1LILA

Bence jones protein cle, a lambda iii immunoglobulin light-chain dimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
212
structure length
212
Chain Sequence
YEVTQPPSLSVSPGQTARITCSGEKLGDAYVCWYQQRPGQSPVVVIYQDNRRPSGIPERFSGSSSGNTATLTISGTQTLDEADYYCQVWDSNASVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LAMBDA III BENCE JONES PROTEIN CLE
publication title Pitfalls of molecular replacement: the structure determination of an immunoglobulin light-chain dimer.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 34
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lilA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lilA01
4DKFL 2D7TH 4LMQI 4KTYA 1KCSL 1BD2D 3L6FB 1VEOA 1FH5L 4I8DA 1CT8B 4OGXL 3OKKA 5HHOB 3P30L 3IDMB 1XF1A 1N5YL 1AIFB 4L29A 1KELL 3VFVB 5I0DA 5DMKA 3VXPA 1KLFA 4JVWA 3BD5A 4LSPL 3HZMB 3K8MA 2Z31C 2C3HA 4QHKI 1F4YL 2J5LB 3F7PC 5EWIL 2IBZX 1EEUA 1KJVA 3GO1H 4FQJH 4BJLA 4X6BA 2DKUA 5JQ6L 2HKHH 2X4TB 3OXRA 5E2UH 3UJTL 4BSJA 5I1CL 5EO9A 3MBEC 2VLJB 4K7PH 4QRRD 1GGCL 2O5ZL 1IM9D 4GW5A 1RZFH 2P24A 3IKCA 4PJEE 4E41E 3MRBA 1YEJL 3DV6A 4U1KA 3MV8D 3SDXB 3O9WA 3FB5B 3U9PH 12E8H 3QDHA 1FZKA 5E1AA 2A0LD 5DLML 4F58H 3O2VL 4UT7H 4Y2DD 5EOCL 3T3PE 1DQJA 4WJ5A 2J8UB 2VO5A 3D3VA 1XMWA 2CDEB 4JVPA 3U9UA 1KC5H 4MHHI 1EV2E 2DL9A 3WMSA 1MEXL 5FK9B 3KLDA 4Y1AE 1TCMA 3JWNC 1R3LB 4LLQA 1NANH 3CDGB 1CDIA 3FAXA 4MDIB 3NVQA 5ENWB 4MA1C 4NNXB 4I0PA 4O9HH 4JPWH 1OB1A 3GO1L 4FQJL 4HS3B 2HKHL 5E2UL 5HYIA 4FTVD 4L3EE 3FOMA 4X5WA 1CLOH 1U36A 4BKLB 3RNQA 1DUZB 5IW1B 1YEIH 4XX1G 1MHCA 4K7PL 4ZUVB 2Q76B 4F7EA 4KHXH 1B90A 4LVHB 5MEND 4ZPTB 4K9EC 1RZFL 4P5MA 2ID5A 4PTUA 5DJYA 1YJDH 2PXYC 2VABB 4OZGE 3NTCH 3SN6N 4FQCH 4NHCH 4Z77A 2C3VB 3VG0L 4K3DH 4APQD 1M7IB 2XNAA 3MPCA 4P2QA 4WW1A 3U9PL 12E8L 2O61B 4YDIH 1PEWA 4FQHA 1G7IA 4HCRH 4UT7L 1MLCB 4N9GA 4RAVA 5GS0C 4Q2ZB 3REVA 2ZPKH 3UO1H 1XGYH 1T5WB 1A0QH 3BP4A 3OL2A 1KC5L 4R4NC 4V2CB 4LCCC 4XPHH 3ROLA 4A6YA 3O0RH 43CAA 2DLHA 1RIHL 3GM0A 4FN0A 4IRSA 1OLLA 4F3FA 1W72A 3WO4C 1LILA 3OKKB 4GLRI 1V3MA 4L9LA 4D9RE 3L7EA 2FNBA 3AB0B 4YFLF 3PQYE 4QRQA 4XVUD 4L29B 2ADIA 3JV6A 4JPWL 3CK0H 1A6UL 3VXPB 4U1GC 5DMKB 5HDQL 1OLZA 4S11A 2OSLA 1YEIL 3LRGA 1KJVB 4K3HA 4UUJA 2G9HB 4P46C 5DXWA 4X6BB 2XWBA 3VFSA 4AK1A 3QHZH 1NFIA 5EO9B 3GMLA 4X83A 3QWQB 1U2CA 2VN7A 1YJDL 4WWKA 1QG3A 4NHCL 3C60D 3EHBD 5GGQH 5GPRA 4GW5B 4K3DL 4J3VA 2P24B 3VXRE 2Z9TA 2A6JA 3MRBB 3DV6B 1CI5A 4OTXH 5JQHC 3FJTA 4HCRL 3WFBH 4OZHF 3PL6A 3O9WB 3NZHL 1YMMA 4JY6A 2ZPKL 3EJYC 3UO1L 1FZKB 5E1AB 2W1NA 1JMZA 1XGYL 1G1CA 5LGJA 1F5WA 1MOEA 1DQJB 4WJ5B 4XPHL 3KPNB 5F1OB 2OL3A 3O0RL 3NFPA 3D3VB 3GDBA 4WI6A 3WJJC 3RGHA 4NN6B 3U9UB 5HPOA 1NCTA 3CLEL 4LSVL 3HI6H 3WD5H 5I75C 2WP3O 4LLQB 3MR9A 3UP1A 3BOVA 2IC2A 1IGIL 4ACPA 1G6RH 1HH9B 4PREA 4ZAKA 1MCPH 4JREC 4I0PB 3S4SA 2V9QA 4PV9A 3RVTD 1S7XA 3FKUS 1OB1B 2DQUH 3QHZL 2EDOA 3MXVL 5HY9A 3HMWH 4UOW0 3FOMB 4X5WB 3NIFF 2VZ3A 5C1MB 1CK0H 1R0AH 3RZCA 1MHCB 1KXTB 5FECA 4LLWA 5JZ7C 5GGQL 1B4RA 4HZLA 4P5MB 5CZXC 3MLTA 4PJHA 5J11C 4PTUB 2HG5A 5DJYB 4GO6B 5IB2A 4Z77B 4OTXL 2OBGA 1T7VA 3WUWG 2YN3A 3WFBL 3U0PA 4AZ8A 4OZ4A 2XNAB 4ZSOE 3VGFA 4HMDA 3QA3B 4YHKH 4WW1B 3VXUD 1W0YT 3U4BH 3I85A 1A02N 4N9GB 5KTEH 3RPIA 3LPWA 3REVB 3J7HA 4NZRH 5IIEA 1T89A 1IAII 1MY7A 4IJ3C 4WTWA 5FYLH 5INCA 1MCOH 3BP4B 1XGPA 4HWZA 3ROLB 5DJ8B 1T1YA 1KCUL 3QJHB 4X80H 5E5RB 1EAPA 4IRSB 4RMSA 5E1HB 3WD5L 3OB8A 4HT1H 4F3FB 3IGAB 4MDJB 3KJ6H 4XB7A 3ULVD 4OF5A 4RGOH 1WEJH 3L7EB 3OKDA 1G6RL 5DGRA 1MCPL 4QRQB 2UVFA 3MZGB 2ADIB 3JV6B 1VPOH 4K94C 1EBPA 4M1DL 3JXAA 4A2LA 2DQUL 3HMWL 1PX4A 1XR8B 1QPPA 3QUYD 1CK0L 3BQUD 3MRLA 3G6AA 2XWBB 1JL8A 2W91A 4MJ4A 5GGRA 4GKSA 5C6PB 4WWKB 2BY0A 1NMAL 2ZCKL 2Y06L 3HG1E 1NPUA 2VJXA 3V0VB 3ZKXB 1T6WA 1EERB 4YDLB 4YHKL 1FRGL 2IPUK 3ELAT 1S7SA 1ZLVK 4ESKA 1IAIM 3PL6B 4LPVA 4JY6B 5D8JH 3RVXC 3S36H 4NZRL 1EEZA 3VD5A 4GAGH 3VDBA 1WBYB 3GSNA 5GSVB 5LGJB 1MCOL 2PTUA 1KTLA 3N1QC 2ZG2A 2OL3B 2FGZA 3AMKA 3NFPB 4X80L 1NAMA 4DW2H 4HLJA 4Y1AD 3WIFA 5D1ZC 1X4XA 3KJ6L 1GHFH 2UY7A 4BQCA 1WEJL 1F6FB 4S1SH 4N0CC 3EOBB 3B2UC 5J1AA 2NY4D 2GCYB 1AGCA 3MR9B 5HYQA 5CZVH 4PJDA 4ZAKB 4Z7WA 5D93B 3FRUA 3S4SB 5HGAA 4PV9B 1S7XB 3CH1A 3MCKA 2X1OA 3SBWC 1HYRC 2RBLA 4H88H 1JRHL 5HY9B 2FYYB 5FCSH 1FLRL 1N0LA 2YUVA 4M6NH 3RZCB 1INEL 3Q6FA 5FECB 4PP1D 4LLWB 1CBVL 4HZLB 4PJHB 1F97A 1I7TA 2HG5B 4J3TA 5D7SH 3A6CH 4M62H 1F6AA 2BRQA 5IB2B 4LHUD 3O3UN 1VKXA 4G3YL 3U0PB 4OZ4B 4YHOL 3CFKA 5D8JL 4GAGL 4JFZH 4PLKC 2A6IB 4OLXH 2VAJA 1G9MC 1XCTA 5CSZA 3RPIB 4DW2L 4O2EA 1D9KC 3VXME 1OARH 4PYHA 4AQ1B 1XGPB 3KJ4B 4HWZB 1T1YB 3SDCD 4OM0L 4B0MM 1U95B 5JW4M 1EAPB 2O5YL 3BUTA 2JF1A 4S1SL 2CKBH 2W60A 2NY3D 3PQYD 3CXDL 1FO0A 1OP5K 1X9QA 1ZT4A 2F19L 1AH1A 5EA0H 3OKDB 2Z93A 5DD5H 4OZIA 3G5XA 1UG9A 5FHBH 2HLFD 4H88L 4JDVA 3SHSA 4LU5L 3UBXB 2BY3A 3OSKA 3G6AB 3SE3A 1AD0B 2ATPA 3NACL 4N8VA 2DMKA 5GGRB 3MRCA 1RZ7H 2R0ZH 5D7SL 3A6CL 4M62L 1PQZA 3VRLF 4YE4H 1WF5A 3QIWC 5JOPD 3VI4E 3DX8A 4NQED 1G7JB 2GJ6A 1Z0MA 4JFZL 5FGCE 4R2GD 1NCDH 2JJTC 2EDKA 2R1WA 2IG2H 5KS9F 5I73C 4HF5L 4OBSA 4YEFA 