5DHMC

Crystal structure of the fimbrial protein mfa4 from porphyromonas gingivalis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
282
structure length
268
Chain Sequence
b'ERNQGSAAERLITNLYLLLFDQSGANPAKYYIAGNTFIWLPDDMKVKLDMTQSEAGERKVYVVANVDNAVKTALDAVANESDLQTVKRTTAMPWSTDIASPFLMSGNKTHDFLANRLLDNVPLVRAIAKVELNISLSEKFQIVPIIVNGSLSEFKFRYVNFDKETYVVKPTTKPDNLISSANGVWPQITDWTVWGASLNTSPAPDAGTGYTLDANGKVTALRIVTYLNERDSKGATVEVALPRGPELYRLPLPDKILRNHWYKYEVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoreactive 32 kDa antigen
publication title Structure of the fimbrial protein Mfa4 from Porphyromonas gingivalis in its precursor form: implications for a donor-strand complementation mechanism.
pubmed doi rcsb
source organism Porphyromonas gingivalis atcc 33277
molecule tags Cell adhesion
total genus 67
structure length 268
sequence length 282
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dhmC01
3R4RA 4GPVA 4RDBA 3UP6A 4JG5A 4JRFA 5DHMC
chains in the Genus database with same CATH superfamily
1GMIA 2EDRA 4IGBC 3DX3A 5A16B 2CDEA 2OA9A 3K71B 1U6AL 4KVNL 2QADC 2W91A 3DX9B 4X4YB 1LILA 1MI5D 4KTDH 1GAFL 2BW5A 2EXWD 4JG0L 4FG4A 4H88H 1MQ8A 5C2BL 5F96L 3NZ8A 2X4NB 5CO1A 5I74C 1G6RA 3DROA 2OYMA 2B14A 1KYUA 5KYXA 1CXFA 2AJUL 2G5BA 3QI9D 1IM3B 2EUWA 4JQIA 2YMTA 1X3DA 3FPYA 1XR9B 5ESQB 2QPDB 1LK2A 1UWEL 1JZDC 1WAEA 2ZXWB 2PR4L 4PJDA 4QRUA 5DK2A 3QPXL 4ZMAT 5BVJB 3E9UA 2XA8L 4PMEA 4RRPM 1JZ8A 2PWGA 1AGCA 3KM2A 3EXJA 4U4BA 3WEMA 2PP8A 4I3SH 1E67A 1Z0NA 4F5CE 1EZLA 4JFDB 2BY3A 1FYHB 4LSRL 3IXAA 2DWSA 4LZKA 1PFCA 5CWSB 1BFOB 3QO1A 1TVBB 4OGYL 3O2DA 3OGOE 4L1LA 2X87A 1BZ9A 3WFDL 2Z6FA 4LASH 1D9KA 1JS4A 4QHNA 3LKQB 3VGEA 5I6NA 3DYMA 3MLXH 1V7NL 4FFWD 5GZOD 1U21A 1GZQB 1QWUA 1AMYA 1WYJA 2FJHB 3FO0L 1N59A 4JGJA 4NNYA 4XT1C 1GKOA 3CZEA 5DZ9A 5ELIA 2ZOTA 3RL1A 5KVFL 2CRYA 1OM3L 3W9EA 2FR4A 2YRPA 1AHKA 5AZEH 4F3FA 1QFWL 3N43F 4TVPE 4E42A 5HHOB 3MFFA 2CDFB 1KC5H 2VDMH 3HS0C 4JRXB 3K2UL 3S36L 4YSUA 2EIMB 3FKUS 3T4YA 3QNZB 1NBVL 3ASWA 3VGHA 3MOBL 5F7FA 1MNNA 2H6OA 3CFJB 1NIDA 1YEJH 2N7BA 3JWNE 4L0PB 5SX5K 3SQOH 5DHXB 1NEZG 4L4TA 4ZZKA 2AQ2A 1T0PB 1OW0A 3GIVA 2RFXB 3MYJA 3SKJH 2F19H 5C0AA 3RTQB 4TRPH 1FA4A 4PREA 3QIUA 4XB8A 1IC7L 1HC1A 5CEXB 1DQKA 2CJ3A 3T0EB 1UYWH 4UAHA 2AJXH 4MS8D 5J3HD 1QSFA 5D5ME 1VRSA 1DQTA 5T5FH 4QTIL 3RGVA 3VYOA 4TOYH 4LEEA 5ID0A 3FCUB 4CBPA 1A5FH 2G9HA 2O5ZL 1TSRA 1BOGA 2WXKA 2WB7A 4ZBJA 4EN3A 3HZKA 3TO4A 5K9KA 4LKCB 4M29A 2EXWC 2EKSB 3ILPA 4FMKA 4I13B 2X4RB 5IBLC 2NXZB 3VGAC 5LO7A 2BNUB 4GSXA 3RGBA 1AD9A 3ZYJA 1CLOL 1KIPA 3MA9H 2P8PB 3C8KB 4A39A 1ZLVH 3QI9C 4NJ9H 2C5DC 5D2NB 4NOBA 2R0WL 4F9PC 1CBVL 4X7SH 4YSSA 2APXA 1OB0A 2APTA 1QWNA 3UTQA 1SUHA 4WY7L 2EACA 3DRQB 4NGHH 5FGBA 3WLBB 2A3TA 2QBWA 2JCCA 4NM8L 5FO7A 4NQCD 2YBRB 3V5DB 3N0PB 3MBWA 5EZIH 4XPHH 2JB5L 4I3RL 5BUAA 1A7QH 2PETA 1GSKA 4ETQB 5I1LA 1NIBA 2BXYA 4WU7A 3K72A 3UYPA 2XRAH 5BV7C 2ZSVA 3X3FH 3GXMA 4LARH 4Y9FA 4BUQA 3K3QA 4FZEH 3HZYB 1JZEA 2C9RA 5DZPA 2F74A 5HHXL 4BSWB 5FA3A 4APXB 1VPOL 4FFWC 1N5YH 2CR3A 2ITCA 1PL3A 4M9OA 2VDPB 3DETD 2IPUK 2ZWYA 2FSEB 2EDWA 5IMOA 3FOLA 1FIGH 3T9WA 4G71B 1AD0B 3AQZA 5D7IE 3QNYB 5SWSB 4OLYH 3SE3A 5DXWA 4YHNB 1WSST 5I28A 3P40A 5CD5D 2KLRA 1MOEA 3ZE2B 3TV3H 1PU0A 3UC0L 3AUWB 4CVXA 1I1AB 1SZNA 4WI6A 3VFOA 3GBNL 4KNTA 3HPLB 5E9DB 5HHPB 5E8NB 4F2MA 2FEEI 4IM8A 5DMKB 3TWCH 4R7XA 3VXUD 2FSDA 1AACA 4YHLL 1SNRA 3FDWA 3L8QA 1XGQB 3ARYA 4P9HL 5B39B 4G6ML 5DJ2B 1KLFB 1MHHA 1FZMA 2HTLC 2NY4B 1G7HA 3GDBA 4HIJB 4E9XA 4ZO7A 4G7VH 4IYKA 1EDHA 2MJWA 2BVTA 1B0RA 3AU1A 3CFKA 4GAJH 1PY9A 2FWLB 4JVUA 3WIHL 2JTDA 4G1MB 2QQKH 2F1AA 4KBPA 1GZPA 3E7JA 5KVFE 1TLKA 3VFPB 3TF4A 5K33A 4H1LG 1Q4NX 4MS8C 4LPTA 1JPGA 1QYGH 2FQDA 2XG5B 3OM3B 4D3CH 3ZKXC 1G7IA 5BXFB 1OAKL 4APQB 3ISYA 2CA3A 4H0LC 5AB1A 3FMGH 4PJFE 1A1NB 3DWTA 4H0GA 1HDMB 4HALA 4JPSA 3H42L 4JZJC 5I1GH 2YKLL 3DPBA 4JL1A 2XWJA 3DX6B 4MKMA 2QLYA 3CC1A 1P0SE 3IU4L 5B3JE 2DW5A 5BPPA 1T21A 1G7JA 2EZ0D 3GMRB 5B7MA 1K2DB 3U9PH 1BSIA 2AXHA 5A6LA 4CSSA 4PJHB 6TAAA 2B1AH 4JO2H 2VJ0A 1KELL 2HTKD 3HKZA 3MODH 2EDJA 3V7AG 2IG2L 4HD9A 5I1CH 1FYTE 5JQ6L 1QKZH 5DSCB 1CN4A 2R2BA 1S3RA 3D39E 4J2QA 1QHOA 3ULVD 3DUUB 2GFBA 1TO4A 4MMZA 1AAJA 4YO0A 4KQ3H 3T4AC 2O5XL 4RZCB 4WNQB 2K6ZA 3HUJA 3MRIB 4HH9B 4YBQD 4YWGL 1IKFL 4K3DL 1V7MH 3BGFB 4RFEA 2GY7B 1B2WL 5H37G 2R7EB 4JMNA 3IJYA 4NC0B 1QATA 3RWEB 4TLSA 4XMLL 3PQYD 2D9CA 4QCIB 5D72L 3DETC 3UP1A 4QRSA 4EZJA 3LPWA 4HISA 1IU1A 2I25N 3IRCA 2PPEA 1RP8A 2AXGA 2QVMA 5CZXD 5LAXA 4NC2B 1HX0A 4HIXL 4ZUWB 3C6LB 5D7LE 4BCYA 5CD5C 4KGJA 5AKSA 1YEFL 3M1BB 1GSMA 5E56A 1DJYA 4Z3IA 1CE6B 1ZT4A 2NZIA 4GMTL 3TA3B 1CGYA 2Q3AA 2IFFL 1X9QA 3NDZE 1HXYB 3VXPA 4ZMWA 5DMGD 5TDOA 3F7VA 4DVBA 1AKJA 2EIDA 5GGQL 1BLNB 4HGMA 1PGRB 2WMPB 2O6CA 3O11A 2QFPA 1YHPA 2NNFA 3MROA 4XNAA 2EKJA 1DE4B 4F7PB 3WKQA 2GBAA 3L9RA 2UXFA 1ET5A 2W94A 3QEUA 2QSQA 1MCDA 5EEYA 1RIUL 1QHPA 1EHNA 5GS0L 1H19A 1M1XB 3JSSA 4Z7UB 3DNKA 1PFOA 1CICB 1FE8H 1RI8A 1TR7A 2OR9L 5D55A 4H25A 3T8MA 3VB9A 4WKZA 2H3KA 2WIIB 4JO4L 5LVEA 2DMKA 2IH1A 1A7PL 3TP4A 4UANA 3UAFA 2R29A 3F00A 1U8CA 1XHHA 4L5FL 1KCWA 