1LILA

Bence jones protein cle, a lambda iii immunoglobulin light-chain dimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
212
structure length
212
Chain Sequence
YEVTQPPSLSVSPGQTARITCSGEKLGDAYVCWYQQRPGQSPVVVIYQDNRRPSGIPERFSGSSSGNTATLTISGTQTLDEADYYCQVWDSNASVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pitfalls of molecular replacement: the structure determination of an immunoglobulin light-chain dimer.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords LAMBDA III BENCE JONES PROTEIN CLE
total genus 34
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lilA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lilA01
2Q3ZA 2A9MH 2A77H 5DZOA 4JY6B 4N8CH 1FL3A 5BV7C 1IRAY 1WT5C 3GSRA 4NZRL 2APWA 3QB7C 4RMTA 4GRLA 3ALWA 1KIPA 4P46C 5F8QC 2ICEB 3DRTB 4JRYB 3MJ7B 1NKOA 1UEMA 5FYJE 4JY6A 1MHPH 1AIFA 1UEYA 3VFMA 1WFNA 3D25A 2I9LA 4NZTH 2HKHL 2IQAB 4Y19B 3KPSB 1RZKC 1A7NL 1NGYA 1FDLH 4U1JB 4HBCL 2CK0L 1FH5L 3SKNB 3ULSA 5HDLA 3HR5B 2EDJA 5LGJA 1RIVH 1RZIA 1MJ7L 1RZKH 3F7PC 4LCUB 4UT6L 2NTFB 3PGDB 2J5LB 4J3SA 2PO6A 1JGEA 2V2WA 1T83A 3GMNA 3RWEB 1A6TA 3VD7A 3GMMB 1YYML 2XFXA 2C1OA 1N8ZA 3IYLW 5DD5L 4ZDHA 3QWRA 4H5SA 1S9VB 4JFDD 4GG8A 2V5SA 1BQSA 5BO1H 5FO9B 3MLRL 4NO5A 4PLKD 1MF2H 3AAZA 1YEIL 1Z3GL 5IOPB 3TT1H 4WFGD 3EOAA 1KT2A 2DIBA 3HLAB 4HK3N 3L6FB 4XMPH 2E7LC 3W0WA 1T0NA 1YJDL 3GO1H 3GBMH 5E2UL 4X4XA 1VKXB 1G7IB 1L7TL 4M7JL 4D9LH 3RY4A 4P2YA 1I3GL 2JJTC 3QZWA 4XZUB 5GXBB 1PG7X 3C8DA 3C5SA 1LO0L 3G08A 3OPZL 4P4KC 1JZ7A 1MJUL 2YC1B 4QRSB 3W9EA 3CZFA 3EDKA 3REWB 1R0AL 3PHOB 3J7HA 1AXSB 4UAOB 1KYOK 3BKJL 3RDTD 3GUTB 3P73B 5ICXA 3QUXD 1CK0L 2HMIC 1CU4L 2LTQB 4UIKH 5L7XH 4QGTA 4Z7UE 2Q20A 4PGEB 4OZHA 3VXQA 4HJ0C 4K94C 4YHKL 4KKBD 1BMGA 1IC5H 2E5EA 3ILQC 5E2TH 4F57L 4PTTA 2BVPA 2H1PL 4KI5D 1WBXA 5D5MF 4M6ML 1JPFA 2APVA 3HMWL 1UJTA 4OGAC 4ZUUB 5E5UB 2AXFB 1LO4L 3ZL4L 3CVHB 4GUPB 4KROB 1HQ4B 4PRDB 1S78C 4MXWL 1T20B 1ND0B 1EGJL 4WEBH 1B4JH 1SY6L 4PJ9A 5CP7A 4OD3L 3IFLH 3KXFA 3FO1A 2R15A 3U7WL 5IHUH 3MV7A 1HHHB 4N0RA 2XFXB 4LLUA 4HJJH 3MNZA 4OLWH 4WFFE 3MA7A 3TZVC 2FJFA 3QEHB 3MV9B 2ZJSL 4QHKJ 3UTZA 4RQQB 2K3TA 2F15A 5INDA 4YPJA 4JFYA 4RMRA 4R26L 4KROD 2NY4D 4M1DL 3NGBC 2BDNH 1T2QH 3QQ9C 2HT4C 3ARQA 4MCYA 5JMRA 3ARDB 3HZMA 1YNLH 1FZOB 1LEKB 4L9DA 4LVHB 4IHOA 4XTRC 4XRCB 4KROC 5IWLA 5MHSD 3VA6A 3H7LA 4L5FL 2VWEE 3QULB 1VERA 1F4YL 4IJ3B 3C08H 4JHWH 4UILL 5EZJB 3X3FL 3T77B 2BNRE 5E2WH 3W39A 4BSJA 4X7SH 4MD4B 4X9HA 5LGHL 4HK0A 2ADJB 3D18B 1CYGA 4PBWD 2V9RA 4XP9H 4NO3B 4PGZA 1CL7H 1FSKB 1AE6L 4WWKA 4Z77A 1JF6A 4RAUA 1XZ0B 5IB4B 1XGRB 5D1ZC 1XF3A 4W6WB 1V3JA 1WISA 4JPVL 2AKRA 2R0WL 1TETH 5FB8A 2J8HA 3TNMB 4RWYL 1KJMB 1XIWC 3DURB 2HLAB 2OJZH 4JY5L 5BZDB 2VYRE 1LP9A 2NZ9D 5JOPE 1VADA 2HP4A 1NDMA 1TVHB 3QNZB 5F3HA 1QBAA 2OBGA 5FYJU 5DFWH 3EO9H 2EYRA 3OKLB 3X13B 4RAVB 4RMQA 4YAQB 3V52H 2D9CA 4XX1G 1OAQL 4JKLA 2ORBH 1YJDH 2FRGP 2JB6B 5CAYB 3WLWC 3CDGA 3JTTA 4FXKB 1PYWB 2KUTA 3JTTB 3MGOB 4ENEC 4P9ML 4PRIA 4LPWA 2J12B 2FJGA 3VD5A 1VACA 1JPSL 3H3KA 5CILL 5BMFH 4MJ6B 5I8CA 2WBJC 4KK5C 1IAIL 4GSDH 4ZXBD 5L8JB 1VADB 3KHOA 2FX7H 4B7LA 5LAXA 3WE6A 2NY6C 3FRPA 1DFBH 2GTWB 3DRQB 5BXFB 3NPSC 3VXMB 3AS3A 1J8KA 5BCAA 2HTKC 2Z4QA 4I0KA 1BFOA 4DZBA 4ZUVB 2BMKA 4M7KH 5HPMB 4MMZC 5D7KE 2R2CA 4AEHH 2OJEB 3IDMA 4OT1H 4Z7QF 2DKUA 2P8PA 1MY7A 3BAEL 1CTNA 3CXHK 4LCYB 2P42B 5I1CH 2GY5A 4KJYB 3BZEA 1ZA3B 3ILPB 1TZHA 4X98B 4Y4FC 1FFPA 3UTQB 2EH7H 4XWOD 3BP6A 4FQ1L 4DUWA 4LSUL 3FN3A 4LPYA 5I71B 5L2KE 5I8KH 3MLUL 4PJGA 4MA3B 3O3BA 4KKCD 5AWNH 1OOAA 3CAFA 5FUOH 5GGQH 2NR6C 3NGBB 4HXAL 3BP7A 4IM8A 3DVNB 3UP1A 5DJAA 3PWPA 1ADQL 4BKLA 2R0KH 2ZJSH 4O9HL 2B39A 3BH9B 3B2UD 1HI6B 2IPTL 1FRGH 4LSRL 1BIHA 2FYYB 5M95B 3GEWB 5DLMH 1CVRA 1JGVL 2VR9A 3MRLA 3D1MC 3WXWH 5KJRL 4G8IB 4KK6C 2ED8A 5BJTA 4IS6B 5EO9A 1E4XI 1JRHI 1BBJA 5CZVH 5INDB 4OD2A 5GSVB 1FO0H 3MRJA 4ZFGL 4OZFH 3FB7A 5IG7B 2ICES 4H8WH 1KGCE 2XYCA 2YN5A 3TYFA 1NFDE 3MLXH 4LLDA 2MWCA 4O2CB 4ONHA 2O26U 4AMKH 4WJ5A 4JN1H 4QT5B 2ZCKL 1QEWA 4X7SL 5CS7A 1QKZL 2IALA 5EU6A 3LVEA 3PJSB 3G6DL 4S0SD 1QBLH 3KJ4C 1B0RA 3OXRB 3MRMB 4LGRB 3AUVA 3K0WA 5FYJH 2YBRA 4LGPB 4DGVL 1FO0L 3G6JF 4I18C 4G8GD 4JDZB 3WHE1 3FQWB 2VR4A 1MAJA 1IJ9A 1BQHG 1G7PB 1U58A 3S97C 2DI9A 5FV1L 4OD3H 1GC1L 2YPKA 2IFFH 1LO2H 4MSWB 3U9PH 1IT9H 5ALBH 3RAJH 3W0WD 2X09A 4PS4L 1YEDA 3L3DB 4OFYA 1OP3H 5HBBA 5CEYB 2UZIL 3D48R 3FFCB 1V7NL 4Z7VB 2RIKA 1XMWA 3HR6A 2ZOKA 2ZG1A 1Q9WB 3VI4E 4BFIA 2EIZA 3O3AA 1IGJB 4XMKL 5IK3B 3U0WL 4HZLB 43C9B 5D4QA 1VKXA 3SPVA 1CG9A 1HKLH 4JVWA 4OCRH 1CIDA 4PJIB 4DGIL 3AB0C 3MQIA 3VXTB 5IOPA 4RMSA 1MI5D 4OI7A 4GXVL 4M4PA 5E1AB 4POZC 3QPXH 2FHFA 4XI5D 1P4BL 4QHNB 3VXNB 1LE9B 1FO0A 4KKAC 1L0XA 3STZB 4ZPVA 3OHXA 4K7FA 2AP2A 5I74C 3PDOA 5JXAL 1AQKL 2WUCH 3IJSB 1LDPL 4KHTH 2VLKE 2PO6B 1QVOB 4CVWA 1UA6H 1G7JA 1ODAA 4ZAKC 1B90A 4HKBA 12E8L 5LGKA 4FMKA 3VXRB 1RK0B 1NAKL 3DROB 4XNMA 1NGYB 3V5HB 4Y2DD 4KKAD 1FLTX 3RNKA 1LDSA 3DPBA 5KS9F 1KN4H 1TTGA 5E99L 5FEBA 5D7KD 3C60B 2X4SB 4LSPL 5C8JA 1UADC 1YN7B 4I2XB 4DZ8B 5DI8A 1JWUB 4X9IA 3VFUB 1IGCL 5T1MB 4X6FB 