4YMPA

Crystal structure of the bacillus anthracis hal neat domain in complex with heme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
112
Chain Sequence
b'VFDAVIKAYKDNSDEESYATVYIKDPKLTIENGKRIITATLKDSDFFDYLKVEFHDVKVLSEDKRKHGTKVIQFEVGELGKRYNMQMHILIPTLGYDKEFKIQFEVNMRTFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin
molecule tags Heme-binding protein
source organism Bacillus anthracis
publication title Crystal structure of the Bacillus anthracis Hal NEAT domain in complex with heme
rcsb
total genus 22
structure length 112
sequence length 119
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ympA00
2Q7AA 3QZMA 2O1AA 4NLAA 3RURA 5D1ZI 3RTLA 2E7DA 3S48A 3SZKC 3QZNA 3VTMA 3QZOA 2MOQA 5D1QE 4H8QA 4FC3E 3VUAA 2K78A 4YMPA 3QUHA 2Z6FA 4WJG3 3SZ6A 4H8PA 5D1XE 2ITEA 2ITFA 3QUGA 3OVUB 2H3KA 2O6PA 3QZPA 3SIKA 3QZLA 4MYPA
chains in the Genus database with same CATH superfamily
4IK7A 1PZBA 5CIPA 4FP8L 4Y9GA 2ZKMX 4BA8A 4HS6B 4PJXE 1XSIA 3EDEA 3RWFA 3KVDD 4L5FL 2VXSL 1VZHA 4PRHB 4IIQB 1OAXL 1ULVA 4XNQA 4KZEL 1LQSR 3TBWB 3MOAH 3WIIH 2Z0UA 2ZXBA 4J3OF 5DRXA 1V8HA 3N85H 5K9JH 5L9DL 2H1XA 1T4WA 1BD2D 4EDWL 4XVUC 4BGDA 3C5ZA 3QG6A 3ZDYE 5CKGA 1BQRA 1ZIAA 2B15A 4QXVA 4PG2A 3HZYA 2EEAA 1EFXB 4DQOL 2W60A 3ARDD 1RUPH 3QZWB 5IESL 3K6OA 1EDYA 4ZW6A 3T4YA 4IU3A 1I31A 2MOGA 3KNBB 5CR8A 2B59A 4W1TA 2QQNH 4NWTL 3NDZE 2VLMD 3BXNA 3UTTD 4Z76A 3HZVB 2NR6A 3H1ZA 4FCAA 4N22A 1DFXA 1QP1A 1MN4A 1QI5A 2V2TB 4WO4C 4QAMB 1A7OL 1BV8A 1IE4A 4WIQA 4J12A 1RUAH 1X7QA 2KZ1B 2RTTA 1HS6A 5ICXB 5HYSA 4JPIB 1ZLVH 2QHRL 2CK2A 1RZ8A 5IVXA 3WIAA 3G04B 2XWZA 2GB2A 4C4KT 3TF7C 1UA3A 4K23L 1F4WL 3SDDD 2IVFC 1AMYA 1TDQA 4IIQA 2ISDA 4X42A 3UTZB 1XGRB 4JMNA 4BWUA 4A2EA 4TLUA 5L0QB 1A7PH 1JV2B 2RALA 2YK1H 3J07A 1U93B 5C8JB 2WHVA 4XMPL 1JXFA 1TLKA 1QQDA 2P28B 5F7NC 4IEFB 3DLQR 1AVAA 5ECGA 1LWHA 3BWZA 3DGGA 3KXFA 4QHNA 3TWCH 4YFEA 3RTLA 5IEKA 3EH1A 1EFXD 2HMID 1HXKA 2ZX7A 3M88A 5IB3A 5INCB 1PYWA 5DWUH 4M8RA 5B21A 1YEHH 3Q5OA 2WB7A 4WJ5B 1BQHG 1HHKB 4XNZC 4WJG3 1X5YA 2Y7OA 3PQYB 1KY6A 3EH5B 1HDMB 4XWOC 3MRJA 5F7DB 4OAWA 5I1DA 3WLBB 4FXKC 2PCPB 4FRWA 3X3FH 1E4WL 4LPTA 1U8LB 4FQJL 4NIKB 4ZNCD 1DQTA 2ESVD 3DX7B 4E9WA 4U3HA 4JCMA 2OYKA 4JG9A 1DBBH 4ZO7A 2EYRB 4CMHB 1GMEA 4MHHI 4G7VL 4EVNA 2FIKB 4UINL 5DJYB 1HYSC 5JPNA 1DQDH 2YPKB 1U8IB 3IJHA 3STZB 4CBZA 3RG1C 2Y2YA 1RIVH 3U0WH 3ATDA 3C8DA 2DWDB 4AYGA 2Y72A 3TPUB 2NY1D 5IBTH 1FHNA 4UNVA 3MJWA 4BK5C 1EZLA 1GC1L 3WLWC 2DJMA 2FSDA 2XG4B 5BV7B 1B0WA 3QXDB 2M1KA 4RQQA 5A3ID 4HIXL 3MLYH 4FAAB 4X6DB 1WZMA 3LOWA 3QEQA 4KQ0A 2ITDB 3IJ8A 3C6LC 3QEHB 3WAKA 1UWYA 1OK0A 2WZ5A 4X6BA 3RIAK 5DGQA 1D3CA 4XN2A 4LLUA 1TF4A 3AMLA 4F8TA 3W0WB 2F53D 4GAJL 1VADA 2XY1A 1HIML 3GFUA 4YNYB 5F21B 3GIZH 2WXRA 2NLJB 2PR4L 2Z31C 4PG9B 3NPSB 4K55A 2OFQA 4QRRE 3LH8A 2DQHL 5E1AA 1FQ9C 1L0PA 4JDEA 1HT6A 5G5DA 3VGFA 5E8NA 3WNOA 1BMGA 4JPWH 4Z77B 5EEWA 2L0DA 1V7NH 2ITDA 2JQMA 4I2XA 1O0VA 4R3SA 2R0ZH 1TEGA 4YJZL 5DHVH 5GGTA 2OR9L 5EZOH 5BXFB 1OTSC 2G30A 5EULV 3QQXA 4ABUA 5FUZH 2FATH 1F4XH 3OKDA 3FBKA 4HKBB 4KROD 1C5DB 2IPTH 1JFHA 5I2IB 1H3WM 5KYWB 2PCFB 4YXKL 1SOKA 4W9DC 4A2LA 1PY0A 2NY5L 2EXYC 1DBKL 4JY5L 4YHOL 5DHXB 2HAZA 2X70B 4PV1C 4G5ZH 3RGVC 2YKLL 1K3ZA 4X7SH 3POHA 2FQGA 5L6YL 4NO0D 2WINB 4PFEA 5C0BE 1T1XB 1NWPA 1NGYB 3ROOB 2NXYD 4BFRA 1GHFH 3KPLA 2YGPA 4YHYC 4GI6A 4MD0A 4PLKD 3PWPE 4I3SH 4TNVF 5FF6A 5ESQB 4NQDB 1UH4A 1CXEA 3BVNB 4A7GF 4QF1A 1R3HB 4MNQB 5AKRA 2EC9U 2NRDA 5JOPE 4U1KB 3C6SA 2XCMC 4QYOA 1R33A 4Y1AD 3VXSA 3U4AA 4GUQA 5HYSB 2C34A 2X44D 4PWHA 1PS3A 3NJJA 3IU4H 1CU4H 1IBZA 4ZMYA 5BV7L 1Q0EA 4PRIE 4R0LA 4TL5A 2H2SC 4NEHB 3MN8A 3TEXA 12E8H 1KY7A 2BX5A 4FZ8L 2VLRB 1ETJA 2QGDA 4U0QB 5HDQL 1F6LL 2CAKA 3E0GA 3HKZA 3U9PL 1T0MB 1OAXH 3MUUA 2XVLA 3ETTA 4FMKA 3BFWA 3SPGA 2VLLA 4YH6A 4JM4L 1FYTE 4POUB 3C12A 5GGSA 5KUKA 2F8XC 4YIQA 3AXIA 2B14A 1IJ9A 2CUIA 1NCGA 5DDHA 2R2BB 5GRWA 2BSTB 4WV1C 2AERT 4KJPC 3MGOB 2VQ1A 1JZDC 3MRHB 2YZ8A 3IMRA 1EHXA 3F8UB 1S7QB 4FTVA 1IQWH 3OZLA 1G1YA 4BINA 3FQ2A 3AM8C 3ARED 1A8ZA 1TQUA 4XB3A 1L9MA 3BKML 4Y1AE 1BXVA 3AU1A 1A6PA 1E67A 1CC3A 2H32B 1JGEB 4P59L 3QAQA 1KGYE 3RVUC 4LGRB 3ULVL 4LCYB 1E2ZA 1KB5B 3FUEA 1QLEB 2X1QA 4JPQA 4M6OH 5F6HI 2Z4TA 4XXWC 1IGFL 3E6HA 5HHME 2FHFA 2NPLX 4GSXA 3DBXB 3KNBA 1MHHA 2V2XA 1OSYA 4X0KA 1T5WB 3P1VA 2F19L 2XWXA 4YBQD 5DA0B 3O3DA 5IKCA 1CL7L 3HVNA 2EINB 3BN3B 4G7QB 4P2QD 5IG7B 3MV01 1KGCD 1N5YH 5MERA 2ATPB 1NBZA 3IDGB 1DVQA 2HTKC 4KVNL 3RGHA 3FAXA 4QXTA 2BIPA 3FO0L 1DQMH 1MW1A 2GUOB 4CSPA 1DO5A 2HLAB 3MZGB 1FNSL 5B39B 2W59A 4N8PA 1G7PA 3ATBA 1LO0H 1QBBA 4U1NA 2Z93B 4JM2F 4XP5H 5F0LB 4F2ME 1BWWA 3RQ3A 4HJGA 4HMEA 2B2XL 3IXAB 5CJBA 1ETZB 1XWVA 3QDGB 1T1ZA 3WEXA 4O2EB 1NC2A 1CUOA 3FUIA 5D2LA 1OLLA 4LSRL 5DJ0B 1HI6B 4S10A 1H3XA 4Z7UB 3I9AA 2HXAA 1UEYA 2PABA 2DDQL 1TTGA 4ZJ9A 4XPBH 1NGXA 3QR1A 2VDMB 4U1IB 3UGUA 1N5YL 1XTLA 1ZHKB 5D7SL 2K3TA 2J5LC 3CBJB 5GRXG 1N6QH 5ESVA 3WDIA 5JZ7D 5TE7H 4FP8H 2Q0ZX 1SDAB 2NW2B 5DK2A 5E9AA 1KELH 3B9KD 3IMUA 2ZSVA 3D85B 4FFVD 3V4PH 4R26L 5HDRA 4HSAC 4Y2LA 4XBPA 5AZEH 5HDWA 4LKXB 5IIEB 1ECZA 