4YMPA

Crystal structure of the bacillus anthracis hal neat domain in complex with heme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
112
Chain Sequence
VFDAVIKAYKDNSDEESYATVYIKDPKLTIENGKRIITATLKDSDFFDYLKVEFHDVKVLSEDKRKHGTKVIQFEVGELGKRYNMQMHILIPTLGYDKEFKIQFEVNMRTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Bacillus anthracis Hal NEAT domain in complex with heme
rcsb
source organism Bacillus anthracis
molecule tags Heme-binding protein
molecule keywords Internalin
total genus 22
structure length 112
sequence length 119
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ympA00
2H3KA 3OVUB 2K78A 4YMPA 3QZLA 3S48A 3QZNA 4NLAA 3VUAA 5D1QE 3SZ6A 4WJG3 3SZKC 2Q7AA 3QZOA 2ITEA 3RTLA 2ITFA 3QUHA 2Z6FA 3QZMA 4MYPA 4FC3E 4H8PA 5D1XE 2MOQA 5D1ZI 3QZPA 2O1AA 3VTMA 4H8QA 2O6PA 3SIKA 3RURA 2E7DA 3QUGA
chains in the Genus database with same CATH superfamily
4N85A 4V33A 2R0WH 5AZ2H 4ONHB 1M1XB 4M93B 2X1XR 4RBPK 5AW1B 2G3MA 3GTTA 4F8QA 4Q97A 4W9JC 3S96B 3RX5A 5IHZA 3SZ6A 2YAPA 5TQ2L 2WZAA 4L48A 4PUBL 2NY5C 4N0YL 2A5UA 2EEDA 3I50L 3HBGA 3WGUB 1Z66A 1CICA 3ZKND 1G84A 5DVNA 3U0PA 3VYOA 3MRMA 5HXMA 4XPBL 1JCKA 1E2ZA 5ILTL 1OAJA 4OGYL 4NUGL 4GI8A 2F8OA 5EEYA 1VJSA 1FPTH 1LEGB 1U8IA 3NH7L 1AC6A 3V0GA 5EU4A 3TBYB 4FFWC 1HNYA 4WV1C 4HX1B 3T09A 4FQ1L 4JFWA 4JFTA 3LXUX 4WY7H 4YMPA 3Q1SL 3POCA 5JPNB 1CLOH 5EF0A 3O4OC 3MRDB 3PWNB 4QEGA 1A9VA 3B2PA 3FUFA 2J1KA 1Q90A 4G7YL 2VDNB 4B7LA 4ZK8A 5KSAC 5ITBL 4NNYA 4QNPE 2EXWD 3HC0B 3IU3B 2OTWB 4HGKC 3L5WA 4GT7A 4ZMYA 2XTJE 2TSBA 3HZYA 2JWYA 4Y5XA 2DBLL 3UFIA 5IVZB 1RSYA 5IMOB 2AGJL 1PFCA 3B1TA 4IBTA 4M6AA 1BQKA 3ARED 3Q8EA 4F80A 4JFOB 3KPSD 2F74B 2YPLA 2R0KH 3WDIA 3CG8A 4WUKH 1N68A 3NK4A 4K3GA 5CZVL 1F1AA 1KXQE 2IBZY 1JK8A 1JERA 4FXKB 1AZCA 1DSYA 1W0WB 3G5ZB 4XPGH 3MJ9L 1KTLB 4FG6C 4RQQB 5EU5A 4OZGF 5F8QC 5T1LD 5EIIA 5C0GA 2QZQA 1K8IB 2BSTA 1JZ6A 2WQWA 3SPGA 1AOZA 3E1ZA 2X4NB 4CKVX 2VL4A 3PWUA 3GQFA 2AEIT 3U9PL 3C6LA 5DMGD 4NIKB 1XF3B 3ZRFC 2JJWA 1DP0A 2C9VA 3DOIA 4N0CC 4LARL 4WJ5A 1PCXA 3D1MC 3QPXL 4PJCB 3ZE2B 1NAKH 3WUWG 5IR1B 1OPOA 4I85A 1QYGL 3V4PB 3MA9H 2ICES 3OR6A 2ZX7A 3L54A 3RDTC 4UT6H 1HL5A 2NNAB 2A6JB 2DM4A 5D7SH 4JANB 15C8H 3D9AL 4RZCA 5LBSH 2H3NB 4YWGH 4HXBH 2MEJB 2HT2D 2QLVB 3U46A 3EFFA 3ZL4H 5IEHB 3HI5L 1FA4A 1GHFH 4JFDA 2YUZA 3WXVL 4U1KA 3H6JA 5HYJE 2OJEA 3MV9B 2FGZA 3VI4E 3IDIA 4PJDB 3GHPA 4NZTL 2O4EA 1MQKL 2XZAL 3MN8A 3UTSD 1RD6A 5D6CB 5JYMA 4NZUH 6TAAA 1MCIA 1PZSA 2F58L 4QKTA 3M1CA 1QAWA 3CFIC 4EBQH 1WBYA 3RNKA 3FS9A 3NBNA 2C26A 3QFJB 4Q74A 3HB3C 4M5YL 3ZTNH 2J1WA 2QVMA 4NFCA 5FA3B 1X5MA 3BEVA 5I30L 4QAWA 1HEZB 4HIIB 4I8DA 4KMLB 4XC3H 5JOFB 3ARGD 2D73A 3ZTCC 1F1DA 1OIOA 3ABMB 3D69B 4XXCA 1JUFB 1QR1B 2WO4A 3PXHA 4ZFFB 3WKYA 3L5JA 3LEXA 3RWCB 4BK4A 1AAJA 5HHXH 4KMTH 3QJQB 2ZXAA 5DLMH 3M7OA 1BZ9B 3DXAA 4F92B 2J25A 1YDPA 3VDCA 1CCZA 3IAQA 1NMBL 4XX1E 3U83A 4IMKA 4HEME 4A1RA 4DVRL 5CBEA 1ZDQA 1AKPA 4P5KA 2IOIA 3RWJB 5MEQB 1N19A 4AYDC 1XCXA 2QV2A 3KWVA 2GEEA 5HI5C 5JO5B 1BZQK 5EUKA 4NWTL 2ENPA 5EO1A 4M61A 4HLJA 5BPPA 3MR9B 2Q8BL 2YD2A 4LNRB 1DE4B 4DQOH 2NDFA 3FNKA 1GS8A 4I18A 5HGHB 1REIA 1ILUA 1MG2C 4JHAL 4U7MA 2PO6D 3B8SA 4APQB 3IMRA 3KPNB 4HH9A 4R7DA 1R3HB 5GPRA 1YPZA 4EN2A 1LGVA 4WGWB 4EDWL 3CZKA 3PJLA 5IQNA 5I6PA 2AZAA 5CEYA 4YIQA 4PJEE 3FT2B 3KWTA 4IDJH 2IAAC 5T1MB 4HOXA 4QCIA 3KH4A 5DRZB 4OGQC 1LP9A 3TNNA 5CJBA 3WMQA 1S2EA 2D4DA 4Y1TA 2F08A 2E7CA 2X42A 1PD1A 4JFFE 3RWGB 3MYJA 5J3HD 1ZS8A 1AHWC 1RK7A 2VW6A 2FQFA 4P23B 4I4WA 4F37K 1FSKC 3FQUA 5GSRA 3QI9B 4RGOL 3WEBA 4S0HA 4JAMA 3SKMA 4L4VD 3SO5A 5TQ2H 1RPQA 4AK1A 2VE6B 4P46A 3BWSA 1PEZA 2KQNA 5ESVA 5EN2B 3U2IA 2GUOA 1F4YH 2KHAA 1JZFA 4MASA 1KWGA 2XZQL 1J8SA 4LSRL 5LGKA 2C8NA 5GRXG 4ZTPH 1C5DB 4NBYB 4IEFA 1U21A 2W9DL 4PJFF 3QDGD 2CHXA 2IH9A 4BHUA 1JMZA 3TVMA 3NAAH 4MAUH 1WCBB 4GSQA 3DETC 5F44A 3W38A 3JTTB 3QRFM 1VGEL 1I7ZA 3A4FA 2ERJB 5KZCD 2DLFL 3MNZA 3UDWC 3R1GH 3AT0A 3NCXA 2LU4A 2H1XA 1AQKL 1E65A 4GMTH 1LE9A 2XVGA 4L3FA 5GS2D 1J8HA 5ITBH 2HCZX 3OR7A 3OX8A 2QTEA 1JZ2A 3GMQA 2WBJD 3U7AA 4KJPD 1UJ3B 3BAKA 2V6HA 1MIMH 2D4FA 3RPIA 3ARXA 2PO6B 3T6QC 4J8QA 5D96B 5PCYA 1PX3A 5FYJL 1SFDA 1XCTB 4WWKC 1ET5A 3FO2A 3SYOA 1HI6A 3T4YA 1I8MA 1X5IA 4JREB 4Z7UE 5FW7A 1CE6A 3QCTL 4GRLC 2VDQL 5KJRL 1HZHH 4BV1A 1WFJA 2CJUH 1PY9A 4FLOA 1VFOA 4OBSA 2VLKA 1OGAA 1JZHA 4HWUA 1YA5A 5CU5A 2A6DA 1NBQA 3G9AB 4A66A 3QAZB 3FK3A 1MCPH 3MRDA 1Y6MR 2YWZA 4QRSA 1CDYA 4YGVB 3VXSA 4NJ9L 1JPFB 2ZXBA 4TLSA 3DBXB 3QZWB 1MZZA 3BKYH 4BFGA 4CVXA 3QPKA 3MA9L 4OCRH 2OMUB 3HTLX 4HKBA 4PJAE 4Y9CA 1RKRA 1YN6A 3KPPA 4HAFA 5D7SL 2F7QA 1BCIA 5E00A 5LBSL 1PLBA 4AE0A 2BCKB 2XBTA 3X11B 5FB8B 3BP5B 4HYTB 4O2EA 4B27A 1A0QH 1LK3H 3LNIA 1GHFL 2APBA 4JDEA 3O2VL 3P40A 4HDIA 1FHGA 3EJSA 4JFQB 4EDXB 4MCNA 4QD2E 1OW0A 4XPTH 3V0IA 4C4KO 3CZUB 2IQ9H 3DMMA 4TTDD 1P2CA 1M1XA 3NFSL 4J4PD 5CCKH 2A74C 1VPOL 3G7TA 1KB3A 4XX5A 5ICYA 2A6IA 3Q06A 4JNXA 4YHYB 3TEYA 2IAND 2IGTA 4L4TB 3MV9E 4YN3A 2EC8A 3MCG1 4W4OC 4FNUA 3SJVE 4AEFA 4WEUD 4YHLH 3QRLA 1Y6KR 1JGEB 1P69B 3U0WL 2JKWA 2VR6A 4BK5A 2VH5L 3M8OH 4L8DA 5CZXC 4HJIA 