5DHMC

Crystal structure of the fimbrial protein mfa4 from porphyromonas gingivalis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
282
structure length
268
Chain Sequence
ERNQGSAAERLITNLYLLLFDQSGANPAKYYIAGNTFIWLPDDMKVKLDMTQSEAGERKVYVVANVDNAVKTALDAVANESDLQTVKRTTAMPWSTDIASPFLMSGNKTHDFLANRLLDNVPLVRAIAKVELNISLSEKFQIVPIIVNGSLSEFKFRYVNFDKETYVVKPTTKPDNLISSANGVWPQITDWTVWGASLNTSPAPDAGTGYTLDANGKVTALRIVTYLNERDSKGATVEVALPRGPELYRLPLPDKILRNHWYKYEVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Immunoreactive 32 kDa antigen
publication title Structure of the fimbrial protein Mfa4 from Porphyromonas gingivalis in its precursor form: implications for a donor-strand complementation mechanism.
pubmed doi rcsb
source organism Porphyromonas gingivalis atcc 33277
total genus 67
structure length 268
sequence length 282
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dhmC01
4GPVA 3UP6A 4JG5A 4RDBA 4JRFA 5DHMC 3R4RA
chains in the Genus database with same CATH superfamily
2WNGA 4Z7VE 3S35L 3EOTH 5K1JA 3WTUA 3UZVA 4NZRL 3X17A 3UBXB 4I48A 3KLHD 1CGVA 2J6EH 4KY1H 5CJ8A 5FWQA 3TF4A 4BJLA 3KG5A 4QJ5B 3AY4A 2X9XA 1AOHA 3PE9A 5SWSE 3RE0A 4M6AA 4OD2B 2G75A 3SOBH 1LDSA 5CZXC 2K3TA 2V2TA 1NLBH 3QGVA 4DNLA 3QYMA 1RIVL 3MN8A 4YAQB 5DK3A 5IUCA 3ULUE 3K80A 5IEHA 1AS8A 3KWTA 1CLYL 3IBOA 2AMGA 4G6MH 3DWTA 1A7QL 1E2VA 1AO7A 4K71B 4UAHA 3WHXB 4HHWA 1JNNH 2D9QB 2DL2A 2CM6A 3BVTA 3WTTA 1NLDL 5AKVA 3UCRA 1A14L 2X4SA 2YXVA 3FOLA 5FOJA 5HGAB 4AGQA 5C0FB 1ZLSL 3LQAH 4TSCL 4BK4A 1QACA 5J11B 3ZKSD 3K6IA 3RDTB 3DX2A 2X2YA 4KK8D 3DA0A 2DMKA 5ECJE 3MRDB 3VXRA 4YHZL 4NIYE 5DXWA 4JDZB 2MNJB 4H8HA 3EYVB 3J7HA 5SWZD 4DGYL 2CXGA 3GGWA 4ZS7L 1FA4A 2AXGB 2D0GA 3UDWC 1QEWA 2GITB 3DJTA 4WSKA 4YFLI 1T20B 1U8PA 1CBVH 1PQZB 1QLRB 2AQQA 3ZMRA 3QJXA 1IZKA 4QYOB 4XAWL 2X4UA 2SEBA 1CD1A 1PZ3A 3QUMA 1SOQA 4G8EB 5INDA 1T1XB 3FCGA 1NC2B 3FU3A 3BPNC 3TFKD 1AD0A 5T1LD 1MH5B 4MB5A 2X10A 3ULUL 3EJUA 9CGTA 3RUGA 3LNGA 3QEQD 5JMOC 1EXGA 3C5ZB 1A7OH 1QBLH 4AJVA 1EZVX 3VWJA 5A2BA 3CLFH 3UTTA 3K0WA 1JZGA 2BNRD 1DEEA 3EO1A 3UC0H 3OJ2C 5B21A 3F7YB 2I32A 3STZB 3VFOB 5C0BB 4F7CB 1U4EA 1ITBB 1XEDA 2ZOUA 3KEHA 3PNRB 2JI3A 5D2NC 2VQ4A 3UO1L 2ZX6A 1A0QL 1N7ML 3FCSB 2DTMH 4AVIA 5PAZA 4P57B 3MJ9H 3DRQB 2Y5TA 5HHXL 4GUPB 5A40E 3J07A 4L0PB 5H35A 3ZE0B 2CHDA 3UMNA 1Q72L 4W1TA 1CVSC 1DZBA 3FUEA 5C08E 3INUH 3LKNB 2YBRB 5D7IB 3CVIH 3D9AL 2H2PC 3PHOB 3VTMA 4PS7A 5GGTA 5KVGE 4ZYKA 4NXSA 1TEYA 3V0FA 5KW9L 4YEEA 2RCSH 3UIZA 3VXQB 1FL5B 3C08H 4WI6A 2AERT 5ESAA 4OGYL 3ZDYE 3O4LD 5JUEL 1JG9A 1MOEA 4FLOA 1OSEA 4WUUA 4YMPA 4F8TA 4IEFB 2AZUA 3K8MA 5CD5D 2Q20A 4WFFE 4Y9BA 4PJXB 1ZHNA 3T0VA 4N90D 1YNTF 2XCMC 3G5YB 4HSQA 2QVTA 1A6AA 4JE0A 1SEBA 1PIGA 4OSUL 5AAPA 2GT9A 4UWQB 4JPIA 3HI6L 1U9KA 3ECBB 4Y1AB 4PJBF 1I9JH 5C0GB 3COOA 1EHLH 1WCBA 4EDXB 3PF2A 2XWBB 2W9DH 1DN0B 3NTCH 4N2MA 4JPVL 5LAPA 2FBOJ 2HT3C 4K7PH 1UVQB 2CZNA 4W9HC 1NEZB 1KB5L 1N67A 5EOCH 3QVAA 3FOMA 2CGZA 3MX0A 3FUKA 3IF1B 2Z8RA 4XN1A 1RHHB 5L2KA 2B3RA 2VDNH 1E7UA 1PY9A 3L3GB 4TNWK 1TENA 1S7RB 2VRAA 4WV1C 3RYMA 1X9UA 4IU2A 1S7XA 3ILPB 3VA2C 5IESH 5F9JB 1YEKL 1YPZB 4X7DC 3TEUA 1JP5A 2XBTA 2FATL 4GQPH 4LVHB 4Q4IA 2B1OA 5J3HC 5B1JC 2B20A 2X87A 1JMXA 5ACZA 2VUKA 1H8OA 4KKPA 2CR0A 3JV5A 2GEEA 4PCTA 4D7BA 4G43B 2ZCLH 1UM5H 1KZQA 4ZMZA 5KVDE 3E8UL 5C07B 4PRPB 3LQAC 3SJVE 4X50A 2IOMA 3GDCA 5T3XH 3MVSA 4JO4L 2ADJB 3BLBA 3FSOA 4N8UA 3UTSB 1S3KL 1HXMB 5I71C 3Q9QA 1LXMA 2C9RA 2ENPA 1Z0NA 3QUZC 2VZSA 5HJ3A 2FYVA 2ICWJ 2B14A 5FO7B 2Q6WB 2P3YA 3ZQXA 5I1HH 5BO0D 2HJLB 2BVYA 1G7PA 1XGZA 1TZIA 2WCPA 4XVUC 1KGJA 2V3FA 4X6CF 3FF7A 3NCFB 4B7LA 3RGVA 4AG4L 1SFHA 2PPFA 1P5UB 4KX7A 3A21A 4GRWB 3OHXC 1FVEA 3R18A 4JL2A 3FCTA 4D9QE 2FD6L 4L1LA 2H1XA 2EP6A 3FJTA 4OZHB 2HMIC 3QDGA 2JMRA 5ANHA 4O2FA 1DYZA 4A7SA 4H0GA 4H2CA 4L18A 3O3DB 1HQRA 2CRZA 2EKSB 4H40A 4HX1B 2IPTL 1IIKA 3ZKXB 5KVDL 4ONFL 5AQ0A 3GRWL 1QLFA 2IWEA 1AMXA 4BELD 4GKNA 3OXSB 3NRFA 4MXVF 4NNXA 4Z7WF 5ID1A 4Y4KA 3V4VA 5JHAA 5C0NC 4HALA 3NP4A 5DJDB 4PJ7E 5BZXA 2GUOB 1J12A 2EO7A 4FQLH 5EF3A 3U7AA 3BH9B 4MSWA 5JHDA 4O2CA 5FLUA 3BPLB 2BCKA 1CO1A 1ZANH 1GGIH 4QY8B 3VYPA 1JZJA 1TQCB 2OYLA 1GGTA 4NN5C 4YFEA 1B3IA 4X9BA 1T6BX 3R06B 2AVFA 5K9QI 3U0PB 2FX7H 2ZWZA 4OIAA 3DX0A 2GK0B 2GJ6D 5E00A 4F15B 5I6MA 2YN5A 2N7AA 2K0RA 1MPAL 1MXDA 2EE3A 4XBGA 3KMDA 1I85A 1VEOA 1MFBL 1EO5A 3IFOB 2DB8A 4JY5L 5AW2B 1CLOL 4AQ8C 4H5SB 3HMXL 2OAAA 5CCHE 3VD5A 1KPVA 3MRNB 2PP7A 3SDCD 1JZ3A 4DTGH 4KQ3H 4FG0A 4AT6B 1RPKA 2WGNB 4XPHH 2DWEB 2YAMA 2VLLB 2D7OA 2F18A 1OCOB 1WUZA 2X9WA 4L3EA 2ED6A 2Y06H 1FLRL 5DU7A 5B3NA 4LHUD 4PGEB 5EZLA 1KLFA 3QG6A 3THMH 4AX3A 1MI5E 3RAJL 1S46A 3PWUB 5KSUB 4XMPL 3QK0A 1FZJA 2F74A 2J88H 3GHBH 3L1EA 4QOKA 4JFYB 2OYPA 2GFBB 1SLUA 3PWJA 5DYOB 1S3RA 2F8VA 4YZFE 5GGQL 3G5ZA 3RTQB 3D39A 5DRXA 2CCVA 2AK4A 1X7TA 2HLFD 1FNEB 3AREB 4HLJA 3IXTB 4NLHA 4XPAL 4ERSH 1OOWA 3RZWA 4UTAL 4F8QA 2X3CA 1TNNA 2LQRA 3BPCB 35C8H 2ZXQA 2NYYC 2P43B 4M7ZB 1UD4A 3F00A 4PRIA 5DFVC 2H0EA 2DQEH 2P80A 1QPXA 4LL1A 4GO8A 3DRTA 3T6VA 4JM4L 1JGLH 3P2TA 5GSVB 3IKCA 3HC0A 5JOPD 1MZYA 2P8PB 4Z3IA 3G6JE 3MU3A 3V5HA 