1G0XA 1MUJB 1AAJA 3FC8A 5FO7A 2QVTA 3ZDWA 3V9FA 3WLBA 4F58L 2ROXA 5CUSL 5ANMB 2FAUA 3PGFL 1ACCA 4G6AC 1DP0A 4FLRA 3W11C 1AKPA 4F37F 4C4KO 1LHZA 1OZTG 3D2UD 4NQSB 3MLXL 3DMMB 2VMFA 25C8L 3PGDB 3IRZA 4AZUA 5G4OA 4MZ3A 3K3QA 4RDQF 4ENED 4RFNC 5B1CA 4B96A 2A74A 3H2PA 1GZQA 5CO1A 4DGVH 3SGDH 2HG5A 3ZHNA 1X4YA 4KXDA 3DURA 1DFBH 1JUFB 2F54B 1TG8A 3X12B 4DIXA 3EZJB 2WO4A 4RA3A 2DY2A 2OLDA 1JZ3A 4TUJB 1OT2A 4KKBD 2QQNL 3NJLA 4ZUUA 3TX4A 2BY3A 3O6LL 3D0VB 2CDFA 4OV5A 4YUEH 1V27A 4HWZB 2NR6D 3UH8A 5CZXD 4HIHA 2B5IB 3UG4A 4GI8A 1O75A 5I66B 2C4FT 2ZKXA 8FABA 5BO0D 2PWDA 1DDHB 3IK2A 2IV8A 2E9WA 1KBVA 4AQ8C 2BS9A 2MTAA 3H9ZA 5IB5A 1BG1A 3DHUA 1DVFA 2AEWA 2J5WA 3VFUB 1IAOB 2AXWA 2J88H 4YLQT 2NW3B 4UM9B 5GS2D 3Q8BA 4XGZA 2ICEB 5IMOB 2IALB 4ANVA 2D3VA 3N04A 3GK8L 5TFSL 1AXSB 1NCTA 3ZKXC 4PVBA 5CP3A 4IOSD 5BJTB 3EGSA 2NY6D 4KTYA 2YAQA 2ARJQ 2YD4A 2DLTA 4YR6A 5GRZA 1T03H 5IFHH 5C07A 3J2PA 3AS2A 4Q9RL 1OP3H 3QB7C 4BZ1A 4JG1L 2CALA 3ASWA 2C9RA 2CIKB 2V5TA 4ZMLA 1I7ZB 4P8QA 4OF5A 1G9MH 1U3JA 3ULSB 3MRCB 1K85A 2W60B 4KK9D 1R5IB 2J8UB 5E2WL 2LQRA 3PWJB 1PU0A 3D4YA 1T89C 1XSKA 2APVA 2DV6A 4AIZA 4EDWH 4FQ2H 4Y4KA 4RAHA 2AS5M 4KKCD 1NDGB 2I32A 3M6DA 5H4YA 2EE3A 4Y4FB 2DIJA 3NIGF 1DQML 2XV0A 4G7YH 4X4YA 3HZYB 1A3QA 4LPWA 2FHBA 2FTAA 2P7TB 1CICB 3CXFA 3M46A 4ZSOE 5BUPA 3F04A 1F3JA 2VJ0A 3SODB 1RZJL 2V37A 3CFBA 2J20A 4B60A 1Q94A 1IGMH 4FQXA 3QDJA 1WAAF 3FF8A 5L2KE 1SRDA 2NX5D 3QJRB 5TH2B 2B20A 4A2HA 1EHAA 4KJYB 3BDBA 5JOEA 1SYSA 2RA1A 4O02B 4ZTPH 2FQFA 5ES4B 3I74A 4U33A 1XCQB 1L0XA 1URZA 3HHRB 3EAKA 4PGCB 4DUXA 3PUUA 2A4ZA 3A67L 3BYTA 3DJ9A 1KCKA 3CX5J 4GT0A 4XP6H 3U7YH 5ID0A 1GGYA 2WUCL 4UQIM 1OAUH 3BLPX 3GNML 4FLSA 4R5XA 1RULL 5ID0B 3WJLA 2YR3A 5AZEL 3C6LB 1RPQA 3DOSB 5LQBH 2O5YL 4ETQA 5T1LA 2CWRA 1OP3K 2WAQA 3TYFB 3JTSA 2W1NA 3SKNB 1KFAH 3HE6B 3NEOA 3IVKA 4M5ZH 4WUUD 5CSBA 4LCCB 2CR6A 1U8JA 2QQKH 2WLLA 1TQSA 5D7LE 1CDYA 2IEPA 2BS8A 3E1ZA 4RBPK 3RBGA 3L9RB 5HYJE 2JIXD 4KJPD 4R3SB 4TVUA 3U1QA 3WUZA 3SKOA 4ZXBA 3TV8A 4MQTB 4PJFA 5LJYH 5EU6A 2AI0L 4ZXBB 1OTTD 5GZOD 1BZ8A 2VDRB 3FOMB 4OZGB 4JX0A 5KBNC 3SCMD 5IM7B 3ZMRA 1FYHB 5MHSD 3QJUB 2VQUA 2DLEA 1UCBL 4PY7A 4FTVE 5MENB 2XX0A 5KS9F 5IQ7L 4JKKA 3TXAA 5LDSA 4OM1H 4QOKE 5ILTH 3QUZA 1IEAB 3N9GH 3O3UN 1NBZB 5AW5B 3HI1B 4HFWA 4PJ8D 1IAIH 3GHPA 1KBPA 4G7VH 4F7MA 3I6LD 5EDSA 1V10A 3MTXA 3I2CL 3UTQA 5JTWA 4BFGA 4RISL 1YEFH 1KIPB 3HLAB 1S5HA 1YN6B 2BSRB 2OXGA 3T77A 4URKA 1GJIA 2BDNH 3OX8B 4QHLA 3L6FB 5F2FA 4F2MB 4DP9X 3BSZA 4H1LH 1DQKA 3EZ8A 1DVUA 3MLSH 2R9HC 4Y4FC 4B6ZA 2VDRH 4C59B 2W38A 3KYNA 3DTUB 4XPGH 1SXBA 1T2QL 1MIML 9CGTA 2OQJB 4FEMA 2WYIA 3VXME 1QUNB 1V05A 4G8IB 2PCPA 2P80D 1IM9D 3FT4B 4UAOC 4YO0A 3VTTA 3PWPA 3D18A 1MXDA 2QMJA 4YDLC 3GUTA 3ESOA 1CZ8H 3FUJA 5LBGA 2IOIA 5D1ZI 1XAUA 3VRLF 3IDIB 4U3SB 4V2CB 2VDPB 2C1OB 3EJYC 3RZCA 5D1QB 4KJWD 4PJ9D 4Y5XA 4XCYB 3MV9D 2IBZY 4PREA 3F65A 1U4EA 4O9HL 4GXVL 1VESA 1IQWL 3SY0A 1NZRA 2AEIT 4UUJA 1TKWA 3SY0B 2WMPA 2YAMA 3IMWA 5GS0L 5D9SB 4U1HA 4Z0XA 1OB0A 1MWAL 5C0ND 3RBSA 2BFGA 3QIUC 4G1MB 3CU7A 5TD4A 3RAJH 4XNXL 4X5PA 5L9DH 4MJIB 1R24B 3O9WD 3F7LA 2QDWA 5KOMC 2Y1VA 4R6UA 3A6BH 5SV3A 1D7BA 1GPOH 2EDLA 4JM2D 2Y06H 3MV9E 1BFOB 1NAMB 4U0RC 4GKZB 2LGNA 4HC1A 2YPVL 3TTSA 3SDAC 2XUWA 4NCDA 5D96C 1U21A 5T5NF 2YFOA 4DKFL 4MKTA 4A37A 5GXBB 1MI5D 4TUKH 4YEEA 5IVZA 4TQEL 1MCJA 4DN3L 4FNLH 2A9DA 4KNTA 1DANT 1I7UB 3EGSB 5CCJA 5KSBB 5GRVL 1F6FB 1IU1A 2HKFL 3ARSA 1E7UA 3D06A 3FAWA 2A4CA 3DXAB 4J7RA 4NQEB 3WEXB 2Q76A 2EJ1A 3NJVA 2AQ2A 4UOW1 4RGNE 2CCLA 3DPBA 1KTKE 5FOBA 4XNUL 3F64A 3WEAA 3GLEA 4HV8A 3S7GA 5AENA 2CRIA 2XIIA 2XT1B 5EN2B 4K7PH 2VR6A 3W37A 2E6QA 2XTJC 2NZ9D 4Y88A 4OZIB 4OCNC 5FUZL 1XR9B 2F1AA 3LRSA 1CK0L 4XMLL 5SWSB 3ZL1A 4OZIA 4XPAH 3SJVA 4YFLI 4L2YA 3FULA 4YSPA 5AZ2L 5JIPA 1XB6A 3VD0A 1EV2E 1HIMH 3ZR6A 1FO0A 3WFHB 3FS9A 2OZ4H 4ADIA 4UILL 3LRGA 5IKCB 4MJID 4K3HA 3ETBF 3M1CA 1I9IL 1FFTB 1UKQA 1S7SA 3NJMA 4LP5A 4UT9H 5LUMA 3V0GA 2IXQB 4PHZA 2B9AA 4GRWF 2FQDA 5C3LD 5K9KA 2Q8AH 1KB5A 3SE4A 4NKOA 1JDAA 4NLHA 2F6AA 2VDML 5DVMA 4Q14A 5HGHA 4L4VD 1ADQL 4DOHE 1IZKA 3VXSD 5CD5D 2A77L 3T6WA 2GSGA 1QWUA 3SYCA 2Y36L 4MQ7A 3JV0A 4RGND 4FQCH 4HGKC 3OKKB 3QHZH 3S3PA 2ZOUA 4XPAL 3RX5A 1U3ZA 4LDLB 1E65A 3UABA 3HLKA 1KJMB 5MEPA 5FV2A 2DKSA 4KUCF 2XBDA 4AMKH 4QTHB 3Q48A 1AR2A 3WKPA 3UP1A 2O5ZL 2VZUA 4K5NA 5E6ZA 3B8YA 4AEFA 3W0WA 4U1IA 5EFIB 5CN2A 3GC3A 3O6MH 5KOVC 2XN9B 3D0LA 2JCCA 5EUOB 5AAMC 3G3LA 4B9PA 3BVWA 3LRHA 1MNUH 3M1OA 1P4IH 5FFLA 1BQLH 4RGMB 4UT9A 5FUOH 4O2EA 2YGQA 4IRJC 2Q7NA 5HI3D 4C56D 4WZ9A 3SD2A 3GTNA 1ITCA 3U7AA 2ADFL 1QO3A 5TF0A 3RIKA 3F05A 3PE9A 5MP6L 1D5BA 2JXMA 2R2CA 1S9YB 3GDCA 4GFXA 3QCTH 3AAZB 4U2YA 4OJDH 5E8PB 1FG2A 1MFEL 4TTDD 3VJ6B 2DMKA 5A6IA 4AQOA 2CO3A 4P5TA 2JELH 4JHZA 2EDJA 3OSVA 4HCRA 4QT5A 5CZXC 4P2OD 5GRUH 1QD0A 2V9UA 3GQFA 3CJJA 4V11A 1RURL 4A04A 4IMLA 5C3TA 3ARVA 3MREB 4JEGB 1JNLL 1I9JL 3PQYA 5F7DA 1S9KC 2VE6A 1IAKB 3JTBA 3UTSA 2BY1A 2RB8A 3DHJA 3GJEB 1I3VA 3CD4A 2XRAL 1E5YA 1CVRA 1S9YA 3MCG1 2AQTA 4HEME 4B9YA 1XVSA 1DFBL 4FJ6A 4X5XA 2FGZA 3WTTA 4IU2A 1HYSD 4XBMA 3NP4A 5GS2H 