3T4YA 4K8RH 1EEZB 3MV7D 3GSNB 4ODUA 4X9FA 3SDAD 2QQNH 4FQXD 1NAMB 5C3TA 3QXAA 4TPRH 3RDTA 2CKBL 5JOFA 2R2CA 3NPSC 2J2ZA 1XIWD 3ARXA 5EA0L 4EEEA 5J1AB 5DD5L 4S1RL 3CXHJ 1AGCB 5HYQB 3G5VA 4N68A 3QDMD 4J6RH 1PYWA 5BZDA 4GG6F 2BSTB 2V5TA 4QHLA 4Z7WB 3FRUB 5HGAB 3MCKB 3CH1B 4LLAA 1T22A 2VZVA 5FUOL 1RZ7L 2R0ZL 2GFBA 3VFGL 3NIGF 4OI8A 5IOPA 1RI8A 3Q6FB 3K81A 1I8LA 3OF6D 4YE4L 1I7TB 5E70A 2Z92A 1F6AB 4DVRH 1VKXB 3O8XD 3QCTH 4RCAA 4X4ME 1N7ML 2EDWA 1NCDL 4NZTH 2IG2L 3CFKB 2GSIA 2XWJA 4K8RL 5HHME 4U7KA 4MAYD 4JO1H 1S5HA 4U1SB 2ZNXA 4RDQG 5CSZB 3P9WB 4JHBA 3VWKC 4TPRL 4JDTH 1IT9L 1IAMA 3KYNA 4DN4L 2IPUG 4OF6A 4OI9A 1XGRA 4FQPA 2DM3A 2XZZA 3CXHK 1LO5B 3E6FA 2W60B 4Y5VA 4QRRA 1TZGH 2WLZA 1QSVA 1JFQL 1FO0B 2GT9A 5DSCA 1ZT4B 4U1JB 4J6RL 2NY0C 3FMGH 2Z93B 2Z31D 3EIFA 3U83A 4NC0B 3PJSA 4OZIB 3MV8A 3G5XB 4IOFD 2QSTA 3CD4A 3TVMD 4JDVB 4LOUC 1LEKA 3MBED 4DTGL 1PGRB 2DLFH 2QLVB 3MFFA 4Y2DA 5JORB 1IILE 4I3GA 4U3CA 1VENA 3MRCB 1AHWA 3HZVA 4G7YH 4NO0D 5BVJA 4DVRL 2EDTA 1RZ8A 2AABH 43C9B 3NGBC 3DX8B 5AG8A 3C8KA 5DZOA 4TNWK 2GJ6B 3IDUA 4PV8A 4OIBA 4OLEA 4JO1L 2R1WB 4OLVH 3T4YB 1KB5A 1NUFA 1JGUH 4KDTC 3F8UB 4ODUB 4JGJA 3VGHA 1F00I 4LLMB 4LCWA 4PGBA 1WAAA 3F6IA 4FTVA 2HFTA 3QXAB 5JOFB 3GJEA 4R96B 1Q9KA 1TZGL 4I3SH 1DQML 5MENA 2EO9A 4LHJB 3L5WA 3QIUD 4U6YA 3FMGL 3V6OE 4OZFA 2CLRA 2ARJA 1V3KA 2NY2C 1DBJH 4B5EA 2KBGA 3FQTA 1F42A 2J7LA 2JTDA 2VR4A 1UM6H 3G5VB 1PYWB 5BZDB 5KJRL 4GRLD 1QEWA 3RY6C 4HEPG 1G6VK 4QHLB 1E4KC 9CGTA 3GSVA 5I2IA 1MFCH 4G7YL 1PKQA 2UYLA 5F71A 5TE7H 2IPKB 5IOPB 4EXPX 4AL8H 4LMQE 3CC5A 1NUNB 2CR6A 4YEEA 3QUKA 2Z92B 1AI1H 2YD5A 1RUAH 4YZFE 2WK2A 5DS8A 2CK2A 4LSDA 4QRPE 1LMKA 4OLVL 2XWJB 4ZD3H 4ZO8A 3BP7A 4JM2F 2VLMD 5DHVB 1D3CA 1P7QA 1S5HB 3WXVH 1GGTA 5KW9H 2PN5A 3LD8C 4EN3B 3WLBA 1F58H 1GOHA 3KDMA 4GJTB 1F11A 1BQSA 2YPVH 4I3SL 1XGRB 4BH7A 4Y16C 3KR3H 2CO6B 2I9LB 1BVLA 3O11A 1MJJA 3E6FB 4HUVB 2W0PA 4YR6B 2NX5B 4Y5VB 4QRRB 1DBJL 3C60A 4HQQH 2GT9B 2R1XA 5DSCB 1UM6L 1YEGH 1OAZL 3W9DA 5CGTA 3ULUF 5IESL 3MV8B 5I16A 4YO0A 4I5BA 4UAOC 1ND0A 4JO3H 1DBKH 2YUXA 4YJZL 1SQ2N 2IANE 1LEKB 5F9AC 1MFCL 4LSRH 2YS4A 5BS0A 1UH2A 3MFFB 4Y2DB 4AIXA 4OZIE 2HH0H 4DGYH 3ZL4L 1AHWB 3HZVB 2Q1EA 3PWPB 1O7SA 4XAWL 2VXSH 3BN9C 3NFSH 5BVJB 5LBSH 1RZ8B 1NEZA 4MD4A 2AQ3A 3BXNA 2V5RA 5TPWH 1V5JA 3F7RA 2LTQB 3C8KB 1QLFA 1F45A 4LRIC 1MRDH 4X6DF 4NM8H 4PV8B 5F96H 1C5DB 5J4MA 1KLGA 5KW9L 1KB5B 2IMNA 2WIMA 1F58L 3WIIH 2DMCA 2GJ6E 4PGBB 4LCWB 3LV3A 4GFTB 1L9MA 2NXZC 3GJEB 2Z4QA 2YMXH 4H8WH 1Q9KB 2JK5A 2BMKA 2EICA 5MENB 3L5WB 4PG2C 3F58L 1S78C 2CLRB 1C12A 2ARJB 1DP0A 3PWJA 4MMZC 1T21B 5A40E 1RK1A 3FQTB 4B7LA 4LGRB 4JO3L 4XP6H 1DBKL 3CDFA 1QEWB 1INDH 4LSRL 3V2AR 3L3IA 1SMOA 3MOBH 5C0BD 2YD9A 2W9DH 3RBSA 5J1SC 4HGWA 1YNLH 3GSVB 2HH0L 4DGYL 5I2IB 5E24E 2E27L 3IFOA 4OLYL 1PKQB 3O6ML 2UYLB 1WBXB 4PJ9D 3TN0C 3NFSL 4YXHH 4ZUTA 5LBSL 3HMXL 3MACH 1OHQA 4MJIE 1X5ZA 3CC5B 5TPWL 1LEGA 3C6LD 1F3RB 1MRDL 5HHMD 4MQTB 5DS8B 4NM8L 4RX4D 1I9IH 3T3MF 5F96L 3DUUB 2P4AB 4M7KH 4NYLA 4PYGA 3E1F1 3BP7B 4JFOA 1P7QB 3WIIL 4NSKA 5JMRA 1KIRA 3EZJB 3X14A 3BAEH 3BQUA 3WLBB 3KDMB 4H8WL 1F11B 3Q0HA 5D1QD 2XZAH 4LEOA 4BH7B 3IDXH 2BVYA 1BVLB 2MKLC 3O11B 4KRPC 4GUPB 2MTPA 3BP5A 3MOQA 1EUUA 3C60B 2R1XB 4TTGA 4EBQH 3E3QC 2JIXD 4XP6L 3W9DB 4XCEA 3IJHA 1IGMH 3FQRA 4NKMA 3UJJL 4O4YH 4Z7QE 3MOBL 1BQLH 5I16B 4QHUA 4YO0B 3S5LB 5F89A 1F4WH 2NX5E 1ND0B 1YNLL 4EUPG 1D6VH 4MD0A 2DQHH 5DK0A 5BS0B 4PD4J 3ZE2E 4YXHL 4J12A 1N2RA 1JYVA 2W9LA 5D5MF 3MLYH 4BH8A 2AQ2A 1CICC 2YBRB 1NEZB 1JGLL 4MD4B 5E99H 3TP4A 1Q72H 3BXNB 5GJSH 3C5ZC 5C2UB 3RVXD 5DZLA 1QLFB 3M17A 4M7KL 5IB3A 3PWPE 5MERA 1UJ3C 2YUZA 5GS3A 4YDVA 5D96B 5KVGH 1KLGB 4PRPD 3BMWA 3E2HC 1TQCC 3QI9A 4MB5A 3BAEL 4K7PY 4KXZI 5D1ZD 4Q9CA 3GHEH 2VISA 4X7TA 3QZWA 2XZAL 5CILL 4NNPH 3LV3B 4ZO7A 2IH1A 3Q2CA 2ATKA 4ZS6C 2Z4QB 3HPLA 4EZMA 1MH5A 1EX0A 2VDLH 4DK3A 3I6LE 1D6EA 5E8PB 4PJBB 4EBQL 3TCXA 2FRGP 2IGFH 3V7AE 1WAAE 5C0AE 1C12B 3PWJB 4LHUA 1RK1B 4O4YL 1BQLL 4RMTA 1BEYH 1D6VL 3PGFH 5CKGA 4UIMA 3L3IB 4ETQA 2DQHL 3I75B 4XP5H 3F7QA 1G7HA 4HGWB 4YIQA 4I77L 4QTIH 1AXIB 3AAZA 1FE8H 5JMOC 2Q86A 3IFOB 3TV3H 1NKRA 4CU8A 3MLYL 3LN4A 3VGDA 2BSSA 3QNZB 2CLVA 3B9EA 1KN4H 3LZFH 2B5IB 5E99L 4EKXA 1MJ8L 3P9MA 4XWGL 1Q72L 5DI8B 5GJSL 3S37H 3UTZA 5BOZG 1LEGB 4QRPD 5ALCH 4J2XA 5C08A 1PKQE 4JLRA 3NCFB 4PLKD 5LXGL 5KVGL 2FJFA 3ZO0A 3ROOB 4NYLB 2WAHA 1OTUD 3BGFC 4M6OL 3TIDA 3GHEL 4NNPL 4R90H 1EHLH 4KKBD 1VADA 3SKNA 3X14B 5GS1A 3BQUB 2FECI 4MQSB 5CJXC 5BMFH 3V4UL 4A6YL 3QUMA 2OL3H 2VDLL 3FQUA 4LEOB 5FV2A 1NQBA 1W72L 1CWVA 3CGTA 4KI5C 5E8DH 3BP5B 4NZUL 4UILH 3FFCD 3S35H 1KFAL 2HRPL 4OFVA 4XCEB 1AGFA 3IJHB 1BEYL 3PGFL 3FQRB 1F3JA 3SDDC 4NQEA 5KVFH 2J8HA 3P0VH 2VDPL 4KKCD 4XP5L 1ZLUK 5F89B 1QYGH 4POYA 4QTIL 3M07A 1FE8L 4XP9H 1T1ZA 4MD0B 2VDRH 5DK0B 3MV7A 5DVMA 4MJ6A 2DLIA 4JEGB 4BFIA 3LZFL 1C08A 4K3GA 1K4DA 3SDAA 1N2RB 4C54A 5JTWA 4RFNB 4FQXA 3QIWD 5ALCL 3QDAA 1OL0A 4K71C 4BH8B 4Q0XH 1H8NA 1DQDH 4PB0H 5BS0E 4WFHD 3QFJD 1MQKH 2NZIA 5I1HH 2EDQA 3CPLA 1CD9B 3QFDA 2NY4B 1VGEH 5IR1A 3M17B 5IB3B 5MERB 1NDGA 3CFEA 4PJCE 