1P5VA

X-ray structure of the caf1m:caf1 chaperone:subunit preassembly complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
227
structure length
191
Chain Sequence
FASKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDPFVVTPPLFRLDAKQQNSLRIAQAGGVFPRDKESLKWLCVKGIPKDVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLPNVSWRIINDQGGLDRLYSKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone, structural protein
molecule keywords Chaperone protein Caf1M
publication title Structure and Biogenesis of the Capsular F1 Antigen from Yersinia pestis. Preserved Folding Energy Drives Fiber Formation
pubmed doi rcsb
source organism Yersinia pestis
total genus 32
structure length 191
sequence length 227
ec nomenclature
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p5vA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p5vA02
2YKLL 4LSRH 3PGFH 4XVUD 5BS0E 2HKHL 5GS0D 4DGYL 3KJ6H 4WIQA 1P6FA 5TQ0L 3OKDB 2B5IB 4ZFZA 3T08A 1LO4L 1HILA 3RAJH 1DDHA 3QFJD 3QUMB 4X0KB 5BV7H 4I18C 4P3CL 1H8NA 2DKUA 2OM5A 2F53E 5FHAL 5GSRB 1IKFL 4UUJB 4FTVD 4ZPVB 4HT1H 1CD1B 3LKOA 4I8DA 2E27H 1H3GA 3JZ7A 1TQBB 4TVSa 5FOBB 1Q9WA 2BMKB 2R39A 4PYHA 2H8PB 3NACH 5FK9B 1Q72H 3JUYA 3RDTB 1YN7A 3ZDXF 4R0LB 4D9QE 3HCVB 3DUSB 3BRDA 3W0WB 4G3YL 4DN3H 2WUBH 3MFFB 3FJTA 5HJ3B 4NCDA 5ANMA 3CSYA 4YHLL 1NJ9B 4WHDA 3IGAA 3PL6B 3OBAA 2X1XR 3S34H 2OLDA 1RJLB 3RZWA 4K7FA 4XP1L 1XGTA 1CI5A 3VXOB 3KPSE 1DR9A 2B0SH 1EAJA 3BYTA 2WLYA 5JDSB 1A7RL 4NQED 2G2RB 2RFXB 1NMAH 5LXGL 3UJTH 1QSZA 3DV4B 1TENA 1PG7L 4K8RC 1KPUA 2DI7A 5TE6H 4GG8B 2E9IA 4IRJC 3GSQA 4O9HH 4P2RA 3QUXB 3VRJB 3GRWH 1UJTA 4OF0A 1NFDF 3GKWH 3VFNA 1FCCA 1RY7B 1CFSA 4NC1C 1UWEL 5DJ0B 4LKCB 3GSUB 3RUGE 2O61A 1IKFH 2CKBH 5K9OB 4P4RB 1HN1A 2ITDA 3QDGE 4X6FB 3QEHB 5J89A 1ZV5A 1LEKA 4V2CB 2DQEL 2DQJH 2EDFA 3D2UA 4NP4L 2EDJA 4Y19A 5KOMC 3G6JB 5DZNA 1A6TA 4WUKL 2XA3A 3MNZB 5HYQA 4I4WA 2OL3H 4PJEE 4HH8A 2GCYA 1TFHA 3R8QA 5C0EA 3C8HA 4G9DA 3MV7E 3QRGH 5T3XH 4P4KA 1KUMA 4KZDL 3DX8A 4L4VD 1ZXQA 4LIQH 2IALA 