4YMPA

Crystal structure of the bacillus anthracis hal neat domain in complex with heme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
112
Chain Sequence
VFDAVIKAYKDNSDEESYATVYIKDPKLTIENGKRIITATLKDSDFFDYLKVEFHDVKVLSEDKRKHGTKVIQFEVGELGKRYNMQMHILIPTLGYDKEFKIQFEVNMRTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin
publication title Crystal structure of the Bacillus anthracis Hal NEAT domain in complex with heme
rcsb
source organism Bacillus anthracis
molecule tags Heme-binding protein
total genus 22
structure length 112
sequence length 119
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ympA00
3SIKA 3QUGA 2ITEA 2O1AA 2K78A 2MOQA 3QZNA 3SZKC 2ITFA 3S48A 2O6PA 2H3KA 3SZ6A 5D1ZI 4MYPA 2Z6FA 3RURA 3VTMA 5D1QE 4NLAA 3QUHA 3OVUB 2E7DA 4WJG3 3QZLA 2Q7AA 4H8PA 3RTLA 3QZMA 3QZPA 4YMPA 4H8QA 4FC3E 5D1XE 3VUAA 3QZOA
chains in the Genus database with same CATH superfamily
1WZ1L 1FL6A 1UM6H 4EO5A 4LLDB 3HUJE 3LQAL 3CLFH 1QEXA 5K39B 1U58B 4EBQH 4FQJH 2P8PA 1G0YR 4MKTA 3EGDB 4YZWA 5KZCD 3NA9L 2F8XC 1E6JL 2ZUVA 2AI0H 3BP7A 2NYYD 4MJ5A 5GGUB 4AG4L 4JHZA 1FUNA 3VXRA 5CSGA 3FH8A 3ZZSA 3KPRD 4N0YH 5IW6A 1SRDA 5A2IH 4NC1C 5BRZA 5E0FA 3OLEA 2HT3D 2BERA 4IKKA 1OT4A 2JLLA 1P4IH 4L9LA 4LQFH 2V33A 4NQVA 3BKYH 1T1ZB 5JHDE 1GTNA 1ZPUA 3SJVA 4JZJB 2UWEB 4JR9L 5CN2A 1YMHB 2BDNL 4UTAA 2BP0A 4C56E 5JQHC 4N2EA 4PJFB 1JZDC 4PJBA 5BUPA 3L4ZA 5FECA 1HHIB 3IMRA 1ONQA 4U49A 5C71A 1HHKB 4AL8C 4PJCB 3NAAH 3K72A 5F1IA 4KFMA 2X88A 5F7BA 4O4YH 1FYTB 4P23A 1AGFB 3EYSH 4Y4HB 4YPGB 2EZ0D 3IGLA 4L8DB 1NAKH 3O0RL 4TULH 5DJ6B 5EA0H 4J1UB 2BCMA 4ODBD 1OGAE 3N40F 3VXRD 1N5AB 1H3PL 1WS8A 4Y5XC 3TF4A 1KBGL 1P5UA 3SDXB 2IMNA 3VCLB 2FDBP 4GG6A 5BRZD 5HJDA 1C7SA 1MCCA 4G8FA 2W60B 2ZNWA 5DK0A 2A9NH 4EI6B 4EDXB 1R5VB 3G5YA 4QKTA 4TUKL 4XNZC 2RQ8A 4LASH 4ZUWA 3SJVD 3MLVH 4ANXA 4JEGB 1CWVA 4NS0A 3SN6N 4J3SA 1CICA 1C9SA 2H2SD 1Y07A 3TYGL 4P57A 2VDKH 5I6NA 1ZSDA 5I1AA 4ANWA 1WS7A 3HAEA 4ZRGA 3TBTA 3TP4A 1K8IB 1DQJA 1ZT1A 5DA4A 4CBZA 3N85L 1JPTL 4P23D 5C0CB 1SDDA 4MMYB 1JCVA 1TO4A 3I6KB 5E99H 4MJ6A 3NIGF 2BNRB 1XCWA 3OLGA 1D6EA 2VN5A 1Y6KR 3CXHK 5GS2D 4OUUA 4WSKA 1FO0H 4J8RA 3TCLB 1JFQL 1FIEA 4OBSA 2HKFL 3OJ2C 4NOFA 4NRZA 3RPKA 1EHXA 3KGTA 1FC2D 1FVEB 2NY5L 3HI5H 1GXEA 2MOGA 3HI1B 3E2HC 5LBSA 1NC4A 5CUSH 1I9JH 1M71B 3OHXA 3HLKA 1CICD 3SE3C 4HPHA 2X6AA 4MCZA 2BIMA 1Q9WB 2OZNA 1CBVH 5DUPH 1FNEA 1EA9C 1WH0A 3ZL1A 2E6PA 4LHJB 5GGVL 2YPVA 5EEVA 2JF1A 2HVKA 4KTEL 1AH1A 1UCBH 2VO5A 5KW9L 3RNKB 4KI1A 1MCRA 3HR5A 1AS7A 1YPZF 5D7IA 2QV2A 3RGVC 4OCSL 3PWUA 5A6IA 2Y7OA 2IGTA 1A6UL 2E46A 3GSUA 1CI3M 4NSKA 5FIEA 5B8CC 4B97A 1QLRA 4J23A 3S35H 4A2DA 2IOIA 4RBPK 2QSCL 1KTLA 2RR3A 3B6SA 4KTDL 1NC4D 5JA9A 4FFVC 5GSVA 3BI9X 1A7BA 2Y7SA 5CEZH 3X1NA 43CAB 1PEWA 2WCGA 3ARWA 4K3EH 3ZHFA 4RGNB 2F6AA 4IMKC 5CZXC 2ZWNA 3VWJB 4JFTA 4GBXC 3QXVA 3QQ3A 3HS8A 1GAFL 3NIGE 3BJ91 3ET9F 4FXGA 1N6QH 4ZOBA 5E1AB 2OL3L 4R7XA 4F7KA 1J0YA 3H3PL 3E6FB 3BWSA 4K71B 3WU1A 2Z92B 1OY3B 4P2RB 1GIGL 2CLVA 3VXSA 4A63A 3NRQA 4EXKA 1GHFH 3PL6A 4QHMB 4JM2A 4YBHA 4F8NA 3E6HA 4NQTA 3DJ9A 2WXNA 4G1MA 3NGBC 3M17B 5D71H 2E5EA 1UURA 1E28B 1O7DC 2J2ZB 1XGUB 4ZFGL 3A4FA 5I71C 2C9SA 2JWYA 4RBPH 4XHQA 3UBXG 5IM7A 3QIBB 3KG5A 5C0DA 1GPOH 5EORL 4W9FC 2WQXA 2IANB 3EADA 1PFCA 1G6RL 1IIIA 3D4YA 3MLTB 4QRTA 5HP5A 3ZO9A 1ZGLA 3C12A 2QELA 1JPSH 4JO2H 3KXFE 3MA7A 1SXSA 4YDVA 4WDIB 1R5IB 4JJ5B 5C97A 4TNWF 1EJ8A 2DDQH 2FECL 3OKNB 1HXMA 3FCGA 1BZ7A 2K9UA 3VXSD 4YAQA 2YXMA 3WIAA 1OGTB 4OZ4A 1T4WA 3PL6D 2A4CA 4HLZG 3AACA 3GRGA 4JM2D 3MJGX 3ARSA 4MVBC 2R56L 2ID5A 2EDJA 2WKOA 4D9LL 4WFGE 4NNXA 1MCFA 5DRZA 5EBLB 1A25A 3ARFA 2A3TA 1XGYH 3UYPA 4FJZA 2AQ3A 4V1DA 2E27L 3TO4B 1TZAA 1BQKA 3FS9A 4JQIL 3NMEA 1T5WA 1CGXA 1Q1JL 2VDPH 4PWIA 3AUWB 5G55A 5IVXA 3IJ8A 4GB9A 2JQAA 5AZ2H 3RA7L 3C6SB 4Z7IA 4PJDB 1IGTA 2J6EH 5IESH 4XOBA 4HQQL 1WFNA 1XD0A 3WD5H 4QRRB 1UJ3A 5B1JC 4KVCL 2VDLH 5FLVA 2WBJB 4PGBB 3RVUC 3MV8E 4AITA 5F9JB 5B3NA 4BFOA 2MNUA 4LSPL 5I1DB 2YSSA 2PP9A 1XZWA 2GJZA 4FKEA 1WIUA 2ZX7A 4AIXA 2GCYB 1DFBH 2FEDC 3WEXB 1ML0A 3ARFD 3C5ZA 3TX4A 3F85A 3MRPA 3MMEA 3GSNL 4YUEL 5L2JA 4NO5A 2ZSWB 1EBPA 4JRYB 2WNXA 2CO6B 2EYRA 3KL0A 1G9EA 4FNLL 1EFQA 2EYTB 2MSPA 2XTLA 3B3IA 3LKQA 4U1IA 3U4KA 1RZGA 4DZBB 5J11C 3GIZH 4U3SA 1VAHA 2YPKB 3GB7A 2X4QA 4CUCA 5MERA 3FRPB 5AZEL 2YKLH 5D7LE 1UYWL 3MR9B 2AXGA 3FL7A 4ZPVB 1YDPA 4N6QA 4WSGA 5T8IA 2F54A 4WY7L 2F19H 3QORA 4G72B 1JDCA 2OTPA 3KBFA 1IFHL 5FCUL 4GAGH 4JMNA 3VYNA 2VERA 1Y0LA 4GAJL 1KSRA 3WKMH 4GSXA 1B0GA 2NPLX 3C5ZD 1BW8A 4N0CC 4KK5C 1FG2A 4KFZC 5DUML 2N0KA 5J1SC 3LIZL 4XMXA 1HWWA 2CCVA 1RK0A 2UUDK 3BD5A 4NP4L 4U3HA 4U2YA 3KWTA 3WL9B 3WENA 4AL8L 1MHHB 1A6TA 5CJ5A 1UGNA 4N8PA 1UXWB 4XBPB 3MDJA 4YEFA 5SWQB 2HRPH 1T4KA 3L3OB 4TMPA 3ULSA 2V9UA 2UZYA 4LPVA 3N3EA 2NY4C 4XP1H 4HHAB 3X1FA 1GSKA 3ESUF 1AC6A 2D7OA 1U30A 3H42L 1HKFA 1E9PA 2F54D 1CR9L 3DBXA 3IBEA 1MVYA 1ED3A 3QORD 2XIDA 4MA7L 4TQPA 3EO0A 4RIRB 2X7LA 3BKML 2ZE0A 4ANVA 3AT0A 2MMXA 5ESAB 4LLWB 1CT8B 5HGAA 3QPQD 1WAAF 3MBEC 4ICXA 5B1CA 1L5GA 1CQYA 1E8YA 3RL2B 3IWVA 3V4VA 1R3JB 2K6ZA 