1CMOA 4JB9L 1CB4A 4CVXB 4BA0A 3D1MC 4W9FC 2NW3B 5EN2A 5ELIA 5GS0L 1T0MA 1PCXA 5BV7C 5I5MA 2Q76A 1NCJA 2PCFA 4G9FE 4KFZC 3FU5A 1HE7A 1U92A 4G80B 4PJ5D 3RNKB 1NEUA 1YUKB 3HNTH 2DWTA 4XPTH 1ODUA 2RGSA 1OK0A 1R0AL 3Q2LA 3REVA 2YOCA 3QUXC 4TOYL 4NKQB 3X1GA 1UA6H 1U36A 2Z8SA 4FXGC 1RZFH 2JF1A 2XJKA 4W93A 3AMKA 4J3BA 2WAHA 1UWEH 4BFBD 2V7NA 5D1XA 3PGFH 1GH7A 1NANH 5J1SC 1FORL 5I75C 4AYFA 1XHHA 1FI8C 1LK3L 2YD8A 1YNKL 3L5WB 2HJFB 4PLJD 1TETH 2Z35A 1ZXKA 4Y5YB 2OL3L 3ZDXB 1PFCA 4HUVB 3T6WA 4PJAA 3Q2VA 1EAQA 2ZWNA 1GGCH 1N8OE 5LNEA 1AHWA 4GSDL 3WY3A 5FO8A 1MCRA 4ORGB 3B56A 2VZUA 1NH6A 5CSZB 2CE6A 2HT2C 2FSDA 3NDZE 32C2A 3IB4A 3WFHB 7FABH 5IG7A 2DTSA 3HZ3A 3ZZ1A 4HVBA 4A7UA 2YUWA 3VUAA 1WD9A 3NIGB 5T1LB 3DVGA 4RRPM 4UU9A 4HJJL 1U8IA 3FQRB 3I85A 3BEVA 3BUIA 2IDCA 3QEQB 3LEYH 1J1PL 2E9GA 4K8RC 3OZLA 1CDJA 4NYLA 3MR9A 1E4JA 2O5XL 4G83A 2LABA 3E9TA 2Q7YA 5JDSA 2CK0L 4Y19D 3W39B 5FKAB 1HTYA 1NIBA 1WT5C 2FJGB 4G7QB 3VQLA 2DLTA 4K3GA 4PMEA 5DJYB 5C2BL 4HW6A 3BJ91 3KLAB 3CDFA 4R7DB 5J4MA 4IHBA 3ULVD 4G70B 3TIEA 5HI4C 2ZPKH 5DZ9A 5D2NA 1N5YL 2K8MA 3IDJA 1LK2A 2J12B 4FZ8H 3GB7B 4IRJC 3KH4A 6CGTA 4X5RA 1VZHA 1DVUA 1PD1A 3BZDA 4RGNE 3KLLA 3N6YA 5LBSL 4NI6A 3O6MH 5IW1B 3QARA 2ENJA 4CMHC 5D96C 5IKCA 2OMNA 2OKMA 2FR4A 4U05A 1XCQB 2WTRA 3ALPA 4J4PD 4Y16D 4ODTL 2IALA 4ZUVB 4N9OB 4X9IA 2Q0ZX 3WU1A 3O4LB 4K9EL 5TF1H 1AGDA 2UZYB 2Z4TA 1ZLVK 1PX4A 3F12B 4QIRA 4IK7A 2BNQE 2ZX7A 3UACA 4ELKB 2J7LA 3WEBA 2H0PA 4JDTH 4YC2B 5CSGA 3DX8B 3O6FA 4C56A 5IM7A 3F2LA 3LRMA 4RWYH 1JZEA 3MA9H 5ID0B 2J5LC 5IV2A 3G5XA 3LMJL 4UTBL 3PJLA 1I4FB 5B8CB 1R6VA 1VFOA 4MTMA 3FQYA 1KPUB 4YHYC 2OZ4H 3WXWH 2ZCKH 4Y8AA 2J1ZA 1MFMA 3MBED 3A6OA 3D12B 2LT9A 1HESA 3LTVA 1UM6H 4L05A 2E4TA 2CKBB 4BSWA 1O9WA 7PAZA 1FFPA 1J05A 1YYCA 2KKQA 2O26U 3B8YA 2JXMA 4FLQA 3EFFB 2XWTA 4I2XA 1U93B 3GNMH 3T3ME 4OKVB 3RWEA 1ZT7A 3ILDA 4UQ3B 4WV1A 3QI9A 2FUTA 3JT2A 2QZ5A 4PRHA 4BK8A 5A3IC 3GMNA 5FKPA 1E67A 4H0IA 4PQXA 4LVNB 1O7DE 1E28A 3BLPX 1BFSA 3HI1A 3CFBA 4HKZA 1X5JA 3FTXA 4EUPG 2X4TA 1KCRH 2VDPH 1E9QB 3M1BA 1ZMYA 3LIZL 4GYBA 4K23H 4I9XA 5IJBC 4ADGA 2JB6B 2DS4A 2XICA 4YHLH 4XVTL 3LY6A 3MKKA 5C09E 3AQXA 4X99B 4PP2B 2Q2EB 3RY5A 4MAYC 3WJMB 4HEME 5CINH 4KKBD 4PCKA 3DUUB 1FAIH 4K3JH 4UV4L 1FZOB 3QQNA 2QV2A 1INEL 2X6CA 2YKKA 3HA0A 3ZT6A 1MCOL 3QUZA 4YBQD 5FF6A 1WFNA 3B2DC 1NDTA 1WC7B 4XMUA 1OIOA 5EULV 4X6FB 4NDMA 4C58B 5I1CH 3EZJB 3QYNA 3ZIYA 2QGCA 4KUZH 1WFOA 2G0KA 3D06A 2BVOB 2JLLA 4YZWA 3NZ8A 2ZAIA 4IS6B 3PAVA 5FB8B 2XRAL 4CJ1A 5KANI 2A0LD 3K3QA 2YR3A 3SGDI 3Q1EA 1CIDA 2MKLC 5L4IA 5HTSA 1BQUA 1OM3L 1FN4A 2NOYA 3UTQB 3C5JB 3GDBA 5TGBB 2EEBA 4DQOL 4EZLA 3BSZA 4HFUL 3DIVA 1OPGL 2NZ1A 1BBJB 2LU7A 4L8CA 4E42B 4N0FA 1YUHB 3QIUA 1NCAH 3OX8A 3QO0B 2GCYA 4KKAC 3JV0A 1WIUA 4U4IA 4NBYB 4IMLB 4LLVA 1SBSH 1U21A 4UT6A 4OZGA 3WFBL 1IC7H 5F9WB 1BQHG 2YAFA 4JL1A 3EOBB 5LAXB 1YEGH 4WEMB 3HNSH 4GRMA 4PGBB 4FQIH 5CU5A 5F6IB 1FO0L 5I1IH 3L1OL 5D1ZC 1T1YB 3HMWL 4U6VL 1Z3RA 2FH8A 2JKSA 3I50H 1CK0L 4M48H 2BVPB 3MACH 2GJ6B 1MVYA 3NFNA 1P1ZB 1YNTA 2JVUA 4R7NA 4XHJD 3L3HA 1CE6B 1AGCB 4XNYL 3GJEA 4YE4L 2BS8A 2CIKB 2BHZA 2MMXA 2VQUA 4G7YL 4AJYV 1HU8A 2OMUB 4ZFZB 4PJBA 4FTVB 1P7KB 3NIDF 1OT4A 3RVXD 3SDCB 3WIIH 1JVOA 4WGKA 1QFUL 5K1VA 4ANVA 1LP9F 3O3UN 3IGLA 4MJHA 4P05A 3AWGA 3VG0H 3VXSA 2HRPL 1MHPL 5DI8A 1XB6A 5AOMA 4XOBA 1AQKH 3H9SD 1HHJB 3DHJA 1ND0A 4NZUL 4RFEB 1ZKAA 4HUUA 3TYFA 1PDKA 2PPDA 3H2QA 2P5EA 1XGUA 3CVHH 4P5KB 5H37G 5EEVA 2BP0B 4QRRD 3UJIH 2C5DC 4JVUA 4QHUA 2ESVB 3IDGA 1CR9L 3FO0H 1TZOA 3OJVC 4PPTA 4FOMA 3FT2A 4PP1C 2CO1A 2DQTH 1VADA 1RJLA 1QLEB 1A7NL 2WIIB 3V6OA 1J0IA 3SBPA 4PW3A 4X6BA 1TQBC 1O75A 2GAZA 3O2DA 4NERA 4TPRL 3QFJA 3C09C 3PV6A 2YMTA 1J1OH 4WI7A 3V4PH 1OT2A 1DFBH 1JDCA 5MENE 3UTTE 2BHYA 1H3VA 3K72A 1X44A 2KL6A 3N9GL 3OPUA 4OZFH 3QQ4B 2Q10A 4U1KB 3QUYA 1D6VH 4FG4A 1YZZA 3U0TB 5IT2L 1FV1A 4PJHA 5FFGA 4F91B 2Y07L 2K7PA 1FAKT 3KNBB 1U8NB 1VDGA 2OJEB 5AALA 1GJIA 5JHMA 3WDHA 2JQAA 4EDWH 3A4FA 3EJZC 5IF0B 4HCFA 3T2PA 3CWGA 1MCNA 1CLCA 3RVTD 1XGQA 1NANI 4LPUA 1TNMA 1Z7JA 4POYA 3KW7A 3MBXL 1IC0A 2QSCH 4PJ5B 1RZ7L 1MWAH 1W72B 3NCXA 3VSVA 3NUKA 1H6UA 1D5MA 1UZ6F 2VLRA 4MQ7A 2CUHA 1OLLA 3HI5H 5E8DH 1RY7B 2H0JA 2R9HD 2VL5B 4WUUE 1OGTA 3V5DB 4YN3A 1ES0A 3RWCB 4Z8FL 4R97B 2ITDB 2A7BA 1MUJA 5GPRA 1CE1L 3N43B 4WHTB 2FHFA 4IDJH 1CFQB 4JFOA 4N6RB 4OD1H 5DZAA 3NJJA 1GVIA 4Q4EA 4L4VB 1CICA 2BERA 2EEDA 4WO4A 1HDMB 4PJEF 3S34L 2GTQA 1SOXA 4EXPX 3KZ8A 2Y69B 4P04A 1ETA1 2YLKA 4XI5C 5HGBB 1G84A 5CBAA 4OLYL 4GB9A 2WO4A 4GS7C 4HFWB 4U1LB 4FYRA 3UIYA 2EIMB 5DJ8B 3E38A 1KJMB 4OJYA 2X0WA 2C8NA 4F5CA 1MKFA 2XI9A 4P5TC 4N2FA 1JK8B 3CBKB 4JDVA 4DP2X 1H3GA 3HLAB 2HAZA 1DQMH 4GIOA 4GG8B 5GGTL 2WVSA 4OBSA 1TZGH 2EXSA 1AIZA 2PF6A 1DJWA 1IGCH 3I3BA 5I1GH 1RUQL 4OZIA 1N70A 5HDWA 1IFRA 3GYRA 4P9MH 3BZFA 4OQTH 4G82A 5TE4L 5I16B 4HQQH 4HUKB 3TBTB 1UEYA 3NZHH 4HS8L 3LKQB 2UX7A 5D1ZI 1RURH 3LRKA 3CFTA 4FA7B 4KBPA 1XBRA 4QTIH 1YYLH 3PL6C 5E99L 1WT5A 5EUOB 4G72B 1GSKA 4MMZA 5IMLA 4X6EA 4QKXB 4HBCL 4HZAA 3RG1C 4B9GA 5BRZB 2CAKA 2VMJA 2KH2B 4NJAL 2YMXH 1O9ZA 1BAWA 1R75A 4M1DH 3MRCB 1W15A 4LLQB 2ENQA 4GSQA 