1DFBH 3QIBC 3QDMA 1F6LL 4YDVB 5D6CA 1D5MA 4R90L 4WY7H 1EHLL 1FG9C 5C07D 3QI9B 5BMFL 2VISB 4X7TB 2OL3L 4PS4H 1CIDA 2IH1B 4TUOA 2W59A 3OAUH 4PPTA 3B9VA 3HPLB 5E8DL 1MH5B 3AMLA 1D5IH 1D6EB 3OF6A 5DRZB 3H7BA 1T7YA 3OJVC 1QSZA 3H6JA 1WT5C 5FA4A 5KVFL 2HJFA 4R97B 1IEAA 1WZMA 1QYGL 3KYMB 5FYKL 4PJBE 4XP9L 2OS7A 3AM8A 4N5EC 4UIMB 5D1XC 2VDRL 1HYSD 1S7VA 1G7HB 3NABL 1OGTA 4YIQB 5CP7B 2CIIB 3AAZB 2DAVA 4G8GD 4M7ZB 4MJID 3RWJB 3GJFB 1LK3L 2OTPA 4YDKH 2X4UA 1BM3H 3LN4B 4Q0XL 2BSSB 4N0UE 3TPUA 2CLVB 3LPFA 1YMHA 2OQJA 3P9MB 4PB0L 3T0VA 4ZS7H 3UTZB 3ESUF 4QHKJ 2B1HH 2EIEA 1CFVH 1VGEL 5C08B 4JLRB 1A64A 1DFBL 3VXNA 4ONOA 2FJFB 5C09D 2Z31A 5JHLH 4WY7L 3RHWK 4FQ2H 4MNHB 1ITCA 4XWOD 3TIDB 1A22B 3FB6A 3MBEA 3MRQB 3GSNH 4X6CF 3OAUL 3SKNB 5GS1B 1WSST 3EO0B 4GXUN 3QUMB 3FQUB 1D5IL 2NR6D 4E0RA 1NAMH 5IGXH 3DARA 5E4IA 4NO0A 4DFHA 2R69H 4LLVA 4C4KT 3ORJA 1CFNA 4JKPH 2BVPA 4D9LH 4D8PA 1AGFB 3O4LB 4LOUD 2EIZA 3BVNB 3BRGC 1F3JB 4NQEB 4TTDC 3A67H 1X6NA 2X4NB 2E3VA 1T1ZB 3LSOA 1UWXK 4MJ6B 1BM3L 4R0LB 4BFIB 1C08B 3VFRA 3BIKA 1K4DB 3SDAB 4ZS7L 5DD0H 4FQXB 1MFBL 2B1HL 2GAZB 3FB7A 3QB7C 4N1CA 1CFVL 2LV4A 3NIFE 5GISH 5IW3A 1R5IA 3UYPA 4AH2A 2Z0BA 3QIUA 1UKQA 2OTUB 3QFDB 5JHLL 4LVEA 3PV6B 4NFCA 1EHNA 3L3OA 5IR1B 4M4RA 4CGTA 1NDGB 3BUYA 3MRIA 1LK2A 3SGJC 5D6CB 1D5MB 4JO4H 3O6FD 1HDMA 3GSNL 3OAZH 4ODBD 5CEXA 1DE4A 1HHKA 3S34H 1NAML 3I6LD 4TUOB 5IGXL 1UADC 2Q20A 2PXYA 2QBWA 5GS2D 4QHNB 2WW8A 4JKPL 3PABA 4Y19A 4D9LL 2FB4H 3UTTD 5FA4B 2PKDA 1MCCA 2HJFB 1FO0H 3O3DB 3OWEA 5CIPA 5CLWA 3LH2H 1HQRA 5DWUH 2BXYA 5CSGA 1MFAH 4TYUA 1MI5A 2OMBA 5ANME 1S7VB 1OGTB 4LCCA 2OK0L 3VW3L 1JP5A 2YD2A 2ZUSA 1SY6A 4QWWD 3I6GB 4X7CC 3TEUA 3TJHC 2X4UB 3ZE1F 5DGQA 1YMHB 4BSVB 2OQJB 3SQBA 3ILPA 2Y6SC 1OP9A 5IVZB 1DSFH 5I1LA 2EDDA 4KQ4L 1DVFC 2A38A 4GBXD 2C3GA 1W0WA 3GIVB 3BRDA 1FYHB 3I50H 3VXNB 4FQQA 3PDGA 3WS3A 1P53A 1FL5A 3IVKA 2Z31B 2D7OA 4JO4L 5E2VH 3RP1A 1YNTA 3K0WA 4P46A 3ZKMD 5C08E 1KCRH 4UDUA 4ZQKA 3S34L 4Y16D 1N6UA 3MBEB 2YPLE 3T77B 4C83A 4HUXA 1GPOH 4E0RB 2P45B 2VSDA 3C08H 4X4YA 5T1LB 2FB4L 4NO0B 4LLVB 4C58B 4NQDB 4YC2C 1FO0L 2FX7H 5J9PA 1JGEA 1CFNB 2BVPB 4D8PB 3SDYL 5DWUL 4JKMA 4PJ7F 1OSZA 1XGUA 3BFOA 3HAEG 3LS5H 3WO3B 4HKXA 1Y6KR 3GEWB 3WJJA 3RQ3A 4JR9H 4KTEL 2DTML 2AKRA 5FKPA 1PKOA 3O4LE 4C56D 3ZHDA 4PJFF 4O5LL 3MYZA 1CQYA 5AZEH 3VFRB 4Q6IC 3BIKB 2VLKE 3QO1A 2WBWB 1DSFL 4KGJA 3S88L 5IVXA 3IDGA 2X9XA 4GLRH 1G1YA 3FB7B 1R5IB 4M9PA 5EN2A 1ROWA 4Z7VE 3I50L 5E7BA 4P4KC 4MA1B 1X7QA 2G5RA 2LU3A 4AENB 1KBGH 3L3OB 2OR8A 3QXDA 2BVOA 2ED8A 3BUYB 3MRIB 1LK2B 4LBEB 1GYAA 4GS7C 1KCRL 4RAHA 4P9HH 2CUHA 1HDMB 1AO7D 5CEXB 5C0BA 1DE4B 4JFHD 5DHVH 3GMRA 4U6VH 2G2RA 1GPOL 4KRMB 3C08L 5MP6H 1A6ZA 5K93A 2PXYB 3S3SA 1P7KA 3QQNA 4RZCA 2R29H 1YN7A 4K3EH 1BOYA 4KMQA 1I3RA 5C0RH 2FX7L 1ZLSH 3QCUH 4YXKH 4N90E 4Y19B 1MCJA 4CN1A 1OWRM 1JGDA 3QEQB 2OJEA 4AEIL 4HJJH 5EZLA 5CIPB 5T3XE 1GJIA 1UQSA 3LS5L 1HQRB 3FB8A 4Y88A 4NKOA 1MI5B 1H3VA 2CXKA 3KPOA 1EEYA 1ZVHA 4LCCB 2QSQA 5AZEL 3ALPA 2NLJA 2AJUL 3BJLA 1S8DA 1QSEE 1IC4H 4HKZA 4RGNC 3WNOA 1JF6A 4X7FC 3WO4B 4UV7L 5I1LB 1KT2A 4X99B 3VFWB 5TJWK 4ELMF 1MIMH 4XCNA 3IXTA 5BZWA 1SMAA 3FT4A 1KBGL 1QD0A 1PG7X 1R6VA 1BZ9A 2VWEE 4U1GB 4FQQB 4H0GA 5CBAA 2JIXA 2HMID 1FL5B 3KPSE 3VRLE 4PUBH 4LAJH 4HMCA 4KZDH 4Z6AT 4P9HL 2WUBH 3H9SD 4URTB 3DO7A 3O2WL 4H0HB 2M26A 4P46B 4ALAH 1X4ZA 4U6VL 4LVNC 3HFML 4UDUB 4ZQKB 4EDXA 2BNUB 3T0XA 1Y18A 3W39B 1KB5H 3FFDA 1BBJA 3DMMC 3LRHA 3PIQA 2K1MA 5SX4I 4K3EL 4C83B 2JELH 4HUXB 5E0QA 5HGDA 1ZLSL 5IFHL 2KL6A 3LHPH 1C7TA 3D39D 4X5LA 5ALBH 1EMTL 2GHWB 4LNRA 4N8PA 3ARPA 5J9PB 4HJJL 1JGEB 1MLBA 4LGSB 3GSQA 2XKUA 3TWCL 1GIGL 3W5NA 3MJGX 3W0WA 2ZCLL 4JQXC 4M5ZH 2DI9A 5DMYA 2FEDC 4DGIH 1OSZB 1XGUB 1IAIH 1AFVH 3Q5TA 3QPQD 4NQDE 1NCAH 1WK0A 2CRMA 4HKXB 1OVZA 4PRPA 2FLBT 2V7NB 3BEVB 1DLFL 5FKPB 5D1ZA 2DN7A 1IC4L 1L7TH 1CICD 4N8VG 3EBAA 1DDHA 3QO1B 2DQJH 5IVXB 3IDGB 1VFUA 5I75B 1GVIA 1MIML 5SWSD 4KROD 1ACYL 1F90H 5EN2B 2D2OA 4Q9QH 3LQZB 4YQXL 4WO4D 3WKNA 4PUBL 4W6XB 2MWCA 4JREB 5M95B 4KZDL 1DLHA 4KAQH 5F7DA 2BVOB 1FNAA 3MO1A 5DRWA 5TFSH 3W81A 1VHPA 3IDJA 4FQLH 3SBWA 3LIZL 4F57H 4ALAL 3VD3A 2BNQD 8CGTA 1KB5L 4IRJC 4ZS6D 5C0BB 2BSED 1T1XA 3GMRB 2JELL 2G2RB 5AUMA 3F62A 2GYSA 3UAJC 1A6ZB 3LHPL 1YN7B 5ALBL 3WL9B 1XCQA 5C0FA 4X7DC 5DJZA 2DQIH 4Y2OA 3VXTB 4P23C 5CJQH 3QUXD 2EE3A 4M5ZL 4DGIL 2OJEB 3LEXA 2FJGA 4HFUH 5EZLB 1IAIL 1AFVL 1UQSB 3CVHA 5K9JH 5IMMA 4NKOB 2AXGA 3WLWC 3L5XH 4IJ3B 2Y5EA 3CNKA 4H1LA 3Q3GB 4GG8A 3KPOB 5FDWA 1EEYB 1L7TL 3MROB 3QEQE 2NLJB 2DQJL 5KG9A 3NCBB 5FYJE 5ECJE 3ES6A 4HKZB 1MI5E 3CX5K 1FVCA 2H41A 1VEPA 3PV7A 4BQBA 1KT2B 4XCNB 3IXTB 5ADOL 5BZWB 3FT4B 4F80A 4Y8AA 4KAQL 3X11A 2JIXB 2ZKHH 5I1KH 1EA9C 2P47B 4YHMH 3DO7B 3DX7B 2RQ8A 2FIRT 1UM4H 5F1IA 4NBZB 1L0QA 2VL5A 4EDXB 4YFEA 5J56B 1U3JA 1Y18B 1H3GA 4ISVB 3FFDB 1BBJB 2FL5A 3WYRA 1QA9A 3PIQB 5ACZA 3UYRH 2NMSA 1CQKA 5HGDB 4ETYA 5KOMC 1J88A 2I5YH 4Y4HC 3QIWA 1RUPH 1I9RL 5CJQL 4FFVC 4OI7A 4QGYA 5L9DL 3MJ9A 1KYOJ 4LNRB 3ZSTA 2JJTA 3QFJA 4NBYB 3GSQB 5FM5M 3U4AA 2XY2A 2VDNL 5DK2A 1MFNA 3W0WB 5K9JL 1FFRA 3CSBA 3C87A 