4YMPA

Crystal structure of the bacillus anthracis hal neat domain in complex with heme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
112
Chain Sequence
VFDAVIKAYKDNSDEESYATVYIKDPKLTIENGKRIITATLKDSDFFDYLKVEFHDVKVLSEDKRKHGTKVIQFEVGELGKRYNMQMHILIPTLGYDKEFKIQFEVNMRTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Heme-binding protein
molecule keywords Internalin
publication title Crystal structure of the Bacillus anthracis Hal NEAT domain in complex with heme
rcsb
source organism Bacillus anthracis
total genus 22
structure length 112
sequence length 119
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ympA00
3QUGA 2E7DA 3SZKC 2H3KA 3RURA 4WJG3 5D1QE 5D1XE 4MYPA 4H8QA 4YMPA 2Q7AA 2K78A 3OVUB 3QZMA 2ITFA 2ITEA 3SZ6A 4FC3E 3QZOA 3VUAA 3QZLA 3QUHA 3QZNA 3S48A 2O6PA 4H8PA 3RTLA 3VTMA 4NLAA 3QZPA 3SIKA 2O1AA 5D1ZI 2MOQA 2Z6FA
chains in the Genus database with same CATH superfamily
4YN3A 2NY1B 1X4XA 2AK4D 4MTMA 2H6PA 4QOKE 5D96B 4TNVK 4Z7WB 4PJGA 2VDML 3VXUA 1FGVL 3KXFA 4OKVA 1C5CL 3JV4A 3G6DL 4IOIB 4FQXD 2QFPA 2UWEB 1ZV5A 1P7QB 1NGXB 4FFZL 4Z3GA 2JCCE 2VOTA 2AXWA 5HGBB 5IQNA 3RTQA 3LRSB 5IEHB 5DUPH 2DEWX 5D2LA 2LLGA 2R39A 5L8LB 1ZGLM 1S9VA 1G4MA 2NXYC 1AANA 4MJID 3WXWH 2BIIA 3SIKA 3BAIA 2AXFB 4WTZG 5I73C 4NCC1 5DR5H 1QNIA 2CSPA 2PP9A 4PI2A 2E4FA 3DV4B 4D0DA 4Y4HB 3PJNA 4FJZA 4H1LH 3WOVA 1XCTB 3T8VA 1LEGB 4PGDB 2UYLA 1ZHNA 2VABB 1YG9A 5DD0H 4QYOA 4U6TA 2NY3D 3EGDA 3IB4A 3BO8A 3M8OH 4KO9A 4HU2A 2ZNWA 3W82A 2WINB 3OPZH 4GIOA 3HCVA 4FG6C 5GGSY 1B4JL 2IH9A 1AXSB 5C3IA 4AGMA 3UERA 4QO1B 1ZHLB 2UUDH 1SRDA 2A6JA 2I9LB 5EDXA 5AFAA 2YLHA 1I1AB 1R24A 32C2B 4XMKL 4UM8A 5KSAB 3VXSA 4FZEH 3EF4A 4XVSH 1T0PB 4G8IB 3MLRL 5JXEC 5GRVL 2HYMA 4WCYH 3U7WL 3WCYA 1FL5A 2V5MA 3RJDA 1DP0A 4LHUA 1YPZB 5DZLA 3MA9H 2A9AA 4AT6B 4LNVA 4BZYA 3OKEB 5DUBA 3K1DA 2CGRL 1QLFB 1KXTB 2Z65C 1CT8A 2PXYD 3AMKA 3W11C 3FUJA 4AGPA 5ITBH 1Y07A 3CX5K 1JGUL 2CA3A 4TPRL 1JPSH 1MRCH 1W72L 5JIPA 4KTDL 1V7ML 3POHA 1QVOB 4JGNA 1JAEA 1P1ZA 3O3AA 4OI8A 5H37A 5AVZB 4HV8B 3T4AB 3TO4C 3F6IA 3FU6A 4E9XA 1CGWA 1UJ3C 3CN2A 3ZDYE 4CC4A 2V7HA 1X6NA 3OKNA 4IIQC 4ZJ9A 4BZ1A 4QJ4B 2PPFA 3TO2A 1H8SA 3X13A 1AP2A 4M5YH 5D2NC 2XN1A 3FQWA 3EYQC 3H42H 3KW7A 5B7EA 2IBZX 5C9JB 3O3EB 1Q9KA 1OK0A 5B39G 1C12B 4K71B 1M71B 2H8PA 4PU2A 3SGJC 1CU4H 4N20A 2LVEA 1A2YA 2YPVA 2YZ8A 3EBAA 4UU9A 1EEYB 2FBOJ 3WIAA 5EF3A 3MGAA 2CR0A 1THCA 2CMRL 2Y72A 3HNSH 3EYFA 4GRMB 2XYCA 35C8H 4LPXA 4DO5A 5F0JB 3EXJA 2TRHA 1CVRA 4E9YA 2WQUA 4LK4A 5ABAA 1N68A 2Z7ZA 3QDAA 1IZKA 1RZKL 4MS8C 4UQBA 5CD3A 3SOBH 1IC7H 1T22B 2PCPB 2LE9A 1F86A 3I50H 3QJOA 3QS3A 1MCSA 4QHPA 3QYCA 3CDGA 3L9RB 4KROC 2YXWA 5FDWA 5FUOH 5K5YA 3MACH 2G9HB 3VW3L 2BZDA 3G6JE 2TSAA 2FCBA 2BDNL 1RZFL 2EO9A 4NC0B 1W8EA 5IB3A 2C1OA 4IMLA 4BXSV 2GSGA 4ZXBD 3CH1B 4HPOL 4PJHF 3JWOH 3NJLA 3O9WD 5M7QA 1FFNA 2IPUK 3MRQA 3RWJA 2K7PA 3AM8A 5DTFA 4U1SA 1FDLL 4JVUA 4HDIA 2AFNA 3TBTB 1ES0B 4TLTA 5D1ZI 2OMYB 5T1LB 1P4IH 4KOBA 3HG4A 3U6RB 2VN3A 1E0OB 4LLMA 2IGTA 4TNFA 4JRXA 4OD3L 4X6CA 4DKTA 5DJZA 4ZUSA 2XWJA 3CDYA 1FCGA 5B38A 2NY0C 5SX5K 3EBHA 5ERWB 2DM2A 1WH0A 4AG4L 3VM7A 3O2DA 3K81A 3T3MB 2BXZA 5KYYA 3CZUB 5IM7A 2ZWNA 5BZWA 1XGZA 1R3HB 2VUOA 1XH2A 3MV9D 2NY2C 3RWCA 1A21A 4KH2A 2WBJD 2D03H 2YAPA 2WUBL 4A2MA 2VXQH 4NJAL 3U30B 3PF2A 3IDYB 4PV9A 4KI5D 1URIA 3DC0A 5T3ZL 1MIEH 4M6NL 2ADJB 1HIML 4DCQA 4F7MB 4KJWD 43CAA 4OQ1A 3VVVA 2OMWA 1I8IA 4GW4B 1UKTA 5K9KB 2WN2A 2EYTA 2OV0A 4JPVL 2JI2A 4P5TA 4Z3IA 3IJSA 5I6XB 4GINA 1S9YB 4WENB 4EE2A 3ZE1F 5DD3H 3FJTA 3L1OH 3C75A 1N6UA 5BRZD 4TM9A 2XIDA 1JVKA 2O6PA 5D7LE 3T1FB 1INDH 4XVTH 5AW2B 1MNUH 1RU9L 5BZXA 2J2ZB 2IDUA 1W8OA 4M5TA 3NN8A 1NBZA 1CGUA 3G7TA 1R1CA 4N9GB 5KN5A 2XVBA 1SXCA 5E2WL 4BFBD 5CWSB 1GZQB 3H7LA 1A3RH 4L9LA 1TVDA 1B6DA 2GW5A 3RDTD 4F8PA 3VQ2C 4NUQA 5J3HD 1CBVH 4QXTA 3D1MC 4OLYL 1JPGA 2D9QB 2WXKA 3QQDA 4UNUA 4ZAKC 4A7VA 2N7BA 3D33A 2IWEA 2VN4A 4WHTB 4X9YA 5DZJA 5B1JA 5T8IA 4YZWA 4HKJB 3GBLA 4R8WH 3O3BB 3QA3A 4IRZH 1BLNA 3H53A 1Q90A 3QFJE 1QPKA 5F7KC 3F5WA 1LE9A 3QXVA 1G6RL 1D5MA 1G7QB 1KCSH 1ZVSB 2XDHA 3WJJA 1QFUL 3GF8A 2KC0A 4IKNA 4Y1AD 5DVPA 1JNNH 4GRLA 1JGLL 1GZPB 3ESPA 3O0RL 2IH3A 4NQCD 2HRHA 5FPIA 4KK6C 5IZ7A 5HPMB 3RVVD 2F54A 4F20A 1ZLUK 3ALPA 1Q1JL 3CV5A 2BXYA 4UQAA 1YAZA 4LO9A 1TJIH 3ZKQD 4BSWA 3WLWC 5E1GA 3LKPB 5HGGS 4P2CG 3AUVA 1RH8A 1OB0A 1PS3A 4BQBA 3E8UL 1OCCB 4M1GH 3KS0H 4N2GA 4S1DC 5TE7H 4XHQA 4XPBH 3VXMB 1IGMH 1G87A 5IWLA 3NZHH 3FYEB 3LIUA 4PQXA 5I8CA 4DSYA 1M7UA 2WTOA 4Y5YA 5TPWH 1YN7A 3L3GA 1WT5C 5AKRA 3LPPA 1CDCA 1KN2L 4QJ3B 4YLCA 3EO1B 3MUJA 1K5WA 5FA3B 3BFWA 1F56A 1HSAA 1X4YA 2WQAA 2XN9B 3P69A 3ZDXB 3ECWA 5E5LA 5HHME 3OKLB 3QUYB 3VGEA 4KJQD 2CIKB 3N9GH 2XFGB 2GJ6B 4GBXD 5A2IH 1YAIA 4EXKA 1BW8A 3QEUB 1YZZA 4YSOA 4Z78A 1M3JA 3GMMB 5KUKA 1NCCL 1OGSA 3MLXL 4P9HH 3HB3D 3PWPD 3SOTA 3F3HA 3OMNB 4JEGB 2ADIA 4ONGH 2X4QB 2ZOTA 1MREH 2VMFA 3WDJA 2R0KH 4RFEB 2VL5B 3QRLA 4NO3A 3PQYD 4N2OA 1I7TA 3FAWA 3GBNH 2OBGA 3TCXA 2C4XA 3S2AA 3GSVB 4X9BA 4P48A 2B0SH 4OZHB 2WJ5A 4EBQH 5L7XL 5EIIB 5KS9B 4N2BA 4G8AC 1K8IA 4OZFG 4I1NB 1ACXA 3B1TA 