2ZSVA 2YS4A 5CR8A 3GK8L 1KCVH 5T5FA 2NZ9C 4LSQH 4WWKA 1J0JA 5L7XL 1Z5LB 5I18H 3LKSA 4Y16B 4ODVL 5AOIA 3VFVA 1MELA 2FT7A 2X4NA 4H25B 4MQTB 1DSYA 1I9IH 2CIIA 2VDMH 3HG1E 3NA4A 4X5XA 1J0HA 3GLZA 4NQVB 4NHCL 3VGHA 1JNJA 4J1UB 3JTSB 4MCZA 4AWJC 3EYFB 4K7PY 4LLMB 5KEZA 1T7YA 1OXYA 1I3VA 5HHOE 3U4EB 4HJ1A 1JRHH 1TZHA 2ZOOA 3QDGE 1WVZA 4PRNA 1MLCA 3U7YH 3WFDH 2YUXA 3HC4H 4HKJA 2NSXA 1FFNA 2DF3A 4AIZA 1AZVA 2P5WD 3MBEB 4MQSB 2R83A 1A6ZA 1UB5B 2IPKA 3EBIA 3PP3H 4YK4C 5GS1C 3HZKB 1DO6A 3IMWA 3FFCD 4ZUSA 1RMFH 2GC7C 2R0WL 5I23A 4ZX4A 1PEWA 3LKPB 3Q43A 1ANUA 1HX0A 4MB1A 5CXPA 5LCVA 5FUCC 3LX9A 4LBEA 2B59A 3U9WA 2B3IA 4F7EA 3ARDB 3VFUB 3SDDB 4XP1H 5EORL 4ONHA 1N64L 5D2LE 5HD8C 3HS0C 5CIPH 2O6FA 5IVNA 1T83A 1IGTB 4LEXH 5JR1H 5D1QD 2A77H 1YVLA 5CGMA 1HOCB 4UQEA 4N2KA 3QIBC 1RZ8A 3L3KB 3SCMB 1KTJA 2LFGA 4Y4HD 1S9WA 3FQWB 2GJZB 3M46A 2OQJB 3U36A 5IB3A 4NM8H 3GJFB 4PTUA 12E8H 5SWQB 1Z9SB 1J1XL 4JMXA 4K3EL 4PJ9B 3QIWD 3LNHA 2J4WL 2IADB 1I1AD 2BWQA 2BSTA 1CLZH 4MAYA 1J8HA 2YFOA 4RX4D 4CJ0A 5FDWB 1P7QD 5JORB 1GGBH 2D7MA 4IQHA 4IK6A 4I3GA 2F54A 3V4VL 4M93B 1VHPA 2Q9OA 3O2VH 5JPNA 3CSPA 3P1VA 1AIFB 1D7BA 3PWVA 2YPKB 1MVFA 4GW4A 4MLSA 3EKCA 1PCSA 2ZUTA 1YC8A 2X1XR 2PTTA 4JO1H 3VG9B 2GIMA 1AMYA 3EBAA 4L1TA 3BKMH 4Y5VB 4QTHB 3ORJA 2C3VB 3D39E 2CUIA 1BQHA 2D4DA 3GM8A 1ACCA 5C1MB 5JIDA 5JMRA 4E41A 1DJGA 1UH3A 2WMPB 4WEBL 3FONB 3P73A 2WKLA 5DJZA 4F2ME 3WIHA 5I6KA 4U7SA 5FYJU 1P53A 5I66A 1XH1A 4UOQA 2FGWL 5E08L 2UWEE 1F4YH 4FL4C 4HT1H 1OP3K 2OI9C 4KY2A 1QABA 1QEXA 1CGYA 2C1OA 3SYCA 2HRHA 5A7BA 5E5LA 1H5BC 4L4TD 3ARXA 2HCZX 4LL9A 3IGKA 3BDYL 2FJFA 3HB3B 3D09A 4XB3A 1EDHA 4KU1A 1VESA 3WHE0 5JOFA 1V3MA 2JWYA 1G4MA 3P4MA 5L6YH 4U1JB 2RB8A 1DBML 4FHBD 5E6IA 4Y2DD 3TEYA 1MJ8L 1VAHA 4L9LC 4PU2A 2XQBL 4H8WH 1EV2E 4DQAA 1SPDA 1XF4A 3DX6B 4EMZA 2W59A 2CRIA 3OB8A 1G0DA 2YSTA 5HYQB 2XA3A 1DUZB 3HFMH 1QSFB 4BYHA 4FQXA 4WF7A 4KJYA 3K81A 3UYPA 1DBKH 1T6WA 1X3DA 2AGJH 4N8CH 3LXUX 4PV9A 3M8OL 4OFYA 5E4EB 1LEKB 3GI8L 2OW6A 1BAGA 1W8NA 5F9DC 4AVKA 4JCWA 4LF3A 4UMSA 2FO4B 3VB9A 2XXFA 4X98A 1L0PA 3B4NA 3CH1A 1SJEA 4GY4A 5D1XE 2B7DT 4HKBA 4XH2B 5GRJL 5DD6A 3KYKL 2C4FU 3H9SB 1GW6A 4PJAE 3DYMA 1QR1B 1QSEA 1ZHKA 4P46B 1B9KA 5CEXA 5I0YA 3QEUA 3SBWC 2NY3C 1MJJA 4PB0H 2CBQA 5EEXA 1G7HA 4Z78B 3EYSL 2H6OA 3OKYA 4FFWC 1HT6A 5E8EA 1ZIAA 3FYEB 3TT1H 1UYWH 3UP1A 2A1WH 1YQVL 4Z7VB 1AD9A 1T0OA 4E9QA 1OHQA 1YEFL 2F19L 3LN5A 4FLRA 1MHEA 5ISZE 5DZPA 3S36H 4RIRA 3G3LA 4EIUA 1VFBA 4XB7A 3VCLA 2BSCA 4ETQA 1HVXA 5AAWA 5KYUA 4P2OC 5SWSB 1DVQA 2AABL 4UQIM 3Q2CA 2QQQA 4A6YL 3H7LA 3OKEB 3GIZH 2YEVB 1MQKL 1G6RA 3O0RH 2OYMA 3BE1H 5LG1A 5JQ6H 2XWCA 5IOPA 2C3HA 3PY9A 4OCLC 4NC1C 3V9CA 1WEJH 2N0MA 3IDIB 4PVNA 4W9ZA 1XGYL 5D2NE 1IAOB 5I1JH 4BFOA 1R5VA 3ARFB 2K7QA 1HL8A 2ADFH 3IFPA 2APFA 3ABMB 3ASOB 4FQCH 4TUUA 4KJPD 5ETUB 3W57A 4K7PX 4PI0A 3ZBMA 2Q3XA 3W81A 2APBA 4M7LH 5IVZB 3WOVA 1GAFL 1VERA 2RACA 2X4OB 4NQXA 4ODUB 1CFNA 4CU7A 3IGAB 2O5ZL 4Q2ZA 1TZ8A 3SBQA 1HE8A 5I24A 3S96A 3FFDA 1QTYT 2K8QA 4FS0A 1V5JA 2R1WB 3FQNA 3O6KH 1D2PA 2P24A 2YGOA 4M5ZH 1EFXB 1DVYA 4XP5L 4ZS6D 5EO9B 5AD0B 5C0AA 1GTNA 1IUZA 3E6FA 3A4AA 4JANB 3PG2A 2HRLA 1OO2A 1NIDA 3SDYH 3BKYH 2VM9A 3X14B 1IEAA 1BYOA 1FL6B 1N0XH 1JF1A 4P2RE 4C56E 2BMKB 2AXFB 1OAXL 2VN7A 2V5SA 3QQ9D 3BRGC 1LGVA 1CGSL 5E5RB 5EU5A 5IROC 3WEMA 4ZSOA 4JBSA 3DVIA 3VH8B 1EJ6A 4JO8A 1A8ZA 3LH2H 3TL5A 2WQRA 5E2JA 3TV3H 3OZ9H 2XU9A 1USQA 5EOTA 2R0ZH 5EZJA 2WVVB 1P7HL 1RZPA 3O2WL 4TLSA 5CZVL 4R7LA 5KBDA 2GB2A 2OW7A 3ARGC 2R56H 5F7EL 4BV1A 4H8WC 1KFAH 4N0CD 2YO3A 5ITBL 3DJSA 5F7YC 3VD1A 4AVJA 4NUQA 2X0VA 1JNLL 3LRLA 3N04A 3E6HA 4TTDD 3R7QA 4I2XE 3V6FB 1YHPA 5M7QA 3Q13A 4OLWH 4V2CB 2PYEA 1LD9B 1L3NA 2I5YL 1TMCB 3MO1B 4KC3B 4OIIL 4QHPA 2UX6A 2YHGA 4GP8B 4OTXL 4PRHE 5A2LH 4N25A 5C8JB 1E5BA 4MB4A 4YDIL 3OKOB 5C08B 3FMGH 3GMOB 5CGTA 1F11B 5ICZA 1NFDA 4GEJA 3U1SL 4HJEA 3QEGH 5EZIH 3O8XC 1T66D 1LP9A 3GS4A 2CO6A 3CFMA 3BI9X 3DI3B 5E2UL 2GHWB 5FGBA 3LDBC 4TQ8A 5I30L 1QA9A 3TC9A 5KJRH 2UYLB 4DZBB 4GUOA 4HZ1A 2BNQD 2ADGB 1A4JB 2C1PB 5AZEH 1T1ZA 3JWOH 3TM6A 3WLWC 1V7MH 4RQQA 4I18C 1CD8A 4WUKH 5EPMA 4BXVA 3RL2A 4CU8A 2Y7LA 5IWLA 3QO1A 4PJXF 1QBAA 2L4OA 1JL8A 2XKSA 4I0PA 4NNYA 1UQSA 2I24N 4DP0X 1FYTA 4HEPG 5KBNC 1KF9B 4YSRA 1DSFH 2C7UB 5DD5L 1E50A 1A1NB 2AQTA 1NGPH 4KZCA 1U6AH 1OT1A 2GYSA 3P69A 4NO0D 3GSQB 4F7KA 1KFGA 3W82A 5HYSA 2V7HB 4FABH 2CO7B 3WEXB 4YIQA 5I0WA 1IKFH 2MKWA 4YDVA 4FDWA 1F90L 2DICA 4CVUA 2W94A 3BP4B 2NCEA 1ZJBA 2VIRA 4UV7H 2NXYB 2OMTB 1D5BB 2P5WB 2BC4B 2DMGA 3WO4B 3KS0J 4K71C 4DN3H 2QBWA 1ZWIB 1HNFA 4P99A 1YPZF 1QFPA 4GPVA 3ETTA 1ZLUK 3GKWH 2I9TB 3EGXB 1J0ZA 4LCWA 1RK0A 5IBUB 3PWNB 2V6HA 4TUOA 3B7YA 3IMSA 3GMPB 3EH2A 1ZLEA 4DCQB 5C09D 5K1NA 2DQIH 3ARZA 2FB4L 4PJCB 4WCYL 5J11C 1BP3B 5B22A 4HG4J 5BVPL 1KTDA 3MKGA 2Q3AA 2LVEA 5D1QB 4JGUA 2K78A 4AV5A 1BD2D 4HCRA 2IBGA 2VQ1A 3OKKA 2DJ4A 1A7PH 3F7VA 1IRAY 5DJXB 2OSXA 3MNVB 1F2XK 4Y4HB 1NDMA 5EIIA 2E0PA 1HH6B 5TDPB 3DKHA 3IMRA 4DGVL 3GSNA 1G1OA 3ATDA 3IDXL 3IFLH 4DVBA 3Q2NA 1TJIH 1QBML 5IFHH 4ZOCA 2C3GA 4XO5A 4XNUL 4OCWH 5B4MC 3EUUA 3RZCD 4PJBE 1K8DA 3QIWB 2H26B 1J9SA 3CCHA 4G8GA 