 4C55A 3LD8B 4ZPVB 5I1KL 3G6AA 3DXAB 1I7ZB 1IKFL 2DRUA 3BP7B 4XVTL 4OJFH 1GH7A 2NY3C 1HDMB 5DWUL 3HUJB 1I75A 3LY6A 4JRXA 1CVRA 2E6PA 3ES6B 8FABB 2J7LA 5CMAA 1PZ5A 3BKJH 3WIIH 5KVDH 1LO0L 4CNIA 5KVEH 4NO0B 4XCEA 1BFSA 5L0QB 2AJYL 2X1QA 1D5MB 2NX5A 4PJIA 3GDBA 1OTUD 5E8NB 2Q3AA 4XHJC 3W9EA 2R8SL 3W81A 3UJIH 5JW4R 2MOVA 4QHNA 3UBXB 4HJ0D 2CRZA 3S98A 2VLLA 3CIQA 3NGBB 2L0DA 3VRLE 1RZFL 3IDMB 1YEDA 3C2AH 1A6UH 4JY5L 4LPUA 4PBVC 1NLBL 3GSNA 1F5WA 4IOFC 4G6FB 2DL2A 4JGJA 2AI0H 1S7UA 2H2PD 5GS0D 5DJXA 3DVNA 5EBWA 4U3XA 3VH8A 3LB6C 2ZSVA 2J5LC 2X9XA 4RAHA 1A6ZB 3H6JA 5C0EB 1WTGT 3W0WA 1KIUA 5TF1H 4CBPA 1TJGL 3PL6C 1H0DB 2AXFA 5DUBA 3U36A 1VGEH 3VFWA 1OAQH 5D7SH 3O6FB 4NKOA 3KNBA 4RISH 4DVBB 4P2RA 3PG2A 5GGTH 3E8UH 4WTXA 3NIDE 4UIKL 3MJ8A 2PTTA 4U7MA 5HYSG 2AK4B 3CFKB 2Y07H 1MF2L 3HG1D 2FHFA 2XTLA 4X6CF 1GOGA 1MCSA 3CFJB 3CFBB 1S5IL 1A7QH 5BRZA 3SGEH 2ZSWA 4N5EC 1WAAA 1YA5A 2R69L 3SBWC 2OL3L 1HHJA 4QRTA 5GRUH 3WJJC 1I8IA 4YX2L 4DGIL 3GMNA 4OLUL 5INCA 5ESQA 5I8OL 4HLZH 1BD2D 1SYVB 2OJEB 3VG0H 5A3IC 3L3KB 2LABA 3UAJD 1UM6H 5IT2L 1U8IA 2E9WA 4YUEL 1CE1L 1FZMB 4Z7OE 2DQEH 1VB9A 1LP9E 4FQLL 3OB8A 4A6YH 4IIQB 3NABL 3NZHH 4V1DA 1RIVH 1OAZH 3KPNA 4DK3A 5E4EC 4F7CA 3O45A 2Q8BH 2R2HA 4TNVK 5JHLH 1ROWA 2V17L 3KPMA 3IDIA 4LKCA 1WICA 3VD5A 1NGQL 5I1DB 4HS3A 3EJYC 3ILPB 4R9HA 3B9KC 4GG6E 4OV5B 4D0CB 4KGLA 4KUZL 5JMRA 1KB5L 3D25A 2W0LA 5E94A 4NUGH 4XPAL 1P1ZB 4HULB 2GTZA 1PKOA 3O4OB 4GW4B 2IADA 1IT9L 5EU4A 1DTUA 2VLME 4UAOB 4WWKA 3RIFF 4K3EH 4M1CD 3MLZL 1A6PA 3OKKB 3CFCL 4MS8D 5ESVA 1A1NB 2ZG3A 2R0KH 4KROD 3Q5OA 1S7VB 4N8VB 3P77A 4DKAA 1BVLB 2NY7L 5KSUA 5B8CB 1B6DA 1G6RA 2APTA 4S1SL 4OKVB 2WBJB 4QOKD 2AP2A 3ARXA 2XY1A 5D9SA 1FO0B 2ZCLH 4ONGL 4ZNCD 2VE6A 2P24A 4MNQE 4GAYA 4JVPA 1HNGA 5DF0A 5E9DD 5C71A 4BUHA 2EIZB 3V4UH 2HA1A 5J6GA 3GMLA 3ARGD 3ZYJA 1CXLA 3QH3B 4HIEB 4JO3L 1KIQA 3HAEG 1UYWH 4FRWA 4DW2H 1UJTA 3QSKB 3FN9A 4MJ6A 5TGBB 2VAAB 4CADA 1K8IA 3ZE0E 1HQRB 4Z5RA 3IJHB 1YECL 3SCMC 4XAKD 1JTOA 2DWDA 8CGTA 1FNAA 3RWFB 3CK0H 4HCRL 4HG4J 2AW2A 2BNUB 4D0BB 4PRIA 5GZND 5CLWA 1EHLL 1FGNL 1MH5A 3NN8B 1PAMA 3OF6A 1AR1C 1YEHL 2DYPA 3GSQB 2EKJA 3MZGB 4Z0BH 4DUXA 5HDBF 3KLDA 1QHPA 2I26N 2NY3D 1X6LA 3V5HA 1DLHB 4LU5L 3FMGH 1IC4H 1KPUA 5D5MB 3RJQB 3OAUL 3RU8H 3ROLA 4HZLB 1T0NB 3WO4B 5DD1H 2JIXB 4J3OC 3RI5K 4IRZH 5IB4A 1OSPL 4N0CC 3VWKA 4MX7B 4XHJD 2DJ4A 4DQOH 3OJMB 5ESAB 1LEKB 4JZOB 1UM4L 5CEZE 3RWIA 1MVFA 4ODVL 5DVNA 1F2QA 5BS0B 1D5IH 1DUZA 3RHWK 2VR5A 5JIKA 1CU4L 4WUUA 5JHDA 1EHXA 5CKGA 4HZAA 4Y1AE 5LAXB 4P4KA 2ENSA 1NGXA 4U6XA 4NHCL 4MA3B 3BGFB 1DQQB 1WWCA 2X10A 4KKAD 4UQ3B 2R56L 1K3IA 4LLUB 4L4TD 2NTFB 4YXLL 1LEGA 3D85A 2F54D 1FRGL 5F89A 1D5BB 4QRPA 4M4RA 4BSJA 4R0LC 4CW1A 4LOUC 5IB3A 3GSNL 4YIQA 2YPLB 1HSBB 3QXTA 2A6IB 5GPRA 4LVNB 3BZEA 1IRAY 4GW5B 4ZS7H 2FHCA 1S7XB 1E6JL 2XQBH 3NIGE 5DS8A 1T83A 4XCFL 3ARWA 3V52H 3V5DB 2WUBH 4N5ED 3KYNB 4BELD 1BQHG 1Q9WB 3BSZH 1QBLH 1ZTXH 5K9QG 2HJFB 4OZFG 4DN3L 1NANI 3GMRA 5GGQH 2VXQH 1A9BB 1Q94B 3DX7A 5A3ID 3OPZL 1T2QL 3CFEA 2DDQH 4DUVA 4GBXA 4PV8B 3PQYA 3VI4E 4MXWL 5I71B 3D3VB 5T5FL 1DSFH 4UZGA 2FGWH 3JVGC 3DRTB 4M1GL 1IMHC 4CMHC 2YUZA 4R7DA 4NKDB 5JR1L 1Z9SA 3RVVD 1TPXB 4FQPA 5FM8A 4PJBE 4R4FL 4P9ML 3QFDB 1RMFL 4H5SB 3VXRA 3QIUC 2NW3B 3CZJA 4I1NB 3CDGA 2XKNB 1RZJL 4OGYL 4TVSa 4CVZA 1A4JA 5AZEL 3QDMB 5FO9A 1TVBA 5BXFB 1OAKL 3QDJB 2HMIC 1BOGB 3VFPA 2GK2A 1DBAH 1I85C 5T1MA 1ZAGA 1V7NL 3SDDB 2ARJA 2YZ8A 4OZGF 4PJAF 4NNPH 5FB8A 4XPGL 3MXWL 1Z9LA 1HHKA 4WJ5B 5MENE 1NEZA 1OB1B 5IWLC 4H26A 2DIJA 3BX7C 3QXUA 1U0QA 1KBGL 1S78D 3M17A 4JG1H 2GCYB 1FGVH 4NT6B 1TENA 4Q0XH 2CKBA 3QEQB 1U36A 4R96A 4U6YB 1FC2D 3U0TA 1OGTB 2VISA 3RL2A 1TXKA 2YPVH 3CLFH 4JDTL 5T1LD 1C5DB 1P84K 3QUYB 5E6IA 4LCYA 4Z7UB 5IBTL 5FAAA 3KPOA 4GMTL 1CQYA 3S88L 1VDGA 4LSUL 4KVNL 5HVHC 4JPVH 1XGPA 2Z8SA 5D7LA 1VSCA 2IANE 3LQMA 4OUUA 5D7JC 1DUYB 3FFDA 5GGVL 4G8IA 4PGEA 5EU6B 3CPLB 4PLKD 3CZFA 4FFZL 2VKWA 3NA9L 3R4DA 3RWGA 3OTTA 4PJXE 3Q5YA 3ILQD 5DUPH 5D70L 1VA9A 2RR3A 3SDCB 5E95B 1G6RL 4MJ4A 3CCHA 4K8RD 4Z77A 3KYMA 5CS7A 1TDQA 1E4XI 4L8DB 3OKOB 2FX7L 5EO9B 2IAMB 2KDGA 4LCCB 1FYTD 3CXHJ 2JJSA 5K9OA 1A21A 1I8KB 4YHOL 3TT1H 3I3EA 4Y5YC 2VDOL 5C09E 4NQED 6FABH 1AR1D 1HK6A 3D9AL 4ZD3L 3I6KA 2AEIT 5ITBL 4HH9A 4MD4B 2YD7A 3KPSD 3W9DA 5CJXA 3TCLB 1OD9A 