2RQ8A 1C8PA 1TIUA 3IJHB 1TFHA 4MAYD 2EO9A 3D9AH 3BIBX 5E6IA 3OX8A 4P48A 1G7HB 1MPAL 1AD0B 2MHAA 1QFHA 4Z7WB 3OKMA 5KG9B 4Z7NE 2H2PD 1IGYA 3VFNB 2AVGA 4Y2DB 5HD8D 1RZKL 2E27L 2R23B 2HVJB 3OTTA 5E9DA 1F4XL 3KPSE 4M61B 5TH2A 4LNVA 3LKOA 1NCAH 4AT6B 1UC6A 4LDOB 5D72H 4LCWA 3IDXH 3NIDE 2FR4A 1EZVX 4JDTH 5IMKA 5DHVB 3QRGH 1JK8A 5HVHC 2YOCA 5C0BD 4ZFGH 5C0ND 5J1TC 3QYCA 1A7PL 1KJ2L 3V4VL 3MLZH 1WZ1H 3HC3H 1KXTB 2YRZA 1UXWA 3ZYJA 4UQ3A 3GKZA 3SGEH 3DV6A 3CSPA 3UDWC 2E27H 3HC0A 2P5WB 4FQJH 5ESAB 3NBNA 4Z0XA 1EFQA 1A1OB 4HUNB 1DN0A 2V5RA 4TVPL 1CBVL 4LSSH 3GSUB 4WUUD 4NSKB 3ABZA 3TBWA 1MCSA 3T0VA 1U3HD 5IW6A 3PQYD 3MCLH 2WBKA 1DZBA 3EJJX 1WC7A 3ARTA 1RQ5A 4OZFB 4OGYL 3SE4A 3RVVC 1A6UL 2HJKA 5INCB 2Y06L 1U41A 4MCZB 5SX5H 1WQVT 2V7NB 1UFUA 4HS6A 3VRLF 2WANA 4GRMB 1WWAX 4UNVA 3VGGA 3HE7C 5CJXA 5EZOL 2DD8L 4KK6D 4JVUA 2P5WD 1RUAH 4PV8A 4YFLF 5BS0E 1JI1A 5LQBL 3DUHA 2DLEA 2W0FA 3QEUA 4C56A 3S35H 3QCTL 3LPGA 4G9FE 1IAIM 1LILA 4UDTB 4MNQD 2EDFA 3VWJC 4NKOA 5F21B 4LLWA 1MHEB 3G6AA 4UV7H 2EE2A 5E8NB 1MCPL 5EUKA 3CH1B 1XGPB 1A64A 3ZHKA 1UM5L 5GGVL 4XNZC 3RJQB 4EUPB 1Q72H 2EDEA 3TF7C 4YHML 1YEGL 4RZCB 5DRNB 1L0YA 1HXYB 1PKQA 3O6KL 1FGNH 5IBLC 1TQCB 1MQ8A 5DMJB 1OSZB 3VA2C 1JYWA 4M5ZL 1P69B 1JZ2A 4F58H 4QHMB 5I1HL 4P5KA 4JFOA 2NY0B 2VQ1A 4E5XB 1LWRA 1UA6L 5E2JA 4UINL 5IUSA 4G8EA 1YMMB 2XKNB 4R90L 5IBTH 4KVNL 1R3JB 1VEMA 3EW3B 5EZIL 4M62L 1T66D 4JREC 1LK2A 2ZCLH 3PWVB 2VSDA 1SYSB 1MFCL 2EEBA 1X5ZA 2P8MA 3OAYH 4WUUA 3SGEI 4ZNEE 2Z93A 5IW1A 3TA3C 4HF5H 4QKXB 5CHNB 1A9BA 2H9GA 5IMLA 3QH3A 3QUZB 4XPBH 4PJBF 3QRFM 2F8VA 5IR1B 2P24B 4QRPD 1A1MB 4CADA 3FO2B 2WBJB 2FBJH 1INDL 2VN4A 3GMQB 4GFTB 1WFOA 1CE1L 5ACZB 5F3BB 3L3KB 2B0SH 4YBQC 5F6IB 1DQML 1FYTB 2FATH 4AIZB 5I1EL 5IVOA 4JLRA 4HQQL 3H42L 3X11A 4PRAB 4NFBA 1VENA 1BX2B 1I7RB 2OL3A 2QKIB 5T1DL 4HMDA 4A2MA 3MUGA 1FVEA 3GNML 5K9KB 2IBZY 1NBZB 3RL1A 1DBBL 5GS2H 5E6YA 5FYKE 5A3IC 5I75C 4ZAKD 4Y4HB 5D5ME 2D7PA 3ALXA 3UCRA 5HHMD 1AGEA 4TOYH 3DYPA 3FQUA 1C7SA 4APQB 4LASL 4LQFL 2DOCA 2EDNA 4CDHA 1CR9L 3B2VH 1JPST 3H0TA 4HAFA 5D1ZB 3WL9B 3K1DA 3HRZA 4NZUH 3OGCB 1RK1A 3TA3B 3GIZL 1P84K 3P4OA 1IILE 1QBMH 4HWZA 5E08L 3W9DB 3BKYL 5HYJD 4HK3J 4OSUH 5IJVB 1FJ1A 4P2RB 4JO4H 1DEEB 5ID0A 2GK0B 4APQD 2AV7A 2I9TB 2YPLD 2HJFB 4OCLC 4L8CA 5FM5O 1CGSH 3UAJC 2AEQL 1C16A 2VXUH 3HG1D 2ADIA 2Z0BA 4P2OC 4ORZC 3RA7L 3SKOA 3GO1L 4P5TA 5ADPL 4XPGH 4KK8D 3PWJB 4M9OA 4BQ6A 1PZUB 3OKEA 1CD9B 4LHQB 2CDFA 4OF7A 4L4TB 4JHBA 4JZOB 4NQUA 3FQRB 3KNBB 2XIDA 1S8DA 2BNUA 5BW7C 3T4AB 2RR3A 3D6GA 3QDAA 1ZHKA 4H1LG 5E94B 5BS0D 3MCKB 1FC2D 3RIFF 5EU3B 3DO3A 2Q8BL 3QUXA 4M9PA 1CICD 1MCRA 3M17B 4NJAL 1GCFA 3DYMA 1EFXB 5KW9L 4OFYD 5EZLB 5F9OH 4EN3D 5DD0H 5DVNA 1MVFA 1NUDA 3I3BA 4PTUB 4U1LA 3HI6L 4PJDA 4TSBH 4P46B 2ATPA 3MLUH 1JZ3A 4H88H 4YXHL 2NY0C 2YS4A 3MV8E 4BYHA 4TULL 3LN4B 4L3CB 3LD8B 1IAOA 1CDUA 4GKSB 4NGHH 3UPAA 4BQ9A 2A9ML 3GI8H 5DS8A 2H6PB 1BD2B 5EFIB 3O6FB 5C0CE 3E1F1 3PWPE 4N8CL 3DVFA 3CX5K 1VFBB 1NC4A 3G5YA 3L5XL 3C60D 4KVNH 4L9LA 3OWEA 1JGVH 3V9FA 2ED9A 1JZ8A 1YPZB 1CLCA 2F54B 2F53D 5CLWA 1FZKA 2GUOA 1F2QA 1AJ7H 4X4ME 1T21A 2GFBA 4K8RD 4RGMB 4PG9A 4U1KA 3HI6H 5JUEL 2CLZB 5MENE 3T2QA 4P4KB 4KY1H 1KOAA 4QXTA 2VDOH 1TJGL 3L9RA 1KPRA 3RKDC 4R96A 3O6FD 3JTSB 1T2QL 1UENA 4U1KB 3WHE0 5J0BA 4AZ8A 3FOLA 1MFEL 4X6DF 4LLYA 4BJLA 1VFOA 3KR3L 5ERWB 4OLUL 4GMTH 3G04A 3BEWB 3F7RA 1WK0A 3HE6B 5F89A 5D5MB 1CFNB 1HXMA 2AJSL 3HTLX 5ID1A 2X44D 4MLIA 2VRAA 2YD9A 4A6YB 2QV2A 4WO4D 4P9HL 1A6VL 1ZT4B 4WGWB 2PCPA 3VI3E 5T33L 2R39A 5BRZD 2VXTL 3L3IA 5JMOC 5C0FA 3SQOL 3P9WB 1IAOB 1X5IA 3QXAA 3L7EB 3LN4A 2RHEA 4L3CA 3HFMH 2YSSB 3ARGD 5GIRB 1FAIH 1GPOH 2J5LC 4JFPA 5FYKD 3RFZC 9CGTA 1PEWA 3WBDA 4JO3H 3MJ8B 3PV6A 3DX6B 4F8TA 3WFCL 4P5MB 1LO2L 3NIDF 4XAKD 1MJUH 4MXQD 2R0WH 1MCCA 1U3HB 2VDQL 3RZCB 3UBXA 1S9XA 5I0ZA 1I8MA 4F7TB 1P5UA 4L1HA 1OTSD 2PYED 3BSZL 4JG1H 4TSAH 2UWEB 1AGBA 5HGHB 2B5IB 3BJLA 43CAB 3KNBA 1H8SA 4QLRA 2FIKB 1RZ8B 2E9BA 3MOAL 5KANI 4YDKL 5LBSH 4LQ1A 1J0IA 1DR9A 3V2AR 1RZFH 4JDVA 4AENA 3NOIA 1SYVA 3H9HB 3LKRA 4Y5XC 1QRND 5HY9B 2XWJB 1A02N 3ARRA 3RVTC 3WO4C 1RUMH 5I1LA 3BPOC 4Y5VB 4QYOA 3B5HA 4N9GB 4HWEL 3RU8L 1ZLVH 3KJ6L 5EBMB 5FGCE 4HQQH 3Q6FA 4NFCA 4UOW0 5FDWA 4OUUA 1O5DT 1MHCB 1LDPH 4ZO6A 1QYGH 3I3DA 2DLFH 3ZDXE 1P2CB 3IFNH 4S2SA 5FUCC 5EBGA 1ORSB 2CKBA 3EDEA 3KPRE 2EE6A 3U30C 2DQTL 1OLLA 3S5LG 5F7EL 3C6LB 15C8H 1QA9A 3QIUD 4KTEL 1T83C 1FL5B 3IJYA 3LQAC 1J0HA 5TPWH 4LSPH 2HN7A 2Q7YA 3HZVA 3MLTA 5C7XH 1IAMA 1OSPH 4XPTH 2VWEC 1EA9C 1AGCA 4MJIB 2C3VB 1A22B 3EO0B 3MV8D 4G9DA 2WMPA 4OI8A 4C4KT 1FN4A 3BRDA 3VFVB 2DM3A 1K2DA 2EDTA 5DRWB 5F9AC 4JFEB 5FUCE 2R2BA 4QRPB 1S7WA 1EO8H 3FJTA 4N0UB 4ZTOH 3IETB 3PWPD 3VDAA 5K59F 4HPYH 1J0YA 1SVZA 3EGSA 3NZ8B 3RRQA 3BDYH 1GSMA 1HHIA 4HMEA 3ESUF 4LSSL 1X7QB 3T09A 3UTTB 4TTGA 4UI2A 3QUML 2NY7H 4M1GH 5TQ0L 2EECA 2I27N 5CHNA 4X7DC 2IBZX 4ZYKA 1NFDA 4YFLI 5MEND 1NL0L 3O3DB 1N6UA 2EIDA 4Y4HD 2FO1A 4R7NB 3WD5L 1WAAF 1MUJA 5LKNA 5L8LB 4OUUB 1BLNA 5J1AA 4FXGB 3OJVC 4WV1A 2HG5A 4P9HH 1PKOA 4DQOL 2AJXH 3VWJA 1PGRB 3SE8H 3PWLA 1BIIB 1F13A 