1DDTA 3VH8A 2GT9A 2H32A 4LVNB 4ONFL 5D7JA 4FULA 5DZOA 1QVOA 2EUXA 3MLPA 1NDGB 1OGTB 4Y2NA 1YUKB 4KOCA 4AYBA 2EZ0C 4MNHB 4P4RB 2N7AA 1TJIH 4GBXA 3WE6A 1C5BH 2HJFB 4NQUA 5EFIB 5GJSL 1CFVH 1TYRA 4N0RA 4AH2A 4ZFFA 1YPZB 1BYNA 2VDRL 2JKLA 4LPCA 1HCFX 2XLLA 3STBA 5I15L 1DDHB 1A6WL 2YIHA 1JGEA 2OPCA 2Z0BA 2HTKC 4TSBH 1FL5B 4AQEA 1R33A 2H9GB 4E9WA 5I0WA 5C09B 4NO5B 5C08D 1T4WA 2GEQA 3T04D 3ZT5A 5ALCL 2DYPB 2VZVA 3BT2L 4FNTA 2DWYA 3DVIA 4K3HA 4XTRD 2XIBA 1EJOL 2TRYA 2FECI 3B5HA 1TFHA 3PDOB 1KCVL 5CZVH 1N19A 3AS2A 5DTFB 1O6TA 4Z7VB 4IMKC 3FF8A 4POZD 4QOKD 5EU7E 2VM4A 3MJ9A 4WW2F 3BXNA 3V4VL 4HPOL 1OANA 4OCXH 5GIRB 3MGAA 4FQXD 1I8KA 1WBYB 2CNZA 2DWEA 4G11A 1BPLB 4X6FB 3S3DB 4GIOA 4UB0L 5CZXC 1RJLB 4M5ZL 1LEGB 3QCUH 1S9WA 3NCWA 2C3VB 3S3BB 1FZKA 1LE5A 1A4BA 1UADC 1OGAE 1Q9KB 2DAVA 4DETA 4UV7H 3Q8FA 3S3PA 1JV2A 1NM9A 3WFEH 5FX3A 4LCWA 1N12A 4K71B 1YNTF 2X41A 3M07A 4DN3L 1M2OA 1SY6A 4HIEA 5DMGC 1E28B 4DN4H 1YNTA 3HCVA 2EE2A 4EDXB 2FB4H 4G7YL 3NZHL 3T0AA 1F58H 1NC4A 2GAZB 2Y1VA 3L48A 4Z7WA 1MXGA 3RP1A 3RUGB 1L9QA 2NXYD 5F3BB 3C09B 5IHUL 2DLIA 5C07E 2VABA 4UT9L 4ETYA 1YY8A 4ELME 2ZXEB 3R18A 2Y7SA 3BDBA 4MA1B 12E8L 3BAKA 5KZCD 3NCCB 4EO5A 2NNAB 1F4AA 4ODXA 5EBLB 3OAWA 4FNQA 1FO0L 4OZHA 3KR3H 2Q3XA 4BKLA 5IV2B 1OT2A 5DD0H 3WEOA 1GYCA 1CFQA 1TJXA 4JQVC 5IKCB 5E03A 2BDNL 3V2AR 4XNQB 3SJVE 3GTVA 5CJXA 5EG6C 2X4SA 3DDGA 4TV3A 1WD9A 3MBEA 3WY3A 4PS4L 1FFNA 3Q2WA 1JD9A 2BOLA 4NUJA 5D2LF 4PUBH 4UNVA 3BP4B 5AVZB 1JMZA 5E5RB 1P4UA 4XXCC 3IJ9A 2XWDA 5TQ2L 2F54D 2B5IB 1G7MA 3UTSB 5JW4R 1FNAA 4UQ3A 5D2LA 1QSEB 1U0QA 4GG8A 1ETZA 1U2CA 4J4PD 1NGWB 3ZYIA 4MZ2A 1EXGA 2O5YH 3W2DL 4S0SD 1AKPA 5F8RC 2MFNA 3D48R 4FAAB 4XPGL 4M7LT 4WHTB 4IRJD 5FYJH 5ANMB 1S5HA 3DTUB 3OJVC 5DUML 4B50A 1NGXB 3LHAA 4JL2A 1EIBA 5IJVB 4PJ5A 3ME0B 5EB9A 3V0GA 3ULUD 2OSYA 3CVHH 4NQDE 2WC7A 3C6EA 3IXTA 4NHUB 2Q9OA 5GGRB 1ZANH 3EOYG 1TUPA 4XTRC 3MJWA 3TYFA 3QUYB 4L5FE 1HVXA 1M6OA 3CSGA 5IHZA 3R7QA 3JUYA 4I0PA 4POZC 4QF1A 5B1JA 2EIKB 2ZCHH 1IGCH 4NX0A 1MFUA 4BK8A 2DMBA 2XQYG 2R4RH 1E6OH 2GUOB 3IK2A 1Z1WA 1IZKA 4P3CL 1ZRUA 3FSVA 4FQXC 3EAKA 1VADA 3QEGH 2F7QA 1TYJA 1NBYB 3HS9A 4HEMA 4X6EB 2N4IA 3A6BL 3GMOA 4G9FD 5JORA 1JCVA 1TPXC 2CKBB 3F6LA 4DP8X 3ABGA 9CGTA 2I60L 2HUEA 2FZ3B 2OTPA 1P1ZA 2NYZA 3K4ZA 4EDWH 4R90H 4Y4KD 4HZ1A 2EQDA 3VWJD 1QQDB 3O8XB 2BRQA 1AJ7L 1X9LA 1UFUA 5FYJD 1BF2A 1WFOA 5FO2A 4LCIH 3VAEA 2NXYC 1KOAA 4FFVD 1JZIA 4WJ5B 5I1IH 1AXSA 4FHJA 3ZHNA 2GTQA 3JWDH 3W56A 2Q8BL 4U2ZA 5IG7B 4UT6H 2VE6A 1BIIB 1TQBB 4CILA 2UWEF 4LHQB 2XV0A 4PYHA 2XWEA 3GFUA 4M4RB 1TU2B 5F0PB 3S37L 3RNQB 1ES0B 4ZUTA 2WBJD 3H9SB 4CN4A 5ICYB 3FU7A 3BVVA 3U0TA 1DN0A 2WQUA 4UQDA 3DJTA 2DWTA 4RX4A 4ORGB 3EGSA 4MNGA 4HYTB 2BVPB 4MFHA 3NSDA 2AK4D 5HJDA 1IL1B 1ZY9A 1FSKC 2FX9L 5DCCA 2WK2A 3QDGE 3RIAF 1JSYA 5FYKL 4ICXA 1IEAA 2XVKA 3PP4L 4YR6B 3X11A 3ZDZF 5IVXB 2PCFA 1J18A 2EO1A 1B9ZA 2DQUL 1LE9B 4U33A 4AGQA 2W65B 5SWZB 2XKUA 3AFLA 4K55A 4J4PC 4ERSL 1G7LB 2EH8H 3DSNB 2ZOLA 2X4PA 3D08A 3EJYC 3W9DB 5HVWA 2KDGA 4P2RE 5E4EB 1U3JA 5L2JB 4KAQH 4Z0BH 3UDWC 1D2OA 2BNQB 2GG1A 4TVPH 4IRJC 4QRAA 1OWWA 1A6ZB 2MCAA 2FD6H 3A6CL 4NZFA 1UTDA 1ED3B 1E27A 3AM8C 1PCSA 2O26U 2ZXBA 2FWSA 3LNFA 3ULUC 1YEDB 3HRPA 2NYKA 4YDMA 5C0RH 3I2CH 2DQGL 3JWNH 1N3NA 1UEMA 3IJHB 5DJYA 5AW7B 3U2JA 3NSJA 5I1EL 4P05A 4TNVF 4U6YA 5AAWA 1ET7A 1TJHL 5E6IB 2PXYB 3MV9A 2K9FB 5AW2B 3OGCA 1AHWC 2IGFH 4L8SB 2WYIA 5JHDE 3K80A 5D70H 3Q1SL 4O2EB 4P2QB 4HWEH 5EOCJ 2OL3L 1DEEA 4DO6A 4F8NA 3GSUA 2M1KA 1BQLL 1ACYH 1LDSA 3EZ8A 1G0YR 4ZTPH 1BFTA 2P44B 3BHBA 3MRRA 4JHBA 1IO4C 1HL9A 3G5XB 4B0MM 2ZG2A 1CE1L 1I1YA 4HXBH 4EVNB 1ML0A 1R3JA 4Y4KC 1NGYB 1FAIL 2AV7A 3ZKND 2FQEA 2F53E 3H3BC 5DMIL 1DEDA 4NC1E 3SY0B 2Q5BA 3KPSB 3VWJC 3ZL4H 4ZMZA 2W92A 4ZYKB 4TVPD 1X5AA 4RIRB 3FSWA 2H0PA 4JUTA 4S11A 5MEQA 1V5JA 3PGCA 4FFVC 1OARH 1GZHC 1HEJC 3IETB 4NQEB 3HFML 1H9DA 3D85A 3POHA 4NZRL 5C6PB 1UZ8B 3TX4A 2AK1H 3EDJA 4AX3A 1U6AH 1MDTA 2OAAA 4PV8A 2ILLA 4AVKA 2R1XA 1RMFL 4X8GA 3D3VB 3TTYA 4MMYB 2WBJC 4XP1H 2CHDA 3QIWA 5ENWB 4EIUA 2IH8A 2YN5A 2MRYA 3H9ZA 5IVNA 1GAFH 1K4DA 5EZJB 1KPUB 4JG0H 5C2BH 3CXFA 3MLTA 3OKNA 5AFAA 1P84J 1TZIB 2WQAA 1IM9B 3VW3L 1ZA3B 2AJUH 4RDQF 1M3IA 4MWFA 1N18A 5LBSA 1CL7L 4AIXA 1JXKA 1UWEH 2W59A 1AGBA 4HWZA 2PR4H 1J8KA 1HZHH 4PRNB 3QPXH 3TIDA 3RVXD 1BZ7B 2XA8H 2GJ6B 1EFXD 1L3WA 3NESA 1KEML 4G43A 2YGPA 3QWRA 4X6BA 3T3ME 1M7DB 3EJUA 1UA6L 2J55A 2VXTH 3E6HA 3HN5A 3QJHA 3D0AA 5DLML 3UCRA 4LSRH 3SCMA 1BZEA 1RUML 1WGVA 2HG0A 3RYMA 4PJ9B 1NAKL 3NIGB 4OSUL 3W57A 4OGYH 1FF5A 3BAWA 3WFDH 3IDMA 3NIFF 8FABB 4AV0A 2XXCB 3COOA 3JWDC 1QBMH 3RVWD 5J4MA 3BWZA 1V7NH 3ML9A 1IEBB 5LN8A 3FB7B 5FYKE 3BP5A 2XZAL 3FO0H 2ZJSL 2PO6C 4MJ5A 3TL5A 5E4AA 4OIAA 5KVFH 1OM3H 5CLYA 3TJHC 4MASA 1LDPL 1FFOB 1PX4A 1QFWH 3GK8L 3T1FB 2WWMC 1U8JB 4WK4B 1HXMA 1JI2A 4RA3A 2CLZB 1P4LB 4P07A 3DK0A 4YHPB 3K2UH 2XCMC 4W1TA 3IRPX 3ARDD 1G9MC 2XPGA 1SXAA 2A9DA 4WHYG 3BH9A 1NBVH 3BZEA 2VT0A 3FQTA 3MOBH 4LSTL 2WVVB 3EJQA 2UY7B 1FL3A 3ZKNC 1ZTMA 3GT6A 2VXUL 4X99B 3ZZQA 1FCGA 2AXWA 4OZIE 4A6YA 4NBXB 3ESMA 4XN2A 3D2UD 2VSCA 3BWUF 3L1FA 3B8YA 3D30A 4D0CB 1E50A 2GITB 2VJXA 