3MYJA 4YPGB 1JL8A 3HZMA 3O3BB 3SDYL 3FFCD 3H7BA 3DPBA 1MJ7H 4PRAB 4UT6H 5DC9B 5F9WC 4TUOA 4IRJB 1I3RA 1QBMH 3LQZA 4N0CD 3BISA 1MI5D 2CXGA 3MYZA 1I8LC 4JE4B 2X4NA 4Y16C 3V9FA 5JOFA 3MCG1 3BD4A 5LJYH 4RMWA 3DLQR 5GGRY 3GKWH 4PGCA 3LKSB 5DMGC 2AABH 3OR6B 3T77B 1J0JA 1YQVH 5T33H 3I02A 1S9KC 1DLFL 1PSKL 1V3KA 2ADIB 3GJFH 3BHBA 1A4KA 2VDKH 3VGBA 4ZOCA 1JNHA 4AT6A 5D93C 1MCRA 2MQ0A 2OZ4H 1JHLH 3MA9H 3AMLA 1AD0A 1BBJA 2WP3O 5IMKA 5I1EH 3BUYA 1A7RL 3SKOB 1R5WB 1CLCA 4HKZB 1HXMB 2WP3T 1LE5B 3C2SA 5IFAL 1LNUB 3BESR 4QY8B 5DO2D 3VJ6B 1P9MC 1K4CA 3MODH 4GKZA 5JORA 5IV2B 5E99L 2R0WL 3EDFA 4IS6A 4LVHB 1CL7L 1P7KB 2IFFL 4KPHH 4JQIL 2C3XA 1KJVB 3G6DH 5C0RH 4JLRB 1KCVH 1ZE3C 2D7MA 2OCFD 1I7UB 3ARED 3DHMA 3WXVL 5DFVD 3VXMA 5FYKU 1ZOXA 4AYFA 3GJFK 2QQNH 1QSVA 1KPRB 4BFEA 5LGKA 1XIWA 1XF4B 2J3SA 1UXSA 4JFYB 2NLJB 4LCWD 2PN5A 3QQ3B 1OPGH 2A6JA 2HLAB 1N5AA 5IHZA 1JHTB 4M6NL 5BZDB 1JGEB 4NPYB 4PRDB 1FNEB 3VFGH 4TSAH 2HFGL 2DLHA 3PUCA 3V6FB 1LMKA 2JCCE 2GW5A 5T1KA 3MACH 4I48B 4YHNB 1ZHBB 4ELMF 3QIUD 3G08A 4G9FE 4KTYA 1BD2B 4OZIF 4R4BA 5AAMA 3LH2L 3QDGE 4ODBD 3MGOA 3LN4A 2Q6WB 4TTGA 3QI9A 1WC7A 5D2NE 4IBLT 1MJUL 3U83A 2MHAB 3F58H 3O41A 5F7EL 2VN4A 1UQSA 3VFRA 2GJZB 2XPGA 4NZUH 1JCKA 1OD7A 1N2RA 5KN5A 4WU5A 1CBVH 4J8RB 2P5EE 4XP1L 2C3VA 4XC1H 3CMOL 1MPAH 3QNZB 4AQ1B 2Z31C 2LV4A 1DANT 1I1AC 3KXFA 3LEXB 5FGSA 5JTWA 2DQTH 3G6JE 4LSVL 3AB0B 2UY7A 5F3HA 4CN6A 1PQZB 4FQ2H 4ODUA 4PRHD 3PV7A 4K94C 3PDOA 1CZ8L 2E27L 1GGUA 4HBCH 3MV9E 5I1GH 3O8XA 3Q6FB 5DK3A 4MNHB 4O51B 4S1QH 5BOZG 3PHOB 2Y4SA 5FYJH 3U4BH 3WEXB 1EJOL 2BNRD 2CKBL 4IMKA 5FA3A 1G9ML 3C6SA 5EZJA 3QZWG 4KROB 2ZKHL 4KK6C 4DKFL 4F37F 2ZNWA 3U7WH 3KLHC 4PP2A 3SQOL 3C5ZA 3Q2CA 1YMMD 5SWSD 4M8VA 4AEFA 5IK3A 3C9NB 4IDJH 4LAQL 4QOKB 1N5YH 3QG7L 3QFJA 1U93B 5JNYB 2E7BA 4CU8A 3MCLL 3PGCB 5CUSL 5E9DB 1EVTC 5MEQB 1MAMH 1AR2A 3ARGB 4K9EH 2R29L 1JPFA 1UA6L 1AC0A 3GMPA 2VLRA 4K7FA 4NQSA 2IALA 2VDNH 5JA9A 4OF0A 1IZKA 4AH2B 3OXSA 3GJEA 1BBDL 1DVFD 1LDPL 4S1DD 3LQAL 5DJ6B 1JHKH 5H37H 3T0DA 1F4YL 2XN9A 3OKYA 3G9AB 1FL5B 4P46A 4M43H 3T0WA 5JIIA 3KWWB 4KTDL 1AY1L 4YDIH 4OLXH 1WV7T 3K2UL 2QR0B 1ACYL 3QA3A 1CFBA 4X4XA 3HG1E 5DMGD 2DS4A 4BJLA 4JFDE 2NY3B 4RNRB 1RIUL 1C12B 1MSPA 3FKUS 5KSBE 3ARZA 3LSOB 4E41D 3STBA 5E8OA 3TBYB 2GHWB 3GK8L 3L3JA 3H9SD 3AU1A 4WFEE 4NZRH 3ZKMC 1OWRM 2DLTA 4UIMB 4U49A 4OTXH 5C9KA 4UDTA 4XNUL 3MLWL 2GQHA 4MA1C 3OX8B 5FUZL 4MJIA 4KMTL 2X7LA 1G7JB 1M71B 4Z7VA 5A43C 4P4RA 3BRDA 1CFTA 1F4WL 4K2UL 4ZS6C 3TJEL 4L4TB 4KJWC 1BLNB 2F54B 2FX9L 4DN4H 1IGTA 5M94B 3REVA 2P7TA 1VKXA 4QT5A 4LSSL 3FB5B 3DIFB 4U1JA 2HJKB 3O6ML 1A8JH 1ONQB 1U8HB 1ZA3B 2CUIA 2R2BA 1T04A 3OKMA 3BGMB 4PREB 3VFTA 1GGCL 4MCYB 4WV1A 5C08D 3P4MA 1HEZA 1MFNA 1GAFH 3SPVA 4PGDA 4DEPB 3QXAA 3NOIA 4MNGE 1BZ9A 2DOCA 4LRIC 3V6OE 3X3FH 4NN6C 3SKNB 3H7LA 4Z0XA 5I74C 2XZQH 5FOBA 3UYRH 2F5BH 5DMIH 1A3RH 5JW5B 1FVEA 3F7RA 4JFPB 4GG8A 3S4SA 3BP6B 4CJ0A 1F3RB 5DJYA 2ARJQ 3R8QA 2I9LA 2UZIL 4ORGB 7FABL 2VZUA 1RHHB 4M5ZL 1LO3H 1WSST 4TSBL 2Z91B 9CGTA 4UNUA 5HGHA 2OK0H 1H9VA 3THML 5BVJB 3ULUF 4AEEA 5IMLB 3GSWA 1LP9A 2LTQC 2BNQE 4TOYL 3QXDA 1SJXA 3JTTB 4NNXA 3MV7E 4DFHA 2YPKA 3CUPA 1U92B 4D9LL 1S7RA 3DV6B 5CBAA 1I1AD 1U6AL 4WGWB 5ALCH 4X9HA 5HI3C 5D1QC 4WU7A 4P5TA 4B0MM 1T0MB 3MV8D 4ODWA 1A14L 1GZQA 1QSFB 2DQFB 5J7CC 1WZLA 4YWGH 3RVWC 2HN7B 5I2IA 2BMKB 2BY1A 5IHBA 4WO4C 2CLZA 4HUWA 2VDPL 3FONA 4PS4H 1AGCA 5L2KD 4GG6A 3KS0J 4ZPTA 4NRZB 4D8PA 3MNVA 5F1SA 1HH9B 3BWAA 5H2BB 3G5XA 3MREB 1SEBB 4KQ4L 2QHRH 3I84A 1K2DA 4KK6D 3VXSD 1QRND 4EIZC 2ED8A 1PX4A 1NSNL 1W0YT 3R1GH 5T1LB 1QO3A 5CEYB 1CLZH 1TITA 3FL7A 4ONHB 1UZ6E 5KANG 4F7MA 4ZPVA 5ADPL 2IQ9L 2DQJL 2IGFL 4OT1H 1AXSA 2VLJD 4ZAKC 2MPAL 3Q1SL 4K71B 1QNZH 4E42B 3LS4H 5EU5A 4XPBH 3QUKA 3TZVA 5F7MC 3DX6A 4NO0A 1W2KT 1AHWA 5HHOE 4NP4L 3MLYL 4LGRB 5F70A 1CVSC 4CJ1A 4UILH 3RL1B 5DD3L 2BRQA 4OFVA 5EWIH 4YJZL 4P23D 2DI9A 1FYTB 2AQ1A 1ZA6B 4PTUA 5C07E 4PJ7F 4FMKA 1YDPB 1R3JB 2V7HA 3BIBX 1DQJB 4Q6IB 1INEH 3NCEB 4NQEB 1JPSL 4HKJB 3FO2B 5F7YC 4X6BB 5ACMA 3DJ9A 4G7YH 1OF2B 3GSUB 1H0DA 4X6CE 4S0SD 4UINH 3W39B 1BFTA 3KPSB 3GGWB 5C0AD 5IJKC 2V5SA 1ES0A 2ICWB 3FFCB 3VGEA 3GBML 4XB7A 1BAFH 1E28B 3KPTA 1N0LA 3O2VH 1MI5B 2C7UB 3OAZH 4JN1L 4KZEL 5FO8A 4P3CH 5J4MA 4NSKA 4JFZL 1X4XA 3CFJA 2HKFL 4JO2L 4X4YB 3QP3A 