3L5XL 4GAYA 5E9DB 3ZT7A 1TVDA 5ILTH 4PRPB 4P3CL 1QRNE 1NGQH 2P48B 5D1ZB 1Q9LA 1H15A 3D25A 4NWUH 2ZOLA 4ENEC 1UA6H 1DDHB 1CFQA 5E8OA 2Q3AA 3BDBA 4GKNB 3A0OA 1S7QB 1QSFE 3KPTA 3QIBD 1WC7A 1RU9H 4DKAA 4PJXF 2Y72A 5HHVH 1DLHB 2FR4A 3DPBA 5DHXB 5DRWB 5TF0A 3IDJB 1F8TL 1A2YA 1UACL 4LRNH 3L3GA 5C0CD 5ABDE 3TNNA 3ZYOA 2WLYA 5ITFA 3VXQB 3QNYA 3UYRL 3KHQA 4G8GA 2I5YL 4P2OC 4CL7A 4LSTH 1RUPL 3DRQA 1KYOK 1Z9SA 1PSKH 4TVPD 4LCUA 4NKQB 5DJZB 2QHRL 1EGJA 4OZFG 1N6VA 5HGHA 3IFNL 3VWJC 1FZOA 1J9CT 5D1XD 3KS0J 2CGRH 3LEXB 2EZ0D 2VXTH 4OJFH 4M7LH 2D0GA 5ILTL 3CVHB 5C09A 5IMMB 1MY5A 3VWKA 1JZ3A 2AXGB 4OBRA 1D9KB 4Q58C 1DBBH 1NGQL 4GG8B 3D6GA 4GAJH 5FDWB 2PW1A 4NWUL 3MCLH 3EOAA 4F37F 1UA6L 3T0BA 3V52H 5KG9B 3OJ2C 3QXVA 3ES6B 3I3DA 3EJJX 4FRWA 4JFFD 4P57A 1WWWX 1FVCB 5I18H 3CSYA 1RU9L 2E7MA 4G8FA 3KPSD 5HHVL 4JANA 3ULVL 2X44D 2W0KA 3FN9A 4QTHB 1F02I 2Y1VA 2G75A 1T7WA 4LRNL 1A5FH 4QRUA 4G7VH 5F1IB 2R1YA 1FNSH 5FF6A 4G5ZL 2VL5B 5BV7L 5JO5A 2Z35A 5FXCH 2FL5B 3TFKC 1UZ6F 1QA9B 4LSTL 5ACZB 2R9HC 1KTKE 3M1BA 3X17A 2VZOA 1PSKL 5EIVA 1NC2A 5DO2D 1TDQA 3QIWB 3MLVL 2ZOKA 4CBPA 2R0KL 2X5PA 2C4FU 3R1GH 3U36A 1J5OL 4WIQA 1KJ3H 2VXTL 3KVQA 5I17B 1QNZH 3PXJA 3QFJB 5I73B 2C5DC 4LP5A 5DK2B 1FIEA 1OAYH 4KDTA 1DBBL 5FHAH 4M6MH 4GAJL 5GRVL 5DK3A 4GQ9H 5EU3B 3QG7H 1YY8A 2WWMC 5I66A 3V52L 4H26A 3O6FA 1YEEH 2HFGL 1Q9LB 3W0WE 2BY2A 1H15B 3D25B 3CZJA 3NPSB 1AR2A 5E9DE 1K8IA 5I18L 3J8F7 3GJFH 2K9UA 1UZ8A 5E8OB 1SEBB 1X5HA 3SCMC 3SE4C 4NQSA 1IEBA 1YEFH 4KKAC 3ZE0F 4NBXB 3GGWA 1CLYH 2OR9L 4NP4L 1R3HA 5EO0A 5MI0C 2FATH 1E0OB 2FR4B 1E4KA 2MJWA 4G7VL 2SEBA 3I02A 1FNSL 1GH7A 5D2NC 1A2YB 1L4IA 4KGLA 3IT8D 4IMKC 3T3ME 3VJ6A 4XC3L 2Y07L 4WHDA 1S5IH 4NZDA 1QR4A 4WFEE 2PYED 4UDTA 2PO6D 2EXWC 2JB5L 5A16A 5GSRA 3DRQB 4LPWA 3QUMH 1RD6A 1TXKA 3R1GL 5FV1L 1KJ3L 1QNZL 4JPVH 5DTFA 5HGHB 5I71C 4DAGH 4HPYL 4MXVF 4EXKA 4GBXA 1OAYL 1GOFA 5FHAL 4M6ML 4ODTH 4NQVA 2DM4A 4TN9A 5DURD 3V4PL 3ZMRA 1SJVA 2DWEA 5DFVC 3FRPA 3WFDL 3MOAH 3VWKB 5ITBL 3ARUA 5CINH 4K7PX 3JBG7 2R23A 1KPRB 2PW1B 4JO2L 3S3PA 1FGVH 1QFWI 3N1PC 4Y16A 1DVFD 2YA1A 4U1MB 4NPYA 3VRJA 5ESVA 1YEFL 1FG2A 4P57B 2E7BA 2XTLA 3EFDH 1UKTA 2NY0B 2Q7YA 4G8FB 4JFEE 1QOKA 3OR7B 1UGNA 2FATL 1N4XH 5JPMB 5D5ME 3CUPA 4CMHC 3VRIA 5C2BH 5IBUG 1EJOL 2G75B 1V7ML 4QRUB 1OTTC 3MRRA 4M61A 4P59H 2R1YB 5D2LF 3BN3B 5F6IC 5JO5B 2Z35B 3R0MA 3BDXA 4M5YH 3RUGA 1BIIB 2EEDA 5DHYA 4C56A 3ZHKA 3OAYK 3M1BB 3QUML 1BWMA 1NC2B 4JPVL 1IC5H 4G9FE 3SGDI 4UTAL 1EK3A 5CEYA 4DAGL 5F9JA 5T3XH 2BJML 2ZOKB 5DJCA 3FAWA 3U36B 2Y25A 3MGOA 4JQVC 1FYTE 1JPTH 4XMLL 4RWYH 1BP3B 1LO0H 3AC0A 5CINL 1QFWM 4TSAH 4IRZH 4JCMA 1RJYA 1CFTA 2EYSA 1XH3A 1YY8B 2OJZH 1FGVL 5I66B 4R8WL 3W2DL 2GTWB 4H26B 4Z9KB 5IEKB 3I84A 2WBJC 5E5UB 4L9LC 3QO0A 3STLA 1BWWA 4PG2A 3HKFA 3BRFA 1WGOA 1LDPH 1N4XL 3LVEA 2NY2B 4NQSB 4KJYA 1A6WH 1NBQA 3U0TA 2CXGA 3GGWB 3SKOA 5C2BL 5EO0B 5ELIA 1FNEA 3WXWH 2XWTA 4R4BA 1HQ4A 2EIDA 5IQ7H 5B22A 1BFTA 4P59L 2SEBB 4K2UH 1MCWM 3I02B 1HIMH 4ELKB 4JM2D 4QXWA 5GRYA 3V5KA 3TN0A 3VJ6B 2Q6WA 1JYXA 1M6OB 2KH2B 3QZWG 3RL2A 2BVQA 4K23H 4R4FH 4HIXH 4UDTB 2BNRE 3VXSD 1IC5L 5CEZE 5A16B 5GSRB 1KG0A 1IKFH 5T3XL 1RJLA 4OCLC 4ZOCA 2R2HA 5DTFB 2OXHA 2FD6H 4KRLB 4LHUG 4ZDHA 2LAAA 2M1KA 1LO0L 3UX9B 4RWYL 4U1NA 4U0RC 3RWFA 4ORGA 3ULUD 2DWEB 2OJZL 3CSGA 1SEQH 5E7FA 4YHIA 3LD8B 3H9SA 1KIUA 4OZHA 1MWAA 5C0JA 1ODAA 1A4JB 4PJ8C 4M7JH 4Y16B 4ZNEA 1WFUA 3T3PF 3H9HA 5JUEH 3VRJB 5ESVB 1FG2B 2ICCA 4O2CA 2WZPD 4JN2B 2Q7YB 4NUJA 4L8SC 1ZS8A 1YEDB 1RIUL 2WIIA 3D39A 4YK4C 3WXWL 2GI7A 1IKNC 3CUPB 4UAOB 3VRIB 1KENH 4RNRB 1MCIA 1JRHI 4RMRA 3DMMD 8FABA 3MRRB 3GMNA 1T6VN 2F74B 4YAQA 4K23L 4R4FL 4ODVH 4HIXL 3RUGB 4ZTPH 5J13C 4M4PA 5DA4A 2DWDA 1IKFL 1BOGB 1CICA 1PBYA 4K9EH 3MJ6A 3O2DH 1CDGA 3CFDA 5DFWH 3C5ZA 5LJYH 1XF5A 3KPRE 2FD6L 4NO5A 5CEYB 5SWSA 1DEDA 2FDBP 3UEZA 1F4HA 2FEDD 3DVFA 1UJ3A 2Y5TB 4AYFA 4KK8D 4EVNB 1F2QA 5E2WL 4NZJA 3LKNB 1SEQL 5DEZA 3HC0A 3D0LA 1T0NA 4LVOB 5CIPH 4R3SA 5DJDB 1RJYB 1CFTB 5FYJH 2AK4D 5GS0H 4M7JL 3NCJH 1JK8A 2NXZB 5L2JB 5HD8C 4N0YL 3QO0B 1IC7H 5FO9A 1PZUB 4LGPB 4KJYB 1NAKH 2YR3A 3SKOB 4OD1H 4TSCH 1KENL 4KJWD 4OV6F 3V0WH 1JHTA 1FNEB 2XWTB 2HAZA 1MRFH 5A2KH 5BJTB 3BD4A 4ODVL 3KYKL 1EEQA 2DF3A 1I9EA 4ZTPL 3V5KB 3TN0B 4IIQB 4NHUA 2HVKA 5I1IH 4V2BA 2CPCA 2BVQB 3GMQA 3BZ4A 5TF1H 3RL2B 1P6AB 1KG0B 1J1OH 2FO4A 1RJLB 5T3ZD 3B9KD 3NBNA 4EI6A 4M8VA 3BYTA 2R2HB 5EG6C 3KPPA 4HXBH 1U58A 3RGVC 3WLWD 1JYNA 2P43B 4U1NB 3D87B 4YGVA 1GXEA 1T0MA 4ORGB 4S10A 3RWFB 4OD2A 5GS0L 4OCYH 4KXZH 4ZUWA 3NCJL 3ZYZA 5IW6A 1CF8H 1MWAB 2DTSA 5C0JB 2MQ0A 4MAUH 5CJXA 4ZXBC 1WJ3A 3SJVA 1J0JA 1AQKL 1IC7L 5E94B 1SY6L 1MHHB 4QY8A 3H9HB 3SOBH 4KRPB 2X09A 1CZ8H 4JZJC 1BJMA 1NAKL 4I48A 1ZOXA 4KK5C 4O2CB 3HNSL 3SDXF 4OD1L 2OR7A 3S36X 1NGYB 2AV1A 4PRDA 4NUJB 4KY1H 2WIIB 2KQMA 3D39B 2J8UF 1UCTA 4RAUA 1RURH 4OLUH 3R4DA 2F54D 3LAFA 2ZSWA 2ADGA 3GMNB 3BE1H 4ERSH 3QCVL 2C4FT 5TF1L 3TYGH 1G7MB 4LPCA 3KWWA 1I75A 5IFAL 4FFVD 4Q74A 2DWDB 1CICB 1J1OL 3CFDB 3C5ZB 1XF5B 4DCQA 2XA8H 4HXBL 2B0SH 2FZ3A 4D3CH 1UJ3B 3QIBA 1F2XK 3SQOH 2XQYK 4OCYL 4X5XA 3S3JA 4OCWH 