3ROOA 4IU2A 1IC7H 1JRHL 4H8WL 3TN0B 1L6ZA 4N87A 4KRMB 4JFPA 1I85A 4NN6B 3U6RB 3JV6B 1IGYB 1OPGL 3ATEA 4V2CB 1UM6L 3GF8A 3RBGA 4QTIH 1EGJA 5JYLA 5JHAA 4NS0A 2I27N 3U2SB 1FI8C 4JFQB 4JVPA 4XMUA 2BP5M 3MO1B 1JZHA 1DJIA 2YXWA 4Y4HD 1BX2B 1SDAB 2VO8A 4PSPA 4DP1X 4DPBX 3QFDB 1EH9A 4ABVA 5HYJE 4ADIA 5CGYD 1CLOH 4OB5L 4UNTA 4DKFH 1OCWL 1ONQA 5IW3A 4QAMB 1A2YA 1NC2B 3CN1A 3UBXI 1NJ9B 1CBVH 4OFVA 2Z4QB 4U3SB 2OTWA 1P9MA 3K6DA 1HKLL 4WY7H 4JG1L 3TBVA 3RVXC 1ZHKB 1VFAA 2AZAA 4CC0A 3QJVB 4BYHA 2X6UA 4BZ2A 3AGWA 2ZOUA 3BKJL 3TM6A 1I1CA 1PZSA 4F8QA 4OCMC 1AZUA 3NA9H 2JB5H 2MOGA 5M7QA 2JJSA 3NCYS 4JRFA 4PWEA 1KFGA 4OJDH 1AOHA 1B2YA 4LDOB 1HEZA 3HR5B 3X1FA 1FHNA 1BGXL 2X09A 3ZT6A 3EADA 3F12A 4KJWD 1ORSB 4A2HA 5BS0D 5HHXH 4IS6B 3OVUB 5E5MB 1SOKA 4G9DB 3RVWC 5BRZE 3UAAA 2UZIL 1FYTD 1A4KB 3V4PA 1GYUA 1VPOH 3D39D 3S0PA 4TLUA 5EZOL 2ARJB 2ZZUT 3B6SB 3LPGA 2NY5L 2WSDA 1ZV9A 5I9QB 1FG2B 4OF6A 5DJ6A 1Z9MA 3UTZB 1MREL 2C3XA 3QZWG 2G3NA 3T65A 3WHE0 4Q14A 2ZE0A 5LUMA 4E68A 3UC0H 4OQ1A 5EO1B 4QYOB 4WK2B 2CXGA 4QJ5B 3GBNH 1E0OB 5L4JA 4NRZA 3ARDC 2K0RA 1KEGL 5I8CB 1PG7L 3DGGA 2R2HA 2VMEA 3P77A 2RHEA 2PYFA 4YHLH 1PMYA 2D7TL 5D1QB 2EC9T 3WNOA 5EOTA 4P9HH 2AVGA 1P5VA 4G6MH 4V1DA 1E9OA 1QBBA 4CADB 2VOTA 4RGNE 4WEUD 1XL4A 5D7LD 5CMAA 1Q0YL 1A6PA 5C0EB 1M7IA 2NY6B 5E0QA 5E9NA 2Y7NA 2YAOA 2K7QA 3RX7A 3WIHH 2AJYL 2GHWB 1XGTA 2VL5B 3VXRB 1Y0LB 4HSCX 5CJBA 1OL0A 5FFGA 3QNFA 5CJ8A 4N90D 5DURB 3AADB 3U25A 3OB0H 2ADIA 3K81A 3P02A 2G3XA 3M8OL 4JRYB 3CFBA 3N41F 2FK9A 1HQRA 1D5IL 1OAKH 3DOSB 4P2OA 5C92A 5EU6D 5CJQL 3GSQA 3H42H 5LG1A 3HE6A 5TE7L 1JPFA 2KT6A 2YKLH 4M56A 3VJ6B 1D5BA 4MX7A 1AO7D 2XWZA 3GSNB 4Q56A 3S3CB 4HZAA 4PRBB 2I24N 1UD3A 2MNWA 3QFJE 4X8CA 4KI5F 1N68A 5CGYC 1LO5B 1E4XL 1Y6MR 5E2TL 3D1MC 3ALXA 4TULL 1DLFL 2D4DA 4XGZA 4ENED 3GHBL 3O0LA 2WQVA 3WNLA 2H0JA 3IYLW 3O6FB 3DMMB 4N2IA 4MYWB 4TUOB 4Q6IB 1ZHBA 5JQ6H 3SHSA 3V10A 4HGWA 5L88L 3OAYH 4L1BA 2A83A 5T8IA 2Y25A 3OZ9L 3UG4A 3LTVA 1HHJA 3FT9A 4QYAA 3ULSB 3QB7C 4AGMA 4Y1AA 2O5XH 3UTTB 3WMQA 4YWGH 1IKFH 4K3DH 1I7ZB 4NHCL 5AL0A 3AITA 1B2WH 5JYMA 3RL2B 2EE3A 2JI2A 4LQ1A 3S7GA 1WAPA 4KPHH 1KULA 4ELKA 4KXAA 4XMLH 3DI3B 4J1UA 3RWIA 5D72H 2JI3A 4HVBA 3WSQL 1FH2A 5HDWA 1VDGA 4AYEC 1NUNB 3O41A 1FVCA 4Y16D 4HIXH 1PZ3A 5GSVB 2VC2L 4DUXA 1XMWA 4OD1L 1QTPA 3CSPA 5DRWB 1YEFH 4DP7X 1F8TL 3D5OF 1XZ0B 3ZQWA 4KFMA 4F15B 5EPMB 4G72B 4GMTH 4ZDHA 1RUKL 5L2KD 3KLHC 2IFFH 3IGUA 4NT6B 4PJAB 3CFCH 4TVUA 2DM7A 5FCUL 3FQUB 5GGQH 4D9LH 3V0HA 5B8CB 5HJGA 4Z7OB 5FYLL 2OCJA 5D7SH 5FAAA 3CFUA 2WHVA 1Q9OA 4HBQA 5DFTA 4LSPL 4QR7A 5E1QA 1NEZA 4FFYL 5IFJA 4UOW1 3ZE0F 3W11D 1B6UA 1IAOA 3DX2A 2MMXA 2ZKXA 1O7VA 1D5MA 1ZWIA 2X7LB 2E9WA 3HJ0A 4O51B 3SKNA 3TGXA 5BOJA 1RIUH 4M7ZC 3SDCD 3QYMA 1I3RB 3F7YA 2ID5A 3S8GB 5L0QB 3QFGA 3W1ZA 5CSBA 3TCLB 2UUDH 2OR9H 1J8RA 2B59B 3NN8A 5C07D 2VLRB 4JO4H 3RY5A 4ZO6A 1A7PH 2W60A 3OZLA 4L5FH 3MV01 4M9PA 4EIGB 4G8EA 4ONFH 4H2CA 2R0KH 4AJVA 2BMKA 3EF4A 2C9AA 1W0WB 3DHUA 4A66A 3O4LE 1KCRH 1U8NB 1Z3GL 3QUZB 3OWEA 5DT1L 5GJSH 4YDLB 1MAML 2PNDA 2V2XA 4I2XE 4ENEC 3LXCA 3SJVD 4Y2DB 3GI8L 2VDRH 3HAEG 4G8GB 1ZSHA 4PG2C 1PBYA 2OXGA 3KCPA 4BFIB 3ABZA 4GRMB 4L37B 4RQQA 3SOBL 4P9HC 1RAMA 1JK9B 3VG0L 4Q6YA 1ZS2A 5IW6B 5ALCH 2Y1ZA 3BT2H 1LK3L 35C8L 3MLUL 4HAFA 4OCRL 4D8PB 3HG4A 3ZRCC 1EJOH 3VFSA 5DK3A 1KCUL 4NKQB 3V0WL 5IMMB 4AMKL 3CTTA 3C60A 5JIPA 3SQRA 4PG9B 2JTYA 1XMEB 4HIIA 5LAPA 2A9BA 2PR9A 4K8RL 3N3EA 2JB6B 1HOCB 4LKXA 5GS0D 2VR3A 1U3ZA 3ECVA 2BOBB 1AS8A 3G5YB 4JZNA 4HPOH 2FYYA 4PRAB 3V4VH 2IQ9H 1MAKA 5J56B 4XOEA 2JCWA 4L23A 3DTXA 3MGTA 3CZNA 5CP3A 3MI6A 3NTCL 5KOVC 4XCEB 2B3IA 4M5ZH 4Y16C 2LVEA 1IQDB 3IM1A 3H1ZA 4JFEE 4BQCA 4ELMB 4FQIL 4O9HL 4FXGB 3IJSB 4PWHA 2ESVB 3MV8D 3QARA 5E6YA 3I9IA 3ZTCC 1AQHA 2HG5A 3ISRA 1GVIA 4DN3H 3ZDYB 3MRDB 5IK3B 2W0FB 4DEPB 4HFUL 4NDMA 1U8MB 2WSKA 4G7YH 1ZVSA 1YQVL 1S7QB 4MXQD 4QHKJ 2VZ1A 5B38B 1E5ZA 2A9AA 5IHUH 2D7MA 4UT9H 5ACZB 3BWAA 1T0OA 1CJYA 2W80C 4XN4A 4U1NB 3MBED 2DJSA 5HDBE 3L3IA 4PLNC 3LVEA 2KHAA 4HULB 2G3ZA 1BQ5A 1FO0H 3SDCC 4U1HB 5GS2H 4F24A 5KBKA 2XUWA 2JV6A 4N6RA 1OCZB 2OSLA 3VGGA 1NZRA 4H1LA 2X4TB 4LLQA 3C6SA 4P23B 4R0LB 3B4NA 3EH4B 2BDNH 5D7KE 5D96C 2QGCA 3LN4B 5IQNA 1OWRM 5FDWB 4G42B 3EO0B 5DZLA 5HHNB 2MQGA 2NNCA 2VDQL 4PS4H 3OKMA 2ZYHA 1VAHA 1JZ7A 3DRTA 5T1KD 3TVMD 3R8QA 1WUZA 3AT9A 4HPHA 4N2HA 4Y19D 4X9IA 5TQ2H 4YX2L 1U33A 3Q2CA 2XVLA 1BD2A 5LGYA 1AQ8A 2SEBB 2ED8A 2WN3A 3TOPA 3BD3A 2OZ4A 3KWXA 1F45A 2VDKL 4XP9L 3W2DH 4RWYL 3ECQA 1XGYL 3VXNA 3H4FA 2X4OA 4XPGH 1BVLA 3W5MA 3CV5A 3CDZB 1KN2L 43C9A 2ZSWB 4Z7QB 2GW5A 5DUMH 4JQIL 4U1IA 5E2VH 4X9BA 4KUZL 2I5YL 1U8OA 2WZ6A 1NOFA 3LN5B 1WG3A 2WBXA 1LEIB 3MRPA 5JUEL 1YMME 1D3CA 5A40E 4PCSA 5B1BB 3VFMA 2DYSB 1AGDB 3OJDB 4L8DB 4AENB 4U3XA 1K8IA 2TSAA 4GSQA 3ZKQD 3PHQB 1MH5B 4NKIH 1EJ6A 3FFOA 1WV7T 1FUNA 3KW7A 3OMNB 2PYED 4OFQA 1YNLL 4PJBA 3L3JA 4OGZA 5H37A 5GS0C 3N5AA 2A99A 1SHXA 1WWAX 3MRGB 4QRPB 1CWVA 1XF3B 4QWWD 3FPXA 1KGCE 4JAMB 4P3CH 2PWEA 3H6JA 5CXPA 5I74B 5C70A 4KV5E 2W9LA 3H6AA 5JLZA 1S46A 5IB2B 3P30L 2KYIA 2VR9A 3A6BH 4WFFE 1TQVA 2E3VA 4JFDA 3ARED 1CI3M 4KY2A 1B4JL 2E9IA 3SZ6A 5CWSA 