3LHPH 1PCSA 1ZHNA 3OSKA 3TTYA 1NCGA 4WO4C 1FH5L 3EJTA 4Y5VA 4EBQL 5ISZA 2FSEA 2M1KA 5DVLA 2AI0L 4PJGB 5BUGA 1E3XA 4JFYA 5LGJA 3FOLB 1BVNP 1Z9LA 4X2UA 4Y8AA 5KVFL 4YVUA 2FRGP 1IAMA 2UUDH 4FFYH 3BN9D 2ZX5A 4UT7L 1Z7JA 2P42B 3HHMA 4V1DD 2B1HL 3FO1A 5INDA 2C9AA 5FO7A 4TPRL 4TLTA 4ABVA 1ZWIA 1WWCA 2XCMC 1B2YA 2AANA 5EBWA 1A0QL 3L54A 4ZFOB 3M1OA 2H0FA 3RPIA 1BVLB 3OKLA 1DANU 5EZJA 3OV6A 2QHLA 4IBTA 3LKNB 3K7UA 2NY0C 2W65B 2V7HB 5ISZD 2G2NA 2QFPA 3NCYP 2WXIA 2BVOA 2A73B 1MFNA 2VDMB 4TULL 5EA0L 4UV7H 1KXTB 2CJUH 3TASA 3X11A 4XBGB 4MS8C 3S96A 2Y1VA 2Q20A 3EG9B 4HEPG 1J9TA 4LGSB 4NKDB 1EVUA 3S34H 3AFLA 5D1QC 4UYPA 2P8LA 5G5DA 3E1F1 2B2XL 1E4JA 3QH3A 4QRQB 4RFEA 3VYOA 3LPGA 1TSHA 1G9NH 1E9OB 3VSQA 4KMLB 3D4CA 5BV7H 1TVBA 4ODWA 5DVKA 2K8MA 1WAAE 5DQJA 1LVEA 4HS6A 4PGJA 3D69A 2Z31C 2LHAA 4CC0A 4W9EC 3UAJA 4RSVA 4DP9X 1W80A 4HYTB 2EC9T 4TNWK 1IBFA 5H37H 4M6NL 4HULB 3G5ZB 1Z9MA 2ICWB 2OMUB 3EO9H 2FJHB 1AGDB 1ODUA 3REVB 1KENH 3O2WL 4KKCD 3QUYC 3D7PA 1DN0B 2F5BH 3GO1L 5DFAA 4M7LT 1X4XA 2YD7A 3B9VA 3L1GA 3UDWC 4AKPA 5E4EB 4HUXA 1S78D 2H3NA 3VYPA 3P4OB 4NNYB 4A68A 1AQKH 4GIPD 3H2WA 4WEEA 1N2RB 5IB5B 5LVEA 5GGSY 5AB0A 1UM5H 3LQZA 3T71A 2VISB 1NGZB 5KSUA 3F00A 4HX1B 1NDMB 1QMUA 2ZYSA 4I3SL 3UAJD 1A7PL 5C0AB 1CBVL 3RWEB 1OSEA 3CFCH 1HCVA 1SLVA 2VDNB 5CJXC 4H8HA 1RSYA 4RAUA 1JYNA 4JPVH 4D9RD 3ZHKA 5C0IB 2H9GB 1HHGA 1EAQA 1ORQB 3H54A 3QIWB 3BAWA 1TTGA 1YQVH 5A6MA 4MAUL 1D5RA 4GRMB 5IW1B 5F9WB 1FSKB 4HCGA 1E27B 3UABA 4BWUA 2M2DA 1S9YB 3GI9L 5CO1A 1GR7A 1G7QA 2D31B 2BOLA 3BD4A 5DJ2B 4BQ9A 1EDHA 1YUKB 2XKNB 6CGTA 5KYUB 5EZIL 4G7QB 1JFHA 4ONFL 4X6DA 2BRRH 2PABA 5EO9B 2OTUA 4NZFA 4U1HB 2A9BA 3DWTA 4FG0A 4H0GA 3JVFC 4FI7A 3NCBB 4U0RB 5LNEA 4HBCL 4YS4A 3RG1C 1NGWB 4LLDA 4JFDB 2LLGA 3O41B 3EDEA 5K39A 2R15A 1F97A 1CD8A 2H6UA 3QDHA 1JPGB 2MOQA 4N2FA 3EGSB 4JN2B 4LLUB 1N6QL 3EGDA 5BNXD 3GXUB 3UG5A 1BEYL 4QRSB 5CZVH 5C3LD 4HJ0D 1CXKA 2XJLA 5ES4B 2XZZA 3FNKA 3Q06A 1RJZB 3BKJH 2E7LA 1FFRA 4X7SH 5ID0B 4QHLB 5D2NA 1V5JA 3MTXA 2F1EA 2GT9B 4ABQA 4ZNEE 2ZT9C 3BAKA 3FYEB 5HJ3B 5D6CB 2J25A 5HDQH 2DN7A 4GKSB 5I5RA 3TIDA 2VXTL 1U8LB 4GUCA 5AENA 4KI5D 2VRKA 5JW3L 1LTXA 1PKQA 4M1DH 4MMZC 4PJFA 1W0WB 5EU6B 3K6SB 2PXYC 2EJ1A 3ETBF 5DS8A 1HEZB 5EEYA 4N0UB 4KY1H 2CBMA 1U8QA 4KOCA 2CCLA 4HXAL 1XT5A 2Z3FA 4U1NA 1XWVA 4YPGA 3VA6A 3GMLA 3FQ2A 4H0HB 1E3ZA 1NGQL 5HGGS 4J1UA 1NGPH 4AXWA 5TPWH 1N5AA 1U2HA 2XBZA 2ADFL 2WCPA 4WTXA 1MUJB 4K07A 3SDXA 4OH2A 3NESA 2HKAA 4OZHB 2W60A 5T5FA 5KVGH 4EI6A 5EZOL 1R5VA 1QX1A 3QDGB 4LHUG 4HF5L 3VI4F 2X2YA 2WQRA 5CCJA 1ANUA 2B4CC 4XNQB 2WNKA 2K6YA 3MRHB 1WEJH 5B1BB 3TWCL 5I16A 1P84J 4L18A 3QE5A 2VDPL 4TVPH 5GRVL 3S36H 3THMH 3ULVE 3IN0A 2J6EL 1AD0A 1AY1L 5IESL 2WANA 3MOAL 1L7IH 4K5MA 5C0CA 4MMYA 5B7EA 4PW4A 3I6KA 3C5SA 2WZAA 2BNRA 3GF8A 5FO8A 1UOLA 3LH2H 4K5OA 4YLBA 1JGUH 5JQ6L 3FTVA 3TCLA 1PYWB 3NRPA 4OI9A 3UC0H 3QWQB 2EDKA 3QDJA 1SUHA 2F2HA 4D0CB 5EIVA 1DFBL 1LO2H 4PYHA 4ZBJA 4CSSA 1LP9B 2IDQA 4NRYB 4NZ8A 3KDMA 5FWRA 1M71A 1ZEAH 5B39G 2WSKA 3CN4A 5ESQA 4HZ1A 3UZQB 3COOA 4RMUA 2R39A 1C5CL 1RPKA 3FFCB 1BIHA 1FIGL 4POZC 4H1LH 4DK3A 2EE6A 5I8KH 3GIZL 3O45B 2YLHA 2R29H 5CWSB 5C0CD 1F1AA 4OM1H 1KFGA 2VN6A 2J88H 4YSCA 2HX8A 2G4GA 3DVNB 2BNRD 3F2LA 4MTMA 1R17A 3DJZA 4Q14A 4G8AC 3SGDH 3OBAA 3HTLX 4OGYH 4YHIB 5DYFA 2F19L 3T6WA 3V0FA 1JZ5A 1T03L 3D18B 3E9UA 4L5FL 4NHUB 1A3LH 3DK2A 3LZOA 3GKZA 3KLLA 4FQHA 3T0EB 3VI4E 1NCJA 1W0VA 4Q8BA 5C1MB 4OQTH 3MRIB 1PAMA 3QDJD 3WKML 5IMKB 2HPOA 3GSRA 2AC0A 3BT0A 1PCXA 5IIEB 5ADPL 1BM7A 4A6YA 1U8IB 2BVPA 4R0LB 43CAA 2Z8SA 2WOYA 4A2EA 2MCG1 1E5BA 1KACB 2A6IA 1OQOA 4RRPM 1U8MB 3MNWB 1T1WB 3MLZH 4LVHB 1AR1C 4ZQKB 2HRPL 5JDJA 5C6TL 1J48A 5E6UB 1NOFA 1ID2A 5IROC 1R19A 4LEEA 1S7QB 1R3HB 1B4RA 2FZ3B 3E6FA 4QTHA 4Z7QE 2A0LD 1GCYA 4P2RA 4PLJC 3ZMEA 2W0FB 4G80B 4LOFA 3VGBA 4QHMA 1KGUA 4IBSA 4APQC 1IC7L 3C5JA 3VI3A 3AY4C 3OMZA 2TRYA 3LOWA 1E28A 2J2ZA 1XGUA 3WDIA 2DI9A 4JM2F 4TL4A 4DEWA 3R4DA 1UVQB 4OCNC 4RGND 5F89A 1MJ7H 2VMCA 2WWOA 3CFTA 1RVFH 3BESR 5GISH 5K9QI 2IANA 1DVXA 1MEXH 1YQ2A 3MLTA 4AUJA 4NIKB 5DHXB 1OSZB 2FQDA 4FFYL 1IEHA 4ZTOL 2NY2B 1GW0A 1ULVA 2APFA 2CRMA 4WDIA 3MRFA 1VFOA 5AVVB 4JE0A 4JJ5A 5CINH 4GMTL 1G7LA 4OJDH 2EXTA 3OKNA 4P2RD 1LO4L 3WJLC 1OGTA 3KYNA 3KH4A 5ACMA 4OAWA 3O81A 4XVJH 3UJTL 5GRJL 1A8ZA 1VEMA 5E94B 1O7SA 1KN4H 1UWEL 4HIPA 3OAYK 4DKDC 1QTSA 4JDVA 4YHOH 1Y18A 2V4LA 2WKOF 3QR2A 3D34A 2OSWA 1RPUA 3HG1E 2B9BA 2IAND 2NRDA 3QO1B 4NUGH 4NQEB 4UV7L 4A7GF 2EICA 2E7BA 2LOEA 2OM5A 2YAMA 1OTSD 4PJDA 2A9MH 2Q1EA 4CMMB 1F90H 4N2DA 4R90H 5DURB 3IMWA 4FLRA 1YEIL 2KMWA 3BAXA 4N8CL 2JQMA 5BW7A 5KVDE 1NCTA 4PGBA 1EO7A 1YJDH 3SYPA 5DJXA 1G9NL 3UADA 1F11A 4KROD 4A67A 2L3BA 4B9GA 5I1DA 1EHNA 1M7XA 3O4OB 3SKJH 3WBDA 1LWRA 3TCTA 4P5TA 3WNJA 3UO8B 2BNQB 2GCYA 2SODB 3MRBB 4UQIM 3WEXA 5ACZA 5ITBH 3KYKL 4PRAB 5H8DA 3UFIA 4NO2B 4KAQL 2CIKB 4JRYA 3UTTB 3VD7A 1ZHBA 2CO6A 2Z1KA 1KEGH 3EO9L 3MRDB 3U36A 4HGWB 5FDWB 1KENL 5CFAA 2F5BL 2R23B 4LT7A 3UJIH 1VADA 1WBZA 3OAYH 4QTIL 3SYAA 5JMOC 4OV6F 4JM0A 2EIZA 3DX0A 4WV1B 4B5EA 2HJFB 2O5NA 2EE0A 1AQKL 1LMIA 2DEXX 4ORGB 