2EIDA 1RK0A 5E03A 1V54B 2IWKA 3BP7B 2F9BT 4X5PA 3KZ8A 2D3JA 4M4PA 3M7FB 3NP4A 4DJMA 4PV9A 4DPBX 2X3CA 3H9HB 3RNQA 5ADPL 1Q4NX 1FWXA 1OWWA 3RTQB 5B1CA 2Y3NA 4UIMA 3QUGA 3OPZH 2LFEA 3HR5A 3MBXL 5DRNB 4CNIB 1A7NL 3BUYA 1INEL 3SGKA 3GM8A 4OCYL 3HG1A 4M3HA 5JORA 3AACA 3V4VH 2DQHL 1OB1B 4Z7NE 2H26B 3CNKA 1BZ7A 4Q14A 2JCWA 1MKFA 1C12A 4D3CL 5C0RL 2NQ3A 1O75A 1CR9H 2JCCB 2OCJA 5SWZB 2VUKA 4H40A 5K59F 2D9CA 3FFCA 5EDXA 3ZL1A 4FYQA 1ZGLM 2WSKA 4LLDB 5K9KB 2AJYL 1RURH 4NXSA 2H4EA 5F96L 1NOLA 1S46A 4BFKA 2EECA 4BYHA 5BS0B 4XVOA 4PVBA 3MCLL 5F1OB 1CFQB 3GXMA 4RMUA 1TZHA 4MD5A 5E7BA 5IHWA 4K9EC 1FIGL 5IQ7H 3FN0L 1F5WA 5C6WH 1Q0YL 1A2YA 2VN5A 2IWFA 3ARDD 4JDEB 1T6VN 2D03H 2BVOB 1GIGH 3MVSA 2BVOA 3BZEB 1MCEA 2VLJE 1T5XA 4ZMAT 2WHVA 1SY6A 2CBTA 2BIHA 4YX2H 2KC0A 2DY2A 1TZHB 2F18A 4MD5B 4NPYA 1GC1C 1AP2B 1XR8B 1ZT1A 4UTBL 4J2QA 1KGXA 4OZIE 2J6EH 3REWB 5HDQH 2X4UA 1ODUA 4GS7B 4HUXB 2NXZD 2YIHA 4NRZA 1J5HA 4WY7L 3NIFF 4PP1D 4PLJC 4N68A 1OP3K 1IGYA 2CGZA 3NJXA 3VFWA 1NEPA 3BWUF 4PGBA 2LR4A 3C2SA 1AOHA 3K6NA 1MCJA 2A6KB 4FGMA 3NJFA 1U8HB 3ALWA 2BVUA 4YSTA 1I53A 4XP9L 3GJFH 2YC1B 3FB6A 3CU7A 4XN2A 2OFQA 1F4WH 1RZFL 4Y9BA 1XGYL 4PRHB 2X3AA 3LS5H 4GKLA 1EUUA 1QRND 1I4FB 3FRUA 3C5JA 1DSWA 2O6CA 3PAZA 3TPUA 1CL7L 4F9LA 2RHEA 4YPGA 4R3SB 2VDKB 1N10A 4Y1AE 2WLZA 2IALA 4N5ED 5A40E 2IV8A 1N6UA 4X9BA 4BWWA 12E8H 3LD8B 3LTVA 2DMBA 2AK4B 5I8KH 1SLVA 5TH2B 3MKKA 4GEIA 4TQEL 1ET7A 3QC5X 2EP6A 4XB8A 5I9QB 4QRRE 1QI5A 2XA8H 5I6KA 1L9QA 3SBQA 1MH5A 3SGDH 2IVFC 1T3FB 5D4QA 2FEEI 1TEYA 4OD1L 2JV6A 3O6LH 3Q5TA 4XNMA 3QCUL 2EVJA 4YR6A 1FNSH 2ZAIA 4HKXA 1OHQA 2GUOB 3PNWB 4JFEB 1AO7E 1RULL 5CZXD 3EADA 3HI5H 3FN9A 2P5WB 2C9XA 4NEHB 4PU2A 5DHXB 3SY6A 4PRPE 3UYPB 1E8YA 2HT4D 3C6LD 1DN0B 5JPNC 2H3XC 5TE6L 2AJZA 3VG0H 1DUYB 4JM0A 1J5OL 4FI8A 5JIKA 1HNFA 5I73C 5JHLA 2FD6H 3LXAA 2K1MA 1C12B 4XAWL 5A2LH 2GSMB 4WFHE 2NNFA 4FMFA 3OGCA 5JIIA 2ZAGA 1IGML 5KUKA 3BWZA 5KS9E 4OCRL 4KKAD 3VXSB 2A99A 2RIKA 4PB0H 2H0JA 3BPNB 2AJSH 4PBXA 2IGFH 5T1MA 1J1XL 3ZL2A 5CLWA 5KSUA 4PHXA 1JV5A 2XWCA 5K9QG 1RIHH 2EYTA 4WW2B 1G9MC 2IPTL 4JFDD 4GH7B 1LMKA 1N5AA 1XGRB 4UMSA 3C60B 2OCFD 4MD0A 1MLCA 2NW3B 4Z0BL 2IQ9L 1CFTA 4CJ1A 4LPVA 2Q3ZA 4XB3A 4BSVB 1AVAA 2R4SL 5KYWA 5JW3H 4PVMA 2M83A 3WNIA 6FABL 4KMTL 3LCYA 5ICXA 3G6JE 2WINB 5IROC 4ZOCA 3HE7D 3MCYA 3GUTA 4Y19D 3L4ZA 2LTQC 4DVRH 1I75A 4OM0H 3RVUD 3OX8B 4BQ6A 3VO0A 3MLZL 5E6UB 1R9FA 2F19L 4QRBA 4P4RB 1UGNA 3A47A 4PCKA 5JHDB 4UBDD 4YHOL 1JFHA 1EA9C 3D51A 2FBRA 3LPWA 3L9RA 3O9WD 1NOFA 4M48H 3BKCL 3DK2A 2MOGA 3CGTA 3OKDB 4UILL 1HH6A 3P3TA 5IHUH 1JVOA 1U36A 5HI3C 1L9RA 2O5XL 2EVGA 4AW7A 1N0XL 3MXVL 2F5AL 4PFEA 1M6OA 3GKWL 5DLLA 3REVB 3UAFA 2HG5B 4MCMA 1P84K 3K72B 2EDRA 4OT1L 5E4EC 2JCCF 1PG7L 2BSSA 3EYFB 2NNCA 2FATL 5GS0D 2CHDA 4M7KH 3ATEA 4UZSA 4GW1A 1KGYE 5KBNC 2NY5H 1NCGA 2HPTA 2Y7MA 4F9PA 1TCMA 2VYRE 1Q72L 3VFNB 4XH2A 2VKWA 5E99L 1P5VA 1AJ7H 3CDYA 1N5YH 1PIGA 4JVPA 5K33A 4BHUI 2BOLA 4TUJB 2UY6B 4JKKA 5I1JL 2FT7A 2EDMA 1NM4A 4DT2A 1V3LA 4KOCA 1I9JH 1HHJA 1UJ3A 1ES0A 1URLA 1OPGH 3CX5K 3L1FA 3LNHA 3U4EA 3GMQB 3O3BB 3VU2A 3LVEA 1BW8A 4YL9A 3QUZD 1YQ2A 2FX8H 3G04B 3KPRE 3SY0A 1NGXA 3DGGB 4KROD 4AKQA 1X5AA 4EI5A 1G7HB 5ISZE 5KBDA 5I76A 3BYYA 4MAUL 3D4CA 5DZOA 4TKWA 1LEKB 2VDPB 3KGSA 4U1IA 2C9QA 2WWOA 3B34A 3K5SA 4L18A 1QO3B 3VDAA 1IIKA 1YYML 1DVFD 1WVZA 1SN0A 2E6PA 5L9DL 2HKHH 4HFWA 5EU6E 1RZJL 1SRDA 4PP2B 1D5ZB 1P7BA 4JGNA 2PTTB 1L9PA 2C3WA 1IGCL 1PZ3A 3G5ZA 2GB2A 1JHTB 3PUCA 1VDGA 3IDXL 2JJVA 1YEEL 4EIUA 5ESVB 4TSCL 4L2LA 4O5LH 1BBJB 2DWSA 4HWBH 5IQLA 1K4DA 4YZFE 1C5BL 1XGZA 2QPSA 2OQJA 1MI5B 2YQBA 1XQ4A 2B3RA 2CJUL 3I6GA 4LEBA 5EOTB 4YDVB 3SGJA 3ML9A 1CL7H 4CSPA 3W0WA 2X2YA 4GG6F 3QR0A 3TGXA 4AITA 1VIWA 1FORH 3N1FC 4I2XE 5F9OH 2V4LA 3Q44A 2WJ5A 3OSVA 4PSRA 2VDLB 4NDMB 1PX8A 3IGAA 1YY9C 3II1A 4UTAH 1XF2A 1G9NL 3OKEB 3RY5A 1UB5B 4JO8A 2HKFH 4Z1PA 5DK3A 1J0HA 3FSAA 1KXTA 2LAGB 5C70A 3I6GB 5EOTA 4M8UA 3OVUB 3VI4A 1I31A 3ULVL 1QASA 4Y9GA 4TN9A 1CDIA 1NCHA 3EO0A 2EYSB 4UOQA 1UENA 4XBEH 4EMZA 2A73A 1JRHH 4ELKA 2WXLA 1HYRC 1WD8A 3N41B 4GSDH 1WFMA 2Z0UA 2YPVH 2FBJL 3IFNH 4L2YA 4OIIL 4XHJD 5EOCL 3GXTA 1A0QL 1LK3L 1RJLB 3ZTDC 3B2DC 4NCC1 1IE4A 2FIRT 2VRKA 5FK9B 1A7OL 1WE5A 1WGOA 4AEIH 2GIYA 3LOWA 2JJSA 2J2ZA 5GSVB 4M1CD 4CGUB 4KGLA 1PKQB 5JHDA 3N40P 1T2JA 1WZKA 1MFBL 2BNQD 2B1AH 5JLZA 5G55A 3VXMA 3QBTB 4K15A 1VPOH 2TRYA 5B21A 3BCFA 1B9ZA 3BMVA 3RWFA 5FKPB 3RTQD 5CBEB 4QTIL 4X5QA 4F8NA 4UF7C 3F12A 3BQUC 5I26A 2AEOA 5JW4R 4BEIA 1U3ZA 2IGFL 1E2VA 1RZPA 3UGXA 2L7QA 2VUOA 3SDDD 2B9BA 4EI6A 2WZPA 1A5FH 4GUPA 4Z7WB 4N5EC 5B39B 5FO7A 3RGVB 3H0TB 5EU5B 1R5VA 3LV3A 5F6IC 4LLVB 1E6OL 3X17A 1B0RB 4XHQA 3V5DB 3VNZA 5IWLA 4PBVC 2PYFA 3HPJA 4EQ3A 3C6SA 2EYTB 3KPSA 1LO2H 3SIKA 1TF4A 4QGTA 5IK3B 1P4IL 2BMKA 4H5SA 4LOFA 2W80C 2Q7YB 3O6FB 4G5AA 4OCYH 4PG9B 3RNKB 2OXHA 2X2UA 5IJBC 2ZG3A 4FKHA 4HS6B 2L04A 4HMCA 2ICEA 4OJDH 4X5XA 5B22A 5E4OA 4XCEB 3NZSA 4DPCX 4GW1B 2YXWA 1EHXA 1U8MB 3T2NH 3FU7A 2BSED 5JHLL 1L9MA 3IDIB 4M1DH 2R2BA 4PJDA 3QZMA 1XF1A 1S7RB 1T0NB 1EO8L 5ABAA 1ZLWK 5LLIC 5AW2B 1A1NB 4OR1A 