3R06A 4GKNB 3VYNA 1I7TB 5DJ0B 5CP7A 4ZAKB 1HJBC 1XH3A 4K3EL 1RFDH 2NY2B 4R7NB 3T0VA 5CEZL 1JNHB 5DJ8A 2X28A 1I8AA 2Y7OA 5IJDC 7FABL 2BP3A 1AI1H 1AJ7H 1Y6NR 1I1FB 1PDKA 4BM7A 4QXTA 2XN0A 3VFVA 2QFRA 4FL4C 4AVJA 4OKVA 2P26A 1REIA 5E08L 2Q8BH 3LRLA 1E9PB 1FRGH 1RK1B 4NN7B 1QPKA 3AQXA 3VWKA 4MD4A 4Q9QL 1BP3B 2F7OA 5D1ZA 4R4FL 2XOTA 2DQFB 3IDIA 4QXUL 1TZ8A 3DARA 4DVRH 4P2RB 3ARRA 3RZCA 3CFQA 1U8PB 3FT0A 3CFIC 4NKOB 4PGBA 3BP7B 5EWIL 3CFJA 2DM2A 4Y9GA 1D5XA 4I9WD 4BXVA 1EZSA 3G5ZB 2HFGL 2FX9H 2XWTA 1MIMH 2VLKB 1QLEB 4FTVE 4BV1A 2MCG1 3TCXA 5FYKH 3PP4H 4N2AA 3TVMC 3CG8A 1S9YB 4X8JA 4XPBL 2PPAA 2DQUH 4JM0A 1KCSL 2YO3A 3PUCA 4OZFB 5KVGL 2W5PA 2NY1B 2CO3A 2Q20A 3IJ7A 2VITB 4ERSH 1N5AB 2FT8A 5CEXA 1HI6B 3BIBX 2DWDA 5FW7A 1BXAA 5TF1L 1ZLUH 2YAPA 2GBUA 3C9NB 3DXAE 2H2SD 1IT9L 5IQ9A 3A6CH 1UG9A 5FGSA 5JHDB 2V17L 5I6PA 1BXUA 2OZNA 2A77L 2XKNB 5DGRA 4LKCA 2Z31D 3L5WA 4H5SB 4ZUUA 3UGXA 2NY3D 2JKXA 5LBVA 4X6CB 2LTQC 5I1EH 1CFNA 5EC2A 1MI5B 1B4TA 2XVBA 3NFNB 2YAHA 4YHZL 5A2FA 1IMHC 2IALA 3FUMA 4JANA 1MW2A 3STZB 4ZMOA 5ESVB 3BP6A 3Q1SH 4M1GL 4CU6A 4Y5YB 1RHHB 2OL3H 1B0WA 4M6OL 1C5DB 1SVBA 4LPWA 2QMJA 1BQRA 4AL8L 3AREC 1SEQL 2AJ3B 43CAA 1F41A 4EIZC 4C4UA 5C0GA 2DI7A 3NABL 2ZYSA 4UM9B 5KBMA 1FAIH 1HEHC 4WU5A 2GJPA 1HSAB 5LNGA 3HZYA 2AAAA 4TQPA 1UFGA 4IIQC 3EKCA 1QFPA 4RSVA 5DMIH 5T1DL 2XXFA 1HHKA 4KMLB 4P04A 1SJMA 1MJJA 2CUIA 2C1OB 3WS6A 2XN9A 1YEEL 5EUOA 3RAJL 1E5UI 1YA5A 3AG2B 1BA9A 4ZPTA 2D3NA 5DDHA 1GYWA 4I85A 3ZE2F 2ENYA 1JZJA 2H0EA 4NZRH 4B6ZA 2AQPA 5E24E 2Y2TA 3VXMD 4GP4B 2IDUA 1PJ9A 1SQMA 4NC1C 3OMIB 2IPKB 3OSVA 5E9DA 5E8NA 5HI4D 3O3DA 4ZMYA 3D4GA 4Y5XA 4DP6X 1PNCA 3APNA 1TVHA 3SGJA 4KK9D 3RKDC 4YSDA 5B3SB 2YZ8A 1N7ML 4M6AA 4CVWA 5B39A 3RY6C 1RUAL 2OKMA 4OLXL 1SLWA 4AMXA 3SE4C 2WNKA 3BUPA 3SCMD 4OI8A 3HVDA 3VW3H 1USZA 1PTZA 2X2JA 1CL7H 3NZUA 1JPTL 4PRHA 1P4BL 2E47A 3DX0A 4Y88A 4IBZA 5C0BE 2P3YA 1KEMH 4ZFZA 3GSWB 5DK0B 5BRPA 4GQPH 5C7XL 2EEBA 2NTFB 5C0AE 4AYDC 3VMNA 2VLJE 5C0IB 2H2SC 3P9MB 5DLMH 3IMRA 2APSA 4G8FB 1NAKH 4OSUH 3AABA 5LNDA 2Z31C 4P5TC 1I9RL 1QRNA 4RVBA 2NY3C 3QQ4B 3ARFD 2PMZA 3SDDB 4XR8C 4PJHF 2XZAH 5IQOA 1CUOA 1XCTA 3T6QC 2QVTA 3H2QA 3VFTB 3N91A 1XCXA 5KVGE 1P7BA 2ENSA 2XQYA 2R2EB 4TTGA 3GK8H 1UXWA 4PM1A 4NIKB 5BRZD 3IPFA 2AF2A 3UZQA 4RAUA 1BWMA 1II4E 2EDMA 4KRPB 3RWDB 3MGOB 3ZKMD 3I6SA 5IJKA 3RWFA 1T6VN 3JTSB 1T20B 3VRLF 3OKOA 3L5XL 1KB9J 1PNDA 2FQFA 1M3JA 3HHSB 5GHWH 4TUKL 1I1RA 4LSTH 4JO5A 4NQTA 3VMPA 3S2CA 1N4XL 2VXUH 5F88A 4KVPA 4LLUA 1N0LB 1HSBA 3K4DA 2FEDD 1BBDL 3WE1A 2JJVA 4PPTA 3BIKA 5LKNA 3WN5C 2GHZA 5DQ9A 1JRHH 4YE4L 4H8WH 4PFEA 3UFIA 4M02A 1QLFB 1NCGA 4W9CC 3KLQA 1ID2A 4LIQL 2D73A 1N0XL 4XNMB 1MRCL 3WI9A 3PAVA 4XC3L 4UAOB 3T0DA 2FL5A 1UM6H 4NWUH 3WS3A 4GPVA 1MCWM 4KDVA 3IDUA 3U4EB 3RHWK 3OHXB 3Q3GB 5HI4C 5A2AA 3H9HB 1MCRA 2P5EA 4DGYL 2FE0A 3ESVF 3K1DA 3LEYL 5DZJA 4AT6B 3V9EA 1KWKA 2VERA 2VR4A 2ADGB 2EVFA 1T22A 1BXXA 4LCVA 3BRFA 2DQIL 1QASA 4OB5H 1OCWH 4MLSA 2MOVA 3HMXL 2V2TA 4BH7A 4UDUB 4F2ME 1QBAA 4F7PA 4HUMB 3VXUB 3BFWA 2BZ7A 1P2CB 2IXQB 4UMGA 5EU5A 3ZN6A 4DZ8A 4L3FA 4Z7UF 4A2EA 2L7JA 4JG1H 3CCHA 5J7CC 4WKXA 5D6CB 4Z7UA 3BOVA 5I6XC 3BKJH 1EXUA 5F89A 1NAMA 3QFJD 1NGPL 5EA0L 3QUXD 1RKRA 5DUBA 3NJFA 3HE7A 3QRGL 5KS9A 3TEWA 1HOEA 3EYUL 1YAIA 3QSKB 4JZOA 3QIBB 4FXKB 3ZU8A 1BGXH 3UAJC 5C0DB 1P7KB 3ZHKA 3KPRB 3ARFC 4QRQB 5KVMC 4PS8A 1TTUA 2UZIH 1YPZF 3A4AA 2JKSA 4AEFA 1PVHA 1IGTB 2VSDA 2HJFA 3T2QA 3FT3A 2PP9A 3GMLB 3NJKA 4F33A 5AOJA 2NY5H 1MIEL 2QKIA 4MJIB 2BIOA 4GP5B 2IAMB 4YHIA 1T0NB 3BQUC 3TEUA 3UBXG 1MREH 1DL7H 3EGDA 4BJLA 4U7SA 2YSSB 4JM2D 3KXFD 3N42B 1FN4B 4E9LA 1A02N 5CBAA 4ANVA 1T3FA 3Q05A 1XXFC 2DDQL 3ZKMC 1L9PA 1KEGH 1PG7H 4Z7VF 3RPIA 1JNJA 4KDWA 4D0BB 3ARZA 5J1AA 2QL1A 1KJVA 4WI9A 4M4PA 2J6EA 1X4ZA 2G2RB 5E00B 4UQ2A 4Z7VA 3S4SG 3LD8B 1UJ3A 5T5NG 1JN6A 4V33A 3NCYP 4ABQA 5A7EA 4OCSH 1Q0YH 3EYVB 4OFYA 5HHME 4E41D 4ZW3A 3KNBB 1TITA 3HE6D 4AKOA 5B7FA 2AJYH 3GUFA 2WGNB 3KPMA 4LQFL 4JVWA 1W9XA 3BGMB 5DVOA 1G1KA 4N26A 1SVCP 3V79C 1F1GA 4X5LA 1LEGA 3QAZC 3TZVA 1WWBX 3LPFA 3P4OA 3RIFK 5KS9B 1TETL 5CJOL 3M8OH 4W9IC 2ZOKA 1JHLH 3IFOB 2NCEA 5F1OB 3B1TA 1AZNA 2XBTA 4RGNC 2CO6B 1D5ZB 3QJZA 3ZKSD 3Q43A 4FJ6A 4YFLF 1W72L 5DHVB 5CJQH 1C08B 1PF3A 3WTYA 1CBJA 1XT5A 4Y89A 1P7QA 3RUGF 5CFHA 1JD7A 4DKTA 3GRWL 5DS2A 2GAZA 2OR8A 5E4IA 3DBXA 1SMOA 5BQDA 2CJUL 1NBZB 2EJ1A 1DVZA 1KXTB 2LE9A 1E4XH 5E2TH 1CDJA 4FJYA 4TULH 1DLFH 5H94B 3K91A 4YZFF 1CTOA 4YNYA 5A7BA 3EYOA 4LCCB 1OZTG 1DTUA 4LIQE 4WI8A 3JVGA 1QNZH 5IV2A 5DVKA 4LL4A 3WAJA 5FYJU 1JGDB 5F8QC 3FONB 4HP5A 4J3OH 3QEHA 4GT0A 5L88H 4PB0L 3I02A 5C0FA 2G75B 3QUXC 3OZ9H 1F4WL 3BSHA 2X10A 5DRZB 2WLNA 1S7WA 2GIYA 4WCYL 1QFWM 3A47A 4F8LA 1ID5I 3HBGA 4JFFE 4FYRA 4NHCH 4U1LA 5L8LB 4H8WC 3WGVB 3QNXB 3ZDXB 1OT1A 1CIUA 4JFTA 4AYSA 1RULL 3O6ML 3F01A 3FT4A 2X42A 1QFWI 3L2NA 3UMTA 1KIRB 4KWUA 5IR1A 2VQ1B 1KB5L 3QZLA 5LG6A 2D03L 4O2CA 2X3AA 4P5MA 3WSQH 2VDOL 5TFSL 4YEFA 5BQ7A 1LP9B 4MDRA 1GJWA 2WXFA 4MCZA 4MB1A 4WHTA 5GRVL 4OGXL 5KG9A 3VFRA 3K2KA 1WICA 4ENZA 1OCOB 2VC2H 4JM2C 2H8PB 2G60H 2JSFA 1FP5A 3QDMA 4OD1H 5JOFB 4I5BA 3V0DA 1F8TH 4JDEA 4HV8A 