3ZKMD 2D0GA 5TE4L 4RFNB 1J0IA 4XWOD 3NCFB 3R0MA 2JJTC 1KNOA 1J05A 2V2TB 5M95B 2R15A 3ZMRA 1XF5A 1OP9A 4ZOAA 4U1IA 2D7QA 5E8DH 1NQBA 4OQTA 3RZCA 2NNAB 4PB9H 2RQ8A 1CLYL 4OFDA 3BIAX 1Q9LA 4KJWD 1IEBA 4RWYL 4Y1AA 3OBAA 1JF1A 1U42A 4X98B 5SWZD 1G7LB 1H8SA 3K4ZA 1OVZA 5IW6A 3I9GL 3OAZK 4HXAL 3ZSSA 3HC4H 4LPXA 1KULA 1QEWB 5HGDA 4LEOB 1I8MA 1FC1A 2Y5EA 3DUSB 5T3XH 5HYQA 1U8JB 4RGMC 5I76A 4D0CA 2XIDA 5DJ2B 3AREB 1ZVSB 3BT2L 4HF5L 3VWJC 3VGAB 4N9GB 3GIZL 1R5IA 3O6KL 4HS6B 5FYJE 4PJCB 4O4YL 2PW2B 5CSBA 3MRCB 3P0VH 5MEPB 2A2QT 4ZDHB 4LCWB 4MHHG 3CVHB 1OM3L 4I18B 5DT1L 2COQA 1VGKB 4KVCL 1JYXA 3BQUA 25C8H 1J7VR 3RVXC 4EJ1C 2HRLA 3VFNB 1CK0H 1MQKL 2OTWB 2RAMA 3K8LA 5E6ZA 1U58A 4YDLC 3MBXH 3QHTC 2CJUH 5DC4B 3G5YA 2HFEB 2R1WA 2AV7A 2FIRT 1NCAH 3NTCH 4P3DB 5FUCC 2P45B 2G75B 1LO4H 1ND0A 5FUOH 4KHTH 4PJBA 5HI3D 5D1QD 4EQ2A 3IDNA 3QCVH 3BJLA 4H1LH 4C4KT 3L6FB 5CGTA 3RVWD 4C56E 3FT2B 4EI5C 4ZXBA 1M05A 4HC1L 2CIKA 4KKBC 3EDEA 3NFNB 1JNNH 3C8HA 4NJAH 4NQDE 3P73B 5I18L 5LBSL 4BQ9A 5I1JL 3IJHA 3ZE1E 5HDBE 2A9NH 3T4YB 1GIGL 1NBYB 3D2UA 2XFXB 3RWFA 2FH6A 1AGFB 4K94H 4ZFOB 3B9DA 3QEUB 3T0BA 4PBWD 5H8DA 4XP5L 4PRHB 3ESVF 5E24E 2FDBP 3BYYA 4NZJA 4MB3A 2VR9A 2FJGB 3RDTD 4HIJA 3GHBH 1QR1B 4Y4HC 1RJLB 1HHGA 2WZPD 3HS0A 1OWWA 5C6WH 4EVNA 3E2HC 1UXWB 4S11A 2VB5A 4FQCH 2B0SH 2EYRB 1U8OB 1P7QD 5JIPA 2EDRA 1UB6B 2IANA 3ULSB 1AO7D 4AEIL 2O61A 1YMMB 3MLUL 1VFAA 5SWSB 5ITFA 1MY5A 4JPKL 4OV6F 4R97C 5EU3B 3MRGA 1TVHA 1ORQB 4M9PA 1EVUA 3CSYA 4PJXA 3UTSD 1HH6A 2EDDA 4LHJB 1KCUL 3BMVA 4FQIL 4LDEB 2CXKA 4YO0A 2X89D 3VRIB 5D7KE 2Y72A 5E2TH 1AI1L 5EC2A 4NWUL 1FORL 1F6LL 2RIKA 1RU9L 1UH4A 2EIEA 3BZ4A 2DTML 3QQ4B 4HHAB 5JA8B 4F37K 1OW0A 3BKYL 3K8MA 1RVFL 1BFVH 2IPUK 1DVFB 1FL6B 2BHUA 5C09A 2E3VA 4Q9QL 3CXDH 4NM8H 1EK3A 5GGTA 3QPQC 4PJHA 2PXYD 1ZGLM 1CTOA 1DBJL 2VQTA 1F4AA 4HKBA 1HXYA 3WN5B 5D8JL 3VFUA 3QG6A 3DX9B 1H5BA 5F72S 5KG9B 2Z35B 3HPLB 2DQCH 1EO7A 1NGZB 3WLBA 5ICYA 2HWZH 3B5GA 3T65A 2X4OB 4ZFGH 1Q8MA 3RUGB 5DMJB 2W65A 4E41B 2X4TA 4MDIB 4RRPG 3H9HA 5IMMB 4PR5A 2CPCA 1MFCL 3UO1H 3H9SB 2FWOB 1V3JA 3OL2A 1TCRA 1XF3B 5FYLH 1ZGLB 1UG9A 2YBRA 1ZLSL 4A6YA 4NC0B 3UJTH 1XGYL 1I3GH 4U3CA 3H42H 2NW3A 1RIHL 1YUHA 1F8TL 4LKXA 4F3FB 5CWSB 5C7XH 5CIPB 4WW2C 4PJAE 3EYOA 4D9RE 2X4RA 1KCSH 4JFOA 4OQTL 4JFXB 2A0LD 4FN0A 3ALWA 5JW3L 3CAFA 4NFDA 4LK4A 4PJGF 3O81A 1OCWH 1N6VA 4ZQKB 1JWUA 1J1OL 2HVKA 5HYIA 5D71L 5FXCH 2C1PA 4Y2DD 1A3QA 4Z7WB 2QL1A 4YR6A 5HPMA 1RUKH 2WAHA 3RY6C 5F1NB 1OB1A 4GSDH 2VSDA 4Q2ZA 1JK8B 3VD3A 5F3BB 1SJHB 5E8PA 3VMNA 4YXKL 4XVJL 3RVXD 1KEGH 5C08B 4JHAL 4W6YB 5FDYA 1YEGH 2GFBB 2MWCA 1Q0XH 3EO9H 3LIZL 4GMSH 4M3KB 4RGNC 5CILL 4U6YA 1UB5B 1DEEB 2CRMA 1Q9KB 3UJJH 2IH1B 3RWJB 5EIIA 3SGKA 1AFVH 1S8DA 4JHWL 1C5DA 2YOCA 5CINL 3EDDA 5I75C 1N0XL 4OCXL 3GNML 1F42A 2JCCA 4MB4A 5C3TA 1YNLH 3FO1B 3GO1L 1U8MA 1KGCD 2NY4D 4DZBB 2I9TB 2YD5A 1HYRC 4G9FA 5KSAA 4TTDD 2ITCA 4PJIF 4LASH 5HYFA 1CFNB 2MQCA 3QDGA 4HDIA 4L5FL 4IRSC 4RX4D 4YQXH 3T8XB 3LKNB 4YDVA 5D2NA 2CIIB 2WIIA 3SGEI 2IAMA 2OP4L 4LCCA 4KY1L 3IU3A 4JZNA 5EZIL 2G60H 3MNZA 1T2XA 4HFWB 3MV8B 1U3JA 2P5EA 1WIPA 1MHEB 5BZWB 5J12B 5L88L 4YBLC 4PJFF 4XNXH 3SGJC 4LCUA 2BOCB 1XZ0B 3ZHKA 5L2KB 1M4KA 5JDSA 2KUTA 5D1XD 4HLJA 3EFDH 3PJSA 3OJDA 5J9PB 4HAFA 2D31B 3G6JA 3CH8A 3UTTD 4PRAA 5DD0H 4NQVA 3P11L 3BH9B 5HYSB 1SM3H 4X4ME 5GJSH 1H15A 5I73C 1X5JA 5DEGB 4EUPH 3MV9A 1FPTL 1UC6A 1A5FL 5EO0B 1QRNB 4M6OL 4GKOA 3WLWD 1F90H 4OCYH 5HI4D 4WI9A 2E7LC 1A0QH 3LKSA 4Y4FD 1AIFB 5L6YH 1RJZB 2R39A 3HE6C 3MZTA 3W5MA 3TA3B 2VLJB 4U1NB 4PY7B 5BCAA 4L1DA 3HCVB 1AXTH 1T1WB 5AD0B 3BKJL 2EDXA 5E0QA 2SEBB 5KVDL 2BZDA 4XNZC 3R06B 3OB0H 4PV9A 2BSRA 1K4DB 4LBEA 3UYOD 1F13A 5GJTH 2AJSL 5C0DB 4NIKB 4XNYH 4OGXL 3UJIL 2EO1A 4HWEH 4XX1G 3LEYH 2C3WA 5ALBH 5T3XE 2Z8WC 3VJ6A 3UP1A 1YEFH 4P23B 2C4FT 3C2AL 3QPQD 4QRQB 3BVNB 4D94A 3T4AA 2AI0L 2X4SA 1P7KA 1KJVA 4XRCB 4JLRA 5ICZA 4KJQD 1NFDF 3A0OA 3VDBA 4L9LC 4EEEA 1KPRA 4G42B 5C0AB 3ARFD 3TH4T 3IXAB 3T2NH 1VGEL 1OAQL 3OB0K 2NLJA 3PHSA 3CMGA 3MBED 5GGTL 3E8UL 1MRFH 3HRPA 3QQ3A 4ELME 5C2BH 3WXWH 1IZJA 2PUQT 5JW4N 3HG1A 5EO1B 3GMQB 1R24A 1FNHA 4JFDA 2LVCA 1NLDH 1KC5H 2Y07L 5FKPA 3BP5B 4CDGC 3C5SB 4Z18A 5I6XC 1IAOA 3WS6C 2EKSA 5KSBA 5JQ6L 1S7WB 1A7QL 3GMOA 4YLQT 2AERT 4HIXH 4NHUB 2HH0H 5A16B 3PP4H 2F53D 5EDXA 3MJ9H 