4YDJB 4X7EC 1I1AB 2MHAB 3EYQC 1GZHC 2FNWA 4GRWH 3UC0L 3C5ZC 2ARJA 2VABA 3NEEA 1L9SA 4S1RH 1DO5A 5GZNC 3N1QC 3SPCA 4LRIA 2V9QA 5FO2A 2F1AA 4HG4K 3QQ3B 5I73C 1TTUA 4GRWF 4I4WA 3U82B 4NZTH 4BK5A 4KKZA 4Z76B 3TCXA 5KYYB 5FS5A 1P5VA 4UM9B 2VLJE 2P5EE 5EA0H 4OZHF 3P0VH 3PXJA 4EQ2A 1MJUH 2NUPA 1CFTB 1NGXA 3D48R 3QW9A 4OR1A 1M1XA 5DHVA 1B0RB 2L3BA 1W0VB 3SGEI 3D69A 4P3CH 3HE6C 4AY0A 2D7TH 1EEZA 5I8CA 3BUBA 3PDOB 3QA3A 4PBXA 3VXPA 4PJ7B 3HR5B 1JERA 2VLKE 4YO0A 4F80A 4LSSL 3MCKB 4JS7A 1XCTA 3X1NA 4HMCA 4Y2NA 3O41B 3G04B 5IJDC 3SKNA 1EGJH 1YEEL 2QDWA 4HUWB 5IMMB 5ABAA 1C08A 1KJ3L 1U4FA 4TVPE 3RIKA 3NRQA 4L4TB 4LP4A 2F5BL 1GKEA 2XDHA 3SN6N 5HHPB 4NPYB 3WFCL 3QHTC 1F41A 1ZTXE 3QNYA 1PLGH 3JWOC 2EACA 1AO7D 3PPSA 4N0UA 2PXYB 4Y2DB 1JPEA 2R7EB 5D8JH 5C2UB 1I8MA 3N85H 2IDSA 2YC1A 3S8WA 2M8XA 4K2UH 3G6DH 4XOCA 3PWLA 4ZMAT 4ORZC 2F53D 1S7SA 2R1YB 2ICEB 5BXFB 4FHJA 1R33A 3BD4A 3U48A 1UB6B 4GQQA 2C4FT 2VDNL 1HNGA 4H1LB 4ODWB 5I1AA 3RFZA 3TU6A 3CZFB 4U6XB 1HHKA 3VXRD 3NH7H 1FUNA 1OAQH 2E9WA 3RBGA 1GC1H 1AP2B 4BXSV 2XVLA 3F83A 1F3JA 1CJYA 2KS0A 3BN9C 2VLRE 1OTTC 4LEOB 2K1MA 2VZTA 5J13C 3O2DL 3ILQC 4ECNA 3PWPA 1MQ8A 1PZ5A 3ATAA 3UBXI 2BWIA 3QZWA 3X1BA 4L0ZA 4AYDC 2IBBA 2WBWB 3CPLB 4TVPL 2RTTA 4N85A 2FWSA 2H3NA 3PDDA 5FM5O 2G30A 4LVHC 4MXVE 4WI8A 4Z7WE 4AEIH 3GBMH 2ATPB 2VB5A 4DP6X 3U83A 1KJVB 2A9NL 1LLAA 1JGEB 1YYML 1ZTXL 4Q9BA 3VWJD 4IRZA 1CXKA 1N0LB 1PFOA 3SE4C 4MA8L 3WE6B 4F8PA 5DR5H 3SBWA 3NCMA 1VEPA 5DS1A 3MCLL 4ATTA 3KPOA 3T4YA 3QZMA 2DLFH 5T1DL 4XMKH 1RZGB 1FVCA 3ZDZB 4KXZH 4EO5A 2BRRH 4YUEL 5CP7B 2V5TA 3RPBA 3ZHKA 1UUNA 2UUDK 2ICWB 4MDIA 5BV7L 3KGRA 3EYOA 5K9QG 1MCWW 1DANU 4UT9H 5BQDA 3WEAA 4BFIA 3BW9B 4D9RD 5CKAA 4ZMWA 3VD9A 5J6GA 15C8H 1SMAA 1L7TH 4ZMXA 1F6AB 4G9FB 3RA7H 3FU6A 4NRYA 3GC3A 4X6DF 1FGVH 3U9PL 1PPIA 1OWRM 1RUKL 2NTFB 1RZQA 3IDMB 1DQIA 1DQQB 2XOTA 1QPKA 4KZ0A 3MMEB 1UFUA 5J06A 5ICYB 2VCOA 1P5UC 4MRCA 5BZWA 3BAEL 5I26A 2DQFB 4KHXH 2FWOB 4ADJA 1E2ZA 4MJ5B 3H6JA 2JK5A 3MLRH 2UZIH 4WUUD 1N8ZB 2E56A 2XPGB 5GS3A 3VFSA 3D4ZA 1ZS8B 1QFWI 2V8LA 2Q8BL 2VW7A 4XP6L 5IQ7H 4TN9A 4YVNA 1T5WB 2LFEA 4NO3A 3HZMA 4KOBA 4XVJH 3T8MA 2WZPA 2DMHA 1NUGA 3D0LB 3ZKXC 4X4ZA 2O30A 2W65A 4RGMB 4JFZH 1M7IA 2G9HB 1WBXB 4CA4A 1FE8H 5FHAL 1MDTA 2I60L 2HJKA 2PETA 1DVZA 2J2ZA 5TFSL 1UUSA 3GSXA 1YMHA 3APDA 1WAPA 3ZDXF 3ZTJH 1GYVA 5I2IB 1RSFA 3PYCA 3HUJA 3LZQA 1C5BH 5I1EH 5F1IA 3RWDB 4LAQL 1GS6X 5L2KD 2QTEA 2DIBA 1L7IH 1JFQL 1XZ0A 4MWFB 3V0DA 1MVUB 2FX7L 1KBGL 1NC4A 4K8RL 2XV2A 4JKPL 2A74C 2XNAA 1TQCC 3FB7B 3IETB 4JFHE 2DZEA 4XTRC 5LGJA 5E4AA 3SKUD 2DJUA 4N87A 1XGRB 3FU9A 3NJHA 4JRXE 5FV1L 2JCCB 3K46A 5IIEA 4HC1A 4TQEH 1CDGA 3A47A 3HRZC 2F5AH 4MCYB 3ZUCA 3D25A 3N42B 1NKRA 3UTPE 1GSMA 2ITCB 4Q9RH 2ZJSH 3UAAA 3DNKA 4IBUA 3HZVB 3I9GH 1IGJB 4U6HB 4LL4A 1IGML 4HHAB 2W0FB 3GXPA 1IKNA 3GLDA 3VI4F 1BLNA 5D5MA 1PEZA 2A4CA 4Y1TA 3A67L 2JJWA 3QQXA 5DO2C 3BMVA 4ENZA 1S7TA 3VVWA 5T5FL 3AS1A 3MCYA 4IGBB 3H0TB 2IQAB 3ISYA 3ZHLA 3IAGC 2O5YL 1TSRA 4WI9A 1HWHB 2KMWA 4HJ0D 4P0DA 2A5UA 3SQBA 2B08A 4UQ2A 1J7VR 3MODH 1RVFL 1DLFH 3MXWH 3AWEA 3JV6B 3QR1A 3DI2B 4LE8A 1T04A 2XXCB 5GJTL 2OSWA 3TJEL 4H8PA 2IDFA 3RTQC 3ZL4H 3W38A 3Q8BA 4HJTA 4POZC 2CDEB 3VXMA 3RVVC 2YGQA 3EJRA 2JTDA 5T3ZL 2BNQB 5HPMA 3RGVD 4YHOH 4OCYH 5I1DB 4FX5A 5JHBA 1PJ9A 1I7RB 1ZGLM 5DS2A 5D7KE 4KZEL 3DV6A 1Z2KA 1J8HE 3MUGB 2CDGB 4HIXL 4G1MB 4M7ZC 4R0LC 4NI3A 4DT2A 2MOGA 5MEOA 1FIGL 3QDGD 3MRPA 5BUAA 2LHAA 2X70B 5KS9B 3UFIA 2AC0A 1CL7I 2UY6B 3NABH 1WBYB 5LCVL 2F54E 2EIJB 1TPXB 5AWNH 2HZHA 1JZ8A 1MZZA 4FNUA 4ZI8A 3KLHC 2CKBH 1J48A 3FUJA 4JFUA 2JLPA 4JQXA 4NO0B 1JIBA 3WYRA 4Q6KA 4JQIH 2ED7A 3FB8B 4LARH 4Y4KD 3IJ9A 1YY9D 1BOGA 2I07B 4FFYH 3VRIB 2JQZA 2BOCB 3QXVA 4MA7H 3DK2A 4Q0XL 1PNCA 5E9DD 3FC8A 5DSCA 2Z92A 5JHDD 1UWYA 5E1AB 5IB5B 1A3LL 1U3NA 4XPGL 1HCVA 4WWOA 4ZO9A 5IHUH 1E9OB 1NKOA 1NJ9A 4QDGA 3SPVA 4PY7A 1SFDA 4NQDE 2UZXA 1X4YA 3S5LG 1TETL 3HIZA 5CUSH 1NMAH 3BLKA 2W60A 4PIRF 5JZ7D 1NGWA 3QE5A 1L9MA 4W9JC 5C09B 1SYVB 1NGYB 2BIIA 4IU3A 4ZG1A 2VN4A 2EDEA 3F85A 1UJ3B 4KK8C 4P2YA 4KGJA 5KBKA 1T7VA 4P48A 4AENA 4IRSD 3TURA 1SLVA 3QUKA 5DZLA 1BD2B 1JFHA 4GLRH 5ABDE 3QS3A 2K4AA 1EAPA 3ALXA 1ONQB 1ACYH 2EC9U 2NT1A 4G42A 4L3ED 7FABL 3L16A 1JGDB 2C9PA 1I9RH 3WUZA 3B9VA 1A6TA 1Q0XL 4Z1PA 5ALCL 1FO0B 3HPJB 1SQ2N 4WW1A 4GO6B 1IKOP 4JCLA 2W81C 5LN4A 5LLIC 3LAFA 4QOKD 1F4AA 3TFKC 4JG0H 3VSUA 3GO1L 2DBJA 3G08B 3VJ6A 4J3OG 1PYWB 4ANXA 1XO8A 5DQJB 1U8CB 4HF5H 4S11A 4Z0XA 1GYAA 4GINA 3A22A 3A5VA 5IJCC 2AK4D 3FHEA 4G6JH 1NBYA 1GGUA 1D3CA 3FB5A 5DLLA 1NCIA 1IM9B 2F7RA 5B38A 3AM8C 1LHZA 1R3LB 4IIQC 4WNQB 4R7VA 5KOVC 1HHGB 1QSEE 3NSXA 3FDWA 3BDXA 4ZUWA 4S10A 4C59B 1LO3L 5A16B 5CN3A 2WXHA 3HG4A 4PRID 2KZKA 3D2UA 3PDGA 4JG9A 4OLZL 4TUJA 2DLEA 1KC5L 5G4OA 1V05A 2P80D 4XBPA 2EICA 1GCFA 1EIBA 4YDKL 5HSFA 5KYWB 4MZ2A 3UZVB 1X7QA 1KCUL 3MLSH 3JBG7 3HE6A 3MLTA 4I48B 3KYMA 3S5YA 2ZE0A 3QFGA 2YBGA 4CBPA 4DO6A 1L3WA 5CP3A 2OK0L 1YECH 2OMXB 2HPOA 4KXCA 2AJXL 4N4YB 2ZXCA 4G71B 5DDHA 2G75B 2RQ8A 5I74B 5CHNA 1XB3A 2V2TB 5EZOH 5ILTL 4YQXH 3ZO9A 5IEHB 3ZOAA 5CD5C 4N2AA 4IM8A 3BZ4A 4K3DH 5BMFH 4F7PA 1NUNB 