4KJWD 1UM5L 4Q9CA 2GB2A 3R1GH 1T21B 4CGTA 3L3KB 3IYLW 2CGZA 4UINL 3DETD 4P5TD 1R1CA 3ZTJH 3DVGA 3M1BB 1I7TA 4HD5A 4KXAA 4OGQC 4CC1A 4OJYA 4E0RB 4LRNL 1DLFH 2WZ0A 3PGCA 3S5ZA 3S8GB 5KS9F 4JRYD 2ADGB 2D73A 3MRMB 5D2LE 4JPVL 5CZKA 3WL9A 4UTAH 4MNGB 4B0MM 1MHHA 3GUTB 1I3GH 2XPYA 3IS1X 3QISA 4L9DA 4X6BB 2DEWX 4XPHH 5BZXA 4BFIB 5I73C 2NCEA 1UXWA 3LVTA 4XBPA 3DX4A 3UROR 4BSWA 4U0QB 5CM1A 3L3OA 5C7XL 2OXGA 5CEXB 1PJWA 4JGUA 2DQJL 2MCMA 1ECYA 1D7DA 5SWZB 2NYYC 4NWUH 4XMVA 5DR5L 2W94A 4GQRA 3SIKA 3NOIA 4Y5YA 2WY3B 2CO7B 1EWHA 4RIRA 5GS2H 3WXVL 1I1FB 4YDZA 5ESAA 4LLWA 3DOSB 1CT8A 3BFQG 4AZ8A 3F64A 3TBWA 4Y4FC 2GEQA 4S11A 2CAKA 5I74B 1R3JA 2O5ZH 4OFYA 3GS4A 1Q94B 4GRLB 5ALCH 3JQOB 2EIJB 1KG0B 4Z3JA 2FK9A 5EHFA 1N7ML 3VRJB 3QPXH 3NACH 4P46A 3HAEH 2OXHA 3QFJB 1YN6A 5CZVL 5DD5H 3LXCA 5FYLE 4MDJB 1H3GA 5T1KB 3FOLA 1NCUA 4ABWA 5K1VA 4ZXBA 5FB8B 4BGLA 5C0BB 1O75A 4DQOL 4EQ3A 5DJCB 2N0MA 3NCMA 4Z9KB 2IVFC 1CDGA 3T09A 1LWHA 4HK3J 5JXAH 3S88H 3H9HB 1DDTA 2NTFA 3PAUA 3HIZA 3JWOC 4F9PC 4OJCA 4OLWH 4TOYH 4GLRI 4OIIH 1K2DA 4MA3B 3O11B 1FV1A 4M1DL 4TNGA 2VE6B 4QPEA 4ZFOA 4N8UA 3TA3B 5KS9E 4AK2A 4FGMA 3KM1A 2MRYA 4IGBB 4OFYD 5LBSH 5JYMA 4KY1L 3WIIH 5FGRA 2IBGA 1RERA 3FCTB 3SDAC 3EOBB 4BRVA 1E7UA 1YNTB 4P46D 5DI8B 4A7TA 1UUSA 4L3EE 1UKSA 4PREB 4UAOB 4NO0A 4PD4J 5MP6H 2N1TE 1NGPL 4XBGA 1MCWW 2YPVH 4YBLB 5TPWL 5FGBC 3NJJA 3NFPA 3EG9A 4NKDA 4ZXBD 2Q3ZA 3P2DA 4PMFA 2VIRB 3VRIB 3GNMH 2I60H 3AROA 5LBGA 1TTFA 1X7SA 2PPEA 1LNUA 4QRQA 5F1SA 1V7NL 1MDTA 3O2DL 2E4TA 4N6RB 4DTGH 4U6YB 1HL4A 4Z1PA 1V3JA 1WEJL 1MI5B 2W88A 1A21A 3ISRA 3WY1A 4W9LC 4TVPL 3BZEB 2HRLA 4OCWH 1QQDA 3K5SA 2J8HA 4ZDHA 5EF1A 3MV7B 4V2BA 2GAZB 1GC1C 2HJKB 3G6JA 1IC1A 3V4UH 3OPZL 1FI8C 4ONOA 3G5ZA 2ICWA 5MHSE 1L7IL 4NO0D 1QACA 1SVBA 2FJHA 2KZ1B 4Y1AA 4C4BA 5DRXA 1ZCRA 4O02L 3T3PF 2WXJA 3LH2L 5HDWA 1CL7H 3ARGC 5EF2A 4M93C 1YEFH 3WUWG 3C8HA 2BWDA 1QEWB 2GSIA 4NNYA 1CLZH 1VFAA 4H0LC 5D1XE 2Z9TA 3RRQA 4WGWB 1LO2L 2BFGA 1K8DB 2VISA 4P5MB 3V6FB 4GFTB 5TE4H 1NGZA 4HX1A 5H4YA 3A4AA 1WLHA 1NDMA 3EO1B 3TT1H 3HMXA 3W56A 3F62A 1TFPA 5LN8A 2X0WA 2R4SL 5F2FA 5MEOB 5FO9B 5I8KL 1KTDA 2VTFA 1YRKA 4TUJB 3MREB 1MCPH 2NTSP 4OM1L 3OKDA 5C0IA 1SEBB 1OCOB 2GJPA 2J88L 2E9GA 3KBPA 4Y1AD 1MCHA 1FFOB 1ORQA 4PRBA 2E4FA 4NYLB 4QWWD 3GEFA 2PW1B 3PHAA 4GRMA 3U7YH 5IW3A 1HIMH 1QR1B 3VSUA 1P4BH 3VMNA 4WFED 3JWNH 3KLDA 1Y6NR 5AW9B 3ASWA 4F7CB 3ARVA 3SE9L 2BS71 5JOEA 4OQTL 3CTTA 5ANMB 1PFOA 3C75A 2WLLB 4F5CA 4GXFA 4PJIA 5DJ2A 4ODXB 3LVEA 1SF3A 1BQHG 4KK6C 3GBLA 5FM5M 3GFUA 3NYKA 4H5SB 4HEMA 4X6EA 2H0JA 4QLRA 4U1HA 4UNTA 5CCHE 7FABH 3DI3B 1ZA3A 2Y6SD 4M00A 1USZA 3O41A 4P5KB 4YGAB 5ICUA 4GG8B 3EGSA 4JN2A 4LLUA 4N1HB 5H2BA 5KEZA 1F5WA 3T3PE 4E42B 4AIZB 4QRSA 3V4PB 3QARA 3IGFA 4BJLA 1Y1UA 5F0LB 1RURL 4Y7MA 3FF8A 3SD2A 4E9LA 3TFKC 1EXHA 3RL1B 1RJZA 3U7WH 1MWAA 5I26A 4U1SB 2Q86B 1RMFL 2KDYA 3FHAA 1V3MA 4K0OA 4FL4C 4QHLA 4R4ND 6FABH 4OQ1A 2FB4L 4FJ6A 1LD9B 1TETL 5LAXA 2ISDA 1LK3H 5D6CA 3TA4D 1YYLH 1I82A 1AGBB 4LAJH 2XQYG 3IAPA 1KULA 1W0WA 1MJ7L 2CD0A 5EU6A 2QLYA 1RVFL 3K6SA 3GPSA 1A7QH 1CCZA 2HT4D 1I8LC 1MEXL 2UWEF 4N0UA 1T7XA 4LK4A 1S7WB 2OSLB 4PJFF 4JFWA 5HGHB 5IFAH 1S7TB 2DKSA 3BZDA 1HTYA 4PJCF 1TF4A 5CINL 4JHAL 3B9DA 3AJ7A 3QAZC 3D09A 3TNNB 1MUJA 3Q1SH 3U48A 5F44A 4NZTH 4M3KB 2MHAB 3I50H 1S6NA 3GBNH 1BPLB 2R27A 4OZHA 4R2GC 3QEQE 4K9EC 3NJFA 4JFZH 3H6AA 5F7HA 3I6SA 4XVJL 3AS2A 3NEEA 5CLTA 3VD4A 5E70A 2C3VB 1KN4L 4KK9D 4PJ5A 3O6FC 1P0SE 4XCEB 4BGDA 3MRHA 4HV8B 4YHOL 1BECA 2WIIA 4O00A 5DJDB 2HN7B 5EU6D 2AEPH 3EYFB 4LCIH 2CU9A 4C4KO 1Q0EA 7PCYA 4KMTH 4EVNB 4N22A 4ZPTB 1I7UB 1KYDA 3LSOA 1UD6A 4I13B 1P9MC 4MBRA 4B53A 2E3VA 4BK4A 4JREB 3UO1H 3BUTA 3LMJL 3CU7A 3L45A 3D0LA 5GS0C 1BREA 1G1CA 1NIEA 4EDWH 3NJKA 4N68A 1GZQB 3HHSB 1MAML 4E5XB 1PYWA 2O1AA 4MCYA 2XKUA 3DUHA 3HE6C 4CN1A 1R33A 5LQBH 4D0CA 3ES6B 5HYSG 1L6XA 1IM3A 2ZXAA 5AOLA 5ITBL 4PJ5D 4WW2B 1LP9A 4NRYA 1D9KC 2H8PA 5FM4A 1AANA 1E4XL 3PJNA 1KEGL 2UWEE 4PJ7B 1CU4H 3V4VH 4O2EB 4JANB 2Z93B 3UJIL 3O45A 5EDSA 4MQXD 5CWSA 2CO3A 4OLVH 4PJCE 2JTDA 4Z7UE 2KLTA 5E6RB 4JKNA 3CQPA 1IGML 1FYTE 2P43B 1ZANH 2IH1A 4TKWA 3M86A 1AQDB 1MH5B 4ZSOA 5I18H 4YHIA 4K94C 5HDRA 1B0IA 3BZFB 4AOFA 3LRSB 2NY6C 3D18A 3R1GL 4NHUA 4U1JA 1C5DB 3SPCA 2XWTB 4X7CC 3MRIA 1IM3D 4PRPB 4H26B 4OLZL 2ICES 3RTQB 2HWZH 1DLFL 3CIAA 2OR8A 5IIEA 5IQLA 1GOGA 4P9MH 5ERWB 1U8IA 4R0LA 4HOWA 4BZ2L 4X8JA 3L48A 1I3GL 4WWID 5ABAA 3BUDA 2X4NA 4MNQB 4XPHL 1KPVA 2Q7YB 3BRGC 4JFSA 5I66A 1U8MA 3ZDYE 1T1WA 5I0VA 3LXAA 2DQEH 4D0DB 1U4FA 1AHWC 2CA4A 4O5LH 3D1MC 3UCRA 1S7QA 3G7TA 5C70A 3L5WB 4NWUL 4MX7B 2FZ3A 4YJZL 3MC0A 3NEXA 3QHZH 2W0FA 4G80A 1T04B 3N50A 2VW6A 1YMMB 5F1KC 3LRHA 1MCNA 2VCOA 1MQKL 3F3HA 3CBJB 3MRQB 1X5HA 2QQLH 3LS5H 4K9JA 4QRUB 5ALCL 5F0PB 4L8SB 3IDYC 4AT6B 5IFHH 2H45A 1GGCL 1A9EA 1HHHB 3QPXL 3NACL 5DD1L 1A1MB 3AWFA 1IQWL 4LOVA 2W0LA 4ELMB 1AQ8A 1SY6A 2IFFH 4OI8A 4FHBD 4Z0BH 1MHCA 2ERJB 2CK0H 4O58L 4YC2B 5LKNA 4YH6A 3HI6H 1QR4A 3HPLB 5F96L 3UIYA 4A2FA 4ZO6A 2WD0A 3MAWA 3CZNA 3HC2A 4NXSA 3B2VH 4KBPA 4TOYL 1I9RH 4TLKA 5KYWA 2PWFA 2CPCA 4YSRA 1JHLL 