3GZKA 1LK3L 1JGIA 5KSBE 5EF0A 4TNVF 3DX1A 4W9JC 4XBPA 3KYOB 3TZVA 5C8JB 2EC8A 1TZ8A 1U8HA 2ZX5A 4G8GE 3ZBMA 1GJUA 3R0MA 3ECBA 4Y4FC 4ZMXA 2HG5A 4TRPH 4KC3B 3TJPA 5D6DA 3P9LA 3EGSB 4AX3A 5BQ7B 3L4UA 5EA0H 3QUHA 1AACA 1KN4L 2ADYA 1A02N 5ISZD 2XV3A 2FT7A 5HVWA 4YBLB 3L4XA 1T6WA 4U0RB 3WG7B 4DOHE 3NA9L 1YN6A 4XH2A 4KHTL 1QSEB 1JK8B 3NJNA 1L9OA 3RVUC 4CBZA 1AQHA 1AIZA 3LRGA 3P4NA 2PCFB 4HIEB 4MA1B 1TZAA 1VCBC 1I3VA 1ESOA 5E03A 4A6YA 1JHTB 4L8CB 2EIEA 4J2XA 1RIHL 4NO5A 1JZIA 4KY2A 3QDJE 1W2KT 3UP1A 4JZJA 1XBDA 1U8LB 4NNYB 2DYSB 4PRNA 1OAUH 4HKXB 4ZO8A 1WRFA 1XGRB 1HHJA 3MBWB 4N2CA 1USZA 3TIEB 4AGQA 1XGPA 4XOCA 3U4EA 2OCFD 3U6XS 3RNKA 1FP5A 1EQWA 1VDGA 2YXMA 4WW1A 4XCNB 1MJJB 1DFXA 5CS7A 3AADB 1LM8V 2EEDA 1XTMA 3P73A 4LCWD 1I9RH 1YY9D 5DRZB 3BPNC 5DK0A 5FXCH 5ACLA 4ACTA 1JF1A 5DVKA 2PYEB 3KGSA 2HH0L 3RAJH 1BGXH 4DQOH 1DL7H 1GPOH 3RWIA 1XX9C 3T04D 1TIUA 4NSKA 1PZBA 2ZUYA 3FFCB 4PR5B 4LESA 3T0DA 5F89A 1U8MA 1U8JA 2DJ4A 1TKWA 4Q0XL 4F27A 3G6AB 3HG3A 1UH2A 1C08A 2FWSA 1XH1A 3CLFH 3ZYIA 1BQKA 1A6WH 4AQ8A 1NOLA 4HOXA 1FZJB 1KGCE 2Z35B 4N2AA 5F9OL 1SM3H 2R1YA 5ALCH 2PLTA 4LAQL 4NYLB 2Z64C 4MJ5B 4P05A 4XPFL 3UTOA 4TNGA 1Q0YL 2F19H 3HR5A 1ACCA 1UWGL 3CN4A 4Z8FL 3JTSB 1FL6A 1RULH 2BVUA 2H2SD 4ZUVA 2CM6A 2W8CA 3L9BA 2OR7A 4GKZB 4PS7A 3SDAC 2FLMA 4MAYB 1V05A 4P2RB 4BSJA 4XOAA 5EC2A 1RUKL 4I0PA 3Q2NA 1HSBB 4JPWH 2F61A 1KJVB 1JXDA 1GKOA 4W70A 2E7HA 4OUOA 2ZOLA 5T3ZE 4U2ZA 1YQVL 2EH7H 4ZG1A 1SMAA 2EAEA 3CBKB 1EHXA 1M6OB 5HGDB 5FUCE 5IG7B 1QLEL 2J8UA 2OCJA 2ZWSA 3AZUA 3FT4B 4P2QB 5JYLA 4YE0A 5CGBA 3GWJA 1LO5A 4H8WH 4UUJB 1KUMA 1HDMB 5JW5B 4HD5A 2N7SA 4PJHA 2JB6B 1S7XB 5KBLA 3Q5YA 4H40A 4O5LL 3Q43A 3BZ4A 2YD8A 1VFBB 2NTFA 2DWEB 4NDMA 3HG0A 3S9DB 1WUNT 2ZOOA 3QWNA 4KQ3L 1AGFB 4CVZA 4HEMA 2BM3A 1HILA 4HWBH 3EH5B 3L2LA 4FF9A 3CHPA 1USQA 1F58H 1BVLA 4G42A 5KEZA 3INUL 1FYHB 3BXNB 1R0AL 1JPEA 2W9DL 3CXDH 5DZOA 3NCJL 1G9MH 1SVBA 3FU7B 4JJ5B 5E95B 2WVTA 5LQBH 2EVIA 3FUEA 4GSRA 4QRRB 4B9JA 3H7BB 4X4ZA 2BJMH 2CBOA 1I9IH 4GFTB 4YXLL 1QRND 5E1HB 1DVXA 3IKKA 2R1WB 5HI4C 4HWEH 3NGBC 3MLZH 2W95A 3OL2A 4AEIH 1TNMA 2YAFA 5E8OA 2W07B 2JQAA 1E3ZA 3Q1SL 4PPTA 3I75A 3KJ6L 4JO1L 4P2OA 2EEFA 1RV6X 5E5UB 5FUZL 3NIFB 3DETC 1I3RB 5DJAA 5DQ9A 5TDNB 2JJTA 4N5ED 4YEFA 1IGTA 4FZ8L 2HSIA 2RFXB 3B9KA 3F04A 1OW0C 1GIGL 4QRUA 1KCRH 3QJQB 5B39B 1XCQB 3HPLA 2OJEB 5DDHB 5H2BA 2DJSA 5CEZD 4NUJA 4PB9L 4F8TA 3UTTB 3ASWA 2Y1ZA 3L5XH 2BP3A 3VI4E 5I1GH 3TO4B 4XPTL 5C0BD 5K1VA 1A7PH 1YC7A 4F58H 4M7JL 1CG9A 1MCPL 4IIQB 2KL6A 1A14H 1IQDB 4PJDA 1NEUA 1NLDH 3NSYA 4YXHL 4MJ6A 1CXLA 3VYPA 3FRPG 4EQ3A 4FAAB 2QQNL 3K3QA 1ASPA 5DC9B 3RL2B 3N85L 2OSYA 5I15L 5GRWA 4L3EA 5AW7B 2XZZA 5I71B 1OWWA 5MERB 1CL7L 2ZUWA 4JFDB 4NNXB 3ZGIA 4AKQA 2XNAA 5ILTL 1BZQK 5JIMA 4XPGL 3FCTB 4BEIA 2Z4QB 1G1YA 2IQ9L 4KTEH 3FOMB 5T5FL 5DC4B 1HHIB 3DROB 4P99A 3MRBA 2OULB 3U82B 2XBZA 5BS0A 3QZMA 3C8KB 3N06B 5EU5A 3QCUH 1LQSR 5G4OA 1BA9A 4HK3J 1EXHA 2HX9A 2GITA 2H2PC 2I27N 5F70A 2KQNA 5EV7A 5F7MC 3HZVB 1JTTA 4AYDC 4ANUA 1AO7A 4X5QA 4APQB 2VJ0A 2WKOF 5HJBA 1PIGA 1N59B 5DUPL 1F3RB 4X5LA 4IRJD 3UTSA 2JK5B 1ITCA 3D0LB 4HHWA 2YEQA 4X80H 3EYOB 4F91B 5D7IE 3WXWL 2VR4A 4KZCA 1FL3B 2VDOH 2BIOA 2L8AA 2EEXA 2EDFA 3DVNB 1HC1A 5DR5L 4JANB 3STLB 1SEQH 2JH2A 5CJQH 5E8EA 2AZUA 5JNYA 2FIKB 3REVB 2CDGA 1WAAF 4L5FE 2KYIA 5IBLD 3QQ9C 5TQ2H 3QJHA 1K9TA 5DD0L 5DJ6B 1HH6B 2DMGA 2VERN 2VLJD 2R4SH 3M8OL 1BECA 3AY2A 3SY0A 4AM0B 3OPZL 2EDLA 1C1EH 1E5AA 3KPPA 2VQ1B 1G0YR 3U48A 3D09A 5KJRH 4FQQA 3BE1H 4F7EB 3GSXB 3VXUD 1PPIA 2WWKO 4FHKA 1T1WB 4EJ1C 4PTUB 1GHFH 1A66A 2WWKT 4XXCA 3SGEI 3L1EA 3P2BA 3HR6A 1RZGA 4C56B 4FZEL 2C9RA 4XVSL 2OTPA 5A43C 2RH0A 3Q44A 2C3VB 3E2HC 2ID5A 2WAHA 3RTQD 2R1XB 1BG1A 4WCYL 2ZSWA 4WGVB 3F85A 4IKKA 1BQ5A 4JDZA 4N25A 4N4YB 2JLPA 3MA9L 3QDHA 4HAGA 4DUWA 1DN0A 1GW6A 4ENZA 5EEVA 3FO2A 5FM8A 4TTGA 5I2IB 4MJIE 5IW3A 4X98A 5CINH 4N6RB 2X4SB 1FF5A 3RUGE 1NC4A 3HHMA 3RPKA 3RX5A 4F80A 5ITBL 5AUMB 3GBDA 4NWTH 1PG7H 4YFLF 1HWHB 3R06A 4R96A 3CBRA 1JPSL 1MRCL 3CFDA 4FFWD 2NXZC 4LXFA 1RJCA 1T5KA 4ZPTB 3MREB 3MJ6A 5JHDA 3E3QC 5A6LA 2DI9A 1TEYA 5IVNA 3N43B 5EB9A 2X89A 3UBXA 2IFGA 3WIHH 5IR1A 1OAZH 4AQAB 2QZQA 4JE0A 2AQ3A 4FNTA 4U6YA 2XY2A 1WWCA 5CSZB 1HEZB 2GBUA 3B2VH 2I69A 4M5YL 4BQ9A 3HTLX 2IANE 3H42L 4UCFA 5K59F 5SWQB 3L7FA 4PJFF 2BX5A 3HN5A 4TUKH 2CIIB 2XXFA 5JOPD 1MHCA 2V3FA 4KGJA 3OB8A 1CU4L 2C7UB 1XD0A 2X4UB 3E9UA 3T0EB 4RMSA 4GYBA 4LHUD 4DPCX 3F2LA 3IJYA 3TNMB 1TMCB 2XWCA 4FP8H 5ANME 1F4YL 1JI2A 5HJ3A 3AROA 1U95A 3QDGE 5AW4B 1A3QA 3HNSL 3T8XA 35C8L 2C26A 3SCMC 3FONB 4N0FB 3OAZK 3LZOA 3V6ZA 1UFUA 4NCC2 3GXMA 3NDZE 1UCTA 4JRYB 1U3HA 2LU3A 1IC7L 3I50L 4DT2A 1U3YA 3LXAA 3ECUA 3GEWB 2O6FA 4G72B 2FHCA 1BQLH 5DGRA 4JCLA 5FUOL 1QTSA 3MACL 3NPZB 4MA3A 3STBA 3BVDB 1DCEA 1M56B 4UT6H 3X11B 3TNNB 1WZMA 4XMXA 9PCYA 3N41F 4MDIB 4YGVA 2H1PH 4X6EB 3ZUCA 4ORZC 4AYID 2FYVA 5IEKA 1DSFH 3K71B 3AC0A 4PTTA 3V5KB 3JWOL 2CWRA 3FT0A 2YUXA 4N2LA 3VRLE 5F88B 1WBYA 4Q14A 3KPNB 4W6XB 1FVCA 4M3JA 1XQ4A 1P4IL 5E00B 3W9DA 4X6BB 3C5JB 2HVBA 3IJ8A 2R69A 3IT8D 1XIWC 3N1MC 4OKDA 2FD6H 1AXIB 