1A7PL 1F3JB 4IM8A 3ES6A 3FSAA 2BHUA 5LGYA 4HKXA 4DW2H 2DQCH 3KGSA 1SJMA 5GS1C 4YXHL 3LIZH 2JCCB 2YO3A 1P7QB 5KVFH 2CIIA 3ARFB 1OAYL 1LM8V 3JTTB 1YUKB 3WKQA 4AVJA 4BKTC 4K7PL 4P4RB 1JBJA 3LMJH 1PX4A 1HOCA 4LLAA 1D5BB 1GRWA 1D5MA 5EMYA 3O41A 1H8SA 1U36A 4ODVL 4MQSB 2VO5A 4BFBD 3RJQB 1JTTA 2XSKA 1G9NL 2VWEE 3BZ4A 1DTUA 1BEXA 1U8CB 1UH2A 1YVLA 2WM0A 4X6EA 5LN4A 1KXTB 5I6OA 5TE6H 3SGDI 2EXWC 2HG5B 1T6BX 1TJGL 3O3BB 1E6JL 3L1GA 3BAXA 2P26A 1JYNA 4EZLA 5E2UL 2Y7MA 1BVNP 4WGVB 5T3ZD 4UV4H 3KPSA 3CVHH 2PWFA 1KLFB 5HHPB 3DSFL 5T1KA 4M62L 1DJSA 3LDBB 3H9HA 1HZKA 4Z18A 1OM3H 2MFNA 1CFMA 1OD9A 2WYHA 2HKHH 1KTJA 3HI5L 2FWOB 1RLWA 3WJMB 3SCMA 4QLRA 3D3VB 5GRJH 1YEIH 1QR4A 1VGEL 2H6UA 2MOQA 5HHNB 1EGJA 5IQ7H 2IANB 4PVMA 2WY3B 4M1GH 3IDYC 4GUCA 4OFYD 1NANI 2QKIC 3GB7A 3K1DA 4GEIA 2HWZL 1YSOA 4GRWB 1P5UB 3CNKA 3ETBJ 3IDUA 3GHBH 2IQ9H 2JJWA 2XTSA 4H88H 4Q6KA 1QR1A 3MLRH 3DJZA 3GSQB 1YN6A 1QLRB 3Q2NA 3ILDA 2R9HD 5J1AB 2H32H 1UT9A 1G9NC 4FG6C 3IF1A 1QLRA 5AVVB 2BZ7A 5CN3A 4JQIH 3SQOL 4AL8L 1ZGLM 2WZ6A 2AJ3A 4LDCA 1M9WA 4N0UE 3TYFA 1JJUA 5C0JA 1VFMA 3CFNA 3D8MA 1DL7H 4QRTB 4Z7WB 2EIZA 3GPEA 1ZXQA 3QORA 5D1XA 3QUMA 1U8KA 3QI9A 2NT1A 4KI5F 4LQFH 2ZUQC 2NX5E 3GNMH 3ML9A 2HFEA 4UM8B 2XWEA 1XZWA 5T3XH 4XP9L 4N3UA 3K6IA 4LBAA 1JGDA 3FUDA 3VMOA 5BVJB 3F7QA 1QNZH 1OSZA 5DC0A 4H40A 4JM4H 2X4OB 2BCKB 3FFOA 4KUZH 3CFJB 2DAVA 3US9A 4LLMA 1A3ZA 1BIIA 2H0FA 2HJLB 1AFVH 2BWQA 4FLQA 4DZ8A 1J0IA 3KPOA 1NGZB 3NTCH 5AD0B 1GC1C 2B59B 2VZTA 1NAML 1BPVA 1RJYA 2FRGP 5BV7H 4PUBH 3EKCA 1SMDA 3HS0C 2GT9A 3OKYA 2QADC 1I1AB 1MCPL 3MRLA 5GS1A 4HOXA 4DK6A 1T03L 3GBNH 1R6VA 1GGTA 4Z7OF 2G3MA 3VU1A 1T04B 2OL3A 3ARGC 3KPMA 1IL1A 3GJFB 4BFFA 2YD7A 5HHMD 3N9GL 4OZ4B 1GS8A 2NX5A 2F9BT 2ICWB 1I1RA 2Z7UA 1MF2H 3JWDH 1MDTA 3EFOB 4XVJL 4FG2A 1WA2X 1J05A 1EGJH 3BE1L 2LT9A 1JRHH 1I8KB 5DMGD 3QQ4B 3RVTD 1EJFA 3VI3A 3ZE1F 3A6BL 4M6NH 1ZA3B 2KERA 3JWNC 1AO7D 3LKPA 3TWYA 4KDWA 2AAVA 2VL5B 5CJOH 1K8IB 2HUEA 5EZJB 1CXKA 5C86A 1MCOH 3U6XS 4IGBC 2CXKA 1XH2A 3RY4A 2JJTC 4HUNB 2DQEH 3QHTC 3SO3C 3EO1B 3WFBL 2C9UA 1J9QA 4PJ7B 3HFML 1I7RA 4MRBA 3V0FA 2ZSWB 4HKBA 4Q9QH 2UZIL 4NN7B 5FGCE 1CD0A 2VDQH 1JOIA 4NN6C 4W4NA 1N0XH 1N70A 4ERSL 4W9FC 1DQLL 3OGCA 1ZHNB 2Z6FA 4GW4A 2VQ1B 3BO8A 3TFKC 5L8KB 1WP6A 3V6FA 1S7WA 3WMQA 4LOUC 2CNZA 2DEYX 3ULAB 1RKRA 1I1FB 2VDNL 2QGBA 1J1PH 2XA3A 3R1GL 5GGQL 3CLWA 4U1HB 5HGHB 5IJCC 1G7LA 2CKBA 4RMVA 2I7OA 3M86A 3D48R 3V4PL 4ZX3A 5KJRL 4DP6X 2R8SH 4TSBH 4DN4H 3PDOB 2D3LA 1W72A 1U3HC 4QRSB 2FSEA 1FL5B 1WS8A 5I0DA 3MBEC 2IOMA 5DZPA 5J12B 1GMIA 2PXYB 3VI3B 1ZK9A 4WCYL 2EXSA 1DE4B 2J6WA 3FOLB 3MLWH 4G3YL 5J5EA 1MNNA 1CTMA 2R0KL 1TNNA 4QHKJ 4AEHL 2A6DA 2XWJA 3ME0B 4P5SA 3E2HB 4ZBJA 5C1MB 4AQ8A 2P5EA 3LZFL 4YHKH 4HETA 4H20H 4U7MA 2DDQH 5C09A 3DRTB 3UIYA 5I16A 3REWB 5KVMC 4RZCB 1W0YT 4U7SA 2VDRL 3ZE2B 4KK8C 4UWQB 2YLKA 5HD8C 3JWNH 15C8L 3V9EA 4N2KA 3I6GB 1W2KT 1PSKH 3DVNB 5DSCA 1S46A 4LSUH 5CJQL 4HWEL 2WXMA 4GYBA 5DA4A 5BW7C 1ORSA 1ZHKA 3FPXA 2GI7A 1AMXA 4QGYA 3D6GA 4DN3H 4PHXA 4HIPA 3V4VB 5FYLD 5I1KL 1KTCA 3ULVC 1HWGB 1LO4H 2ERJB 1D9KC 2SODB 3FRPB 2O5XH 3KDMB 3DX0A 1NDMB 5E5MA 2P9RA 5HYSG 2IAMB 3H3BC 3HNTL 3MJ8B 4ZO9A 3D39A 3BT2L 3QNXB 4UT6H 3A4DA 4YHPB 3O2VL 5FEBA 1DJHA 1Y18A 3FL7A 3RNQB 4HQQH 5G2NA 2VLJD 3N1PC 5FYKE 2VRQA 3K4ZA 5D4IA 2CMRL 1HK6A 1Z3RA 2O6PA 4JRFA 2DI8A 4ZMVA 2O1AA 1KNOB 5IJBC 1FVEB 4H8HA 5GS0H 2WN2A 3C8KA 1XCTA 5JQ6H 1MCBA 1QEWA 2ZE0A 1X7TA 1ZT7B 2YMXL 3T1FB 2JB6A 3ZPDA 4M02A 2WUBL 4JPKH 3TONA 3RFZB 3CLFL 5E70A 5AG9A 3QPQC 1YQVH 4NQEA 4WY7L 4HIJA 4ZUTA 3ZDZB 5A1AA 5E08L 4KKRA 1QTPA 1DBMH 2UXVA 1BMWA 4IU2B 4ZMZA 3IFPB 4UOJA 2EDYA 4K7PX 5EC1A 4HQQL 3LZQA 3EBIA 4DKFH 3M1BA 2XJKA 3L3KB 3VFRA 4PJ7A 1K8DB 4HX1B 3LPPA 3U4EA 4WW2C 2NY4D 2BSTA 2VABB 3KCPB 1K72A 5CZKA 3DX8B 4WHYH 2YXVA 5DC2A 1OT4A 5D1QC 3IPEA 4MNGE 1NM4A 3RZCC 1MSPA 1NCWL 1KLFA 5HHPA 4LPXA 1I85A 4JRLA 1A1NA 1CGTA 4ANKA 1ODUA 1QSFB 3T0AA 4AVHA 1UVQA 4Z7OE 5D7LA 4I9WE 4DHLA 5CILL 3R8BB 2I9TA 3UTPE 3L3IB 4HUUA 4PV8B 3V4VL 3O6FD 4AG4L 4W9HC 4TOYH 5EORL 3P3UA 4ZS7H 4BJLA 3FQRB 1X7SA 1BVKB 2CK0H 3N91A 4YXKH 2JNZA 1I3UA 5L6YH 2WXGA 3MREA 2DQGH 4HUKB 4QHUA 5KVGE 2YAEA 4P23A 1ZWIA 5DJAA 4Z7VA 4G5ZL 3MRLB 4DJMA 2VJXA 3SDCD 3BCFA 4OTXL 1BXUA 2WP3T 4GG8B 3DMMD 4LRIA 4Q74A 4Y4FA 1W80A 4XN4A 5ESQA 1QPXA 3GMOB 3MLWL 5DQ9B 1WFNA 1A2YA 2X6MA 5F7HA 5E1QA 3MLZH 5DMKA 1G7QB 1H8LA 5DUBB 4IRSB 2I69A 3CBKB 3GSWA 4F7TB 2FEDC 4NBYB 5HJ3B 4BM7A 2VE6B 1JF1A 4N6QA 3UTSB 3PIQA 1XF4B 4GUOA 5I8OH 4KO5A 4MB3A 4BFEA 2XG4A 3GRWL 1KC5H 4FJYA 1FDLH 2G9KA 3ZJAA 2XETA 1DLHB 1U3HB 1HH9A 3GS7A 4EAEA 1CB4A 1E30A 4Y4HC 3VSTA 4LLWB 5KVEE 3CMOL 4I2XB 3NEEA 1BJMA 5FYKL 3BP5B 3DOSA 4LP4A 4PVLA 3S35H 1IEBA 5IFAH 5BVJA 3NJGA 3K2IA 4F7EA 5TQ2L 1C1EL 1DVFD 3SPVB 4F8NA 2X3BA 1GGIH 2NTFB 3TESA 3BKJH 5I28A 1AE6L 1WD8A 3QIBD 1AC0A 3KL5A 3MVSA 4LLVA 2X05A 3MLUH 4XNQB 4Y89A 5DFTA 5HGGS 1OANA 1DLFH 4A6YA 2G3ZA 1QO3B 2AEPL 4TPRH 2Q2EB 1CGVA 4E9RA 1A1MB 1R34A 4DEUA 3WJLC 5FGBA 4DCQA 3F83A 3X1EA 4NJAL 2ZUWA 4DETA 2PO6A 1M57B 2HG0A 4HWUA 5DHVA 1WC7B 5D4HA 2NUTB 5DUMH 1O9WA 5FW8A 