3OB0K 3OKKB 4PRIB 2HT4C 4DW2H 1EVTC 1BWMA 1JF1A 3HMXH 1MFBH 3PQYA 4MAUL 2NQCA 4MJ2A 2I5YH 5D2LA 5F3BB 1CXHA 1NGYA 2BOCA 2NXYC 4HG4K 3SJVB 5E2UL 2WBWB 1N8ZB 1JNLL 5A2KH 3EZJB 4RMUA 1OM3L 4C56A 3BEVB 1IC4L 1DL7H 1UKTA 2BSTA 4WW1B 1V8HA 1RFDH 2XRAH 3FOLB 5MERA 1SY6A 2I07B 4TULL 1IARB 1RUPH 3M07A 4PTTA 1IL1B 3RVUD 1JNNL 1T04B 1CICA 3FOMB 1N59B 1A14H 1KG0B 3R0MA 3V8OA 3V6FB 2CXGA 3TBWB 4P2RD 4K07A 4JAMB 1DBKL 3INUH 1P5VA 4DFHA 4K3DH 5D5MB 3QZWB 4IRSB 1FG9C 3GM8A 3CPLB 4UDUB 1TDQA 4NDMA 2EDOA 4HUUA 5D7JB 5EUOF 4LKXA 3O3DA 3IFLH 1YY8B 2DDQL 5JXAL 5JPNB 5F72S 2R8SL 3EYSL 1QHPA 3VD9A 3GUTB 3S97C 2EXYD 2AXHA 5IF0B 3D2UD 1L0QA 3CDFA 2A74A 1KN4L 2X4NA 4JO4L 3EYUH 5K9KA 4H25B 3HC0B 5K9JH 4Y19D 5I66A 1I3UA 4WENB 3L3HB 5A1AA 3D3VB 1MJJA 2R0ZH 4HWBA 5DJAB 3VFMB 4N5EC 5EU3B 1KENL 1K5NB 4HF5H 3STZA 2A6DA 1XCQB 4MCYA 1AY1L 3KPMB 4PY7B 1UZ8A 4P5MA 4U6XA 4JFXB 4P4KD 4NUJB 1S7WA 3PP3K 3GMPB 4M4RA 5I76B 3WIHH 4Y0GA 3U46B 4FZ8L 4U7MA 1HH9B 3PQYD 1URLA 1XIWC 1AIFB 1KGCD 3HR6A 4JFFA 1O0VA 2BFVL 4L8SC 1SBSL 2EEBA 4C56D 3QG6B 2QKIB 5HY9B 5ACZB 3ZKMC 3P40A 3UTSB 2GTWB 2HA1A 4O2CA 2OQJB 2VL4A 1GXEA 4M1DH 2R0KL 4IMKA 4WW2C 3MRPB 4HIIB 1IC7L 1CICD 5D1XB 43C9B 2N1KA 3RTQC 2P8LA 4KK9C 5DRNB 4NWUH 1T5WB 3REWA 5T3ZD 5KW9H 1KT2A 3H42H 3PWUB 1DBJL 5CJBA 2KPNA 4TOYL 1PG7W 4NM4L 5AZ2H 5ID0A 3O4LB 1XAUA 3QIWB 4V1DE 3KYNA 3TH3T 1IEBA 2GFBB 2A0LC 1DVFA 3EDJA 5DHYA 2C3GA 4MVBC 4OLYH 1QRND 1NBVL 2R69H 4KPHL 2V2XB 2GY5A 1B2WH 3BKML 2KQMA 3GSWB 5M7QA 5DD5H 3BFOA 2CR6A 3DSFH 3B6SB 4MWFA 1INEL 3I75B 4RZCB 3PNWA 1LD9B 2JE8A 3D0LA 5EH1A 4AIZB 3WHXA 2YA2A 3ALPA 3ULUC 3IDXL 4Q7DA 5FIEA 3UZQA 3V6OE 3LVEA 4M48L 4OLWH 5FO7B 4HIJA 4ZTOL 4OLEA 4Z7QF 1IRAY 4F8QA 1I7TB 1T2XA 4XPTH 5HGDA 4L4TA 3R4DA 4X6CE 1GYAA 4CDHA 4GQ9H 3KDMA 4GW1B 4Z8FL 2VWEE 2VWEC 4OUUB 5ETUA 4RFNB 4MAYB 2OK0L 4BA8A 2AEQL 3MRKA 4H20H 4NHUA 3RVTD 5ESQB 3FT2A 3ULVD 4PRPE 1UM4L 3MREB 4PJAB 1R5IA 2HFFB 3MJ8A 4PGCB 1MAJA 5DSCA 1Z9OA 5F89A 2ATKA 1U8QB 4LLUA 1U91B 3SDCD 2JJSC 5MEPB 4E41A 5A2IH 3O41A 4JFFD 