2GPZA 3HS9A 5I76A 1F1DA 2WO3B 3LEYH 2YSTA 4M5ZL 4NXKA 4X9GA 5F9OL 1VIWA 2FBRA 2FX8L 2QVFB 5LBSL 1IE5A 1NUFA 5F8RC 3OMNB 3AG1B 5BQ7B 4HKZB 2K4AA 4OF3A 1BGXH 3PHOA 3QO1A 4WFHE 5DSCB 3FTWA 3V0EA 1E0OB 3DK0A 1BLNB 4JY6A 3GNML 2I60L 3ZL4L 1X6LA 4QRPA 5SWSB 4PJDF 4GAYB 1AI1L 5HVHB 1AFVL 5TH2B 2X2HA 5SV4A 5C09A 2YAQA 4QXUH 3GXFA 4XXWC 2D7TH 1ZIBA 3U9PH 1JF5A 1A7RH 1K6QH 5IREA 3MRBA 5GS1A 4JHWH 1HHJB 4XWGH 3PNRB 2VRQA 1CYGA 4FQ1H 4I0KA 4PRAA 4U33A 1BFSA 2CIKA 2ITCB 3PWLB 3WEBA 1DSFH 3ESOA 2NMSA 4GIAA 3O3EB 3SCMB 4KV5F 4P2QA 5AAMA 3SDDA 5BS0A 1JAEA 4J4PA 5DURD 3ZYIA 3H56A 1KELH 1YEFL 4EF3A 2YA2A 4QRPD 3GBDA 2HJFA 3T4YA 3TS8A 1BSIA 4LGPB 4BCZA 3U6RB 3NH7L 4ORGA 2FH6A 2KDGA 3ILQC 1NBQA 1CGSH 1T21A 5DJ0B 5C09D 1IFRA 3X3GH 1Y1DA 4I0PC 1NFDB 3OHMB 4Q2ZB 4PN6A 1CQKA 3MBWB 2JCCB 3M1BA 3L3HB 1LM8V 1KNOB 4J12A 2ADGA 1HQ4B 3OXSB 3MNZB 3B4NA 1QPXA 3NRFA 4P2QD 2O6PA 3GUTA 3SDDD 5BS0D 4BFIA 4FTVE 4AENA 3U7YL 3LZFH 3AADB 3KJ4C 2A9CA 2PP7A 1HIML 2WWMD 4J4PD 4K23H 5DGQA 3ZXAC 1UD8A 3A0OA 3VD2A 4BHUI 3HRPA 2AK4A 2XN1A 4QRRE 4QY8B 1WTGT 5SWZA 4DO4A 1UKQA 4K9EL 3PPEA 4DUWA 4LAQL 1XCXA 1FFNB 2CO7A 3GMOA 1HE7A 4F8LA 2WYTA 4TYUA 1E5UI 3U1PA 3X3FL 5J7CC 2PCPA 4XP9L 3DOSA 5E9DA 3EF7A 3FQUB 5T5FH 5JW4Q 4NWTH 1E65A 1V3LA 3G08B 1A14H 4EIUA 4MSWB 2DQCH 7FABL 5DU7A 2FECI 5I82A 5HVGB 4OLUH 4KV5E 3Q01A 4IIZA 2HA1A 4MLIA 1F45A 3VRJA 4G6JH 5D5MB 5IMLB 2B14A 3IDNB 2IV8A 1BVKA 1JBJA 3V0GA 4UQ3B 2NX5E 3TBYB 5FA3A 3SE4A 2FIKB 4FQQA 3U7WL 1OF0A 2AK4D 5FB8A 2BXYA 3BWUC 5SWZD 4PJGF 3OGCB 5DJCA 4Q4IA 3C2AH 4OSUH 2VJXA 1NJ9B 3OLDA 2VMFA 5AW2B 1BXAA 1KGXA 4ODUA 5C9KA 3PWVA 2BVEA 2RAMA 3DX7B 3KGUA 1S3KL 2UZIH 5E9DD 3NFNB 2F7IA 4MA3A 3TL5A 4BD4A 3O11A 1GYWA 2CR3A 2VE6A 3TXAA 1EHLL 4G8EA 4HG4K 3TA3A 2LLNA 1MCSA 1A7QL 2BSDA 4PP2A 3CSTA 3L4WA 4EI5C 3AS1A 2W95A 4F15B 5I24A 1HYSC 3EOBA 1BM3L 5DI8A 3P73B 2G3MA 4PREA 4M43L 3A6CL 1XR8A 3OAZK 2X12A 4R3SA 4ZFQA 3NQIA 1M7IB 3ROLB 4K94L 1MNUL 3A6BH 3G04A 4NZTL 1SLUA 3I50L 4XI5D 5DTFA 3EJZC 2VIRA 3GBNL 3QR0A 3VRIA 1LEGB 3ECQA 3C6LC 3BAEH 1XBRA 1FL3A 4E41B 1ZMYA 2PTTB 4W93A 2HVBA 4TSAL 4F2FA 4Z7OF 3DECA 4U6YA 5BZWB 2X4OB 2ENPA 1MI5A 4HIQA 3TA3D 5C0JB 1V7MH 3C6EA 4LCIL 4JM4H 3BUIA 3BRDA 2GAZA 1YNKH 2GBUA 3QUGA 4A6YH 5K1NA 1U8OB 2RACA 4UOJA 2YQGA 5IHBA 4N0FB 2G3XA 2XQ0A 3UO1L 3EJRA 5BOZG 5KWYC 4AEIL 2A6DB 4RNRA 2V3FA 2ZCHH 5EIIB 2WJ7A 2VZTA 3M8OH 3BIBX 4PJGE 1UENA 4KQ4H 4EDWL 2FWOA 1XF2B 4I77L 4UNIA 4JKKA 1JRHL 1EEZB 2R1WB 4EJ1C 4YXKH 4BFJA 3OAZH 1IX2A 1VESA 4BSVA 1R0AH 1DSWA 2CLZB 2H47C 3ATFA 1S7XA 2VAAA 1K8DA 1UH2A 4FG4A 3DARA 2XG5B 3G6AA 2XX1A 1A4KB 4P5MA 3KE0A 3JV6B 3V6FA 5LG6A 4G8IA 1MI5D 4OUOA 1JVOA 5I15H 1DJZA 1MWOA 3FRPG 5MEOA 1XF3B 2BMKA 1BZQK 3KPOA 4JRXB 3SGEI 3V5HA 5J3HD 3ILEA 3MREA 5IOPB 4RMRA 1JZJA 2V3DA 3S3BB 3WTTA 4UNUA 4PHXA 2NSXA 1KJMB 2XA8H 3UCQA 4F7PA 2ZOKB 3ZYOA 2PW1A 1BOGB 1ZANL 4NQXB 4TNVK 3FUKA 2XQBL 5JZ7C 1QR1A 1FNSH 1WA0X 3PGDA 4PR5B 3ARXA 4F7CA 4C55A 2GTQA 3DX6B 3INOA 4Z7OE 2HKHH 5JQIB 1A65A 4BWWA 5HTSA 2ESVE 4GPVA 4DKAA 4PB0L 3KWWA 3HB3B 3ML8A 1SN5A 4JJHA 1TXKA 1C16B 1KYFA 4DKEL 1DQLL 2HRHA 5HGBA 3C60C 2FBJL 3K1KC 4MJJA 4EOWH 2NDGA 5AAWC 2YD2A 4OCYH 4G9FB 2DB8A 4PJ9C 1EXUB 4HUWB 3KZ8A 2A5UA 5I75B 1RIHH 2DQEL 3US1A 1GS7A 4P5KA 3IMTA 4GG8A 1MSPA 2YQ2A 5LGKA 4NNPH 4PGEA 1N9PA 5C0GB 4AIZA 5L0QC 2BO0A 2B15A 3V4PA 5EU7C 2J1WA 3QC5X 1DVFC 1CG9B 3P3TA 1OD7A 4RMSA 2Z8RA 5J1TC 3MX0B 4U1SA 2YN3A 5JIPA 1I7RB 3BZ4B 2FYYB 4LNRB 4WFEE 5C0EB 1ZHKB 1U42A 4IRJC 3DGCR 4ZMQA 1T2QH 3MZTA 3E3QE 3MJWA 4LEBA 3LS5L 2H3XC 5IB4B 4NCC1 5F6IB 5F3BB 5D1ZB 5IFHL 3ZSTA 1NFAA 3WY2A 1WISA 2Q3XA 4NM4H 3OB8A 1ODAA 1Z3GH 5IMMB 5IKCB 4FQXA 5C0AE 1NCOA 2IFFL 2ZOLB 3U4AA 1S7WA 3B34A 4FMVA 1MRFH 4Z0BL 5HGHA 1U3YA 1S7TA 3LN9A 1QFHA 3HI6L 3DUSB 4B9ZA 4KKAD 4XXDB 2VR9A 1TENA 2PYFB 4J3BA 2HRGA 4XN5A 3TO2B 1QTYT 3BPOB 3TNNA 3B2VL 2F8VA 4UQBA 2MHAA 3ZOAA 2NNXA 4D7PA 1BQHA 1KJVB 1MJ8L 4F2MA 2C9RA 3HE7B 1GY2A 7PAZA 5L6YH 3EYVA 1TJIL 1OLZA 5FYJD 3UYRH 4Y2LA 3FT4B 4OZHF 1YY9D 2HLEB 4DUVA 4HV8A 4GSDL 4WVRA 4HEME 3TEZA 3BLKA 1SYSA 1WRFA 5DJDA 2BOCA 3EYFA 1SXAA 4FQXD 1ZGLM 4M9OA 2JCWA 1A64A 4HUNB 4JFDE 2WQVA 4ZPTA 1I7ZA 3WMSA 5MI0C 1E3FA 3FC8A 3ARQA 1CF8H 3VU1A 1HZKA 2IPTH 1N3NB 4WHYH 2JV6A 3D39A 4MAYC 4PWKA 4RFOL 1T83C 2MCAA 4HOMA 4XMLH 1JK8A 4U1MB 1GZQA 1CXHA 2EIBA 1WAPA 1DEEA 4HWBA 4ICWA 4IK7A 4M4PA 5HDOA 4E5XA 1GVIA 3K8MA 4JG0H 3MLYH 4QXUL 2AJXH 4HDIA 3U9PL 4WNJA 1K6QL 3K0WA 3PREA 4HJGB 1P6AB 5AYUH 4QGYA 4FQ1L 3RFZB 3C09B 2D2OA 3DETC 4R83A 2EIKB 3NDZE 1XIWC 4JBSA 3P9WB 5D70H 3I9AA 1DSFL 3ZR5A 2I85A 4PJ7A 4I3GA 1ZK5A 1LO3L 2DM7A 2DQGL 4Q6IB 2K70A 4O2EA 2Z93A 3ZRCC 4NN7C 4GFXA 2D3LA 5KSBB 3BQUB 4DP1X 2H2PD 3MCKB 5EDXA 3QZWB 2DAVA 3D39D 4YR6A 3DDFA 2HFGH 1S7SB 1BMWA 1W6WA 1C7TA 1CGSL 1QO3B 5SX5K 1C5DA 3H0TB 2XTSA 2XWTA 4XCYB 4YL4A 3S48A 3ZKSD 2HSIA 1W6LA 2XT1B 1E5YA 3TV3L 3V0DA 4YK4B 5CCGE 3LRGA 4PRPA 3WNLA 5I1HH 4H26A 2BSSB 5DFVC 3FUNA 2ZCKH 2CJSA 2X6CA 2V0AA 2R4RH 3CVDA 3QDGE 4IBZA 4A2HA 4S10A 4LU5H 4LLYB 1BJ1H 3ZRSA 3CC1A 1TZ8A 5IV2B 1DSYA 2JIXB 5B38G 4MNQA 1KLUB 2Q7YA 5E8OB 2E7HA 2VMDA 