2VXTH 5GRYA 1BD2A 3UZEA 5GRUL 1TJHH 2ZWLT 3MV01 2M8XA 3VG0L 5K9QI 3HC3H 4PY8J 2AJXH 3ZLQC 5TH2A 4M62L 2Q86A 5FHAL 1Q9OA 2DQEL 5DZOA 2AVGA 2P42B 4PD4K 5SWZB 3CXHK 4A6YL 2FO1A 3NZHL 3HAEB 1HQ4A 5EN2B 5GGRB 2D03H 2VR4A 1RIVL 1OAZL 3VXUE 2Q8BL 5JOPD 5D7IB 5JHLL 2UYLB 3Q0HA 4L8SC 1RPQA 1IAKB 4JO4H 4FXKA 2IH3A 1K9TA 5F1IA 4RGND 1CDGA 4JPIB 3UDWC 3PWVB 4NN7C 3RY5A 4MDJA 5C0JA 4NN6B 1B6UA 4KMQA 2QSVA 4HIIA 2BDNH 2GK0B 5I74B 2IQAB 2E7HA 4NUGL 4DGYH 3VXSE 2PCPB 3IXTA 4R7NB 3VXNB 5CEXB 4C83A 1YPZB 2CDEA 4MNGA 4NYLA 3V6OA 3QISA 2O5XH 2AJYH 4PGBB 2H3NB 1WCBB 4CGTA 5DHYA 2R8SH 5HDLA 3P0YH 4PLOB 1OSZB 4OBRA 3BKCH 3CLEL 3OR7A 3VW3H 4OSUL 5JUEH 3BI9X 3U9UB 2QV2A 5DUML 1GZPB 2LTQB 3OXRB 3MNWB 1S9YB 3MRPB 2CLVA 1O7SA 1FZKA 2GY5A 4NO3B 2VXVH 1HNFA 3PGCA 3MJ6A 2ZCLL 4MWFA 3LDBB 3L3IB 5D1QB 1QP1A 3ARGA 3V4UL 3MRJB 3OHXB 3MV7A 4LF3B 4PJ9C 3NFPA 3JTSA 2J8UE 1UYWL 4LVOB 4I9WD 2IWGA 5I1AB 1WEJH 1PLGL 4R4NC 3AAZA 4F7PB 1S7TA 1U8LA 1NMCB 1CDJA 3O9WA 4UV7H 4HUVB 1HZHH 3I6GA 1J1XH 1IQDA 3KWWA 4KI5F 3CK0L 2BCKA 1P69B 4ZFZB 1UJ3C 2QR0A 5B4MD 3ZSTA 1JGDB 1TQBB 4OIAA 4YBHA 4G6ML 5LXGH 4EKXA 3RDTB 4YX2H 4OLEA 3L7EB 4OLUH 5EPMB 3HE6D 4OZFB 1T22A 3F6IA 3IFOA 3FQWA 1FZOB 3HRZB 3D39E 3LPWA 5IT2H 1C12A 1H3GA 4Y5VB 3DROA 1JIBA 3P9MB 3RU8L 4BSVB 3DOSA 4FQLH 3GJFA 5FYLE 5DD1L 5DEFB 4XXDA 3NABH 4IRZL 1P7QB 2PYED 1IQWH 4XH2A 1LE9B 4P57B 1AO7B 2OZ4A 1FZJA 3MJ7B 4DQOL 3EOAB 4GH7B 3P4LA 2ZG1A 5TDPB 5HHOA 3UTSB 1D5IL 1X7QB 4OCSH 4WFGE 2YEZB 4UT7H 4XMLH 1I1FB 5HTSA 1NUGA 2Q7NA 5DVKA 2AJ3B 4E0RA 3TF7C 1ZHKA 4GRWF 4FQQB 4XVUC 4KUZH 3TVMC 1D6EA 4MCZB 5CJBA 1LQSR 1F4XH 4OLWH 3L3GA 3QWRA 3SO3B 2IPKA 1A9EB 3PL6A 3QEGH 1J8KA 3DGGB 5C07A 3REWA 4R6UA 1AGBB 4FABH 2X9YA 4I0KA 3UTZA 1JBJA 1SVZA 1YMHB 4WFHD 2AK1H 4M48H 2PXYB 1MCNA 3IF1A 1J12A 1D5ZB 4L9DA 4QGTA 1WUNT 3UTPE 4YAQA 1PY4A 4XNMA 1J5OL 5GIRB 3IDGB 2NY7H 3SBWA 1F3DJ 2WUBL 2Y5TA 3WJJA 3BSZL 1QBLL 3E3QC 4M9OA 3HZYB 2VXQL 3FJTA 2W1NA 3WFCH 5JPMB 1W8NA 5DD5H 5CSZA 2DDQL 3O11A 3TLRA 3M07A 3MRFB 3TN0C 1DSFL 1T6WA 2PW1B 4XMPH 5SX4H 4M5YH 1HHHB 5TE7H 2OR9H 1XGTB 4PJ5D 1U9KA 3T1FA 2OSLA 4JN2B 3V6BR 2XTJD 5TE6H 1YECH 1J0KA 1U92A 2DQUH 5T3ZD 3B9KA 3DV6A 1KJ2B 3KYKH 3U46A 1FGNH 2VXUH 1YEHH 1R3KB 2GUOB 3BO8A 3PDDA 1DBAL 4U1HB 4Y2DB 4P2OD 4EOWL 2DJSA 4JFFE 3GHEH 5J11B 5HD8C 1BQLH 5BV7C 4NNPL 5MP6H 1VESA 3VXOB 1FVDB 1N59A 4J23A 5ID0B 5C0IA 2LAAA 3DNKA 3ZZ1A 1BF2A 4JDZA 1OSPH 5HY9B 3FQTA 5DK0B 5KBNC 4OF6A 4K3DH 3KVQA 4JG1L 3FB8A 1UVQB 1X9QA 1FGVL 4QWWD 4Q0XL 3DARA 2VZSA 4P99A 4OD1L 4V2CB 4ODVH 3L5XH 5ETUB 1E4WH 2D2OA 3BZFB 2YPVL 3CLFL 4OCRH 2ZOKA 5B3JE 1B0GB 4XBEH 1A2YB 4JPVL 5GISH 4NHCH 1LD9B 2NY4B 2R56H 5CJOL 1KLUA 3SGDH 1WBXB 4BH7B 5KS9B 4Y19E 4PJ7E 1T5WA 2R0LH 1W72H 5JLZB 2VL4A 3U9PL 3HPJA 5ACZB 1MNUL 3F7YB 4GQPH 4YHLH 1SBSH 4G5ZH 2RCSL 1BMGA 3P4NB 4HJGB 4R4ND 3WS3A 4FQXC 4L4VD 4N0UE 2EC9T 5E8EB 3SCMA 3IKCB 4GS7B 4KV5F 4XVSH 2K7QA 3T3PF 4HGWB 3KYAA 3N0PB 4PIRF 4F58H 4I77L 3SE9L 3TT1L 3MOAL 1T20A 4QTIH 4MXVF 6FABL 1S7QA 1YC7A 4KK5C 1QFWH 3W39A 5D1XB 2VITA 3IGAA 5FGCB 1OT1A 1TJIL 4ZUSB 5ANME 3UTTB 5T5FH 1MJ7L 4UT6L 1YEIL 3L5JA 4MD0B 1QBML 5I9QB 1OAXH 2Q8AL 3RWCB 2WSKA 5F88B 5F6IC 4R26L 2DBLH 3X12A 4J1UB 4P9MH 3MRRA 1X44A 4Y4FB 1K3ZA 3KPPB 1WFTA 4R97B 1QSED 3JUYA 3O4LD 2VDMH 1CFQB 1HWGB 1CICC 4WY7L 5JPNA 2AABL 1YQVL 2VLKD 2V2TA 5AZEH 5KOMC 5DHVH 1J8HD 3LRSA 2YHGA 1OAKH 1X3DA 4X0KB 1RQ5A 5C0CD 4KRPC 1TLKA 5IP4A 3QIBC 4WTWA 4BFIB 2VDKL 4K55A 2AXHA 1JWSA 3IDYB 2OZ4L 1JHLL 3MA9L 5I1EL 4AIZB 1BEYL 4QO1A 4XPGH 5D4QA 4R0LA 2OJZH 3DI2B 5I19L 5JXEC 1NGYA 1RZIA 4LLWB 1QYGH 4F7EA 3KPQA 3VH8G 1KBGH 3BW9B 2BHYA 4LEOA 2ATPA 3MODL 4JG0H 1EXUB 3MLXH 1FL3A 2FCBA 1U8JA 2XA8L 1D9KD 5IKCA 1ORSA 5ISZD 3BJ91 5F1OB 3G6DL 5IBTH 5C0RL 1N8ZB 2XOTA 3H9ZA 1D5XA 4G9DA 4O2CA 4GMTH 3S88H 2QQNL 3ARFB 1IGFL 4TULH 5FECA 3MRCA 4U1LA 5MEPA 4X6CB 3MBEB 4LCWA 1O7VA 3QULB 5EOQH 2H8PB 2QQLH 3L5IA 1OPGL 3NA9H 3JVGA 1Y6NR 3TN0D 2GJ6D 4TPRH 2X4QA 5FUCE 2WWMC 3DSFL 3IJYB 5C0BD 5E56A 3ME0A 3VFGL 4H8WC 4TSAL 1CFSA 4M6MH 2FH8A 4LLYA 3QQ9C 4MAYD 3MACL 2F53B 4D9QD 3QIUA 1A1MB 2HFEA 4NCDA 4WW2B 1RUPL 2EECA 4X6EB 1FG2B 3RWHA 3BIKA 2FR4A 3CSPA 4LAJH 3TEUA 1I85A 2ADJB 4QRRE 1YEJL 4ZD3H 2FEEL 5ILTH 2VWEC 3IETB 3Q3GB 3DVGB 2V5RA 5A2IH 4PJAA 3DUUB 3F58L 2D7TH 3KLSA 1WWAX 5IWLA 