3HC0B 3D0LB 3E2HB 1CF8L 3HUJB 1TQCB 2P5WE 4R3SB 1MAMH 4ENED 4BSWA 5F7NC 1FGNH 4MX7B 4M8QA 4ZUSA 1JK8B 1OAUH 5C0CA 3SOBL 2APTA 1CZ8L 2MQ3A 3K80A 3RVWD 2UUDH 1ZEAH 5FO9B 4PFEA 4J3WA 3WFHA 1WT5A 1YY9D 2DJ4A 4UNTA 4KY1L 5IB4B 2YZ8A 1E4XI 1T4KA 2VLRB 4JE4B 1RURL 3OHXA 5C0ND 3BZDA 4YHPA 1JHTB 2A9NH 2GITA 4POZD 2DIJA 5D1XA 4V1DE 4QXUH 4K94H 3L3HB 2H45A 3BE1L 5I0ZA 4ERSL 1OT2A 5I9QC 3JWOL 4HK0A 3TYGL 4P2OD 1T7ZA 1OD7A 2BNRD 3C5SA 2P8PA 3IXAA 4NHUB 5LGHH 2IAMC 2IF7A 3E8UH 3GMQB 3BZ4B 3L1OH 3UTPD 4WTZG 1TVBA 5AAMA 3VWJD 2H8PA 1A7PH 2XA8L 1XF4A 4PRIA 2FO4B 4D3CL 5IWLA 2XICA 4JFFA 4Z76A 4EI6B 3SQOL 2OXGA 4RFEA 2YXFA 3KPPB 4OCWL 1U58B 3MNWA 1SVCP 3QH3A 1ZV5A 4YGVB 3WIHA 3BGFB 2MQCA 3BD3A 4UQ2A 4CN4A 1MAML 1T0MB 3U4EA 1WIOA 4OD2B 4OCXL 2FECL 2LU7A 1FJ1A 2XQBH 2XTJC 3RDTC 4ZUWB 1BJ1J 1OAUL 5IW6B 1ES0A 3C5JA 5KS9A 3WUWB 3SJVB 1FC2D 4XX1E 5T5FH 1Q38A 5HYJD 1GSMA 4C59B 4QY8B 4BK5A 4K55A 2VB5A 5GGSY 4LIQE 1VESA 4I48B 1RJCA 1I85A 3PWUA 4PY7A 4OLZL 5EBLB 1IAOA 1V05A 2AV1B 4PRDB 1OAKH 3E6HA 3SDDB 4OCRL 2A9NL 4ZNEE 4QRSB 4QXUL 1S7RB 4K94L 4JFYA 3UC0H 2VZSA 4JG0H 1JUFA 3WFEH 2R9HD 2ADGB 3QQ4A 4GG6A 5LGHL 1P69B 3L1OL 1A1OA 3KWWB 1CL7I 4K71B 1A7PL 4D0BA 3BIAX 5EDXA 3MRHA 3WJLC 5DFTA 2W9EH 4DCQB 2FZ3B 4W4OC 3KLAA 5I6XC 4CADA 3QIBB 5BVPH 3SGJA 2XQBL 4X5XB 3TH3T 1FZJA 2P5ED 3GMMA 4KKNA 4ZTOH 2YPKA 1G9MH 2ESVB 3CVHH 3MREA 4BSWB 1IFHL 4M8QB 4ZUSB 1AE6H 4HUWB 4Y8DC 1JPGA 1OGAE 3KXFB 4QYOB 3QYCA 2PW2B 3HUJE 5SX5H 1IGCH 3WFHB 2RGSA 1OAKL 2VXQH 1T4KB 5C7XH 3TBSB 3BESR 3OHXB 3ARGC 3FQXA 4W68A 1DQTA 2VKWA 4YHPB 1W8NA 2GITB 4JG0L 5D1XB 4XHQA 4ELME 1B4JH 1YC7A 5E8NA 4IDJH 4HK0B 2VLRE 1Z9LA 1K8DA 2XKSA 1CXIA 3C5SB 4RMQA 2P8PB 2ZZUT 1MCNA 3IXAB 2FIKA 1P84J 5DEGA 1LO4H 3OV6A 2H2PD 1DVFA 2B4CC 1TVBB 2W9EL 2H8PB 4PRIB 3UPCA 4XH2A 3VFTA 2XN9D 3RKPA 2H9GB 4JHAH 3K3QA 2RR3A 2B2XH 2F53A 5BVPL 4PJAA 1JPSL 4RFEB 2HVJB 1UWGL 4LHQB 5F3BA 3QH3B 3MJ9H 3VMNA 2MNUA 4ZTOL 4UQ2B 3WNMA 1G9ML 1F4AA 3CVHL 3MLRL 1FJ1B 1FFOA 2EE6A 4TVSa 3B6SB 1AE6L 1ES0B 3C5JB 5D7JD 4NO3B 1CG9A 5KS9B 1O5DT 5C9JA 4S0TD 1N26A 2DBJA 2JJWA 2NY6C 3DTXA 2LVCA 1OM3L 4HUKB 3MLXH 4PGDA 2VXQL 4APQC 5DQ9A 1GGBL 4TUJA 2XFXA 4HIJA 3PWUB 4LLUA 4PY7B 3OG6B 2UWEE 4HIEA 4EI5D 1Z9OA 1OTTD 2IMMA 1UKSA 3QDJE 4IDJL 4DZ8A 1B88A 2R0WL 1MHEB 4KJPD 2MKWA 3DIFA 4HH9A 3X3FH 2RCSH 1JUFB 1MRCH 5I1JH 3QQ4B 4GG6B 5CEZH 1HKLH 5GZND 1NFDA 4Q6IA 5HI4C 3WFZA 1A1OB 1LO4L 4OLWH 4PRBA 4D0BB 1A3LL 3QEGH 3F6LA 4P4KA 3MRHB 3EYVA 1TJIH 4XVUC 3KLAB 2OZ4H 3MJ9L 2KKQA 4CADB 1EGJH 3QDGD 2G5BB 3BGMA 4W70A 4ONFH 4NJ9H 1XZ0A 1FZJB 5BRZE 4QCIA 2WBJD 3WS6C 4MNGE 4PJHF 4DEPC 4P9MH 4DJMA 2WUCH 1U91B 3MLXL 1JPGB 2N7BA 1H3XA 4NOBA 3EHBC 4H25B 5H2BA 1JWSA 2DJUA 3VXSA 3B5GA 1KXQE 1Z0NA 2ESVE 2GTZA 3EDFA 1IAKA 3EOTH 2IBBA 4AG4H 2CIKA 1PG7H 3RTQC 4FXGA 1PZ5A 2J3SA 3KXFE 1J11A 2DLEA 4ODWA 2DICA 3FQXB 2CJUL 5I15L 3UMTA 5CJOH 5DR5H 5E8NB 1NEUA 1HKLL 2WBKA 1CLCA 1P6FA 1K8DB 2CQVA 4HC1A 4OLWL 3QEGL 5F1NA 4U6HA 5DEGB 3LRSA 1DVFB 5ISZB 1TJIL 1I8MB 2AXHA 4XH2B 2K3TA 2X4OA 4QT5A 1KEGH 1EGJL 2F53B 4L4TB 4PJAB 2ZUYA 4ONFL 4NJ9L 3SPVA 3RVTC 5F3BB 5KAQF 2EYRA 1ORQA 4PJ8D 3W11D 1FFOB 1TVHA 2WUCL 3EYSH 3P4NA 4MXQD 4JN1H 2PNDA 3GI8L 3A6OA 3DMMA 4H1LG 5ACMA 4HG4J 5L2KB 1CG9B 3FT3A 3T0EC 4WI7A 3WE6A 5C9JB 1T0PB 4Y5YC 3N1MC 1FNHA 1HK6A 3BO8A 3DTXB 4OM1H 3EOYG 3DXAD 5AD0A 3BWUC 3WSQL 4H0IA 1I3GL 4PGDB 2VLLA 1HNFA 3MLSH 4I9WD 1D5XA 3HE7D 2AJ3B 3P0YH 4YC2B 3D85A 5DD1L 5DQ9B 5ICYA 4TUJB 1BMGA 2XFXB 4HIJB 3IYLW 3RWEA 4JQXA 1GGIH 1KLUA 4HIEB 1U8NB 1KACB 4ZMAT 5CJOL 5DR5L 2JE8A 2Q7NA 4DZ8B 4XPFL 5D6DA 4KI1A 1J0HA 3DIFB 4HH9B 1J86A 4PJXE 1U8LA 5IBLC 5HDBE 4WHYH 2RB8A 1NFDB 4Q6IB 1F3DH 2ICES 3QNXA 1NJ9A 3HN3A 1WITA 4PRBB 2BERA 3UZVB 1RJZA 3ULVC 1UB6A 3P40A 2EC8A 5JPNB 1JGVH 1KIQA 3HLAA 4TOYH 1JIBA 4JZOA 1KEGL 1DQLH 4P4KB 4WUUA 3EYVB 4X6FA 3D9AL 4MQXC 4MA8H 3PDOB 1ZSDA 1CDBA 2X6MA 2JCCA 4M6AA 3Q5YA 5BV7C 1MCEA 1IZKA 3P3YA 4GS7B 4JVUA 2EEBA 3MBXH 3BGMB 4HG4K 4YZFF 3EYSL 3QUYC 1XZ0B 1EXUA 4IRJA 5EU6E 3N50A 4RIRA 4QCIB 2A74B 1YYMH 1YEKH 2O5XH 5SX4H 4OM1L 5EIIA 2D0HA 5HHQB 2HFFA 3MLSL 4U49A 4XAKD 5H2BB 2DQCH 1FIGH 4G6JH 3T04D 1A14L 3L3DA 4P23A 4OGZA 2GTZB 4HBCH 1IAKB 3RVUD 2EE9A 2CIKB 4L5FH 3U1SH 1C16A 4FXGB 3B9KA 1PZ5B 4BELD 2X1PA 3EJZD 3QISA 4ODWB 1TTFA 3IJSA 3VI3E 3GBMH 1X5AA 2OMNA 1HWHB 1X6LA 4JRXD 4LAQH 5HYSG 5J0BA 4QOKD 2AJXH 4Z7OE 5HVWA 5TQ0H 2IFGA 4RGNB 1MNUH 3TO2A 5JHDA 5EFIA 5F1NB 4TOYL 5GQBA 3FCTA 4M48L 3LRSB 2VL4A 1CXKA 4OZIF 3RGVD 4X9BA 4Y7MA 3QPXH 1UZ6E 2X4OB 4QT5B 5IT2H 5LQBH 1U3ZA 3MBXL 3JTTA 5ID1A 3BKML 4UV4H 2FLRT 3GKZA 3NZ8A 5ISZE 4ZXBD 3MMEB 4OCMC 5DA0B 5J3HD 4LVNB 2EYRB 1ORQB 1YYML 1CU4H 5GRUH 1YEKL 2O5XL 3HR6A 1TVHB 4O2FA 4XVTH 2BC4A 3DMMB 4L4TE 1RAMA 4FFYH 1CN4A 3FT3B 4PP1C 4WI8A 3WE6B 3HE6C 2WQRA 1HXMA 2E7HA 2DQCL 4KK5D 5FA3A 1FIGL 3D69A 3FO2B 5AD0B 4Y4HA 4LSUL 2BHUA 2VLLB 4HBCL 3DOSA 4JFPA 3JWDH 4BK4A 1VFOA 5B38G 3D85B 5ICYB 5L2KE 3QDJD 4HWBA 2KDGA 5HVHC 3B83A 1NFKA 4HPOH 1KLUB 1JCKA 1Q8MA 1AGDA 2PR4L 3GBML 5FOJA 4GSDH 5IJKC 1U6AH 5T1KD 4LAQL 2AJXL 1QHPA 5TQ0L 1NCWL 1U8LB 4GW1A 