5C0NC 3LZFL 4KJQD 4CGUB 4RGMC 4D0DA 4ZMLA 1JP5A 4K7PH 5CGYC 3POHA 5KYYA 2VDMH 3ARDC 1GW6A 1XTLA 4MX7A 3C8DA 4AM0B 3MTRA 2GW5A 3HFFA 4YWGL 1YO4A 1TKWB 1LK2B 2YGOA 1I4FA 1T1YA 3GSWB 1WHPA 3VJ6B 2C8NA 4XC3L 1T04A 1VA9A 1ZTXH 3IDIB 2X10A 1UATA 4PRPD 2IQAB 4DQAA 5HHNB 1J8HA 3MRQA 4QR7A 5K9JL 5CN1A 1JXGA 1Q72H 1RZFL 3NSDA 2VL5B 3EZJB 5F7DB 4OLUL 4JFFA 4Q97A 1DDHB 4L8SA 1EAPB 1M2OA 2ZKHH 2B1OA 3GHEH 1HHHA 4MNQD 1A1MA 3OKOA 4BH7B 1IEBA 1ZXQA 3GMRA 5I1CH 3W37A 4AV4A 3FFCE 4JO3H 2EDFA 1EEQA 5E00A 4ELMA 4JZOB 3RZWA 1U3HB 4KHXH 5AW3B 3LRKA 1NMCC 3MRKB 3VTTA 3MFGB 5I6MA 4ZFFA 3EBIA 1MFAH 2XWCA 3FQXB 4OSUL 2BOBB 5K9KB 3D3VA 3GTVA 3P3YA 1OM3L 2APBA 3BP5B 1BG1A 1DJHA 3B5HA 2A74A 2LFGA 2R2HB 3HW7A 3ELAT 2J1KA 1J8HD 1EGJA 3T0EE 3R19A 4GP8B 3NZHL 1UTDA 2OL3B 2X3BA 3E9TA 2VERN 4JFFD 2GC4C 3FQRB 5MEPA 3AXLB 3HMXH 4MYPA 3TPUB 5I6LA 4GRWH 4HKZA 2VZVA 2YPLE 3VD5A 2F7OA 4G6KL 3TWYA 4IRSB 5DSCA 3RX8A 5DT1L 4CW1B 4H7VA 1LYQA 2TAAA 3VFMB 2VKWA 1BLNA 3IKKA 4TTDD 5D96B 3DA0A 4PJ8B 4N5EC 5LB1A 4N5UA 3TLRA 1HSAA 1T89C 3D3VD 2GABA 4U6XB 3QJZA 1LDSA 4GAYA 5AKTA 1E2WA 2EDXA 2ZUYA 4XP4H 1XH3B 4PP1D 4FXKB 4DPBX 1G6RB 5JYLA 2C1OA 2C5DC 1B9ZA 4LPTA 5JR1L 2VXSH 4A37A 3OMIB 1FNLA 3HOGA 4ODTH 4F37F 1HHJA 4JM4L 1S7VA 2ZAIA 3FU8A 3UL4A 2BHYA 3SPVA 4A6YL 4I9WD 4M02A 2ITCA 3PWLA 3NFSL 2LQRA 1IKNA 4HWEH 4MMXB 4K5NA 4XNXL 3SCMA 5ETUB 4B41A 2ZCHL 1R3LB 2YUWA 2IDSA 1Z2KA 4KQ4L 1X5YA 4M8QA 4ZK8A 5M7QA 2AP2A 2G2RA 2J3SA 2HG5B 5JTWA 4YXKL 1V8HA 2L8AA 5FV1L 5GJSH 4MYWB 1H8LA 1R0AL 1MCBA 5E2WL 2O5XH 4LP5A 1MWAH 4RZCB 5DJ0A 3V6OE 4IBQA 1NFDA 3IDGB 4XO9A 3PY9A 3MBWA 1T7WA 1D5XB 3L3HA 4R8WL 4PVBA 1SXNA 1F8TL 3ZO0A 1X5FA 2FVNA 2WUCH 1HQ4A 2DLHA 3OXSA 4M6MH 3GIVB 4PFEA 3MNZA 3OKEA 4WCYH 1TJGL 2FNWA 4I85A 4ANKA 2VSDA 2DWDB 4Y16B 5FUOL 3SCMD 4NERA 2XA8L 3MACH 3H9SA 2Z91B 4W9KC 5L4FA 4MXQC 2H1XA 4NQEE 1KCBA 1FNSL 1AAJA 3GSNB 3I6LE 2CK2A 3BWAB 3MYJB 1FAKT 1OTUD 4RGOH 1TEGA 4Z95H 4JCWA 1V55B 4A2MA 1VRSA 1HH9A 4PG9A 5JIMA 3O4LB 2HKHL 2DBJA 5IVNA 4TLSA 1JNJA 1T3FA 1ZD6A 3GKWH 2R2BB 1W8EA 3CHQA 3LAFA 3VNZA 4OV5A 1XB6A 1NGXA 3ZT5A 3G08A 2YD0A 2ZUUA 1OP9A 2FT8A 1D5ZB 4HFUH 4MSWA 3NJIA 3UZEC 2BNQE 4QXVA 5HYJB 4OZFA 2YGPA 1D7BA 3FYIB 1YHPA 2C4FT 1WCBB 2AABH 2R69L 2VLRE 5D5MA 4IRZL 3H9SD 4NNPL 3UTTE 3WGUB 4F24A 4LKCB 3MO1A 3IDNA 3L2NA 4XCCH 1TQVA 5E9NA 5LO7A 3L3IB 1M9SA 1J8RA 1SYVA 3TBYA 4L05A 1L6PA 3HZKA 5E2TH 1I3RA 2LU4A 4ZD3H 1WWAX 2RA1A 5ENWB 3FTZA 2EDNA 2Q6WB 2VW4A 1NJ9A 1HNFA 4IJTA 5FFOA 4CMHC 2X4UA 1AJ7H 2W9DH 4DNLA 4OD1H 1A3RH 1XH2A 3KPNB 4M9PA 2OMYB 1M57B 1M6UA 2G0LA 4JQXA 2CMRH 1AR2A 4N25A 4Y5XB 1IBBA 1TJXA 3VA2C 4TNFA 3MRCB 4HUKB 2X6UA 4U1GC 1Z3GL 5CP3A 4AQAB 1BYOA 5LCVA 5LGHL 3AG3B 4UMSA 4F20A 3D2TA 1GGIH 1MRFL 4XNZB 4M1GH 5DRNA 4MNGE 1P2CB 3IPFA 1B90A 2CNZA 4BM7A 3CSFA 1PQZB 3P0VL 5DK3A 2Z0BA 4LIQE 1YNTF 3ROLA 1L0YA 1XGQB 1ACCA 3EFOB 4XRCB 2DPKA 3DRQB 5BVJA 1SGKA 1LEGA 4QAWA 2FT7A 2FEEL 1HINH 4NQDE 1XGZA 4R7NB 5L6YL 2OMVB 4IBLT 4P99A 4Y4KA 4AE0A 4J6IA 1ILUA 2PTTA 5IWLA 1NMAL 5BZWA 2X4OA 1QYGH 2VQTA 2OMWB 3T6ZA 1JGVL 5C0JA 1JK9B 3TBSA 1YEKL 3MSPA 4K2UH 4TF4A 1JWUB 3CVBA 3DHUA 2V2XB 4QDGA 1U8OA 1FCGA 4Z7WA 3FTXA 5ABZA 4N0FA 3E2HB 4BFEA 2J8OA 1S4IA 2IPTL 3QEHB 2QQQA 3ARZA 2EKSB 4LOUC 4JHVA 1MY7A 2CO4A 1Q9LA 3QFJE 4MQXC 3QZBA 1XF2A 4EMZA 1V05A 4OGXL 4R26H 2YRBA 3J27A 1EEZA 1WT5A 3QA3B 4JG0L 2AJXL 5I1GH 1KBKA 5CD5D 2DQFB 5C0BE 4Y4KD 3U2JA 4N9GB 4LL1A 2CLZA 2MPAH 5AYUL 3RGVB 2TSAA 2XG5A 1U3NA 3OC5A 4U6VH 1ZE3C 2I07B 3ROOB 4PLKD 5D70L 5B8CB 5ABDE 2F1BA 1OOWA 2FAUA 4XX5A 3MGAA 2CXGA 5HHVL 5HYQB 4JRXA 4YHKH 4EIZC 2AV7B 4LSRL 4MAZA 1X9LA 3IFLL 2YEQA 2FO8A 4JFXB 1C5BH 4FCHA 3PLYA 2QDVA 2ZOKA 5HHOB 2HFGL 4O51A 4PRHB 3A47A 4LLMA 4BFRA 1SY6H 5FGSA 2ATKB 3VGAC 3FO9B 5GRYA 3WAKA 5JO5A 4J3OG 4GQ9H 4PR5A 3QZLA 5DJ8B 5IGXL 1CIDA 3WFHB 3DX6A 1WO2A 4AK1A 2EECA 3BUYA 1NGYB 1CC3A 2R4RL 5MENB 3DYPA 2XTJE 4G7VH 5J0BA 4LU5L 3MGOB 1GCFA 1OE1A 2MPVA 2C9XA 3SE8L 1KYOK 1IAIH 2VITB 3P4NB 1ZLEA 4BYHA 1KFAL 2ZUWA 3LKOB 4JRXD 4JKLA 3V55A 5KSVB 3JV4B 1EXUA 3MV7E 4BFGA 5IVZB 3CDGB 1IC4L 3VQLA 3WTXA 1UOKA 3ZZLA 3GWJA 2K45A 4P2OA 1KBBA 5C0GA 3ARBC 5DF0A 5I71B 2OMNA 5CLYA 5AKSA 2NXYC 4XVTH 1CG9A 2RBLA 1JL8A 5EU4A 3P9LB 3MX0A 2R83A 4AE1A 3QUZA 1I7RA 2FYYA 4LNRA 3TT3H 5C0EA 1ZHKA 4H44C 5EEXA 2J4WH 4X80H 4HSCX 4E2OA 3WN5C 2FSDA 1Q72L 2LGNA 3L4VA 3HB3D 5IB4A 4WF7A 4ZMPA 1CFTB 2PPCA 5F3BA 5D1ZA 4KK8C 1FVDB 3NUKA 4GOSA 2NY3D 4L8CB 1FF5A 2ED7A 3GHEL 5DMYA 3JYCA 5IMMA 5CSBA 2ZOLA 2BY1A 3EYOB 4ANUA 5J1AB 1DFXA 4YHPB 2VB5A 4P2OD 5FYKD 4QUOA 1DQKA 4XC1L 3UBFA 1MFAL 3GRWA 2X2JA 5HHPB 1GGUA 2WLYA 3TJHC 1JNHB 4DCQA 3QUZD 1CGYA 1BQLH 1X5IA 3HE7A 2AJVH 3FB6B 2AJYH 1NH6A 1SN0A 5ANME 3AB0C 3TEUA 5GGTL 3IJSB 3STLB 2W81C 3FT4A 3QZMA 5D1ZD 3X12B 2KPWA 3MVSA 2O6FA 3FMGL 2XXFA 3L3DB 1S8DB 5DUBB 3RGHA 2ZWSA 2BVYA 3J07A 4QHKI 3QYCA 3BVTA 5E1IA 3RILA 3PAZA 4MA8L 3SYOA 2PN5A 4TNEA 3L4TA 2BS9A 1X7QB 2ZX9A 3CV5A 3AABA 4FNPA 1FE8H 3MLXL 1N3NA 1RIVH 4LIQH 4OF0A 1E4KC 4PGCB 5L8LB 1FJ1A 5FEBA 4QRAA 3ULVC 1JMZA 4U1MA 2B7DT 4DEUA 3I3BA 2UV3A 5J11B 3HE7D 1RZ8B 1WA1X 4B0MB 