4NZUL 4ZUWB 1MHPH 3WNOA 1RV6X 1RY7B 1YZZA 5DJDA 5IEKA 1F11B 1CBVL 2HT4D 4RGNB 4XC1L 1MPAL 2WINA 4XT1C 4C59B 2PYFA 4K7PL 1AGFA 3QEUA 1NC2A 4HXBH 1DE4A 4G8GE 2DQTL 4OFPA 5GS1C 5J3HD 3STZB 4FQHA 43CAB 4FQ2L 3ROOA 2FJGA 4POZD 3CC5B 3RNKB 1QR1A 5D7JA 1EEUA 3MROA 4HBCL 5LCVH 5I1GL 1H3XA 1I1RA 3NAAH 4S1QL 3PHQA 4OLYH 2OMNA 3LEVL 2BNRA 4EDWH 5FYJL 4LEXL 4OM1H 5CBEA 3U4BL 1UH3A 1QQDB 4QYOA 2FSEA 3TC9A 2VZ1A 4UTAH 4RIRB 43C9B 5SWQB 4LFHG 2DAVA 3MRIA 1W72B 4YGVB 4DK6A 1AKJA 5ENWB 4JO1H 3IJSA 4FQXD 4IDJL 3N1PC 5E99H 4P59H 3M1BA 4FHBD 4RZCB 2IFFH 3EOYG 4JQIH 2W60B 1NEUA 4Y5YA 3GSOA 2D4DA 4Z7VF 4HWZA 1ZHNB 1T1ZA 1G84A 2BX5A 1MCDA 3PE9A 1MAML 2VDQL 5EBGA 1UWGL 1KTDB 1NDGA 2EC8A 4YBLB 3V6ZA 5TDNA 4C58B 3HE7C 1Q38A 2AKRB 4ZTPH 1JYWA 4I5BA 4ZUUB 4IOIB 2AV1B 3SE8L 3CX5K 1QA9B 1I8LA 3VFOB 2GT9B 4HK0A 4M8QB 4Y16A 1L7IH 4NBYB 3WE6B 1MAJA 3GB7A 1PX3A 3C60D 2M2DA 5EBMA 2D0FA 4M43L 1FFNB 4YDIL 1F3JB 3C6LD 4OLXL 1KJ3L 3KJ4C 4X4MA 4UNVA 3HE6B 4CDHA 4MJ5B 5JXAL 5MEOA 5HGAB 2LQRA 1J86A 4OF8A 3ZDZF 4PP1C 1T0PB 4KRPD 1UFUA 1CXHA 3QIBD 3T0EC 1F97A 5EOCJ 4E41A 4P5KA 5BO1H 4M02A 4XNZB 5I1LA 4U1KA 2PYEB 5K93A 1CG9A 4I2XE 1MFEH 4JVWA 1C5CH 3H9SA 3PWJB 4ZUTA 3BPNC 3L9RB 2A83B 4EN3D 5LKNA 5JXED 2CDFA 1URLA 4NZRL 4XP1H 1P9MA 1L0YA 2APFA 4OTXL 3CMOH 3WDIA 3LKPB 4OD3H 5CWSA 3RTQC 1B88A 5KJRH 2X70B 1GXEA 1INQB 2VDRH 4PRBA 1JYNA 2NY2C 5D96B 5AYQA 2GSGB 5TQ2H 4ZQKA 4O2EA 5D1ZA 4RAUA 1U2HA 4L3CB 1ZSDB 5ERWB 4M93C 1FQ9C 1PKQE 2VL5B 1LO5B 3B5HA 4DN4L 5CAYB 3LMJH 1VEOA 4OAWB 5L8KB 3SY0B 3MRLA 4GKNA 4OZHE 3QWOA 5FYKD 2CKBH 4FFYL 1IGYA 1S3KH 1G9MH 4B5EA 2ZKHH 4DKFH 3V0WH 4M7ZB 2P8PB 5L7XH 3TBSB 1DEEA 3SQOH 3ALPA 4FG6C 3U4AA 1EEZA 4CVWA 1GAFL 4ELMA 4LAQH 2DQDH 4MQ7B 4YFLF 3PV6A 2Z9TA 4YE4H 3X3FL 1PG7W 2ESVE 4LSDA 3MCLH 3LD8C 4R2GD 2XZQL 3CVHL 1KYOJ 3NZ8A 4JKMA 2A9ML 1XF2B 3UYRL 2F5BL 1H3WM 4HWUA 5DMIL 3O3EB 4JB9H 3GBNL 2HVJB 3WFDH 2R29H 2WW8A 2BOBB 4H20H 3MUJA 1HHIB 2H32B 3VCLB 3V0AC 4XCYA 3SN6N 3ULUD 4XNQB 1GOHA 2BVQB 4LL9A 4Z78B 1LO3L 4GW1A 1CFNA 4PJ5B 3VXQB 4L8CA 2OK0L 4WDIA 3O2WH 4YBQC 3LQAH 2CIIA 2XTJB 4NKQB 1EEYB 4NO2A 4B7IA 1KIRB 1WITA 1I9RH 3IAQA 4PJFE 2BVPB 2E5EA 5HHPA 1M7DA 2Z31A 3HN3A 1I1AA 4NN7B 4OZGB 4LPWA 3MV8A 5ALCL 3QUXD 2IF7A 2HFTA 2YUWA 3U6RB 1Y6MR 2X4PB 4HJJH 2QKIB 4P2OB 3TO4C 3L5HA 1KT2A 2ERJC 3ZE0F 3FQNA 1J11A 1BIIA 3EYVB 3FO9B 2BOCA 2HAZA 2Y06H 1MCIA 2PF6A 5CD3A 3O6FC 2Q7YA 1OP5H 4PS4L 3OKEA 4BK4A 3KHQA 3U7YL 2D7NA 2A77H 3FB6A 5B21A 3AVEA 3H0TA 1CXEA 1ZK9A 1GVIA 3GK8H 4QXTB 1S5HB 1U95B 3VXSA 4ZFOL 2H26B 1QRNA 2QHRL 3ARRA 4QHUA 1F6AB 4LHUA 5HHNB 3R1GL 1JPGA 1ED3A 2ICES 4ZG1A 3U4EB 4PTTB 4JFQB 4PY7A 1MWAH 5IF0B 5DMKB 4OT1L 3AS2A 4M3JA 1F4WH 4KJYA 1ZHLB 5AD0A 1QNZL 4WHYH 3LS4L 2G5RA 3TJEH 4DGVH 4XPBL 2HT2D 5DYOA 2BSED 1OP5K 4Z8FH 4IIQC 3U2SA 1VEMA 5GS3A 3FCTB 2P8MB 3QO1B 4P2QD 4P5MB 4CN4A 3WNLA 2DLGA 5GGVY 5C0NC 1NFDE 4L4VB 3PIQB 1GGCH 3IKKA 5EWIL 4QRQA 5DK2A 3D48R 5HBBA 2J8UA 4ISVA 4HMDA 4Y5XC 5AUMA 5DDHA 1REIA 4J3TA 1INEL 1C16A 4HGMA 4I8DA 5IMOB 1MHCA 2A6KB 5DJ0A 3JZ7A 3X14B 1I7TA 4G7VH 4MLIA 3FQXA 4G7YL 5HPOA 1A1OB 1G9NC 3MPCA 3ZKXC 5H35B 3GKZA 3SE4C 4I0PB 3IXAA 4PP1D 3QHFH 5J0BA 3LKOB 4XBPB 2OTPA 1LVEA 3T0ED 4AM0A 3OWEA 3MO1B 3CH1B 3O4OC 1BAFL 3NCCB 4L4JA 5E1AA 4F9LC 1RZ7L 4GUPA 4M5ZH 4UAOC 3UZVB 3O2VL 2B20A 4NQCD 4KK9D 2GITB 4OD2A 2NY0D 3BP5A 4TSBH 3TIDB 3D39A 4P3CL 5MI0B 2H6PA 2FL5B 4E5XB 1XGRA 1JTTA 3NACH 4WEBH 2FRGP 1SMOA 3O4LB 4R8WH 5DZNA 4ZO6A 3PWPD 4NKMB 3VFVA 2W9EL 4XWGL 3FRUA 5B8CC 2VUYA 2NYYC 4YK4C 3RTQD 2VLKB 1J8HB 4D9LH 1I1CA 2QSQA 2WBJC 4UDUB 1TVDA 3UPCA 5C0CB 2NY2D 4HGKC 4Q58C 5E8DL 2RFXB 2CO6B 3B9EA 1FDLH 2KZWA 3W82A 2X4UA 3MRDA 4PB9L 5TFSH 1HINH 4RWHA 3S36X 1NGWA 3P9LA 2VDPH 2VRAA 4F33B 3DBXB 1OGAD 1KJMB 5FM4A 1T3FB 4U7SA 4PRIE 2YXFA 5INDB 3K74B 2P8LB 3HC4L 5DI8B 1CCZA 1S9XB 1D9KB 4J3SA 3KPRE 5ISZB 4FG6D 1FJ1A 1KTLB 4X7SL 3RZWA 2OXGA 4LRIA 4CVXB 3MCKB 5ADPH 4LSTH 4F9PC 1MVUB 3B9VA 3PGDA 4LLVA 2BSTA 5FYKH 2IG2H 4L8BB 5GSRB 2MPAH 4EZMA 4XCCH 3P0VL 2EE9A 2CLRB 3N06B 1T2JA 4XP4H 3WO4C 1QLFB 2GJ6B 2ZZUT 3MLYH 3WNMA 5ELIA 5C0BB 1CK0L 4MAYB 4OZIB 3IDJA 3OXRA 3MBXL 1DL7H 2CJUL 5IQ9B 3MRKB 1NCAL 3KLAA 3NTCL 2IJ0C 3OG6B 4PJXF 5DRNA 2ZUTA 3QDHA 4HS8L 4ETQB 4YHMH 1LO4L 1GJIA 2F5AL 5FUOL 4KHTL 2X6MA 3FB7B 4RFEB 3DURB 3QCVL 3BGFC 