4YC2C 1D5IL 3OLIA 3ZGHA 5DC2A 2OV0A 1GOFA 5F3BA 4F92B 2H0FA 2ADIA 1X9LA 3KPPA 4XCNA 2K45A 4DP8X 2BH0A 2X4SB 3FOLB 4I77H 5D1XD 5FUZH 5C86A 4NJ9H 4KAQH 2VJ8A 5I8KH 3ELAT 1OGAA 1QZNA 1UXWA 4P06A 4RETB 1UWXH 5E2WL 3TBSA 2ZIDA 3P9LA 3VXRB 2YGVA 1KEGL 4HIQA 3D51A 4JHVA 4QAMB 5KANG 3SE9L 3EJJX 3T65A 2FBJH 3GGWB 4HPYL 3N44B 1QEWB 2DQDH 4HJSA 4OF5A 1E90A 1U8PB 1K4CA 4BM7A 2DQCH 2XXMB 3IDYC 2ZAHA 2X4UB 5TPWL 2JCWA 2SEBB 5EEZA 2BHUA 3QUMB 4KXZI 4NFBA 5INDB 1MHCA 3KVDD 2JJSC 5EO1A 1SY6L 4R26L 1IJNA 3BKJL 1IBFA 4LVNC 1BX2A 1QLEH 2JKJA 3CXDL 4XNXL 4IKLA 3AMLA 1AD0B 1YMMA 1EHAA 1G6RL 2VSKB 1DJXA 3R1GH 3RWHA 3FF8A 3RLSA 5KJ4A 2YEZA 2EO1A 4ZSOE 2J56A 2DY2A 2E27L 3VWJB 4YS4A 3K6OA 4F33A 1ID5I 4A67A 3UTTB 3N0AA 3V7MA 3TH4T 1T80A 5L0QB 3EO1B 5F88A 3MZGB 1R3IH 3AVEA 1IL1B 4TTGA 4W6WB 2X42A 3ARRA 4XR8C 5JW4M 2WNKA 1ZV2A 1XXFC 4WSGA 1UH2A 1SHXA 3ARBD 3K0YA 4KFMA 3P3UA 1WIPA 2AHIA 4JY6A 1F6FB 2CR6A 1ED3A 3SKMA 1XMWA 2PYEE 1TFHA 2Y5TB 2DQUH 3OMIB 1K8IA 3LVTA 4KPHL 3L3IA 5H35B 4UOW0 3RGBA 5J7CC 1RZIB 1QBBA 5IJVA 2B39A 1BZ8A 3C60A 3OR7A 2HTLD 1EVUA 1IFHL 1R3JA 3BVUA 3ZTNH 1NFDE 3NIDE 4OV5A 1NCWH 3U46A 4NN6B 1YNLH 4ZYKB 3F7KA 4BH7A 1LP9E 3U4BL 1W72H 4FNQA 3OWEA 5LO7A 5I17A 5BPPA 4KH9A 3OAUL 2WXJA 4HCIA 1AZCA 4AIEA 1U3YA 4QHKI 3WS6A 5ESAB 2J6EA 1EO8H 2WTPA 4DERA 1O6TA 4WUUB 3RI5F 4QXTA 2RR3A 3L48A 3WBDA 1IC4H 3VXNA 1NFIA 3GXDA 4BZ2H 3LPOA 2VYRE 2BY1A 1ZHNB 3AW5A 4NWUH 3TNNA 3P0YL 1A6AB 3WFZA 3O6FD 5D7JD 1SEBB 2BP8A 4PUBL 2PW2A 2IWGA 3I9AA 2GT9B 4JPIB 4B9FA 4XP4L 4UNIA 3VFWA 2QLVB 1KMGA 1EK3A 1JI2A 3N43F 5FYJD 1WCBB 4IJTA 1KXQA 2J72A 1ET7A 1XR8A 3BVNA 5EC2A 2LLGA 4FQIL 1M2VA 3MX0B 1VGKB 5DUMH 5L2KB 3VFPA 4F57L 1GPOL 4DW2H 4M48L 3TEXA 3S37X 2FL5A 4F7MB 1S7XB 1TYJA 1TZAA 2A74A 4PRHD 5FAAA 4N24A 2H6UA 1QW8A 1PTZA 1H8LA 2YA0A 4XE0A 2FRGP 5AVQB 1ZHLA 3HRZA 4YR6A 3OG4B 2XX0A 4NRXA 5IB4A 5C97A 3MRRB 2J8UA 3EGSA 3SDCC 5ACZB 2CBPA 2HLAA 4GAYA 2E7LA 3X1EA 4LEEA 3U7WH 2XPYA 3IMBA 3QCVH 4JG5A 3D0VA 1TEGA 3F05A 1MCLA 3ULVF 4JDEA 1KGIA 3DO3A 4YGVA 5EUOF 5ITFA 1WE5A 3HG3A 4MBOA 1TO4A 2PR9A 3U6XA 5FW8A 2HKHH 1F3DH 4GAGL 3U2SA 3WSQL 3I9PA 3MJ6A 3QZPA 1UURA 1JAEA 2PP8A 1J18A 5HJ3B 4W6XB 4L1HA 5FLVA 1UM4H 2VOTA 1G7PB 3CFDA 4M8QA 1TZIB 1M05A 1A9BA 3MJ9A 2BVTA 4QI3A 5I19H 2YAHA 2HLFC 1DFBL 3QNXA 4NSKA 1JZ6A 4PJEE 4QRFA 3RGVB 1AANA 2JSFA 5FX3A 1S7UA 4NP4H 1TXKA 1FVEB 3LN4A 3ZR5A 4WSJA 1NL0H 3FCTB 2VN3A 5HHOB 2P4AB 1H3WM 2Y7NA 2BM3A 3QDGB 3I2CH 2WTOA 4O2FB 4R0LA 1ADQH 4EDWL 1DBJH 4HGKC 4P3DA 4EF3A 1HQRB 3QDME 1DVFA 4L8DA 1E4WH 4X7FC 3RHWK 2AEWA 1QLFB 1QI4A 1WJ3A 2BY3A 3SPHA 1EX0A 1JD7A 4GKNB 1K6QL 1MFCH 3QIUD 4NNXB 5ID1B 5AW1B 4EZJA 5LQBL 5D7LA 2V9TA 4OV6F 4Y4KB 2WB1A 4LGPB 4PG9A 3V4VB 3H56A 2N1TE 4HCRL 4X6DA 1B88A 1EANA 3C87A 4JLRA 4G7VL 4NQCA 3QHFH 3FQUA 5A1AA 4AVHA 1F42A 1F97A 4GLRI 5DEFA 3VXOA 3ERXA 3GSNL 2QFRA 4O2CB 3WS3B 5JHDB 2BCKB 3ZW3A 4JVPA 4YHKL 2EC9T 1KN4H 4DAGH 2CDFA 3CQFA 3K2MC 1NUFA 2ZTBA 3SODB 1UXSA 2CGRL 2QADB 3MJWA 3OB0H 1BVLA 4NN7B 1EPFA 5E00B 4PGZA 2BPBA 1KUMA 4XBGB 3ULSA 3GJFH 4R97C 4MMYA 5D7EA 3GSRA 5AB1A 3OKDA 4FG2A 4DK5A 3LNIA 4U2YA 1XMEB 4N0UE 2X4PA 4OB5H 3OKLA 3CU1A 1WAAF 2HXAA 1KPVB 4N5UA 2D9CA 4R5XA 3A4DA 3ZYZA 5TDNA 1RFDH 2WXKA 2XN0A 2YFNA 3CH8A 3DIDA 4WNSA 3VXSD 1UXMA 1QO3B 1IB5A 4L3EB 5SWZA 3V6BR 1IC1A 1Z1WA 2NX5A 4JPQA 1FDLH 3QAQA 4P3WA 1XR9A 4WRLA 2EE9A 3GBLA 3OMAB 3O0LA 3QG6B 5EZLB 5JIKA 4GI9A 3S36X 2QKSA 2LR4A 2IOIA 3D50A 1RQ5A 1FZJB 3FZUD 4Y2OA 2F74B 4QOKB 1JZIA 3EDDA 4LGSB 4WTWA 25C8H 3FRUA 3WY1A 5F9OH 4XNBA 2BJML 4YSDA 3PWJB 3PWPE 2VXUL 1J11A 2DQJH 2EDQA 3OWRA 3MQIA 1BXUA 1H3UA 3SE3A 3G5ZB 3NJIA 3D39B 2GI7A 4FMKA 5DRXB 5EUKA 3OF6A 4TULH 2AK4B 3EO9H 4NZFA 3UOAB 2ZICA 4L5FE 3ARVA 1F13A 4DN4H 3V10A 4MD0A 2AKRA 4KDVA 5CCGE 3QFJD 1P4BH 4TS6A 1KTCA 3KPRD 2BNRA 4N5ED 5FYLH 3VI4A 4AC4A 2UWEB 1KGUA 5IY5B 4LSPH 2XWZA 5DZOA 3PJSA 4WKXA 4ZTEA 4PRIB 3QUYD 4LHQB 2NY4B 4LOUD 3MLZL 3DRTB 3ETSA 1A6VH 2HN7A 3OKMA 3MRFA 2X4QA 2PKDA 2FEJA 2AJVL 3IKCB 3HC0B 3UJTH 1M6OA 5L2JA 2ZWLT 5HHMD 1HIMH 2DQHH 4ZTPL 1ZOXA 3BPOC 4OW6A 4WEUD 3Q6FA 3V6ZA 3S35H 2J1KA 5EN2B 2VNCA 5C0CA 4J4PC 1T0MB 4NZRH 1DFXA 4Y16C 5E0FA 4DO5A 2Q76B 3MGAA 2NNCA 2PCFB 2VDML 3CHPA 3G6AA 3KL0A 1U92B 4EI5A 1QUNA 1PX3A 4HKXA 1INDL 3S88L 4NO5A 2IPUK 4KO6A 1RL1A 3RPKA 1OE2A 1O0VA 2VLRD 4XO9A 3REVB 4NC1E 1RIVH 4L5FL 3V95A 5K33A 1U8JA 3BC9A 1KTKE 1R47A 4X4KA 1CLYH 3ULAB 4Q9QL 2GEQA 2V7NB 2EIBA 1HQ4A 5D1XB 5FK9A 4IRZL 5DJCA 1A7QH 3BQUD 4G7SB 4AYFB 3MBEC 4NQTA 5CMAA 1IAKA 2Z35B 5CCKL 4NUMA 3EJYD 1CICD 1UH4A 1NLDH 2QVKA 4PJAB 4WO4D 3TCTA 1MJ7L 3UJJL 1A14H 4Z6AT 4PBWD 3EJQA 4FYQA 4Z0BL 1ZLSH 3OVUB 4W9KC 4TSCH 1AHWB 1C5DA 2HUHA 5FO8B 4LEXL 5LGKA 4M1CC 3I02A 4LASL 3SDDC 4YHZH 2E7HA 3QWNA 5IG7B 5JO5A 4QRQA 4XPBL 3IS0X 4DGYH 5DT1L 4ZS7H 4BDVA 3ROOA 3TJHD 3DVGB 4XAWH 4UU9B 5L8LB 1U8IB 3GSVA 1V3LA 5CILL 3BPNB 3BEVB 2EYTA 3WJLC 4ZZFA 1H6FA 3HCVA 3KVPA 3QJQB 4NYLB 5D70L 4CKVX 3MR9B 2EYRA 5F7MC 4XMLL 2WWNA 1BQ5A 3MUY1 4V1DE 2Q7YB 4PFEA 5JDSB 2YKLL 3ULUH 3K6SA 1H8NA 3V8CA 1BEYL 4QRPA 4B50A 3TIEB 5EU3A 4KKBC 5D2NB 3IDJB 3CFKA 3PAYA 3VNYA 1LK2B 2UVFA 3WKML 1NDGA 