3D48R 1KB5H 3FUHA 4AUJA 2Q7YA 4BKTC 3JT2A 2C34A 5CEXB 1MELA 3V4PH 2HN7B 3QUGA 5C0AD 2NTSP 3MXVH 3QG6B 1HHGA 1J5DA 3D18A 2D03L 3RY5A 3BOVA 3KPSA 2Y36H 5CEYA 2OXHA 4XNZB 3VA6A 2VXQL 2ZKHH 3QZBA 3SQBA 1T21B 4YC2C 1H3GA 1E67A 1GYCA 5HD8C 1EIBA 3OJDA 3R4DA 1MIEL 4PY8I 4HLZG 4LEXH 3NTCH 5GGTH 3D85A 4L37B 3MNZA 4IQHA 2H26B 4JUSA 3C09C 2Q3AA 3U2SA 3X14A 3B34A 1THAA 3SE3A 4XPHH 3TVMC 3DA0A 4J1UB 4PEEA 4CDHA 5DD3L 3L1OL 5GS3A 4LU5H 4F7PB 1FVDB 4K55A 1SHWA 4MNQD 2JQZA 4NRXB 3CWGA 1INDL 5ENWB 2K3TA 1YNLH 4XVTL 1MNUL 1JYXA 1YMHB 3NIGF 1N2RB 2C4FT 4AJWA 1LWHA 1ZWIA 3GKWH 4PW9A 4YZFF 4EMZA 1JF5A 1KEMH 2VZOA 4K5PA 1W72B 3HI1B 1MW2A 3N6YA 3NQKA 4WFHE 4WU7A 3TJEH 1HL4A 1A7BA 4O02H 4A6YH 3L5HA 4W6YB 3QC6X 1KLGB 5C08A 4HKZB 4WO0A 1A3RL 4H20H 4LVNC 1CBVL 3UZEA 1MUJA 4DERA 3BPLC 4UZSA 3MX0B 4UMSA 3EHBB 5E6SB 2FL5B 3MRCA 3DDGA 4R8WL 1FI8C 4IRZL 4CA4A 2W80C 3C60B 4KH9A 3UAJC 3G3LA 3KAAA 1KCSL 1HQ4B 2FR4A 3M1BA 1ILUA 1OGAA 3UPRB 1JNNL 2LFEA 4WJ5B 1P6WA 5I1AB 3H9SA 1QW8A 4PJ5D 1MCWW 2CLRB 3SPGA 5AAWA 2E4TA 2VW6A 5TK4A 5L2JA 4J3BA 3PL6B 3W56A 3GJEA 4ADGA 1KIRA 1BHGA 4PV1C 4YL9A 4FI7A 4JW3A 1S4IA 1TJIL 3BPNB 4GS7C 2HJFB 3I3EA 5GIRA 1S7TA 1IE5A 1F4XH 1P69B 1SF3A 5LB1A 4TVPH 5GS2D 2ZXBA 2P5WD 4DEPC 5SV4A 4M1GL 5HVFB 2AITA 2XY1A 4ZMPA 3BIAX 4EI6B 3PHQA 3RU8H 1IGML 1YSOA 3UX9B 4D3CH 3ROOB 3D4YA 3NZHL 4EVNA 1G0XA 5TPWL 4DWHA 3ZDWA 1IAMA 4MZ2A 1FH5H 2G30A 3PGCB 1AS7A 1T66D 4OGQC 4UQ9A 2BSDA 4N2EA 4B6ZA 3P9MB 1FNGA 3ES6B 3SD5A 1N9PA 3C5ZA 3NA4A 2XVGA 1O6VA 1ZXQA 3N9GL 3OMAB 1NBYB 1WVZA 1YLBB 4GRLD 4TL4A 5JO5A 3LZQA 3B8YA 4YK4C 1N10A 4EN3D 1G7JA 4P9HL 2F54D 3HZYB 3T3PB 2YFNA 2WKOA 4Z7QE 1BFOA 3EW3B 5IHUH 3S4SG 4Z77B 2ED7A 1MREL 2EDTA 2R0KL 4ZZFA 1BIHA 4JJOA 3S5ZA 1F02I 2OFQA 3NYKA 3F7VB 3GBNL 3IETB 3OKMB 5DJ2A 3FXIC 4R0LB 4G80B 1SHSA 4ZODA 4DO6A 2B0SL 4N2DA 4B0MB 3RX7A 4EBQL 4BFEA 1JWUA 1CE6A 1GY1A 4GAGH 1JHLH 2GT9B 1SYVA 4JZNA 3HAEG 3ZTCC 2ZTBA 4FTVD 4KJYB 4QCIB 2J8OA 4FN0A 3H9YA 1WAAA 2FO8A 2A6IB 2VL4A 1U2CA 2XTJD 1B2WH 1WUZA 4M61B 2BC4A 4KKCD 5IQMA 2AMUA 5KBNC 4ACPA 1PZ5A 3W9EA 4Y7MA 1DO5A 3TJHD 1C8QA 3BLPX 5BV7C 4TRPL 3IJHB 3NCCB 2BIHA 1JSYA 2XKSA 3NCYS 4JQXC 3A4EA 4NOFA 4EF3A 1X5FA 3TCLA 3KYNA 3LKNA 4RAVA 3IGLA 3PJLA 3QORC 5EA0L 4YH6A 4BBWA 1ZS8A 4PJ8B 3FDWA 3VACA 3IS0X 4HFWA 2VJXA 1ILSA 2P48B 3E8VA 2FJSA 5FM5M 4Z76B 5FCSH 1P4UA 3SE4C 4RSYA 1TG8A 2ZG1A 3QB7C 3QZOA 2WN3A 3VD3A 5CKAA 2B9AA 1L0QA 4YFLI 5CP7A 5BZDA 3GDCA 1Q9WB 2J57A 2FQEA 3QEHB 1Z5LB 3FRPB 3KMDA 4I2XB 2WLLB 1WCQA 1T7WA 1C7TA 4MZ3A 3LN5A 1HK6A 2FZ3A 1OAUL 3ESMA 3D4GA 4X4YB 1XF2B 4IM8A 2HJKB 1RJLB 1LMKA 3GSUA 1I1FA 1UVQB 4CN6A 3HE7B 3IJ9A 4ZUUB 4JFEE 3MMEB 4X50A 5GSRA 1G6RB 1I9RL 1V3MA 5CCHE 4YNYA 1XF5A 2CRZA 3HKZA 4DQOL 3FZUC 1BGXL 4N2MA 1AGCB 1DL7L 1GPOL 4MJHA 5DZ9A 3RAJL 2ZXDA 5GSVA 3X1FA 1AQMA 1PIFA 3MRLB 3UROR 3AVEA 1MCQA 3OG4B 2F74B 2VR9A 4FULA 3AWEA 4PJFA 1A5FH 3RPIA 5CD5D 4JFWA 3GT6A 4DKEH 4ENEC 1XZ0A 2DV6A 2PO6B 3CLFL 5ISZE 3SYPA 4N90D 1A6WL 1KB9K 1DJIA 4O2CB 4U4BA 2XSKA 2IG2H 2W1NA 4RRPA 1WBXA 2WQVA 1U8IB 2ED9A 1SM3L 1WFMA 5ALCL 3C8DA 2GQHA 2F19L 4JFPA 3ARED 3W0WB 1JUFA 4FTDA 4IBSA 4MMZC 1W8NA 1RULL 3K91A 1SQ2N 5KOMC 1JNJA 4M1CC 4KXBA 1WWWX 5DZPA 4X7CC 3TFKD 4P23A 4AXWB 1YJDH 3I02B 4PRAA 1EHLH 2WVVA 3WO4C 5ETUB 2ZIDA 3VJ6A 4O2FB 4JPWL 2IEPA 4UT9H 5HHOA 5A2FA 3FQRA 2DYPD 3P77B 2EH7L 3KE0A 3DXAD 3ORJA 4FQLH 4RBPK 5HJDA 4B9IA 3ISYA 2DAVA 2EJ1A 1FNAA 3TV8A 2BWDA 2A73A 2PYFA 5MI0C 4P57B 2D4FA 4H8WL 2JFCA 3OAUH 4OD2B 1GYUA 4KNTA 4GP5B 1KELH 2CO7B 4Z5RB 3VFUB 4DNLA 5I1LB 1FNEA 4I4WB 5IUSA 2VITA 3MFFB 1MCKA 3C6SA 3ARFA 2TRYA 1GS7A 1FC1A 4HWBL 4S2SB 4QRPE 2E3VA 1KY6A 4JM2C 4YFDB 1CC3A 1F58L 5FYJE 2XC8A 1PG7W 2VMCA 4U4IA 3NFSH 3PP4H 2X4PB 3T65A 5ICXB 4LCVA 3CXDL 5EBMA 2CK0H 1A9BB 3NABH 4XMLH 1G9ML 5LQBL 3WUWG 1KJMA 2MIZA 2BJML 2JKXA 1I9IL 3T4YB 3NK3A 3X1NA 4UOZA 2VXVH 2O1AA 4IBUA 4HWEL 1XXDC 4IBQA 2Q76B 3MLZL 4MNGB 1VGKA 2DKMA 4AEIL 1H5BA 1OIOA 3B3IA 3GMRA 3DURB 2IF7A 5H4YA 1CFSA 2ZUQC 1ZEAH 5IJVA 1QW9A 1NAMB 1OPOA 1QO3B 4MXWH 4Y5XB 4Y2DC 1AS6A 3WDHA 2VSMB 4Y19B 2CPUA 1QR1B 1KCRL 4L48A 4H7VA 4RAUA 2DMBA 4Z7NF 2C3XA 4M6AA 3PDDA 4K23H 4XNMA 3QPQD 2VZ3A 3L5XL 5F1IA 5I1GL 4YAQA 1AQKH 2NZ9D 3G9VA 3MLTA 3VWJC 4UDTA 1A7PL 2KERA 3ULVC 4M8QB 1NMBH 4HJUA 1A14L 3KPRE 1NLDL 4LFHD 4GMTH 3U1SH 5KG9B 4GT7A 2IXQA 2UWEF 4NBYB 4JRLA 4YDIH 2QT6A 1QUNA 3LKQB 2DOCA 3IFNH 3RGVB 1VADA 1I75A 1CFVH 4Z23A 2R59A 1T2JA 2YOAA 4C8XA 2OS7A 4KTEL 1QRNE 5MHSE 5IB2B 2HT3C 1YNTB 1IGCH 3ERXA 3FPXA 2ICEB 2E9JA 2UX7A 4A2EA 1P5UC 4OLVH 5E56A 1UZGA 3QCUL 2AVFA 4RGND 5BJTB 3B9KD 2YSTA 3MV8A 3X1EA 3CFUA 1EBPA 1FZMA 3V95A 4JY4A 1H9VA 4PJCB 5CILH 1M53A 3FF7A 5JHLH 1LO3H 4POUB 4TTDC 5CEZE 1IAII 1LK2B 2Z91A 3VGFA 5IESH 4AYEC 2MQGA 5AW9B 3JWNH 1QPXA 2WXNA 4NO0B 3RFRA 5I0XA 4X80L 5JORA 5FGCE 5KVMC 1UC6A 3NEOA 1JK9B 1DZ0A 4OB5H 4PW4A 5C0BE 3UZVB 5ID0B 4P2YA 2VDOL 4YIQA 2R69H 4P9HC 4XCYA 5JPNC 2CKBA 5DUMH 3DX6B 4AV0A 1GJWA 1SEQL 5CJQL 3VD7A 4ZZKA 2BOCB 2K7QA 1G1CA 1XWVA 1YDPB 1OOWA 1YPZF 2CHZA 3FTWA 4IU2A 3U46A 3TURA 4UM9A 3QUXB 2NUTB 4KHXH 3BZEB 2C5DC 2VM3A 2EIMB 