1QQDA 5HY9A 3LKRB 2FJHA 2YA0A 1ZAGA 2QQNL 3L95B 2FLRT 1U8LB 1A6UH 3MROA 5BVJA 2ZG3A 3U2SB 4DN4L 2NX5B 5C9KA 1FP5A 3UJTL 3MO1B 1YA5A 2WK2A 2X4PB 1R5WB 1X6NA 2X05A 2I07A 4P2RD 5DJ6A 3WIHA 4Z7NF 3IDIA 1I3GH 4B7IA 4EDXB 1A3QA 2YD4A 1NEUA 2R4SL 4QEGA 5E00B 1YMHB 2YEZA 3S37H 2BVQB 3VXUB 1BREA 2DICA 4LCWE 4N5EC 2BCKB 4Q9BA 5JIHA 3CPLB 4YWGL 1J1XH 1U8LA 4LL9A 4NM4H 3HPJB 4YO0B 5GGVH 4C56B 2HRPH 2PYFB 2PYEE 2AJUH 3IB4A 3MJ8A 3PV6B 4OFKA 1AD9B 1BBDH 2OR9H 4QWWC 2NXZC 3V6OE 3BPCB 4KDTC 3TBVB 4HUVA 2VUYA 5CCKH 5GS0C 5I19H 2DN7A 1M7DB 3QDGD 1LO4H 3CH8A 1V7MH 3QFDA 2XZCL 1MUJB 3C8KB 1R5IB 4IIQC 3VGDA 3O3UN 4U6XA 2YXFA 2XXCB 4WWKD 1H5BC 3IKCB 3T0EA 2E7CA 1NCNA 2DWDB 2JB5L 3BMWA 1SBBA 3K46A 2I60L 1IM9A 3JSSA 2F58L 5CJ5A 4OLXH 3OKDB 1AQKH 3LKPB 5DUML 1MAMH 4G80B 1QO3A 1HHJA 1RIUH 5HGGS 3UTTA 2VLMD 2WUBL 3GI9L 1NCUA 2LV4A 5E6ZA 4QTHA 2E8ZA 1BBDL 3U4AA 4NBYB 5T1LB 3OB8A 2DL2A 5F7EH 5FYLH 4DTGL 4G7YH 4XNUL 3VXSB 4HW6A 1II4E 4LSVL 4E41B 3L1OH 5F9WC 1J10A 5F7HA 5CZVL 4J3UA 4DCQB 1SJEA 3OKNB 1RAMA 3U0TA 3BQUB 5C3LD 1ZA6A 4Q6YA 4HPOH 1DLFL 5EC1B 4KKLC 3T0XA 5I66B 4LLQA 2XWBA 4UMGA 4GW4B 4NQSB 3S7GA 2N4IA 2F19L 1U8NA 4LRNH 3WIHH 4WEUD 2QADB 3MLTB 3HZVB 2AEPH 1GC1H 1FIGH 1DQMH 4UTBL 3U9PL 4EI5B 4Y2DA 5D1XD 4JFEA 5E2WL 2E9IA 4ELME 4YXLL 3RGVC 3I50H 4QTIH 4IMLB 1EO5A 2ATPB 4C4KO 2X1OA 4XPHH 4RSVA 5F7DA 1SY6A 3QUMH 2ITCA 3SDDC 1D3CA 2AXJA 1MVUA 1I9RH 2ICWB 4RWYH 1T3FB 3O9WD 2PXYA 3MBXH 4JY4A 5EU3A 3E0GA 4NP4H 2AEPL 2JF1A 1HSAA 3DHMA 3SDXA 3KYKH 4PBVC 1T2JA 2BNUB 3TZVB 4MA8L 3I9GH 4FQJL 5EOQH 3VFWB 5D9SB 3VFTB 3V5DA 5JW4Q 3FB6A 1I1FA 1HE7A 1UGNA 2XTJD 4S1SH 3RUGE 1LK3L 5FDWB 1RZJC 3AY4A 3OR6B 3CLFL 5EN2A 1DQJB 3DXAA 4FZEH 1QNZL 4OGXH 3MBEC 4OGYH 4HHAA 4KQ4H 3EO9L 2A83A 2UWEA 1DCLA 1D9KB 2P7TA 2VLRE 1PSKH 3BRGC 3WFZA 4NUJA 4AIOA 3VXPA 4NHCH 5T5NF 2AV7B 4K7PL 5IK3A 1CFTB 4R4FL 3RL2B 2NYYD 3RDTA 1RUPL 3BKCH 4TYUA 3EYSH 2PTVA 1Y18B 3WLBB 3WO3B 4WFGE 4Y5VC 3RPIA 1F6AB 1NMBH 4K3JH 3UPCA 3H9SA 5HGBB 3WNOA 1YEDB 5HD8C 3L7FB 3MYJA 4LIQH 1JP5A 1S7XB 3ALPA 5GZNC 2G5RA 1A6ZA 2OTUA 4L3AA 4K3DH 5I1IH 5FO8B 3ZDZE 5D7IA 4QRRB 2GHWB 4JCLA 4LCWD 1P7QD 1EHAA 4KRPD 5D1QA 1HH6B 3BAEH 3M45A 1E6OL 4Z7UA 3FQUB 3MYZA 1X4YA 1KLUB 1AQDB 4PJEE 4HWBL 2YBRB 4LSTH 3S6CA 4F9LA 3EZ8A 4GW4A 4NT6A 3E6FB 3AM8A 4K3HA 5HHOE 2L0DA 2NZ9C 5I1CL 3GMPB 2G5BB 4H0GA 4U0RC 5JA8B 1XGYH 1Z0MA 5CJBA 2EO1A 4LHUD 1TPXB 4JHZA 1CXEA 4I5BB 4XCFH 3IDNA 3EOYG 1JN6B 4BH8A 1QPXA 4OLUH 3U46A 3PL6C 2A0LC 4X4MA 3OJMB 5FA3B 2J8UB 5C0DA 3MC0A 4FQXD 5C2BL 1T21B 2GFBB 4KY1L 1WSST 1J1OH 2ARJQ 3HZYA 1QO3B 2I25N 4KVCH 1UCBH 3PNWB 3L5JA 3MV8B 1UVQA 2R1WB 3MUJA 2H9GB 3UTSE 5ERWA 4FQ2H 4Z95L 2KZWA 4DCQA 1DBJL 1FV1A 3KHQA 5I1KH 2UVFA 4KK9C 2VDOL 4I0PC 5DUBB 3FFDA 3C09B 3HC4H 1R3JA 1R5VB 1AO7D 3MMEA 5DHYB 4KQ3L 3KS0J 1CE1H 3BH9A 3GSNB 5GS0D 3F12B 5T1LA 3ZO0A 4PRIE 3CFJB 4PGDA 1O0VA 1RZ7H 4R8WH 3SDDA 3NCCB 1GZPB 4OCMC 5I8OH 4H20L 4CW1B 3MUZ1 5KVDL 4FFZH 2JCCF 2RFXB 4H1LB 3BSZH 2OTPA 1RU9L 1QFUL 2BOCA 5I16A 4JVPA 1TDQA 1A21A 4X99A 1OGAA 5SWZD 5D7IB 4GAYA 3D3VE 4PRNA 2LVEA 4MVBC 1R5IA 2BRRL 4BK5A 2W07A 3MA9H 4MHHG 4FG6D 4UB0L 1X5JA 4LGSB 2XZAL 3L3OB 4YPGA 1FC1A 3OPZH 2C5DC 4OQTL 1EFXA 1F3RB 3KLSA 2CH8A 5GS1A 5F72S 3BE1H 1SBSH 1QPPA 4G42A 3VXMA 4HUKB 4UINH 3MLSH 3ZE1F 1TJIL 2W0PA 1N5YL 3RBSA 3PWUA 3L3OA 4M4RA 5C6PB 5I1JH 5B4MC 1R6VA 1I3UA 2QHRH 2PF6A 3T4AA 2I9TA 1A2YB 5A43C 3JXAA 2ZSWB 1FVCB 1I7ZA 2VMFA 3KPTA 3OR6A 4WEMB 4NQEE 4G3YL 3QIWB 3IDIB 4DVRL 5EWIL 4K2UL 2IC2A 3VXUD 3LH2L 3CFEA 5B39B 3V7AE 1XGQB 2V2XA 1MNUH 2YRLA 1EO7A 2VZ3A 3DIFA 1X5KA 5KBNC 1RK1B 1UM6L 4PRPD 5DWUL 2WZPD 1JTTA 3OKLA 3GSWB 4PJBA 5HXMA 1QACA 3BHBA 2IPUG 2QL1A 1FVDB 4CW1A 2CJUH 3WUWA 2HG5B 3X17A 3H9YA 1T7WA 4WV1B 3CFJA 3SDDB 4HUMB 3MX0A 3C5ZD 4PG2A 4D0CA 1N26A 1VFMA 4Y4HA 5IQ7H 1S78D 3QO0A 3W9DA 1EAPB 5IMKB 1OAZH 1EJ6A 3ULVH 5JHDA 1AY1H 2HTLC 4LPTA 4HG4K 5IESL 4PRPB 2UV3A 3DSNA 1QLFA 1HYSC 2VNCA 2FBJL 1DQDL 3ARDD 3BZ4A 1U95A 5TH2B 5L2KB 4H88L 4AM0B 4OLWL 5EO0B 4ZPTB 3U7AA 1EJOH 3BT2H 1GRWA 4N0UA 5TQ2H 5L2KA 1UT9A 4LARH 5C09D 3VXSD 3FO2A 5HHOD 5KG9A 1NAKH 5CSBA 4ZPTA 5I30H 1JE6A 5EC1A 4X83A 3KYNB 4HBQA 3BP5A 2WINA 3JV4A 4R0LC 4H1LH 4BUHA 3LQMA 1SJEB 3NABL 3TJEH 2R9HC 1BM3L 1EAPA 1WGOA 3X11B 5IM7A 1NGWB 4NQVA 3MREB 1GGYA 4C56E 3T08A 5KSAC 5JHDB 4KQ4L 3A67H 4MCYB 2OLDA 3HAEA 4WFHD 5C08E 3TWCH 5CZXD 5A16B 4U0RB 4QTHB 5KVFH 4AG4L 5I1KL 3CDCA 2VDLH 4G6JL 4GLRI 3ZE0E 5CEZD 3SJVD 1VCAA 1CXIA 2ENSA 5I1LB 5C0NC 4Z7UB 3VGHA 1HWGB 3P0YL 2XN9E 3ARDC 3STBA 1G7JB 3RIAK 2DQEH 1QLFB 2BC4A 3WLWD 2RBLA 1SM3H 2IGFH 2IAMB 3PGCB 5IHZB 1RULH 2FIKA 3RNQA 2HLFD 2NX5E 2C4FT 5C92A 2E6JA 2AXGB 5E8DL 5K9OB 3IU4H 3DVGB 4G6ML 1GGIL 1U8OB 3O2VL 3DI3B 4PRID 1M4KA 1DUZA 1SEQL 4HV8A 1QSED 2BRQA 1HHKB 3RVVD 1DBKL 5GHWL 3SCMA 4QRTB 2HRPL 4N9GA 1YPZF 1W0VB 5I71C 1FDLL 4LLVB 2N1KA 2OR9L 3O0RH 1PKQB 4GMSH 5EN2B 4N0CD 5F70A 1X5GA 2C9AA 3B4NA 4Y16A 3SDCA 4ODVH 3BPLB 5B3NA 4NBZB 2R4SH 1UWGH 4UV7L 4HS6B 1RV6X 2PYEA 3LS5L 1NGPL 4XX1E 3L3IB 3CZFB 3F8UB 2OL3L 1IGIL 1SEQH 2V17H 3PV7A 1RUKH 3PWUB 4JDZA 2A74A 2CRIA 