2MOVA 5BOJA 3VFTA 4XO4A 1WDAA 4YBQC 3HE7D 3N0PB 3UO1H 1IQDA 1A0QH 3GZPA 5CZRA 4M93C 2R51A 3Q8FA 1Q4NX 5HHXH 1UEMA 5IKCB 5EIQA 2YGPA 2FR4B 1Q72H 1XH3B 3DJRA 4LIQL 2WTRB 4WWKD 2NTSP 2WLNA 2IALB 3VG9C 4D0CA 5FM4A 3FN9A 3QHZL 4NIKB 1T21A 3D9AH 4Y5VC 3VDCA 1AGDB 4JPSA 3QJVB 1W0WA 4HHGA 4XN4A 2EXTA 2HFFA 4P23A 5D4JA 2NT0A 3L5HA 4DKDC 3ZX1A 3GRBA 4OZFG 4HC1L 3HC2A 3T0EA 2F7QA 3T04D 4C56B 3O6FB 4FNRA 5IM7B 4OGYH 4OLXL 2Z7ZA 3LZLA 5JUEH 1RZJC 5IV2B 3ZHDA 3G5XB 1I3GL 3PABA 3KM1A 3CZSA 1KGCE 2AZAA 3RPIA 5T3ZD 4NQEA 1BA9A 3GBDA 4EIGB 1CGTA 2WC7A 4QKTA 3UTPD 5JXAL 4OSUH 4MA3A 4AUUA 4GRLA 4BSWB 5IHZA 3HI6H 3AITA 1F18A 1UD5A 3KYNB 1FFPB 2GSMB 1GHFH 3AU0A 1J05B 2KHAA 3KDMA 2JXMB 1NIFA 3CN0A 4JPVH 1B6UA 4I2XB 4FJYA 2CHXA 1KB5H 3MRQB 4OIFA 1U33A 1ZT7B 4M5YL 4WV1B 3QI9B 4JHWL 4PRHB 2ORBL 3GMNB 2H47C 5FKPB 4CN1A 4XHJC 5GGUA 1TLMA 1E28B 3HI1B 1N4XL 3CFBB 3MRHA 2IGFL 4HKZB 5DWPA 3T08A 5CR1A 5EN3A 3F84A 2XZAL 2OZNA 5A43C 2X4TB 5D72L 1MCIA 3GUTA 3RVXC 2JIXA 1IMHC 1YEKH 3CDZB 3M1BB 3S3PA 3DDGA 1XF2A 2FATH 3NDYE 2E9JA 3QDHA 4XBEL 1PZAA 1T2QL 5FYKE 2DIJA 1C16B 1I1RA 1FVDA 4OI9A 4LHUA 2COVD 5D7KD 3TT1L 1EERB 3SE8L 2X41A 3E8UH 1A8JH 4O4YL 3A24A 5E70A 5DQDL 3QUZB 4JO4H 2XSKA 5FF6B 2JH2A 4YJZL 1VCAA 1N3NA 1S3KH 2GQHA 1E8YA 4NDMB 1BXAA 3LHAA 3RX9A 4TNEA 3H6AA 5A2KH 4MHHI 4EI0A 3NZ8B 4YHNA 3CSYA 3U1PA 5ACMA 3LXAA 2UZPA 2O4EA 3D0AA 5HVHB 5FGSA 1G9HA 4OIBA 4RH4A 4MYWB 5TE6L 2Y22A 4E41D 4JN1L 1FN4B 5ERWA 3SZ6A 5IB1A 4AG4H 1S78D 5I0VA 2XN9A 2XKNA 1ZLWK 1JHLL 4KJQD 5EC1A 3VQ2C 2GBAA 1EJFA 5DUPL 5C0BE 4AL8L 4L8CB 1UOVA 1NAMA 1ETZA 2FD6H 4N0FB 3NJLA 1KIUA 4G6KL 1S9YA 3QIUB 3OX8B 1A3QA 4DK3A 4B41A 5FYKL 4AH2A 2KT6A 3RVTC 3Q6GL 4OZGB 1A1MA 1NSNL 5KVDH 4ONFH 3R4RA 5E6ID 2Y24A 3B83A 1UA7A 5KSBF 4GRMB 2BVQA 5GZOA 2OZ4A 3MNWA 3KPNA 2W1NA 3FQTA 4LCCA 4XXCC 5BNXD 4PCYA 3QCUL 4BWWA 4PJCF 2A4ZA 4PRBA 3SDYL 3UEQA 4M8UA 4JRYD 1QFWL 2R9HC 4HXBL 4JUTA 3B7UX 1YNTB 3NFNB 4R7NB 2P7TB 3L3HB 2ZXGA 4XPFL 3GJEB 4X5QA 1TJHL 2AJYL 4I5BA 4CC4C 2EDLA 4PJXE 3LZNA 4Z77A 4PJBB 2WUCL 4R83A 2R0LL 4XN8A 4C4KO 4YLCA 3RWIA 3KWVA 3GMMA 1NAKL 2P49B 1MPAH 3TS8A 1FC2D 4YVUA 1FG2A 3HKFA 2EVHA 5HGGS 2VMEA 1MFBH 3NAAL 3VXSB 4JY5H 2WKOA 2NPLX 5EU4A 3BIBX 3HMXH 3MRLA 5DI8B 2YD4A 4KXDA 1FYHB 2ROXA 3L9BA 1ND0B 2ZP0T 3Q8CA 3EJTA 1QSED 3GMQA 4HUUB 4OLWL 1PDKB 3TYFB 3VU1A 5J57B 5KYXA 2P5EB 1QKZL 1M9SA 2WCGA 4N2OA 3NFPA 2ODIA 1KBWA 4Y5XA 4X4YA 4QHUB 1FLRH 3NK3A 3VGDA 3IDGB 6PCYA 3FMGL 1AS7A 2CPCA 3JWNC 4ES9A 3JSSA 3RAJH 1WA2X 3AACA 4FHKA 5BO1L 4XMPH 5DHEA 5MP6L 2K3HA 1VADB 1RJLB 3I84A 4H2AA 3OBAA 3V4UL 4X6BB 43C9B 1YMME 2GAZB 3TPUA 1YPZE 3QFJB 3KCPA 5HYFA 5F96H 3PV6B 4TSAL 4PD4J 1AXIB 5GGQH 4ESKA 1MRDL 5F7DA 4ZOEA 4FQPA 2N4IA 4AZ8A 3ENEA 4GAFB 2WXPA 3ZYIA 2E8YA 5IEKA 5AZEL 4XPAH 4XN2A 1FV1B 2X89A 4PJHB 4UTAH 5F7LB 3NJNA 5C07E 4PRPE 4TNWF 3FQXA 5TJWK 2E75C 3MTRA 1HSAA 1VKXA 1SUHA 1AKJD 3IN2A 5HI5D 4RSYA 4MBRA 3IGFA 1XGQB 1G43A 3L1FA 2GBTA 3KL5A 2ERJB 3ZT5A 1XL6A 3K8KA 4JM4H 4L29A 4HJUA 4OGZA 2Y6TE 2PNDA 3ESNA 2EDMA 1W16A 3QXAA 5G5DA 4DIXA 4QXWA 1S7VA 4FJZA 3ZK0A 1U58A 2ZKWA 2ZXWB 3APFA 3K1DA 4H1LH 1WQVT 4JB9H 4PD4K 4XMZA 3SD5A 5BV7B 4MYPA 2BIPA 3NJKA 5DK0A 5GS0H 2N01B 1QFHA 1D5MB 1C12A 2VLRB 4MQ7B 5AENA 5C0AD 2Y36H 1OGTB 4GRWE 3T4AA 4LPCA 1ES0B 3UGEA 1CL7L 4ZMPA 1HN1A 3L9RA 4WW2A 4CAGA 4MDJA 4OZHE 3BP6A 4F93B 4HWZA 4K94H 4TOYH 3CFCL 1IC5L 4AQ1A 4JFOB 2Z4QB 3WO4C 1LO4L 2Y1ZA 5I75B 4TYUA 2P8LA 1CICB 4WO4B 1Y0LA 3VMOA 1FORH 4DGWC 1KXQE 4L3FA 1LK3H 1YNKH 5F1NA 1CTNA 1DJZA 2OL3H 5J6SA 4W4OA 3VE0A 1I8AA 2PWDA 4AM0A 4JRLA 3VI3A 4MJ4A 4QHKJ 4IBQA 4JDVB 5D1QC 5FO9A 4B9IA 4GSDH 3ZZQA 2J8OA 3IEAA 1CDYA 2PYED 2Y1YA 5K9JL 4Y4HC 1MNUH 3ZDZF 2ZKHL 2AQPA 5FA3A 1RUAL 1KOAA 4JFFE 4OZIB 5JPMC 2DYPA 3CHSA 2Q5BA 2ZXDA 3BZFB 5F3HA 2WQVA 5BS0A 3OAYH 3QORD 2MPAL 4L1DA 5BW7C 5MERA 4F8OA 4S1RL 3QIWC 1DCEA 3UYRL 1J1PH 1I1AC 2IFFL 5DHDA 2O5XH 3T0XA 1KGXA 3TZVA 1SXZA 1OSZA 4NZTL 4MMZB 5IMLB 4X6EB 4TQPA 2I7OA 4NKOA 2CK0H 4H88L 2HLEB 5J8OA 3TV8A 1HS6A 5C2BH 1D9KA 4NB7A 1TIUA 3B2XA 4GKSA 4PR5A 2YSSA 3R8QA 4ELDA 1N5YH 3S97C 1QUPA 1JNHA 1S4IA 2ZNXA 2ZSVB 4I0PD 4WWKB 4WJKB 5D96B 5IBTL 3UBXG 2G9KA 4RAVA 1FYTD 2M83A 5LBSH 1HYSD 1QWNA 2B9AA 3MXVL 3VFVB 4JRWA 4W9GC 3WLBA 2GY5A 2X4NB 1JXKA 2CIIB 2FJHA 4JREC 4X5XB 4WTZG 3F5WA 4KQ0A 4ODTH 5L4JA 1FPTL 4JJ5A 4MCZB 4XNQB 1OZTG 3G5VA 4K9EH 3L4CA 5E03A 2MWCA 4TNVK 1MWAA 2I7SA 1TZHB 4BQ9A 1FRGL 2J44A 4PRNB 3CN4A 1CXFA 1MLCB 4HKJB 3GINA 1FFNB 4AIZB 4HPOL 5L9DL 2NCMA 1XBDA 3G6DL 3GEWB 1A6ZB 3ARTA 3LMJH 4Y2DC 3F64A 4LP5A 4UTBH 5F7FA 4D94A 4PW4A 3MV9A 4APQA 2JCCF 4KHTL 1TYEB 4ZUSB 2DN7A 3N42F 3B2PA 2ICEC 1BREA 3JVGC 4LBEB 2B59B 4LCWD 2PW1A 1WTGT 4FYTA 4X6DE 4F7EB 4ONHB 1IAII 2VISA 3ESPA 3H7BA 4ZW7A 5ABZA 1BZ7A 1Q0YL 1O5PA 4BFKA 2I26N 3X1FA 4NRZA 1RZ8B 1XGPA 5D4QA 1S9WB 2YQGA 2XWRA 3U36B 4M6OL 5IB3B 4P2CG 4JY4A 4PTUB 3H9HA 3IFNL 4A7GA 1O6VA 1AZNA 1ZE3H 3U6RA 3QZBA 5DMIL 4K94C 2XN1A 3MLYH 4FI6A 4IOIA 1X9RA 4G8GD 2E8ZA 3B43A 3LIZH 1MW3A 2BSTB 2Z9TA 4MAYB 1KJ2A 3CLEL 1J8HB 4XVTH 4K5PA 4TL5A 5SWZE 3BSHA 4XMKL 2NX5E 1EZSA 5DFWH 4KMTL 2CGYA 2IG2H 4WJ5A 1KLGA 4QRRA 5G2NA 