2R4SL 3KH3A 1QLEB 4PS8A 1LWJA 1C1EL 1CQYA 5BS0D 1UZ6E 3UOAB 5KJRL 3BE1L 1UH4A 4JKPH 2G5UA 2ENJA 4WUKH 4N0UE 3GLEA 3T09A 3EJZD 1FSKC 1GHFL 4X5XB 5CBEB 3LHPH 1A4KA 1HESA 4GAJH 3QT2A 3GSRB 3GSWA 3VO0A 4DVBB 4A04A 5C0ND 3CIQA 2I07A 3TBYB 1WD8A 1JZ3A 4A7TA 2ZG3A 3UTSD 4NEHB 3BP6B 5BRQA 3VD9A 4K8RD 2XZQH 3MVSA 4WZ9A 3RBSA 3TT3H 4WWKD 3WAJA 2BVOB 2NR6A 3FTGA 4NKIH 5CINL 2XQBH 2CK2A 4F2ME 3OKKA 3G5XB 3N40P 1D2PA 4D8OA 7PAZA 1KCBA 3C09B 4NWTL 3KDPB 3UDWA 3ML9A 2OJ1A 2C9QA 2YLKA 3TVMB 1VSCA 2E7DA 3NSXA 5TDOA 2AEIT 3LN4B 3QUZA 6TAAA 2CGZA 2HTLD 3VXRA 3WDIA 2IBBA 2X38A 3FQNB 3ESNA 4J8RA 1TU2A 2N7AA 4MBRA 2RJMA 1OAZL 3WIHL 3PGDB 2M1KA 2Y2WA 1T83C 1OTSC 3PAYA 4P5KB 4WNJA 4I8DA 1NJ9B 3FKUS 3B2VL 1Z9PA 1DJZA 3AXLA 5F1KC 1CN4A 2Y3AA 4PJGE 3VXUE 3FU8A 3KXFE 1Z7JA 4R4NC 1S7RA 5D9SB 3VI3A 4TUKL 4NXKA 1Q0XH 4K3GA 4I77H 4BHUA 3UFIA 5DZAA 3T1WA 3HLAB 4PGBB 1PQZA 5D72H 4OZIB 2YPLD 5D5MB 3H2PA 3CN0A 5EU3B 1GGUA 5F97E 4FP8L 4HCIA 5D2LE 4FLHA 5IV2B 3EFOB 5DS8B 4AC2A 1BD2E 2MCAA 1UWYA 3ZRFC 2NOYA 3K5RA 5C07D 1I7UB 1SOSA 5D7JA 3WN5C 2NXYD 3K2KA 3U7YH 4M56A 4AZ8B 5T1KB 1SYSB 3VXPB 1IM3B 2X3BA 4WUUA 4BGLA 3FBKA 5JHDD 2FH8A 4HMCA 3FQXB 4RA0C 3T9WA 3PYCA 1KGIA 3C5SA 1BQLL 2X89D 4FYTA 1A6TA 3RX8A 2GAZB 3DPBB 3ZDZB 5L2KB 4POZD 2ENSA 4H2AA 1H3UA 3HC2A 3OSKA 4UT6L 5EC1B 1VIWA 3L45A 1F13A 5C9KA 1HYSD 1LILA 1Z32X 1E4XH 5FHBH 4Q9QH 2BCMA 4PS3A 1DSFL 2DQTH 3FB5A 4GS7B 2OQJA 4JFZH 4P46B 1BOYA 4YHPB 2MTPA 3VXSE 3WO3B 1NANH 4X5RA 3ROLB 5B22A 1TJGH 3EADA 5EOTA 5GQBA 4GRWH 1HFUA 5EUOF 5MEND 4L29A 3HMXH 3UP6A 5CMAB 3V0AC 1PX3A 4CVUA 1EAPA 1LNUB 3T6WA 2EEAA 2QSQA 3NRPA 4FERA 3S4SB 1NKOA 2X6CA 4LHQB 2FD6L 3V55A 5DJDB 4LQFH 1KB5L 3V5HB 2Y7QB 2ZAHA 3ZKXC 4JM4H 2FH6A 4KXCA 4LBAA 2IFFH 2WYTA 3V4PL 3A6BH 3D4ZA 3MXVL 3O3DB 4NXSA 3HAEB 4EKXA 5J89A 4Z7OE 2Y36L 2J3SA 5CEXA 5C0EA 2R2BB 5IK3A 2V7NB 2ZKHL 3CZKA 5JQIB 2RIKA 2ZXEB 1IM9B 4L8BA 5TE6H 4LSPH 2ENPA 2YJQA 2Q6WA 5E5MB 1TTAA 1G9MC 3NTCL 4LEXL 5GGTL 1L9SA 1NM4A 1HHHA 4OCYH 1KCVH 3P02A 4F24A 2BY0A 3ECQA 1X5ZA 4XPHL 3RA7H 4G59C 2R0LH 1J9QA 4PGCA 4Z7UF 4MYPA 4ZO6A 5ESVB 3IDIA 1P7BA 5B3SB 1RJYA 4LU5L 1BPLB 5EU6A 3ZUNC 1N3NB 3B7RL 3U0TA 5MP6H 2ZWKA 4EI5B 2L04A 3LNDA 1YNLL 3CCHB 3ISWA 5HDBF 1DTUA 4LLYA 4G1MB 4NN7C 3GKWL 4OGAC 4WI8A 3D08A 4FG0A 2Z6FA 5I8EB 1KEML 1ZKAA 2VLLB 1TQBC 4LPCA 5BV7B 3I6GB 2QHRH 3TJEL 3KPMA 3WD5H 4O02L 4A6YL 2R51A 4NO2A 2EKSB 3G5YA 3HBPA 3HZMB 4QAMB 4ZUWA 4E0RB 3EOBB 2Q10A 5DJCA 3CUPA 4H20L 2HVJB 4YDJA 5JLZA 2AERT 5JIHA 1UH3A 4NQDB 1G7HA 4MS8D 2F08A 5EHFA 3GTTA 8CGTA 4NLAA 3U7AA 2AF2A 3V0WH 2H32B 1NFDB 2XI9A 3ENEA 3FO1B 4J4PA 3TWYA 3HPJA 3ZSTA 1U3NA 1U33A 3VXOB 4NENA 3IE9A 1JWSB 3OR6A 1NMCB 4IGBC 4PJ7A 4QRQB 1MEXH 4PLKD 5HVHC 1KCKA 3FO0L 2C1PA 4WGWB 3N1PC 3W5MA 3EJYC 1RUMH 1PU0A 2LGNA 1ZT1B 3SDDC 2AKRA 3O45B 4N3TA 4D9RE 4YHMH 4JRXE 1ITBB 4X6CE 3ZDXF 3OKDB 3BI9X 2DQHH 1MLBB 1I8LC 3GKZA 3WSQH 2H9GA 4JAMB 4IOIA 1F4XL 5DQJB 2HG0A 1TJHH 4TVPL 5E9NA 15C8H 2UWEA 1HWGB 1S7SB 5C08D 1UXWB 1P7QA 2NNXA 2P5EB 1SFHA 4H8HA 1NGXA 4P49A 4K7FB 4RMTA 4UTBA 5HGBA 3RU8L 5ESQB 5IF0A 3LRSA 4C47A 1L9RA 3I9IA 2OSWA 4OGZA 4FNRA 4LOFA 1GC1H 5AOZA 4AV5A 1Z3GH 1QI4A 3O4LD 1HX0A 5KVDH 1WHPA 5FYKU 1FH5L 3LAFA 4YDLC 3S97C 2NCEA 3LVTA 1TQCB 4UAOC 3KBHE 4GLRI 3DV4A 4U1KB 1OGAD 4Y4HA 3VX0A 3EBIA 3ARVA 4MMZB 4HH9B 5FGRA 1XCTA 3ZYOA 4D8PB 1LEGA 3H9SD 4PGDA 1D7FA 3DYPA 1OP5H 2X05A 4YMPA 2VABA 2OPCA 1C5BH 2VDRB 4ZOAA 4PLJD 5DYOB 3TN0B 1SPDA 3QQ3A 4ZNCD 3AQXA 5IHUL 2EO7A 5KSUB 3TA3D 4A2FA 1HOCB 1S2EA 5INCB 4HEPA 1ZHLA 3GIVB 2I9LA 4QO1A 4QT5B 1JFHA 1PJ9A 1I1AA 3HRZC 5E4AA 1ZSHA 2Z1KA 5KSAA 1CIUA 4YX2H 5MI0B 4M62H 5AALA 1OD9A 2C4FU 4GAGL 1JHLL 5A1AA 2D0GA 2ZOWA 5CR8A 5TE4H 1Z9SB 1YPZA 2F1AA 2CJTA 2P47B 1B2WL 2B1HH 3ILDA 3V0EA 3OKEA 3OPUA 5I75C 3BUPA 1QLFA 3FAXA 5D1XB 1KXTA 2UY7B 3QZWG 4N0YH 3CHXA 1XV8A 3II3A 1KIPB 4ZAKD 1AD9B 1JRHH 2R23B 1RCYA 2LV4A 2F1BA 4OF7A 4X9IA 4JM2B 3PGFH 1I85A 2HZHA 1QVOA 4KKRA 4N2KA 1AQ8A 2WZ5A 3NIDE 4L4VE 4HV8A 4HIJB 3GPEA 5F1NB 2W0LA 4CW1B 5AAPA 2F54E 3U2IA 4JFYB 3KYMB 1IJ9A 3EIFA 2YBRB 1UACH 4ILDA 4KK6D 1S9XB 3L81A 3O3EA 5C9JA 4E68A 1K4CB 3GPSA 2ZUQB 1C12A 1S7UB 3US1A 4PSRA 4Y2DB 1RP8A 1AFVH 3RGHA 3CZLA 4K94H 5GRVK 5MEOB 3QJVB 1RQ5A 1EEYA 3F7YA 4G7RB 5C71A 1UKSA 1RIUH 4OCNC 2XTJE 3ULUE 3FCSB 2DLEA 2EKJA 3SZ6A 4LL4A 5HHQB 4S1QH 4GRMA 4W68A 2AC0A 4GQPH 3VWJB 1OE3A 4XP5H 5D7SL 5EH1A 3ZK0A 3TWCH 5DS2A 1T22A 2D73A 2PCPA 2QKIC 5E9DB 5FGBA 1SJEB 5HHPB 1A5FL 1T04A 1J5HA 2CJ3A 2A1WH 2A74B 4BJLA 4DKEL 1J8HB 4RGOH 1YMMB 3CZFA 4MMYB 1MI5B 4W9FC 5HTSA 2IG2L 2G9HA 3CVCA 4FCHA 2F8OA 4Z7VF 5DHVA 3ZKNC 4D9LH 3KPLB 4LSQH 2HP4A 2RGSA 3QNFA 4XE0A 1KFGA 3VDAA 1QFWH 2AGJH 2CD0A 4HUCA 3CH1A 4HSCX 1P5UB 4G43B 4WAFA 3FN3A 3SKNB 1CIDA 1YJDL 4MCMA 2FAUA 4JKWA 3TBTA 1EHLL 1ES0A 2WLZA 2CKBH 2OMYA 3BQUD 5T1LA 3JZYA 3U6RA 4UT9L 3BEWB 5CZVH 2ATPB 1E5YA 2VLMD 1L9MA 2B1OA 1T1XB 2IH1B 3AG1B 5F2FA 3ZJAA 1MRFH 3MJWA 3JSSA 4FQLL 5ERWA 4ECNA 3NH7H 2OKMA 1E90A 5AW1B 3HC4H 4F15C 1NA8A 1JXJA 2V5RA 2RQ8A 3L1FA 2CHWA 3D30A 3N44B 4DGIH 1R3HA 4HJ1A 4RAHA 5JPNB 3OAUL 5A16B 4HC1A 1NCIA 4UDUB 