4ODHL 3I2CL 4RWHA 5DMIH 2R56L 5HGAA 4CKQA 2MCPL 2C7FA 3D52A 2F53D 2FJGB 4HCRL 2H3NA 3N06B 3ULVC 3JV4B 4XGZA 2H7WA 1KB9K 1OGPA 2B1OA 3U0PB 2JNZA 4M6NH 3B9AA 1SHWA 5LNGA 4JL1A 4DIXA 2R0ZL 1XF4B 3OJMB 3OKDA 5F7KC 2YAMA 3A4EA 4M3KB 3HI1B 1R3KB 5D72L 3FFCD 3L5XL 1A3QA 4U1LB 5DVPA 4PJGE 4DAGL 5HYJA 4JM4L 1UXSA 2IQAB 2FATH 4JQIH 3VFTB 5T33L 4O2CB 4JFVA 1NJ9A 4UTBH 2BY2A 1DJZA 4PJIE 5EWIH 5EDSA 3LEVH 3ULUL 3ZO9A 1I7RB 4GRWH 4K7PL 5FUZL 1AZBA 2XACC 1E42A 2PCYA 2QADD 2R2CA 4BCZA 4EF3A 4GY4A 1CDUA 4HLZH 1IBFA 1RVFL 2OMWB 4WEBL 3LS4H 4EIGB 5E56A 4AQ1B 3DROA 1KIRA 2XC8A 2CBQA 3EGSB 3FB8A 1OCZB 4FG4A 4MKTA 2B4CC 4ZFOA 2WBKA 1DQLL 1D5IL 1JPSL 2VR7A 2X4RA 2WCPA 4TOYL 3IF1A 4FAAB 3TCLA 1NL0L 1LWHA 3HC0A 3ZQ9A 3CVBA 5IB5A 1CG9A 3ARVA 5IIEB 5JMOC 2EDKA 4XNZB 1OSZB 1NCOA 1KGJA 3PHOB 5CBAB 4ZT1A 1HOCB 2XTJB 2P5EB 1SDAB 4I1RA 1W6WA 4NRZB 3QQ9C 4OD2B 4YFLI 3PAUA 4L1LA 4B0MB 3JT0A 5DWPA 3VCLA 5CKAA 3O6KL 1UWXH 3FTZA 3GKZA 4OGAC 2OLDA 3OKMB 5K9OB 4G7VH 4DP9X 3ARGB 4GQZA 3QIWA 4NQVB 3EF7A 3VFUB 1KGUA 1W16A 3BIBX 3F7RA 3DMMD 1Z5YD 5HDWA 5K39B 4GG6E 1L7TL 3ESOA 4RGND 4ZMWA 2D2CC 1UD3A 2EE6A 3BZFA 2YRPA 3LB6D 2ZWNA 4HJTA 5ENWA 4UT9L 3EZJB 5BRZE 2GPZA 2FIKA 4EKJA 1S7SB 2EIBA 4MBOA 4ETQB 3ESMA 1FNSL 4KRPC 4WI2A 4IRZL 5EORL 4R97C 1IT9H 5DK0B 2HMIC 1Y1UA 2V8MA 3U9WA 4OGZA 1FGNH 1ZGLP 1B6UA 3FDWA 2VN6A 2CZNA 5KSBA 5HPMA 2EDYA 4HV8A 3DV4B 3U4BL 3PCYA 3SPVB 3WD5H 5ISZB 2CKBL 3QJVB 1QBMH 1K5WA 2WBWB 1XGPB 2ORBL 1XGQA 1A6UL 2DQCH 3TA3C 2Y5QA 4LIQL 2ZJSH 1ZWIB 3MROB 4L37B 2P24B 3CHOA 3QFGA 2ESVD 3OG4B 4G8GD 4PRNA 4NZ8A 3L2LA 5FGBC 2KUTA 3CDFA 4PJHB 4P59L 3LZFL 3QXDA 1QSEB 4DO6A 1ZLSL 2H9GB 5F97E 5B1JA 2BVPA 3EJRA 1SXAA 2GCYB 4XBGB 5CBAA 3DRQB 1GGCL 1F18A 2XQYG 2YGNA 1MIEL 1JOIA 2NT1A 3HW7A 1QTPA 5T1LB 4DO4A 2KZWA 2QVKA 4JCWA 3SCMB 3T3ME 5F7HA 4QHLB 5J6HB 3PU7A 4GAJH 2ZPKH 2EZ0D 2E4FA 1CU4L 1EZSA 1JGLH 4JFSA 4N5UA 3MRKB 2SODB 3E3QE 4MCYA 4QAMB 4YO0B 3BVDB 2HMID 2CA3A 1KEGH 1UA3A 2DV6A 1KLUA 2NW2A 4Z7VF 3SE8L 3MACL 2X87A 3V52H 1TZGH 2J3SA 2KLSA 4C4KT 4RFOH 4PJBB 2R7EA 1FO0H 4LF3A 4UQ3A 1OP9A 1GZQA 3H2QA 3CHPA 5JXEA 4OZGB 4N25A 5EZIL 4NC1C 4P2OA 5HYJB 3KYOA 1FZJB 3N50A 5L6YH 1BFSA 2NY2C 2VM3A 1MW1A 3CSTA 4GSUA 3ZTJG 1SJEA 2CIIB 2PCPB 3VFGH 3RUGA 3T2NL 3LSOA 4QHNA 1JZ5A 1JPFA 4G9DA 2R2EB 1MRFL 2VR9A 3X13B 4MA8H 2WXIA 5DA0B 2V2XB 1DHKA 1IAII 4JFFB 1ADQL 3OF6D 5F71A 4B5ZA 2OR9H 1MN4A 5FYJE 4AH2B 3IPEA 1D9KB 3CFCL 3L45A 3QK0A 3DX1A 2W88A 3WE1A 2E46A 4DP5X 2VLRB 3QUYC 1KNOA 2O61A 1T0MA 4DTGH 5D7IA 4AYGA 1Y07A 1S3RA 4NUPA 4PY7A 1BREA 3BVVA 5I18H 3TO4A 3RVVD 2WUCL 3IFOA 3NACH 1FVCA 1UOKA 4NUJB 1G7QB 3NABH 4GB9A 4P2RB 3RNQB 3IMUA 2ICEB 3HIZA 3WOVA 4JZOA 3WGVB 2W59A 4PJFE 3LXBA 2ATAA 3WAJA 1NGZB 2PTVA 1G5GA 1OZTG 1S9YA 5FF6B 2CO3A 2Q76B 3G08A 1RK0B 3WIIL 1CUOA 4G83A 2BMKB 2GSGB 1A6TA 3ULUH 5GGVY 3C2AH 3PV7A 5IMKB 4L8BA 1RZKH 1RZIB 1AS8A 3QHZH 4FKKA 3AMKA 2A9NL 2CH8A 2EIZB 3EBGA 4XP6L 3JTTA 1VADB 3DYOA 4HWZA 5L2KD 5L9DH 4N8CL 1CMOA 4HD5A 4QGYA 3LS4L 1EV2E 2HLFC 4J3VA 4WFGE 3VXUE 4AYEC 4HPYL 8FABB 5BW7A 2UXFA 1RK1A 3WG7B 3L2NA 3C87A 1A14L 1UD2A 2HFGH 3H2PA 4L9LA 4RMBA 2GIXA 4TOYH 4XNYL 3NZHH 3QUZA 4FNTA 4JFQA 4RAUB 3SYPA 1SVZA 4OFDA 1YEEH 3PNRB 1U8KA 1F3RB 2ZOLA 5E95B 1UM5L 4CU6A 3DSFH 3MUUA 1OSEA 2HT3D 4R2GC 3HG1D 2ITDB 5J89A 2F8IA 3MLVH 3Q13A 4HU8A 3BLKA 1TFHA 4Y19E 1BAGA 2WN2A 3G5YA 5EU6A 5IB3B 3H3PH 4IOSD 3WHXA 4LSTH 2WZ5A 2Y2YA 3V4UH 4OW6A 4HS3A 2E7LC 4NO3A 5FYLL 2GVYA 4OLYL 5D1ZA 3SHSA 4AGOA 2Y1VA 4U2ZA 1C5CH 1P4BL 5AUMB 4R4FH 4PJ9B 3O0RL 1RFDH 2VISB 4DOHE 3P0YH 2PWFA 5I1HL 2AS5M 4GKSB 5AKSA 2ALWA 2GBUA 3FQYA 1NLBH 1OLZA 2ZG2A 4I1NB 2R2HB 1JYVA 4ES8A 2HA1A 2MFNA 3FCSB 1BLNB 1Q9WA 3CX2A 1FYTB 2Y36L 3X3FL 5E2VH 3V0JA 5AD0B 1BBDL 4OCWL 3FQRA 3E8VA 4ZPVB 3IJYB 1Z2KA 4QXGL 5C0AA 2M2DA 1E4KC 3AS0A 3QCVH 1B0IA 2DWXA 3LPFA 3WS3B 2WMPA 1LDPL 1DBAH 1GCYA 3IJHA 2JKXA 3P30H 1KLGA 5KVEL 4HT1H 3BQUD 2K45A 4YHPA 2B1AL 4KI5F 4ZQKA 5TE7H 1L0QA 3NCCB 4PHZA 4L8SB 4OJEH 1UOWA 5T5FL 3U1PA 2DEXX 4P5KB 4KZDH 3IDGA 4HK3N 1HK6A 4KX8A 4IMKC 4ZFGH 3TEZA 1P1ZA 2W0PA 3DI2B 2FJSA 3UC0H 4D7PA 3HN5A 4JGUA 3GMNA 4H8UA 3I6KB 4TULH 4XCYA 4CN1A 4JFZH 4ZQTA 2NYYD 1TVHB 1H3XA 3FYIB 4G5ZH 5C08A 1PW3A 1ZIAA 3O2WH 3RFZC 2XN2A 5E8NB 1SBSL 1IKNC 2UYLB 3QUKB 3L3OC 4HG4J 3VXNB 3BCDA 3F6LA 2FH6A 3SDYL 2XZCH 4KKZA 3A21A 2VDOB 2F54E 2X1OA 5HI4D 1TVBA 2QJDA 4FFVD 3BPOB 4HETA 1QA9B 3MU3A 1HC1A 3VUAA 5T3XD 4ZO8A 3S2AA 2VXVH 3M86A 4JM2F 4BZ1L 4TUOA 2Z4QB 1QWHA 2VAAB 4YE4H 2D7TL 4D9QD 4NQED 1FE8L 3RAJH 4Y4KB 1KEGL 2QVFB 4XN1A 1T83A 4IGBD 1UM4L 1ITBB 3GSVB 3VH8G 1BOGA 1LM8V 3MJ8A 5FDYA 2WXJA 1NC4B 5C07B 3WEXA 2VN3A 1ZSDA 1OCCB 3RIAF 1BPLB 1CFBA 2YO3A 3QRGH 5BS0E 1WBZB 1AMYA 1ND0B 3PHQA 5KBLA 2DD8L 2JKRM 4KK5D 3CZLA 4HQQL 4WWOA 3IGUA 2PP9A 5IP4A 5FKAA 3LSOB 4QHNB 4BQ8A 4S1SH 1AQDB 3LMJH 1LP9F 2IH3A 3NPSB 1AHKA 3MX0A 3ZO0A 4PJCA 3LKRA 1RAMA 3N42B 2CKBA 3BQUB 1DVFC 3MCKB 3BN9C 1NIFA 4DP6X 4JM4H 3AY2A 4HHWA 3MTRA 2O1AA 4QXUL 2XIDA 4JKMA 1J0YA 3IB4A 1MFDL 4PTUA 4LB8A 3L9RB 4ZMNA 7TAAA 2ZYIA 4JJOA 4R9HA 4LL9A 3RVUC 1JZ8A 4JUTA 1YMMA 4ZRGA 4PPTA 5B7EA 