4QNPE 5TE6H 5LWYH 5EUOA 3SDCC 4HFWB 5D7KE 4N5UA 3QNXB 3CDYA 4O51B 2A1WL 4XP1H 4CW1A 5IKCA 1RJZB 2NY3C 1UB6B 2HKFL 3ARRA 3QPXL 3CFBA 1KIQB 3HLAB 4EUPA 2Z8VC 4WUUB 5LQBL 3RFZC 1NFDE 3B43A 5D7IB 5IJVA 4CDHA 4KUZH 5I1GH 2F58H 1ZSDB 4U6XA 3RIAF 3KYOA 2JCCB 2MOVA 5KVEH 4XCFL 3TNMB 3HA0A 1UEYA 5GRUL 1CU4L 2F8XC 3UTSD 5LGKA 2I9TA 4XVTL 1EXUB 5IVOA 4IRJB 4RIRB 4FFYL 4O58H 3DHMA 3S37X 2CRIA 4PJ5B 4P2OA 5EIIB 4NWTH 1MWAH 2HFFB 1YN6A 5KSAD 4YBQC 5LAXA 2V2XA 1AP2B 1U8PA 3SGEI 3FN0H 3L3DB 4P23B 4JFDE 1VSCA 3VWJA 3RI5F 1AKJD 25C8H 4R2GC 1C16B 4HS6A 1NDMB 2DYPB 1U6AL 3E0GA 5F9WC 2HT2D 4HWNA 3D0VA 3IJSB 4IM8A 3JTSB 3BKJH 3LEYH 4DKFH 4Y4KD 5LWYL 5KVMC 2IAMD 1Q9OA 2YXMA 3SE9L 4Z7QF 3OZ9H 3D2UD 3LEVH 3C6SA 2XPGB 4F7TA 4ODXA 1FH5H 2CH8A 3MUY1 4L1HA 4PJIA 4ZNCD 1XIWC 2FHCA 3TO2B 1XGQA 5SWZA 5JHDB 5EFIB 3P30H 4PJGA 2MFNA 3FCTB 1N5YH 5HYJA 5D2LE 2DL2A 5I1GL 1KELH 2ILLA 4Z5RA 3GKWL 3BGAA 5KVEL 5CAYB 3GRWA 2XTJD 3JTTB 5ID1B 5EWIH 3TZVD 3NZ8B 5JQ6H 4O58L 4MZ2A 1ETZA 4O2FB 2VSCA 3N9GH 2BC4B 1MWAL 1GGCH 3RWGB 3GNML 4XNXL 2Y36H 4IS6A 1AY1L 1HXMB 3VGGA 5FA3B 4WEUD 5IHBA 4Y4HB 3FN0L 4C57C 4JFPB 4DKDC 3U0WL 3O8XC 3EDDA 1UFUA 1IQDA 2J4WH 3K4ZA 5FKAA 1CXHA 1G7QB 4BM7A 3DSFL 3U6RA 1S9WA 4MAYC 3MYJA 1S9KC 1AGDB 3LEYL 3OB0K 5D7LB 4XC1H 1WAAF 2HP4A 1FAIH 2P5EA 3OZ9L 3LEVL 2J88H 1A6TA 3BZFB 1MEXH 4GW1B 3T2PA 5EUOB 2NXYD 1ULVA 1X5XA 3S5LG 4OCSH 3QXWA 5IKCB 5I76A 3SCMA 3SE4A 3ECBA 3DVNA 4EUPB 3ZKND 2HTLC 1PFCA 1IGYB 3RIFF 5IJVB 4IOFC 5DUPH 4U6XB 3TVMC 1R24A 5D2NA 5J6HA 3G5YA 5I1EL 2I9TB 4IMKA 1OAQH 3N9GL 4WUUE 4JHZA 2E6QA 1FFQA 2LQRA 5D7IE 3RZWA 2Y36L 4NQCD 3MX0A 4LLYA 4P2OB 2V9TA 1D5BA 1YN6B 4TSBH 1JTPA 2ARWA 3VG0H 3UJIL 1JZ4A 4LPTA 2J4WL 1U8PB 1JF1A 4X6CA 4JRYE 3MCG1 1BGXH 2Y4SA 3ARGD 4P3DA 1Z5LA 2AXFA 4F8QA 2XOTA 4PJ5E 2GK2A 1I7RA 2XN9A 1R3JA 2D31A 4LKXA 2H32A 4HS6B 4OF8A 1LP9A 4UMGA 5CUSH 4XC1L 5FYLD 4WFGE 1FAIL 4MB3A 2J88L 2P44B 1RULL 1RIHH 1Q9OB 1Z9MA 1JWUA 4NCC1 5JXED 3MUHL 4OCSL 3C6SB 4I4WA 4KDVA 4F7TB 4ODXB 4PJIB 1U0QA 4D9QD 4X7EC 2Z91A 2FSEA 1XGQB 3QIUC 5SWZB 4NN6C 3HI5H 4PJGB 1KN2L 1D5ZA 3IDIA 5HYJB 3U7AA 2X41A 4OGYH 4NDMA 1A6UH 5DUPL 5J6GA 4Z5RB 1MAKA 3CZFA 4GRLC 5HDQH 3CX2A 1N8ZB 1U8QA 1OAQL 2F15A 5B8CA 1TQBC 3RNKA 1FNFA 3VA6A 4EI5A 3VG9C 5M7QA 2NY6D 2MCG1 1ETZB 1FPTL 4PJCF 4XTRD 4TSBL 5H37G 4IS6B 2FBJL 3KLHC 4LLDB 1LE5A 4HK3J 1BGXL 1FNLA 2AV7A 4RSVA 2ZNWA 1IQDB 2LABA 3ZDXF 3NFNA 4QXGH 5FKAB 4JQVA 4Q97A 2K7QA 3NZHH 5CUSL 4L4VA 4KQ3L 2VQ1A 4M02A 1S9WB 3U6RB 3MYJB 1JBJA 1J8HE 4RFOH 4DGVL 4P4RA 1YZZA 3QDGA 5HI4D 1NGXA 1X5FA 2P5EB 3EZ8A 3ZYIA 3OKYA 1QFWH 3CLEH 1A6TB 4NN5C 2WBJA 4LSVH 1N59A 4PJBF 2B1AH 3HI5L 5D7LE 5K9QG 5FYJU 4OGYL 2AEWA 4LP4A 5I76B 3SCMB 4J7RA 3ECBB 2I27N 3KG5A 1IGIH 5FCUL 3DVNB 5H8DA 5EUOE 3TH2T 1JTOA 3Q48A 4U3XA 1WWCA 5HHOE 5MI0B 1JHKL 4BFEA 4IDLA 1R24B 3MXVH 2WSKA 3OXRB 5D2NB 2AQ1A 1UJTA 3TT1L 5F8QC 2X10A 3WKML 2GW5A 3WIHH 5IBTL 3IKCB 1CGUA 1YPZA 1FL3A 4LLYB 4P2RA 3JVGA 2D03L 5EH1A 4U1KB 1ED3A 4JFDD 5J89A 3RTQD 4KKLC 2VLJE 3ISWA 4D94A 1JF1B 2OI9C 4QXGL 3MV9D 4NRXA 2YZ1A 5I71B 3BZEA 4P3DB 2AXFB 4JY4A 5B3JE 1I7RB 4TVPL 4M7LT 1R3JB 2D31B 4LKXB 2H32B 4LSSH 4RFOL 1LP9B 4XGZA 1P4IL 2UY6A 3UCRA 1JI2A 5JXAH 1S9YA 3SDXE 4ONGH 1QFWL 1KCUH 2EDFA 4XHJD 4PJ7A 2B1AL 2DRUA 2X89A 4PJ8A 1CD0A 2J8UE 4I0KA 4ZODA 2DLGA 1E6OL 3OQ3B 2Z91B 2FSEB 1IZJA 4A2MA 4F7MA 3DXAA 1D5ZB 5DUBA 3IDIB 1NMCC 1YYLL 4L8SA 4NDMB 4DQOH 5J6GB 1KTRL 1OCWH 2CDGA 4M1DH 1AR1C 1IKNA 3CZFB 3JWOC 4CMHB 4PRHA 5SWZE 3RNQB 4OQ1A 1U8QB 3K2UL 3LPGA 4HX1A 3RNKB 3WIHL 4F7EB 5F1SA 5HSFA 3T0ED 5F6IB 4CMMA 3GI9H 4PJ9C 4WV1C 1NMAH 2ZCKH 1BQUA 4J1UA 2Y06H 4XCYA 4LEXH 1ZTXH 4WVRA 1LE5B 2V5MA 4P2QB 4MNQD 3C6LC 1E28A 1FRGH 1S7TA 3V7MA 2AV7B 4FQHB 3QQ9D 1G7IB 4I2XA 3NFNB 4RAVB 4LSSL 1X5JA 4K8RD 1I8KA 2BCKA 3MRMA 4FXLA 4L4VB 2VQ1B 2EEAA 5JXAL 4ONGL 3TM6A 5IBLD 4RMWA 4A6YB 43CAB 4P4RB 2BOBA 1VFMA 1W72B 3MLZL 3EYQC 3PGDA 2VH5H 2WBJB 3BDYH 5D1QC 4L9LB 1N59B 1XF3A 2QV2A 1V3LA 1DEEA 3VMPA 3OGCA 4MQXD 4DQOL 1BJ8A 4YFDB 1OCWL 4JB9H 2J6EA 2X7LA 3HAEA 2WWKT 1N6QH 3R8QA 1X44A 2OSLB 4YLQT 1DBMH 4UT6H 4UUJB 3VFSB 4R7NA 1JRHH 1FBIH 1NFIB 1CE1H 3GMLB 1U3HD 4E41D 3GI9L 5H94A 1FLRH 2WV3A 4MCYA 4LFHD 1INEH 1CBVH 4LEXL 1ZTXL 1YPZB 2A6JB 5JLZA 4JRXA 4P2RB 2V5SA 4JRYD 1ED3B 3LKOA 2O26U 4LQFH 4G3YH 2X4SA 2XIDA 4YHOH 1YMMB 4NRXB 3BZEB 3ARZA 3RGVA 4JY4B 4U0RB 3AUVA 4XGZB 3OR6A 5F3HA 2HTKC 3F7VA 4B53A 1S9YB 5F97E 1ZLVH 2VH5L 3BDYL 4ZXBA 4OM0H 4PJ7B 3O3AA 2O5YH 4KPHH 1JZ5A 2YEZA 3D3VE 3V6OC 4ZYKA 4RMVA 4JZNA 5F9OH 2DD8L 4WUKH 1H8SA 3CXDH 4JZJA 2F19H 4JB9L 3TO4D 4F7MB 4Y0GA 5DUBB 1YNKH 3I9GH 4PREB 1N6QL 1TFHA 1MCFA 4L3ED 4L8SB 3ESVF 1DBML 4YK4B 5C92A 4UT6L 4LPYA 1FBIL 1CE1L 4LU5H 4PRHB 3QEHA 4ZOAA 4Z7VF 2NY1D 4HX1B 3NACH 4TQEH 3IS0X 3MLTB 4Z7UA 3HE6D 5D9SA 1YQ2A 5T1KA 4CMMB 3QRFM 2AGJH 3O45A 5J13B 1Q0XH 4XCYB 4LQFL 3T65A 1U8IA 1A4KA 4RISH 3H3KA 1QACA 2XYCA 3BPNC 1HHJA 2QADD 4F9LC 1E28B 2FH8A 1EVUA 2F8OA 4KRNA 4I2XB 1U8HA 3FO0H 1JI1A 1L0XA 1I8KB 2BCKB 3MRMB 4HF5H 5F6HI 5IIEB 2CK0L 1U93A 4P2QE 5INCB 3RKDD 5LVEA 1OTUC 4OFKA 1WQVT 5IB1A 2BOBB 