3HFMH 4OFVA 1KELL 5SWZB 3KLHC 4DKFH 5J7CC 4Y2OB 2BNRB 3L5JA 4CSPA 4N90E 3RL1B 1G84A 2ADJA 3NIFF 4F7MA 3WNOA 4UNIA 4GW4A 2Q2LA 5K9KA 2Q1EA 5BQDA 2WLMA 2WXHA 3GSOB 1F90H 1CJYA 1WA0X 2CHDA 1D7BA 4K3DH 5DHDA 3NFSL 3PP4L 1S9YA 4P23D 1AZUA 3ARBB 4LSSH 5SWSB 3EJJX 1XBRA 1RZPA 2CK0L 3NABL 4XMLL 1FSKB 4MLIA 2P26A 3T1FA 1EGJH 1PZCA 1RFDH 2GUYA 3L3IB 2VXVL 5LN8A 4F9PA 3CC1A 4FNUA 3OVUB 5BOPA 3PAZA 2CLVB 3CU1A 3ILQD 3RIFK 1PLGH 1F3DH 5K1NA 5BO0D 4PHXA 4N9GA 1ZVYA 3AY4A 1ZEAL 1O5PA 1JHKH 3HE6B 4P4RB 1A1MB 4MXWL 1PW3A 5CWSA 1GZQA 2GC7C 1FCCA 3RIAK 3W3BA 3QUMH 3JVGA 4PS4H 2VLRB 1IBHA 4JMXA 4J3OH 3ZDYF 1L6XA 5JW4R 2XQYK 2HMIC 1A6UH 3BPOB 4HKJA 4K23L 5A7BA 3QS2A 4HJGB 4YE4H 4XT1C 4FE9A 3ARFD 1AQKL 4MMXA 2W92A 1S7WB 1G7QA 2VMJA 1A4JB 5EFIB 3WNLA 1NMBL 1ZVSA 3ARGC 4ERSH 4TVPE 4GMTL 3U1SL 1PBYA 2W5PA 2AABH 4YDIL 1NEZB 2IWGA 1PDKB 5FWQA 3K72B 1TVHA 3ZE0B 5CAYB 3IFNL 5T3XH 1GZPA 5HPMA 3IAPA 4XO5A 1CFVL 2IMMA 3N1FC 5JOFA 4LBEB 1MRDH 4Y88A 4NQXB 1F00I 2D0FA 2A77H 2WXOA 3GNMH 1IGCL 3BUBA 2YMXH 3BAKA 5ECJE 4NFBA 2HT4C 3LKPA 4OLVL 3KHOA 3D0VB 5KTEH 3E6HA 3K2UH 5HVGB 2J8UE 2EIJB 3F64A 4JG0H 1HT6A 1R5WB 3DBXB 5FUCC 3VXMA 3L95B 3RRQA 4PJHE 3WN5B 4MHHG 3IMTA 2G0KA 5CILL 4GAYB 5FYKD 5CLYA 2HUEA 1NC2D 3IF1B 5JHLL 1OO2A 3G6JF 1LO3L 1TTRA 2XT1B 2BSRB 4P3CH 1ETZB 4MQTB 5IESL 1IFRA 3V6OA 1FLRH 4P04A 2KHAA 4I5BB 5FA3A 4OB5L 2JKSA 4LT7A 2YQBA 2XN9A 4E9LA 1ANUA 3PXHA 3TTYA 3WEXB 3OKLA 3QO0B 2CCLA 1I3UA 2R69L 2CIKA 2F53D 3K6DA 2GJ6A 1H3XA 5DUML 3VWKD 3QEUA 2WZAA 2D2CC 3GMMA 1J0KA 4RZKA 4BGDA 2KT6A 1QASA 2QMKA 3HNTH 3KPQB 1FHGA 4KK5D 2XIBA 1DBBH 4I18B 5C7XH 3REWB 2EICA 4KHXL 4NJ9H 3S8GB 2CDFB 2X4QA 4N8UA 1YHPA 2VL5A 4RFEA 2ENYA 1GA2A 4GG6B 3BVTA 4AITA 3MRKB 4JKPL 3F7LA 1VFAA 4QTFA 5INDB 2DY2A 3GSVA 4WUKL 5J13C 4GNKB 4OZHA 1QMUA 3MV8D 5EIIA 5KS9A 4YDKH 1BJ1H 3LHPL 3TLRA 5L88H 2FTAA 1A6ZB 4GAJL 4JR9H 4QHKJ 4M7LH 3ZKXB 3NOIA 2V9TA 4MB5A 1R3JB 1M1XB 3N43F 3KYOA 1F45A 4H8VA 4DPAX 3ZE1E 3IRCA 1ETA1 1PKQB 5HI5D 4TKWA 4UTAH 2XZQL 2FWOA 2JKIS 1TEGA 5JIIA 2B3RA 3TT3L 3SKMB 1G9NC 2COVD 1A6PA 5CHNB 3EGSA 5F72S 4A38A 5AB9A 1PG7X 4NKIL 5BQ7A 2XQBL 4PJDE 3S37X 5GGVY 1RUPH 1KYDA 3PDOB 5ELIA 3IAQA 4WWNA 4G8FB 4IBYA 3MV7B 4M02A 3WEAA 1UXMA 1MFVA 2CZNA 4L3EE 3V4VL 3GIZH 4UM9D 1U4FA 1MCRA 3QZLA 4KV5E 5EU4B 5EEUA 1QSEA 1JK8A 2GJZB 3S5LB 2PCFA 4HIEA 4ZMWA 5E6UB 4L8CA 1T7VA 1JHTA 2BNQB 3NJVA 5CCJA 2G60H 4U3SB 5DHMC 4M43H 5BS0E 4K5OA 2GC4C 1J8KA 3N42F 1U8LA 3GZQA 4FQHA 1WA1X 4NNYA 1TQBB 4HKXA 1RZIB 1MZZA 3CG8A 1Q0XL 4NN6C 1XGRA 4I77L 3TIEA 4KPHH 1WK0A 4H25A 3ARDA 1AO7E 4TXVB 4PV8B 4XCNA 4KMQA 1MJJA 4WKXA 5D72L 5FM5O 2AJZB 3D2UB 3NK4A 4OV5A 3I3DA 5I9QB 2OZ4H 4HT1H 3UTSE 4MQXC 5KBKA 2FSDA 2F9BT 3EDJA 3HJ0A 1IFHH 2WNXA 2BVYA 1IV8A 1HS6A 3ZRCC 1KTKE 1SMOA 3QI9D 5KANG 3U7YL 1Z2KA 3S3JA 4ZFGH 5AYUH 1JZ5A 3K8LA 4A7GF 1OTUC 3UC2A 5KVEH 2C3HA 1YEJH 4XVUD 4WI2A 1QYGH 1FZJA 2Z35A 1KG0B 2B4CH 4IGBB 2OMBA 2XCMC 3VXRD 5HVHB 4NYLA 2PWFA 3HA0A 3QXUA 4MJ5A 2B5IB 3FCUB 3MOAH 3WNKA 4CBPA 4NQED 3SDDB 4X0NA 5IGXH 2NQ3A 3JTSA 3KCWA 4HGWB 4O2EB 5J9PB 3WTWA 3ABZA 4GKZA 3P0GB 4E41B 2WWMD 1E4XL 4MAYA 5FHBL 4Q9QL 1F18A 2J5LC 1ZPUA 2ESVD 4ABUA 4JFZL 4FRWA 1GS6X 1INQB 4TF4A 4NERA 3M1OA 1OY3B 1X9LA 1HSBA 5DHEA 1B6UA 1CD1B 1M2OA 1EPFA 1TJGL 5EO1B 1G7IB 1CB4A 3HMXL 5C0CB 4UB0H 3MI6A 2X7LB 2OK0H 4FQXC 2VDOB 5HGDA 4Z7VA 5IG7A 2A5UA 3ABGA 4AVJA 5GS0C 4U1NB 1W0VB 1WZKA 4LQFL 3FT4A 4P2QA 4JFHE 1RLWA 2Q7NA 4JM4L 4UUJA 2EO1A 1HDMA 1LP9B 2IFFL 3MU3A 4OR1A 1XGYH 1DSWA 4UAOB 2JB6A 1S7XA 1HHKA 1URLA 1YECH 3A6BL 3DHMA 4WLCA 4G7QB 3MRNB 5DF0A 2AAAA 3APDA 1VFBA 2DWEA 2DKSA 4NOBA 1DBJH 4HUKB 5K93A 5JHDE 1Z5YD 3E38A 2BS71 2JELH 1AGFA 4NZDA 4LVOB 5TE6L 1DLFH 1MCWM 4ODTH 1WS7A 4NAQA 3MBEC 3LRLA 1QSFE 4YHIA 1ZXKA 4J3WA 3X3GH 1PNCA 3POCA 3T08A 1A0QH 4F8QA 3QJSB 3I3BA 3BXNA 3DKHA 4OCYL 5C0RH 1KCVL 1OSEA 5FV2A 3RA7L 3VD1A 3HRZB 4JJ5A 2R0LL 2O5ZH 2WVSA 4MWFB 3KYKH 3H7BA 1O9VA 4PRIE 4N1CA 1DBMH 1DQMH 3PHAA 5MP6L 4DZ8B 5ICZB 4ZNEA 1TYJA 2YD7A 3T0XA 1I3RA 5TDNA 3Q2CA 2FGZA 4GKNB 5JW4N 1TQSA 2B14A 4TSCH 1LYQA 4GKSA 2QHRL 4J2QA 4B7IA 4BH7B 3WD5L 4TVSa 4WEMB 2V8LA 3N55A 5B39A 4K3EH 2WXRA 1ETB1 2OL3H 5IJCC 4WIQA 5DDHA 3ET9F 4OVVA 3UTTA 4L3CB 3OZKA 1XL4A 4H88H 2ICWJ 4FNSA 2IAMB 4BA0A 1IQDA 1H8NA 3KEHA 4U1IA 1PZSA 5CBAB 2WQSA 3DX8B 1ZIAA 3GK8H 4JDVB 3V0WL 1EXGA 2MTAA 1KGWA 5EG6C 1JJUA 1AQDB 3UYRH 2LT9A 4R2GB 5MERA 4JFDA 4NNXA 1Z9MA 3SGJA 3FCTA 1MEXL 2Z4QA 4A7QA 3NESA 1R9FA 1RUML 3FOMA 1HHIA 2IDCA 3DROA 4HSAC 1WFTA 2I7SA 4YHML 3GJFH 1CFQB 2P28B 1SJHB 2DQHL 4P4KC 3WSQL 4JGMA 1T2XA 2MSPA 1J05B 4FHJA 4MAUL 3HZVA 1E9QB 3U4BH 1TJHL 15C8L 3IDGB 3N2JA 4YSSA 3RIFF 1IBYA 3DK2A 1WE5A 2QKIB 4OGYH 3T3PF 4AI7A 4APQA 2YN5A 4UQ3B 1VENA 1N59A 3WXVH 4N1EA 5C2UB 2VN5A 1WISA 2HLEB 1N64H 2B77A 3D0LA 3KPSE 3UTZB 1GC1L 1Z3GL 3RIAF 5F21B 1QOKA 3FCGA 5KVDL 1AC0A 2E9BA 3L13A 5EOCJ 3DVNA 5EUKA 3X3FH 2NT0A 5E4EC 4JANA 3STLA 4U2YA 3OM3B 4EDWH 1QUPA 3OXRB 4JLRA 4LMQE 3RHWK 2FIKA 5HY9A 2FT6A 3TYFB 3QW9A 4A2HA 5DLLA 5LAPA 3A23A 1C5BL 5DJ6A 4ZS7H 1HH6A 2IC2A 2NNCA 2QVIA 5DVMA 4MB3A 4AM0A 3OMIB 3G6JA 4ZXBC 