4FHJA 4ODTL 1MFCH 3ML9A 3CC5B 4HJGA 5AAPA 1XSKA 2FJUB 2XI9A 4BA8A 3V0VB 2YXWA 2AQQA 4X98A 2WINB 3EGXB 2VOTA 5EN2B 4I48B 4WW2F 2ZXQA 1GS8A 4YN3A 5F8QC 1U33A 4Q6IA 3C87A 1N64H 4G5ZL 4G6MH 5AW4B 1J87A 3BQUA 4FYRA 3JUYA 1FWXA 4PJ7F 1BBDL 4H8WC 4XOAA 1Z9SA 3ETSA 1LHZA 1C1EH 4R4BB 5GJSL 2VDPB 4M6OH 3SKMB 1W8OA 3UTZB 5HPMB 5I1LA 5CJ8A 4L0ZA 1QO3A 1MWAL 1IB5A 3O9WB 5GIRA 2DH2A 4XCYA 4NJ9H 4BUQA 5K9OB 5C0RH 1KJ2A 2CBOA 4C8XA 2NY4B 3GJFA 5I1JL 2YGVA 2BM3A 1M1XB 2Y07H 1TVDA 3ULUD 2R1YA 2WUCL 3VX1A 1RJYB 4M6ML 3VDAA 1JTTA 3MLRL 3NJGA 4LLYA 3GBEA 1F3DJ 4Z3EA 5IV2A 3JZ7A 5I0XA 1FC1A 2D2CC 3IPBA 4X5LA 1KLUA 3MACL 4XO4A 3SKOA 5E8OA 2XICA 3UMTA 3BQUD 1LQBC 3SYCA 3QCTH 2F8OA 4X4MA 4L2YA 2CRZA 2C9PA 4WO4B 1OP3K 5GXBB 2BIOA 4LBAA 1OAZH 1EQWA 4AM0A 2FATH 3VXMB 1SHWA 1TKWA 2Y1AA 4AX3A 3PAVA 4L29A 5I1KH 1GJUA 2RCSH 5JPMC 1NFIB 3ME0B 4L23A 2VL5A 1R6VA 4I2XA 1U2YA 3DSFH 1MHEA 1UQSB 1Z9OA 3BLPX 2AABL 3GGWB 1N68A 4EN3C 3GD1C 4HGKC 5CCKH 2TSBA 3CDZA 3MRRA 4BH7A 5J12C 4YGVB 2JJSC 1YN7A 2X41A 5AVQB 1YVLA 1L6ZA 4NOBA 3NSFA 4EUPG 4G3YL 2QVIA 3OZKA 3K6IA 2VMEA 4JZOA 3DOIA 1U3HA 3LN4A 4GAAA 5E8PB 1ZV5A 1YSOA 3L2LA 4ZD3L 3RDTC 3MRKA 3TEYA 1NEUA 3RVTC 2NY0B 4ELMF 5IQ9B 4BDVA 5LXGH 5K9KA 2XWZA 3QXDB 4MXVF 1M9WA 4X50A 1CZ8H 2W9DL 3FF7A 5BVPH 1A3RL 1M2VB 4MDIB 5HI5D 3H4HA 4GXUM 2B8OT 2YBGA 4X5WB 2DJMA 1TCRA 3PQYE 4XO5A 2HFTA 3JVGA 5L4IA 1OP4A 1ETZB 3O8XC 3QUML 5D1QB 1OP3H 5EIQA 4YSSA 4GS7C 3ZYJA 2OL3A 3FQRA 1GGYA 5CNHA 4Z78B 1JGDB 1KCUH 1GGIL 3AXLA 1LMKA 3TPUA 4QKXB 2IQ9H 4AQEB 2IEPA 2X38A 2ZZUT 4FMKA 3Q8FA 4IRSA 1RP9A 4CW1A 1MOEA 1U3HD 2D3JA 3LN5A 3NTCH 2Z34A 2AXWA 5JDSB 3RUGA 4PJ8A 1RXLA 4YDNA 5E7BA 5BJTB 4JPKH 5FF6B 4U6XA 4J2QA 1MPAH 4ATTA 1URZA 3GDBA 2I26N 4LCYA 4FXKA 4CILA 1G6RA 4NBXB 2ZNXA 4TUOB 3QRFM 1QYGL 3CH8A 4W4OA 5FWQA 2QPFA 3HRZA 4WUUB 2SEBA 2XPZA 5TFSH 1I3UA 4HXBH 1YMME 3BH8B 4XTRD 3Q2VA 3CDCA 5I9QC 3DX8A 4H88L 2A1WL 4XN2A 4U1KA 3CBKB 4IRSD 4HKXB 1N5YH 5ELIA 5EO1B 1H19A 4EE2A 2DM2A 3AGVA 3SGJC 2DWYA 3MV9E 5J3HC 4KZEL 4FABH 1X5XA 2JELH 1NIDA 4PJ8D 5DZLA 1C8PA 4F33B 2ZTBA 4ALAH 2QFRA 2V7NA 5JIQA 3L4UA 2HG5A 2PCFA 4XVUC 3P54A 4JQIA 3MCG1 5FXCH 3V4PH 4CAGA 5I1GL 2J1XA 3W3BA 2X87A 5ADOH 4DGIL 1HCZA 1HFUA 1WGOA 5I5IA 1M6OA 4RZCA 3EXJA 1GGTA 4F91B 4U6VL 5K9QG 3ZE0B 4Q74A 3VQMA 2Y9RT 1D5XA 3OG6B 3MJ8A 2DM3A 4MJHA 1KDJA 3BQVA 5FYJH 5IBUG 1QUPA 5AEAA 2IH8A 2VXVL 3PHQB 4BK5C 2IGFH 5EOCJ 1O0VA 1H5BA 2EO9A 2AK1H 2JCCF 4XCNB 4Y16A 4PTTB 3AW5A 1TU2B 1SY6L 4JFQA 4U3CA 1VSCA 4A55A 1HZLA 1DVTA 3MYJA 3BWAA 5L8KB 3BCFA 1QWNA 4BE5A 2VZSA 3AU1B 2L7EA 4IK6A 3O4LA 1ES0B 3NBNA 2EDDA 5FGCB 5SWSE 5JW5B 1K5NB 1T6WA 4Y19B 2PPFA 2PCYA 3QJUB 1BDYA 4OLXH 2F7QA 3PIQB 4FZEH 4XPBH 3AT9A 1L3WA 2XACC 1Q0YH 3RVXD 4KNSA 3RGBA 4FFWD 2LVEA 3NZUA 5HY9A 5HYJA 4P48A 1PEZA 2A9AA 4O2FA 4MJ2A 2WKGA 4XNYL 4Y16D 3F12A 4LCCC 3BP4A 3MKKA 2NNFA 1WCBA 3Q0HA 1C12B 3NPSC 3OKYA 4MMZB 4XVTL 3L3IA 4UDTA 4XNUL 5DJYB 4GXVH 3FTGA 1E4WH 4F1ZA 3ULVL 5K5YA 5IG7B 4FQIL 5ENWA 1QBMH 4M4RA 1J1XL 1LO0H 1WZAA 1I1YB 1X5LA 1QG3A 2OJEA 3O4LD 2Q6WA 4Z76B 3ECBA 2AF2A 3VAEA 3IJ9A 5ALBH 4PI0A 1IVTA 4XE0A 5KG9B 2VUYA 4NM8H 4HWBH 2EIEA 3HEIB 3KPNA 3SKUD 4Y5XA 3MODH 3OAUH 3GSQB 4HCFA 3FOMA 3DDGA 1PG7H 3MRCA 2DH3A 2CZNA 3KHQA 5HYJD 3K0YA 3OTTA 2XN9B 2Y06H 3HN3A 2JCCE 3PPSA 4AQAA 1YY9C 4HU8A 4OB5L 1SZNA 3N44F 4UNVA 4IOFC 3FUJA 4J28A 3U7AA 5HHQB 2PR4L 3EBAA 4H8WL 1S9WA 1P2CA 1O6SB 2Y69B 1PQZA 5FCSH 3VGGA 4Z3HA 1P6FA 2CR6A 3SPGA 2J5LC 2QMJA 3K2MC 3TN0C 3EFOA 4XPTH 4HCRL 4XRCA 1ET5A 3GSVB 2Q8BH 2B5IC 4R7NA 1B88A 2OMVA 3BGMB 1U0QA 1J9SA 3OMAB 4NN5C 1F4AA 4B27A 5E6IA 1CL7I 5CEYB 5EU3B 2YK1L 2OMWA 5JW4R 1QRNB 3PABB 1N10A 2XU9A 3O6LL 4L4VB 1EHAA 3IDMB 1JWUA 5HGDB 4Q9QH 2EXSA 2F5AL 1Z9NA 2V2XA 4YHYC 4KNTA 4HH9B 1MELA 5TD4A 1DZ0A 4MJIE 4JAMB 2Q10A 4QO1B 3ZSSA 1YEEL 2CWRA 3QEHA 3SE3A 3WTSA 3ZQXA 2EKSA 1L9RA 1E8ZA 4P9HH 5I28A 2VUKA 3WFCL 1T0NB 3H3KA 1U8HB 5IZ7A 3KAAA 4ERSH 4OKVB 3QA3A 5TGBB 2ICEC 4BFNA 5F1NB 3RU8L 4YXHH 2DQFA 1JTOA 2GFBB 4JCMA 4PRIA 2WLZA 4N9GA 1EZSA 2JQZA 2VO8A 5E6ID 2DQUH 3RIAF 5DFTA 3T6XA 2W9EH 1HS6A 1R3KB 3OGOE 4MWFA 4LCUB 3S2AA 2I07A 3AG4B 3ROOA 3QXTA 1NEZA 5B8CA 4X9BA 4HC1L 4G6FB 4H25B 4UV4H 2ITEA 5D1XC 1N64L 4G6ML 5AL0A 5DEZA 5GRXG 4YL9A 1PZSA 2AV7A 2ARJA 1PLBA 3QI9C 3BE1L 4JFXA 5A43C 2BNUA 2EH8H 4JPQA 3BIAX 1CXLA 2Q2LA 2F18A 1P4LB 4HMEA 4WTWA 2DYPB 3FO9A 8FABB 2FJSA 4M7LL 4JZNA 3BD3A 4IMKA 4IIQC 4WUKL 5DJ8A 4NJ9L 3X2QB 4GBXA 1AR1B 4PRID 3BPNC 2YARA 3NIFB 4ONHB 2OZ4A 1CB4A 3JBG7 5J9PB 3R8QA 2I5YH 2Y07L 4KH2A 4O02B 1AP2A 2PLTA 4E41E 5MENA 1ITBB 4F3FA 3FSAA 1EGJH 1QSFE 1Z6JT 1TEFA 4ZMAT 4AJYV 1DANT 5KSVA 1PIFA 3FN9A 1CTNA 2QGDA 4BKLB 2LU3A 3Q6FB 4L1LA 4FFVD 4Y2OA 3L95B 5IVZA 1QBAA 1G5AA 3RKPA 3QCTL 4RDQF 5DGRA 4PJEA 5IB1B 2EYSB 2FATL 3D08A 4H1LB 1QP1A 2KLSA 5CZXD 4X7DC 3V52H 3SBPA 5I1KL 4IBVA 2AERT 2ZIDA 3B5GA 4GBXD 3VVWA 2RCSL 3H8NA 2EEXA 4RSYA 4CN6A 1P7BA 1OVZA 4R84A 3GZOA 1AOZA 3GLEA 3JTBA 4HIIA 1XCQA 5MEND 1DVUA 3NSYA 5E2VL 2Q0ZX 2AJSH 2VLMD 5DZPA 4MJ4A 5KVDL 3N04A 4HCIA 1FVDA 4B9PA 3FT2B 4K7FA 1DUZB 2CJTA 3TU6A 1PX8A 2QHRH 4TM9A 3BXNB 