1HNGA 1WA0X 5GZNA 4JK0D 3TPKA 5GGRA 1RUKH 1FNSL 4NBZB 2KLTA 2ITDB 2JKIS 3QAQA 1JZ3A 2A73B 1KNOB 3UC2A 4GRLB 5FCUH 2YUXA 1KV3A 5KTEL 1ZGLB 5F7HA 4PP2A 2ZG3A 1D2PA 2F7RA 4LSPH 5HYSB 5FO9A 4J2XA 1SF3A 3GI9L 4J3OD 4YN3A 4FFYH 4WFGD 5KSUB 4YDVA 3VXSA 3FTSA 4JHUA 2E7DA 5JDSA 4MVBC 4DH2A 4OM0L 4CMMB 4OD2B 1E42A 2AQ1A 3BPOC 4OT1L 1TEGA 1CYXA 5I76A 1RD6A 4HDIB 4UTCA 4XMZA 4DUVA 2ZOOA 3O4LB 1A9BA 1W8NA 3CZLA 3TBTB 2D2OA 3FUFA 3IF1A 2L7UA 3MCLL 3X1EA 3MJGX 5FLVA 2IOOA 5E7BA 1KDJA 3BO8A 2Y2YA 5G4MA 2OYLA 5LXVA 1AXTL 2RD0A 1DZ0A 2P49B 4TM9A 2XX1A 3BUBA 1RJYB 3N1PC 3X17A 2NY5C 1J1XH 4WUUE 3GEFA 3SDAB 2C4FT 1G4MA 1Z3GH 3FH8A 4EI5B 4M61B 2R4SL 4L9DA 3WO3B 3QUML 4GIPD 5DT1H 1MAMH 3KS0H 4MDIB 1PAZA 4WRLA 1BDYA 5D7KD 3VXOA 2N7SA 2WIMA 3CXDH 3B3BA 3DTDA 3PYCA 3MRQB 3KWUA 4EXPX 5IHBA 1HL4A 4Z7WE 2NXYB 1HINL 5GRYA 2YLHA 2HX7A 1VACB 4G5ZL 5JPMA 4U7MA 3SOBH 1M7UA 5MENA 1A4AA 4U1JB 4U1KA 2IQAB 3VG0H 3VQLA 5FYLD 4LDLB 5IB5B 2XBDA 4U6TA 3G5VA 4CL7A 2KPWA 2BY1A 35C8H 4OCRH 5GGSA 3O9WB 3L9YA 1BMZA 3PV6A 4LEOB 3CSFA 3V0WH 3X14B 2DQCL 1IL1A 5IVXF 1QI5A 4J3WA 1MWAA 2WTOA 2WBWB 4YR6A 2P47B 4ZFOA 3A23A 1BECA 3U0WH 2NZ9C 4PW9A 2IDCA 4YVUA 1ACXA 1MCFA 4PI2A 5SWZA 5E8PA 1R5VA 1S7TB 4NO2A 4LVEA 1X9RA 4AWJC 2AAVA 5KUKA 2WTRB 2XFGB 1AZVA 1YMMD 3IRZA 3PY9A 2RBLA 3W9DA 2X0VA 1J86A 5L2JA 2P80D 3FRUB 3MNVA 4WIQA 4Y5VC 2JKTM 1WTLA 2WSPA 2IV8A 2W8CA 5GGRY 4G3YL 1DCEA 5D2LE 3NSCA 5I8EA 3UG5A 4N5ED 4N9OB 4FQIH 4O9HH 5I2IB 5J5EA 5BJTB 2EDLA 3MV7B 1TYEB 3L7FA 1AFVL 1N67A 7PAZA 2X1OA 3QXUA 2E9JA 1I3VA 1F6AA 1CD9B 4HFUH 2FWOA 3UOAB 3EZJB 2O6EA 3EJSA 4WFFD 4PJ5E 5E6IA 3B2MA 4MCYA 1PKQA 4X6DB 4J3OC 2WNGA 2LQRA 3EOAB 2I9LB 1X5JA 4RFNB 4QHUA 5KANI 3ZIMA 4R5XA 1OAUH 5GS1C 3K0YA 1A1OB 1BD2D 4WJKB 1XTMA 4HFWA 4L8CB 4HLZH 4W9KC 3U83A 9PCYA 4K8RD 3WFHB 4NQXB 3CPLA 1OP3H 1OP5H 1EO8L 3N85L 3OPUA 4HEME 3E3QE 3ZZLA 4CBZA 3AC0A 3U48A 4QTHA 5F7NC 2VDQH 4G70B 3QRBA 2HFFB 1TEYA 3UBHA 3BLBA 3GZQA 3OX8A 2J5WA 4BZ1A 3GSVA 2QV4A 3MUY1 3A5VA 1QLRA 5TE4L 2EIJB 3UGUA 1FVDA 4YX2H 1SN5A 4XXDA 3DECA 3FT1A 4XNXL 4NQEA 3S2AA 3AG3B 5DO2D 1WS8A 4N2EA 5J6GA 4WAFA 2VDKH 4XP9H 4RWYH 1C7SA 4MMXA 3LCYA 3HZMA 4NKMA 1KN2H 1ZVHA 2FUTA 4WSJA 3F5WA 1Z9NA 3SZKC 1BWWA 4JQIH 2OMVA 1HU8A 4FTVD 2I5YH 2JQAA 2ITFA 4KUZH 1MLCA 1TQCB 3QQDB 3BISA 1XGRB 2YQBA 5CLXA 2AQ3A 3LIZA 4RMSA 5E70A 5HI3C 5F9JA 3WXVL 2F1EA 4R83A 1JAEA 4LCYA 1CGSH 4XCNA 1JTTA 1EUTA 1NIEA 1YNLH 1A1MB 5HGHB 5DVPA 4WZ9A 4OVVA 2WTPA 3RJDA 2FQGA 2YPVA 2M2DA 3EJCA 1XIWA 3SKOA 1P5UA 5IW1B 3HA0A 2EC9U 4PRNA 4JHAL 2NUPA 2GJ6A 4R4ND 1TCMA 4OZ4A 1CXLA 3H85A 1FL6B 1M7DA 3P30H 4ZFQA 5KJ7E 1BF5A 4NEHB 4WENB 3TIEA 2OMYB 3CFEB 5BRQA 2XQBH 2VKWA 5HGBA 3NIGF 1IGML 3LEXA 3L1EA 3ZDZE 4LVHC 1B4JH 1YG9A 2NLJA 2IAND 2PCPA 1UT2A 2PWFA 5ETUB 3RWHB 5ERWB 5LCVL 3A0OA 3WY4A 4K3EH 3MRFB 4F1ZA 3P3SA 3KYOA 4LE8A 1CTMA 1N6VA 2L3BA 2APBA 7FABH 2Q7YA 2BC4B 2GSMB 3WIAA 4B53A 2NR6A 3FB7A 3L3OA 3KBEA 4XI5D 1GOHA 4AJYV 1I3UA 3IDJA 1DO6A 5E8OB 1ET8A 3QDJE 4DOHE 5E08H 2Z65C 4MJHA 4PJIA 5JPNB 1CFSB 2J3SA 1FFOA 5I6OA 3RWJB 5AYQA 1G9HA 3IN2A 3MV9E 3LS4L 4Q9QH 1ZV2A 3P2DA 2ZAHA 3GDCA 3TEXA 4PJXB 4R4FH 4K8RC 1UHVA 4F80A 3NP3A 4OBSA 3ZTJH 4PTTA 2I69A 4L48A 2FYVA 1QA9A 3BVNB 4MZRA 2JI1A 4ZX4A 5EWIH 1SVZA 2GJRA 1VGKB 1PYWB 4GUQA 1ZHLB 4IRSA 5IB1B 3HLAA 3QWOB 3EBAA 2MTAA 2V33A 4XPBH 2GITA 3FU0A 4P4KB 4NERA 1KCSH 4W81A 1WWCA 5KVGH 5M94B 2MWCA 2CDEB 1FJ1A 2XFXA 1UH2A 2LHAA 1O9WA 5TF1H 1KJ2L 1MRDL 3ET9F 1KBKA 5CEZD 3K8LA 3PL6A 1JCKA 5GS3A 4WSGA 4U3CA 1PIGA 1IT9H 4XMXA 1Q90A 3HG1E 2V17H 3NZ8B 5C8JA 1GR7A 4J28A 2A77H 4KX7A 4ZXBA 1EEQA 1G6RB 3DROB 1X5MA 1T04A 5KYXB 1J0KA 3ZX1A 3BMWA 5C0BD 1MLBA 3EDKA 4IRZA 3NDYE 5CKAA 3S5ZA 2OJZL 3CX2A 1LK2B 3QZOA 4PJDB 1IAKB 4Q2ZA 4QRUB 5DK2B 1EZVY 2E7LA 2VLJD 5D1XE 1CFTA 4YHZH 3GHEL 4JDVA 4JQXA 5KBNC 3CBJB 2H41A 1G5GA 4EKXA 4E9SA 3K6SA 4KRNA 2X4QA 4M1GH 4ZPVA 15C8L 3IXAB 1NDMA 1T7XA 3QZMA 2YA0A 4M6OH 3HG2A 5MEOA 3QO1B 1ROCA 4OFKA 4PJ6A 5CSGA 4NSKA 1SEQH 1BZ9B 1KTRL 5C0CE 1D9KB 1TZGH 4QHNB 5FV1L 2K1MA 2WWOA 4F7KA 3NABH 4FMFA 3FNKA 1EFXB 4AGNA 3G6AB 4QJ4B 4KDTC 5AG9A 3KZ8A 1TTRA 1N59B 4NNYB 4PS7A 5I66A 2OCCB 4HUWA 5T1DH 5LNEA 3MU3A 2ZUQB 4OH2A 3TH2T 2FVNA 3RL1B 3W9EB 2FR4B 3ALWA 4ZMXA 2IPTL 4XI5C 4FNUA 4OV5A 3MX0A 1LWHA 4R2GC 3RAJH 4OVUA 1IKNA 4F3FB 5JHLA 3MKKA 1A7BA 5IQ7L 2CHWA 1FVEB 4CU8A 4E42B 3MFFB 4KOBA 3UTZA 4LLWA 2GVYA 4OF7A 3MOAL 3T4YB 3NIFE 2RACA 4AOFA 4HQQL 2HYMA 2E46A 3REVB 4LPVA 5DYOA 3WEXA 1EHXA 4PRHD 2Z7ZA 1ZE3H 5JQIB 5GPRA 5CCKL 3SSGA 5CILH 2XWBB 2BHZA 4L4TB 1BZOA 3B9AA 3MYJB 4N28A 3I85A 4AQ8A 1SXSA 5EOQL 5C0AB 1N7MH 1ZXKA 3BDXA 4OLXH 4PREB 3QIUB 2V7HA 4OUOA 4QHKI 2JFCA 1PLBA 3ARDB 4HC1A 4XX1E 5AVRB 3IEAA 4L4VA 1I8LA 2QEJA 5SX4H 3CAFA 3WENA 3NEOA 4ZS7L 1QSFB 2PW2A 1G1CA 1JPTH 1P4BH 3RGVB 4KJQC 5ID0B 3BYTA 2F08A 2R83A 4U6XA 2G9HB 5C7XH 3G3LA 1OLZA 1BOGB 3GQFA 1JGIA 4IQHA 4EN3B 2DBLH 2WP3O 3HZKB 4Z0XA 5AAMC 3TO4B 3QISA 5K9KB 3ILPB 1RERA 3U7WH 4F27A 2AEWA 4Z7AA 3GM0A 4KZDL 1AD9B 3ZQ9A 3GXNA 4JKMA 1KIPB 3GSNA 1F56A 2X12A 2VSKB 2ZKYA 4Z77A 5F6IB 2KUTA 4Z76A 3L54A 2BSCA 1P6AB 3QJQB 4PRPE 3UTQB 4ZW6A 5EZLA 5DFWH 4Y4HB 