3P3TA 4CRPA 1L6ZA 5LN4A 3DGGA 3O9WC 1KB5B 2VQ1A 3D3VB 3FQTB 1A8JH 4I48B 3UAFA 4F7CB 4F7EA 4DTGH 4GQ9H 1UCBH 1U41A 5EZJB 1NEPA 1T1WA 2F15A 3DJTA 3V4PB 3ZQ9A 4BE5A 1CDGA 4PTUA 2WOYA 5DT1H 5IOKA 1R5VA 2PPCA 3Q6FB 2J1YA 4C56A 4YX2L 1QAWA 1P7QD 4M62L 3S3CB 4DFIA 2C3VA 4N8VG 1OXYA 2BWIA 5C08E 2E27H 2R1XA 3GSNH 5TE4L 3NJIA 5FKAB 5IB1B 3FF8A 4EKJA 2B1HL 4HGMA 3H2WA 2WBWB 3T8MA 3MRPB 4I7ZC 4KFMA 3TGXA 4XXWC 3HN8A 5I2IA 1CI3M 4R83A 1QEWB 1DUZB 2P80A 2X4SA 4N6RA 4N0YL 3X2QB 2WBJC 1JRHL 1KLFA 2QQQA 2RB8A 3KLDA 5AUMA 3M7FB 1OP3H 3WFEH 1UOVA 2IOOA 4GEJA 2VXTH 4KI5C 3PGFL 4NZUH 4ZPTA 1OGAE 3UTQB 3MREA 4TLKA 2CBQA 2DF3A 2HB0A 4OQTH 2AHIA 4BCXA 4HPYH 4ZOEA 2VDLH 4HX1B 4LPUA 4BA8A 4KJWC 5FW8A 3FCBA 3VM5A 3FRUB 3W39B 4ANKA 1LMIA 4OF8A 3M46A 4TV3A 4AQAA 1DVYA 12E8H 1HEZA 4Q8BA 3SGDI 3H55A 1UACL 2CXGA 5SWQA 4CJ0A 1XCXA 2UUDK 2W91A 2J73A 4UILH 2CIIA 2J7LA 2DQMA 3OB0H 3D39B 2C7UA 2X2JA 3T0EA 1WICA 4KKAD 1AFVL 4E9SA 4K94L 2DH2A 3UACA 5LGKA 1CK0H 2EIBA 3TNMA 1YEIH 3GB7B 1RIUL 2OMUB 4IK7A 2X70A 4F9LA 5E1IA 2GEQA 1XEDA 4N22A 4S1QL 4X5WB 2HFFB 4J28A 3RDTC 5L0QC 3CMOH 3FONA 4N0FA 5J3HC 4RX4D 4XP5L 1BVNT 2MNJB 3FW6A 3TWCL 3F6JA 4BE6A 3IDNB 2MQCA 4ZQKA 3BP5B 3BPCB 4HPHA 4B50A 4PRBB 1XL6A 4NM4H 2A1WL 2NT1A 1H19A 4RGOL 4MDJA 5F96H 3TH3T 1WDAA 5T33H 4PREB 3QIWB 3PFUA 4HG4J 3SPVB 2H47C 1RLBA 4D9LL 1OM9A 2COQA 3X11A 3TNNA 2Q86B 1J0IA 1IZJA 4MDIA 3L3HA 4XCCH 4LSQL 5EN2B 4X6EA 5L8JB 3BIBX 3RVVC 1QFWL 1JPTH 2AGJL 2OA9A 4FFZA 1ZLEA 4JKMA 4QHMB 4DEUA 1AZBA 4JKKA 4IK6A 5F88A 3HG1B 4A7UA 2YWYA 4HCGA 4A7GA 3HZKB 1PD6A 3CHOA 5E00A 1WAAE 3AWFA 4X6BA 1UA3A 5F71A 3C5JA 5GJSH 5CZVL 1ZHBB 5F0LB 5DVOA 4LVHB 1MRFL 2EQDA 3DPDA 3NH7L 3ZKSD 1VZHA 3ZTJG 3EJQA 2NX5B 2CO6B 1DJXA 3HC4L 5AW3B 2YQGA 2A4CA 1NDGB 2HN7A 5IROA 3VB8A 4DGIL 4Z1PA 3EO0B 3QG6A 5HYJB 1GGIH 3RYMA 3HFML 3PV7A 4QI3A 4DKFL 1TQWA 4AE1A 1QHOA 3ESOA 3GXIA 1T21A 4FFYH 1ZGLP 1Z9LA 4KJQC 3C6LB 5FA4B 1MAMH 4WI5A 1IC0A 4GBXC 4L0PB 1I7RB 2Z7UA 5D6CB 2H26A 4HUMB 4J6RH 1CBJA 1M7XA 4YWGH 1F90L 4ZX4A 3HB3C 4K3DL 4WO4B 2X5PA 3VFMB 5JPMC 2I25N 4Q9CA 5J13B 4LSSL 5A2AA 2WVUA 1TF4A 2EDEA 1E4JA 1QFPA 4A2DA 3L3KB 1X9UA 3P4OA 4PD4J 4NRXA 5ENWA 1EGJL 1RFDL 1RXLA 1YMHA 3T0WA 1JF6A 1AMYA 1N2RA 3O6FD 4ZTEA 2FX7H 1VZGA 1KPVA 1PLGL 1ET7A 1SXBA 3I6KB 1W72A 3HI1A 4E9WA 1TETH 4ALAH 1OVZA 5I28A 2E46A 3OGOE 1JHKL 3NAAH 4JZOB 3QUML 4H8QA 5K59E 1RPUA 4PS4L 4U1JB 4LDCA 3MX0A 2VLKB 4NZTH 4JDEB 2O61B 1U21A 1DEEB 2FL5A 1A6UL 4HUNB 5FYLE 4FQPA 1MIMH 2A99A 3FUIA 4YE4L 4H0LC 3C60A 1LTXA 5J12B 1DANT 3RKPA 4IBVA 1IU1A 1UT2A 4ERSL 3ALXA 1HQ4A 1AGDB 1MQ8A 3IXAB 3V7AE 3QFDB 3UPRA 4WJ5A 2CJSA 3BRGC 4PJCF 1LO0H 5I1AA 4XBGB 3L3OC 1F11B 5T3XL 3PV6B 2CLRA 3N04A 2MQ3A 5K33A 3WFCH 2AEPH 3K80A 4B3EA 3PL6A 1MRDL 4WDIB 5HHOE 3VVWA 1BF2A 2A77L 4IOSD 1JE6A 3GNML 3EJUA 2YMXL 1PFOA 1JG9A 2HJFA 3ZSSA 3GXPA 5KTEL 3S36H 3K2UL 1KSRA 1PD0A 1E27B 4FXGB 3EFDH 4JG0L 5I23A 3DGCR 1G6VK 4EI6A 3BW9B 1ZPLA 3DOSB 2QGEA 3I85A 5D7IB 3ROOA 4IYKA 1EFXB 2FE0A 3Q8CA 4LCUB 3FOLB 2X4NB 2XUWA 3L9EA 4P3CL 3QNZB 1J1OH 2Y6TE 3PGCA 3H4FA 2ODIA 4FFVD 2ALWA 1FLRL 3QDMB 3ZTNH 1NCDH 5DHXB 5AL8A 4QTHB 1NGPH 3ES6A 5AKVA 2AXGA 5KVFH 1EZUA 3E1F1 3VRLF 1NBYA 3SPHA 2Z8VC 3SZKC 4PRPD 2YPKB 2LAAA 2J5LB 4ODWB 3T77A 4LRIC 1RZJC 3HNTL 3NRQA 4MHHI 4GO6B 4XAWH 4ZMLA 3QRGH 3HIZA 2AK4B 2H2SC 3CFCH 1DBBL 4DP6X 5C7XL 3V0IA 3WNIA 5I24A 4NJ9L 4Z77A 2YA2A 4YBQD 3P0VH 4RETB 4PBDA 4UNTA 5IVOA 3BEVB 1PZAA 3F7VA 4HOZA 2H0FA 3ETTA 3OKMA 2XU9A 4R0LA 4G80A 2XQYA 4IMKC 1G1OA 5LLIC 3DO7B 1XMWA 5FIEA 5FK9B 4YDKL 2GT9A 5L88L 1JFQH 4QCIA 4KJYA 4JR9L 2PW2B 3IDJB 4M7LL 2V17H 5LCVH 5EDSA 2A6IA 2XWZA 1JDDA 3RUGB 4BFIB 2DICA 3W1ZA 3IMBA 5SV3A 4UTAL 5CP3A 1AD0B 2C9PA 3IJHA 1J10A 1PFCA 3ARQA 3WS6C 5KWYC 3NIGE 2PN5A 1M57B 4IS6B 4PVBA 1KNOB 2P5PA 2YS4A 1EDHA 3QZNA 4YZFE 2GJ6D 3SDCB 1RUPL 4PJ8A 4R4BB 3WJMB 2W0KA 3BH8B 5FW7A 3MGOB 2NY3B 3X17A 4XO3A 4OZIF 1HL9A 2NSQA 3RWHB 3GIZL 4CU8A 1GZHC 4G5ZH 2PETA 4KX9A 3AG4B 1CF8H 1FZOB 3RHWF 1CYGA 5SX4I 1MHHB 5C0GA 1B0IA 4IJTA 1Q9WA 2G60L 1Z5LA 3QEHA 4M43L 5E70A 3MLVH 4I2XA 3SHSA 4NRZB 4ZQTA 3B5HA 1XF2A 4X4YA 4YSAA 1M1SA 3MV8E 2HJKA 1RJLA 1X7QB 5C0IB 1UVQA 1J11A 3HE7A 2RTTA 4HISA 3B9EA 3TEWA 2FLBT 4ZUUA 3MMEA 4N5EC 1G6RA 3L4YA 2A0LD 2PXYB 5F7DB 2OZ4L 1AGCA 4HT1L 5GGVH 3AITA 5D1QB 3UG5A 5K9OB 3MRLA 4B9ZA 1IFHL 1ZHKB 3QAZC 4V33A 2F74A 2EABA 1U8OA 2ED6A 3MN8A 2ZT9C 3PNWB 4DUXA 2BSTB 4PCSA 1X5IA 3DLQR 3ETBF 4KKQA 5F9WC 5AYUL 5AZ2L 3EGXB 4ZSOA 2PO6A 3S96B 3LRHA 1Y0LB 2YWZA 5KVEL 4LKXB 1U8NA 1OSZB 1YEJL 4O2CA 3VH8B 1QYGL 2FJHB 4NPJA 1JWMB 3AACA 3LSOB 3NSFA 1QSED 2WGXA 5KJ4A 1U8IA 2B4CL 4IBLT 4JQIA 3APMA 4MSWB 3T2QA 1I3GH 1OGTB 4UTCA 2EXSA 3BP7A 3LKRA 5IGXL 2J21A 5TK2A 2HRGA 2VSCA 4LP5A 1EZVY 3DV6B 3SO3B 1GSKA 2P49B 2JSFA 1PNDA 4FXLA 3I02A 1O7DE 4JMNA 2VB5A 4NKQB 3V0VA 1IAKB 5KANI 5HI3C 3L54A 1X5KA 4LSVH 4O2FA 4XNXH 2JKRM 3P4MB 1J9SA 1FIEA 3ARDD 1PAZA 2BHYA 1V8HA 2WTRB 2LHAA 3CVIH 3VRJB 3ZR6A 1UWEH 4OU3A 3P77A 4W4OC 4UB0L 4KKLD 4C54A 3BAJA 2OK0L 2BIQA 2RMNA 3SDXE 3QIBC 2OLDA 4LOUD 1BF8A 1KXVC 4UQDA 4P57A 5GS1C 2H0PA 5DFVC 5C70A 