3TO4D 2CDGB 4QEGA 1KCRH 1V5JA 3ARUA 4WO4A 5BV7B 3HMXL 3V8CA 4PJEE 3HZVA 1VHPA 3ZYIA 4JDVA 4KI5E 3FTGB 2NMSA 5FA4A 4FTVE 4G80B 5EZLB 1JNNL 4JN1H 4NJAL 3EUUA 4KZEH 5SV3A 3A6CH 3V0VA 2VDLL 3MUY1 1R6VA 4JFFA 4PJHF 3ZDYE 5CJ8A 2A9NL 1M7IA 4ODHH 3TM6A 1DN2A 4WI5A 4EUPA 1W0VB 2UWEB 2APWA 4TNVF 4K94L 3QJFA 5LWYH 1CE6B 4LQ1A 1CF8H 5K9KB 1ZT4B 1LK2B 1MCPH 2RB8A 3EHBD 4N90E 3KG5A 4ZAKA 1FZOA 1RI8A 3GHBL 4JRYD 4NOFA 3KYOB 1RD6A 3P9MA 3QIWA 4ZSOE 1IVLA 1U8QA 1T5XB 4HV8B 5DEFA 5I71C 1P7QA 3BEVB 3PWUB 2B0SL 2XI9A 3OGCA 3MJ7A 2V2XB 3EOAA 1MUJB 4HXAH 1QOKA 3QPXH 5IFJB 3S36H 2P5WD 1X5HA 4FQXB 4Y19A 3Q5TA 3ULVF 3ULVC 2NCMA 3OKLB 2R1YA 1EZVX 5BMFL 1CXIA 4X5WA 5IW1A 2BVOA 4MQXC 2VSCA 3DMMD 3QUMH 4NZDA 5E2TL 4N0UA 12E8H 4XPTH 2Y25A 5E6YA 5H94B 3SDDC 2A74B 1EAPA 4HIHB 5IJKA 2ORBH 1T1XB 1OM3H 2DF3A 3IVKA 3MV11 4TQEH 1B4JH 1IEAA 5A2KH 3DTXB 3S7GA 3CXDL 4W4NA 2NZIA 3E3QE 3C60B 3H2WA 1CT8B 1GCFA 4EDXA 5EORH 3DETD 5DRZB 1WTLA 1VEPA 4X7FC 1DDHA 5ANMA 5F6HI 3C6LB 4L3EE 1X5LA 5E1HB 3I85A 3DO7B 4JFED 2DQGH 2JJTA 2ZG2A 3QUYC 4Z7UF 2NYYD 4KRLB 1ACZA 2DQCL 2Y6SD 1G7MB 1JRHL 1G7PB 3AXLB 5FK9A 4QHLA 1SY6H 3QIBB 5HYEA 3NCJH 4JANB 1BPVA 1RZGA 4ACPA 5J1AA 3AY4C 3BP4B 4HC1H 5ACLA 2V2WB 1EV2E 4UOW0 3UO1L 3OMZA 1NPUA 4JHZA 4EN3B 2I24N 5FYLL 3TGXA 1B2WL 3X13B 1U8KA 3SDCC 2J12B 3G04B 1N64H 3UJTL 2AXGB 1I3GL 2EYSB 3H42L 2DWEB 5DGQA 2NW2B 4LHQB 2EXYC 5C7XL 4JJHA 1RJYB 1KCSL 4HPYH 1QFHA 5HHME 3B9AA 1I9IH 3EAKA 1JFQL 2JJVA 3PNWB 3VWJA 1IJ9A 3C08L 4D0DB 2BVTA 3ZKNC 2ATKA 4MJ2A 1KXTB 1MRDL 4HW6A 4H25B 1WBYA 3FT3B 3SE3C 1C7TA 2DB8A 1YN7B 2XG4A 1SQ2N 3U1SL 3OAYH 4GSDL 4U31A 4RQQA 3RVTD 3G6JF 3RVUC 4BSWB 4IRJC 3BEWB 1KEGL 1YEGL 5C6TH 3ZYOA 1Q0XL 3EO9L 4AEIH 1OTSC 4GMSL 4KC3B 2EDNA 5ETUA 3UJJL 1BZ7A 1AFVL 1J10A 1C7SA 3S96B 4JRXD 4RDQF 3SJVD 2X9WA 4R2GB 1A7NH 1KCUH 5FO7B 5TJWK 3QNXA 5FDWA 3RKDC 2C3GA 3QO0A 1KLGB 2NX5D 1AI1H 2L7JA 1FORH 1YNLL 5DRXB 2FJFA 1YY8A 4DTGL 5IB5A 1RU9H 4EI5A 4KV5E 1S7SB 1OTUC 4ERSH 3CDYA 3T3PE 3OAYK 4GRLA 4RX4A 4HJ0C 2EDJA 1AGEB 4YDJB 4Q9QH 3P4NA 4QRRA 1HYSC 4MXVE 4X6DB 1DBJH 4WENB 3U48A 1MOEA 5GS0C 5D8JH 2G60L 5J6HA 3QUXB 1XGUA 3W0WD 2ZUQC 2EYTA 1W0WB 4HKXA 4P2RD 1IGJB 1QVOB 5EULV 3VI3E 3DVFA 4Y4HA 1SBBA 2CH8A 4JAMB 2YR3A 4XNXL 1VFBB 1QLRA 4PJDA 2EDQA 4UI2A 3EFDL 4NUJA 3PWNA 4UU9B 3QXVA 2EXWD 2V9RA 4URTB 3TYFA 4KXZH 4TVPH 1SM3L 5BRZD 2ZNXA 4FXGA 1ZLSH 5DQ9B 3VXPA 5HGGS 5KSBF 1F90L 2QQQA 2YS4A 4OCYL 3UPRA 3JV4A 1RIHH 1A0QL 5FKAB 4DAGL 1DQMH 1N6UA 5CP7B 4OQTH 4GBXC 5BJTB 3NPSB 1P4IH 4X0KA 1Y18A 4FQ1L 1HILA 1AXTL 3VMPA 4V1DD 5GS2H 4MQXD 1Q1JL 3TT3H 3QRGL 1I7RA 5D71H 3DGCR 3B3IB 3GSXA 2Z4QA 4KDWA 3QNYB 3SDXE 3B5TA 1BX2B 1NBQA 4P2QB 3WIHL 5E4IA 4PJ7B 4XNYL 4HWEL 3LEYL 3ARPA 4JEGB 1FFOB 1YEFL 3FRPA 4BUGA 3OZ9L 1EXUA 3QEQD 1R3HB 1ZWIB 5GRZA 5JO5B 5I1CL 3VGGA 4TUKH 3QUZA 1NAKH 1G9NH 2GTWB 5FYKE 3KJ4B 1NAMB 3AB0C 2ARWA 1P4LA 2PTUA 5HYJE 1G7HB 2YSSB 4LMQE 4JHBA 3GSVA 1VCAA 4WWKD 5GGUB 3T0EB 3GO1H 4WTZA 3T2NL 1JV5A 5E5UB 1MRFL 2X40A 2XZZA 5DJ8A 5C2BL 3WXWL 4NQCB 5DVLA 2NY0B 2XWTA 4MS8C 3BPNB 1NBZA 4L5FH 4TUJB 2MQ3A 1NLDL 4OGAD 4YHPB 5C3LD 1TZHA 1PFCA 4XBGB 4X7TA 3PWPB 4MVBC 2F53A 3MLTA 4LFHD 1FO0H 4W68A 4JGMA 2HH0L 3RTQB 4WW2A 3PP4L 4G8FA 4WI4A 5I66B 1OY3B 2VXTL 4AENA 2MKWA 4IMLB 4NQXB 4J12A 1I1YB 1TJHL 1O5DT 1MLBA 4AJ0A 3HC3L 3WFHB 2Q76A 1FN4A 3GRWH 2AJXL 3TNMA 5KW9H 5LG1A 4JM4L 3BRGC 1FVCA 5IBLC 3GMMA 5D2LE 3ZKND 1N4XH 3OKDA 2BY2A 5L2JB 1IAIM 3RY6A 1BFOA 3Q6GH 1OGAB 5EIQA 2D03L 3EJZD 4ETYA 3RAJH 1T4KB 2HJLA 4ZUWA 3PABB 3RVUD 2BC4B 2JJSC 3CSGA 1FPTH 4JO4L 4HH8A 2VNCA 1DQDH 3OF6D 3TBTA 1OTSD 2DYPD 2FJHA 1Y0LA 2MJWA 3LN5B 3E6FB 5GZNC 4OZHA 3FQUA 1NJ9A 1JNLH 4KKLC 1R5VA 4LLMA 4AG4H 3CFDB 3JWDC 3MJGX 4JR9L 1PD6A 3STZA 2BDNL 1DANU 1J9CT 4X80H 3ZTJG 2WQRA 3LRGA 3TP4A 1C8PA 3UTQB 3RKDD 4G6JL 4DGYL 3MRNB 4F7TB 2DN7A 2AGJL 1P5UA 3DYMA 3ALXA 2ESVA 1UZ6F 2O5XL 1T21A 3HKFA 2YZ1A 2AJSH 2FB4H 2FBJH 4OGXH 3P0YL 4IRSA 4MJIE 3BKCL 4HX1A 3SOBH 3HR5A 3HFML 1H3VA 5HVWA 5JHDD 4Z7VE 3VW3L 1W72A 5IB2A 5JUEL 4P4KD 1HYSD 1R3LA 4OIBA 2G2RB 3RWEB 1CN4A 1TMCB 5EUKA 1U3ZA 3OGOE 2VXVL 2R1XB 1IGIH 3D85D 3GZKA 2PO6C 3EDJA 4IHOB 4LSQL 3TO4B 4KKAC 4KZDH 3HNVH 4QRPD 4ZFFB 2ERJB 2V7NA 4PJFA 2OTUA 4X6FA 4DOHE 7CGTA 4OFKA 3SGJA 5IEHA 3EZ8A 2AKRA 4RGOH 2MNUA 5MHSE 2X1WL 1S9WB 4N0RA 