5HDOA 2IF7A 2GIYA 5HI5D 1S7XB 1EXUA 1G9EA 5MENB 1DSFL 2VDKL 2AW2A 3QDJA 2OBGA 1MIEH 5KG9A 3JTTA 3VWKA 2X42A 1DEEB 5C8JB 4UNTA 4G7YH 1OB1B 3SDXA 4PLKD 4URTB 2XWJA 1JYVA 1QLFA 1T7YA 1PYWA 3BW9A 4LVEA 1KBGL 1B90A 4JKMA 3S5LG 3QSKB 4KTDL 4AT6B 4CN4A 1V7NH 5EBLA 4WGVB 4RIRA 3QUZC 4UUJA 5I0DA 1DVFD 5F6IB 2F54B 5FYJE 2YD8A 1N64H 5HYEA 4M7LL 3SKNB 4M93C 1BX2B 2IPUK 1I85A 1HHHA 2NXZC 2NTFB 4X9BA 1HQRA 2FGWH 1HI6B 2I9LA 3MO1B 1Q9LA 2CRMA 1AJ7L 3VG9C 2MCPH 3EO9H 4ZOAA 1UWXH 3BPLC 3UJIH 43CAA 5I15L 5BVJA 3FZUC 3DWTA 5T1DL 3MLSH 1SJHA 4MD4A 1C12B 2CLVB 3A6BH 5IFAH 5FGCE 4TTDD 4L4TD 4FQJL 4NZRH 4MA1B 3W9EB 1DLHA 5F7DB 5B38A 5LGJB 1D6EA 4M02A 1RZJH 4WFFE 1RUAL 4CKVX 1M7IB 1SEQL 1HHJB 3P2TA 4BKLA 1MUJB 3PDDA 2Y7QA 5T1LB 3QDMA 5FYJU 4R7DB 3NZ8A 1NCAH 4JPVL 3O2WL 2YPLA 1FL3A 5ACMA 4E41D 4HPOH 1P5UA 5CEYB 2K3TA 4YE4H 4LASH 3HUJF 5L2KB 3LB6D 1YEJL 3QDJD 3VE0B 1F13A 3MUY1 5EZOL 1L7TL 3S98A 5D8JL 2HJKA 1A9EB 2IH1B 4JE4B 4X80H 1OT1A 3B9KA 2PKDA 3P0GB 5GS1B 5F3HA 4I48B 3EYOA 1V05A 3C5JB 5DK2B 3TVMC 3G04B 5TDOB 3L5IA 1CWVA 1RHHA 1MRDL 5I1DA 3HRZA 2PW2A 2Q3ZA 4ZUWB 3ET9F 3QULB 1U2CA 5C0AD 3ECBA 1VFBB 2A83B 2HVJA 3K0WA 3H3KA 1AO7E 3RVXD 1UB5A 3RP1A 4F2MB 4LGRB 1NCTA 1A47A 2QSCL 3DLQR 3OKMB 2XA8L 5H37H 2ICCA 1ZLUH 1D5MB 1K4DB 4B5EA 2V2TA 4KI5D 2VITA 4WHTA 5LBSH 5F1IA 1L4IA 1IAKB 4PRIA 3QPXL 1QEWB 4NO0B 4Y4KA 5GS0L 2FNBA 1S9YA 5IIEB 3BQUC 4J3UA 4PRHD 2Q86A 4FXGB 4CNIA 1CFQA 5J3HC 5IB3B 1FZKB 4LLVA 5CWSA 1ZT7B 1GOGA 3HNSH 4N0FA 3M1BA 1J05B 4PP2A 5IMOB 3H0TA 3I02A 4KMTL 2A6KB 4HG4J 4IJ3B 2NY3B 3QJHB 1HZHL 1KCUH 3GMQB 4NM8L 4FQCL 5CSZB 1H3XA 3I84A 5IR1A 1QUNA 3O81A 3PABA 5DRZA 5I1IH 2F8XC 5CIPB 3WIIH 1WZLA 3HA0A 3QDMD 3OPZH 4OGYH 3GSVB 4LP4A 4G8GE 4NZUL 1FVEB 3LH2H 4OCNC 4LSSH 4YHPB 2EEAA 3AMLA 2DQUH 2W1NA 1FC2D 5CBAA 5EORH 3VFUA 3R06B 4OCXH 4UT7H 3HZKB 2GW5A 1YMME 1RUML 2D0HA 3GRWA 1JRHL 2LFGA 2VXQL 4EUPG 4G6AD 4TNVK 5D6DA 4XC3L 4NFCA 1V3JA 3WSQL 1I3GL 4LLAA 3ARDA 1JPSL 4Y89A 5HD8D 3WUWG 4RISL 1I7RA 2CKBA 1HH6A 4L8BB 2R56L 2BRRH 2WQ8A 4BFIA 4QRPD 