2P42B 5JXAH 4IRJC 3WIIL 4OD2A 1XGYL 5E0FA 2EC9T 1YECL 3OAWA 2CO7A 4JY6B 4G7SB 4Z5RA 4Y9CA 3VFUA 4N8VB 3V9CA 1FN4A 5I1LA 4I4WA 4AQEB 4XZUB 3FTSA 3MFFA 3PNRB 4YHYB 5I6MA 3KVPA 3KBEA 3WKNA 1MCLA 5AG9A 5KW9L 1DLFL 2WYIA 4HK3N 4ODTL 1V7NH 3VXRE 4S2SA 3ATFA 3X3GL 1MCIA 2B20A 3ZL4H 2Y7MA 3O9WB 4KRMB 5IBLC 1A0QL 1B9ZA 2J25A 3QG7L 5MEPB 5C0RL 4PRDB 1BQSA 1SZNA 1FFPB 3I9GH 4MAYD 5ICXA 3RP1A 3P4LA 1A9BA 1EUUA 1JZFA 3LS5H 2UXFA 2O5ZL 4I88A 4GKOA 4LSUH 3VI3E 1BOGB 3KYKL 3MGTB 1HINH 4L8DB 3L1GA 1KBVA 1J5OH 1DBML 1DQML 1J9TA 2D7PA 2Q76A 4MNGA 1GGYA 4PJAB 5L4MA 2Z8RA 4QOKD 4PVLA 3DURA 2CQVA 1Y18B 1JTPA 1NAMA 3RTQC 1QO3A 2PWGA 4U1HB 3MV9B 1UENA 4Y5XA 5HDOA 3LD8C 5T3XE 3BWUC 1TMQA 4Y19A 5FO7A 1QR1A 1J0HA 3V4VB 1QA9B 4K3EL 1ZLSH 3G5VB 5D8JH 2OL3L 1F97A 3VFVB 4F8LA 5I76B 1J0YA 1RUQH 3LEVH 4PBWD 1KJ3H 3F05A 3MV01 4WUUE 2L4OA 3ZL2A 2N3JA 3VFRB 4ODBD 3D87B 4H88L 2ZWLT 2EYSB 3DSFH 3P30H 5DFWH 5C09E 4FFWC 2ZQKA 2IVFC 5LBVA 4M8QA 5LDSA 1S8DB 4ZOBA 2BRRH 6FABL 5KG9A 4JFXB 2EVFA 3GK8L 3IDXL 4Z6AT 1I7ZB 4JREB 4Y16D 2MCMA 5BRZB 2AK1H 3RGVA 3UYRL 4CSZA 2QV2A 4GI8A 4KUZH 1UXLA 2DQDH 2XPZA 3HG2A 3DVGB 1ZVHA 3L5WB 1ACYH 5C0JB 1NUDA 4H13C 1P7KB 5TFSH 1YNTA 4XRCB 3FO9A 2F5AH 5I6KA 2ICEA 4EUPG 1TZOA 4FEIA 4IHOB 3B9DA 2A7BA 4C58B 2NNAB 2KI6A 3OD3A 4ZFGL 3BVNB 1C5CH 3RDTB 5L0QB 3DTXA 3U4BL 4PJCA 3S3PA 3HUJB 2XV0A 3HC3L 2FO4B 4LPYA 4PWFA 1YEEH 4OGYL 4MD0A 3WXVL 3VG0H 1T6VN 4NO0A 1N64L 1WAPA 1KT2B 1MLCA 1U4EA 3WGUB 1EEZB 1JK9A 3KLKA 4GP4B 3DGDA 4XAKD 4Y1AB 3UZVA 5ID0A 3RZCD 2D4DA 3GXTA 3CQPA 3QRFM 1PCSA 4XGZB 4K3JH 3X3FL 3DX6A 4CC4C 5JMOC 4R4FH 1P4BH 4NQCB 4EDWL 4LHUG 4HIPA 5I1JH 4GRWB 2BOCA 2YGNA 3HMWL 3L3JB 4R5XA 1MXDA 3ZTDC 2A6KA 2D8KA 2B59B 4LGPB 4ZS7L 3QUXA 3BZEA 5EU6E 1DE4B 2YA0A 4XPAH 4LOEA 1E40A 4OZFH 3SBWA 2DWSA 2DLGA 1L9TA 3WEOA 2ZAGA 2VDKB 4DPBX 2RR3A 3LXUX 4DTGL 4GQ9L 1UCBL 1BWMA 4ZFZB 2GK0B 2HX8A 4X5XA 5H37G 5CBEA 5C7ZA 3ARXA 3GZPA 3GSRA 3CZEA 2E27L 3QQ4B 4XN1A 4XX1E 1KIQB 3GSNL 4DVBA 3TBYA 2P9RA 2DM7A 3BP6A 4R5TA 4LHJB 1MW3A 2OMVB 4K3HA 1D9KD 1LEIA 3CSTA 3G5XA 3GGWB 1CDJA 3NCEB 1NUNB 2EDYA 2VSDA 2ZUSA 4CN4A 3WFEL 1W72H 2VXTL 3HB3B 3PWPB 4NZUL 3TVMA 5JPMB 4OQTL 5LAXB 4HPYL 3ZT7A 2VDLL 4PJ7E 4AIZB 3PQYB 4Z7NE 3F7KA 2J4WH 3GLAA 1IL1B 3PGDA 12E8L 5KVGH 3AM8C 1K5NB 4P5KA 4ETQB 4LLUB 1EO5A 1NJ9A 1M7DA 3UCRA 4KJPC 2UZPA 4Z7WE 4AVKA 3DMMA 5D9SA 5I1KH 3FH5A 3EBGA 4UILL 4HIXH 4XTRC 2LQRA 2Y07H 1U93B 4G2AA 2IJ0C 2UWEE 1TTUA 2GFBA 3NQIA 3HLAA 3HHRB 4PGBA 2XWRA 4OZIA 4ZPVB 5IBUG 2DL9A 5D5MA 3AB0C 3TEXA 5HYEA 1CK0L 1CTMA 1LVEA 2V33A 5EU3A 1SQMA 3SN6N 1IEAB 4ODSL 4PCYA 5I6PA 3EFOA 1EVTC 2H1XA 3VG9C 2GIMA 4MKMA 2DL2A 3ATAA 5EZOH 4DP8X 1F1GA 2P80D 4NZ8A 4ZD3H 3CMOL 1KBKA 3TC9A 1EJOH 1ZA6A 1I7UA 4C83B 3MJ9H 4RWYH 3ZL1A 4G5AA 2F58H 1HCVA 2W38A 4NZFA 4WNQB 5T1KA 4AZ8A 1SYSA 4I0CC 2Q87A 3TEUA 3VXPA 4AENB 1IM3A 4GXUN 3PJSB 4K7PY 4K9EC 5CLTA 5T5FA 3FQXA 4NM4L 2NQCA 3L3OB 3AG2B 5B38G 5F96L 2DWTA 2DBLH 4G9FB 2FHBA 2GAZA 3DPBA 4P5TC 3QO1B 5T33L 4OT1H 5L2KA 1OT2A 4LIQH 5EC1A 5E6ID 2H3XC 4XCCL 1N70A 5DZNA 4QIRA 5IOPB 5DK2B 1JPTL 1N26A 2ERJC 3EH4B 4P46A 3WHE1 1CF1A 5CSBA 4GI6A 3WV0A 1HEJC 4XO8A 5AD0B 3D5OF 3ROLA 3KLAB 2DTSA 2OR8A 4TUJA 4Y7OC 4C4KO 5D7LD 4LCWB 3LZLA 3G5ZB 2D0HA 3CSYB 3FSAA 4C4KT 1YPZE 5GJSL 1IBFA 1OF2B 3OG6B 3LZFL 5DJDA 4H1LA 3V5HA 2H3NB 2EIZB 2Y7QA 3MODH 5HGAA 1XH3B 5DJ8B 3LDBC 2CLZB 5FFOA 2X2IA 1Q4NX 4MGXA 5B1JC 2A9BA 3BUIA 2DEYX 3DHJA 1I1YB 3NPSB 1GGIL 3HAEA 1WQVT 2KKQA 1AG0A 5FYKH 1ZLDA 2R2BA 4W9ZA 2YARA 2V7NA 3QWRD 3WJJC 3QXTA 4B7LA 3BMVA 4FFYL 4J6IA 1IM9A 4QR7A 1OTTD 3WMPA 1JMXA 1MAML 5E5MA 1DBAH 4GRLC 4R7DB 5E7BA 2EUXA 3CFNA 1E5ZA 1ETJA 4OY9A 3GRWH 3TL5A 4GIAA 1MFNA 4YSUA 3GM0A 5DMJB 4YWGL 4FLQA 2ICWA 3DX9B 2CO1A 2SEBA 5ES4B 5ESVA 2BCKB 2V3EA 2L3BA 1CUOA 1OAJA 2OR9H 1N3NA 4WKZB 3FT2B 2BSCA 1J8RA 2P7TB 2VXUH 4WGKA 4EI5A 4PG2A 3CCHA 3GHPA 2P46B 3BD3A 4GFXA 4G1MA 3GMQA 1E9OB 2FX7L 1Q9OB 2R2HA 1E4KA 1G94A 5I8EA 3UYPB 2YK1H 3BVVA 5IWLC 1RHHB 3I6GA 5C3LD 1TETL 4ALAL 5JUEH 2XTJC 1MFDH 1RJZB 3B7YA 4Y5YC 4LARH 1AHWC 3NAAL 4MBOA 4JO2H 1P84J 4E0RA 3EOBA 3TJHC 2HVJA 3K6SB 5EZIH 3BJLA 3AQZA 3GS0A 4JFSA 2GBAA 4NQDA 4NZTL 3PIQB 3ALWA 2QR0B 2KBGA 2P43B 1VACB 5E8DH 1MIML 4Q56A 4TSAH 3BUDA 3MRRB 4PJGF 3IKCB 3UO8B 2H32A 5I0YA 5CLXA 3GBEA 3FO1A 3NJFA 1SUHA 4X4MA 2ZYSA 4E5XB 1NLBH 1TLMA 2R0WH 4MJ2A 3VXOA 5GGQH 1LO0L 5IT2H 1QRNB 1JWSA 3BKJH 4XVOA 4ICWA 2B9BA 4GG8B 3WEBA 2EDWA 1JZJA 1ZT1A 2AEPL 2BOLA 3WFCL 1J88A 1CI5A 5E4OA 3T71A 1C16B 3OKDA 2FUTA 4RNRA 3GUTB 4JQIH 4MNHB 2KDGA 1N0LB 3OSVA 4JAMA 2QPDB 4N68A 2QPUA 3S36L 5C6WH 3MKKA 1S7SA 4G7VH 1T7ZA 1UXWA 3T3ME 3EFDL 2P5EA 3QAZB 5FOJA 4K7FA 3DNKA 2XHNA 3OLIA 3LQZB 5HGHB 4ZW3A 4G8GD 5D6DC 3LNIA 3H54A 5BW7C 4LCCB 1DJWA 3E0GA 4Y8AA 1BBDH 3WBDA 2DIBA 2DMKA 3C60D 1J1OL 2R15A 4KRLB 4MCZB 1CFTB 2JJUA 3R19A 3ZTNL 5HYQB 2NW3B 1NCDL 1NGPL 3VXTB 8PAZA 5KVFL 2DEXX 4U1KA 3E6FB 3UEZA 5F7BA 2A9CA 3MNMA 1JPFB 4D8PA 4UBDD 1XTLA 3JUZA 3CZJA 5I0VA 3F00A 5ALBH 2FEEL 1DVZA 3UGEA 3BYYA 2EDJA 3EYVB 3AREC 4XAWL 4KK8D 3ABKB 2ARJB 1NUGA 3ESUF 5DYOA 3QRGL 3TN0A 2V9UA 3CFCL 3K1KC 