1OAXL 4LFHD 2HFGH 3DTXB 1V7ML 2WSKA 4U2ZA 3IDJB 3SE9H 4XWGH 1S9XB 4NNPH 5EG6C 5KANG 4FABH 3W0WE 3CXDL 1E4XL 3DV6B 3OR7B 4L4VA 1KIQB 3EOAB 1YEEL 2Y1VA 4UZGA 1K4DB 3EHBC 1QLRB 5J7CC 4JFPB 3U7YH 4P49A 4Y4HC 1FGNL 4ZUSB 5DGQA 3VWKA 1AR2A 1D6EB 4MZ2A 4Z5RA 5FGRA 2A6IB 1IKFL 4K8RC 3T2OA 2JKXA 5FYLL 1ZT4A 1IGIH 4TPRH 5CSZA 1FV1B 4CMMB 3TYGH 5LCVH 5E24E 1HYRC 3G5VA 5DD1H 2MOVA 3PNWA 4L9LB 5AG9A 4PY7A 4LLQB 2GSGB 4XNUH 1IC7L 2O61B 3U0TB 5EOCH 3IETA 3OAUL 3U0PA 2HJLB 5C0DB 4BZ2H 5IMOB 3K8LA 1RHFA 4RNRA 5DHVA 1YEEH 1U91B 3MA9L 4LRIC 4R96B 2N7BA 5DRWA 3BT2L 3M07A 4Y1AB 2DAVA 3GMPA 2CLZA 1UWEL 5IT2H 4YNYA 3KXFD 1FORL 4L3ED 4NQCA 3QDHA 5IHLB 1IC4H 3QXVA 4YXLH 2A9NL 3LKOB 1T7VA 3MLSL 4HJJL 3V7AG 3P30L 3LKPA 3C60A 2IBBA 3IU3B 1PG7L 3WNPA 1F5WA 1CLOH 3GHBH 2AERT 3MV11 1BEYH 5DZNA 3DHJA 2VABB 1MFBL 4KWUA 3LY6A 2VZUA 4QRRE 2IMNA 3TIDA 2EYTB 5D71H 3U82B 2NXZD 1O7VA 3QHTC 4LCCB 2FD6H 1GH7A 4JZOA 4PTUA 4MB5A 1IKNA 1IM3B 5CBEA 1F6AA 3CLFH 3U9UB 2HT3D 3IJSA 3B9DA 5FV2A 2FEEL 2K9UA 3SDCB 4WFHE 5C08D 4Y19D 4OQ1A 3KPSD 1AI1H 2C1PA 2YUXA 2HT3C 5E08H 3QUXB 1TMCB 3Q6FB 3ARZA 5EBMA 1QHOA 1TCMA 3PG2A 4YO0A 2GTWA 3DV4B 3DROA 3WD5H 2ESVE 1SMAA 3R8BB 3FFCD 1S7SB 3NCYS 4F33B 5KAQG 4GBXA 5DJXB 3TT3L 4OZHE 3AREB 3ARPA 4D8PB 4AH2B 3O2VH 4AENB 4EDXA 2P7TB 3FAXA 1RI8A 5IIEA 4LIQL 4P2OD 4TSCH 4A6YH 5KOVC 1VPOH 2AQ2A 5ALCH 1RZFL 3VFWA 2X89D 4HCRA 1H3PL 3FB8B 5GGRB 4Y16C 4U1HB 3UMTA 2A1WL 2FL5A 5C08A 3BKCL 3PWJA 4Y0GA 4YHOL 3GSQB 5IIEB 3VE0B 4L8CB 1JWSA 1W2KT 4WUUE 5DD3H 4PB0L 4GXVH 1G7PA 1U58B 5FCUH 4JQVA 4OI9A 2OM5A 2PO6D 3PWLB 3BPNB 4RX4D 7FABH 5JXAH 1MIML 2Y7QA 3A6BH 4L8DA 1MIEL 5J3HC 3DURA 3AB0B 5CEYA 5BOZG 1KJMA 3TJEL 1BZ7B 2R0KL 3W11D 5I1IL 3SOBH 1T6WA 5T1KD 1QSFA 1XF3B 3ZHLA 1CGYA 4U1MB 4XBPA 5FFLA 3TV3L 2VLLA 4YXKL 1YY9C 3OF6D 4RMVA 3VXOA 3QQ3B 4F2MA 3OGCA 2JJUA 3S36L 4CGTA 3MCG1 1ZVHA 1T04B 4EI5A 3X12A 4BM7A 1JPTL 1QHPA 3NCEB 1P1ZA 2XKUA 1GGTA 1WWWX 1N3NB 1UJ3C 4OM1H 2GY7B 1BBJB 2W9DL 4YHPB 2DBLL 4M6OH 3HMXH 2UUDH 3KPLB 2XWBB 2OK0H 4D3CH 2EDHA 2WINB 3GDBA 3JV4B 4AEHL 1FZOA 1G0DA 1TZIA 5FHBH 4AMKL 2ENYA 3CU1A 4DQOH 3BQUA 4UT7H 3T65B 4G9DB 3S3SA 1H9VA 4HAGA 4RWHA 5IF0B 1NBVH 2WWMD 5DEZA 3NIGE 4PGBA 4XC1H 4U6VL 1F58H 4Q9CA 1MRFH 2YD6A 4POYA 3GRWA 4S0TD 3F7VA 3T2NL 1JNJA 4UOJA 2EH7L 3MR9A 2CRYA 5F1IB 4B41A 4K7PX 3G5VB 3UPRB 2X4RA 3RWHB 5EU7E 3GB7A 1WAAE 4PFEA 1DLFH 5EUOA 1TJGH 4HZAA 4CUCA 4HMCA 2H6PA 1OL0A 1TVBA 3MLZL 4YHNA 3HC3L 3HZKA 4U4BA 1AHWA 2VAAB 4YHIA 1XGPA 4QOKE 2J88L 3KXFE 5DVMA 4PV9A 4JDTL 5CSGA 3K4DA 3VD9A 4FNLH 4KJPC 4U1LB 2R29H 4BZ1L 5D7LB 5BOPA 1KB5L 1DN2A 4ZUUA 1MRFL 4C55A 1L7IH 1QFOA 1LO3H 2P49B 4QHMA 1T1XB 2HH0L 3SGKA 3DSFL 5J11C 2W0FB 3QEUB 1KTRL 5DT1L 4MQXC 4OZHB 3MTRA 1NANI 1XGQA 1U36A 2V2XB 4EQ2A 4H8WL 5CD5C 4HS8H 1RURL 1AR1D 2CIIA 4W68A 3P4NB 3FQRA 2F8XC 3N85H 3ZTJH 4HUXB 1RIHH 3STLA 3T04D 5HHME 3BPCA 4OZFA 5DJ6B 1RZJH 4Y4FB 3NZHL 3CDGB 1MHEA 3G6AB 1T5WB 4PD4K 3TBWB 2ESVD 4HD9A 4IRJC 2DMBA 1KC5L 2OR8A 4LFHG 3FRPG 4NSKA 3X3GL 3ULUC 1GAFL 4JQIL 5GS1B 3AFLA 4RDQG 5TDPB 4NKIH 2J3SA 2O5YL 3UBXG 3NMEA 2M8XA 4UQ3B 1OCWH 2VDRH 1A1NA 1DEEA 1AKJA 3IXAB 3LEYL 5EWIH 1VACB 1BLNB 5J1AB 1CXFA 5FIEA 1NMAL 2DYPA 3E8UH 3BDBA 2HJKB 3RVTD 2YSSA 5FGSA 4BQ8A 4ZFOB 3RU8H 2CR3A 4U3HA 1ZOXA 5K9OA 3PQYA 2YPLE 4IRSB 1NMCC 1TJHL 4RCAA 4UIKL 1A6TB 1AC6A 1P53A 4IOFD 4LDEB 4KRMB 3P30H 3NPZB 4TTDC 2XZQH 2BC4B 3EHBD 4B0MM 1EJOL 3HG1E 2QSCH 4FTVD 4QO1A 2VLKB 1NDMB 5H35B 2X40A 3MOAH 1N2RB 2A6JB 4RGOL 5F89B 4FQCL 1MOEA 4G6AD 2KZ1B 3GSNA 3BIKB 5HGDA 1IVLA 1DDHA 1X7QA 1HKFA 4OZIF 2BSSA 4K94H 3ULVL 3MMEB 5DHYA 2H2PC 1QFPA 2FR4B 1KPUA 2X9XA 2SEBA 5IBTL 4N1CA 5KN5B 1DQDH 2MTPA 3WNNA 3QPXL 5I1AA 1FNLA 2F19H 4LRNL 2EC9U 3EO0A 5A3ID 5I17A 3MBXL 1JWUA 4OLZL 3IFNL 4RGNE 3LMJL 3Q5YA 5HHVH 2HN7B 5C6TH 3AMKA 5DJ8B 3X12B 5I1EH 5HI4D 4XBGB 5EU6E 5FHBL 2AK1L 1M1SA 4P23C 4GW1A 4L3EA 1FSKC 5EOQL 3OXSB 2ORBL 2BDNL 1HH6A 3VFNA 3LKQB 5EO1B 1YDPA 1BM3H 4ELMA 1J1OL 3FT3A 5FDYA 1LEKA 3G5ZA 4WI2A 1MF2L 1G7HA 1MJ7H 4FQ2L 4WENB 4Z95H 1YY9D 4YBLB 4U1IA 5KVEL 3PDDA 5F8RC 2OI9B 5T1KA 2XKNA 5JLZB 4CU8A 1XF2A 3WFEL 4LSQL 3MRKA 5AUMB 5MI0B 3LMJH 3QHFH 4JFOB 4HDIA 3W82A 1TVDA 3DX9B 5JPNA 4CBPA 2J88H 1FPTL 1C5BH 2AJXL 4RFEB 2BNQD 1BECA 4JN2B 3LKSB 3F58L 4HKBB 2WWKT 3OHXB 2VL5B 4K7FB 2FL5B 5C08B 4U1HA 3UYRL 2AK4D 1DBML 3I3EA 4FFZL 1E4WH 1DL7L 2CLVB 4KH2A 3GJFH 3FO0H 5FHAL 5FOBA 4OBSA 3OKEB 1RZ8A 5HGHA 5D2LE 1QFUH 4Q58C 1PAMA 1PSKL 1AGFA 3O6LH 4WIQA 4RX4A 4PJIA 5K9QI 3RA7H 5F7KC 3PHOA 3SE9L 1UB6B 3TPUA 1C16B 3QDMA 4N8VA 4JFDA 4UU9B 1WZ1L 1S7SA 5E56A 4F33A 4JQVC 3QEQE 4DK6A 4P2OB 1T1ZB 3M8OH 2EXYD 1FPTH 5BS0B 4P5MA 2XZAH 1ZS8A 4PGEA 5CEZH 4M6NL 4OQTH 3I6KA 4PV8B 3BO8A 3ZDZF 3MLYL 4I77H 1B4JL 2ZUWA 5M7QA 1A7OL 5FKPA 1ZVYA 2DMCA 2JJTA 3LQZA 5DVLA 3W0WB 1F3JB 1MEXL 3T1FB 3WNMA 1YQVH 3CVIL 1IBGL 3WXVH 5C2BH 1W8NA 3QXAB 1NH6A 4YR6A 1LO5A 4H25B 1PX3A 2BNQA 3RKPA 4D9RD 3CVHL 1HDMA 3ZKQD 1EHXA 5GQBA 4PJFF 2X7LB 3IFLL 3QUKB 4LEOA 2E7BA 5F7YC 2Q8BH 4W4NA 1T0NB 4JPKL 4ZS7L 5HDBE 3VU2A 2E7LA 3ORJA 4IS6A 1V3LA 2CUIA 3RL1B 3SO3B 4AQOA 