1YUHB 5EIVA 3RUGA 2CDEB 1LP9E 3V79C 2LU4A 1ML0A 1P4IL 3THMH 2UY6A 2CUAA 4UDUA 3HNSL 1MCFA 1VACA 2GSIB 3BP6B 5ETUA 4G42A 4HKZB 1IC5L 3D07A 2GJJA 2FL5A 3HN3A 4YZFE 4UDUB 5EBMA 3RWEA 1EANA 4RETB 3O2DA 4RFNB 1QFWH 2XWJB 4RZKA 1JSYA 1SGKA 3ZDXE 1WD9A 5K9OB 3D0AA 4KFZC 4LSUL 5CJQH 2HFTA 3ARBC 4NQXB 4LLQB 3GYRA 1HQ4B 1F45A 4LEXL 4YIQB 2BW5A 1KTDB 4LLDB 4YQXL 4UAHA 5IB3B 1WF5A 1U8NB 3RPIA 4QJ3B 4PRPD 5JORB 1U8HA 3RY5A 2NUPB 4RRPG 1LP9F 3FB6B 3KYKH 3DIFB 4TV3A 5IOPA 4LLVB 4Z3JA 2WIIA 1FCGA 2XWBA 1FNGA 4DKDC 4JZJB 3DARA 2F5AL 2DD8L 3MRRB 3WKMH 3S48A 2IGTA 2MEJB 4XB7A 1HSBB 4PI0A 5B38G 4O2CA 3QUYA 1JWSA 5CEZL 5HYQA 4AMXA 1WTGT 1JPGA 1RUQH 4M7JL 4NZUL 3CZLA 1D6VH 3WNLA 3U6XA 5F0MB 4D9QD 2WXQA 3QI9C 1RD6A 2H1PL 3LIZL 4YAQA 4MJIA 3OD3A 2DL2A 5AB0A 4Y4KB 3WS3A 1MLBB 4WI9A 3V0WL 5C0EB 2ZWNA 4HEPG 1JGLL 4XHJD 1Z9OA 1GOGA 1KF9B 2HTLD 1A7OH 4ZG1A 2A6JA 2ZX9A 3TCLA 1RPUA 3QH3A 3VXRB 1CFSA 1G7QA 4KX8A 1NLDL 1R3KB 3BWUF 5MEND 1F11B 3ZO0A 1OAKH 4WFHD 5BRZE 4B9CA 3NK4A 1A22B 5MP6H 1NGPH 2XPGB 3LXAA 1J9CT 3Q8FA 4M7LT 1BBJB 5I73C 1PJWA 5BZDB 1INQB 3OHMB 2AJYH 5LDUA 2YSTA 4HXBL 5F70A 1TZIB 1DBBL 2BNQE 1FO0L 4G9FB 4K9EH 5AW8B 5I8KL 3VXNB 1CTOA 2NNCA 2FX7L 1RMFH 1S7TA 1ZLUK 4ZFOL 3ARTA 1XSOA 2NQDA 3K71B 5AWNH 5EB9A 1ACYH 3DA0A 2PW2A 1YEJH 3OAYH 2DQMA 1BLNB 2EILB 4P9HH 1RVFH 3HC0A 3Q06A 4N2BA 1FH2A 1X5XA 4MZRA 4ZNEE 2R27A 4YHLH 1Q72L 3I50L 4HU2A 2OMZB 2OR7A 4GXVH 4X7TB 1ZY9A 2HT3C 2NYKA 1QWNA 2F74B 3IWUA 3QORD 4PRPA 3QP3A 1B3IA 1JP5A 4V1DB 3VWKB 3KPQB 4YAQB 4ELME 3KWTA 5TF1H 1YLBB 5DJDA 4YHPA 2NXZD 3BQUC 1HL4A 2PTTA 3G5XA 4MGXA 3SOTA 1WZKA 4WDIA 1F86A 2XN9A 1IM9A 2Y1YA 3D0LB 5EUOA 5F3FA 5GS1B 5HHOB 4QR7A 1QSFD 1F5WA 1S7XA 1WFJA 3VGBA 6FABH 1BVKA 3C60D 1NDMA 5F7EH 3C6SB 5D8JL 5I76B 1YEWA 3D51A 1FVEA 3QJXA 5EOCJ 3AXLA 4X50A 5KYXA 2ZYIA 1AD9A 2R23B 2L04A 1JWUB 1R19A 4QTFA 3QWQB 1F4XL 2O61A 5M95B 4WU7A 4Z8FH 3S98A 2KLRA 4DTGL 3FXIC 2PTVA 3KDPB 4FS0A 1AZZC 3FW6A 4IS6A 2C7UA 5FO8A 3M8OL 5F9DC 1GA2A 2CRZA 1RZJH 4X8XA 3ZKND 4YHIB 3HOGA 4M29A 4FJZA 1VHPA 3V6OA 2JI2A 4PGEB 4GRLA 3U0TB 4E36A 3L6FA 5AAWA 1IMHC 1X9RA 2H6PA 5IB2A 2FT7A 3OZKA 3CUPB 4XPTH 5I6LA 3MUHL 1K4CB 3QDGA 4PTTA 2V4LA 2NCMA 2Z7WA 3BKYL 1K4CA 4BSVB 1J9SA 2XQYG 4JN2A 5BQDA 5KVGH 1F90L 3BP5A 4HUMB 5TK4A 4OW6A 4NC2B 1S9WB 4ZOCA 2FNWA 1AQDB 1GH7A 3W0WE 5CLZA 3RHWK 4AV4A 4OLUH 3ZL2A 1USZA 2NCEA 4JG5A 3X14B 4ENEC 5D96B 3ARUA 2VXSH 1NCAH 2WO3B 2UV3A 3IBEA 3UTSE 3DO4A 2GABA 1E8WA 3WXVL 3ZZLA 2IWGA 2QADD 5DEGB 3QYNA 3DMMC 1A3LL 3I9GL 1ZE3C 1FFPB 4F3FB 3DJRA 4GKNA 3UC0H 4BSVA 5B3SB 2CHXA 3OC5A 4Z76B 1BFVL 1WGOA 2AI0H 2XTLA 1D2OA 3LMJL 4H1LA 4AY0A 4APQC 3A0OA 2A73B 3AT0A 5I1IL 1PG7L 1J86A 4P57A 3QQ3B 1U2YA 3LY6A 2Y5QA 2G75B 1TVDA 3BVDB 4LASL 1J8RA 4K23H 1J0JA 3LEXA 2VDLB 4N9GB 3AQYA 4FL4C 1UUSA 2Y7SA 2BP8A 1MCQA 4AI7A 4PJHE 4I13B 4JN1L 1MH5A 2DLFL 3UTTA 4JJ5B 2AQ1A 3QQ9D 4LRNH 2CLZB 4QRSA 1SLUA 4XOBA 2XZAL 2YD9A 3ES6B 1L7TH 1N8OE 5I66A 1EAPA 4NZJA 2AQSA 2VB5A 5F7UA 3L9BA 4E41A 3ARBA 1OAYH 2QV2A 3K5SA 3GMRB 4Q2ZA 2ICWA 4B50A 2W07A 1CF8H 2CIIB 4HS6A 4HK0B 1A1OB 2SEBA 4GKOA 4XMVA 2TRYA 2VABA 3GTVA 3KCPA 2P1YA 1CD8A 1KCVH 3BHBA 3LEYH 3LSOA 3UYPB 5CEZH 3KPNA 2JCWA 3S5LB 3ZRFC 4G8IA 3R7RA 1CIDA 3IDYB 5F3HA 2YPLA 2ZXDA 4YC2C 3IJSB 1M7IA 3B3IB 4Y1TA 4MD4B 4OFPA 4PP2A 4U49A 4XX1G 4PH8A 2HKAA 4HCFA 3TVMB 2WLMA 1YEEH 1WZLA 5L2JA 1YMMB 3DUSA 2X88A 3KLDA 4GT7A 5D7LB 4D8PB 5HDLA 4YHYB 1YYML 4C83A 3MRCA 1EWHA 2EDQA 2MRYA 1I9JH 3NESA 5A2CA 5FKAB 5DRWA 1MCHA 1YA5A 4UTCA 5CGTA 5GISL 3FB7B 1J8HE 2VMCA 5I1AA 2BWDA 4DQOH 5EF3A 3DO3A 3VWKC 4F5CE 4HFWB 2AEPH 1W9XA 4OCYH 5E7BA 3WFDH 1OGPA 1IZJA 1R17A 4F92B 4EN3D 3EJSA 3DKHA 4MXWH 4NRYA 4X4KA 5AVRB 5IB5B 1BEYL 4PW4A 2H0PA 3MRMB 1BM3H 3D34A 3T6ZA 4OZFH 2J7LA 1SOSA 3RHWF 2VDOL 2VZOA 2X9YA 4XCNA 2GYSA 3K6SA 1X5LA 5H94B 4K8RH 4EZKA 5JMOC 1MAMH 3EJCA 4PGZA 1Z3GH 3FU7A 4ZUUB 1PG7X 3PJSA 3QIUA 3BZEB 2WLKA 2WBJB 4U6HB 4OQTL 3CN1A 3ZT7A 3C09C 1G7JB 1TENA 5I8OL 2X40A 3VGEA 3GZKA 5IUCA 3W39B 1ZV2A 2NNAA 4LEXH 2P44B 1MJJB 2NNRA 1MQKL 3ARFD 1RIHH 3ATAA 3VFTA 3FCUB 5GIRB 6FABL 5E94B 4W70A 1CF1A 1PAMA 3EO9H 4QEGA 1BMZA 4G6FB 4PGCA 3AREA 4YBLB 2VDOH 4XE5B 5C07E 4AYEC 1KUMA 4KI5D 2E7LA 2QPEB 2B1OA 5T1KB 2WV3A 5EEZA 1SN0A 2BIHA 5H8DA 2ZAHA 1ZXKA 4MDJB 4XNYL 1CK0H 3QHFH 4AQ1C 4WWKC 6TAAA 2PO6B 3DTXA 1FSKB 4PJ7E 4OZIF 2VMDA 1YDPA 2BC4A 2DQDL 1KB5L 3HHMA 1ZGLB 4R97B 1NBYB 1N3NB 4JJOA 4EI5A 4HWEH 12E8L 4WU7B 1L3WA 1E50A 3DYPA 2CXGA 3C5JB 3FH5A 5LB1A 4NFDA 1EGJL 1Z9SA 2HFEB 3BXNB 2UY7B 4JPVH 4JR9H 5CP7A 2J8HA 5F9WC 1EHKB 2NY4C 3I84A 1RIVL 5TPWL 4ELKB 3K0WA 4Z95L 4KITB 1A6TA 2WBJD 3KYOA 4AYFA 1G1KA 2NUTA 2VDNB 4FXGB 3BP4B 4B7LA 4BA0A 3LXBA 4FXGA 1JPSH 2BHFA 2YPVH 3OG6B 4ODSH 4WLCA 1BBJA 4FMVA 2QZQA 1JCVA 2EO1A 1QHQA 1V5JA 1FNEB 4XI5C 4KTGA 5FO2A 4ZFGL 4JFYB 4G6FD 3ULUD 3TPKA 4NDMB 2HFFB 5JIKA 2K4WA 5ANME 1A21A 3RWFB 3EOAA 3FN0L 3MGAA 1TVHA 4WEMB 3SYQA 3SEPA 1WZ1L 3KEDA 3ERXA 4ZXBC 1T6WA 4G8GD 5HVHB 3TT1L 3N1MC 4NP4H 5TDPA 3ZE0E 1U2HA 4R0LB 3QIBA 2QSCH 5KYXB 1PF3A 4EPSA 4F7PB 2E7CA 5C0GA 2XVBA 4UQ2A 4HXAH 2FECL 4NRZB 1U6AL 2H2PD 