2F54B 3DMMA 4UV4H 1ZVNA 5JXEA 1INEH 1CF8L 2E74C 4MD5B 5JPNB 1OSYA 3NVQA 3PWVB 4JHZA 1AG0A 4KVPA 5KS9F 3BFWA 3WTXA 15C8L 4GW4B 5GGVY 1Z5YD 3Q2WA 1K5WA 1VEMA 2PTTB 4E5XG 1PKOA 3QEQE 1AXTL 1WS8A 4E41B 3P73B 5DJZB 5DGQA 5E4IA 1GTFA 2W5PA 3E1ZA 3V0EA 5I66B 2BNRE 2XRAH 3VI4E 1JZ7A 1T03L 5F1OB 3U2JA 1M7DA 4B3EA 2C1OB 4Z7NB 1UD6A 1K4DA 1OM3H 1B6DA 2GUYA 3TESA 4DQOH 2ZONA 2FJFB 2ZNWA 4IJ3B 4HFUH 3RJDA 1KV3A 1OPGH 4QUOA 1A3ZA 2WXNA 2WQXA 3IBEA 4KJPC 5E5MA 3VFRA 2WK2A 3P4MB 3AG2B 2NDFA 5E6IB 4PJIA 2VKXA 3BWSA 4BFNA 4RGMC 1XF4B 3FT1A 3L6FB 4EQ3A 1T22A 3F6JA 4LBAA 3MGTA 4OCSL 2IMMA 2H6PA 3GZOA 3WFBH 3LNEA 1NEZG 4N0YL 4X9YA 2EDXA 5T1KA 4RMWA 3HHSA 4PJ8D 4ZS6C 4FQXB 4OFKA 4XXCA 1K3ZA 1L7IL 2ZWSA 3UYPB 1Q9KA 3CU7A 4PEEA 3O4LE 3NSDA 4U33A 5D93B 4PV9B 1FO0H 1XEUA 2HX7A 3L1OH 3HMWH 4U6VH 1OB1A 3IJSA 5GS2D 1CK0H 3LRGA 1Y1DA 2KYIA 3F8UB 4K9EC 1BJ1J 4N90E 4BBWA 3QQ9C 4LF3B 3PWPD 1RK1A 4X98B 1NCUA 4Z3JA 3CH1B 4MNHA 4XNYH 1SJEB 4YE4H 3QP3A 4G7YH 3PPEA 2L7JA 4HKBB 5DD6B 1QFUH 5KTEL 4JO2L 3QNZA 4JHAL 1QSEB 1ZHKB 4N0CC 4U7KA 3QEUB 2HRPH 3G9VA 1MJJB 4LDOB 4TTDC 4KTDH 1QD0A 1G7HB 1MHPH 1ZT1A 1ZS2A 5E8EB 4BQBA 2E9BA 2DBLL 1CT8A 4NZUH 1NCTA 1AD9B 1ASPA 1SXAA 1BYNA 4HOWA 1MCSA 3WN5C 1G9EA 1A1OA 5DUBA 4OKDA 1KV7A 1MHEB 2QMKA 3BJLA 4QHNA 4RIRB 3MODL 1E8WA 5AUMA 3HBQA 3S3BB 2UY7A 1VFBB 2VGLM 3VCLB 1AR1D 4BQCA 1CR9H 3OSKA 1T66C 3TT3H 4ETQB 5E0QA 3ZL4L 1UTDA 4Q14A 4U6YA 3C09B 4LLWA 2YPVA 1A7NH 1CDBA 3E80A 1UZ8A 2BDNH 1ZE3C 1E5YA 3BEWB 4OCYL 4LPXA 4E0RA 1G6RB 3RFRA 5KAQF 4TPRH 2EDKA 3KH3A 5IOPB 2QFPA 2APWA 1OW0C 5D7SL 2O6DA 3MV7D 3N9GH 3V4LA 1T89A 3JTBA 2EJ1A 1R5VB 1T4KA 3OR6A 5C70A 4JO5A 5IT2H 3IFPB 2Y07H 4U7MA 1V7NL 2IAMA 1WFUA 3BESR 2VO5A 2CKBL 1GA2A 2BVEA 3L3DA 2WZPD 4NQXB 1TPXC 5HVWA 1CFNB 1SEQL 5LXVA 4PJDF 4WK2B 2Q7AA 4APXA 4Q2ZB 5CJXA 3TBBA 3S96B 2AXJA 3FFDB 3PXLA 1IARB 1RJZA 3FQNB 6PAZA 2P24B 4ZXBA 3UCQA 1EAOA 2PTVA 3MBXH 5C0AB 3E6FB 2ODHA 1N12A 1RZ7H 4G1EA 2BVUA 2BSRA 3QUMH 4JKKA 3HLKA 4AW7A 1AI1L 1IEAB 4NT6A 4I0KA 4JPKL 1JF1B 1KWGA 4OF3A 1EHKB 4DP5X 3CVDA 3KPQA 4V2BA 2C4XA 4Z7OB 4GIPD 5EU5B 4Z8FH 2OR9L 4ZSOB 2YXFA 3KJ6L 1DEDA 4D0DA 2ZSWA 1GMIA 5JW4R 3ESOA 3FFCA 1BBDL 1CE1H 2WB7A 3DYOA 3ZKMD 3HN5A 4A2HA 5EOTB 2VZ3A 5EZJB 4NKIH 3RUGF 5CM1A 5KSBA 3BUQA 4J7RA 2GKIA 4A63A 1HKLL 2XV3A 4XNMA 1UJ3C 5SV4A 3S34H 4LSVL 4HMEA 2Z1KA 4MD4A 5ADPL 3D08A 2V5YA 2Y1AA 3E6HB 5D7HA 4WHYH 2MQGA 3DGGA 4OLYH 2O93L 1AH1A 3I6LD 2PYEB 1XF5A 3LS4H 3EH4B 5CLYA 1QX1A 3KGSA 3OG6B 2OXHA 2GJ6E 5ICZB 1NFDB 1KACB 4CUCA 3NIDB 5JPMA 1BAFH 2IQ9L 5GGTH 1RSYA 1ZJAA 1LP9B 4Z7AA 2CO6B 1RUQH 1USZA 3QWQB 4KNUA 3OLDA 4JZJA 2PUQT 1KCKA 2HTKD 5HDOA 1X5FA 3WKNA 1QA9B 3FXIC 5TE4H 3CZKA 3VXMD 4HS8H 4B96A 1MLBA 3QXUA 4WTZA 5E23A 1KNOA 1T1ZB 3CFJA 5E99H 5IK3A 1B0GA 5A2CA 2EIDA 4Q6YA 4RQQB 3CXHJ 5EPMB 4FC3E 3RL2B 4YAQA 4C8XA 3QO1B 2LW3A 4HBCH 1E4XH 5IFJB 4I0PB 4NNYB 5GRWA 1UQSB 4M29A 3MLSL 3NQKA 1W91A 4NJAH 3ZGIA 5LNDA 5GISL 4FCAA 4ZNEA 4AIXA 3E1F1 1MN4A 1HCZA 2EO9A 4OVUA 4L3CA 4TF4A 3PQYA 4OLUL 4HAFA 1LDPL 1ZK9A 1ADWA 3GK8H 4CN4A 4PMFA 5L7XH 1KCBA 4NQSA 1B2WL 2QHLA 1T0PB 2KQMA 4TSBL 3AY4C 4AKQA 5HYSB 4LCVA 4ODVH 3CE1A 1BFOA 2WXQA 2IGLA 3FU7A 3RDTA 4YDVB 3EGDB 3QJRB 3Q5YA 5I74C 4HV8A 4BFEA 4Q9CA 5BMFL 4JDZA 3OLEA 2VIRB 2W0LA 4NHCH 4XCFL 1IILE 1LE5A 1BFVL 1DQTA 3FT3A 5DURB 5BRPA 2VTFA 1AE6L 3UAJA 4FNLL 4QXUL 5JOPE 1GY1A 4KO9A 4YK4B 3RQ3A 4PSPA 1WWWX 3M17B 4AI7A 4LCWB 4NLAA 1RK0B 4NC2B 4TUOB 1OK8A 5I1LA 2YN3A 4X9GA 3OAZK 4PW9A 5TF0A 2QPSA 2R0WH 1BXVA 1KTDB 2XWXA 3KPMA 3ZTJG 2ZXEB 2WYIA 1I7TA 2DMCA 2VQ1B 3OKKB 4NO2A 3TWYA 3F7VB 2VUOA 5EORH 4IIZA 1N64H 2DMBA 1NDMB 2VLME 5EIIB 2DM2A 2YPLA 5FW7A 4LKXA 5IQ9A 3QIBB 1X6LA 3GMRA 2FSEA 3GSNB 2HT4D 1F6LL 2NQ3A 4DVBB 4MDRA 5INCB 1OPOA 1RJYA 5TK2A 3Q3GA 2DWDA 3Q0HA 3BGMA 1K8DB 3CCHB 4G8GB 4HK0A 5I8EA 3ZU8A 2BWDA 3IU3A 5E7BA 1QRNA 4QJ3B 5JHLA 2ARJB 4ZW8A 1ZVSB 2VABB 3VWJC 1C7SA 1RCYA 4E5XA 3PHOA 1NAML 1J1XH 2A2QT 1H6EA 5L0QC 4K3EH 3WUWA 1NPNA 3HAEH 2WO3B 3TX4A 4BCXA 4I4WB 2J4WH 4ZAKA 4LSUL 5H2BA 1SZNA 4CW1A 1P5VB 4Z5RA 1FL5A 5FCUL 3B6SA 3F3HA 3DO7A 2HVJA 2CJ3A 1CI5A 5FUOL 1E6JL 3DXAA 4GW5A 4XN9A 2WUBL 2FUQA 2NUPB 1I82A 1BLIA 1NGXB 3FN3A 3S35X 1TUPA 4ZUTA 3CVCA 1M1XB 2AXWA 3D69B 5A2IH 2W95A 4IBVA 3V4VH 3P3TA 1EEZB 5I8CB 4JFWA 3QA3B 4TVUA 5D4IA 3VXPB 3QJZA 1W72L 4AUYA 4ZDHB 4JCMA 4YO0B 1URLA 1P0SE 3M07A 4RSVA 2WLLA 1W9XA 4NN6C 1NMBL 3SKNB 4ZUUA 4HYTB 3D8MA 3L5XL 1C08B 4Y19E 3UBFA 1UASA 4LLDA 4FL4B 2OI9B 4RMSA 4WEBH 3CSFA 3IF1A 3OQRA 3ULVE 5EUOE 5E08H 2FGWH 5JW3L 3QNYB 3EF4A 2D73A 2CJTA 4X7TA 3ECQA 3I6SA 5EMYA 4N0UB 5E24E 2H32A 2WHVA 3L95A 3IT8D 1KPRA 4XMVA 1KYAA 1WD8A 3W0WA 1I8MB 2YC1B 2QHRL 3BDYH 5LUMA 2OCJA 3PWLB 4R90L 1H15A 1S7SB 3LN9A 4NBXB 1U3HD 3LH8A 1MJ8H 4NS0A 1OGAD 5K5YA 2GK2A 1FF5A 5BZZA 5I1AB 4JW3A 3RFZB 4H0LC 4X4MA 1HHKB 1TDQA 3MZTA 2VDLL 4MNGE 4FF9A 1F3JB 4N20A 2C9VA 2EDYA 4IOFD 4MMXA 2OCCB 3TBYA 2ZOKA 3PWPB 3R19A 5EEWA 1PZ5B 1AG6A 4PTTA 4UYPA 3S8GB 2WY3B 3QZWB 1LWJA 3M8OH 4ZFFA 3L3OA 3CIAA 1WP6A 2XTJD 3O3EA 1BFTA 2VN5A 2H3NB 3B8SA 1M71A 5C0DA 5LGYA 1PBYA 3ULVL 1QFWM 1X5YA 4BWUA 3C5SA 3PHSA 1JVKA 1XSIA 