3VGDA 4ACPA 2FDBP 4ZZKA 2DZEA 3UTOA 4W9FC 1JF5A 4YAQA 3VMOA 4JJHA 3GI8L 3KR3L 1DQLH 3HG2A 3MJ7A 2CBMA 2FZ3B 3CN0A 4L4TE 4X6EB 5I1KL 4BH7A 1OAXL 3TZVD 1NL0H 1TQCB 2N3JA 2Z65C 4Z7NB 5I0ZA 4G3YH 5BV7C 5B38B 1BM7A 4P5TA 5DD1H 2ZYHA 4G7QB 4F7EB 1IGJA 2HFFA 2V9UA 4J3OD 5GRUH 4KK6D 1G7PA 3S48A 3QHZL 3AXIA 3J7HA 5JPNA 1OM3H 1KB5A 1UQSA 2FRGP 2Y9RT 3U6XS 3HZVB 3IWUA 2OMVB 1U58A 4ZMVA 1BA9A 1B4JL 3B43A 3EHBB 3KGTA 4U1MA 1YJDC 3K71B 1LK2B 4JY6B 5D7IB 4ODWB 1CFNB 1ZMYA 1T04B 4XNYH 1J8KA 4HKJA 3AG1B 5FX3A 1KPUB 2BVEA 3OGCB 5IFAL 5AB9A 1TJGH 3OJ2C 2WV3A 1GYVA 1UB6A 3OLDA 2Y7LA 3DSFL 3GMRB 2DEYX 1AI1H 3H3KA 4HEPA 4B9PA 3K5RA 1ORSA 3FHEA 3OR6B 3UOAB 1C1EL 2XTJD 3WS6C 2YJQA 4X4ZA 4Z8FL 4G9DB 3U36A 2MNUA 2XWTB 3WJMA 2XTSA 5IR1A 2H2SC 2YAQA 5SX5H 5IY5B 4YR6B 2ESVB 4G8GB 4F37F 1LO3L 3MRQB 1X5GA 2C1OB 4WSKA 4AIXA 3TEWA 2WQ8A 4WEEA 4M56A 3QXUA 2WKOA 2X4QB 4YHNB 3WNJA 2NX5E 3L3HA 2K9UA 2VR5A 1NCCH 2K70A 5IROD 1R3IL 2H6UA 3KPRD 5LXGH 3I9GL 4G7SB 1LO5B 3L3KB 5GGRB 2YK1H 3K6OA 4L4VE 4O02A 1OT1A 3UC2A 2R1YA 3VXRE 3DO4A 1TTUA 4ABUA 4UQ9A 3OHXB 4KDTA 5JIPA 3K8KA 2LAAA 4JFOA 2SEBB 2F53E 1H3WM 5TTRA 4XNZC 3MRKA 3WHE0 1S9YB 1Y18A 4X5RA 2HXAA 5FF6A 3O45B 5DC4B 3ARWA 3D85A 4AT6A 4UAHA 1BD2D 3VGBA 3QEQA 3QULA 5A43C 3IGLA 4Y2LA 2VXQH 1LE5A 4K5MA 2AC0A 3GLDA 4S10A 5B4MD 1HQRB 4KFZC 4MXQC 3TJEH 2PN5A 4QRTA 3CFBB 3PV6A 5IT2H 2UZXB 3QXAA 3T4AC 3MUZ1 3UJTL 4MQXC 1R46A 3DSNA 3QNYA 1URIA 4XCCH 2PW1A 2V3DA 5I1CL 3L17A 2FNWA 3QG6A 4PGBB 2ARJB 4UQDA 4MX7A 1IFRA 4EJ1C 3H1ZA 1I9RL 4BZYA 5C3IA 3LH9A 4KAQH 3GXNA 3LXCA 3NZUA 4YHIB 5KVGE 1Z5HA 4OLZL 3CXHK 2YAFA 1PTZA 1SBSH 2ZUXA 2J5WA 4RFOL 3RL1B 5GZOD 2ZKHH 2PABA 4Y1AB 5BQ7A 1TEGA 4Q6IA 4QHUA 1QRNB 2UZIH 3R7QA 1NMCB 3EO9H 1MCSA 1AFVL 2CXGA 4QHUB 3DO7A 5DVLA 4NZJA 2WAQA 3O4LD 1S7WB 4X6FA 1R3KA 4MFHA 1DVUA 5E9DA 3TONA 3VXQA 3WFEH 2VR3A 4FYRA 5DJXB 5E2WL 4TPRL 1JHLH 4OQTA 3I9IA 2GYSA 2NPLX 4GBXC 1TYJA 1FO0B 1OW0C 4Z7QB 3EJUA 3MNDA 4LSVL 3TN0B 3VM5A 2P8LB 5LXVA 3KPRB 2OR9L 5AB1A 3SOTA 2ZWLT 4UT7L 4MCYB 4YO0A 1CI3M 1T1YB 32C2B 1KZYA 2V5RA 3STLB 1JWUB 4J3WA 1AXSB 1UM6L 5DS8B 4FQQB 2R83A 1PNDA 3BHBB 4IIQB 4PCYA 4OJCA 2XWDA 3HS0B 5D1QB 1DCLA 1EQWA 1YNKL 5H2BB 2BLFA 3FJTA 1U8MA 3OV6A 4S1SL 3DRQA 3KGUA 3D3VB 2AXJA 1Y0LB 4P2AA 4G8EA 1J5DA 4JM2D 3TFKC 4AT6B 2EH7L 1Y0LA 3HC3H 3NG5A 3FQTA 3OF6A 4XMWA 5D2NA 3CE1A 4H1LA 1J9RA 3O6FA 1T1XA 3QARA 4ELMB 3QYCA 4RX4D 3D0AA 2YA0A 3EOTL 3SYAA 2Q87A 4FFTA 3IF1B 4XOBA 4K8RL 5AOKA 2VLJA 3BGFB 1FGVH 1GAFL 1GOFA 1RZKC 4MB5A 5AW9B 3O8XB 4X4MA 5L0QB 4P4KB 4W81A 4EI0A 1NBZB 2J8OA 3CFDB 4BFRA 3WDJA 1U8QA 5I75B 1T21B 4H4NA 1ID5I 5CJ5A 3QFDB 5E8EB 3RIFK 4A2MA 4DKTA 3GI8H 3D2UA 5B8CB 1H8LA 4DEUA 2YEZB 4X5LA 4FABH 2C1OA 3S8WA 3IXTA 4YXHH 1I1AC 2X4PB 3IN0A 3P9MB 1VEMA 3TBBA 4KOBA 2XWTA 4OLUH 4HU2A 4Q9RH 3RE0A 3UZVA 2E9WA 3BAEH 5HHOE 4O2CA 4R83A 3DO7B 2X4SA 2RTTA 5IKCA 3H9ZA 4YC2C 1OM3L 4AMXA 1QSED 5CINH 4DK3A 2P8MA 1GTFA 1UT1A 3K0YA 4Y89A 5HVWA 2OJZH 4J28A 3SDDB 3VW3L 1D9KC 2BRRH 3TVMC 1S9VB 4HIJB 1J87A 3RVVC 3NSFA 4PV8B 3E6FB 3I9AA 1T04A 5MI0B 1X6NA 2XN9E 4PIBA 1FRGH 3K4ZA 1JV2A 1KBKA 2VXSH 1X9UA 3QG6B 1XGTB 4U05A 3GBNL 4FZ8H 4Z76B 1P6AB 5LUMA 5AVSB 2XX1A 3FUHA 1HCYA 3SDXB 5HGDB 3VGAC 2BHUA 1P0SE 1GGTA 3LN5A 4EBQL 4WI5A 3V79C 2TSAA 2Y36H 3HFFA 5CEXB 3EJZD 2QT6A 4IRJD 1H19A 1S7VA 3FU7B 4FFZA 4IIZA 1HKLH 4TVPH 4WI4A 4BK5C 2WKGA 5IOPB 2NXZC 2ZX9A 4WFFD 2NCMA 4ZD3L 5HP5A 1ADWA 2HH0L 3QHFL 3PGCA 1FJ1A 1G0DA 4G1EB 5I19H 1ZT7B 3ILDA 4IW4C 2FLRT 1AGDA 4YAQB 2X70B 2BIPA 1NCTA 3GSNL 5L4MA 1KIRB 1CGSL 3KS0J 3P9WB 3H6AA 5T5FH 1ECYA 1OGTA 4FNRA 1R0AL 2YK1L 4GIAA 2FO8A 5DZNA 3W5MA 4M5ZL 3ESPA 2QKSA 4KRPD 1JCVA 5A7BA 2XQ0A 4NHCH 1KXHA 5D5MA 3NFPA 2DICA 2EO7A 4P46C 4CVWA 3GJEA 3QJHB 3KPLA 1CXEA 1Z9SA 4UTCA 3ARBB 2ZCLH 2BK8A 1HE7A 1X5JA 1IAIH 1A9BB 3KL0A 3L13A 3LN4A 4HZAA 3QQDB 1SEQL 4LLMA 3KYAA 1NPNA 1HKFA 1OARL 4QRRA 4UTAA 1FFNB 3ROOB 4OGAD 1CGVA 4BUHA 4NQXB 4RGNE 4JRLA 2E3VA 4MMXB 2NSXA 2WXRA 1ORSB 4PJFA 2K8MA 2ZKYA 4L4VA 3ILQC 2YQ2A 3GMRA 1T20B 2DJSA 4NYLA 4GBXA 2WLYA 4R6UA 2X7LA 4GAAA 1TZ8A 4NKIH 1N0LB 2OAAA 1NC4A 1FCGA 1V3MA 3WEXB 4KQ3L 3B3IA 4XAKD 1BZEA 4GRLA 1XH1A 2NNRA 3OMAB 4KQ0A 3VFNA 3VD7A 4Z7QE 3H53A 5ILTH 1ECZA 1BFTA 2WWNA 3ZJAA 3S7GA 2GC7C 4WFGD 3TBSA 2A9CA 4X4XA 4TUOB 1SYSA 5FV1L 2J71A 3HZVA 3V6OE 3FB5A 3FQWA 4ZUSB 1Q9OB 3HG4A 3Q1SH 2G5BA 4HMDA 4PG9A 3ULVE 4HK0A 2HJLA 1J8HE 1T22A 4Z5RA 5H35B 3REVA 2ZAHA 3W0WB 4U31A 2WCSA 3CVHB 1LO4H 4FCAA 2CK2A 1MI5A 3ARSA 1CD8A 2OQJB 4HGMA 4IGBB 4P07A 5F7LB 4AJWA 6PAZA 4X6EA 4GFTB 2Q7NA 2C7UA 4TL4A 2W9DH 4DF9A 3NFNB 5E4AA 4OZIA 3LPOA 3OKOB 2CPCA 4DPAX 1YMMB 3EXJA 2YQ3A 2NDGA 3V4VB 2DJ4A 4QNPF 5JR1L 3B9KC 4NO5A 4M61B 1DUZB 4OLEA 1SLWA 1USQA 4YDLC 1X9LA 4AXWB 3T77A 4I87A 4H25A 4UV7L 3NIGE 1WWCA 2WZ6A 4W70A 5I1KH 4WNSA 3AT9A 5GSVA 4CU7A 3OTTA 4N3UA 2VWEC 3RZCB 2AXFB 2J6WA 1MIML 1MHEB 2GY7B 4B60A 5I76B 3PDGA 4NQCA 1WIOA 3A24A 5ACMA 5CN3A 1XR9B 2BIOA 2XWJB 3BKJH 3D5OF 4N1HB 2EEBA 4XRCB 3C9NB 2IXQB 2VZ3A 4HIIA 3BESR 4O02H 3RVWC 5KBPA 4UOW1 1UB5A 3T0AA 3ZE1F 4FULA 4P3DA 4AIOA 4H1LG 3X12A 1ZSDB 5EMYA 