4U1JB 4TNEA 5DURB 4NRZA 4P57B 4BH7B 2R1XA 1WT5A 1BREA 4JRXD 3UTQB 5I18L 1WA1X 4D0CA 1JK9A 4JS7A 1TOXA 4MD0B 2WW8A 4JE4B 2DWYA 1MFEH 4MDRA 4WWKD 4YLCA 3OQRA 5DI8A 4OD3H 1JPTH 3VG9B 2RFXB 4ES8A 3OZ9H 2C9PA 3K2UH 5K39A 5KAQF 4OVUA 4E68A 1E5UI 1HNYA 3B7YA 4GMSL 3O9WB 2ICEC 1ZEAH 2NY3C 4A6YL 5DHYB 4GG8A 2WWKT 3IU4L 4HJUA 3P3TA 4X80H 3DI3B 3EHBD 1IIIA 5IK3B 1EEZA 2G5RA 3GMLA 2CSPA 5F8RC 3VWJC 1E3ZA 1KJ2L 1WCBB 5IVXF 4X6DE 5DD3H 2R2EA 4FG6D 2BFVH 3TH3T 4ZUVA 4IBUA 2MNUA 5I82A 4NP9A 1Q0XL 4FA7B 3VFOA 3FCTB 6PAZA 1I8MB 2E6PA 1I75A 5LLIC 1A7RL 3Q44A 5H37A 3QT2A 4ODBD 3RFZC 1EXHA 1LO4L 3LAFA 5EO0A 5JORA 1CFVL 3BRGC 3MQIA 3CZSA 3BH8B 1FN4B 2AK4E 4L4TE 2EIEA 2N1KA 1A4AA 2IBBA 5KS9B 4OM0L 5EEYA 1PD1A 4XNYH 5E5MB 1K8DA 4HX1A 1JFQL 1MQ8A 5FKAA 5KS9A 5I6PA 2EDNA 4DP4X 3DTXB 1XCWA 5SWSA 4P5TB 1XD0A 2XN1A 3LKSA 4EQ3A 1JZ2A 5J6GA 2BWIA 1FGVL 1PY9A 2OMVB 1IGFH 1N64L 2BSBA 3KPRE 4TVSa 5FYLE 1XL6A 3OL2A 4G6KH 5J12C 1Y18B 3D1MC 3JVFC 4K5LA 1JYXA 4NN7C 3HPLB 3MJ8A 5JYLA 1FVCA 1K2DB 1ZHBB 1MEXH 3UPAA 5F7EL 5GJSH 3QFJD 3IETA 5KSUA 2EUXA 3MLTB 1XL4A 5FECB 1HE7A 3SJVB 1ZT4B 2GUOA 4PBWD 4JAMA 4UV7H 2E7DA 4OQ1A 4HFUL 2X09A 4IQHA 3LKSB 2WUCH 3ESVF 3UZVB 5F1IB 2DWXA 5IW1B 4KJQD 4HH9A 1OSPH 4R7DB 4HF5L 1TSHA 3FQNA 1DQJB 4XPFH 1XV8A 1FNAA 2GW5A 3QW9A 4FFWD 4W4OC 3FFCD 5CSZA 1G7HB 1FUNA 4ZX4A 3I6GA 2DKUA 1H3UA 4B9IA 3TO2A 4EIZC 5SWZE 5FW6A 1KPVB 2ZWSA 3K2KA 3GHBL 4ZFZB 1VB9A 1D9KB 2ZOKB 2K45A 1IRAY 2Z7ZA 1QQDB 4JY4A 1GGUA 1ACYL 3OAYK 2HRGA 2Y23A 3WY4A 4ANUA 3ZDZF 1WAAA 5CZRA 2E76C 4JKLA 5I76A 3L3KA 4MLIA 3VFRB 5E94A 4C55A 4ZQTA 1FH5L 4NP4L 3QDGE 5ACZB 4PSRA 1UZ8B 4WU5A 2X4SA 4G7YL 2DICA 3TJHD 5F1KC 3WN5A 3RWGA 4E5XB 4P3DA 4BXSV 3WFEL 2DQGL 4OKVA 1S7SB 4CN4A 4Q9RH 2FO8A 1AY1H 5CS7A 1JGUH 2CK0L 1FSKC 2YIHA 2F58H 4PPTA 2A9AA 5ICYA 4Q6IA 4LE8A 5AYQA 4DEPB 1PCXA 2P8LB 3SJVD 1WUNT 1HXYB 2XNAB 4FKKA 5LNGA 3BPOC 1N18A 3LZLA 5D1QE 3VSQA 1WISA 4DSYA 1IKOP 1RU9H 2JE8A 2PP9A 4XCEA 1GPOL 2B1HH 1I7TB 3BKCL 4L0ZA 4K5MA 4PGDA 2VIRA 4OGAC 4OH2A 5B1KA 2Y3AA 1N0LA 1Z32X 5G4MA 2D73A 1I8LC 3BD5A 4LLWA 3DC0A 4G8AC 4YE0A 8FABB 2WWKO 1JL8A 2J12B 1WAPA 5SWQB 4J3OH 3NRPA 4K3EL 2XZAH 3TV3L 3IM1A 5EEUA 1FBIH 1LDPH 3PP3K 5TJWK 4TUOA 3OMNB 3GJEA 2ICEA 1PZUB 1FA4A 1X5IA 3KWUA 1MJJA 4AENA 2TSAA 1RXLA 4Z7NB 2D2CC 1ZKAA 4U3XA 4UQ9A 1MCOL 3JXAA 3OAUL 2P52A 5E8NB 5LGJB 4L29A 2MQ0A 2ZOTA 3O11B 2XV3A 5EU4B 4PJAA 1NFIA 4EUPG 3KLSA 1RJCA 3S6CA 2YOAA 2FBJH 2ZSWA 1URLA 3GHEH 1S9WA 1WT5C 1P7HL 2KPNA 3MUGB 4HT1L 1BHGA 3SDDB 1I8UA 5HI4C 5I75C 1EERB 4AIOA 3NJKA 5DLML 4KY1L 4I85A 4LVOC 3ARXA 4XBPB 4EI5B 2Z91B 3PGFH 4QO1A 2V0AA 3CXDL 3HI1A 4YDIL 4J3BA 2PYFA 4F3FA 1NFDB 4ZMWA 2UY7A 2GITA 4NENB 3WIHL 5LNDA 3ALWA 2Y7NA 4JDVA 2EZ0C 3UCQA 4WKXA 4F9PA 2A1WL 2BSCA 4PY7B 4F93B 3ZGIA 2JTDA 2YPKA 4MJHA 1HQ4A 2ROYA 3LNFA 5C6PB 4HHAB 5E00A 3WCYA 5HHNA 4DVRH 4JNXA 3PQYD 3V52L 1H19A 3JVGC 5F9OL 3NCYS 1PZDA 4N5UA 3CSBA 4MMXC 1L0QA 3LX9A 4GKSA 4O5LH 2KPWA 1O7DE 3H0TB 3FTYA 1OAJA 1TYRA 3GXIA 4Y9BA 1OM3L 2CUMA 4LU5H 3EHBB 1JMXA 4U6HA 2ZXAA 2Z9TA 1EHLH 4KZ0A 1AZNA 3FUFA 3P4LA 3VWJD 4BZ2L 4BZ1L 4AL8C 3PWNA 3NJIA 5GZND 5JHDB 5D7KD 4D94A 5A2JH 3S37H 1J1OL 3GSUB 4HW6A 2VXUH 4XCNB 4P9HC 2MCAA 2YD3A 4PJIA 1RIUL 3DVNA 5DSCB 3IFOA 4NCC2 1AGCB 2MOVA 4HOMA 1RZPA 1USQA 1NC2D 1DSYA 1SQ2N 1PKQE 1MRDH 3CK0H 2D7MA 4FN0A 4OQTH 5AFAA 4J27A 3VXSE 4AKOA 1U8KB 3QI9B 3GGWA 3RGVB 4FQIL 3VB8A 4QRQA 4X6FB 1ZLSH 3O0LA 4Q7DA 2VLJB 3BPLB 4WHYG 4HIEB 3CPLB 4LGSB 3T3PE 4AQ1A 4H0HB 4MYPA 4P3CL 2ICES 5ICUA 3TBTB 1CZ8L 3P3YA 2VLKD 3GXTA 1KTBA 2YGOA 5E4IA 1UASA 1MFCL 3DNKA 5KVFL 1R5IA 2J8UA 5IM7A 3L3OB 2X4PB 4NI6A 1YG9A 4I7ZC 3Q13A 4GXUN 4BFOA 3D4GA 4UF7C 1I3GL 1TPXB 5I17A 1GYCA 4Z7WF 2KMWA 4F8LA 3QXTA 5DJDB 4YDKH 4IDJL 3UTTE 5IHUL 3AG3B 5EUKB 2Z65C 1K4DB 4PJ5D 1SDDA 4JO3L 4X9YA 5F1NA 4P5KA 1QVOB 2OM5A 2YRZA 1D6EA 4U1SB 2WXIA 4YE4L 5B1JC 3ZIMA 1DEDA 1S3RA 3KLKA 3KHQA 1F13A 1LNUA 1E6JH 3KJ4B 3VXRA 3Q5TA 1QHPA 2AVGA 5AW2B 1LNUB 5KYYA 2B0SH 4XCYA 4XAKD 2OJZL 3REWA 3SDXF 2DTMH 3MROB 3O45B 1ORQB 2MTPA 2IGFH 4RAVB 2IADA 4IRJB 3EBHA 4ODHL 5F1NB 3EF7A 3FFCB 4B3EA 1XGZA 4DPCX 3QDMD 3BEVA 1T04A 2OL3B 3KPMB 3Q2WA 1A9EB 1LMIA 5G55A 1SNRA 2EE9A 1OQXA 4J4PA 3LNEA 4UM9A 2NW3A 1IC4H 3B1UA 2VMJA 4YHOH 5F9AC 1HSBA 4ZYKA 1A65A 2PP8A 5DVKA 3N2JA 4P46C 1GYAA 2F58L 5GQBA 4DO6A 4PRPB 4RGOH 1WCQA 4IRZL 4KRPB 2X6VA 4LIQL 3KPOB 1ZSDB 3SE3C 2P45B 2WNXA 4P4RA 2R4RH 3WU1A 4Z3GA 3S36L 3B2UC 3BEVB 4JFZL 4A6YB 3K71A 2EUWA 3A47A 4TSAL 4RNRB 3VXUD 5DJCA 3PG2A 5IQLA 4IGBD 1D5XA 2WBKA 1KLGB 3VNYA 2HJKB 4FI7A 3L3GB 3GKWH 2WCSA 4AGLA 7FABH 1UM6H 5E4EC 3RVTC 3UTSD 3ZYJA 3WUWG 4OF6A 1YRKA 5CUSH 3ZMEA 1NJ9A 4WK2B 3RTQB 1HX0A 1NGZA 5AD0A 2WOBA 1QATA 1H6FA 2JCCF 2EVHA 2IQ9L 1OPGH 1C5CH 3O3EA 3ARFC 1BFVH 4NKOB 4LB8A 4ZS6D 5SWZB 1TJIH 3CV5A 3NK3A 5F7YC 2R4RL 5E2VL 2IDQA 1V7NL 5IWLA 4GG6E 2BDNL 2GY7B 4CJ0A 2BSRA 2JV6A 1ET5A 1JK8A 3ROLB 3LN5B 4MCZB 5BZWB 1E2WA 2Z7YA 3I50H 3Q1EA 1UWXH 4U1NB 4N25A 4MA1C 4RCAA 2AABH 2VM4A 2PPFA 4JFOA 3BEWB 3H56A 3H7LA 3B43A 3CUPA 2IG2H 4H8PA 5IEHA 5D1ZD 1GOFA 1T20A 4HWZA 1PZ5A 2YPLD 4B5ZA 