1OAYH 1ZANH 2FATL 5GGSB 3PJSA 5C0AD 4O51A 4Y1AA 1I7RA 5I75B 1N0XL 4ZFZB 1FGVH 3QBTB 4ODHL 1XFPA 2APFA 5IVXB 2W9EH 3KPRB 1HI6A 3TYFB 2ZOLB 4NM8L 2Y5TA 4XNYH 1F6LL 4QXTB 1JHLL 3GMMA 4TRPH 5EIVA 1WZLA 2QQLH 4KFZC 5SWSA 5JW5B 4PY7B 4A6YA 4PG9B 3BP7B 1EVUA 5FKAA 3D5OF 3GI9H 2ED7A 1IMHC 5LGJB 4OJFH 4HCRH 1ACYL 3MODL 3EYQC 5CSZB 2ADGB 4FQLL 2V5TA 1A0QL 3O41B 5C0AB 1A9BB 3VG0L 4LLYB 4I8DA 3NVQA 2VH5H 5AAMA 4KQ3H 3EDJA 4GKSA 1Q9KA 2NY5H 3VWKB 3L9RB 5HYEA 4BK4A 4TUJA 3BMVA 5D1QD 1BD2A 2ICEA 4J8RB 1JN6A 4D0DA 1CS6A 1JNHA 1ERNA 1G7QB 1JNNH 1F97A 4Z0BL 5GISL 4LPVA 5IVXF 4X5XB 4BA8A 1OT1A 3KS0H 4ETYA 3ULUH 4JQXA 2BY2A 4E5XA 3MRCB 4LSVH 4IDLA 4WTWA 1HWHB 3H9SD 2Z35A 3ZKND 5IGXH 4JEGB 1XR9B 3N1PC 1B88A 3KR3H 5J3HD 5GS1C 3IDJA 1ZEAH 3HB3D 4OAWA 4X8XA 3SGKC 4FTVA 1E27A 3CPLA 1AI1L 3WE6B 3M17A 4LVNC 2XNAB 3NACL 4G3YH 4YBLC 2F5BH 2XN9A 2OJZL 5D1QB 1EHLL 3OZ9H 4HWBA 3F62A 4JCMA 8FABB 4WGVB 1VFAA 5C0BB 2EDWA 4MB4A 5FCSH 3FQTA 1TXKA 5IVZB 3UBXI 4NQDE 4NCC1 2X10A 4PUBL 2BVOA 5SWQA 2QBWA 1GXEA 3H9SB 3VW3H 1SJHB 3F65A 3VFSA 3T4YB 2Z91A 4DAGL 1B4RA 5GPRA 1GGCH 2ADIB 4G5ZH 4CJ0A 4LLVA 5L88L 1W0VA 5ACLA 1WBZB 2BNQE 3QEQB 5T3ZL 3O4OC 3S4SB 4X6CB 3HRPA 1OAZL 5KVGH 1EMTL 1FJ1B 5C0JB 5IBUG 2VO5A 3V4PH 1OM3H 4LPCA 3SOBL 1U8OA 1F3DJ 4ORGB 4EXKA 4L4TE 4PP2A 3AMLA 3KWWB 3EOTL 4QXWA 5JO5A 4X6DA 3RAJL 4TULH 4BQCA 2ESVB 5BVJB 1ZWIB 3EO1A 4HIIA 5D9SA 3VRJA 4F9PA 3MLWL 4PJXA 3OKKB 2FJHB 1PBYA 4D9QE 3VXMD 3RTQC 4MMXC 3Q3GB 4ODVL 2MNUA 4J3OC 3QNZA 5I30L 3HNVH 4BZYA 5GRVL 4CAGA 3RIFK 4OIAA 1B0RB 3KAAA 4JKWA 1FVEB 4OCWH 1IL1A 1ZTXL 4WU7B 3PABB 2NCMA 3LRSB 3UO1H 1QEWB 2YXMA 3P4OB 4XC1L 3N1QC 3D85D 2HKFH 5HJ3A 4JM4L 4RISL 3LRGA 4MNGE 4K8RH 3W81A 2VXQL 2DIAA 1OAUH 2GJZB 2IQ9L 3S98A 1OAYL 1H3UA 4MD4A 1S5IL 5DQJB 1UYWH 5HHMB 1DBAL 5IMLB 4O2EB 3TCXA 3UYRH 3TBTB 3Q2CA 2FJFB 5C0AE 2DQFB 3ESVF 3GBNH 3ZTJG 4YK4B 5JOPD 3VH8A 3HZMB 4OCWL 5K59E 2HTKD 5JPMA 1A4JA 4ODXB 4S2SB 3QNXA 1DBJH 2AJ3A 2C3VA 4I3GA 3TO4C 4NPYA 3TNNA 1FYTA 2LAAA 1K6QH 5KSUA 5EOCL 1C5CH 4YHZH 1OP3K 2E9WA 3MLVH 4HWNA 5ISZD 2OZ4L 1MLCA 2WBJD 2DQEL 3WS6C 3E2HC 2VIRB 4YQXH 3MV9A 5GGVY 2VQ1B 3JV6A 1S9KC 4XPAL 4PJBB 3VXRA 5IT2L 1LD9B 1J9CT 3ELAT 3AY4C 3QUMB 3UYOD 5C0RL 4PJ8D 3CFCH 5ECJE 3BP6B 1R24A 4M43H 4PJ7B 4G43A 3RVWD 5IHBA 3HS0A 25C8H 1S7QA 3IKCA 3DX7A 3T0EB 1P2CA 4X98A 5TDOB 2P8MB 4R4NC 5F6HI 3RIAF 3ARBC 3C8KA 5HI5C 4R3SA 3BW9A 2XA3A 2J2ZA 4RA0C 1I7ZB 5IJKA 4JAMB 1SMOA 1UXSA 3H9SE 1E28A 1MCWW 5IFHL 3T1WA 3VXTA 1RHHB 3LZFL 5LBSL 1U92B 4GMSL 1ETZB 1YEFL 3MJGX 3WFHB 2PTTA 3FCTA 1G9NC 1LO0H 1DQTA 4JFFB 3PL6D 2DTMH 3GSNL 3GMRA 1VEOA 3BFOA 4HS8L 3VXUA 1MJJA 4NYLA 2YEZB 1ADQA 5CZKA 2D7NA 3L6FA 5AZ2H 1IEHA 1BJ1H 5DD6B 1VGEH 1ZK9A 1IKFH 2EC8A 2F5AL 4JM2A 3TT3H 2GI7A 4MSWA 2DQGH 4PY8J 2ZSVB 4IRJD 3RGVB 1G0XA 1JNLL 1A9EA 3MO1A 4QY8A 3SDAB 2H1PH 3HCVB 4MA1B 4DVRH 1JYVA 4UDTA 5IFHH 2ICCA 3RWDA 3UBXB 1I8MB 1U3HA 1E4XH 1X4XA 1J86A 3O4LB 4KTEH 3QR2A 5JR1L 1CFVL 4JKMA 4Y2OA 5L9DH 4C83B 3V4UH 4PYHA 1UACH 1OSPL 4XPTL 1MCDA 1YNLL 2EE3A 3Q6GL 4EJ1C 1TJIH 4EXPX 4GG6B 2P44B 4L4TD 4J3XA 4BQBA 3CDFA 5D2LA 2F53B 3NFSH 1FNAA 3QIUC 1R3KB 4TSAL 2VXVL 1N8ZB 1OLZA 4U1GB 5DUBA 1E4KA 4RRPG 1EV2E 4QRQA 4CNIB 4JO2H 4JHWL 4GXUM 3GGWA 4KJPD 3RVXC 2D7QA 2EDQA 2PW2A 1XEDA 3O9WA 4R26H 1JGEB 3HR5A 1FL3B 4O5LL 2FH8A 5DURB 4Z0XB 1FL6A 3I85A 5GRZA 1UM6H 1G7MB 3L1OL 4Z7OF 5IEKA 3EYVB 1FNHA 3WUWG 1KB9K 3FO9B 5JNYA 4MAYB 3JTSA 4YDVA 4LVOC 3NFPA 3U46B 5BRZA 5KSBB 1HNFA 2AJZA 5FA4A 3GSXA 1MCBA 1OGTB 2JK5B 2DWEA 1D5IL 2CR6A 4NCDA 4G5ZL 1OP5K 4N0UE 1MELA 4JO4L 3D0VB 5DURD 1OW0A 2QR0A 3F6IA 2EDXA 2XXMB 3VDCA 2VR5A 4LARL 2PKDA 1YEKH 3D0LB 4HX1B 1TETL 1FZMA 3IFPA 5HI3C 2UZYB 2R23A 5HYQB 4DVBB 5BZWB 5CGTA 1UZ8B 4XXDA 4KGJA 1T2XA 4ZUTB 1I8KB 2Y06H 3H7BB 4MAYC 2FO4B 3ARFA 5CILH 3PHQA 4YGVA 4YUEH 2N7AA 1ZE3C 3DUSB 4P3DA 5FCUL 3X14B 5DI8B 3LN5A 1I9JH 4RGNC 5D2LB 2A6KA 1CFTA 2CXGA 1MI5A 5CEXA 3RWCA 4OCSH 43C9A 4JFXB 4R0LB 5HDQH 2R1YA 4Z6AT 3FRUB 5HGAA 5GGUA 3O3AB 1S7RA 4XMPL 4NC2B 1VPOL 5ALCL 3CFIC 1CR9H 4YIQB 5J9PB 2Z92B 3D3VB 4KK5D 3RWDB 4MWFA 3S9DB 3VWKC 1KCVH 4LLMA 1KENH 1OAKH 2ZOKB 5CCKL 3S35L 2ZG2A 1XCTA 3V6ZB 4JM2C 2XWTB 4JGUA 4AJ0A 3CNKA 4PJ5E 4MYWB 3IDYB 3M1BA 3DX8A 4PJHA 3MBED 2UVEA 3T0WA 1CXLA 5MEPA 4DW2H 4FXLA 4HZLA 4NN7C 4G8FA 4DKAA 5JOFA 5DA0B 1E0OB 1LP9B 4M6NH 3D87B 2APBA 1JGUL 1IQDA 1CF8L 1RZJL 3HUJE 1L9NA 3QFJE 5F1NB 3QJFA 1MVUB 1HSBB 4GAJH 5FGBA 5KS9E 4M1CC 4FQ1H 1PW3A 1FNEB 4NKDB 3DETD 5F6IC 1NGZB 1KC5H 5FF6B 4PR5B 1KYOJ 1X6LA 5F7DB 1MLBB 5HDOA 1PQZB 1BVLA 2O5YH 5FO9A 2CGRL 4HF5L 4HKJA 2Q3AA 5DYOB 3ZSSA 3QUZC 3B6SB 5DEFB 2B2XL 2GCYB 3I02A 3ULVD 1QRNB 4J3VA 4O2CA 4ONHB 4DFIA 3LRHA 2NY2C 2NY0D 5ACZA 4HKXA 5CJQH 3W39B 2NTFA 4I48B 5C0BE 2CDGB 2AXHA 3P11H 3H3PH 1CDYA 5CGMA 1T22A 4JPIA 1F90L 2XQBL 3SKNA 3GSVA 3ULSB 3HPLB 2IBGA 2NY5L 2NY1B 4FQXB 3VXUE 3FHAA 5EUOF 2I9LB 1R3HA 4IHOB 3WHXA 4YDLB 4Q9RL 1XGUB 5EDXA 5KSUB 1B0GB 5D1XA 1U6AL 4PRPE 4WW2A 1K85A 1CQKA 5EU4B 3TYGL 2EYSA 4X8JB 3B43A 1JUFB 4YEEA 3DMMD 3QI9A 1QUNA 4PRHB 5D6CA 4TOYL 4UNUA 4PJEA 4P5KB 1FYTD 1MAKA 5GS2D 