3LIUA 5IBTL 4LDOB 5HGBB 1HSBB 1ZK5A 3ZSSA 3H8NA 1WBYB 4PYGA 1TENA 4ZX4A 1FVEA 3VI3A 1ZXKA 2OI9B 4PM1A 5F70A 2VMEA 3FO1B 3S34H 3DYPA 3BAEL 3TBWB 1AKJA 3B3BA 3K1KC 4FJYA 2UXGA 2YD1A 1JZJA 4P2OD 5DZJA 4ZNCD 1R34A 5C6TL 2OTUA 3KLLA 1JF6A 4NQDA 1OQOA 1KLFA 3MRNA 3C5ZC 1JFQH 1WEJH 3IJEA 4W9HC 1M57B 2VO5A 4HKXB 5KYXA 1IEBA 3AGWA 4B96A 1X5HA 5HHOB 4N0UE 1ZV9A 4OIFA 5C08B 5BUAA 1A6ZB 1OF0A 2X4OB 1K6QH 4QT5B 2JE8A 3MV8E 4JCLA 1RK1B 3UBFA 2K8QA 4FQXA 2AERT 4CVUA 4FLRA 2V2WB 3NCJL 3IYLW 1SGKA 1BX2B 4EO5A 4G71B 2Y07L 3CK0L 3OC8A 4OJYA 1NCAL 4FG6D 4YHLL 3U7YL 1A6TB 1SQMA 3QDHA 3FCBA 1A7PH 4PJEB 1ORQA 4OZFB 3LQAC 5B4MC 3G08B 4MWFB 3M6DA 5BXFB 3BPLB 3UERA 4Z6AT 5CEZL 3HZ3A 2PYEE 4PB9H 5D1XB 5DJAA 1QNIA 2QLYA 3W11D 2EO1A 5ADPH 2EXTA 1FVCB 1MJJB 4DQOL 2EDJA 1TU2A 4RGMB 4HCGA 5IROA 4J23A 4QHMA 3TJEL 5KG9A 1I85A 1N8ZA 4GXFA 1DQKA 5JMRA 1M9WA 4LO9A 2YBRA 4UBDC 4WTZG 3QZNA 3VRIB 4NBZB 4LU5L 4B0MM 5EIVA 2BRQA 1K9TA 4MD0B 4S11A 4MZRA 3SPCA 4HWBA 3IDNA 3WEAA 1INQB 2NY4D 3BJ91 1RCYA 4LCYA 4JFUA 5IFJA 4JFFA 4ODVL 1TOXA 4I0CC 2VISA 3Q2NA 4IRSA 3T3MB 1VEOA 5BZXA 4AOFA 3RUGF 2VZ1A 3BLBA 1OAKL 3N91A 4W6WB 2A83B 5JOPD 5DK2A 3Q6FA 2APFA 4HX1A 2E7BA 3RURA 2H2SD 1WFTA 3ME0A 2NX5A 4LVOC 1CGTA 1TZIA 4M03A 3EO9L 4E41B 3EAKA 1GKEA 1ZA3A 2YD5A 3ZZ1A 1HCFX 2GAZB 1YSOA 5E0QA 4WVRA 2EH8H 3BP4A 3GSNA 3INUH 3CFKA 4KQ3H 2CHZA 3AS2A 4Y1SA 3UBXI 2VDMH 3MFFB 5DVOA 1PKQE 4HOMA 4LSVH 4ONHA 3NCYS 5HHPB 2CGRL 1SVBA 4P5TD 2UZYB 2X6UA 1J10A 1KBPA 4N0FA 2KYIA 2YRBA 3GXDA 5TPWH 5AVTB 4XC1H 1MDAA 4IJ3B 2X89D 1P7HL 1PZ2A 1CLVA 3BZ4A 5E2JA 4BH8B 1T03L 2YSTA 4PD4K 1FG2B 1LD9A 2NQDA 3E9TA 2JK5A 3OXRA 2E9JA 2QFPA 4U4IA 1DBBL 3VG9B 1IAOA 4RSVA 4DCQB 4OV5B 1TETH 1TTBA 3FUNA 3PP3H 3CSFA 3SOBH 1T0OA 1WD9A 5A6LA 3HG1B 5JORB 4G1MA 5DD3H 4LBEB 1N5AB 1NC2A 2CDFA 4YDMA 2R8SH 3WJJC 3JWDC 4GO9A 3VXUA 4LLAA 1ZHLB 1GH7A 1KCUH 2VRQA 4LAJH 2YC1A 4KZEL 4M8QA 2EIJB 5IUCA 1T0PB 4N6RB 3GYRA 5JR1H 1VA9A 1WFIA 2B0SL 2VNCA 4R0LB 2X41A 5I28A 3B2MA 4OZFH 3VFWB 2UZPA 2A2QT 3P1VA 4NKOB 1DUYA 1JTOA 3CC1A 2NYYC 3FCGA 4JPVH 3V6ZA 4HF5L 3JV0A 5I8KL 4NCC2 4JO3L 4ZMTA 3RG1C 1EHNA 5HVHC 2QGDA 3SDAC 3KNBB 1QLEB 4G82A 2P5WA 5AW3B 5DJCB 5HY9B 5ELIA 3AQXA 2K4AA 3AWEA 4NQCE 3EH3B 4MLSA 2XA8L 4LEOB 2W60B 3KPQA 1S7SA 4E9TA 3QQ4A 4X8XA 2IDUA 4YVNA 5ESAB 2ADFH 3EYSL 3CBJB 4LF3B 4UQ3B 4WUUA 2NLJB 5ISZD 4U6XA 4HIXL 4PRHE 4JB9H 3KDMA 1HH9B 3JWNC 3DDFA 1YN6B 3KPPB 4NJAH 3FTYA 1KBGL 3EGXA 5I82A 1C9SA 2FD6L 2ZT9C 2A0LC 1JN6A 5BS0A 3GBNH 4FZ8L 3P73B 3FRUB 4EN3B 4YHZH 1XGUB 2G9HB 1RJZB 3TH3T 1SEBB 2VZOA 4JCMA 4HAGA 3R0NA 1JD9A 1KJMB 1WEJL 1WG3A 1A9EB 3M17A 2BW4A 4R5TA 2IPTH 1Q1JL 1NKRA 1CYGA 2YHGA 4N26A 4FZEL 3S3BB 2XKNA 3MNWA 5G4OA 4BQBA 1GS6X 3ESUF 3NSCA 3GLZA 5HYSA 5SWSB 5LNDA 5E7FA 1S6NA 5ERWA 3D6GA 1CBJA 3FRPA 2CU9A 2NXYB 3PQYA 4OFPA 3VXUB 5L2KB 4ZW3A 4P57B 3EO1A 3GIVA 4J3OH 1N70A 3ARFD 4N22A 5ES4B 1F97A 4LCVA 2JQAA 4MA1C 4XMTA 1KV7A 3CDGB 2FVNA 4X42A 3ETBJ 4P23D 3FU5A 3NA9H 2HLFD 3VSUA 1J8HB 1AP2A 3HBPA 3UZEC 3VFTA 1QSFD 3PDDA 4XP4H 4Z0XA 1CBVL 2FJFB 2NUTB 5HDBE 5GRJH 4PB9L 1A3LH 4L4TA 2WWMD 4A6YH 3N42F 4NT6A 3ILQD 2AJ3B 1WC7B 3CUPA 3MJGX 2FYVA 5GJTH 1Z3GH 4IRJB 2XFXA 5ITFA 5L4IA 4MMZA 2IF7A 4ETQA 1X7TA 5MEOB 5L2JA 2CO4A 2Z31C 5B38G 1I3RA 3UAJD 2F5AH 3CN4A 3FRPG 4IOIA 5C8JA 2YA2A 1DEDA 5JTWA 3MODH 1G87A 5E6ZA 2H47C 2WKLA 1G0XA 4Y16C 5K9JH 2HJKB 4OM1L 3QUYD 4BZ2H 4OT1H 1S5HA 3O4OB 1X5ZA 1H15B 4L4JA 2UY7A 2ENYA 4Y5VC 4XN9A 3FZUD 3Q0HA 2UXVA 3B56A 3LDBC 2X0WA 2FUTA 3F7YA 3L5IA 2ZSVA 1QKZH 2Y5TA 3SYCA 1OE3A 1P9MC 2KZKA 4HC1A 4HEMA 1DJXA 4J6RL 5I8EA 4BKTC 4F58L 2VLJD 4ZS7L 4KDWA 2EDWA 4KVCL 1R5IA 3PIQA 3QZOA 5F3FA 1MCDA 4GG6A 1XSIA 3MBEA 4WFEE 3MLYH 5AFAA 1QEWA 3CFNA 1QFWM 3AY4A 4H88H 4WU7B 3L4YA 1QLRA 2I9TB 3B9KD 3BIAX 5AOMA 4OKDA 3BP7A 4A2GA 1XH0A 2A9BA 4DERA 4EI6B 1JYWA 2AKRA 4Q8BA 3LRKA 1LNUB 1MHEA 3LS5L 4J3SA 4F2EA 3GXFA 5CD3B 3ARBC 2XN9D 3LAFA 5MEPB 4BCYA 2NOYA 3AFLA 3Q7JA 2B9AA 4WTQA 5BXFA 4P2RD 2APSA 3OR7B 3UP6A 1XO8A 5GGTH 2FEDD 4OY9A 2QEJA 2JIXB 1NDGA 4QHKJ 3UDWA 1CK0L 1EZVY 4QF1A 2WYHA 4WJKB 4XODA 3UYRL 5KYXB 3GBDA 3QEQD 3PWPE 1E9PB 3A4DA 1VZIA 3C5SA 1YDPB 3TCXA 1SYVA 2G9KA 1TZOA 1IFHH 1NCBL 2DYPB 3AXLA 3CLWA 3ECBB 1OAYH 2R23A 3ZUCA 4AYSA 4B7IA 1KFAH 5T1JA 1FL5B 2CJTA 3EDFA 5FXCH 5J6GB 3GFUA 1MFVA 3NTCH 3BWAA 1AY1H 2NTFA 1BM3L 2ZIDA 5JOEA 1HIMH 1QFUL 1RUPL 2FEDC 1MCRA 4I0KA 4POYA 3OAYK 5E1IA 3O4LE 1A7QL 3NZ8A 4Z5RB 3KVPA 2HLEB 2CNYA 1AZRA 2VE6A 5AVWB 4NDMA 3MJ9A 1CLZL 1S7RA 2G2PA 1LQBC 3HVNA 3ARBD 1XIWC 2H0PA 2C3XA 5AW4B 5FO8B 3PPEA 3KPMA 2EKSA 1CT8A 5KYNA 3S34L 1U95A 3O41B 3MRCB 3BXNB 3KPOB 3DJZA 3NCMA 1IEHA 3OWEA 2DAVA 1DFBL 2VZTA 5HGBA 3HUJF 5J1SC 1FZKB 3VQLA 4Q9CA 1TJHH 2J8HA 4R8WH 2EEAA 4OCSL 3SQBA 43C9A 1JMXA 2I9LB 2LT9A 3H9SE 1B0RA 3WN5B 5GGSB 3PGFL 3B9KB 1RZJC 2V5SA 1WIPA 3QJXA 5KSBE 4JBSA 4C8XA 4U2YA 5I1GH 1B0GA 4FP8H 2N0MA 1JYNA 1E5CA 4J8RA 1UH2A 1QPPA 3FSWA 4O58H 1DFXA 3M1BA 3UJJL 2EUZA 3A5VA 3ROLA 3EDKA 3MLSH 3C09C 4LNRA 5BUGA 4G8FB 4U6HB 4KKCC 3D06A 1IGFL 5A2FA 2C4FT 3DX8B 4Y2DD 3MLZH 5JO5A 1A6VH 2V2TB 3W0WD 5EIIB 2BSEA 1ZT4A 