4NJ9H 3IYLW 2WVVB 3WMSA 2XYCA 3GGWB 2I9LB 1S4IA 7PAZA 3KR3H 2JK5B 1AYRA 4JL2A 3WO4C 2M2DA 5JQHC 3LS5H 1MJ7L 5BZWA 2H9GB 4CVXB 5ESVB 1YEHL 1KGXA 2J8UE 3D50A 5IBUB 1MHEA 3BSGA 3DBXA 3KPPA 3KDMA 1LO3H 4PV8A 3UL4A 4FX5A 5T3ZH 1FGNL 4C56A 1TQCB 1BPLB 4XO8A 3PDGA 3AWEA 4FTVD 1JZ5A 1AD9B 1H6TA 1PW3A 2R23A 4NHCH 5E6SB 3TIEA 1NFDA 3TC9A 2V9TA 1Z9NA 2YAPA 1PLGL 2K8MA 2EEXA 2Q86A 4O02L 4P2RD 5IG7A 2XIBA 3T4AA 4IHBA 1G7IB 4ODWA 4FQJH 2V2TA 2DBLL 2CG9X 4TPRL 3L3DA 1I1FA 1EQWA 5IK3A 2FT6A 3FCSB 2ZSVB 4D0CB 2W95A 4ESKA 4OR1A 3MV7A 1EBPA 1DANU 4AMWA 2UXFA 1S9XA 4ALAL 2ED7A 2WKOA 2Y6TE 2VERA 5LO7A 4B0MB 4P2QA 5ITFA 2Y22A 1JERA 2AZAA 3QEQE 5EWIL 5I5MA 3KZ8A 1F4WH 1OL0A 1KV3A 4KHXH 3LRMA 4P49A 2GFBA 1A6TB 2IQAA 1EO8H 3AY2A 1RZ7L 3GUFA 2PP7A 3EJUA 3L95A 3VXUE 1UZGA 4B0MM 4M43H 1W0VB 1QSEB 2M8XA 3HI6H 4DW2L 2XQ0A 1E90A 4GO8A 4E41B 1ZV9A 5J11B 2EIKB 3O8XD 1B3JA 2DQFA 1J05B 1LMKA 2ZNXA 1HCVA 1AG0A 1L7IL 3FMGH 3OR7A 3R4RA 3JWNG 4HLJA 3V5HB 1LE9B 1BVNT 5DVOA 2ENJA 4P4KB 3SKJL 3JVGA 2IGLA 2D2OA 3QPQD 5LGJA 3WKML 3QEGL 3PWPB 4OKVB 1C16B 2EICA 3U82B 2WO2B 2FQEA 3QUYB 4XMUA 5KJ7E 5B39G 5JHMA 3MDJA 1U8MB 1ZDQA 3PP4L 4PWGA 2YUZA 4WW2F 3HG1E 1JGUL 4BGLA 5FM5O 5F96H 4YDLB 1NC4D 4L5FH 2J6EL 3AT8A 4W9CC 5E6IC 3WFEH 4JFDB 4D9QE 4FXKB 1AD0B 1HWHB 2K1MA 2YSSB 4IU3B 4JM0A 2G0LA 2O6FA 5JHLA 4GMTL 2XQBH 5HHQB 4HIJB 3HJ0A 2XZZA 5HI5C 4GQRA 3OKNA 4DP0X 5GGUA 3HMXH 3BE1H 3ECBB 1VFAB 4JJ5A 4WK4B 1N67A 2B0SL 3AGVA 5I9QB 2P5WB 1F2QA 3FHQA 3INOA 4FFTA 3GMOA 5E99H 2OI9C 3G5WA 4MCYB 1OGTA 4Y1AA 3UBHA 5EZPA 1KIRA 2OXHB 5B38A 3OWRA 5E5LA 1D5RA 3FTVA 4PRPE 2EDKA 3RA7H 4W68A 5LVEA 3I6KA 1CBJA 3BP6A 1HEZA 1KOAA 1VDGA 2N59A 4M56A 5TGBA 1WFIA 1CFTB 3QEQB 3PFQA 1QOKA 4DKEL 4GQPH 3EF4A 1M53A 4JGNA 1KFGA 4N0YH 2YMXH 4I88A 3T2OA 4Y5YC 1QLEL 3D12B 4Z7VE 5C0NC 2VLKE 3QDMB 2RCSL 3VG9C 4TN9A 4KUZL 3S9DB 1ZS8A 1U91A 1JPEA 1SJEA 3KS0H 3LVTA 1O6VA 2GBAA 4I89A 4AV5A 3CLFH 3T04D 2OR9H 4EOWH 4JVWA 4MAUH 1M2VB 3BMWA 3JTSB 4K2UH 1P7KA 3MJ7B 2G9HB 5I0VA 2VZSA 1EEUA 2HRHA 4WTQA 2QEJA 1QFWM 3RA7L 5IW6A 3KGRA 1I82A 5TTRA 4WI3A 4Y4KC 2C8NA 1LK3H 1ZJAA 1TITA 1T89A 5DJCB 1HNFA 2F18A 4AGNA 5DQ9A 5IB1A 1VIWA 4PJFF 3K74B 4OJFL 4CMHC 2E9GA 3FT2B 1X9QA 1LYQA 1NBVL 3L17A 4Y2NA 3Q8AA 2HKHL 3P4MB 3X17A 3BLKA 5DJYA 5KVDH 1WC7A 4X99B 4AX3A 4BUHA 1SHSA 3L4ZA 2ZCHH 3Q6FA 3S5ZA 3L9RA 1IGYA 3RNKA 3L3JA 4FXLA 4IS6B 3O3EB 3GMMB 3CZUB 3C8HA 2E0PA 3HUJF 4OM0H 1EUUA 3ARWA 4P2CG 4A2GA 3OB0H 2ICWI 2L4OA 3MO1A 3O2WH 1EAPB 5B8CC 1DVFC 2VZ3A 4IKLA 1C7TA 1A9BA 2ZPKH 4R2GB 3SYAA 4CNIB 2G5BA 4MAYD 4JPIA 4JHAH 3KR3L 2HTKD 4LKCA 5H4ZA 4Y19D 4Z0BH 4XPHH 1KB9J 1I9RH 4IBLT 3TM6A 3BKYH 3QJTB 1CD1B 5FFGA 4LLYA 2EP6A 4XXCC 5C6WH 1AO7A 1Q9LB 2ITFA 3QUXA 2VDKH 3BUDA 3T2NH 1CF8L 1T7WA 4FABH 4H0LC 3GJFK 4XCCL 4ONFH 1QG3A 3P9MA 5EBLA 2PO6C 2P24B 4L29B 3KXFD 2HRPL 2HLFC 1INEL 2O26U 1O6TA 5A7EA 1KGCE 4AUJA 2IH3B 3NRFA 2GHZA 5T1DH 4NYLB 1AHWA 2AV1A 1PBYA 3U79A 5JYMA 4BSWA 2D9CA 4WWPA 1OGAE 3IMBA 4QRAA 5IT2H 1R3IH 4XB8A 1QW9A 1Q0YL 2VN4A 3N40F 1COBA 5KYUB 3PABA 5DTFA 1RUML 5KBDA 1PZSA 3G9VA 4O51A 4G9FE 2FJHB 3D25B 5F7FA 5HVWA 5JQIB 2HMIC 5GGSB 3T3PF 3L5WA 1UXSA 1SQMA 4ONFL 4U6YB 3MV8E 4ODSL 2KZKA 4LDOB 4ZTEA 3QYCA 2P8PB 1QYGL 2BVPB 5DI8B 1MH5B 3WFCL 3GMPB 3K8LA 3QUZD 4B9FA 2OMUA 1AI1L 1M7XA 1GSMA 1RY7B 2D9QB 1FFNB 4IJ3C 4HYTB 4QRFA 4X5XB 4D0BA 2R1XB 1WEJH 3BAKA 3A3YB 3VVWA 1YYLL 5AL8A 1CFVH 1Y0LB 2A3TA 4CGTA 1KJ2B 4NZRL 3V4PB 3QXWA 5KSAD 4EZJA 3GUTB 4KC3B 4NO3A 5IVXB 4BK8A 4BKLB 2YPVA 3OAZK 2YQBA 1BQSA 3WKYA 5HYQB 1Q9OA 3H9YA 4G83A 2YAFA 3PWNB 1CLYL 2EABA 4M7LL 5EEXA 1CLOL 1F4YL 3EGDA 2H0EA 4PTTB 4ZS7L 5D7IA 4X2UA 5B3JE 2ZWLT 5IB4A 1H9VA 2DM3A 3MRFA 3HPJA 1LD9A 3QDGD 3QORB 5FYJE 4HKJA 3FT3B 3NIFE 3V52H 5ILTL 1TYJA 3KLHD 3QBTB 4ANXA 3DX6B 2CUHA 3PWPD 5PCYA 1A6UL 1VPOL 2KC0A 2WMPB 1KG0A 5DS2A 4WDIB 4N4YB 5HHOA 3ELAT 1MI5B 3CFEB 2EC9T 3A4FA 1RUKH 3PWVB 5CBEB 3FH8A 1ZT4A 4CMMB 4EN3B 4MQXC 2F5BH 3GRBA 3OZ9L 3VDCA 1YY9D 4F33A 3KLHC 4I87A 3PWVA 4JG0L 1OXYA 3WO4B 1ETZA 2AF2A 2CO4A 3QNXA 5E24E 5JIHA 3D39D 5AKTA 5D1QA 1XF5B 4FLHA 3D87B 3IRPX 4JFDD 4MS8C 4PJCF 3K72B 3ZBMA 2X5PA 3B6SA 2X0UA 3BUYA 3MKKA 1HL8A 2DQTL 3EYFA 5HI4D 2HVKA 4BXVA 2CE6A 4F24A 3QZPA 4LSSL 5DJ6B 1T7VA 3F2LA 1ZHBA 3F7YA 3QFJE 1JNHA 2ETWA 2PPAA 1KIUB 1CDIA 1T3FA 2AJVL 4ZTPL 1XT5A 3MCYA 3WGVB 1QLEH 4LPYA 2P5WE 5D2NA 4GFTB 1HCYA 1WTLA 3L4VA 2ZP8A 5SX5H 2WTRA 1I7UA 4NX0A 1M6UA 4LFHD 5GSVA 2V5YA 4GW1B 4GIOA 1INDH 1MCCA 2FJFB 4K3GA 2WBXA 2H2SD 4XCCH 4Z3TA 1DBJL 2VDOB 4YR6B 3QDMA 4JFDE 4P4KC 2ADJA 2XWTA 2AAAA 1HHGB 2JCCE 2PWEA 4WI5A 1SZNA 1GY1A 2QGCA 3GMNB 1YNTF 4FXGC 4WWOA 2OKMA 3ZDXB 3VH8B 1IM9B 4DUVA 5AEAA 1A5FH 4CSTA 5AG8A 2LTQB 5IMOA 2ZX8A 2VXTL 3VYPA 3FKUS 3GSRA 5I8KH 1BJ1J 3U25A 1DVSA 3I3BA 4Z7WA 3OSKA 4MA8H 4AITA 2ADYA 3QUMH 4R84A 4JGJA 1OB1B 5D2LE 2X89A 1GS6X 1LEGA 2OMZA 3FUKA 4MD5A 2CJUH 1BF8A 3BRDA 2Y25A 5FYJH 1RU9L 4LIQE 4JO2H 3E6FA 1U0QA 2BOLA 2R59A 1P4LA 4EEEA 2ALWA 1Q72H 3ZHKA 4H2AA 1VFAA 1QI3A 4Y2OA 3DGGB 1YNLL 2EYTB 3HE7A 2A38A 4JKNA 5HVHC 1JZIA 2YUXA 4X6EB 3AMKA 3C5SB 2XPYA 2EYTA 3HE7B 1EMTL 4KQ3H 