2JCCB 5FO7B 4LK4A 2HKAA 3MBWB 2WQ8A 3P9WB 2CHNA 3KYNA 5F2FA 3AY2A 4Q6IA 5I1LB 3KJ4B 3ES6A 1ZVNA 4TNWF 4WU7B 3U0PA 3K72B 3UYPB 2IGTA 5D7HA 5T3ZE 1THCA 1A22B 2X0UA 3F85A 4A2DA 2VR6A 4PR5A 2F74B 5F1KC 2ODHA 5FA3B 3L5XH 1ERNA 4KK8D 4U7KA 1QMUA 4TUKH 2ITCB 3M6DA 3MQIA 5DHEA 3RL2A 1N4XH 1FGVL 3HNSL 3GINA 1BBDH 5IMOB 3FOLB 4X7DC 3THML 3ARBD 4PSRA 4J6IA 5I71B 3B9KA 3D87B 4G7QB 4WWKD 5HGDA 3W82A 4E2OA 4WK0B 2CLVA 4HX1A 4ONOA 4XC1L 4YE4H 1EDQA 4CVXB 5BS0B 1QACA 4LIQH 4FERA 1DBAL 3VFOB 4FG2A 1MRCH 2IH3A 3LEVH 4XC3H 4XN8A 4C83A 2PUQT 4PRID 3OQRA 5FB8A 1XZ0A 5J12C 4TYUA 4UUJA 4PJAF 5EPMA 2N0MA 4XPTH 1B6DA 3CLFL 1FZMB 1G7HB 1JDCA 4WFHD 3RX8A 4DGYH 4Z7OF 5K9QG 1MHEA 3LEYH 2QSVA 1ITCA 1B0RB 3AU1B 5AW8B 3QC5X 4GJTB 3ARGA 3PAZA 2QKSA 1NWPA 2DQIH 5IOPA 4I18B 3CZUB 4CSPA 3HMXH 5CJ5A 1L5GA 1VFOA 2XZCL 1DFXA 4AL8C 1UVQA 2WQWA 3L4YA 4Z18A 1JPGB 2N59A 4YQXL 1GIGL 3SE3C 1G7IB 2YEVB 2YFNA 1YMHA 2QPFA 5MI0C 4WO4A 3IFNL 1XAKA 3QXAA 3LMJL 2V5RA 3TCLA 2XIIA 2ZUVA 3DPBB 1NGPH 3ZVVA 5EA0H 4MNQA 2XWJB 4HD5A 5F9DC 3LB6D 3QRGH 2JKNA 2VLRA 4AE1A 1QOKA 3EYUH 4IBSA 4JE0A 3TEYA 2GB2A 1RZ7L 1T21B 1TEFA 3MRMA 4D7PA 1G7JB 5J11B 4FEIA 1EJFA 3BKML 3C2AL 5EIVA 1XF4A 3S98A 1EX0A 2J8UA 3E2HB 4XNZB 1LO3L 3JV5A 4P3WA 2GY5A 5KYUA 1J8HE 2DQJL 5EU6B 4D0DB 4HAGA 1JTPA 4X4XA 1KBWA 1FNGA 1MIEH 3BFOA 4OJEH 2R2BB 1ZE3C 3GJFH 4RWHA 4XAKD 3ZBMA 4K7PX 4P46A 5HHMB 2GFBB 1S9XA 4MMZB 1HL5A 2A2QT 4YO0B 7TAAA 4GY4A 1J11A 3HUJB 4KI5E 1IV8A 3I3DA 4N0FA 4RFEB 2DDQH 3TO2A 3E9TA 2WZPA 3IJYB 4GS7B 3PLYA 4M6ML 4KK8C 1CQKA 2CIIA 2ZUTA 2JH2A 2Y72A 1HFUA 1MFDL 1TOXA 4QRSB 4IMLA 2Q7NA 5BO1L 4JFYA 1I8UA 4M5SA 2OS7A 5BVPL 2AXGB 5LAXB 5JHMA 3ARBC 3O3AA 3GJEA 4LQFH 4WWKC 1F5WA 3NJLA 4LCUA 1VERA 3BSZA 1J1PL 4ELMF 1AXIB 5EN3A 3NJGA 4M6NL 1ZT4B 3QG6A 1TETH 4H40A 3RDTA 4XZUA 1JK8B 3VXPB 4FXGA 4ZSOB 4MB5A 3UTOA 3KJ6L 3F7VB 3ZDYF 1AKJB 2P5WD 3OXSA 4DVBB 4K9EL 4PJ8D 3QP3A 4ZOCA 3HHMA 1CL7I 2W0FA 3MROB 4N20A 2BHFA 3GRWH 2XG4A 1HE8A 3AVEA 5I8OL 1TZAA 1MWOA 5C0JA 3N40F 2CJUH 4XWGL 3QEUB 1OD7A 4MJJA 2GBTA 3R8BB 5L2KB 2F6AA 2JLLA 1W6LA 1WH0A 1KV7A 4FFZA 3VQMA 4DF9A 2Y3AA 2ZICA 4XNDA 2VMDA 4WKZB 1NFDA 4JFZL 1CDUA 1CDGA 3FULA 2IH1B 4PB0H 4P23A 1U8CB 3BH4A 1F4WH 1O75A 3VH8B 2GT9B 2H32B 3LB6C 4WLCA 5D7JB 1V05A 4ZS6D 3ZE0E 1QVOB 4WCYH 3IDGB 3I75A 2P4AB 3SDCB 4YLQT 1M6UA 3HFFA 4W9DC 3CQPA 4GBXB 3WE6B 4AH2B 2B0SL 4ZFFB 4PWKA 3O6MH 1DBBH 4PHZA 4AVIA 3RHWF 1DJWA 1PZBA 1KB5H 2VR7A 1JGEB 1J05A 2D03H 5SWQA 3CN2A 5AOIA 3T1WA 3V6OA 1KENL 4Z7QF 4L3EA 2VDOH 2AERT 3VSQA 4AQEB 5TFSH 1EQWA 4HWNA 4KROC 5I1DB 2NX5D 3N40P 4HWBA 1Q72L 2ZSWA 4NI6A 4OGXH 2A6IA 1FAKT 3VGDA 5EIIG 2N3JA 4XCFL 3D7PA 4U6HB 2G0LA 5FWRA 4NBYB 1FNSH 4IGBA 4AENA 4HJ1A 1ADQL 2WO2B 4F2FA 1HHGA 5FGCE 5HJBA 4DKDC 1JRHI 1BBJA 2YGQA 2ZXCA 4HUUA 2VTFA 4HU8A 1DUYA 4PVNA 3W0WA 4CAGA 1I8KB 4M43L 4JPIA 1A9EA 1JZGA 2CO2A 3K2IA 4RLDA 4XMKL 3PFQA 1VCBC 1IBZA 3GI9H 1BV8A 5AZ2L 1SN0A 4JAMA 5FUZL 4CN1A 2MHAA 4OM0H 1Q0EA 5K9JH 2Y6TE 5L9DL 4NZTL 4OT1H 2C3HA 3VSUA 2Q7AA 3LZPA 4LCWB 2Z8SA 3RZWA 1SYVA 1DSWA 1Z32X 2Q76A 1X5LA 4YBLB 3JTTA 3MACL 4N2GA 4HIEB 1AR1D 1F13A 5ITBL 1YNTB 3HCVB 1IBBA 4XXWC 1NC4B 3RX9A 2C9VA 5FFOA 4PJ8C 4Z7WB 3PE9A 3WTXA 3BKYL 1L9RA 2BSEA 3BJLA 3VE0B 1YY8B 3ETSA 3N55A 1PY4A 5FYKU 2QZ5A 3H0TB 2QJDA 2R4SH 4IOIA 4ODXB 1MCNA 3OF6D 3QUMH 4OZHB 4YOKA 4X80L 4DGVL 2X2IA 3ZSTA 5I19L 4BKLB 3JWOL 4RMRA 4WW2C 1A3LL 5IFAL 2WZAA 3OAUH 2X5PA 3EYSL 1FLTX 3CHSA 1CFQB 2VCOA 4HMDA 3A24A 5SV3A 3RGHA 1R3IL 2NNXA 4OIFA 1WGOA 3MRKA 1Q9WA 4WHCA 2X4SB 5KAQF 3MBEB 3OAZK 5CIPA 1P84K 1FFNB 3IFLL 5KYWB 4UYPA 5H2BA 3SKMA 3KDMA 3HS0A 4FA7B 1TSHA 2DQCH 4GW5A 4UQ3B 1RJZA 1ETZB 1H3WM 1ZGLM 3G6DL 2IOIA 3Q44A 4PN6A 1MY5A 4C8XA 3KVDD 3KDPB 1S5HB 5J6HA 3QH3A 3VI3A 2QTEA 2EEAA 4U1GB 3FFCD 2COVD 4J3XA 3VI4B 3ARWA 1G1OA 4HT1L 1CDBA 2E27L 4G3YH 4URTB 3IXTB 4GNKB 3ARXA 1XB8A 2WP3T 4FQCH 4KK6D 3MPCA 4ZK8A 3UBXA 4BSVA 4JREB 3TYFB 5I18L 3BAIA 4CUCA 2XKNA 3C5ZC 1M6OB 1WIOA 2V3DA 4WVRA 1AFVH 5E95B 4X6CF 4F37K 3PJLA 4H5SA 4I0PB 4QF1B 3GUTB 4GUPA 4X6CA 2J1KA 4OIIL 4JRLA 3MV11 3V7AE 5IY5B 1MI5A 1BLIA 5DQJA 4Z6AT 4X5RA 3AG4B 1KTKE 3BYYA 3S4SA 1VADB 1FLRL 3CC5A 4BEIA 4BUHA 2ROYA 1EZUA 3DJSA 3GMOB 4TNFA 5JORB 3REWB 4I3SL 1IJ9A 4OF5A 4R97B 1IB5A 4F58L 4Y5YA 4KC3B 1RZGA 2PYEB 5DWPA 2KDYA 1ACZA 1G5AA 3QI9A 4HCRL 2HLEB 3EDDA 4CSTA 3L4XA 2PP7A 3PP3H 4YDJA 4F9PA 3NCXA 4MBRA 2JWYA 4LASL 5D93C 3ZJAA 1MCOH 3GTTA 1E4XI 3MLXL 1MCLA 1OO2A 2QGEA 4X5PA 2YS4A 1ZLWH 3STLB 4P48A 2QPUA 4JFDE 5DJAA 2IDTA 1AXSB 2C1OA 2HUHA 4UTBL 3DVNA 5TE4H 2NW3A 1DQLL 3BN9D 4E9YA 5AZEL 1E7UA 2VE6B 4XNXH 2FJGB 2VLLA 5FM8A 3U46A 1MFEL 2OMBA 4WTQA 4NIYE 3E3QC 5GZOA 4PW4A 2IOMA 1TZOA 3FU7B 3U0TB 1JWMB 5AAPA 1DN0B 4YC2B 5KANG 1HYRC 3BD4A 3EGSB 4MNGB 1YEJL 5JXED 1OVZA 1T1XA 2IVFC 1X6NA 1U3HC 1IEAB 5HHOE 2Y3NA 5GRWA 2PCFB 4DK6A 1WZKA 1CYGA 4IKLA 4JRXE 3AS3A 4UMSA 1KGYE 3HRZC 1JF1A 3V6ZA 4F2EA 4JLRA 2D7NA 2ZOLB 2X4PB 3JVFC 4IHOA 4HOMA 4BQ6A 4ODSH 4PGDA 3F7KA 5T5FL 3G7TA 5ISZD 1A3RL 4JHAH 4LRIA 1TVDA 3L3KA 1E27B 1UWXH 5JW3L 5HP5A 5E2JA 2Y1AA 4GAYA 1HE7A 4AY0A 2VZTA 2KBGA 1UZGA 3S5YA 2NSXA 1IGMH 4AEHH 1AE6L 1JP5A 