5CEZH 3LRSB 1DQDL 2B59B 2Z7ZA 1ES0B 4TQHA 4NNPH 1MFAH 4K8RD 3TYFB 1JGVL 2FO4B 4HEPG 2DMKA 4KTYA 4NENB 3LNFA 4FTVB 3O3AA 4C47A 4ELKB 1NGYA 3GZOA 1AGDB 2VOTA 1ASQA 2MOVA 3D69A 5TF0A 3STZB 1ZLVH 3F7LA 4DSYA 4ODTH 5DT1L 3GKWH 4QYOB 4UDUA 3P4OB 4APQD 2K9FB 2XWXA 3OKEA 3RLSA 5GZOC 3ARFC 2E4TA 3NYKA 4XP4L 5CEXA 1CBVH 4Q6YA 1JI2A 5KVGH 3BH4A 4FQ2L 4KJPC 3VVWA 1A3LL 3KBPA 3TH4T 3VFOB 4ATWA 1PNCA 4C56A 2Y5EA 2WVVB 2J88H 1XMWA 1UHVA 4OGXL 4M7KL 1FFOA 2H3KA 2MCPH 1Q94A 1YEJL 4BK8A 3ZT5A 3TXAA 4Q6IC 3K6IA 3QPQC 1S7TB 4MJ2A 4NQSA 1ZV2A 1Q72H 3TWYA 3I74A 3JTSB 4Y9EA 3RVXC 2QGBA 5KWYC 3SE4C 2HSIA 3TWCH 4FLQA 5HHQA 3LB6C 2QV4A 3ZDYB 2DQJH 2CDEA 2NY0B 2AXHA 4KU1A 4PTTB 1QW9A 1N6VA 2ZYSA 4L4VB 2P5EE 2A6JA 3B7YA 1OAQL 4M7JH 4UOJA 5AQ0A 3VWJD 3CZFB 1NDGB 5H8DA 1KB5L 2BP0B 1MFNA 3LKNA 4FQJL 5LDUA 3JVGC 4JE4B 3AVEA 4XVTL 5IW1A 1WUNT 5IBUB 4K7PH 3KXFB 3HVDA 1A66A 1N2RA 4OJFL 3RI5F 2NY6B 1NGPL 4A7UA 1VFUA 2R27A 3PL6B 3VA2C 1RLWA 4WWNA 3NT0A 5D9SB 1XB8A 2W07B 4FG2A 1HL4A 1QR1A 3E7JA 1BPVA 3G5XB 4YQXH 2WZ0A 4F3FB 3SOBL 2J8UF 1T7XA 2XQBL 1XMEB 4PJDE 2FX9H 4U1JA 3BZ5A 1E9OA 3CFJA 5F9WC 3T0DA 2VMJA 2ZWZA 1FZMA 1NKOA 3OLEA 3FQXB 2HZHA 3PIQB 4OIAA 4HCRA 1IBYA 3RGHA 3H9YA 1P9MA 3GI9L 1W6LA 3MRCA 1C5BH 1BFOB 3MUHL 3R06B 3MNWB 4I0PD 2EDBA 4YSDA 1A1OA 2J44A 1IQWL 1BQHB 1IC0A 2GHZA 1H3VA 4KROC 2XXGA 4OF6A 2NZ9C 2WLLA 4PRBA 1S7VB 3L4WA 5F9OL 1HS6A 5H2BA 3RTLA 3VI3E 1S3KL 2AANA 3V0HA 3MMEA 4JO3H 1Z6JT 3OXSB 1AXSA 5BOPA 3VMNA 5E2UH 5HGDA 4UTAL 3KYNA 4C54A 1L7TH 2F54D 1JGUL 5LG6A 1F8TH 1Y6NR 3DETD 3TBYA 3MRRB 4BQ9A 3EGXB 3BT2H 1BVNP 3S4SA 4K94L 3IVKB 2FR4B 4FYSA 2X89A 1AY1L 1EAPA 3EYSH 5C09E 4NQEE 3UTTE 3ZK0A 4OIIH 3RU8H 2TRHA 4WUUB 3WUWA 1PS3A 1V3JA 2VXTH 1T83C 3NRFA 1F3JB 1FNEB 2EDHA 4LVHB 2DRUA 2QGEA 1CLZH 4F8OA 3P9LA 2E47A 3HOGA 4LP5A 5GS3A 4Y4KD 2XWBA 1KENL 2GY5A 2IDFA 4TRPH 4F7PA 4CL7A 2GC4C 5AG9A 1PSKL 3KNBA 1DQQA 5C0BE 4RCAA 1A3RL 2H6PA 3LKSB 4ZSOE 1W72H 1XCWA 3QH3A 3D2UB 5DYFA 3UCRA 4PBDA 4IBQA 1JK9A 2XV3A 3VRJB 4OCSH 1BDYA 3HCVA 1Q1JH 1IILE 3OAWA 1IC7H 5I1IL 4NPKA 3SE3C 5DUBB 4MZIA 4ZFQA 5LBSA 3AWFA 4BFNA 4AG4H 1JNNH 3GUFA 2BNQA 4M9OA 1H8OA 4G9FA 2C3HA 1X4XA 2ENJA 4I2XA 1QLEL 1G1YA 2WNWA 2V37A 4KZ0A 4O58L 4YLQT 1CFVH 5F0LB 4XP1H 2HRGA 5DEZA 1OXYA 5DUPH 3T8VA 1MG3C 2DWEA 2N7BA 4AQAB 2JXMB 2NX5D 4AW4A 2ZX5A 3QEQB 4NKDB 3L4TA 2B5IB 1JF1A 3SKOA 2BIQA 1E6JL 4G6JH 5IW6A 2NY1C 2XXMB 3HZKB 4ZO6A 1PLGH 4DQAA 5IBLD 4OVVA 3QR1A 2J8UA 3QAQA 4H26B 5DRWA 3M46A 3BHBA 4IIQA 3R19A 3QHTC 5DMGC 1JGDA 4X8GA 3SE3A 3N1QC 3V52L 1UD4A 1KDJA 3DKHA 3LNDA 4I77L 3BRDA 5HTSA 2X4TB 5GJTL 2UZYA 1E5UI 4KJYB 4X9IA 1AQHA 4E0RA 1BG1A 2VQ4A 2IPUG 1VKXB 3LHAA 4HULB 4QRAA 1IKFL 3U6XA 3CVHL 3UPRA 5FYKE 4LCCA 1I3RB 1KBVA 4GUCA 3EOAB 4RISH 5LAPA 3C6EA 5JHBA 5LGJA 2BPBA 1TG8A 4YHMH 3I6LE 3FB7A 5D7JB 4GP8B 3PJSA 3PY9A 3CUPB 5E8OA 2NXYD 5DGQA 4DKEH 3AB0B 3NIDB 1O5PA 2FSEA 2F7PA 2UUDK 3KLAB 3KYKH 3ULSB 4XN5A 3QDMB 2FYYB 1O6VA 3P11L 4AV0A 5EPMA 3TPUB 3AREA 3PQYD 2EE2A 2QPDB 4IJTA 2EXWC 4JKWA 2XCMC 4QUOA 1DJYA 1EDHA 1BD2B 3FFCE 1WTLA 2JXMA 1GGIL 2NY1D 4D7BA 3VWKD 4CNIA 3RJOA 1RVFH 3K0WA 3L3JA 1FN4A 3HAEA 4NHUA 4QTFA 4NAJA 2IG2L 3VFPB 3K6SB 2PW1B 4UDTB 2X88A 3QPQD 3NABL 2EABA 4FEMA 1JPSH 1OT2A 4Z3EA 4QO1A 3UYOD 2AITA 3QXWA 4PSPA 1GGBL 1KZQA 2KL6A 4WO4D 4DGIH 3QUXB 3VXMD 4D9RD 4XX1G 1VZGA 2VDOH 1A9EA 1U41A 5IB1B 3KLKA 4ONOA 2X1PA 3KBFA 3JQOB 4FQLH 2C9RA 3LD8C 2A9NH 3RKDD 3VXRA 5FS5A 4OLXH 7PAZA 4PJGB 4ZDHB 5DYOA 4QRFA 4N0FB 2A6IB 4LOUC 1DQTA 5GGTL 5I9QC 3PFUA 2BOCB 3KYMB 4X80H 2ZG1A 3HUJB 2E9BA 3V5HA 1KEML 4LVEA 4GAGH 2WP3T 4NNXA 2FX9L 5C3TA 2BS71 3OKLA 1IFHL 1NCBH 2V2WA 5C7XH 1KYOJ 4ZXBD 4NZFA 1XCQB 3KWWA 2VMDA 3DVNA 3APDA 4R2GD 4XN4A 5MERB 4CMHB 3T0VA 4WI0A 2VLRD 5DFWH 4PLJD 2UXTA 1J1OH 4UT9H 3MGOB 5DI8B 3IVKA 3CN3A 2I69A 4N28A 1FZOB 1NBYA 5HHOA 4AC4A 3VFRB 2R4RL 3ME0B 2PETA 3IE9A 3NCWA 5AG8A 4WDIB 5FOJA 2CIKA 3IKCA 2Y6SD 4HIPA 4NUQA 4OZHB 4X6DA 3V4UL 3WE6A 1PGRB 1SVCP 1EXGA 5F7DA 3P2TA 1RIUL 3RZCD 1TJMA 1VB9A 1A6WH 5HYFA 1XFPA 3HJEA 3P0YL 4E42A 4MAYB 5E2UL 5DJ6B 4RSYA 4NWUL 4YUEH 2DTML 5DRXB 5F1NB 4EVNA 2ORBH 1DLHA 3D2TA 4M62L 1W9XA 2VITA 4ALAC 1GTNA 2DDQL 4XOEA 5ECJE 1JHKH 1Z9OA 3JWNH 1I8MB 5GZNA 3K71A 2OULB 5FYLD 3VX1A 4OCWH 3KWUA 3T65B 3IM1A 4M8RA 4M43H 3HG5A 4DESA 4RFEA 4ZUVA 4JRXE 1BVLA 1GYWA 2HT3C 4BRVA 5I1LA 3QDJA 4UT6A 3PGFH 2LTQB 3FYEB 4LQ1A 3SDCA 2OYMA 5KVEH 3Q2WA 4RIRB 2HTLC 1F90L 3P02A 4XMLL 4XNAA 3UJJH 4JDZB 4PJIA 1WRFA 2E75C 1KWKA 1A3RH 4WI9A 3O3DA 4E41D 3HR6A 1SXSA 2EICA 4N2OA 4ALAH 1FL3A 1NANI 4I48A 2AAAA 1MCCA 2V3FA 1HINL 3IFLL 3FF8A 1F86A 3KHQA 3UPCA 3IJ8A 4NO5B 1NIBA 3HHSA 2WXNA 3ZDYF 1JNNL 1J18A 4AG4L 4XWOC 5DJ8B 2LU7A 5C0IB 4C57C 1CFVL 1BAFH 4KPHL 3EJYD 1FO0L 3LIZL 4RBPH 5KTEH 5EC2A 3VWKB 3L3IA 1E5ZA 2IH8A 3NIGB 4GO6B 5EZIH 4G7RB 5GSRB 1FYTE 1EIBA 4NERA 5GHWH 3TA4D 2NR6C 3WS3A 4G6JL 4JDVB 5CNHA 2QR0B 5ALCH 4F8TA 2IOOA 3RWGA 5DK2B 1CXHA 2NY3B 5I6NA 2QKIB 3F3HA 1RUKL 3FQ1A 1LDSA 4MA8L 1XVSA 5D1XD 5JQHC 5KYYB 2Z8SA 3CBKB 3L9BA 4X6CE 2NY0D 3CCHA 3IU4L 1G7JB 3FB5B 3AS3A 3E3QC 4ZUSA 4PJBE 1ND0A 2YKKA 