1SY6H 2N56A 1TJGH 4AZ8B 4TNWK 2J6EH 3DK2A 5GHWH 1PKOA 3WS3B 4OF3A 3N1FC 4DT2A 3BPNC 1EAQA 1OZUA 2W91A 4Y5VB 5DMJB 4AJYV 1PDKB 5CXPA 4NQDA 5KG9A 5CHNA 3FCSA 4C47A 3OF6D 1KIQA 3EYQD 4IBSA 2Q20A 2XN9E 1L9NA 4PRID 5EUOE 3KLAB 1A7BA 5F8QC 5F89B 1QHOA 3HAEG 4A6YH 2VXVL 4LSDA 1HXYA 2XNAA 3C6EA 2DD8H 3HRZA 4CILA 1H6UA 1ASOA 1AQKH 4PRHE 2DQFB 5JOPD 2J25A 3RDJA 1INEH 4IMKA 4A2DA 1NICA 2VLRA 3VX1A 2RHEA 3AQDA 3GRWH 3UP6A 5KSVA 5F6IC 5EIQA 3TA3A 5IV2B 1JGVH 3AG4B 4BK5A 1N0LB 2GCYB 2GI0A 2H1PH 3WN5B 1X9LA 3U9PH 2FUQA 4G2AA 5E03A 1S78C 2AJXH 3E6FB 1RFDL 4UTBL 1NPUA 4PMEA 1LK2A 2VR9A 1UWFA 2ADIB 2CBOA 4FD0A 5IBTL 4AIEA 1S9VB 1KEML 2SEBB 2XKUA 4M9OA 3EYQC 4WWKB 1LE9A 1HHJA 1OP9A 4LXFA 2MH4A 3JV4A 2OMVA 4PN6A 4AZ8A 4RMBA 3L9EA 2DQJH 3WL9A 5KBKA 3TBWA 4PCSA 3UMTA 3K72A 1E8YA 4X6CA 3C5JA 3WSQL 5I15L 1HHIB 2ED8A 1NCAL 3LVEA 1C7SA 5FO9A 4PJAF 2C4FU 3N55A 1TCRB 4LL4A 2MPAH 4OLUL 1KELL 2GFBB 2IQAB 3OAZH 1OCRB 4Z6AT 3RLSA 2R56H 5E8DH 1C5DA 4M03A 3OMZA 2JJTA 4X0KB 2BZCA 2J8UF 2ZX5A 1XGPA 1AHKA 5GGRB 2C3WA 4EKXA 3N42B 4UQCA 1TTBA 2YEZB 4KRMB 4RISH 4FA8A 2IMMA 1YEDA 1BAWA 3AU0A 2VW7A 5D2NB 2LAGB 2AW2A 1NCNA 1UA6L 1IC5H 4HZAA 5AW9B 2FWLB 5DURD 5BOJA 7TAAA 1R3LB 2OW6A 1HHIA 4JRXB 1HFUA 4RMWA 3UO1H 5B39A 3NZUA 2FBJL 3FU0A 1P1VA 2P5EB 2KDYA 5T5FA 4YN3A 4NZDA 3DV6A 5DZNA 2AZUA 5HJGA 3SDYH 5E9DB 1XGUA 1I9EA 3MYJB 1FF5A 4P05A 1ACZA 3L2LA 5AW6B 1FL3B 4G3YH 3SDCC 3SDAD 4OF8A 3O0RL 4PGBA 1TJXA 2IPUG 4JM2C 3SE9H 4O00A 4PJIB 3TWCL 4H1LG 1HDMA 4ZMOA 2HN7A 5B7FA 2XG5A 5FXCH 2M26A 4KK5D 5BOPA 5JZ7C 3V0DA 4KJQC 3DJTA 1P7BA 5JOFB 1A1MA 1EIBA 4DTGH 3MJ9H 3OJ2C 3O41B 2IH9A 2FIKA 1THAA 1UACH 5J6GB 4UILH 3BSZH 4LSSH 4AJWA 2C26A 2OCJA 4CDGC 5E8OB 3BAYA 5AZ2H 1UD2A 3MBWA 5F97E 5KS9E 1U3YA 1R46A 2ITCA 2LU7A 2Y07H 3CC5B 3MLPA 4MJ2A 3O3BA 2GPZA 3SDDC 2AK1L 3FN9A 5IT2L 5JDJA 1KCRL 1OK8A 3L8QA 3LZRA 3U6RA 1QUNA 4FLOA 3O8XC 3FB7A 5DEZA 5EA0L 3CVIH 4NHUA 5CEZD 1ZA6A 5DO2D 4NKQB 4DEPC 3MLYL 3ARDB 4U6XB 4J2XA 1A2YB 3CTTA 4B53A 1XF2B 3E80A 3NJXA 3NCBB 3ZKMD 5SWQA 1HESA 3FU6A 3TJEL 1JDDA 1BVLA 4BIKA 3HC0B 3ZRCC 1H3VA 4F2MA 1ETB1 4JANB 3MHZA 1AKJA 2ZICA 3GI9L 3IAQA 3PIQB 4OCLC 1DBAH 1OGAD 3SDXB 3FF7A 1HJCA 1BFOA 1IC4L 4PY8J 5DK0A 1MFMA 4HK3J 3UPRB 2OAAA 3I02B 4ZMPA 2W9DL 3SHSA 4MA8L 4Z77A 1AP2A 1NOLA 3NIDF 3T0VA 1AC6A 1ESOA 1HAWA 3B1TA 1R3HA 3QWOA 4RGNC 2GUYA 3HMXL 1FPTH 4W9JC 5D93B 1IGTB 3PWLA 3GMRA 4Q2ZB 4ES9A 3WHXA 4DGIL 1WS7A 3QZWG 1A7QL 5JUEH 5KYYB 5AKVA 2BVEA 5LN8A 5C70A 5FWRA 5JIDA 3KGUA 5T5NG 2BNUA 1AZVA 4HZLA 5INDB 2CBQA 2J3SA 3M8OH 2YKLH 4UMGA 3KGTA 3WTSA 5CP7B 2I9TB 4NZUH 3B2PA 2NY5H 2YRBA 5GSRB 4PW9A 2FBRA 2X9ZA 4GSDL 5EUKA 5KBMA 3PXJA 2D0GA 4KKAD 4NLAA 3BVNA 3MA9L 1MPAH 1Y1DA 2H45A 1MQKH 1OGSA 2WYTA 4GLRH 3VFNB 1MVFA 4DKAA 3PAVA 3H9SB 3HBPA 3UACA 3FONB 1E4JA 4TUUA 3INUL 2J1KA 1PDKA 2BOCA 2QT6A 5L88H 2X70A 1X6NA 3APNA 1DQJA 1AGDA 1PZ5B 2GJZB 1ZVSB 2WK2A 1RJYB 3GMQA 5FWQA 5EBMB 3RWEB 4YXLH 2EIBA 2E75C 2YC1B 2MHAA 3T6VA 4WSGA 2YBGA 1JZJA 4OUUB 2EDFA 2JB5L 3QO1A 2L7UA 3BI9X 4PLKC 3CHPA 4N26A 1E9OA 2K6ZA 1N2RB 1TZHB 2IDTA 1JHLH 3LNHA 3SKUD 2OS7A 1FL5A 3ECVA 2V33A 4CU8A 4G71B 4P9HL 2VH5L 3RUGF 3UC2A 1EHNA 3HCVA 5FA3B 1QA9B 1G5AA 3RIAF 4Z3IA 1E28B 4QRPE 3OKEB 1UXWB 1F8TH 3QDHA 4OCXH 4PJBF 1DYZA 5CKAA 2O30A 4P5TC 2N4IA 4HIEA 1R5WA 3A6CH 4GRLB 3P9WB 5CCKL 1S6NA 1S7RA 3HAEA 1FE8L 1Q1PA 5K9QI 4KZEH 3ULUL 3VAEA 1NCOA 1R5VB 3EFFA 5IF0A 4HVBA 4GNKB 3WEBA 3TIEB 3FQ4A 1R0AH 1G9EA 1QI4A 1SLVA 2KLTA 3MBXL 3HVDA 3SKOB 4C56B 4LSRH 3TNNA 1ONQA 5HI3C 4M61A 2BNQB 4Z5RA 5C07B 1ZSHA 4DK5A 2X1WL 5AW7B 3WIHH 2E47A 1OD7A 3P4OB 2V9RA 3FQTB 3VXOB 4HJJL 2EXWD 4I0PD 4ICWA 4NFCA 4OBSA 5K33A 4CADA 4TM9A 1F8TL 4YHKL 3RPKA 3HG3A 2C7UB 2IDFA 5DRZB 2GVYA 3MLTA 5FECA 3WTVA 3AVEA 3U30B 3PP4H 2CR3A 3LKQB 3C60A 3KLAA 5DRNB 1Z5LA 3ZE2E 3ZTJG 1UXSB 1G5GA 4GQQA 4XODA 1Q9OB 1IEAA 3UMNA 4F7TA 2JKSA 4KGJA 1GZHA 1JZ6A 4Z7WE 3IB4A 2O5YH 4QCIB 1F41A 1KPRB 4G8EA 4K7PY 1FFQA 2RMNA 3QJOA 4P23D 1BD2B 4L1DA 4WHDA 5JPMA 1N0XL 4ERSH 1ZVHA 3C2AH 3V9CA 5IJVB 3P02A 4D0BB 2R39A 3PCYA 2X3CA 3QZLA 5FIEA 3UAAA 3S3CB 1L6ZA 3POCA 3KYMA 3FU9A 3DURB 4MJ6A 5JW4Q 2EDWA 5FS5A 1N4XL 1ODAA 1W0VA 3DIVA 5IQMA 3BRFA 3ZK0A 2VWEC 1A7QH 5JUEL 1HNGA 2WYZA 4OJCA 3QAZC 1BAFL 3S37L 5IGXL 5LBSA 3L1FA 1TO4A 2R1YB 3GO1H 4WI0A 3ZT6A 4NUJB 4UOZA 3VFOB 1M7IB 3B3IA 3IDMA 4A38A 3BC9A 4QWWD 5EG6C 1EXUA 2W94A 1VKXB 1VZGA 1HH6A 2C3VA 3MRFB 1RZFL 5C0CD 5F96L 2VR8A 4IIZA 1FORH 3ZSTA 2OMTB 4RGOL 4X5LA 2ZPKL 1CI5A 1VA9A 3O11A 3UIZA 4FE9A 3UC0L 2Y5TB 5CGMA 1WITA 3X13B 4I0PB 1B2YA 4JMXA 4AJ0A 4LNVA 3ZYIA 5JHDD 2FX8L 3U4EB 3UAJA 1RZKH 1DN2A 4NYLA 2ITCB 1RLBA 1GJUA 1VFBB 2GTZA 3KE0A 5AQ0A 4OZFA 2AXFB 2OBGA 3EJQA 1PGRB 3RVVC 5EN3A 3ZXAC 1V55B 1P84K 4GMSH 4QUOA 2K7PA 2DZEA 3H53A 1QBLH 4OVVA 3MYZA 2VKWA 2R0WH 1BAFH 4P5KB 5L8LB 2VC2H 4NIYE 5HGDB 2N7AA 2EUVA 3EYUH 2X9XA 1XF2A 5IHUH 3ECQA 4N8UA 1E3XA 1A6WH 1LP9B 1GZPA 3UG5A 3VDAA 3UBXB 5T8IA 2BVOA 3LKNA 4V1DE 1NMBL 3FRPG 3LIUA 4M5ZL 5BZZA 4Y5YB 5I1LA 4FADA 3MNVB 4YE4H 1RZGA 3DUUA 4RMRA 2OJZH 4P2RE 1NAKL 5L2KA 4KHTL 1W91A 1E4KC 1M3IA 1AS7A 4CBPA 