4GXVH 5EC1A 1KCKA 4WHTB 4I13B 4Q6YA 1WEJL 4HSQA 1AQDA 3PWLA 3S35X 1JTPA 1RK1B 1NFIA 3L95A 3ZDZE 3G5ZB 1UZ8A 4DCQB 1FV1B 5JQ6H 2E7LA 4UV7L 2OL3B 1VERA 1HZHL 4M00A 1J1XL 3D0LB 1FFNA 5IVZA 3B4NA 4DEPC 2XKSA 4MLSA 3TNNB 3HE6A 5EU7C 3TYGL 5LXGL 3S5LA 2APVA 2H9GB 2BRRH 1HI6A 4GBXD 4JRYB 1OARH 4XI5D 4M62H 3MMEA 5FHAH 1ZS8A 5DHVA 3VDCA 5IR1B 1TZGH 1IC7L 5EFIA 1RUAH 4PPTA 1IQWL 2OQJA 3VXRD 3RVVC 2PR4L 2R23B 4Z7NF 1LEIB 1JWMB 1G6VK 3C8KA 1C08A 3I50H 3ULVH 2P5WB 3F5WB 1M6OB 2AS5M 1FNGB 1A6TB 4QRUB 2FIKA 2NTSP 4N8CL 2F8VA 3DV4A 4NRYA 5A1AA 4Y5XB 4OCSL 5AG8A 4BH8A 4O9HL 3N9GH 4UT7L 2CK2A 4XMLL 1J88A 3AS3A 4ODXB 1KB5B 3B43A 3H3BC 3DMMB 4M61B 1NFDA 4AIXA 2C4XA 4L9LA 1F4XL 4OLWL 5BW7C 2F58H 1IKNC 1ZMYA 3SGDI 3QEGL 3ZKXB 1ZT1B 2WV3A 2YC1B 1CGSH 4NO5B 5BQ7A 4FABL 1ZT7B 3HI1B 1BREA 4OAWA 3JXAA 1XR9B 2F8OA 2JK5B 4QHKI 4U1SA 4DFIA 3RNQA 2AK1L 4M48L 1S78C 3BMWA 3VRJA 1VADA 3DXAE 3WS6A 3CLEH 4OSUH 3HUJE 1SYSA 5FF6B 5DUMH 1Z9MA 1O0VA 1EEQA 5J89A 5DQJA 4JFEB 4MVBD 4QRSA 4JPWL 1F6FB 3L3DB 5D7LD 5HVGB 2B4CC 4YK4B 4UQ2B 1MCQA 4HLZG 3LKQA 2ED7A 2GAZB 4NRXB 1QFWI 3V4PH 4MD5A 4YNYB 4H0GA 4MSWB 3WHE1 1AJ7H 4K71C 3WFCL 5DD5L 3I75B 4PYHA 1JN6B 5IBLD 4PLKC 3GSRB 5CZXD 2FECL 3K4DA 4O2FB 2BVQA 3MUGA 3ILQC 1FLRH 4XMPL 2VQ1A 3WSQH 3IDUA 4M5YL 3EO1A 3MRQA 1MFBH 1EFXA 1II4E 1PLGH 2OR9L 5TE7L 4K8RC 2F74A 5DTFB 2HFFB 4L8SA 5EOCH 3PGFH 3WHXA 1KIRA 4PJGB 1GSMA 1KOAA 2BVPA 1FFPB 5TE6L 1VACB 1KENH 5EUOB 4ZUVA 3UDWA 2YN5A 2DQUL 4PUBH 4E9LA 4JKPH 4XC3L 2VC2H 3KYKL 4OCMC 4Q6IC 1WIOA 3MLVH 2VXUL 3C09B 4KKLD 4XZUB 4G6MH 3S35H 5DJCA 5DEZA 1RZ8A 3MRHB 2AK4E 3FOMB 3ZE1F 2HT3C 2BFVH 1P2CB 2NY5C 2ZJSH 3GHEL 3KPRA 2J1KA 3ABZA 5TQ0L 5IOPB 5EOTB 1BQLL 4TVPE 5MP6L 4PRPD 3GIVA 5D6DA 3RGVA 4P46C 1MCJA 4JY6B 1MCEA 1IL1B 3RWDA 5LGJA 3IRZA 3EFFA 4QF1B 3RQ3A 4WNQA 1A6AA 1S5HA 5C9JB 5HXMA 4K3DL 4O5LH 3WIFB 3I3BA 3D0VA 3G6AB 3R0NA 2EO9A 2CKNA 5FGBC 5I8KH 3L5XL 3QEHA 4OZ4B 1NDMA 4JRXB 4MA7H 4RFNC 1E4WL 3SJVB 1PZ5B 2IBZY 2IPTH 4OCRL 4CNIB 1CTNA 4XCEB 3D6GA 1F45A 1RK0A 2P43B 3O3AA 4XBEL 2NX5B 4PJIB 5DSCB 3VFSA 3W9EB 2PO6D 3E6HA 5GISL 4QHNB 3MGTA 2G5BA 4PJ9A 1MIEH 1I9EA 4ZOEA 4OLVH 3GSNB 2ID5A 2R0LL 2V5YA 1D3CA 1W72L 3QO1A 1CD1A 1CFVH 2EDYA 4JCLA 2XZAH 4R90H 1Z6JT 3C5JB 1S7UB 4L29A 2W9LA 4YHLL 1SBSL 4G5ZL 3DVNB 4KK8C 5DJXB 5DO2C 5EBWB 3VH8B 5GS0H 2ZSVB 5E2WL 1U3HA 2EZ0D 3L7FA 4PJEA 4XVSL 1J5OH 3VXMD 1LGVA 3W0WB 2R2EA 4M4PA 1UJ3A 2AXFB 4FTVA 1C5BH 5DUBB 4F58L 3U36B 3VFWB 1GL4B 1XIWD 4NKOB 3KNBB 3AREC 3EOBA 4P2RB 5DFVC 4CMMA 3VGAC 2XWJA 4QTIL 3U0PB 3HNTH 3MJ8B 1I9JL 5FOJA 2PTTB 2Q3ZA 2EH8H 1QFWL 4PJCF 2B7DT 3LKOA 4XBPA 4APQC 4QHMA 4I18C 3RY4A 1ZLVH 2DIBA 5BRZB 5T1KD 1KYOK 4ONFH 5I17A 2ZSWB 5IVXB 4RDQG 4M7LH 2BP3A 2DLIA 1HHJB 1OAXL 4QRTB 2NPLX 2R0ZL 1I8IB 1BGXL 3GMNB 4X9GA 4ZSOA 5INCB 5ESQB 1QSEA 2DBLL 4M03A 1GGIH 2VDML 1U8IB 5BVPL 4P2CG 5DD6A 1L4IA 4KMLB 3X11A 2RJMA 3H3PH 4MAUL 4U2YA 4ZYKA 3TVMA 4V1DB 5IROC 3VDAA 2ITDA 4M1DL 3KPNB 3HNSH 4F7CB 3O45B 4EOWH 3ARDA 2CMRH 1QSFD 3X3GH 2EEAA 1OP3H 3DX8B 3KPMB 5ADOH 4F33A 3IDIB 1IBGH 3P0GB 1ZLVK 2OJZL 4HS3B 3VFMA 1Z5LA 4U1GB 5C1MB 5KAQF 1QYGL 1XF1A 3KXFD 4G8EA 4LSPL 4P5TC 3V5KA 1HE7A 1XCTA 4OD1H 4JG0L 3D25B 3MLXL 1CL7I 5D5ME 5E94B 1N6QH 1MCCA 1RJCA 4CVXA 1WBZA 1BJ1H 2GTZB 3O8XD 3VE0A 2IADB 2E6JA 4K07A 5EU4B 4WWKB 4RAVA 4UUJB 3RJDA 4TULL 3EW3B 5J13B 4L3EA 5ESVB 5CJOH 4XXCC 1OP3K 5EOQL 5BS0E 1EHAA 1EBPA 3TN0A 2QQLL 3K0WA 3P77B 3EGSA 5KSUB 2YA0A 3U9PH 2F8XC 4TPRL 1VFUA 5CSGA 1JUFA 1MNUH 2H1PL 5DJZB 2KQNA 2RCSH 3QFJD 1JPTH 5D9SB 4NWTL 1NCNA 4M6ML 2B1AH 2VE6B 1XCQA 4GAYB 1MAKA 1MELA 4WFFE 2ZPKH 2P49B 3JV6A 3RFZC 4XPFH 5J6GB 3GMLB 4I77H 5C8JA 3SKJH 3SE9H 1KIQB 3MOAH 2VLRD 2YK1H 3DURA 4OUOA 2YPLE 4DZ8A 5A2JH 1SJEA 3I3DA 5ILTL 1HSAA 2HT3D 4PJHE 3KDMA 2R4RH 5TDOA 4CADB 2D7TL 4Z5RB 1TJIH 2MKLC 2ADGA 2XN9D 4G80A 5EZLA 1DVFC 32C2A 3NVQA 4K7PX 2DWDB 4S1DC 4D2NA 4P46D 1MHPL 1YEIH 4U6HA 2Q8AH 1MH5B 2DYPB 3GUTA 3MRBB 4NC1E 3JWDH 4R26H 3I6LD 1W0VA 3WN5C 4OIIH 3V5HB 4BFGA 1TETL 4HXBL 4RBPH 4WY7H 3D3VE 3ROLB 3EYQC 1LK2A 2YUVA 5F7FA 5IB4B 4OI8A 3VWKB 1P84J 1MCOL 3WNPA 5LCVL 3RUGF 3NAAL 1MWAA 4OLYL 3D87B 2KPNA 5B38A 2EDBA 4EDWL 3RWIB 1BEYH 4OM1L 4Z7QF 3ULVE 1DFBL 1DUZB 3F7PC 5I19H 2D9CA 4HUUA 4WUUB 5JHDB 5HDQH 4DWHA 3QDME 5AG9A 4UTAL 2NQCA 2X42A 2W91A 3QDJE 4P4KB 