3AZUA 4LSQL 1ZTXH 5E6RB 2W5PA 3D0LB 5D71L 3N85L 4KXAA 5EEUA 1R3LB 3K2KA 1GS7A 4MD4B 5F7WC 2RJMA 1XIWD 2DQDH 4FQPA 1J86A 4APQA 4JKPH 1I8KB 1UT2A 4PREB 4WUUD 5EOQL 4NQQA 3BISA 4OFVA 3WIHH 4MB3A 3S8FB 3ETBF 3WHXB 4JG1L 1BF5A 4DKEL 1MJJA 2VAAA 2Z4QA 3NACL 4AV4A 4WF7A 1OANA 2C9PA 3OZKA 4AEHL 2AXWA 3S97C 4RETB 4IM8A 3LRSA 5DHDA 2P42B 2BCMA 2F6AA 1TVBB 5D2NC 1L9SA 4XAKE 5D70H 4BGLA 4UMGA 1ED3B 3VD1A 3JVGA 3S0PA 1A4JA 4JK0D 1ZTMA 4ZNEA 3BWUC 1DUZA 1JXFA 1KPRA 1RZKL 3V5KB 3WLBA 4OJFH 4AUUA 3NSDA 1B2WH 3P2BA 2RCSL 4YH6A 3MRGA 2LVCA 2YBGA 3ELQA 4XP6H 2WIIB 4HCIA 3N2JA 3NDYE 2OW6A 5HJDA 3RKPA 2GK0B 4Z7VB 5SV3A 2LLGA 2D31B 2X28A 2AVGA 2BHFA 3BSZA 5K9QI 1S7XB 1UWGL 1NLDL 1KIQA 4IGBA 3OJDB 2CBOA 2XQBH 3CVHA 3SCMC 4DGIL 1P7QA 2CE6A 2HN7B 2EEXA 5HHNB 1GRWA 4Y2OB 3JWDH 5AAPA 1LEIA 4LKCB 1C7SA 3SKMB 1IC5H 3SGDI 5T3ZH 3SDCB 1Q9OA 3IJHB 2IANE 4P23A 1YEHH 1Z9NA 2JELH 3DMMC 3LY6A 2KPWA 3DPBA 2L0DA 2NY3D 4YNYB 4LSTL 4DETA 2PP8A 1KPVB 2DJUA 5SWQA 2WGNB 3BFOA 4OZ4B 5D6DC 5LQBL 1ADQA 1G6VK 2YPKA 2IO5A 2O61B 3AUWB 3H85A 1BLNA 4H8WC 1T4KB 1MREL 1U4EA 2Z7WA 3QS3A 1B88A 1JGUH 5F0JB 3L3GA 5FWRA 3V0EA 4LAQH 3DO3A 1AIFA 3OMIB 4IU3B 3K4DA 4G6KL 3MC0A 4DW2L 4OD1H 5C08E 4OFYD 4PJIF 3OB8A 4KUCD 3ECBA 4XVUD 1BVKA 4OZHA 4X6DB 4UB0H 2L7EA 5FHBH 4N8VB 4QXGH 5EUOF 1CL7I 2WLMA 4BFOA 5KAQG 1Z32X 2AXFA 1DE4A 4NZRL 3QQ3A 4K7PX 1KYAA 2NY6C 2Y72A 5BNXD 2PKDA 5EO1B 3L3DA 2ZOOA 3EJYC 1K2DB 4K23L 5JPMA 1ZVYA 4LRNL 5LXGL 1JI1A 1UWEL 3ECWA 2DQIL 2WBJC 2EXYC 4TQ8A 1JWSA 2BVQB 5LDSA 1W0WA 1QZ1A 4Q9QL 4ZFGL 4DEPC 4PB0L 5B8CA 1TPXC 4MMZC 3QC6X 1URZA 4JFHE 1ZA6A 4P2QA 4CW1B 1E5YA 1Z9MA 2PWEA 1JXKA 4MXWL 1VADA 2V8LA 2P49B 4AQEA 1AD9B 2R4SH 3MBEB 2XU9A 1BZDA 3BFQG 3WTYA 3LHPH 4G6AC 4KVPA 3FU0A 4FS0A 1FNGA 4JFXB 1QVOB 1TKWA 1NEZB 1S9WB 4HK0B 2E74C 3AM8A 1P6FA 4LHJB 2FQGA 3L4XA 1WAPA 5B1BB 4WU5B 1NTDA 1VLXA 1WK0A 4EZKA 4YE4L 4DKFL 4UINL 1RP9A 3GF8A 4OZHE 3HRZC 3VD5A 2VQ1A 3C5XA 3K8MA 3P3SA 2JKJA 5FFLA 4G6MH 3DARA 2EINB 3C8KB 3MV9A 4GI6A 1W72B 5FCUH 1XX9C 1ZK9A 2D7NA 2BNRA 2IDCA 1ZWIA 2XWEA 1M7IA 3HHRB 1KJ2A 5CU9A 1D9KA 3EFFB 3Q8BA 3HRPA 5J9PB 4KV5F 4OUUB 3A67L 2A9MH 5DJ6A 4NM8H 1H3GA 3QWOB 2Q10A 2DKSA 1BZOA 1U3YA 4X6CF 1UT9A 3G6DL 3W3BA 1CLOL 1G7MA 3BI9X 1I3GH 5SX5K 1AXTL 1DBMH 1ONQA 3UZVB 2DIAA 4I3SL 2VLKD 4KTGA 1EJOH 4UOZA 1PZBA 3JZ7A 5BJTA 4ICXA 4YZWA 3MV8A 1PX4A 1L5GB 2BNRE 3ARBA 4XB7A 5JW5A 3PP4H 5EFIB 1CTOA 1MDTA 4K71B 2P43B 1R33A 5KSAB 4WI0B 4QXUH 2VMFA 3CLEH 3EYQC 4TNVF 3I75A 2NY5L 3BH8A 5L2KE 4X4YA 5JOPE 5ICUA 5CZVH 4WW2F 1Z9PA 3CPLB 4WO4B 4NQDE 1IBBA 2IIJA 2N7AA 3QIWB 5TDPA 3VFUA 1S5IL 2O5YL 4KDTC 1N5YL 3A6CL 4Z9KB 1G7IB 4ESKA 4ELMA 4JKPL 3DOSB 3EUDA 2RD0A 3MZTA 1VCAA 4BE5A 2VDMB 1JXGA 4QR7A 3QRBA 4G1EA 4ZMLA 1OSPH 1SFHA 2VJXA 2LVEA 1WTGT 2DYSB 4O51B 1S8DB 4X7SL 3GM0A 2Q8AL 4PRDA 2ED6A 2G9HA 2ICCA 3QXDB 1KXQA 1BF2A 2ZKWA 4DP7X 1YEIH 3LJ3A 1YY9D 2L8AA 5C0EA 5J7CC 1JTPA 5IGXL 2WLJA 2YD7A 3TN0A 3WXVH 1THCA 3DIDA 4GKZB 4HIEB 1CJYA 1Q9LB 3LVTA 2ODIA 2C5DC 4L37A 2RFXA 4JRYB 2Q86A 4WO4A 4YSRA 4PJXB 4UV4L 3SEPA 2I7SA 1RUQH 2ADGA 3W37A 1AD0A 3UEQA 4MNHA 5KYUA 4N2KA 3FT1A 1UXSB 2IQAA 3GJFA 3ZOAA 1ZLDA 4GW5A 3KLHD 1G9EA 5E6IA 3QYNA 3J27A 1WISA 2R4RH 4U49A 3HI1A 1WZAA 4V11A 1U30A 4WHTB 4XO8A 5KW9H 5CP7A 2HRPH 2YOCA 5JIQA 2K3HA 4PJ8A 2IDTA 5CEZE 2FEJA 4RAHA 3QP3A 4LCCB 2QHLA 2QQKH 3PDOA 4ZXBA 1NCCL 4ORGA 2FJHB 4JO1H 3F64A 3TO2A 3HUJE 1BFVH 3RA7H 4D8PA 5JYLA 2L3BA 5F3BB 4YXKL 4ODWA 4M8QB 4NKMB 3VGGA 3ABLB 2BY1A 3NIFE 4JL2A 2ZUVA 2V0AA 3BUPA 2APTA 3QNXA 1INDL 4ANUA 4LBEA 3LQAH 1WFUA 4XCEA 5EU3A 1UQSB 1RJYB 3BDBA 5CKGA 2ARWA 5I2IA 2KQMA 4AENB 1U92A 1ETZA 4MNGE 4JFPB 1KGCD 1OV8A 4K23H 2J55A 4AJ0A 2X05A 1G7IA 2I5YL 2Y24A 3BN3B 3PABA 3QWRA 3N1GC 4NGHH 4JPQA 3STBA 4W9IC 3DX6A 2C1PA 4U3SB 5TDOA 1V27A 2MMXA 4ZNEE 4Z23A 1SOXA 5AW6B 1OCRB 4Y4FB 1EXUA 3UGUA 4GQRA 4L0YA 2EC9U 1I8LA 1ZEAL 4M1GH 4AIZA 3FONA 4YBQD 1NC4D 3D85D 4OUOA 1C7TA 4KAQL 2Z0BA 2B1HL 3NEOA 2NTSP 2WPGA 3ZE2E 2ALAA 3GBML 1P5UB 3DX0A 2LV4A 2ZP0T 3VXQB 3JBG7 1V3KA 4MDIA 1IGIL 5C09A 1M7UA 3QG7H 3UTZA 1WWBX 1J8RA 3CHXA 3DECA 3MHZA 2CD0A 1QRNA 2OYPA 4WCYL 1UB6B 4TUKH 4V2CB 5AYUL 4MXVE 1L3NA 3FULA 4HLEA 43CAA 3DURA 2D7MA 5HHQB 1H3UA 3Q3GB 4TPRH 3O2DL 5FKAB 2BNRB 4IKKA 3MLUL 3MV7B 1J1PH 1KXVC 1S7TA 1E7UA 3QEUA 4LKXA 3UJIH 2BS9A 3UTPE 4IU3A 4AKOA 1AIFB 4ODHH 1RU9L 5IHLB 2VL5A 3O11A 5DWUH 3WY1A 2CLZB 4H7VA 4X0KB 2WVVA 3QUMH 4UWQB 3GSRA 5H4ZA 4XXWC 2JSFA 3HG3A 5DMJB 2DLFH 2BIIA 2DPKA 2DQDL 4ORZC 3S35H 5INDA 1QVOA 2EXSA 4NM4L 2WLLB 1P84J 3BQVA 1D5XA 1TU2B 1BP3B 2N59A 5FO9A 5C9KA 1BQHA 4R5VA 3ZKNC 1JG9A 1U4FA 4GEJA 3ZT7A 3LKOA 4BH7B 2KDGA 5IM7B 1IBDA 4LDLB 2XN9B 5D7LB 4LPCA 3TEXA 1UD6A 5D70L 1WGVA 5DEFA 1M3IA 3KPSB 4I9WD 3QUKA 4U1GB 3GSOB 3NQIA 1N3NA 4A7GF 1DL7L 2I60L 2PCXA 1HU8A 3CXHJ 3OG6B 1UXMA 5I15L 3RGVA 4Z7IA 1S7XA 3FQNA 1OM9A 3GSQA 4RRPA 5F7AA 4RA3A 5T5FA 4R4ND 1M7DB 1GPOL 5DR5L 3MV11 2QHRL 2Z3FA 4LLUB 4XZ4A 2YPVA 4PRIB 4WK0B 1EGJH 1I1YA 2BSRA 3CN2A 1N7MH 3F12B 3GMMB 2E8ZA 3S88H 4N2NA 4W9LC 3WIHA 3QUMB 2YPLE 5EZJB 1FAKT 1K3IA 2NY3C 4FXGB 5CIPB 1RI8A 3GSWA 4IBYA 