5ENWB 3QEUA 4UTAA 3O45A 2WZPD 3MYJA 4ZSOA 3TT3L 1JDCA 1UOLA 3SKJH 5CSGA 5HYJA 1CGSL 1ZTXH 2EDDA 3ISWA 3FN3A 3SDCB 4DEWA 5FOJA 1E9QB 2V7NA 3CN3A 2BXZA 3FHEA 43CAA 3LJ3A 1JNNH 4OIIL 1A7NH 2ZTBA 3EJRA 5F44A 4NQUA 1MFDH 5HJBA 3UDWC 4MSWA 2Z4QA 1OV8A 1M7DA 4Y16A 4XC3H 2FZ3B 4LCIL 2OA9A 3DETC 4XO3A 2Z92B 2E9BA 3N50A 4CUCA 4PJCA 3TPUA 2AK4B 4L4TB 4DAGH 2PYED 4AQZA 2GIYA 4IRJD 4HKJB 3S97C 2D8KA 1YNKL 4QRPD 4KRNA 3VXRE 2JJSC 4KKCC 1JGIA 1FFOB 2QPSA 3D33A 4JKMA 1DEEB 3LD8B 4GUPB 1MEXL 3JV6A 4HAFA 4CC4A 1TZ8A 3F62A 4Q56A 1MFAL 1KXVA 3JV6B 1A0QH 1ZANL 3LKOA 3ILPB 1DZBA 3OPZH 6CGTA 4XPGL 3VXMB 1EJOH 4Y1AB 2XV6B 1DJYA 1TETL 2K6YA 5CNHA 1SF5A 3B2MA 4AV0A 2HUHA 4E9XA 2YAHA 3RUGB 2BSDA 1A6AB 4AXWA 5IW3A 4Z7NE 2IANA 3HE6C 5E7FA 4XWGL 1D5ZB 3AROA 2CGRH 2I60H 4ZZKA 3QRLA 5CJXA 5K59F 2ZWYA 3L3JB 4R4BB 3MNMA 4LF3A 2BIMA 4ZI8A 3RX8A 3EXJA 4KVPA 2GQHA 4M8QA 2UWEA 3AS3A 1YECL 5I24A 1TU2A 5MEOB 2JKLA 2P7TA 3TEUA 1JIBA 4AW7A 4UCFA 2ATKB 4OGAD 2ZF8A 5I30L 3EYSH 1NLDH 1YO4A 4G9DA 2JKTM 5BZDA 3U7WL 1HHJB 2ARJB 3VW3H 2Z35A 5JW4R 4L3EB 2Q6WA 4FTVB 4OCMC 4QY8A 4U6VH 2Y2TA 3NT0A 1G1CA 1XQ4A 3KPQA 2BJMH 3UXFA 1JZEA 3VD4A 1E27B 2CKBL 4NO3B 4I4WB 3ZE1E 3OKLB 4L8SC 1UJ3A 1MKFA 1JZHA 2A6KA 3ASOB 2DWEB 3P73B 5GZOC 3SBWC 2ZKWA 4D8PA 3FJTA 5FUCC 4WI6A 1GYWA 3WD5H 2X0VA 3U46B 5T1LD 2Z1KA 4QOKA 1SJHB 4WEBL 3GSVA 4OFVA 5HHOE 1IC7H 4OZFB 4D7BA 1T66D 3F58H 5HI5D 2WGNB 1AQHA 4Y1SA 3B37A 4HIIA 3WNMA 1K8IA 3MRBA 1S2EA 4JY6A 4FQHB 3UAJC 3DSNB 3MV7B 2PCYA 4OQTA 2J2ZB 5JW5A 4QF1B 5T3XE 3UEQA 2DBJA 1OAZH 2ICCA 3LEVH 2RR3A 5MEQB 3KPSE 1A6VL 3IJYA 1P1ZA 4JRYA 3RVXD 5BS0A 2E59A 4F57L 2XZQL 2WPGA 4GBXC 4DWHA 2G2RB 3MXWL 2UYLA 3CFCL 3QXDA 3I3DA 4RQQB 4CW1B 2AITA 4ODUA 2FWUA 1CICD 3MRDA 4Q97A 3L7FB 1SY6L 4Q52A 1FZJB 3CZNA 4HP5A 1EVUA 3ZKNC 3ARQA 3SJVE 4MAYB 4R4NC 5DO8A 5AUMB 2JKIS 4WSKA 5EO9B 1OE3A 2DWEA 4MAYA 2H9GA 3D08A 2NSMA 1Q0XH 1GYVA 2FLBT 2X4PA 1BIHA 2OL3H 4NOFA 1KGWA 3VFTB 1G87A 2FX8H 3QQ9C 3N85L 4M7KL 4JDEB 3CFKB 3HPLA 5D7KE 4EMZA 2OQJA 4KBPA 2V6HA 4UM8A 5AKSA 3GXDA 2VCOA 4BZ2A 2V7HA 3E8UL 2GJ6E 1YMMD 3UO8B 5T5FL 1TJHL 1RV6X 4FFYL 3BN9C 4WFGE 4Z7QF 1HILB 5FYKU 3HN8A 1F6AB 1QRNA 3TVMC 2G4GA 4XP4L 3WTUA 1GGCL 1OT1A 2Q76B 3O2DL 4XN8A 5L0QC 1XGTB 3RFZA 4OF0A 2WTRB 3PQYE 3HG1A 1T5WA 2C9QA 3Q6FB 4G70B 1TO5A 1X5FA 2VDLH 4OJFH 3E38A 1IBHA 3BH8A 1D5ZA 3MLXH 4YSRA 4B9JA 3EO0B 3F7YB 2WZ0A 1RERA 1DBJH 4I9XA 5B38B 1DBML 3O4OB 4A7UA 3GINA 2F7RA 3ULUF 4MBRA 1QEXA 1UURA 4JFFE 5C0IB 1DHKA 1YEIL 4HHAA 5L2KD 4IYKA 3BWAB 3P2BA 1XGYH 3B8SA 5DMIL 5SX4I 3G5ZB 3BP7B 4AW4A 1PMYA 1WBXB 3F7PC 1MRDL 1I8AA 2UVFA 3QXVA 3SZ6A 3VVVA 2HKFH 1T4KA 4KRPC 3S4SB 3IKCA 1BEYH 5DJ6A 1IAIM 3QO1B 4R5VA 1FP5A 1SJEB 4N0YL 2NSXA 5KWYC 2RGSA 4JE0A 3H42L 3NACH 5EN2A 3DX6A 4EN3C 1B4JL 2DI9A 1FPTL 3U83A 4DERA 5KVEH 3BIKA 2BP0A 1NSNL 3MPCA 3QCVL 4TNGA 2D03H 2DWTA 5BNXD 4CVXA 1U8MA 3L1EA 4R7NA 2WLHA 4F7CA 2QMKA 3Q8CA 2E56A 4ZS6C 2DLGA 2XYBA 1HINL 2QDVA 3V0AC 3AABA 4N1EA 4ZT1A 2XICA 3L2MA 5FV1L 5KSBA 5LG6A 2EXTA 1OKEA 1ZVYA 4HGWB 2XZCH 3RWIB 3A6CL 5AOJA 1HL5A 4HUWA 1RZFH 3G6AA 2UZXA 4NAQA 5IFHL 3O6KL 3UJIH 2ADIA 3SB3A 1XXFC 3KJ4C 35C8H 1BZDA 2H32A 4RWHA 2CGRL 2I60L 5CGYD 3T0EB 1IKNA 4AEIL 2BS71 4IK6A 8PAZA 3ARDC 5KW9L 5L4JA 3LN5A 1Q94B 3EFDH 3O6FB 4FERA 1MHHB 1CDCA 5CMAA 1NCBL 2H5UA 1SXCA 5KVDL 2A5UA 1ZT1A 3U36B 3ZT5A 3MXWH 1BFSA 1J1PL 3R1GH 1V7MH 3INUH 3KM2A 3NABH 4E5XA 1MELA 5KG9B 4LHQB 2IPUK 3PXLA 1HH9B 3M17B 1YHPA 1UACL 5AOIA 4DP5X 4EI6A 1YMHB 3LQAL 2VUYA 5IQNA 5E1HB 5AB1A 5I1LB 1BYNA 1D2PA 1KACB 4GSDH 3FQRA 1SVCP 2PR4H 3QK0A 3DVGB 4JO1L 1OCWH 2GIXA 2OJEA 2X2YA 3UBXI 5CFHA 5JW3H 3NZHL 2HT2C 4XXCA 1CE1H 3SGEH 3TBCA 3A22A 1PG7H 5D1XE 4HJIA 4JFPB 2LU3A 2WOYA 4GPVA 2JXMB 3W9EA 1AQMA 4OIIH 4K8RL 4XXWA 1RUQL 4M7JH 1HAUA 3CN4A 4N0UB 4CDHA 1IVTA 3WFBH 4ZYKB 4M1GL 2K6WA 1CU4L 1PJ9A 4RX4A 4PB0L 4UBDD 4D0DB 3C60B 1KENL 4L05A 3QJFB 4ZPTB 2MSPA 1G4MA 1U8JB 2VDQL 2DIEA 3AM8A 5G4NA 4LEOA 5D72H 1P5UC 4XHJC 1AGBB 2I07A 1CTNA 5GRUL 2YRLA 4XNMA 3ULUE 2HA1A 3L13A 3K7UA 3LV3B 3QUZB 2NT0A 2YKKA 1SF3A 4GRWE 1GHFL 2A0LC 5DWPA 3RNQA 3TNNB 3R7QA 4N5EC 4H26B 3L45A 5JIQA 1DSFL 4ADJA 3IDXL 2Y9RT 4Y16C 3HLAA 2A1WH 5BZXA 2R0WL 4LZKA 4JQIA 3HE7D 4BK4A 2AQ3A 3PHOB 3VGAB 3C8KB 3H85A 3MV7D 3TN0D 3DRQA 3BH9B 2VISB 3ET9F 4LCUA 3NAAL 4QT5B 2CBTA 1F4HA 2R0LL 1A6AA 1DQQA 3PNWB 1FE8H 5BRQA 1FL3A 1IAIL 3G6DH 3BQUB 2WWOA 3KPRD 5GSVB 3FTWA 1KYOK 1WK0A 3CAFA 4PCKA 5D72L 5H94A 4PLOB 1CD1A 4E9VA 3CFIC 3C9NA 2F68X 3CVIL 4HWBA 4OLWL 4Z3FA 5I8CB 1U33A 5JPNB 1QMUA 1MCWM 3KAAA 2BVQA 3LN9A 4N2CA 3F7KA 4KX7A 2O6DA 1CGUA 3IFNH 1OCZB 3O4LB 4HGMA 5DHVB 2IDUA 2V8LA 3BW9A 3ZTEA 5KVEL 4RZCA 5GS3A 1XH3A 2F5AH 3TA4D 2OX5B 1J5OL 3I6KB 2D7NA 1II4E 1MVUA 1R9FA 2HJFB 3E3QE 3DIFA 4NFBA 4UNUA 5IOPB 1WBYB 4MS8D 2LFGA 1M2VA 2ZYSA 3Q05A 3NH7H 2W9EL 3EW3B 5JDSB 4WJ5A 3RGVA 3P30L 4GAAA 2W88A 4PS8A 5ANHA 1E5CA 1UM6L 2XWDA 4LCCC 4HGWA 2QVIA 4YZWA 5J1AA 3MACH 3U1PA 1ZS8B 1M7DB 3V4UH 2Y1ZA 4MDJA 3IJ7A 4ELMF 1Q9KA 1XHHA 3WJMA 3L7EA 2IAMA 3FT2A 2ZUUA 4JO5A 4PJDA 3MJ7A 3STZA 1JF6A 2A99A 3MUJA 4ZMXA 4QXUL 4LSVL 3BZFA 3QZBA