3KWVA 3U9WA 4N2HA 1MFEH 4L3CB 5DEFB 3NK3A 1U8KB 2W92A 2WXOA 1RHHA 5J1AA 2LR4A 4YHPA 32C2A 4GNKB 2IADB 3LYRA 4FZ8H 5LXGL 2AGJH 4NKOA 2AW2A 4H40A 4NCC2 3LS4L 2F74A 2OMBA 4P3CH 5F0JB 5BVPL 4X4YA 1JNHA 1DBKH 2J8UB 3FQTB 4NRXB 1MIMH 2WN2A 1JZ2A 1IRAY 3B56A 4XX1E 1PZ5B 2J1YA 3V5KB 1CE6A 1SVZA 1UZ6E 3FB6A 2GIMA 4ZO7A 1NCWH 2H32B 1T6BX 4W9DC 5B1JA 3TFBA 1A9BB 3IJSA 4N8VG 3RWIB 3STLA 2F9BT 3X12A 1JZ8A 4KDTC 5CGMA 1U9KA 4S1SH 2G30A 3TNMB 2IQ9L 1S8DA 2C9QA 3GSOB 5DUBA 5ACLA 3D9AH 4MVBD 1KB9K 2XG4B 5FOBB 4B9KC 2LV4A 2ZYIA 3NTCL 1HZHH 4CJ1A 1KIQB 2DWSA 4G9FE 4JVPA 1GSMA 2VQ4A 1X7QA 3QJHA 1XDTT 4JPKL 2FUTA 1MCDA 1WBXB 4Q6KA 4PQXA 1TYJA 4PGCA 4BQ8A 4MD0A 1MPAL 1L9NA 3CH1A 3HBZA 3VACA 1OTTC 3G3LA 4UQCA 4I9XA 3RHWF 3HC0A 3AWGA 1AE6H 1RZ8A 2CQVA 3CMOH 2NUPA 2G2PA 3IK2A 4H20H 5TFSL 3CC5A 4M48H 3U83A 4HXBL 1ASPA 4Q7DA 4OI7A 4R7DA 3U82B 3S37X 5EIIG 5IVOA 3RVUD 1DCLA 4DPCX 4HD9A 4AQ1C 2EDBA 5IBTH 1G4MA 5TF0A 2CDFA 3AREC 3DMMC 1TR7A 5D7JC 1N5YL 1EFXB 3IDXH 4LARH 4OZFH 3PV6A 4PB9L 4CC4A 5SV3A 3EH3B 5LDSA 4LCWB 3KNBA 1I9IH 1RV6X 2FEDD 4MS6A 2JELL 4FABL 3M6DA 4XN4A 3FQ4A 4HISA 3QDMA 5TDOA 4N4YB 1AO7B 1JXDA 3A6OA 4R4BA 5C8JB 3SKMA 4JZJC 3UTZA 2EIDA 3CWGA 1ETB1 5F7YC 5HPMA 5ADOL 5KSBF 4KKBC 5IF0A 2YD9A 4EZJA 4UM8B 1KXVC 5K69A 3UJJH 1IJ9A 5K9OA 1OHQA 4XAWH 2C3GA 1BZ9A 4M8RA 3BEVB 2Y3NA 3ZHNA 4Y4HC 1EERB 1ZLSH 2IGFL 5DS1A 2B59B 4DVRH 2AK1L 3KPRB 4HFWB 4Z0XA 4XX1G 1KEMH 1FFPB 2R0ZH 4OY9A 2ZWLT 5CP3H 5EOTB 5KBKA 3TYFA 3AQXA 1WZLA 5LCVH 1UXSB 1FZOB 3PP3K 4N0CD 4Y4FB 3MBEA 4KK5D 5AW5B 1AZZC 2CXKA 3GLZA 3QDMD 4YBQD 1SLWA 1QA9A 1R3IH 5KJ4A 3P9MA 3VH8A 4YVNA 4WO4A 3EDFA 1FL6B 2YFOA 3VXMA 3U4EB 3PP4H 3EAKA 2P28B 4CNIA 4RDQG 5F3FA 5I19H 3D05A 3JTSB 4OW6A 1J10A 3WFBH 4NPJA 2P8PB 5H4ZA 3N55A 2X09A 2EVGA 3ZX1A 1NFIA 1Q0YL 3ME0A 5A3IC 2DEYX 4XP6L 2J44A 3IDUA 4B9JA 3VXRB 3LD8B 2DLTA 5IW6B 3GK8L 1UQSA 3O3AB 2VN4A 4X6CB 3N9GH 4ORZC 2WB7A 3GGWA 1N8ZA 3V5DB 5BRZB 2P44B 1IQDB 3LY6A 3MA9L 1JGLL 3BT2L 4YGVA 1UKTA 1B4JL 3MBED 2EDMA 2I9LB 4L9LB 4GXVL 3I9IA 5LUMA 3SJVB 1CGTA 1X5GA 2E6QA 3B7SA 5KSBE 5DMJB 4WO4D 4PJAE 1QBML 2DTML 1LO0L 2VM3A 4ODHL 4UANA 5IQ9A 3SDAB 1SN2A 4RWYH 3VXMD 5FECB 5A6LA 3C08H 5ALBL 1ONQB 4C57C 3PP3H 1AKPA 2N4IA 5DC0A 4BE6A 4NM8L 4HWBL 3K72B 3F7VB 5JOFA 1L0QA 2JKJA 4R5XA 5DC9B 4AMXA 4X5WA 1AXIB 3OAUL 1EANA 1IFGA 1QATA 5D1QA 1NWOA 2VLJA 5TF1H 3FQNB 1P5UB 4Z78A 1JGDA 1PKOA 4GG6B 5DMGC 1D3CA 4ENED 4P07A 2Z7ZA 4G8FB 1MF2H 4QRBA 2FD6H 5DK0B 1REIA 4WEUD 4AQEA 3MHZA 5JHAA 4UILH 2Z31A 3O6KH 3G5YB 1YUHA 2HXAA 2WZ6A 5DZAA 1LLAA 2VXUL 3S9DB 2QTVA 3DPBB 3F7PC 3PYCA 4KKRA 3EHBD 4PCTA 5C08E 3WIHA 4XPTL 2NY0D 3VD1A 2Q8BL 1CICB 3HS0C 2HX9A 4YDMA 5EC2B 2R2EA 4P57B 1AG6A 4OZGA 5FF6A 5I1AB 4N2GA 3HAEB 4N2KA 4NPKA 3ULAB 2IDUA 3TBTB 2LT9A 5DVOA 4MS8D 4OFVA 3QUYA 3VFRB 4G7SB 3VFUB 1CF1A 4MLSA 3UDWA 3VWJC 1OW0C 3ARGB 2VLJD 1X3DA 3K1DA 4M93B 4WUUA 3CMGA 5D1QD 3ZPDA 2GJ6B 2AKRA 4Q9QL 4L37A 1E5ZA 1ZDQA 3D2UB 3WJJC 1T5KA 4OUUB 1JUFB 3TONA 4AVIA 3HFMH 4J8RB 1Z32X 1K4DA 2A6JA 3HZVA 4XHJC 4NRZB 2Z31D 4K71C 5EO1A 3Q2NA 4GO6B 3FN3A 1ZLUK 2Q7AA 4F33A 3B5TA 5FYKH 4DP4X 2VRAA 2AXJA 5A40E 4YXHL 1JIBA 1FNEB 3IMVA 5CBAB 1T1XA 4TN9A 1JV5B 3QUYD 1OHZA 1G43A 2DQUL 2ARJQ 3BMVA 3OZLA 3QQDA 3QIBC 3ZTEA 4DESA 4WUUD 4AZUA 3HR5B 5D7IB 4YDLC 3S7GA 1NAMA 3HZ3A 3GZPA 3QCVH 3TVMC 1TJHH 1XCTB 4NB7A 3PHQA 1OSPH 3EXLA 1QLRB 4GJTB 5AOMA 4M61B 3TH3T 3BUQA 1LE5A 2Y23A 2YRZA 3OX8B 4FHKA 1BZ8A 3RVVC 2YD5A 3QRGL 4JFEE 4HLEA 2J55A 3KW8A 4CKVX 2KERA 3MROB 5GSVB 3A24A 3B7YA 3N6YA 3AWEA 3EH2A 1SDYA 1TMQA 1HU8A 3GRWH 4TSBL 1WFMA 5IJCC 3TO4C 1ES0A 1DL7L 2WJ5A 2DS4A 4EIGB 2UZXA 3LQAH 1ZLUH 1K5NA 5EOQL 4KUCF 4Y19A 3RYMA 1S5IL 3NABH 3TCXA 4L3FA 3PIQA 4HZLB 4X5XA 1T7YA 4WU7B 3RNQB 5HSFA 1E6JH 1MLCA 4IU2A 2D03H 3B83A 4FL4B 3UTPE 4ZW8A 5DHYB 4LMQI 4XMWA 3VFVA 4JFUA 2Y36H 1HEHC 2DMKA 2WBJC 2CLVB 3VXSB 2VZOA 2WWNA 2HTKC 1C12A 1H8SA 4I1NB 1EV2E 2P5WB 5K1JA 4PIBA 2NR6C 3E6HB 5D6DC 2YD3A 2Z4QB 4MMZA 4G1MB 4NUJA 5LNGA 2LAGB 3V52L 2K7PA 3D87B 2PXYA 2GTZA 4PJXA 4JR9H 4UQ9A 2N1KA 1CVSC 3F7YA 2BDNH 4KO9A 1I1YA 2GBTA 1ZA6B 3PDGA 3IJYA 5ILTH 4H2CA 3GJFK 3E8UL 3DX1A 4PTUB 5EBGA 3CHPA 4TQ8A 4NENB 4Y19D 1YLBB 1ZGLB 5KG9A 4S1RH 1U3ZA 1ZV2A 2AJSL 2GIXA 5AG8A 1ZAGA 1QSEB 1D2OA 3QAZB 1CGWA 3GSQA 5CHNB 3S4SA 3O0RH 1RZQA 2YUXA 1QVOA 1ZK9A 3AU0A 2QHRL 4YIQB 1H3PH 3FAWA 3ULUH 2OKMA 1BFVL 1HXMB 2MQ0A 3MGTA 5HHQA 4OZ4B 2YFNA 3O6FB 4WWKA 4WJ5B 4QI3A 3S5LG 2FLRT 3CZLA 4FZ8L 2VUOA 5J13C 3UPRA 4ETQA 2APWA 1O6SA 4NNXB 5DRZB 4P3CL 2PXYD 4EIBA 3UYPB 1ZT4B 2EUVA 1P7KB 3BSGA 3DYMA 3BOVA 4LHQB 3VFPA 3K2UH 3V8CA 3WO4C 3NN8A 3W0WE 3UP1A 9PCYA 1NCWL 1JPFB 2D7MA 2VZUA 2NW3B 3I6GA 4YZFF 3CXDH 3N85H 1ZS2A 4KX8A 3LDBC 1FPTH 4DP8X 5D7SH 4DEPC 5JIDA 1KJ2H 1TZGH 3N42B 1U92B 5GGRY 1QKZH 4FP8H 4L4VA 1F86A 4GW4B 3GJFH 2XIIA 3IDMA 3INUH 4IDLA 4CU6A 1HXKA 1XQ4A 3NP3A 4NC1E 4X42A 4KQ3H 2XV6B 3N41B 4QHKJ 1JPST 1DO6A 4ZUUA 1G7IB 3VWKC 4ISVA 2YSSB 3T0AA 4DOHB 4WWKD 1JFQH 4JAMA 3X14A 2ZOWA 2HKFH 5LHDA 2NUTB 3BAYA 1TTUA 2X6VA 2EABA 2NY5H 3OR7A 2OV0A 4QYAA 5I0ZA 3MMEB 5IR1B 4PD4K 5AYTA 4XCFL 3O3DB 