3MRNB 3SGEI 2MCG1 3T8XB 1KLGB 5T3ZL 4A7TA 4HP5A 1CD1A 4TMPA 2OZ4L 5F6HJ 1YO4A 1NBVL 1NINA 4I9WE 5KVFE 3U7WL 3FO1A 3DXAE 3OMZA 1DVTA 2BRRL 3I85A 1J9CT 4Z95H 5GIRA 4ELME 2YS4A 4C56E 3O2VH 5H37A 3BMWA 4L0ZA 4LCWB 2FB4L 3QZBA 4PJDF 3R8QA 3QISA 4E9LA 1R3LA 3FOMA 4LPTA 3MO1B 2PTUA 3AABA 4X6DE 3BD3A 4FHJA 4N90D 4GUOA 1CTMA 5IMMB 3RWIB 3TBTA 3E2HB 2DS4A 4UUJA 4P0DA 5C6TH 5A2CA 4OBRA 4DGYH 3SB3A 3UBHA 1NEZA 1S9WA 4G6AD 3P77B 4LLYB 3OD3A 3LZLA 2Q7AA 5E6YA 1IVTA 4Q9BA 5IVXF 5B38A 4GOSA 4JZNB 2P9RA 5C97A 1M6OB 3K1DA 4HBCL 1FYTD 1KMGA 4QXWA 2NZ1A 5A6IA 1K6QL 1IGTA 1GMIA 1MW2A 2CXKA 5C0CE 3T08A 2UWEB 4IQHA 3U4BH 3Q05A 2P3YA 1TJIH 1RQ5A 4GIOA 3G6JA 3VXME 4D9RE 4IIQC 1E4XI 4LRIC 3HS0C 5D1QC 3CN1A 1YN7B 4LIQH 1J05A 1HNGA 3QIBB 4QXVA 3WU1A 3WY4A 1R19A 4NHCL 2VO8A 2NY4B 3ZHNA 3L4VA 1FBIH 1E4HA 3MRIB 4Y9FA 4KJWC 1WA2X 1RZGA 1BHGA 5EU7C 3BIKA 4FJZA 4P59H 2ZP8A 2HG0A 1QSZA 1O5DT 4IRSD 5EZOL 4OB5H 2HJFA 4NS0A 5TDNA 4WNQB 1RURL 3H9SD 4LFHD 5IMLA 5IMKA 4Z7NF 4ZPVA 4BSJA 5BZDB 1V10A 4FI6A 1MCNA 1P4UA 2ITCB 1HZLA 3BAYA 2ZSWA 2VJ8A 1MPAH 2JJUA 3FN0H 4PJAA 3HC4H 2VLRE 5KN5A 2D0HA 5C2UB 1CXIA 4CA4A 1CGXA 1CQYA 4XN8A 1A8JH 4X7CC 4TTGA 2HTKC 2VABB 4E9VA 4D0DB 1I1AB 3FOMB 2OM5A 3QEQE 5AZEL 2X9YA 1HL8A 1YJDH 4LL4A 3ECVA 5KVEE 3NJNA 5DQDH 4TNWF 3DUUB 5HVGB 4LGSB 5BVPH 3QEHA 2YKLH 1MAJA 3TF4A 4KQ4H 4YFEA 2DQMA 4YFDB 5AZ2L 4Q58C 4KJQC 1PZUB 2IAMC 3CSBA 2EVHA 3G6DH 4GRMB 3MUGA 3K72A 1BSIA 5DTFA 4EZJA 4FFZH 2APVA 2VQUA 5SWZD 4JN2A 4RAVB 3VE0B 2CIIA 1PAZA 3VFGL 3INUL 2EXYD 2Z7UA 4PAZA 3NIDE 5CP3H 5F9DC 3WAKA 4BSWB 5LCVH 3QQNA 2XJKA 3DGCR 3CXFA 3HHSB 3OJDA 5I8OH 4P2OB 3QWNA 3LKQA 5J6GA 4ENEC 1D9KD 1I8LC 1P7QD 3Q9QA 1EFXB 1S9XB 2YGOA 4QY8A 3QJFA 4LIQE 4Q2ZB 4WKXA 4W6XB 4PS7A 3B4NA 1F6AA 1WH0A 1RZIA 3X2QB 1T89C 4KI5C 2FLBT 2Q3XA 1G9ML 3ES6B 2DYPD 1CF1A 2WUCH 3LRHA 5EO0B 4PLKC 4UV7H 4XI5D 4HS8L 4HIQA 1DYZA 1JNLL 1HE8A 3H7BB 3CFEA 3QDMD 4JZOB 5MEPA 3MDJA 3WI9A 5JHMA 4MKMA 2HTLD 5I1LB 1D5XB 1W0VB 3MRJA 3ZDWA 5AD0A 2AMUA 4P3CH 3ZSTA 4KZEH 1VRSA 5JQ6H 1CFTB 1EHLH 1WZLA 4HJ1A 4O02L 4GXVL 4N8CH 4JY4A 4BGDA 1GZHA 3ULUC 1NIDA 1RULH 3GB7B 4ZXBC 1A7BA 4HPYH 2WWKO 1U3HA 1YYLH 1PFOA 1A14H 1YC8A 2HFGL 1NUGA 1N7ML 3X1BA 3DWTA 3DYMA 2AFNA 2JB5L 4Q4EA 4R90H 2X4UB 4HUXA 4JFHD 2PP7A 4X9GA 2GIMA 5B1AB 4RLDA 3U6RB 4GP4B 5AKRA 1O7SA 1YUHB 2V17L 2B8OT 1MFEL 1IBHA 2A1WH 5CSZB 1E30A 2WXGA 5IKCB 4X99A 4GBXD 2C4FU 4E5XA 1DQMH 2J43A 1JNJA 1DLFL 1RIHL 2R7EB 3N43F 3U30B 5LAXB 2AJVH 1AHMA 3UAJC 4XNMB 3LPPA 2CO7B 3EOAA 3FUJA 4CC0A 5LGJB 3NVQA 1IC4L 3V5HB 4TQIA 4AIZB 4P05A 1KBGH 5AENA 3PGDB 2PW2B 4KO7A 4M7ZC 3VXUD 3QZWG 2F58H 5HY9A 3NCJH 2DQGH 2WO2B 3MSPA 5IJVA 2PYEB 3VXRB 3SKNA 1UD5A 3V6ZB 4DVBB 2E6JA 3QEGL 3PPSA 3SQOL 3ESVF 3GK8L 4PJ7F 1AE6L 2ATPA 3HNVL 3NGBC 2PCFA 5DFVD 3LQAL 3MUJA 1FH2A 3IMTA 5I30H 4LEXH 5CUSH 4ZSOA 4NKDA 1ZY9A 4N6RA 3KL5A 1IJ9A 3D05A 4XWGL 2DWEB 5TE7L 1OSZA 4AQAA 4NHUB 3VFPA 1FN4B 5HHXL 4ES9A 3PQYB 4NOBA 2CBPA 3ZHKA 3ZKQD 3EXLA 1BVZA 1GC1L 2K3TA 2MSPA 5IHUL 4V1DE 3ARGC 2E7HA 4NGHL 5JIHA 1N0XH 3LRLA 1UC6A 4XNQA 2K0RA 5DJDA 2YMTA 3OQRA 1AO7A 3DBSA 3PXLA 5JUEL 2F54B 1V5JA 3V6FB 3T6WA 1NM9A 3CLFH 3EYUL 2DQEL 3WTSA 4PJ8B 2B1HH 5FGCE 3S2CA 4A6YL 1XGUA 1YAZA 2VR4A 2FTAA 3SBWC 1I7RA 2BH0A 2W65B 2WLKA 4JHAH 2XXCB 1P4LA 2D7OA 4GFXA 2AXGB 4JM2C 3MV7E 3MGAA 3KDPB 4LHUB 4X98A 1DDHB 2D8KA 3EH2A 1T5XB 3P4NB 5I71C 1MFCH 4EDWH 4XE0A 4Y5YA 3KWWB 2D7TH 4W93A 4HIHB 4Y5YB 5A2IH 4UM9A 1UURA 2ZOWA 1EAPB 4KHTH 3B83A 4OM1H 1AGCA 2D3LA 1ZA3B 1NKGA 2Z31A 4P23C 2BJML 3V55A 3KPQB 2BOCA 3HLKA 2CGRH 3KYMA 4PS4L 4CJ0A 1GYAA 1E4WL 3GD1C 3DNKA 5TPWL 1ZHBB 2BFVH 4K3HA 3UIYA 3QUML 4MNQD 4ZMOA 1JTTA 2O5ZL 4M1CC 2F1EA 2HB0A 4O2FB 1T0NA 5JZ7C 3HG1E 4HWNA 3FFCB 2XPGA 3S35L 1G43A 5AOZA 2CUAA 1UA6L 3PJNA 2O6EA 1ESOA 4CC1A 5TE4H 3LZPA 4I2XB 4OJAA 5DHVH 1RZJH 5AAWC 4G9FE 1HQ4B 1EXHA 5TQ0H 4Z3FA 5HYJD 5CD5C 3QZPA 3QXVA 1HN1A 4PJBF 4EZMA 1XCTA 3ABKB 2R8SL 1HILB 5IK3A 3K6DA 1CGWA 4GSXA 4MXVF 1VGEH 4JRFA 5B8CC 2XNAA 4HWBL 3H9HA 1NUFA 3DLQR 2GTZB 4FMKA 4GYBA 2FNBA 3R1GL 4PWJA 3R0MA 2R9HD 1XGQB 5ACZA 5T3ZE 4MNQE 1FFPB 4BFBD 5CO1A 4BZ1A 2JK5B 1HAUA 3OXRB 2Y06H 3BAWA 3MRLA 1PBYA 4HV8B 1YLBB 1GSMA 3K74B 1EGJL 2PF6A 3H7LA 3IKKA 4OZHF 4F2ME 3KBEA 4WI8A 4LARH 2DMGA 2C9UA 4S1DD 4WHDA 4WTWA 5B3SB 4KX7A 1JDDA 1QYGH 3B1UA 5D8JL 3MRPA 2YSSB 2V5TA 4BKSC 2HVJA 2M8XA 1B4RA 5JZ7D 5MI0C 3BEWA 3MFFA 4OIBA 4X7TB 2Z93B 1MHPH 1MNUL 1AZUA 1SY6L 3QAZC 1WBXB 3V9FA 1R3JB 1F6FB 2WXOA 5DHVB 3O9WC 1YEKL 3L9EA 2G2RB 4TLKA 2LGNA 2FX7L 5K39A 4RH4A 1NCDH 3UBXG 1KPUA 3FN3A 2XIBA 1YYLL 3APFA 4ZBJA 3E6HB 4K55A 3IJ9A 3X14B 1J48A 2EYSA 4X83A 1DEEB 4C55A 2NR6A 4NJAL 4D94A 1H6FA 4NP9A 2CLVA 1W0YT 3TS8A 3Q2VA 3DBXA 3VCLB 4H0LC 3N6YA 1A1OB 5AVQB 1O7DE 4POZC 5K69A 3VFOA 4P9HH 3EDJA 1BEYL 3QWRD 1HOCA 2C3VB 5DUML 1T7YA 1DQML 3T2LA 2R9HC 2GJPA 3UXFA 2E56A 1YNLH 3JWOH 1EAOA 1FZMB 5CEYB 1A5FL 1L9OA 1AD9A 3BD5A 3QJZA 3UTSE 4B9ZA 1EANA 2X4RB 2B4CH 3BH9B 3STZA 5A16A 2FZ3A 3AG3B 5I1GL 2HX8A 3C9NA 4EI5C 4HH9B 3RVWD 4HUVA 1HI6B 2FWLB 1NGYB 4KY2A 3RGVC 3PQYE 1LO2L 1EX0A 3VRJA 5BO0D 4LLQA 4NSKA<