2ZUQC 3WJJA 1FFPB 4UV4H 3L3HB 3KYKL 4R97C 4UTAH 1RIHL 3MJ9A 5A2IH 3F6LA 3B6SA 3T0AA 3PXHA 2WAHA 4Q0XH 4F3FB 4LCYA 1LK2B 1OTTD 1HN1A 3CSGA 3IRZA 3FT4A 3SHSA 3BXNB 1J1PH 3AU1A 4KI5C 2E8YA 3SKMB 4WHTA 2JCCE 4PR5A 3BGFB 5DSCB 2ADFL 1CL7L 4W70A 1KULA 2PETA 3MRNA 1WWCA 3KLHC 4MD5B 3DRQA 4K71B 5BXFA 4IIQA 1F02I 1QBML 3TESA 4XNQB 1ZHLA 3T0ED 5JOFB 3TH4T 3BYTA 4EUPA 3BD4A 2OQJA 5IB1B 1RUPH 4YHYC 3DO7B 1ZHKB 4MXQC 5E94A 4ZUWA 1FFNB 3OKKA 2DLFL 3QUYA 4I3RH 4JRXA 3P73A 3TVMA 2R2HB 3BD5A 3QHZL 4EUPG 1G9MC 1A7RL 3ZHDA 1H3VA 3B8SA 4YC2C 1H8NA 4GQ9L 1MWAL 1BQUA 4TSCL 3SJVE 5HYJA 4JFFD 3PL6B 5EPMB 3TVMD 2A73B 2R2HA 4J3WA 5J9PA 1BWWA 4NO0B 2AI0L 4JRXB 4CKVX 3TBYA 4XCNA 1FYHB 3WDHA 3TVMC 5HGAB 3O45A 4M03A 5IV2A 1CZ8L 1DUYB 4RMUA 2EEDA 3MLWH 1BPVA 1IAIH 2NX5D 2BJML 2F8OA 3AS1A 3QFJB 3HUJB 2ITDB 3RGVD 5TDNA 3HAEH 2C3HA 3VFRA 4R7NA 5B38G 3QG7L 2VDNL 4P57A 3SDDD 1G9EA 1JPGA 3TVMB 2FO4A 2JB6A 1OGAD 1IZKA 3SKMA 4N0YL 4YHLH 1OAQH 2AV1A 4ISVB 4U7SA 2DJSA 4KUZH 4Y2DC 5DD0L 4PJ7E 3P3YA 4NZJA 4GJTB 1XIWD 1UJ3A 2VE6B 2X4OA 1ZHLB 3CC5B 3CFKA 1UWXH 3QFJD 4B5EA 1HEZB 4X7TA 5DK2A 3K3QA 3MNWA 4CU6A 4X7CC 4NHCL 1Q94B 3MFFB 3S37X 5CGYD 4PJEB 3G9AB 1KTDB 4M48H 5GRJH 1RSFA 4XCCH 2VDNH 5CGYC 5HHOB 4Y5YC 1CDJA 1A7PH 1KJ2H 3MGAA 1NMBL 4WWKB 4Z77B 1H3XA 2AJYL 4I1NB 4PRAA 5CZXC 1MCIA 3NFPB 3MXWH 4YDVB 1ZANL 2WWKO 4DUVA 1VGKB 3KPNA 2VDPL 1GL4B 2F74B 4DFHA 3RVUD 1A7QL 3D69B 4K9EC 3O41A 3SGDH 2NYYC 1K5NA 1TQBB 3P2TA 4L8SA 5IMMB 2H3NA 4YHZL 5IFJB 3UX9B 3UAJD 5D6DC 4DN4H 2AAVA 1GGBH 2W60B 3CU7A 2XPGA 1I1AA 1JUFA 3SQOH 3UTZB 5CFHA 2W0KA 4X8JA 4GLRH 3CK0L 4ZO8A 4YZFE 1BQLH 5AWNL 2Z93B 3TO4B 1P7QA 1L6ZA 3FQXA 1ZHNA 2J4WL 1RMFL 1NCBL 2IANA 1HIML 5DD5H 3EZJB 2DQUH 3DOSA 2NY2D 4F7CB 1HQ4A 5BV7H 4HFWA 5CEZL 2DJUA 3ZTNH 4ZD3H 4R2GB 3GMOB 1HSBA 2LU3A 5LWYL 1SYVB 3H9HA 3BP4B 4OLEA 5JHLL 1G84A 2CK0H 1CLYH 4JR9L 3GMLB 1XF4B 4JKPL 1VGEL 2F5AH 1GGBL 1Q38A 2XQYK 5MEPB 3MV7B 1J8HD 3MLPA 2IG2H 2KBGA 4MQXD 2NR6D 1Y0LB 1D5BB 4OGZA 4HIEA 2DLIA 4QXUL 4WU5B 3BWUC 3UTSB 3DXAD 5HHXH 5IB3B 3UTSA 2G75A 1ORQA 3UZEA 2AGJH 4GW5B 3AM8C 2EH8L 2LQRA 4M6AA 3V6ZA 4ALAH 3RZCD 1Y0LA 5FKPB 3IRPX 1Z9LA 3QWOA 4Z78A 1U8IB 1YC7A 4TQEL 4QRRD 5BV7L 2DQGL 3LN9A 5IP4A 5BS0A 4S1DC 1A7RH 4ZSOE 3FCTB 3ZYOA 1Q72L 4Z7VA 1GGCL 1P6AB 2ZUVA 1E4JA 1CK0H 4M7ZC 1MSPA 6FABL 1CDHA 3AAZB 4Q6IA 3RP1A 1LP9F 2P4AB 3GUTA 3BW9B 3HLAA 4R9HA 3V6FB 2IANB 1XH3B 3P4MA 5E1HB 4PJFE 2F53E 1R0AH 3ARGA 3IXTA 2IF7A 2NNAA 3K81A 4M8QA 1OM3L 3FFCE 3T8XB 1ACYH 3MODH 2ZNWA 5A2LH 5ALBL 4Q97A 3GMOA 2W60A 3LKSA 4HSQA 4S11A 3B9AA 3JV6B 3MRGA 1IGTB 3AREC 2MQ0A 2D0FA 4ELKA 5HVFB 2NXYC 3DX9A 2OTWB 3ZKMC 3MACH 2PN5A 5B21A 1XCQB 3H42H 2CUHA 3QG6B 2A6KB 5DLML 3GJEB 4LVEA 2F74A 1J05A 3ARFD 1JTPA 2IPKB 4QHLB 3MRPB 4NPYB 3TNNB 5DC4B 1JK8B 1KPVA 4WWID 1YECH 1P7QB 3GSRB 1C12B 4UBDD 3THML 4OZGF 2YWZA 4HPYL 4I0CC 3EYUL 4PJAE 3Q5OA 5DR5L 3G5XA 5FA4B 1F4WL 4O02H 2UWEE 3MNVA 4CJ1A 4GG6E 3IFPB 4K94L 5DQJA 2W65B 4HFUL 4KKLD 4MJID 2HFFA 5DK2B 1NC2D 3MUY1 3WJLA 3O3EB 3PP4H 3T0BA 2YMXH 3V79C 1NC4D 5MERB 4AQ1B 4KJWD 4NC1C 4NCC2 2ATKB 5GRVK 1S5IH 1C12A 5DRXB 4LMQE 1G9NL 3QCVH 3B2VL 1KG0B 2YKLH 4PRHD 1PD6A 2NY7L 4OZHF 1JPGB 1JTOA 2NXZB 3IAGC 2SEBB 2K7QA 3U36A 4H26B 2EICA 4MS8D 3ARBA 2VQTA 1LNUA 4X6EB 3UTTD 5SX4H 3QDGA 3BOVA 1RJLA 4OKDA 4XTRD 5CD3B 2F5BL 3MZTA 1D7FA 3SDCD 3SDXF 2FD6L 4L9LC 5MEQA 4DGYH 4NWTH 4FQPA 4P2QD 4V1DE 4S10A 3TBYB 5GS0L 1ZSDA 3O8XC 1UH4A 1ZHBA 2YHGA 3VFGH 1X5LA 2GTZA 4OUOA 5I8EA 3N1GC 1G9NH 2ICWJ 3NABH 4QHNA 3QIWD 1OB1A 3GIVB 1AXTH 1CTOA 4NKMB 3OG4B 4Q6IB 5ETUA 3KGRA 3UJTH 1FBIL 1INQA 4RDQF 4N5ED 4OFIA 3BISA 5KSAA 4Q2ZB 2NLJB 3NIGF 3HG1A 1P6FA 2ERJC 1DUYA 1GHFL 5FK9B 4XP5H 1NDGB 4NFDA 4JFEE 3CCHA 2EIZB 1W0WB 4NNYB 2VISB 3O6LL 1LGVA 4XP1L 2E9JA 2HLAA 4I13B 5CWSA 2ZSVA 4GQPH 4NGHL 2G9HA 5JXED 5I2IB 4Q9QL 4TVPH 5D7IF 4PJCB 4Q6IC 4P5TD 3SY0A 4MNQA 4LEXH 3ILQD 4C59B 5GSRB 2WWMC 4F3FA 4YDIH 3BGMB 4JFHD 4U05A 2YA1A 4NO2A 1YEIH 1Z3GH 4H0HB 2GYSA 2A6DA 2YK1H 4X5LA 1UM5H 2MKLC 1AGEB 1B3JA 4Y4KB 2QLVB 5EZOH 5J6HB 1MEXH 4LPXA 2XZZA 3QDGB 5C09A 3WFBL 1TTFA 5E9DE 1DE4A 3BPOB 5D7LA 2OL3B 1BX2A 2QKIA 3HE7A 4WHTB 1A4KB 5E8OB 5EU4A 1PKQE 1X9QA 2GJJA 5AZEH 4N0FB 5E95B 2EE9A 3RY6A 4ZFOL 2V2TB 3Q6GH 5EU7C 1YN6B 4RBPH 5SX4I 2IPTH 5M94B 3WS3A 3LS5H 3AC0A 3C60C 3P11L 2W9DH 1KCRH 4PJAB 4KC3B 2BVTA 4Y4KD 3WDIA 4XP4H 3HE7D 1CLZH 4Q74A 5L0QC 4ZAKA 1IZJA 3S8WA 2ARJB 3SBWC 1RU9H 3ZKXB 1W72B 4LSTL 1XAUA 5MI0C 4DKFL 5EB9A 4X6CF 4I9WD 1A5FL 4LLAA 4TN9A 5C07A 5IWLC 2AGJL 1OQOA 3DUUB 1TQCC 4WCYH 4JFZH 3K4AA 4WVRA 4X4ZA 1NCCH 1PQZA 1GZQA 4N68A 4XAWL 1NCWL 1NGQH 3B3IA 3QO1A 4IMKA 4MDJA 4XC3H 5E4IA 1ZKAA 4BFGA 4JANB 5EC2B 4XNYL 2CDGA 3EOBB 3EJYC 4RQQA 4Y4KA 2P43B 4XPHL 4UTAL 1OTUD 5DJYB 1FNGB 4P4RB 3CFKB 1FFOA 1YNTA 1WEJL 2BSRA 4I48A 5DRNA 1KF9B 5F88A 4HCRL 1WIPA 4GOSA 1YN6A 3N50A 5K9JL 4PB9H 1UH2A 2X9YA 4XCEA 2YA2A 3BN3B 3CH1A 5J89A 5ADOH 4DKEL 4ZNCD 1FLRL 2AV1B 2VH5L 4ZXBA 4PJXB 1C5DA 4WI6A 4KPHL 5DUPL 2G9HB 5F96H 1MCNA 3SY0B 4NNYA 4X6DB 3DECA 2VDQH 3GM0A 4XPFL 3S4SG 1UKQA 1MJ8H 4DWHA 2BVPB 5T1DH 1C7TA 