1N3NB 1T89A 4K73A 5D1XD 5DJYB 3T0EE 1S8DA 5LCVH 4U6YB 4WFED 2BNRD 4U0RB 4LT7A 3OGCB 3BAJA 5GGTA 3PWUA 3HG5A 1B0IA 2XY2A 4JZJA 2EVHA 3VU1A 5FPIA 4PLOB 3S3SA 3FSZA 5IHWA 1DEEB 3GSUB 3ILEA 1Z9SA 2NY3B 4CMHB 4XPHL 1UASA 3BHBB 3MRRB 5JIIA 2DD8L 1R4XA 3PWPA 3NJHA 3EGXB 4YAQA 2NY0C 4ZO9A 3CDFA 1R3JB 2FGWL 1XSOA 2ZP0T 3KBHE 2AV7B 3MJ8A 4M93C 1K8DA 2YA2A 5LGJB 1OCCB 3D25A 3KPOB 1MDAA 3FU9A 5ADPH 3LH2L 4UILL 1INDH 3GZPA 4NQCA 1CK0H 4N0UA 2XTJD 3BJ91 1N0LA 2YXMA 3B1UA 5MEQB 1M2VA 3RPBA 1G0XA 3NVQA 1X5HA 4LNRA 2O93L 1PQZA 1SOSA 3T4AA 1ZT7A 3D85B 1ILUA 1SBSL 2BPBA 3BN9C 3NSYA 1ZA6A 3IDXL 3SEPA 5DHYA 3F83A 2F58H 2K7PA 4PV8B 2R1XB 2EECA 2DQDL 4GIAA 1EEUA 3O81A 4LP8A 1MRDH 2XN9E 3QG7L 4PBDA 3FU3A 2VDNB 2VXQA 5EUOE 3G9AB 5T3ZH 4LF3A 2X6BA 1OP9A 4XP5L 5SWSE 4YSCA 3RQ3A 4EMZA 4M3JA 4AC4A 2BFGA 3OKNB 5D6DA 5JXEC 3SQBB 2X4UB 4ANUA 3II3A 2ETWA 5CN3A 4GAJL 2I07A 2ADGA 3G04A 1BQHG 1WIUA 3HC0A 4JKKA 4MWFB 5D9SA 4X5WA 4Y9CA 1XCWA 5E9DE 5F3HA 2CMRL 4HWZB 1AGBB 1QABA 3RB5A 5J13C 3TIDB 2DIJA 1VFMA 5H4YA 3U1PA 3GHEH 4X6BB 3KGTA 1IBDA 1AIZA 3E6HB 3FRPG 4CJ1A 5A2KH 2C7UA 1F2QA 1RPKA 3FMGL 3QJHB 4OV6F 5AOZA 15C8H 3V4PH 3SCMB 3CHOA 1KXVC 2RGSA 4OY9A 5FKAA 2BIIA 4Y4FD 1IGFL 3CXHJ 4BINA 1DO5A 5CN2A 1CGTA 3IDMB 4MQ7A 4MZ3A 2XNAA 2B39A 5E7FA 5D1XC 1SLVA 1MCHA 3AROA 3O3UN 1SYSB 2X1WL 4YK4C 3U9PL 2V3EA 5C0DA 1GTFA 3BP5B 1QEXA 1O6VA 2EXTA 2EH7L 5F9OH 3Q6FA 2OQJA 3L4TA 4MJ5B 5ABAA 1GGUA 2IGLA 5LQBL 4ODWA 4N2LA 5JOPE 1QAWA 2IPTH 1RXLA 2H7WA 4GFTB 1QKZL 5DA0B 5IQ7H 2MCPL 1HXMB 3N42F 3OMZA 1OSPH 3MOAH 2C4FU 4HPYH 4MAYC 2XPGB 4HQQH 4HOWA 1USQA 3BH9B 4I0CC 3BZEB 3FQTB 4DKEL 4IJTA 4PJHE 1FL3B 3N0AA 5CCKH 4A6YB 3S35X 3ULVF 3Q1EA 1LD9B 3BVUA 5EOQH 3AAZA 5I0YA 3PDDA 1QTSA 4QT5A 1MCQA 3QJFA 3ROOB 4IU2B 3V0VB 1KXQE 2EVJA 2Y7LA 4ZOAA 2NDGA 4JFPB 4S1QL 1INQA 2ZKWA 1I9IL 2OSWA 3ML8A 4ZS7H 4P5SA 3WTVA 1NKRA 4UV4L 4IMKA 3VRLE 1LWJA 3NEEA 5JW5A 3RFZC 2VR5A 3QXVA 3W5NA 2NQDA 2ZWNA 1TNMA 4JB9L 4L29A 3QGVA 1DBML 1UH4A 2EEFA 3MNWB 5BUGA 3PQYA 5DHMC 1D5ZA 3CSBA 5E1IA 3W81A 3ZE1E 3OXRB 4PHXA 3O3EB 4XH2A 2CPUA 3H2PA 3FCSA 4KZDH 3MRLA 3RI5K 1VEPA 2CE6A 2IV9A 4HETA 5SX5H 5F93C 2BWDA 1OEZW 1ONQB 1ZLEA 3NFPA 4A7GA 1A2YB 2HVJA 4FQQA 4AQ1C 2HT2D 1NOLA 4G2AA 2VN3A 2OTWB 2M83A 3C5XA 3IB4A 1SMDA 2P5EE 4R96A 2P42B 2YEZA 4PWIA 2LW3A 4AE0A 3BWUC 3ZHFA 1E90A 1QFHA 4LCCA 4HCFA 3D51A 4Q58C 5E5UB 2KL6A 3HBQA 1UXSA 2G30A 2VAJA 4L1DA 2HX9A 1YC8A 4KKRA 1BJ1J 4M7LL 4WTZG 1INEH 3D52A 4Y4FC 2G75A 5HVHC 4PVBA 4KO5A 1HEZB 3QXTA 3UYRL 5DO8A 1J8HD 4KO9A 1E6JL 5DRZA 4FLQA 4M48L 1JPST 3F12B 3Q2NA 2OMTA 2LAGB 1LO2L 3ZDXF 4Z7UE 5DUJA 4NFBA 2AQQA 3QNXA 4FNLL 4JKWA 3BMVA 3ZGIA 2HVKA 4JQVA 2BSDA 3HNSH 1FGVH 2EXSA 1T1ZA 1G1YA 2WLZA 4BFEA 2VW6A 4XAWL 5KS9E 5DJ6B 3THMH 3GD1C 1LP9F 1FHGA 1T2QL 4QXWA 3T65B 1QHQA 2YC1A 4XC1H 3ARGD 1P9MC 5L6YL 4XXCA 2UZPA 3UBGA 1DBAH 1TXKA 3V9CA 2XZQL 3DGGB 3W38A 2R2HB 3P77B 4LGSB 1YPZE 2PYFB 2EABA 2DPKA 5EOTB 3WUWG 1E5AA 3GZOA 1FQ9C 1P5VB 4KTYA 3CZJA 1E9OB 4V1DB 3CLFH 2CKBL 2Q2EB 5CMAB 3ZY7A 5BO0D 1M7IB 1KNOA 3FUKA 4FG6D 3KXFB 1JHTA 4OCXL 3D2TA 1KIQB 5C08A 5C09E 3ZYZA 3IMBA 3CU7A 1KBGH 1U2HA 1XGTB 4MNQD 1CGWA 1MUJA 2VUOA 4OR1A 1NBCA 3FUIA 3L3GA 3WXWL 3IGAA 5IZ7A 3KMDA 1I9JL 2ADIB 3M86A 4DZBA 3QJSB 2EVIA 1MFVA 2ICWA 3GRGA 4OD2A 2NPLX 4Z7VE 4YQXH 4Z3TA 4YHYC 1GIGH 2ZIDA 3NCMA 3BRGC 1HQRB 3IBEA 4QOKA 5CINL 4P2OB 4YFEA 4E41B 3ZXAC 3WN6A 5EN2A 2D3VA 3IFNH 3VFNB 3LMJH 3GSQB 4FZ8L 2ENPA 3HE6B 4C56D 3PWLA 1JPFB 3MLZL 4FQXA 3WO4B 1D5BB 1NPUA 2FB4L 4R4BA 5BUPA 1MVFA 2QSCH 4B60A 4POYA 4E9RA 3JV0A 5JQHC 4HG4K 1QW9A 2GSGA 1RZ7H 4A67A 3BKMH 2P24A 3C2AH 3H4HA 2WUBL 4F7EB 4JG5A 1EV2E 1IE5A 4NO0A 4XGZB 2P7TA 1HCVA 1LO3H 1E8ZA 4U31A 4NN5B 4K7FA 4PGZA 5IEKA 4M61A 2DQJH 4ZQTA 1ZGLP 2JXMB 1UM4H 3C8DA 4ISVA 1YECH 4K5OA 5ID1A 2ZP8A 1ZHBB 3VB8A 3FSAA 3ZYOA 5KWYC 3D05A 3EFDL 4HGWB 2OMWB 5T3XL 2A83B 1UEYA 4M3KB 4C4BA 4MLIA 3RUGE 3DJ9A 1HHJB 1VACA 5J1SC 1XL6A 4WEBL 2RTTA 4Y1AB 4YDZA 1A6UH 3M46A 2A74C 4JFOA 2F8OA 4PUBL 4I4WA 2WCGA 2B16A 4BWWA 1OTTD 3X14A 4YZFE 2HA1A 4M6MH 4ELKB 1G9NL 2NT0A 4J1UB 4QHLA 3RWIB 2FJFB 1MFDH 2CPCA 3KYKL 4EKJA 2L04A 4RMTA 5BO1H 3O41B 3P73A 5BVPH 4LHUD 1FVCB 4DERA 4KI5C 3ZL2A 4BFBD 3CLWA 3WV0A 32C2A 2F54A 3QHTC 4H7VA 4KXBA 3UTSE 4ZDHB 4IU3A 4K5LA 5E1HB 4J4PA 3EG9B 3KJ6H 4ZMTA 2BS8A 3UDWA 3MBXL 3DUHA 5SX4I 2EDTA 4IRJA 1ZLUK 4UIMA 1JHKH 4K9EH 3TV8A 4JR9L 1RUPL 5ANME 2RB8A 3BD5A 3R4DA 1Q9OB 4A2GA 1UOVA 1A6TA 3DHJA 5T1LD 1NEZB 1PEWA 5IFJB 1DVTA 2X89D 4LSQL 4X6DF 5E2WL 5I8OH 3B7RL 4UT7L 2HKHL 4XWGH 1D5MB 1ZWIB 2YN3A 4UM8A 1UGKA 3SKNB 5H35A 3F64A 4KMTL 2VN5A 3F7YB 1UB5A 4JG9A 1KMGA 2BZDA 3IDNA 2Y0SA 3QJTB 2YPLD 1DJGA 2FEEL 3LVTA 3PWJA 4EDWL 4WGVB 1AHWA 2ZX6A 3NN8B 4JFZH 4L8CA 4G6AD 2OZ4H 3SDXA 3PNRB 3WFHA 2W60B 3AXLA 2MNUA 4WNSA 1MFNA 4G8EB 2BMKB 1V55B 4G9FA 2YD6A 2O4EA 4X50A 2WAQA 3CHXA 4XBEL 3TT3L 3D9AL 1D7BA 1R47A 3LDBC 5AVWB 2X88A 5TD4A 2B0SH 1ADWA 3SE8L 1V3KA 2V9TA 1LXMA 4Y4KA 4KZEL 4TQEH 4OQTL 1IBYA 3VWJA 4PY8J 1KENH 2OXGB 3KCPB 4GG6A 4MD5A 4Y7MA 1S7RA 4RQQB 3KPQA 1Y18B 4OJFL 4EJ1C 4F93B 2QADD 4Z1PA 1BMWA 1MZYA 4LBEA 3W0WD 2ERJC 3TPUB 5G2NA 1BFSA 