4KPHL 4HH8A 3VGEA 4KKBC 4D9RD 3VFNA 1WTLA 5F9OL 4WUKL 1XF3B 5C86A 1BLNA 1DEEB 1YNKL 1FDLH 3DGCR 3I9GL 4S1RH 4HC1H 4LARL 3OGCB 4BQ9A 2X7LB 2BOCA 3HAEB 3H3PL 3LQAC 4KKCC 3MRLB 4MMXC 1ZT1A 4F15C 4R7NB 1OP5H 4TQEL 4XRCA 5FUOH 4YHNA 5CWSA 2R2BA 5TH2A 3VXRD 4GKSB 5TDPA 4WW2C 3VFGH 2AGJL 4MCYB 2XT1B 1Q0XL 4YBQD 2AEIT 2IAMA 4RISL 1SJXA 5EU5A 5JLZB 1EH9A 4JRXB 2QSCH 2VLJD 4JCLA 3CFCH 4GMSH 3LKOB 4XNUH 2X4SB 1J87A 1N7MH 1S7SB 4NJAH 3FO0L 1ZK9A 1WTGT 2Z8SA 3P11H 4P2RE 3RGVB 1KTLB 3GSRA 5F3HB 1I1YA 4WRLA 3F7VB 1CGTA 3WIFB 5E56A 3TZVA 1IT9H 1YMME 5GJTL 4FZEH 4DN4H 1CTNA 4ZXBB 1R5VA 2YEZB 1FDLL 1EHXA 1INQA 4ZYKB 4HC1L 5HTSA 1JFQH 4JZJB 3NA9H 5JW4N 4PJDB 4J3SA 2QJDA 1E4XH 4NOFA 4GRWB 3CU7A 5IEHA 4LCYA 4E42A 5F7WC 3MUZ1 5IB5A 3WEXA 1HYSC 3QEHB 4NKDA 4DTGH 4JGMA 4OF0A 1C7SA 1ZLWK 2BK8A 5FYKE 4ZO9A 3ZT6A 5TDOA 2R2EA 4BFBD 4Z7UB 5D9SB 5T1KB 5CJBA 2QSCL 1BD2A 4XBEH 1A6VL 3OX8A 3CFCL 1JE6A 4GMSL 3PP3K 3QG6A 4P5TC 4XNUL 1MCWW 1ZT7A 2I07A 1U8IB 2R8SH 4NJAL 1EJ6A 1UWEH 4HGKC 1HHJB 1T2QL 4CAGA 3BKYH 3INUH 3WJLA 3P11L 2VN4A 4PJHE 5HPMA 5KSBA 4W4OA 3AVEA 5IVNA 4DOHB 1XCTB 1A3RH 5I8KH 4K07A 3U30B 1G9EA 4O2EB 1JV5A 4XWOC 2YN5A 1T04A 4FZEL 2V2TA 5IB1B 4I2XE 3FL7A 4JFXA 2L0DA 1WZ1H 2YKLH 4JAMA 3VFNB 1IM9A 1A1NA 1DQMH 5GGSA 3AY4C 2NR6C 3NA9L 4NUGH 4NQCA 1DL7L 3RY5A 5ICXA 2HTLD 1E4XL 4W81A 3LKSA 1ONQA 3MODH 4NM4H 1H3UA 2BOCB 5KJRH 4LKCA 3ARGA 3UTOA 4J3XA 2A6DA 4GH7B 1ZT1B 4QGTA 2ATPB 1S7UA 4N8VB 4XRCB 5I9QB 3HG1D 2R2BB 1L9NA 5CWSB 1Y0LA 5TH2B 5TDPB 2RAMA 1AGBA 3STZA 4XBEL 5FGBC 5L0QC 1PQZB 2R8SL 1CL7H 5EU5B 1UWEL 5JXEA 1V8HA 3OPZH 1I7UA 3BKYL 3INUL 1SVZA 3ZT5A 3WDIA 5BQ7A 4JKWA 4YHZH 1DBAL 4I13B 1A3RL 5I8KL 3DVGA 1MCSA 2NTFA 1Q94A 4KZEH 3JSSA 5E2TH 5T3ZL 3RWCA 3GSRB 3OJMB 2XG5A 4TULH 5HI5D 1I1YB 1CLZL 4ODSH 2XTJB 3O6FC 3RDTB 1WZ1L 5EBMA 2YKLL 3KPQA 3STBA 3HHRB 4RGMC 2ZUVA 2YOCA 3GMOA 4NUGL 3P9LA 3EGSA 1R5VB 1KB9K 5CGYD 3MODL 4APQA 4NM4L 1OAZH 2E9JA 4QO1A 5IESH 5IEHB 4LCYB 4E42B 2WQ8A 4RA3A 3O6KH 1T22B 1TCRA 2VITA 4HW6A 4EUPH 4QEGA 1MVUA 2GFBB 3K8KA 1A7QH 1GGYA 4G8IA 4HGMA 4NKDB 4PJDE 5D71H 1R5WA 1LGVA 1Z3GH 4GRWE 4Z7WE 5TDOB 3ZL4H 2R2EB 3KLHD 1CL7L 2E9IA 2PCPA 4QWWC 3IAPA 3OPZL 1BD2B 3AXLA 3HTLX 4XAWH 3OX8B 5F7LB 4F7PA 3GSUA 2W07A 4YHZL 1A6AA 1K4CA 1P2CA 2GSIB 4WWID 4KZEL 4GBXC 4LCIH 5HPMB 4M93C 5CD5C 5KSBB 4KMTH 4YHYC 3VXMD 5E2TL 2YWYA 3WN5C 1LE9A 4PLJD 4TULL 4HWBL 4HWUA 1HE7A 4ODSL 2R15A 1NC4D 3KYNB 3OJDA 1E4JA 3ZKMC 3WS6A 2V2TB 5J7CC 1WIUA 4JFXB 3JV0A 4MVBD 1CGXA 2X1QA 4DOHE 4K7FA 2YC1A 3MV11 1IM9B 4XBPA 4IRSD 1A1NB 5GGSB 1G9NL 3F58H 2Q8BL 3CIQA 5ICXB 5AAWA 1MCHA 3AS1A 3PJSB 4NRYA 2BXZA 1ONQB 2ADFH 3PWLA 1QR1A 3PWNA 3RTQA 3O6KL 4DUXA 4LKCB 2R4SL 3ARGB 5D71L 3BPCA 1A7QL 5FO7A 2A6DB 1Z3GL 4L3AA 1S7UB 3MNVA 3GRWH 3VD7A 1CTOA 1Y0LB 2E27H 1AGBB 15C8H 4CJ0A 4OLYH 3O6MH 3QWRD 3SKMA 3HMXH 1KXVC 4KKLD 5DC0A 4WWKD 1I7UB 4G6AD 2A9MH 1J0KA 5E6ZA 3OMZA 4LCIL 5BQ7B 4G80A 3RWHA 4OUOA 4MA3A 3BH9A 4KMTL 3DVGB 2J12B 2NTFB 1Q94B 1KF9B 1SJHA 3QQ3A 3RWCB 3MLWH 4L1DA 4FTVB 4HJ0C 4MWFA 1EFXD 1EIBA 3UDWC 5EBMB 3KPQB 3GMOB 4GQPH 3BISA 3T0EA 3Q6GH 3HC4L 4Y5YA 5TE4L 2BHZA 2NY6B 2QQQA 1OSPL 1PAMA 4U6YB 3EGSB 4OZFB 1IBGL 3DNKA 5IMLA 3F65A 2ADFL 1A47A 4APQB 1AR1D 3G6JA 5D72L 4MNQA 1OTSC 3VXUA 3UJJH 2VDKL 3F5WA 4FXKA 1TCRB 4ZAKD 3GRWL 4Z18A 4FP8H 3I3BA 2AEPH 2FWOA 4G8IB 15C8L 5EU7E 1R5WB 3SO3C 5EUKA 3S9DB 2PCPB 3RZCD 3CDCA 3V5DA 1I7ZA 3QUKB 1UT9A 1HHHA 5E6IC 2A9ML 3VD4A 2W65A 4C55A 4CN6A 4RBPK 1JGLH 1KCLA 4F7PB 1AXTL 3GSUB 4MLIA 4NFBA 1HILA 3ARTA 1A6AB 1K4CB 2VUOA 1P2CB 3MRKA 1MPAH 4O02H 4EQ3A 3MLWL 2HMIC 2EIBA 4RQQA 2BVTA 3JUZA 4UQ3A 1B6DA 3QUYA 4H20H 4RBPH 3EYQD 2H32H 3OJDB 5KSBE 2J1KA 5CILH 2XXCB 3Q6GL 4DEPB 4PJEA 1U92A 4E41A 1MJJB 1M71A 4K7FB 2YC1B 3ZDZE 2AS5M 1U2HA 4UTBL 1NH6A 4PR5A 2XZCH 4XBPB 4WI3A 3MRNA 2EDJA 4KHTH 4AY0A 2X1WL 3RJDA 2L7UA 1PX3A 3L9RA 1T3FA 4PG9A 4NRYB 3KGRA 4I5BB 3PWLB 1QR1B 3RTQB 1SYVA 4QRRE 3M45A 4FP8L 2AEPL 5FO7B 3LKRA 1KGCE 5E4EC 1QVOA 4I77H 3QPQC 3MV8E 1PLGH 3N06B 3MNVB 3QR2A 2NCMA 4FOMA 5HVGB 4Y1AA 3L3KA 1IGTA 3SKMB 4TNVF 1MJ8H 4XWGH 1CVRA 4KROC 1R3IH 1MPAL 4G80B 3RWHB 4MA3B 3BH9B 4WO4C 5LXGH 2GJZA 4O02L 3TO4A 2HTKD 1SJHB 1I3UA 3QQ3B 4NC1C 4M6OH 4H20L 5BCAA 1CDUA 1H9VA 1KIPA 5DQDH 4WGVB 1BQHG 4MWFB 3F12A 3LQMA 4OZGA 3V4UH 1REIA 4A6YH 1CGWA 2XZCL 2JK5B 4R26H 2BMKB 3T0EB 4Y5YB 3HE6A 4KHTL 2COQA 4DZBA 1I1AC 2Q87A 1W72H 4LCWE 4EQ2A 5IMLB 1NUGA 4FTVE 1W8OA 1KJMA 1N5AA 4NZUH 4XVSH 6FABH 1KFAH 3FT2A 2HRPH 3G6JB 5MENE 3QUXC 3VXUB 4TRPH 1ZA6A 3F5WB 4FXKB 2VDPH 3RL1A 3HNVL 1PLGL 5IJKA 2VZUA 1TZHA 2JJUA 1FHGA 1LNUA 2A2QT 1I1RA 4ZUTB 3ZLQC 3LY6A 4XP4H 5EUKB 3SDCA 4F7CA 4DUWA 1OD9A 3V5DB 4OCNC 1I7ZB 1HHIA 1GC1C 1HHHB 5T33H 1R3IL 1P1ZA 3PQYA 4UNVA 4UZGA 2VXUH 1HILB 5IBUB 7CGTA 3MRKB 2D0FA 5JIHA 3G9VA 5HXMA 2APWA 2IQAA 4PTTA 5DQDL 3IDMA 4JFOB 1P5UA 4NSKB 5BV7B 3TYFA 1KIRB 5T5NF 3V95A 3O3BA 3JV4A 3QUYB 1VFAA 3ARDC 3QAZC 2CD0A 4R26L 1CXFA 2DQDH 3VXRA 4PJEB 1U92B 2CRYA 4E41B 2K7PA 2Z8RA 3I3EA 2X4TA 4MA7H 4PR5B 3ARFC 4XVSL 5FGSA 3EW3B 3H42L 3MRNB 6FABL 3L9RB 5GRJH 4TRPL 1T3FB 2IAND 