3WIIH 5B3JF 3VCLB 3JVGA 3MV7D 4V1DD 1EGJA 3DGGB 1I9JL 4RIRB 2CQVA 4G8FB 1MIMH 3A6BL 1YNKH 1F8TH 2XWTA 4Y8AA 1HYSD 1QR4A 1OB1B 2XTJB 3DX8B 4CVXB 2ZP0T 4KMTH 4XVTL 1CZ8H 5CLTA 2KDGA 5IB3A 5JO5B 4ONGL 1BJ1J 1Q1JH 2Z91B 2BVUA 3PHQB 4YGVB 2YD5A 4ZDHB 5IW6B 1CFVH 1D5MB 2FHBA 4OB5H 1S7RB 4UIMB 3IKKA 5KSAD 4UT9H 2VLJB 2XTLA 4K3JL 4OZ4B 4HC1A 4YIQA 5HTSA 3H3BC 3AREA 4HWBH 5GGUB 3FZUC 1N5YH 1MCOH 5MEQB 2QHLA 4K07A 4Y89A 1JJUA 2VDRL 4DW2L 3D0VA 3ZT7A 5D2NE 4PP1C 2J1KA 3BKMH 4U0QB 5K33A 3UZVB 4JFQA 1ZHBB 1MRCH 4K3EL 4UQ2A 3EFFB 3ZT5A 2VC2L 5F44A 5HI3D 1J88A 2JJSA 1A7QH 4LCUA 3RQ3A 3H9ZA 1UZ8A 4XXDB 5MHSE 2G60H 5DJ2B 5JW3H 3EYVA 3KPSA 2MCPH 5DJ8A 1F6FB 2HVJA 4IOSD 2QR0B 3NIFE 4QHKI 4EIGB 2BNRD 1RJLB 3PIQB 5E9DD 3G5XB 3QEGH 1DQLL 3LDBC 3MRHB 4OF3A 3CX5J 1DBBH 3QI9B 2GJ6E 1R3LA 3ZYZA 3K80A 4JZJC 3P0GB 5E0QA 1DBAH 4ZOEA 1KPVB 1MWAA 1SEBB 3ZE2E 4CNIA 5F9OL 3SGDI 5DRXA 2DI7A 1S9YA 2DJ4A 1QFWL 4TUJB 3MRPA 2R0ZH 3HNSH 3MRHA 4L1DA 1KACB 2A2QT 2DWEB 2NY1C 5F97E 5IMOA 5D2NA 2NZIA 5CJOH 4MD0B 1DDHB 5C0AA 4FP8H 3RNKB 1UCTA 1FL6B 1WVZA 5IBLD 2WNGA 5GRYA 4NQCD 3NPSB 2UYLA 2CLRA 1C5CL 4OCXH 3ARVA 3FMGH 2NY6B 3GIZH 4WRLA 1KENL 1OAKL 4NJ9L 4ELKB 4I9WE 4QWWD 5DDHB 2F54E 5CUSL 2H8PA 1BQLL 2DLTA 2VLJA 4WUKL 4DEPB 4QRQB 4KTYA 4YDJA 4QXUH 3GGWB 1CBVH 2BOBB 2DMKA 4HKJB 3KXFB 3MCLL 1G6VK 4XXCC 1QLRA 5D72L 3RZWA 5DD6A 4EN3A 3NH7L 4Q0XL 4X6DE 1FNEA 4NKDA 3ULUE 4NN7B 4XPGL 5TDPA 3QUKA 3DGGA 4F37K 4HBCH 5SWZB 3BH8B 1J8HA 1AC0A 3SDYL 2AJVH 2P5EB 5TF1H 4XGZB 1OT2A 2WLYA 3MXVH 3O4OB 3PL6A 5EPMA 1PDKA 1Y6NR 4JFDB 2YPLA 1G0YR 3BUYA 2D7TH 1SY6H 4FQIH 2J8UF 3NTCH 4NRXB 3PF2A 4Z8FH 3OKYA 3RGVA 5LXGH 4G6MH 4W6XB 4NYLB 3WV0A 4XH2A 4O2FA 1KCSH 3MLRH 2NMSA 3EFDL 4KDWA 4NJAH 1TNMA 4NQDA 2ZCKH 4XCEB 2Y23A 4GH7B 4HIJB 5D7SL 1JIBA 3BI9X 3K8MA 1T1ZA 4NRYA 3VCLA 5KVMC 5FUZH 1KB5H 1XF4A 3VG9C 1GOHA 4XNQA 1U42A 5E03A 3CFDB 4RGNB 2GK2A 1Y6KR 1UB6A 2ZUYA 1Z5LA 5GJTH 4JAMA 5CEXB 3VXRD 3BWAA 3B9EA 2IALB 4RAHA 5EU6B 5FECA 4OZIE 5KSVB 2NY4B 1DUZB 1OTUC 2X1WL 1ZGLM 2L4OA 4JHAH 2CRMA 1WZMA 4CRPA 4YHIB 5JLZA 2ICWI 4GG8B 5DR5H 4R90H 3V95A 5J13C 2HWZL 2EIBA 1NBYA 5DJ0B 1QFWM 1I1AB 1NFIA 1DSFL 4D2NA 4ZS7H 2DKMA 3VH8B 5IHZA 4PJ7A 5D7IE 2JLLA 4J23A 3I6GB 4OCYH 5C07D 2XPGB 3ZSTA 3GK8H 2QQQA 3CVHH 5TQ2L 3OXSA 2YD7A 2CLRB 4MDJB 1MFCH 4Z76B 1K5NB 1KEMH 2PUQT 4PJAA 1YYLH 5T1KB 5A16A 5TE6H 3B83A 2KH2B 4JREB 2VZTA 3VXME 3PP4L 4QRUA 1JL8A 3AS0A 1I1AD 1CE6B 2DQIL 4IEFB 2QJDA 3HE7B 5IB2A 1YDPB 3WJLC 1G9ML 3MV9D 2V9QA 3E3QE 1JHKL 3EDFA 4WHYH 3TPKA 3VRIA 1Q9LB 2YMXL 5B8CC 4L8SB 1T7ZA 5IMMA 3GHEL 5I9QB 5LCVL 5C0CA 4U3XA 4O5LH 5J57B 3ISWA 3MNWB 1NEZA 4OD1L 4JPWH 4TNWK 5DMIL 3AROA 2GJ6D 5CBAA 3ZDYE 2XG4A 1Z0NA 4FMFA 1KN4L 4N9OB 4ZXBC 5I1AB 2P8PB 5FYJL 4ZNEA 4U33A 5JIKA 3VFPB 3FMGL 4G6AC 2DL9A 3TLRA 3C2AH 1T89C 3PQYB 4GAGL 3KLHD 4R7DB 2E3VA 2UY6A 3EJZC 3HUJA 3QFJA 1OD9A 5GGSY 1IFHH 3G6JE 2IFFL 5IFAH 1HEZA 4ODSL 3S3PA 3IXAA 1NCBH 4BSWA 3ZE2F 1AP2B 4MA1C 1WBZA 1YEKL 3VE0A 4YEFA 6CGTA 3PP3H 1ZWIA 5ENWA 2MSPA 1BAFL 4GKZB 1BOGA 1C1EL 1PVHA 4HS3A 4PJCA 2H2SD 1D5MA 3OZ9L 1MI5E 4K7PH 4ZFOA 1P9MA 5TQ0H 4PLJD 5DQ9A 4N1HB 5I8EB 4JM2B 3QIWA 4GKZA 4LLMB 5C0JA 3C2AL 4GAGH 8FABA 5JW3L 3S88H 4GG6F 2OSLB 4ENED 4M93B 3BVNB 1KBGL 4IRSC 4RMWA 3I75B 5JQ6H 4KK9D 4FTVB 4R0LA 3R06B 3P77B 2WUCL 3GSOB 2FNBA 4NKMA 4M48L 2PR4H 2O93L 3Q0HA 1CU4H 5L7XL 4TNWF 4P2QA 1XR9A 5EU5B 3UXFA 5HVHB 1HQRB 12E8H 1OF2B 5D7SH 4LCIL 3ARBB 5LG1A 2R1XB 5ICYA 2FGWH 1KCUL 1UWXK 1VA9A 3FL7A 2VDPH 2V5MA 4Y4FD 1EEQA 1C5DB 4P3WA 5DFTA 5DTFB 5KJRH 3N06B 2OI9C 1YMMD 3D18A 4WTXA 3F7YB 1Q0YH 1NEZB 4GO6B 5DD3L 3KDMB 1KBGH 4NJ9H 3MRBB 2EDBA 4BH7A 1LD9A 4IIQB 1REIA 2W65A 3QULA 3T3ME 5TJWK 3W2DH 5F9DC 2DB8A 3ARBD 3QUZD 1H15A 1NC2A 1YEHH 4DOHE 3J8F7 3MRCA 4NM4L 2IQ9H 4OT1L 1IEBB 2XN9D 1P4IH 1U3YA 4LKCB 4JRWA 2R56L 1CWVA 2VERN 1U93A 2AJZB 4KRNA 3PXJA 3ECBA 3NA4A 3WYRA 2WW8A 3MZGB 1S7VA 1N4XH 3U79A 3FO9A 5C07E 2BNRB 1AJ7L 4JFYB 2FX9L 1ZLVK 2AJVL 5TF1L 1UVQB 4LOUD 2FEDD 3QI9D 4CMMA 3DMMA 1BEYL 3MR9B 2R2EB 4OIIL 5B8CA 5I18H 1N3NA 4OGAD 1QSEE 1A3RL 4ZAKB 4JB9H 1D6VH 4WWKC 5SWSB 5D6CB 2DLGA 1KELH 1G9MH 2HA1A 4LOUC 1ITCA 3HC4L 5FKAB 5DEFA 4PIRF 2AW2A 3RZCC 4HXAH 2BNQB 5FA3A 4ALAL 1F90H 1JI2A 2XQBH 5FGBC 3KYAA 1RIUL 3P4LA 4GKNA 1T5XA 2IADB 3RWFA 4QHLA 3VMPA 1J18A 2VSCA 5GGSA 4Y8DC 3B9VA 4XXCA 2FEDC 3HKFA 4KTDH 3VH8G 4POUB 1A4KA 5E8OA 5AD0B 4AEIL 3OR7A 5FF6A 4U1MA 1F11B 4U6VH 1DQQB 2O5XL 1CI5A 1NGXB 3FB5A 1BVZA 5DEGA 1T03L 1J1PL 3QXWA 5MEOA 1WEJH 4NN5C 1B0WA 1ZLWH 3G6JB 3PP3K 4PJGE 1WITA 4LHUG 4LEOB 4X9FA 4JPVH 2X2YA 4Z7WE 2P8LB 4UOW1 3VJ6B 5I18L 1K4CB 2R69H 2EXWC 2X4TA 4HT1L 4XMLL 3PE9A 4YR6B 3K7UA 5K93A 4XBPB 4WI4A 1V05A 3LQZB 3EO1B 4LNRB 5T33H 4XPFH 2PXYC 1CFQB 2YUZA 1X44A 2D4DA 1KIUA 3I9GL 3HFML 3QQ4B 5F7FA 2X1XR 4L4JA 4K2UH 5F6HJ 1K3ZA 3LZFH 3RKDD 1IQDB 1RFDH 1YUHB 1XGTB 4KJQD 2H45A 4ZSOA 3K2UL 2VLJE 5ILTL 4NUJB 3NCMA 1U92A 1T0MB 1LE5A 4PJDE 4YHOH 1HHKA 3IGAB 2A83B 1OPGL 3LH2H 3QJHB 5FOJA 1OTSC 3X14A 5GS3A 4WU5A 3S96B 4Z9KB 3GIVA 5I1GH 4U1IB 4R3SB 2BVOB 5SWQB 4M5ZH 4L5FH 3V5DB 2J6EL 3DX7B 