2K8QA 5ITFB 1KUMA 1GZHA 4RISL 4O02A 4ICWA 5GJTL 1PD6A 2WO3B 3NJJA 1XGUA 3VFSB 5J9PA 4HK3J 5K39B 3AT0A 3CVHA 2E6QA 4KITB 1A6AA 4KH2A 4HIIB 1H15A 3FTGA 1UB6A 1ADQH 2QR0A 4LKXB 2XX0A 1OTTC 3PPEA 2BRRL 5CLZA 2BIPA 1AGFA 5DD3H 4JZNB 2WBJA 3ZLQC 3H9SE 2D7QA 2ZWLT 3S96A 4M43H 4PJCA 5HGHA 3A22A 4KAQL 4Z0BL 3DTXB 3LZFL 4XMKH 3KCWA 2AEQL 1X5ZA 4B9GA 2QQNL 2AK4A 5AZ2H 2JK5A 2IF7A 5I6MA 3G08A 2BSED 3WJMA 5L9DH 4NZTH 4XRCA 2F68X 4FCHA 5T3XE 2BW4A 5IVXE 5C6TL 2CBMA 4Y9BA 2Y2WA 5SWZE 2HG5B 3MACH 3BPNB 3IKKA 3L13A 5ITBH 4NDMB 5ERWA 1BMGA 1IAMA 4QTFA 1ZVSB 5EDSA 2AQRA 2AANA 2BNQE 1P4IL 4NOFA 3SGDH 5EU4A 4WGWB 1HILA 2A9CA 4XBMA 3BWAB 1JGVL 4TQIA 1IM3D 3IMTA 3L3IB 3PAUA 5I75C 4DGVH 1ZIBA 3AB0C 1H5BC 4X80H 4Z78A 4GI6A 3UH8A 3JWOH 4YLCA 2Z93A 1A3LH 4B9ZA 4UT6A 3EYSH 3IS0X 2OSLB 2DRUA 3BEVA 4H1LB 4LLQB 1J12A 1T5KA 3SKUD 3WIFB 3C6SB 4PJXF 1QEWA 4FQLL 2PO6A 4F5CA 1S7SA 3PU7A 4DQOL 4BK5C 5CBEA 3BCDA 1QR1A 1R3IH 4ODTH 1PKQE 5FC9A 4G6AC 3N1MC 2F61A 3GLAA 3OKMB 2D8KA 2B7DT 3IFLH 4LLAA 4P2QE 1COBA 1NL0L 3DRTB 4TQHA 2VRQA 4WDIA 1M05A 4IW4C 5FOBA 5F7AA 4ZJ9A 4AI7A 5ECGA 3ASOB 4XVOA 2J7LA 1BD2B 3LS5L 3FT2A 1ZHLA 3B2PA 4RFOL 3G6DH 5KSAC 1MJUL 4G6FB 2DLGA 1RLBA 3VXNB 2X4OB 1LGVA 2AK1L 1H3XA 43C9B 1EO7A 1UA7A 4U1IB 3NPSC 3KPSE 2CALA 1U8OB 2ENJA 4L2YA 3MRPB 4HT1H 4XP1L 5HHOD 4K9EC 2E27H 3BZ5A 3VCLA 4JRXD 3VFMB 1QTYT 1DSYA 3FW6A 1QPPA 1EBPA 1AG6A 5D4IA 1TQSA 3U9WA 4NQEE 1HKFA 5IBLD 1K8IB 3DX8A 4HK3N 5I18H 3WAKA 1X44A 2RQEA 5IBTL 2JNZA 3II2A 4FI8A 1C8QA 5CGMA 3CMGA 3EH3B 3CD4A 4PJBB 3ZGHA 1J5IA 3L3JB 4PJDF 4BHUI 3O0RL 4QJ3B 3LHPL 4OIIH 5KUMA 3D3VE 4HOXA 3B2XA 3I6LE 1IAKA 2J8HA 3RTQD 1CT8A 1HZHL 3VGBA 1FLRH 3ZRSA 5JLZB 1X5IA 3N04A 1SEBA 4QKXB 1Q0XL 2D9QB 2FATL 2VXTL 2WV3A 2JQZA 4P5KB 1D5RA 3H3PL 4N1HB 3TEZA 2XXGA 3JZ7A 5D5MA 5TH2A 4F58H 1KY6A 2N1KA 2GQHA 2VDPH 1X5XA 2H26A 1KB9K 3R06B 4HCRH 2JJTC 3WY1A 4BWUA 5CP7B 1JVKA 1T6WA 2CLRA 1F90L 1XH3B 4DTGL 5DJ8B 1QBML 1EFXA 2GJ6E 4FNPA 3G6AA 4LLYA 4JE4B 5IROD 4D9QD 1PDKB 3ELAT 1M9SA 1NPNA 1RU9H 3WKML 4QXTB 3NGBB 2ED6A 3ORJA 4AGOA 3VFVB 2VZUA 4OKVB 4XZ4A 1CGUA 1HQ4A 3M1CA 4UTBH 1MJ8L 2J20A 2MKWA 1DQLH 3NIGE 3QRLA 5DVLA 5F7DB 3OTTA 4JEGB 4R84A 1FVEA 3AGVA 5E8DL 4E0RA 3VWKB 1B4RA 4KHTH 4MD4B 3VG9B 1MFEH 3IJEA 5D1ZB 3UABA 3IDIB 1HTYA 3ZQXA 3DA0A 3OG4B 3RZCB 3QT2A 1BAFH 3REVA 4FQ2L 3Q8AA 4HK0A 4M7KH 1OV8A 2KLSA 4PGBB 1DVYA 3MUJA 4OBRA 3ROLB 1D5XB 2XWBA 2HTLD 3F7PC 1WQVT 2WANA 3O45A 2XWTB 4K3GA 4AXWA 4TTDD 4PBXA 3ILQC 4X8JB 5DD6A 1TIUA 3U7YL 4KKNA 3HBPA 1WZ1L 3CH8A 4W4OC 5HGAA 1U95A 3UJJL 5IF0A 3PF2A 3ARDA 4N22A 3SPHA 2UZYA 2D7OA 3T2LA 1L0XA 2DWDB 5TE6L 3R0MA 4KY1L 2FDBP 3GM8A 1BZDA 3GSNL 5D7IA 1MW1A 3L2MA 1XZWA 1P6WA 3LKRA 3WHE1 5IQ9B 1A3RH 2XDHA 4J3OG 4TUJB 1GJIA 3EFFA 5INCA 3JBG7 2J56A 3D2UA 5JW3H 2AITA 1I1AD 3DJZA 3L5WB 5INDA 4ZUUB 1AE6H 5J06A 2R59A 3SPIA 5EIIA 5E1GA 1UOWA 4DKFL 4HJGB 5IQLA 1CFNB 1ZVYA 5EC2B 3PWPD 1DUZA 2ZNWA 2WD0A 3L81A 3GYRA 3NACL 3JWOC 2IALB 4FQJL 4JANB 2R1YA 3QUGA 1OHZA 1O5DT 3FCGA 2JCCF 4DP0X 3RTQC 2F2HA 3MR9A 4URKA 3BP6B 1MFBL 4Y4HA 3G6JB 2VLME 3NA9L 3T0EC 3BUIA 1QRKA 3DV6B 43CAB 7CGTA 4W6YB 2DD8H 1WCBA 3JUZA 5C0GB 1NUDA 4X4KA 4QXGH 2Y06L 2FGWH 1GC1L 4PJFA 4HJIA 4WU5B 1EFQA 2VIRA 2KERA 3WY2A 3DDFA 5JOPD 1HHKB 2Q2LA 1LNUA 1MJJB 3RRQA 5A3ID 5LXGL 1WK0A 3LH2H 4UILH 4NRYA 5IROC 1ZDSA 3KPPA 2XN9B 2NXZC 2CK0L 5EUOB 2IBBA 3U4AA 4ZPTB 5DDHB 2FH6A 3T77A 1E9QA 2EEXA 2KC0A 1KY7A 4OLVL 5ACLA 1EWHA 3SO3B 5D2NC 2AJZA 1SBSH 1RZFL 1XSKA 2C8NA 4JHZA 3P0YH 3IDXH 5BS0A 2XV6B 4CJ0A 4HS6A 1ZT1A 2P43B 3PNWA 1YYLH 5B1AB 1FYTA 5JZ7D 2DQDH 5AKVA 2R23A 3O3DB 4Y5XB 3QG7H 3D39A 4M7JH 2D3LA 4QRRD 1TVHB 2P9RA 4WWOA 3S97C 2BWIA 1NTDA 4YLBA 3KPNA 3F65A 2PLTA 3GEWB 4XP5H 5F6HJ 1O6SA 2CRMA 4KQ4H 5JXAL 4BD4A 3LZQA 4TTDC 5F7KC 4PWFA 3APDA 3VD5A 3OMAB 4QY8A 1MCEA 1NAMH 3MMEA 1VENA 2ZF8A 4S10A 5IB3A 4I18A 1IUZA 4PRHB 2QSTA 2CMRH 5AVXB 3WCYA 1YEKL 3WOVA 1X7QA 4Z3GA 4ZFZB 1L0PA 2CIKA 1IIKA 5D1QE 3CVIH 2GK2A 1XO8A 1BW8A 3FQ4A 1LO4L 4XX5A 5D7LA 1NCUA 1GGYA 4IK7A 4OD3L 3VRIA 1VHPA 5FECA 2Q3ZA 4XB3A 4UOZA 1DQDL 1FIEA 2GC4C 1I1AC 3U1QA 1C1EL 1IGFH 3QZNA 2WKOA 2JIXA 3TA3D 3VXRE 2O6FA 4AG4L 1E8WA 1QRNB 3GMQA 1BVKA 1SXBA 5CEYA 4H8UA 2D4FA 1WD8A 2FBOJ 3LKNB 5C0ND 2W9DL 1PAMA 4JRYE 2PTTA 1KJMA 2EH7H 1B90A 1XCTB 2NY4C 4X5XB 3AWGA 1KACB 1J9QA 5LQBH 1MCIA 1GHFL 5EU6A 4I9XA 1H6EA 1OP4A 3HC3L 3QULA 3VDCA 1GMEA 4GQ9L 4D0DA 3CSYA 2X1PA 4LBAA 1AO7A 1UXWB 4JDZB 5DC0A 2I85A 2MCPH 3BEWA 4P9ML 4MRCA 4ZD3L 3GPEA 3HNVL 1JERA 3HUJF 4ORZC 4RAUB 3TNMA 3UZQB 1IEHA 1CICD 2WAHA 1JIBA 3RWFB 1O7DE 3K6OA 3OKOB 4UQCA 4APQC 4ZUSA 3OZKA 5EC1A 2NZ1A 2QV2A 1OSZA 4DKEH 4AUJA 3KG5A 5F88B 2ICWJ 4LLUB 2H45A 1HSBB 4IKIA 4FMVA 2CM5A 5IMKA 4KPHL 5A3IC 4PV1C 4Z3EA 3BIKB 4ZOEA 5G4NA 4L05A 5DMJB 1OQXA 4F8TA 4R8WL 2KZWA 4ZX6A 3ZE1B 5DQ9B 4S1QH 2IAAC 3WIHA 5AZUA 3UTTE 5FK9A 4RMBA 1I9IH 4HLEA 2FL5B 5F21B 3WS3B 4UV4H 4B27A 4E5XG 4HLZG 5I1JH 1MRFL 3EIFA 4JB9H 5JZ7C 5C09D 1DBMH 2KS0A 3QS3A 1JK8A 4GAFB 2HJLA 4ZSOA 1FORH 2P5EB 3E6FA 4CKVX 3DC0A 3CFCL 4I1RA 4B41A 1T22B 4D9LL 4Y16A 5D7SL 3KL3A 1B3JA 3BGFC 3QEQD 5AYTA 3OR7A 2V2TB 4BH7B 4PRIB 3S88L