43C9B 3PL6D 4JZJC 3TFKC 3P0VL 1HOCA 2J1ZA 5INCA 4QT5A 3GIVA 2XVKA 4X6DB 1UB6B 3CLEH 3MA7B 1RZQA 3BD5A 4RRPM 2JKLA 2YGQA 5L7XH 5IW1A 3R7QA 5LCVL 1G7PB 2V17L 4IRJB 2ITFA 1Z9SA 2LLNA 3BGFC 4AKOA 2G2RB 1P1VA 4OLEA 5D1XA 3UC0H 2UY7A 2BLFA 1OAKH 3V4UH 4HOMA 1DVFB 5I19H 2IADA 2R23A 4WWPA 4M5ZH 4AQ8C 2PF6A 3Q8BA 4OAWB 1D5BB 1C8PA 5J0BA 1NAMH 3MRIA 4NKOB 2IPTH 1AZVA 2VLJB 1IGIH 3ARGD 4HIJA 1A1NB 2KH2B 4YS4A 1KGCD 4O58H 3SE6A 5JDJA 4G5ZL 3KYMA 5IKCB 1CF8L 5EO0A 2QVMA 5KOVC 4QHNB 1H3VA 1P84K 1S9XA 4I0PC 5A40E 1QP1A 3EOAB 1K4CA 3QUMB 4JJHA 4XXDA 1S7UA 3MLVL 3FQUB 4CADB 2R9HD 3RY6C 4Y2DA 1VHPA 2GPZA 3CBJB 2UZIH 2EXYD 4B60A 1WFJA 3VXME 5MEOA 4KZDH 4IRZA 2P52A 1RUAH 1S9VB 2QADB 5EU7C 5T5NF 5T3ZD 2G2PA 3FCSA 2FK9A 3L16A 5HHQA 1Y6MR 2EEBA 3WYRA 5GGVL 3VWJA 3V6OE 1AAJA 4MDRA 4MXQD 4D0BB 4EUPB 3N0AA 1GGTA 5CJOH 2WZPA 2XN9E 5DMIH 3ZDXE 5CM1A 2UYLB 3QPQC 4PJ8D 5E9DA 1Z66A 2GJ6E 2NZ9C 4QYOB 2AJVH 2A74A 1J8HA 1P9MC 1YMMA 3CZSA 3A5VA 1E4HA 4LNRB 4MMYA 1MI5A 3MRDB 1MFEH 1V3KA 1DDHB 2V6HA 2IMNA 4X6CF 2SODB 1J5IA 3KPLA 3NUKA 1A7RL 3ZHLA 1I3GL 1UWXH 5DJ0B 4K07A 3N3EA 4ZX6A 1PX4A 3FQ4A 5LKNA 1P5UA 4G43A 3LS4H 5F8RC 3SKNA 2FT8A 2X44D 1FL5B 4OZHE 4QMEA 2BP8A 4LHUB 5KS9E 4LSVL 1SEBA 4XNXL 2W9EH 4G8EB 3HE7D 4HS6B 4XWOD 3IN2A 3CVIL 4Y4KB 5E94B 3BEWA 1DJYA 2ATPA 4FLSA 4HBQA 3H4HA 1T1XA 4CKVX 3B9KC 3J7HA 4LFHG 5F3BB 4OM0H 3PE9A 2GTZB 5IUCA 2OW7A 1TENA 3MLSL 3CJJA 1Q94A 1X5HA 2CNYA 4M29A 1V10A 4QXUH 4HLZH 2V8MA 4ODUB 5JXAL 2OX5B 5A16A 4UDUA 1HCFX 2XN2A 2MRYA 3LH2H 2PO6D 2WNWA 3P40A 2Z3FA 4UINH 3OKNB 1JDCA 1PX8A 2CCVA 4Y2OA 4HOWA 2WW8A 3TO2B 3RL1A 5F6IC 4JQVA 5AVUB 1QSEE 1JZGA 5CGYD 3Q3GB 1S7VB 3ARZA 4M1DH 1V7NL 1CYXA 2P45B 3GSOA 2IDTA 3ZL4L 1VCAA 3AJ7A 5B1KA 1TNNA 2VIRB 3A0OA 3I9GL 3ARBA 5SWSA 1BPVA 2BRQA 5CKGA 2AJ3B 4DZBB 1QFWM 3LS5L 1WA2X 3CX5J 4LSUL 3RWDB 4B41A 1HINL 4WFGD 4CMMB 1J5OL 3VU2A 1PZDA 3IWUA 4YHNB 1EEQA 2CLVA 1IGJA 3EJZC 3WKMH 5GRZA 2LU5A 4LP8A 2D31B 5ACMA 4BUQA 2PYEE 3MRFB 1QHQA 4Z7AA 4JPIB 5C0AB 1HXMB 4AJ0A 3HE6A 4P4RA 3QC5X 1A1MA 2WAQA 3FFCE 5C0NC 4FKKA 1DQTA 2VLRA 1KBWA 2D3NA 4K8RC 2ZXGA 4PGJA 3MJ7B 1ZLSL 4HUXB 5D8JL 3O3UN 1RUQL 3LEVL 1T0MB 1KJ3L 4OBSA 3RLSA 4PB9H 1T7XA 5IBUB 4HJGA 4XVJL 2OMZB 1E7UA 2CBMA 2BHFA 2JB5H 2VO8A 5DFTA 2YN3A 3P30L 1S7WA 3DSFL 4QKTA 1A4JA 5EFIA 4YOKA 2BRRL 1IBDA 4M7KH 3ARPA 4OIIH 5F7EH 4U1SB 3DX0A 4HDIB 3PWUB 1NEZA 4FOMA 2HTLC 3K72A 2VR3A 5I15H 2AK1L 4MNQB 2WXPA 4P2RE 3D51A 4KUZL 2DQDL 1AOHA 3ETSA 2BVPB 3NJJA 5DJZB 3T6ZA 5JHAA 3DHPA 4LBEA 2YAQA 3LRMA 5D1ZB 2QSTA 5IHLB 5T5FH 5TFSL 4NQXA 3CFTA 4XXCC 2Y1AA 3AB0B 3VFTB 2F5AL 4ZW5A 1BWWA 5KVFE 3NRFA 3D0VA 2WJ7A 4Z7VE 1I1CA 2ZKXA 4RCAA 2JKJA 4PWKA 2OYPA 3QIUD 4P2QE 3TCTA 3BHBB 4Y19D 1R5WA 3Q0HA 3L95A 4B9PA 5GS0D 4QRTB 4GAYA 2Z7WA 4ELKB 2VM4A 2UVFA 1YEEL 4WI6A 2CO2A 5JOEA 1Z9OA 3VG0L 4AVHA 2BSRA 1ETZA 1ZANH 1RMFH 1RIVH 5LBSH 1BD2A 3I6LE 3DSNB 4I5BA 1TO5A 1DJSA 3UGUA 4L2LA 3QXWA 1KTDB 1QSZA 3IJSB 3QRBA 4ELMB 1AH1A 2MOQA 3WEXA 2EVJA 3EOTH 4K3JL 1ZTMA 2VE6B 3CH8A 3O6LH 4PJ5B 1UB5A 1WZLA 4ZMQA 4R4FL 5EEWA 1P4BL 3RGVD 5I1JL 3MBED 2I26N 3S8WA 1KZQA 4POZC 2ICCA 2BZ7A 3KPQA 1HEHC 3PU7A 4UOQA 4QRRE 1FYTB 1RZ8B 3BP4B 4W4NA 1W9XA 4I18A 5FAAA 1O6TA 3REWA 1HYSC 2CDFA 1UM4H 4XPAL 3HAEH 1MKFA 2KQMA 2P8LB 4GG6A 2PCYA 5CN2A 3MRKA 2IAND 3BSZA 4ZNEE 2P5WB 1NIBA 5INDA 3BGAA 1M42A 4YBHA 3NIFE 4AC4A 1NICA 1W0YT 2HFTA 4QXTB 2NLJB 1XO8A 5KYUA 1EMTH 1CS6A 2DWYA 3UBXG 2J44A 1R3JA 1M1XA 1Q1PA 3BD4A 4NN5B 4OLUH 1VFOA 5HDRA 2WLKA 3ILEA 4IRSA 4HWBA 4M93B 1PKQA 3UTTE 1HJCA 2NYZA 3QDGD 5FHAH 2V2XB 1TFPA 5CHNA 7TAAA 3F7PC 4JO4H 5GRJH 4XAKE 3W2DH 3R1GH 2GTQA 1ORQB 2APWA 3PDOA 2WOBA 2IH3B 4EN3B 4DFHA 5BV7H 3MV7A 2PW1B 4NKMA 4LDLB 1SGKA 4JFDE 5DRXB 4AQZA 5IY5B 1ZRUA 5EU4A 1RSFA 2GJZA 3ATBA 4AV4A 5IHWA 2FO1A 3FULA 3S5LA 4BSWB 3CFBB 2J4WL 3UJTH 2BNQA 5KVGL 2ITEA 1JBJA 2JIXD 4U3SA 4EIBA 3IRZA 1YEGH 2ZXAA 5TJWK 3MTXA 4X2UA 4NPKA 1P7HL 5I1KL 3FYIB 2OL3B 2WO3B 4FTVB 2WCSA 1RZIA 1AKJD 3VDCA 4HIXL 5FGSA 3WJLC 4JCWA 2H32H 1OHQA 2Y07L 3GM8A 4RESB 1OB1B 1AHWB 3UXFA 3DI3B 2HRPH 4P4KD 4PV8A 1OEZW 4XHJD 2AJZA 3D2UA 4HMDA 4Q89A 2VDQH 4AEHH 4Q52A 2EDKA 2WSKA 3NBNA 1F4YH 1T0NB 5DMKB 3KJ4B 5EZOL 3H0TB 4ZD3L 4H0GA 1EO7A 1MCEA 1PD1A 2QGCA 1OGPA 1EJOL 5IW6B 4Z78B 3MJ9L 4RWYL 4Y1SA 1P5VA 2F58L 5L4FA 2XFXB 4UAHA 2YMTA 3WNMA 3MV11 2J5WA 4KK9D 1XEUA 3VA2C 1DQKA 2C9XA 1KG0A 2CPCA 2BW4A 1A4AA 1FH2A 1FJ1B 3FB8B 1SDYA 4IGBA 4RZCB 5DEGB 2DBLL 2CUHA 3RFZB 4HFUH 3SE3C 1YRKA 1B4LA 3GJFB 4I3SH 4OT1L 3WAKA 1Q0EA 3SDDA 1CGVA 4S11A 5E24E 4LIQL 2R29H 2GYSA 1CXHA 2J8UF 4KMLB 4O2EA 5J9PA 3P0YH 4E41A 4PLKC 3DMMD 3GLDA 4M3HA 2F5BH 3NFPB 5FYJU 3G04B 1INQA 4ZMZA 1J9CT 3P3RA 3BN9D 4C56E 4ONOA 3BDYH 5HDQH 5EO1A 4IDJH 1G7IA 3ECBB 4IEFB 3CX2A 1PY9A 3GI8L 5C0CA 2GCYB 2X7LA 3V6BR 2VDRH 1B0RB 4J8QA 4PJ6A 4OIFA 3R7RA 4U1NA 1W0VA 4WFHD 3ZMRA 3MODL 4QXWA 1BCIA 4K7PH 1LP9A 1CXEA 4KDTA 3ZMEA 3B37A 5T1KD 3MRNA 3GMOB 2F0CA 4A67A 1IKNA 5FYKL 4OF6A 1MCOH 5DI8B 1O9ZA 3P4NB 5F9JB 2ZCZA 4JB9H 1GCFA 3OLEA 4LF3B 3AREB 1NCJA 4U6XB 5DQJA 5L2KD 4PYGA 4HF5H 4CU6A 1DBAL 4JZJB 4JG1H 4KUCD 5F8QC 3GRWL