1RUML 1RJCA 3NN8A 3QG7H 4PRBB 5BZWA 3RWGA 1L6XA 4G8GA 5C6TL 3PGDA 3GRWL 5JPNB 3CX2A 4GBXB 5DJXA 1T80A 4JZJB 4AEFA 5IQ7L 2MQCA 4MQTB 2H32B 3D69A 3LDBB 35C8H 3QWRD 5BW7A 2GEEA 4PJ5D 1LEIB 3JUYA 1PY4A 1JGDB 2ITCB 3CSYA 5KOMC 4YNYB 3ZT6A 1NLDH 2FCBA 1JV5A 4IOIA 5KN5A 5EO1A 3F5WB 4PJ8A 5TE4H 1SJXA 2VDLL 4G6JH 4HFUH 4FA8A 3TIDB 2BXYA 4HH9B 3ET9F 1H8OA 1I1YB 3PGFL 1YEHL 3TH3T 5KSBA 1IQWL 2HFEB 1QR1A 1XF5A 2O61A 3PDGA 4UT7L 2ADGA 4ONFH 4ZTPL 1FZMB 5F9JA 4P3CL 3D0LA 2YZ8A 4HX1A 5JDSB 5EO0A 3CC5A 4XB7A 2HFFB 3VFGL 1UJ3B 2VE6A 2X4OB 2HRLA 5C0GB 4KK8C 4HH8A 5FYKH 2DTSA 1QSVA 2R4RH 4M7LH 1T1YB 4F7EA 25C8L 4FQHB 3W11C 1KJ3L 2R0ZL 4O58L 2X6MA 4MQ7B 3OBAA 2EDLA 5IW3A 4WO4B 1HOCA 3SDXE 4DN3L 5HHPB 4LASH 1K8IA 4TUKH 4WU7A 5CUSH 4M7LT 2Q7NA 1FG2B 5HHNA 5BRZB 4EDWL 4TVPD 1D6VL 1X3DA 1JF1A 1U3HC 1ZT7B 5E2UH 2Q8AH 4E42A 3WNLA 1OWRM 3VMOA 1CFSA 4IRJA 3GJEA 4D0BA 3OJ2C 2GJ6B 5E8PB 5I76A 1KEGH 1SQ2N 2PR4L 2YUWA 4S1QL 3BHBB 1XIWA 4X4YB 3P9MA 1NFKA 1YYMH 5H94A 4LF3A 3VWKD 3MRQB 1NAML 3S5LB 4QY8B 3SDAA 3IFOA 3BPNC 3H8NA 4HIIB 1LO5B 4H25A 4PPTA 5EORH 1KXVC 4OCSL 3SE8L 2OP4H 2NNAB 4BSVB 3KYOA 1OY3B 1R3KA 1A9EB 3IDXL 1EUUA 1B6UA 3I84A 4EOWH 2R69L 4L4VB 1FVCA 4OZFG 4LDLB 4J1UA 2X42A 4LVHC 4W4OC 4ZS6C 1LEGA 2J4WH 2V6HA 4XP5L 4I4WA 1A1NB 2XG5A 3WFBH 4HIXH 3L5WA 4FFWC 3L3GA 4G8GE 1D5ZB 2PTTB 4UB0H 1I85A 2OYPA 2OL3H 4Y4FA 2D7TL 1UACL 1KNOB 3DBXB 4MA7H 2VZVA 3QWOB 1M05B 3T4YA 2P46B 1UWGL 3WFHA 4R97B 4KZEL 2OX5A 4XWGL 5DSCA 3CDYA 4FRWA 4XMKH 5IQ9B 4ZXBB 1UXSB 5IB1A 3LQAH 4OV6F 2D03H 3T0EE 1CGWA 4XVJH 1QG3A 3HZKB 4PLNC 5DHVH 4F57H 2X70B 2XKSA 3C2SA 1CVSC 4OIIH 5EUOB 2V7HA 1QTYT 5DJYA 5E5RB 2FLBT 3HS0B 4Z18A 5GJTL 3CSBA 3S37L 5D1QC 2HWZH 4QOKB 5D70H 3U4EB 5J1SC 2NY4C 2BVEA 1FIEA 2I60H 3IVKB 4MXWH 1HILB 4JHAL 1T4KA 4PV9B 3MRKB 4WCYL 4YDLC 5AUMA 3QO1B 1A6AA 3T0DA 3VGAC 5D7LE 4LPUA 3GK8L 3FT4B 3TH2T 2CUMA 3CFBB 1MREH 1YQVL 3CVIH 5JPMB 3RNQB 2VLKD 3D2UD 1TZIB 3VI4F 2JTDA 3G5ZB 1B6DA 1JRHH 1Q9KB 5JW4N 3VDBA 1J11A 1JGLH 2W59A 3C08L 3R1GL 3WMSA 1U8KB 4K55A 3QUMA 4QOKD 5EA0L 3CUPA 3O6KH 2X4NB 4L8BA 2H3NB 3GB7B 1P1ZB 4ERSL 1V8HA 1D5XB 5TE4L 1F4AA 5I1HH 4OLZH 4UBDC 3LS4H 4G6FD 5IF0A 5E6IC 1FFRA 3OB0K 5A2FA 3O4LE 4WW2B 3HI1B 1YPZE 1S7UA 1ZGLA 2DM7A 4PS4H 5IVXA 3QPQC 2Q76B 1RVFL 1JHKH 1R3HB 3TJHC 3WIFB 2K7PA 1QSFB 4G7YL 1QYGL 4WI8A 5DJCB 5MENB 1CN4A 4M7ZB 4G9FB 1Q94A 4GRWE 1OQXA 3QWQB 3SO5A 5HDQL 4G6FB 2YN3A 2G2RA 3ARSA 1XR8A 4F2MB 2Z31A 3BGMA 2VLKA 3C6LA 5C0EA 5H35A 1K8DA 5TPWL 1MCLA 2H2SC 1U8JA 5CIPB 5B39G 3D85A 3WFEH 3RGHA 4CDGC 3VRJB 4PRPA 4JZNA 4U49A 3VFOB 5J8OA 2QEJA 1HHGB 2YUVA 3UTOA 4TVPE 3PABA 5CWSB 1IFHL 5ISZB 3GRWH 1MFAL 3C6LC 3QIUA 1HCFX 2DYPB 3QJFB 4NWTL 5CMAB 5CP3A 4MJ4A 3ZDXF 5C0IA 8CGTA 1G6RA 4RA3A 4AEEA 4ODUA 2Z92A 3TIEB 1GJIA 3SGJC 4WTZG 2NLJA 3AS2A 4FZEL 3OF6A 1QRNE 2BHYA 3OAZH 2IPUK 3GSWA 1TNNA 4NN6C 5L2JB 3M1BB 5IV2B 4NO0D 2HTLD 3IAPA 4HEPG 4NKQB 3N1MC 1J0JA 2YD3A 4FHBD 1U8MA 2MCG1 4WV1C 1AGFB 4WW2C 1WFTA 3U1SL 5IVNA 5IVZA 5HYJB 1CICC 2JCCA 3DUSA 5GS0H 4U2YA 5DJZB 5CBEB 1SJHA 4GSDL 3VFSB 2EDOA 3D3VA 3TZVA 3AXLA 2MCPL 2D0GA 2FDBP 4AH2A 2P5WE 3QXDB 4F7MA 4JN2A 3LOWA 3REVB 4Q7DA 2VDKL 1GGIH 2UUDK 3U4BL 1MI5B 3DLQR 1FBIH 1A6WL 3ROLB 4MNQE 1DBKH 5GHWH 3V4PL 1CL7I 1WJ3A 4CN6A 1QFWH 3TP4A 4YGAB 2I24N 1AXIB 3U36B 3DX6A 3KLDA 3BEVA 5GRUL 4WI5A 1KCVL 4DOHB 4PG2C 5K9QG 4NNPL 5GIRA 3SDAD 5D70L 5BVPL 4PJDF 3LEXB 1IM3A 4X7FC 1OGTA 2JK5A 3GSXB 5I74B 4P4KD 1U8QB 2COQA 5IB5B 4NNXB 1ES0B 2BOCB 5I16B 4O9HH 3IU3A 3MUHL 5ANME 3U6RB 1IGFH 3QXTA 2BSTB 3MNVB 2LU4A 2PW1A 3HE6D 1CT8A 2AJYH 3MRRB 4P23B 4UV4L 2P48B 4P46D 5SV4A 3ZZ1A 1MY5A 5SWSE 5I17B 1DLHB 2EXYC 3PWNA 3C9NB 2FX8H 1D6EA 4FP8L 2Z8VC 4FABL 4J8RA 4D0DB 3FQNA 1H3WM 1WBYA 1X5HA 4JG0L 4NUGL 5KS9B 1WBYB 4O51B 5FGCB 5D1XB 1KB5B 4WDIB 1YYLL 4WI3A 1J05B 3HE6C 2AK4E 1RIVL 1XGUA 2HJLA 5TE6L 3TO4D 5D93C 2DQDH 3OKOB 3OV6A 4N0CC 2GUOB 4LP5A 5DT1H 4G80A 4NT6B 5KAQF 3GSNH 4C83A 4TNVK 4EI6B 1N64H 3C09C 4JPIB 4AEIH 3TM6A 4JRXE 5E8DH 2DWDA 2M2DA 5ANMA 5LXGL 1BFTA 3L5HA 1MCQA 1W0YT 2A6IA 4XBEH 2PYEB 3ULUF 1QKZH 4MNGA 3WEXB 1JNLH 3N9GH 1V7NH 1T1WB 4R4ND 1KTLA 4IDJL 4P2RE 2QQKH 3TZVD 3KYMB 3E6FA 3L7FA 3JVGC 4KDVA 3WN5A 2MMXA 1F3JA 3U0WH 4KPHH 5DUPH 1WCQA 3DYOA 3LPWA 3WUZA 5LVEA 5HI5D 4HJGB 4P2OA 3T3MF 1KJ2B 3LD8C 2A74B 4XHJD 5FO7B 1SBSL 5DMKA 2EH8H 2YD1A 2VZOA 5JHLH 4HIHB 5A40E 3V0VA 3QDJD 1D9KA 4L4VD 3GSQA 1ORQB 3MGTB 2VXTH 3ARFC 3STLB 1MFNA 4HUXA 3MYJB 1JGLL 1Q8MA 1QSEA 3EUUA 3I6LE 1IC5L 2CIKB 2BSED 3QCUH 1CICA 5ESQB 5EA0H 2RAMA 2VL5A 4WHDA 3PGCA 2EDKA 4OLVL 1Q1JL 3QXUA 5I1JL 1QSZA 4N8PA 5E5MB 1R24B 1P5VA 2C3XA 4AYFA 1BZ9A 2ZUQB 3V0AC 1TJHH 2NXYD 5L2JA 3QDME 3KPPB 3QDJB 4KHTL 2BY1A 2R1YB 1HK6A 1CXHA 2Q6WB 4ZODA 3HNTH 3SCMB 1MLCB 4PJAF 3TFKC 3S3JA 4OZIA 2VLME 1H0DB 2GSIB 2AXGA 1I1FB 6FABH 3GNMH 3FZUD 3WSQH 3MREA 3TO4A 4MA8H 4X6BB 1EUTA 4J7RA 5CKAA 2WIMA 4P59H 2CJUL 3ARFB 1A4JB 4ELMB 3QUYC 1RJZB 3MBEB 1EEZB 1VESA 3KYNA 3B9KA 4GBXC 1HSAB 2DQFA 1MCOL 4JFED 1MRCL 4K3EH 1CD8A 2X4RB 5TFSL 3H6JA 3LKQA 1MH5A 4FQQA 1UB5A 3FN0H 4YX2L 35C8L 1HH9A 4UT9L 3JZ7A