3KVPA 4J7RA 4LNVA 5TGBA 2H6PA 1IGCH 4JDEA 5F1NA 5DYOB 4FF9A 4H20L 2O5YH 1VENA 3B3IB 5L9DL 1RZGB 1OL0A 4U3SB 4W1TA 1RP8A 1R3KA 3DUUB 3I85A 4LCUA 5MERB 5J8OA 5KW9H 1J0IA 4L4VD 2CBQA 1PVHA 3STZA 3UMNA 3IDXL 3A67L 3QNFA 1SQ2N 5GGQL 2F54B 1A6UH 3G9VA 2BC4B 3ISWA 1EJOL 4LFHD 5E8EA 2XWJB 4F7EA 1I8IA 5K93A 1BIIB 1PU0A 1X5AA 1A02N 5AOJA 4BQBA 1QLFB 4QF1A 1B0GB 4D2NA 1JPEA 4A39A 4ZMZA 4KTDH 8FABA 4FLOA 3FONA 4YFLI 1K3IA 2AEIT 3GXMA 1RK0B 4JG9A 4D9QD 1HQRB 3HHRB 3KLQA 4J3VA 3UJJL 1AHWB 1FGNL 2E8YA 4ONHA 4XAWL 4YZFE 1NFKA 5KBPA 3WS6C 2GSGA 4S1QL 4B5ZA 1OCWL 1ZT7A 1IAOB 3SYQA 4X0KB 4F57L 4QHPA 4O02A 5CLWA 3TEWA 3ULSB 4DVRL 1GAFH 3QYNA 4OBRA 4G42A 1KEML 2HMIC 4G6FD 1NC2B 2JJWA 5GZOC 1E9PB 3LRMA 2OL3H 5AW7B 5LCVL 1AMXA 2Y5QA 1UOWA 2X2UA 3NJXA 3EO0B 4WTZA 2X7LB 1OANA 5DLML 4APQA 3TJEH 3RFZC 1GIGH 3AAZA 3AY4A 1R3IL 1RZKH 5H94A 2ZXEB 4PY8I 4LF3A 2VXQA 3IDYB 3BUBA 4GSRA 1L5GB 2EYSA 2LAAA 2N59A 1B6UA 4M8VA 4NQCA 4WI2A 5D93C 3J8F7 4ZFGH 1ZHNB 4NCDA 1AR1D 1ADWA 5DQDL 5I19L 5HPOA 4Y5VB 3HNTH 1JZ3A 2YO3A 5ISZB 3IKCB 3I74A 2QVTA 4KO7A 3N1PC 2BK8A 5BMFH 3EH5B 4JFYB 1G6RH 3RAJL 3RJDA 3QG6A 1HX0A 3ZDWA 3N9GL 3FT2A 1DUZA 2FEEI 3FB7B 3WJLA 1YEWA 5INDB 5E4EC 4NZRH 4DN3L 5EUKB 4L3CA 5DEFA 4APQD 3IVKB 4F8TA 3E3QC 2EDWA 1XGPA 3OKKA 3DVFA 2GEEA 2IADA 3B8SA 4MQ7B 3S35X 1CDHA 1TMCB 1TZHB 5FFLA 4RWYL 3RPIB 4D9LH 5HHOE 4NQCD 5EZJB 4PRHE 1S3RA 2GK0A 3CLWA 5HHME 1R24B 2E27H 2J8UA 3AXIA 1TYRA 3FQTA 5GQBA 5KUMA 1PZ5A 4JQIH 2BVOB 3QNYB 1Q1JH 4WAFA 3DO3A 3X11B 5CBEB 1B0WA 2H32A 3KVQA 3RA7H 5TF1L 4I0CC 4PLNC 1A9BA 4KRPC 3T2NL 3IXTA 3QIWC 2YA1A 1ZHLA 4HQQH 3RLSA 4RMTA 5DWPA 1SM3L 5F9WC 3GSOA 1MF2L 3FO2A 1CDJA 3MJ6A 5JUEH 4JK0D 4PWGA 2APXA 2Z8WC 1KIQA 1I8KA 5A2FA 2BHUA 1XR9A 3Q13A 2Q9OA 1CXEA 2XV3A 3BSHA 4PV9B 2F53A 5E7FA 1WBXA 1JZ7A 2O61A 3KPLB 4F2EA 1RIUL 2WCSA 4LRIC 4YUEH 2IAMC 1UB5A 1SXZA 3DGGA 1T7ZA 4QIRA 1L4IA 4NKIL 3LEXA 1S5HB 4Q58C 1U6AH 3WELA 1A4JB 3F6IA 1HWGB 1E7VA 4HUXB 3T4AC 5AZEH 2CM5A 1QUNB 1UYWH 2H3NB 2QPUA 3C9NA 4WIQA 3SB3A 1EFXA 3P3SA 2YJLA 5D4HA 3RWDB 3P30L 3T0VA 2WTRA 4WY7H 5EZLA 4CRPA 2DKUA 1G4RA 1GJWA 4RMBA 2C3HA 2EE9A 5FCUH 4RRPG 4AGNA 4FA7B 2F53D 1AO7A 2EILB 3RP1A 4GAJH 4HJIA 5C8JA 2IPUK 5CEZE 5I6OA 2WZPA 4X5QA 3DKHA 4BCXA 3WNIA 5IB2B 1PPIA 4XNDA 4NP4H 4UM8A 4AL8H 3U1QA 5A2BA 2J6WA 1NBVL 1IGYA 4UT6A 4A2LA 5F7MC 3L2MA 2PYEE 1D7CA 2D3VA 2QR0A 3WNKA 1PG7W 3BEVA 4DGYH 5L8JB 4QMEA 1PD0A 1ASOA 2B59A 3NG5A 2UY7A 4IW4C 2ZUTA 1BQSA 3GQFA 1C8QA 1EFXD 5EOTA 1CUOA 2W9LA 1NOAA 3BYYA 3OD3A 2AQNA 1CR9H 2R0WL 1A6VL 1UXSA 1FZOA 5DZOA 5AD0B 4Y4FA 2D9CA 1AZBA 3BKMH 1AO7D 1XL4A 4HJ1A 4X4KA 4P0DA 2WZPD 1H6FA 3IETB 3CJJA 2EDYA 3KGRA 3NPZB 3GXPA 4UOQA 5IK3B 3U4EA 3WKYA 2ICWI 3U0WH 5E4IA 3NABL 3JTSA 1FH5H 3VGEA 4HIHB 3OWRA 2VSMB 1WUZA 1XH1A 4KDWA 4U6TA 4AKQA 1CYWA 2IGLA 5DQ9A 1PZUB 1TQCC 4JRWA 5E23A 2D03L 3NIDB 1NLDH 1VLXA 2IF7A 2Y36L 3O3AA 3MRNB 4HA1A 5I6XC 5KVFH 4X6CA 5JOPE 4KRLB 4UT7H 4YPJA 3V5DA 3WE6A 2GI0A 3AQYA 2A2QT 4BZ1L 1IQDA 2B1HH 2WNGA 3LRLA 5D2NB 4F9PA 5KJRH 5AG9A 1X6NA 4MZIA 1KLGB 1WC7B 4Y4FD 4F58L 4TPRH 2I9LA 4UTBL 2ORBH 2I24N 3TIDB 4EI5B 1PY0A 1PKQB 2YBRB 1A0QH 1J5CA 2X4TB 3SDAA 4BZ2A 5ILTL 3VXOB 2Y24A 3M1CA 3ZHLA 5E6YA 5DS8B 4RISL 1YEDB 3ZE2B 1U8QB 4S1RL 5GGSB 4NQSB 5F7AA 4EN2A 3VM5A 3F7VA 3O2VH 3HJEA 5FGBA 4QCIA 3DIVA 1CTOA 2KZWA 4U1NB 1IIKA 3GMLB 4HK0B 1FN4A 2P9RA 4AXWB 3FQNA 2Q8AL 3C6LB 3UG4A 3KLHC 1B4LA 2Z7UA 3ULUL 2JKSA 5EUOE 1MRCH 2B2XH 1F6LL 1RUPH 1XGTB 2HAZA 3BDYL 1RJCA 4ZX5A 3T0EC 3DLQR 3L17A 3KLAA 4EXPX 5IJKC 1QBBA 1BWWA 3BPCA 3CFKA 1YAZA 3DPBA 3F58H 2X1XR 1V54B 2CE6A 3CZFB 1KCVH 1CIUA 3OXRB 4K73A 1CDBA 3SDAD 5I16B 3KPSE 3K2UL 3GMQB 4S1DC 5EC2A 2C1PB 1GJIA 4ZW6A 1SEQL 4JLRB 2OX5B 2PNDA 5TDNA 4M6AA 5G4MA 3VFRA 2J21A 1AD0B 3CXDL 4M6NH 3VFUA 4WJKB 1XZ0A 2K8QA 1FPTL 4V11A 5D7SL 1CURA 1KJ2L 1YNLL 1TZGL 2BHZA 2OZ4H 3ARGA 3DO4A 1QKZL 3O2WH 4FP8L 4LVHC 3BDBA 3C5SB 4HWZB 5E6IC 1UOVA 2GJ6A 3INUL 1J1OH 2IAAC 3GO1H 3QJQB 4P5RA 3ZQWA 4HUVB 3D2UA 5FO8B 4KQ3L 1JUFA 3X13A 5DDHB 4L5FE 4ZOAA 1XF5A 3QDJB 5IEKB 5E5RB 2VDOL 1SMDA 5D55A 2P5EB 3KDMB 5ESQB 2PP8A 4OFKA 4I3SH 4R5VA 1A7PH 1IGCL 1TQWA 5CBAA 1CFQA 2O5YL 2VLKA 1DBBH 1JV5A 3LEVH 4S0HA 1T22B 1QASA 3IPEA 3ARGD 2ZQKA 2QBWA 3PWPE 2GJ6D 2VH5L 3FU6A 12E8L 5L7XH 4MAUH 3D2UD 3N1MC 3W2DL 3UC2A 1CK0H 1DEDA 2APSA 2NY2C 1XCTA 5D1QE 4FJYA 3ZE0F 1HNYA 4OR1A 2P4AB 4Y2DA 3ESPA 4ETYA 4M61A 3GI9H 4FQHB 1KV3A 4LE8A 5IHHA 1ZRUA 3V6OC 1W0VB 5LXVA 4GP4B 3OX8A 1LE9B 4QNPF 3QIUC 3GSRB 3C60B 5EZIH 4ONFH 4TXVB 3MROA 4L4TE 2F61A 3PWJA 1AZNA 2JJVA 2VM4A 4A6YB 2BVPB 2Y2WA 1SJMA 2E0PA 2VQUA 1Q38A 3WE1A 2A6IB 4BEIA 4HBCH 1M05A 1FORL 2BP5M 2VLKD 4GIOA 1BG9A 5FK9A 3T6QC 5GGVY 3L1OL 4KTGA 3ARPA 1EDQA 1YCSA 1A5FL 1DVFB 5D7KD 1TTCA 4HZLA 2Y7NA 1Z0NA 3RNQA 3KGSA 1PSKL 1BEYH 4WU7A 3K46A 3VXUE 5FUCE 2WN3A 3B7TA 1DQML 5DHYA 4QTHB 4Y2DD 4LSVH 4KK6D 2E9WA 2KYIA 1U36A 4JY5L 3CLEL 3TJEL 2G0KA 4JVUA 4RWHA 1KGYE 1YZZA 1GGBL 1RZKL 5GRVK 2P5WA 2VYRE 2Z4QA 2ENQA 3C5JB 3O4OC 3PDDA 3VI3B 4OM0H 4B3VA 3E7JA 2R8SH 2VXTH 1I8LA 2FWLB 5JW3H 4QOKE 4O9HH 3HNTL 4OZIA 2UVEA 4G8GE 4L0PB 4OJFL