2HG5A 5I16B 5E5MB 4KK8D 1NGXB 3JV0A 4N0FA 4JO1L 4U6XB 3QB7C 4P59L 2XA8H 1LEGB 2DLFH 1CGYA 3D85B 2H45A 4PRNA 2OI9B 4RBPK 1EBAA 1KIPA 2ZUQB 3QHZH 4G43A 4Y89A 5F89B 3ISWA 1G9EA 4QRPB 4CW1B 4X9BA 1Q0YH 5IB3B 1EX0A 1DJSA 4GOSA 4YIQB 2Y7QA 1IGFH 3N50A 3QEQE 3D18A 2GEEA 4KUCD 1WZ1L 4ZTPL 4JFHE 3BDBA 3CX2A 4APQD 3A6OA 4Z7UE 1WZKA 3DSFH 1MEXH 2XQYK 1L7IL 1CT8A 4GKSA 3GMRB 1N3NA 3MR9B 5MERB 3DX7B 5EU6E 3LV3A 1CICA 4Q9BA 1RUPH 4PG9A 3CFEB 5E00A 3WUWB 3C8DA 1AGDA 4GBXB 1OHQA 3PQYB 3QBTB 1G7MA 1KN2H 4OI7A 4BQ8A 3BQUC 4LLDA 4PG2C 1A6VH 3DRQA 3L3OA 1MJJA 3NPZB 1YEJH 4WW1A 4R7DB 1XR8A 4WI3A 4OKDA 5BO1L 4WRLA 2AJVL 5GGSA 1MFEL 3VXRB 1C5CL 2Y9RT 4JY4B 5F9OH 1MCKA 3LKRA 2JJWA 3TJHD 3G04A 4CVZB 1A4JB 5KVFH 4GRWB 5FO9B 4JM2C 1KV3A 3VFPB 4P5TD 1BVKA 3SDXA 4OD3L 2VXSL 1CYGA 4K7PH 5T1MB 4HUNB 4NNYB 5DRWA 5KJRL 2ARJB 2DLEA 2VDRL 4GJTB 5JW4M 5FB8B 2EDKA 5TQ2L 1HHKB 3BE1H 1WFNA 4H26B 3EYFA 3OJVC 4QTHA 3QR2A 1AP2A 5GRVK 4ELKB 5J12C 5B39A 2AXJA 4XCNA 1T7WA 3D69B 4YHIA 4ZTOH 2QLVB 1YN7A 3LMJL 4N5UA 4YDKH 3LEVH 5C0GA 2W0FA 4R96B 3MFFA 4RSVA 4LEXH 3U0TB 1QKZL 2VISB 5F7DA 5GSVA 3RL2B 5HYJA 4WIQA 1S3KL 5F7HA 1IARB 1OAYL 5E6IB 4JQXC 4LCYB 3QJHA 3WDHA 1KB9J 3V0WL 2B4CH 5L7XL 1WVZA 3T0AA 1MLCA 2V9QA 2BY0A 1RSFA 5IG7B 5SV4A 1XGPB 3P9WB 5D7LB 4X5XA 4OUUB 2YN3A 3FFDB 2DQDL 4G8IB 4F2MA 4PGEB 1A7BA 4YE4L 4NDMA 4EBQL 3W2DH 3TZVD 3CZFB 3TA3C 1NCDH 1P4BH 1YNTA 3RWGB 3O3DA 4S10A 3FQRA 4JB9L 5K59F 2VDQH 3WFDL 1UWGH 5F7NC 2XYCA 4MNQD 4H20L 1KTRL 1JI1A 4NFCA 4AMKH 2VMFA 2YD6A 3CCHB 4Z77B 4K8RH 2ZOLA 3KYMB 2A73A 4B50A 5KSVA 2KZ1B 3BUTA 1CR9H 2O5ZH 3SE8H 3L3HA 3O2WL 4KWUA 5D2LA 2AJZA 5K9OB 4P23C 2DMCA 4F15C 1I9RL 5IB1A 1U8NA 2LU7A 4HFUH 2J8UF 2JKXA 1KFAH 3I6KB 3RBGA 3QCTH 4HH9B 3U30B 1KJ3H 1HCFX 2NY5H 5GS1A 5I8EA 3W9DB 2Z8VC 3MYJB 1FH5L 3HZMB 4HJJL 4ODSH 5JXAH 5BV7L 3EYQD 4NN5B 3H7BB 1KPVA 5SX5H 2QTEA 1CGUA 5K9JL 5IQ7H 4GRMA 5C0FA 1DN0A 1I3RB 3LQZB 3OKNB 2CO7B 2X4NB 1XH3A 2Y06L 4PRPB 1X5YA 4YEEA 4JKLA 5JOFB 1EDQA 1EO5A 2A77L 1ETZA 4Y88A 4HUXA 2DM4A 3WKMH 1MHHA 4PGCB 1BD2E 5ID1A 5I8CA 3LCYA 3EOTH 3I02B 2E9IA 2WLZA 3TIEA 2N1KA 4XWOC 1A4KB 5DJAA 5CEZD 3VMOA 4J7RA 3EYUH 5EBLA 2J4WH 3S6CA 3RZCD 3RX8A 3T0XA 5DA4A 1AD0B 1BBJB 5IMKB 3BUYB 3BH8A 1MWAL 2PO6B 2K7PA 4X8JB 4Y1AD 5SX5K 2UVEA 1A7OL 4DGVL 4LMQI 3FT4A 1IM9A 3HE7A 3JUZA 5K33A 2DD8L 3QNYA 3QUMA 1K4CB 4Z8FL 1VFOA 4GKZB 4P2QA 5JORB 2I07A 4GXUM 4FFYH 4IS6B 5H37G 2FLBT 4YXHH 5D7IF 5TF0A 1GHFH 3VXMB 1AQKL 2C4FU 2Q1EA 5JO5A 3K81A 1XIWB 1UXSB 1MCFA 1PYWA 3B8SA 3VXTA 1QRKA 3ARBA 4KAQH 4ZODA 1G7HA 4TYUA 2A6JB 2ICCA 3CVHH 4G7VL 1N5AB 2A9MH 5IHZB 3BQUD 3GBNH 5CJQH 3BXNA 3QHFL 1CDIA 3SKMA 1SY6A 5T1KB 3T08A 4X7EC 4JREB 4QOKE 1AD9B 2YWZA 1UWXH 1DQLH 1YEEH 1J1PH 3B6SB 4RA3A 3G08B 4P48A 4HC1A 1FE8H 5E9DE 2G9HA 3RPIA 1EO8L 1HN1A 3FZUC 1HOCA 4R4BB 3NACL 4WEBL 3U7AA 3MGOB 4R8WL 3LN4B 4JM2D 3QI9B 1WC7B 3EBAA 4BKLA 1T89C 4RFOH 5I0DA 1JNJA 3WL9A 3F7VB 2QSTA 1UQSB 5CGYD 3VFRB 2EE3A 3LDBC 1X6NA 4ZXBD 3HLAA 1T1YA 4H0IA 5HGBA 2XPGB 1FDLL 4U1MA 1N2RB 2FD6H 1M1SA 5TFSL 1HINL 5I15H 5KN5B 2Z93A 4WU5B 4ZNEE 4XAKE 4YC2B 3ZT7A 1NMBH 4LP5A 3MLPA 1QSZA 2C3VB 3BPCA 2HTKC 1PJ9A 4WI8A 3U7YH 4LVOC 5HHQA 1UWXK 5MEND 3D2UD 3KXFB 1KG0A 2OXHA 5F3HB 4ODUB 1NMCC 2IBBA 2VABA 3PDOB 3M45A 3O8XB 3ECBB 1TQBC 4LSTL 3DXAA 1I7ZA 4DVRH 3ZE2E 3WD5H 3RDTC 4HAGA 3BP7A 4Q97A 4DJMA 1HDMA 2NR6C 3HI6H 4J3UA 3HUJA 5FYKL 3TA3D 2IG2L 3ES6A 8FABA 3MRNA 3C6SB 4I3SH 1QR4A 4XCCL 2DMKA 4Y5VC 3WJLC 2IAND 5TPWH 4PP2B 1EMTH 4XP4L 4H8WL 1CGVA 1D5MA 5E8NA 5B3JF 2JE8A 5IK3B 3UBXA 3QFJB 5E2JA 3WFEH 3F65A 3IDMA 4EI6B 4L4TE 4OF5A 1DL7L 2F54E 3T0VA 4G3YH 1BECA 4X7CC 1A64A 2VQUA 3GMPB 4XP6H 4ZMAT 2VLRB 4K7FB 4NQSB 4YHML 2IALB 4I3RH 3TO4A 4OB5H 2N56A 5KAQG 1A6ZA 4AY0A 5C0EA 1UM5L 5DQDH 1QBAA 3OXSB 3GJEB 3SO3C 1KCRL 5C09D 5IHUH 1YJDC 5LVEA 3O6FA 4CAGA 4DVBA 4LLQB 2XN9B 2WLYA 4NBXB 2O93L 3SKUD 4P46B 1RZ7H 2AK4A 2CRYA 5EU7E 3CFKA 3A6CL 5C70A 2PXYC 1UCBH 4POUB 3QA3B 4HMCA 3IAPA 3CFBA 4X4XB 3EYSH 1T03H 4ODHL 4YHZH 2W9EH 4HQQH 4XWGH 4EXKA 5LWYL 3TNNA 5FCUH 4Y7MA 3LVEA 5IJVB 1CF8L 4POYA 2H9GA 1MCPL 3NCBB 1SYVA 2OJEA 5HHXH 5E8OB 1TZIB 3L3KA 4Z7NE 4D3CH 3L3JB 1FZMA 3AU1B 1F2XK 3CJJA 4IIQA 3ARQA 4UDTB 5FM5O 1WJ3A 2YWYA 1RULL 2R23A 5JIHA 4YFLI 1P6AB 2P5WA 4MJIB 2VJXA 4XAWL 3QPXL 5CIPH 3BDYH 2UUDH