4NKMB 4PG9B 2UZIH 4QHUB 1X4YA 1SYVB 2VZTA 5FYKH 4OFPA 4XT1C 1T83C 1QVOB 3NABH 4O00A 4XP4L 4DN3H 1LK3H 4Y1AB 5T33L 3L3KB 1IGTB 1ZLUH 1XIWA 3QEUA 4OFYD 2VXUL 3BPOC 4R0LC 5F7YC 1HZHL 2FHFA 4FG6C 1ZGLP 3EO9H 2GJZB 2YHGA 1QO3A 3BX7C 2GJ6D 2ADJA 3CDGA 2IQ9L 5LG1A 4G42A 5HGGS 3QZWB 3DLQR 2DQDL 3ZDXE 2ATKB 1QFHA 2BVEA 2M2DA 3F12B 1T03H 2QQLH 5B21A 4P3WA 4OZGB 4MA7L 1H0DA 4BKLA 1J8KA 2VQTA 5IW1A 5IROA 3HE6B 4DZBB 4ZUVA 3EUUA 2Q76A 4ZSOA 1M4KA 5GRJL 3SGEH 4XBGA 4LHUB 1N5AB 4CVWA 3O8XA 2UZIL 5A1AA 3RY4A 3FT2B 5DZNA 5TGBA 3G5ZA 2Y23A 1ZA6B 5HVHB 4ETQB 2PF6A 1RUQH 3RL1B 2EZ0C 4MAYA 2J6EH 5CGMA 3HAEH 4X9HA 2Q86B 4DN3L 1TZHB 4Y5XC 2EE2A 3G6JE 3OKEA 3UTQA 2APVA 2AERT 1LNUB 1X3DA 3ALXA 4HAGA 3X3GL 5KVDH 4P5TD 3SDCB 4F7CB 3O81A 1A7OH 1T5WA 1MFBH 1HHIB 3ARWA 1P1ZB 2NY3B 3PQYB 5IWLC 3EO9L 2VWEC 4X9GA 3TBVA 4PIRF 3IKKA 4M43L 2IQAB 4PTTB 5HBBA 5I19H 4XPAL 3TVMA 1C5BH 1CXEA 4QHMA 3TYFB 3GIZH 3ZYJA 3ULVE 2ENSA 3O3BB 1T03L 1VADB 3JV4B 2GK0A 1VFAB 2QQLL 1II4E 2AK1L 5T1DL 3FONA 4WCYH 3TBYA 1QQDA 4EN3D 3HG1A 1I8IA 3VXRB 5ETUA 2G9HA 1T1WA 3G6DH 3B9DA 3FO9A 4Q7DA 1I85C 5DO2C 3N0PB 5DUMH 2NX5D 2XZQL 1RUQL 1KGCD 4R2GB 2J6EL 1EZVY 1PEZA 4ONHA 4GRWH 5F9WB 1FC1A 3MV7B 4BA8A 5KVDL 2OK0H 3VW3H 2NY5C 5A2LH 1A7OL 3WFCH 5GGTA 3KPNA 2H2SD 4OUUA 3DURA 2D7TL 1XIWB 1I3VA 1FAKT 3PWPD 1B9ZA 3QEUB 3EDEA 4EDWH 3CPLB 4KQ4H 3ILQC 5HYFA 1UWXH 2OX5A 2WWKO 3CFEB 5I19L 5SV4A 3QDMB 2KPNA 1C5BL 1QO3B 4GRLA 3GIZL 3R8BB 2ADJB 3CH8A 2HFEA 1HH9A 4WCYL 4G42B 1MJUH 4XXCC 3RUGF 3WDHA 4WTZA 3G6DL 4LCWD 3P77A 5C0AD 3U48A 1H0DB 3SKUD 3H7BB 2PO6C 5DUML 3WBDA 4ZSOB 1RHHA 3BJ91 4XBGB 1HN1A 1YDPA 3O8XB 1IEAB 2Y9RT 3NAAH 5TGBB 3SDYH 3G5ZB 3V6BR 3VXMA 4MAYB 3QA3A 2WINA 4FZ8H 4IOSD 3BH8A 3OG4B 2N1KA 4F58L 5FFLA 4KTEH 2DTMH 3OKEB 3UTQB 3WFCL 5JA8B 3TPUB 1NC4A 1CD8A 2X4PA 4O5LH 1D7FA 4OFDA 3O41A 3S88H 4EDWL 5DJ8A 3QJHA 5CD5D 3IGAA 4MDJA 2D4FA 3TBVB 1T7XA 5IUSA 4UBDC 3T0AA 3TVMB 4QHMB 1MJUL 4O9HL 3FB6B 5CKAA 4IEFB 2FEEL 5I30H 4U1LA 2GK0B 1P7QD 3HCVA 5HJ3A 5HGBA 3FONB 2VOTA 1XR8A 5HHXH 3TBYB 1RSFA 1CLOL 2DQGH 1QQDB 5E5MA 3HG1B 4HBQA 1I8IB 5ETUB 3FZUC 1T1WB 3QULA 4KHXL 1PY9A 3K7UA 3QWRA 4KC3B 3FO9B 5DD6A 1I1FA 3NAAL 4M03A 4YXLH 3NTCL 4FQCL 4FHBD 4OQTA 2EIZB 3DV4A 2KUTA 3V0VA 3QJFA 1NBYA 4AEIH 4YBHA 5E00A 3FQNA 5I74C 4FZ8L 4ONHB 4YDIL 5DMGC 3TA3C 3LSOB 5JOPE 3EYFA 4OF7A 4NQEE 3TC9A 2QEJA 5FOBA 1EUTA 2AJZA 4LDLB 1WBYA 5GSVA 2AJUH 1QPXA 5BS0D 1EFXA 1A0QL 4P2CG 1JJUA 4OUUB 2VXVH 3DURB 4NQXA 4UV7H 4ZO6A 4AH2B 3MV7E 4AEHH 1WUNT 2VZ1A 3QIUB 2E9BA 5HYEA 1XFPA 1U41A 3H2WA 4NQTA 1G7LA 3EOBA 2UZYB 1QRKA 3DETD 3M8OH 2GCYA 4GRLB 1T80A 4HJ0D 3CK0L 5I30L 3ME0A 3O2WH 1HHKB 1TQBB 2HFEB 5HHXL 3VG9B 2DQGL 3HFMH 5EZOH 4OAWA 4U05A 5JNYA 1WISA 3QDME 4HDIA 4JM2C 4PJ9A 1HH6A 4WV1A 4F37K 1HHGA 3P77B 2E9WA 2FYYA 3CLFH 4DUVA 3PABB 4X4MA 4YXLL 2NW2A 2AEQH 2OLDA 5IFHH 1OTSD 1RHHB 3C6LA 5HHPA 1T2XA 1K2DA 1EMTH 1YDPB 1ZWIA 2Q8AH 3NN8A 4RX4A 3TWCH 1GIGH 4ZPVA 5CFHA 2ZCLH 4MZ3A 3HUJF 1DN2A 3VXMB 3ULUC 4B41A 2WINB 3BH8B 5I8EA 3BW9A 3SY0A 3WV0A 1DLFH 1XAUA 2A6IA 5E6ID 3RX7A 2L4OA 1NC4B 1S9XA 2H1PH 2VXVL 2X4PB 4NN5B 4Q6YA 5D1QA 3ILPB 4AEHL 4W6WB 3O41B 4MB4A 3PNWA 4N0RA 2ITDA 5KBNC 4EIZC 1ACYH 1W0WB 1U95A 3HI6L 1HINH 1SYSA 4YQXH 3WS3B 3M8OL 3IVKB 2B4CH 3N85H 2GQHA 3RVVC 3G04A 1YNTB 1RZKC 2YA0A 3LIZH 5EZOL 4UB0H 1TNNA 4U1LB 3MXWH 3HCVB 2BZDA 5HJ3B 5HGBB 3CLFL 5E5MB 3UBXA 5B39G 4X4YB 1R0AL 2AEQL 1TJHH 3QULB 1AD0A 4NGHH 5DD6B 2Q8AL 5FGCB 5IMKA 1I1FB 2OI9B 4OZFH 4HKJA 3DV4B 1CFSA 2VDOH 3QJFB 1NBYB 1WZKA 2VR5A 1NGPH 5E00B 3FQNB 4KK8C 4UI2A 4Y4FC 2X9WA 1G7JA 2R4RH 3U4BL 5D6DC 3REWA 4BQ6A 1JMXA 2AKRB 3EYFB 5KTEL 2B20A 2H1PL 5FOBB 1TETH 2AJZB 3IF1A 5FYLL 2UWEF 1EFXB 3V6OA 4KI5F 3PUCA 4NQXB 4U3HA 3VFPA 4U1IA 1HINL 4HIIA 4U2ZA 4HT1L 3CX5J 1X7QB 3FN3A 2G60H 4GW4A 2B4CL 3W82A 5ADOH 3N85L 5GZOD 1NMCB 2NQCA 4RGOL 3QXDB 3TGXA 5A2JH 3JZ7A 1G7LB 2VUYA 3WHXA 4KJWC 3C2AH 3NIDF 2JB6A 3IDNA 4UB0L 1VPOL 1FNGA 1Y6NR 3MXWL 7FABH 3CFIC 3U82B 2YSSA 3GUTA 2BSTA 4OAWB 2OP4H 3QI9D 5JNYB 5J11B 1I1AD 4HDIB 5A2IH 1P7KB 1TJHL 3FQWA 1HH6B 4PJ9B 4RZCB 4WV1B 4LK4A 4Y89A 5AYUH 1HHGB 4NGHL 1I3RB 2H6PA 5F6HJ 3GFUA 4QRPA 5A3ID 2ZG3A 2NW2B 4F9LA 5FO8A 1I9RH 3BT2H 3C6LB 1ORSA 5HHPB 1JGDB 1HSAA 1K2DB 5L9DH 2VDOL 5HHMB 3B9KC 1ZWIB 3NN8B 2XV6B 1NGPL 4MXWH 4RMUA 3KNBA 3FB8B 2VDNH 4ZPVB 2R4RL 3K46A 5ACLA 4Y19E 2YD6A 4S2SA 1RY7B 3MQIA 4YDJA 3S36L 1TETL 2VDQH 5I8EB 3BW9B 3SY0B 5DVLA 4P3CH 1FP5A 4YFLI 1S8DB 4U1SA 1S9XB 1A3QA 3HI1A 1BVZA 5D1QB 3QBTB 1J1XH 1E27A 4QLRA 2VLME 3PNWB 2ITDB 2G60L 4GXVH 1GHFL 1ZKAA 1OQXA 3ARVA 1BZ9B 1SYSB 2DQEH 3FFCA 1X5GA 1LO5A 5CBAB 3K1DA 3C2AL 5C08D 1EPFA 4FQ1H 3HPJA 2IANA 3QWOA 4XI5D 5CZVL 4XNZC 4U1JA 7FABL 2FO1A 3G04B 3ARDD 1F8TH 4U33A 1ZE3C 2YPLD 5JW4R 2EECA 3CMOH 2OP4L 1UACH 4WW2A 5EULV 1FZMA 4KFZC 5FUCC 4N1HB 5J12C 5AYUL 3ARFD 4M1CD 3WNLA 1Q9WA 3BEWA 4M6NL 4PY8I 3KYAA 3HS0A 1TIUA 3BT2L 5JORA 3MJ8A 2EDLA 5SWQA 2QHRH 4MXWL 5IMKB 4OFYA 1MLBB 1KPUA 2NNAA 1UXWA 3IFNH 4HKJB 4UT9H 3VGAC 1CFSB 43C9A 3UZQA 3IS1X 3SO5A 3HB3C 3O4LD 1B0WA 3ABZA 1ZHLA 2XG4A 2VDQL 3REWB 2EKSA