5CJQL 1LEGA 3S0PA 1RIHL 1OANA 3KBPA 2BSSA 5GRJH 1N6VA 3KYKH 4FKEA 2XBZA 1TVHA 3B7TA 1NBQA 2HKHL 4HUCA 3KPOB 3T4YB 1VCBC 1CXEA 4L8BA 2NXZD 1FVCB 3VD2A 2X05A 4OCRL 3MRGA 1QWHA 1FSKB 3EYSH 2KLSA 4MDIB 2V2XA 4HJ0C 3EYOB 1YQVH 3OHMB 4BFIB 2E76C 2G0LA 5I19L 5J6GB 1YEFH 2F19H 3C60D 4PJ6A 4F3FA 4NRYB 1WAAE 3FAWA 2ZXAA 1Y07A 5D6DA 2Q87A 4W70A 4MAUH 2E3VA 1M6UA 1N59A 4I3RL 5DK2A 3RGVC 2AABH 5BZWB 1BXXA 3HBPA 5DJDA 4A6YH 1YLBB 2GUOA 2JK5B 2O6CA 1BQSA 1J9RA 1MQKH 3WMSA 5LG6A 3VFSB 1BOYA 3AZUA 1NQBA 2QSTA 3D5OF 5E9NA 5HI3D 1X5ZA 3ME0A 2CBOA 4NO3B 2BS9A 3HZMB 3CFIC 3A6CL 1MFCL 4PVLA 5CEZD 1XGYH 4QRAA 1BMZA 5KSAA 1DHKA 2W65B 4GKLA 4XZUA 2VZOA 4JO3L 1M7IB 1A6PA 3P30L 4JHUA 5KZCD 1YQ2A 1LMKA 2HJKB 5T5NG 2J2ZB 3WIFA 3GSXB 1G7LA 1YMHB 4Y4KC 1GAFH 1JZ4A 1OVZA 1YY9C 3L2NA 4RMTA 5F7BA 4L37A 3HUJB 3BWAA 4NFCA 2O5ZH 4PJAF 3WXVL 5F1IB 5I0ZA 3LPPA 1IAMA 2J1XA 2FGZA 4AYMC 3C2AL 1ET8A 4DAGL 1NOFA 1QSZA 3HVDA 1XZ0B 5AB2A 3X11A 3US0A 2UXTA 2VLLA 1NC4B 3QQDA 2XNAB 1XB8A 3CQPA 1NUDA 4KROD 1ML0A 1BMWA 2NY1D 2NYKA 4BH8A 4NN7C 5IIEB 2GBUA 4G5ZL 4PJFA 3AUWB 5GGSA 1I85C 3D25B 1OAXH 5JZ7C 2QV4A 1CGSH 3N41B 5GRVK 4HDIA 3MLWL 1DQVA 4MJ2A 4LFHG 3FQ4A 3SKOA 1BLNB 1QQDA 3DDFA 5D5MB 1OP3H 3O2WH 3AREA 4RZCA 4KDWA 4P2QD 5F7EH 2XN2A 1S7TB 3JYCA 3QR0A 5E8NA 5ITBH 1MFAL 1JNLH 3W9DA 3A3YB 5F9OL 1OHZA 2MNWA 4Y4FA 1E4XI 3S98A 2I5YH 4OIIH 4UQ2B 5EEYA 1C8PA 5ADOL 3VSQA 1ZA3A 1N5AA 5SX5H 3TGXA 1UHVA 3O8XB 4S1QL 1OTUD 1T04B 4YDIH 4ACPA 2G5UA 3RZCA 5IR1A 3RURA 4R96A 4FP8L 4GKZA 4U49A 3VXMB 5CJOL 4GI8A 4OM0L 1CI3M 1BWWA 2NW3A 1RZJL 2FQEA 2MSPA 5C0ND 5HPMB 4LOEA 5J9PA 5E2UH 1DL7L 3B9EA 1A7RL 3DV6B 5I30H 1OAUL 2D7PA 4PV8A 5L88H 1PZDA 5EG6C 4GIAA 1OQXA 4OJEH 3MRPB 4JZOA 3DV4A 5FYJH 5AOJA 4QRRE 2R29A 4DKEL 3J2PA 1W8OA 1DVFD 3FRPA 5DD3L 5J0BA 1OAKL 2PLTA 1Q9WA 4HWBA 4XCYB 4JGJA 1ODAA 1G1KA 5D7LD 1KWKA 1A2YA 5DD5H 1BOGB 1F4WL 3WFEL 3UADA 4M7KL 3JZ7A 1RV6X 5DMJB 4ELMA 4OBRA 2QKIA 4NQCD 5DSCB 2Z92B 4XNDA 4FKKA 5CJ5A 3SB3A 1DVTA 3VXUA 4ZT1A 1NJ9B 3SPVB 1U3ZA 1E6OL 1F90H 4WWNA 1A25A 4PY7B 1HL9A 5EU6D 1Q1JL 5I6NA 2BO0A 2UZXB 1JPFA 1F58L 1NFKA 2IANA 2H8PA 4IKKA 3F65A 3LSOA 5D1XC 4AJWA 1NGWB 4PJDA 2F53A 4IU3B 3GD1C 1OALA 2I25N 1WBZB 5IFAL 2WINA 2AEIT 4J3OD 2FX9L 1I8UA 4AENB 2W88A 3QUKB 4ZW3A 3TN0D 4AGPA 1EAPB 4ZPVA 1EDQA 1KCSL 1AHWC 4G42B 4DUVA 1F1DA 2CNZA 2FB4H 4WCYH 1MRFL 2NX5D 3OQ3B 3JYBA 2BINA 2JELL 5BVPH 4CBZA 1X5AA 1A6TB 3KLAA 3LV3A 2FO8A 4GXVL 4DUWA 3SKJL 3DECA 5EWIL 4V33A 4YH6A 1AXSA 1TJMA 4WW1B 1YEHL 2A6KA 2XG5A 4XT1C 1M1SA 4M8RA 3ZKND 3VJ6B 4WFGD 5T3XD 3ISRA 2VC2L 3VGAC 4Z95H 4DGVH 1YY8A 1CTMA 4XO3A 3IDXH 4HLZH 4RMRA 1YEIL 1QBMH 4Z0XB 1PG7L 4ZQKA 2Y23A 5AZ2L 4XNUH 3OF6D 3STLA 4HBQA 1NBYB 1SXNA 3FB5B 5B38B 4QO1A 2X1PA 4QRBA 1BQLL 3QPXL 4I88A 4ZODA 3O4OB 5I73B 1KXVA 4ZUWB 3ARBC 3F58L 1N6QL 1PY0A 4A7QA 2XYCA 3D2UB 3PNWA 3JV4A 4NHUA 4TUJB 5C0RL 4XBPB 4A66A 3VXTA 3Q5TA 1WS7A 3GLAA 1BJMA 5GRVL 3DX8A 1X7QB 2HTLC 2TRHA 3JWNE 3HE6B 3TP4A 3MLTB 5I5JA 3KYMB 5HJDA 3O9WA 3CPUA 4JQVA 3KHQA 4P8QA 2BY0A 4OZGF 4PV1C 3B7RL 3RIAK 2P47B 2XVGA 5C0CD 4WTXA 5DDHB 5CHNB 2WZ6A 1DE4A 4LSSH 4KNSA 4J23A 4EI5D 5C71A 3MV8D 4JQIA 4DJMA 1YEEH 3BZ4B 4A2LA 1KJ3H 3SYQA 4F7PB 3MOAL 4FFZA 1AZRA 2ZUYA 3O6FC 4WI2A 2F5BH 4FG6D 2HT2D 2ZYSA 5D7JC 2DAVA 3S37L 1Z32X 3SSGA 1RUML 1Z5HA 2PYFA 3NCYP 4RZKA 5ACLA 5F3BB 4BGDA 3WFCH 2ADIB 3KPPB 4LSRL 4P4RA 1O7VA 3FTGA 3L45A 3LOWA 3NPZB 4XCNB 4N6QA 3IPEA 1Z9LA 5G4NA 2CCWA 4TQHA 1NBZA 4OFDA 2YGNA 1HJCA 4ODBD 1GHFL 4M4RA 3V7AE 1OGAB 1OV8A 3NJXA 2A6JA 1UXWB 1U95A 1VZGA 2FVNA 3AQZA 3HN3A 3P9LB 3TBSB 4J2QA 3T65B 4JFVA 3CK0L 3PGCA 3BP5A 3BAWA 5J1TC 1K4CB 5LKNA 3B9KA 1LEIA 3D05A 5F21B 1R9FA 5J13B 1Q9LB 2GY7B 3QI9C 1MHCB 4LRNL 2IDUA 4U4BA 5EO1B 3JUZA 5AZUA 1A6UH 2XTJB 3LIUA 1Z6JT 2YPVL 4AOFA 1WLHA 2R0KL 2ZCHL 4Q52A 1YMMB 3O2DH 2COQA 2WAQA 3RWHB 2P5WE 2YEZB 3F01A 3MJ8A 1UD8A 4DPRA 1MFUA 3IAPA 1Q94A 4TVPH 4F33B 4ZFOA 1B4TA 4QR7A 3FFCE 5T1MB 1IAIL 1VF5C 5KSBE 1KYDA 2EE0A 2F2HA 5GSRA 2XKUA 2AV1B 1F0LA 1XIWD 2A9NH 1YYMH 3FQ1A 5IQLA 1ZTXH 4U3CA 2NXZB 1NCCL 1ET5A 2XUWA 3K6NA 4QRPD 1VENA 4PJCE 1EZLA 4BCZA 8FABA 4MA8H 4JY6B 1ED3B 1LO2L 4M7JL 3SKMB 4PJHF 5D1QE 3VFGL 2ZYRA 1K8IB 3L3IB 4S0TD 1PF3A 3MCLH 4WY7L 4JFDA 4MZ3A 5T1DH 5IJVB 1J87A 4E9VA 3C60B 3OR7B 1ZLUH 5JTWA 5H4ZA 1K5NA 1R3JB 4YUEH 3APMA 3ASWA 5SV3A 5MHSD 1F8TL 2BHFA 5BV7H 1L6PA 3U46B 3L2LA 1IEHA 4XBMA 5I17B 5JOEA 4GW1A 1CFMA 5L4MA 2QPUA 5HVHC 3GLEA 2F68X 1X5KA 4GMSL 1CFVL 4HZLA 1LL1A 2YK1L 2MCMA 3U9PH 1RUKH 3POHA 4QXTB 3GKZA 2RFXA 4U31A 3DGCR 4K5MA 4TMPA 3VXNB 1JF6A 1NFIB 4CADA 2CHZA 4P23D 3TNNB 3BAEH 1B4JL 3HPLA 3T0ED 1FJ1A 2CO2A 2EH8L 2PW2B 1OCZB 3D3VA 1S9XA 3ESUF 3IRZA 3KS0H 3MFFA 1K85A 1EWHA 3HTLX 3QIUC 2Q8BH 4XP6H 3BD5A 4NQED 1DQLL 2HG5B 4IKNA 4JM0A 3B1UA 1XR8B 3BVNB 5EC2B 3W5NA 1MY7A 3NEOA 1M2VB 4GRLD 5FHAH 1B4RA 3CMOL 2EH7L 5CLTA 2I60H 4HU8A 1HJBC 5TFSH 1X6NA 3SGDH 2G2RA 3HKZA 2J1WA 5E9DA 2D0HA 3T2LA 1ERNA 2FL5B 4HIIA 4KROB 3WD5L 4HK3J 2X0UA 4PLKD 1D5XA 3TVMD 2WWMD 5BJTA 3GXFA 2A74B 4LAQH 3C6SA 4L4TE 4JFFB 1JFQH 2VR7A 3T1FA 3KYAA 4N8VA 4MXQD 5HDBB 2E46A 1KBGH 3EYUL 4K8RH 4RRPA 4JKPH 1I1YA