2HVKA 4PRDB 5DJYB 2HFGH 1ZWIB 4JZOA 4PJ8C 3MCG1 3HS0B 3QNYA 4Y2DC 3UTPE 3LRGA 5CGYD 1FIGL 3VFMA 1J86A 4TUOB 2FIKB 1PKQA 3CZFA 2NZIA 4AL8H 3I50H 1D6VH 4EJ1C 1QSFB 3BPNC 5IBTH 5FYKE 3L9RB 4S1QH 1ZVSB 2QQKL 1NBQA 1EJOL 3U6RA 1LDPL 2OL3A 3OG4B 3RY4A 1MH5B 4Y4KD 1INDL 3SKJH 1FZMB 3WS3B 3MGOB 3HAEB 3G6JF 1UH3A 3OAUL 4IOIB 4Y5YA 5EWIL 4CBPA 1UH2A 3JWDH 1U3ZA 4YJZL 3TBYA 4F37K 4LEOB 2ZCLH 2XFXB 3HMXA 4L3ED 1T21A 4PIRF 4YDIH 5KVGL 1MNUH 5K9QG 3U2SA 1R5WA 1AQKH 3SPVA 3MNWA 1T3FA 1VCAA 1RJZB 4HBQA 2FYYB 5C0IB 3AUVA 4FQLL 4LSPL 3W5MA 4YK4B 1QNZL 3HC3L 3W2DH 2C26A 3QA3A 5D96B 2I24N 3O4LA 5FYKU 2IJ0C 3TBSB 2GFBA 3FCTB 2JB6B 1MQKH 1JE6A 2QQQA 2VDPL 4O4YL 1XR8B 4JO2L 3IETB 5DURD 5CAYB 3THMH 3GSWA 1CE6A 3G6AA 4TPRL 3ARDD 3I75A 3ZE1E 4YEEA 3GMOB 3HC4L 1OHQA 3V79C 1JVKA 4P2QD 2UWEB 3ISWA 4LSVL 5K33A 1DLFH 1FAKT 1MJUL 5CJOH 1S7QB 3RWDB 2OZ4H 4XMPH 5I1AB 3QIBB 3CCHB 4R2GC 1RAMA 4WO4B 4XHJC 1B4JH 7CGTA 3S3JA 2CDEB 1BVLB 4D2NA 1YYML 4KKCD 4P5TC 3L3DB 1JRHI 3BP4B 1M05A 2Z8WC 3A6OA 2NX5E 1H3PL 4MDJB 4Z0XA 2NW3A 3ZE2F 4RGND 2WP3O 3BD3A 5HYSA 1J0ZA 4Y16B 5ILTH 3BVNB 2NY5C 5T3XD 1OAYL 5E1AA 3H2WA 1Q9KB 3FMGL 2HRPL 2CDGA 2ZUVA 1FNSL 5E2VL 4JFZL 1A1MA 2W0KA 2RR3A 1BD2A 3GIVB 3VW3H 5MHSE 2IH3A 4WI7A 1AFVH 2XKNA 1WBXA 3KJ4C 5F1KC 2CR3A 4U6VL 3REVA 3NZHH 4KKBD 3FB6A 3STLB 3PWPA 1RHFA 4JFDA 1JN6A 3QUYC 4NKMA 4XH2B 3H9SA 1UA6H 4FQ1L 4K94H 5E56A 4NWTL 2R4SH 3BZFB 2C1PB 4Y5VC 2MCG1 5FHBH 1ZA3A 3MLUL 4UQ2B 5E0QA 4EDXB 5GRJH 5T1MB 3VU2A 4YHYC 3JV4A 2IANE 1BEYL 2VAAA 3BT2L 5F88B 2VLRE 3ETBF 3FN0H 4RNRB 3JWOC 2Y6SD 2V5YA 1D5XA 1QBAA 2AJUL 4HCRL 4PJ5E 1RIVH 5TE4L 3IXTB 3X3FH 1CFTB 5E24E 4Z5RA 4Y4FB 4HFWA 1GH7A 3SDAA 3RBGA 1JCKA 2NY2B 4D9LH 3HNVL 3MRCB 3MUGA 1ZLSL 1CIDA 3MJ9H 1J11A 1FBIL 5D9SB 5T3ZL 3NFSL 1VGKB 1AHWC 1EJ6A 2XZAH 4NCC1 2GSIB 4DCQA 2UYLA 5F8RC 4DEPC 3IFNL 5T33L 3PIQB 4ZSOE 4GS7C 2N56A 3ESUF 4KQ3L 5HI4C 4KQ4L 5IWLA 3IRZA 1MCEA 1T4KB 3TA3A 2R23A 4KWUA 2HT2D 1MOEA 3MA9H 4LPVA 3WD5L 2JIXB 4NO3A 2CKNA 2AVGA 4AJ0A 3IDJA 2LAAA 1R3LA 3CVHH 4ACPA 2EKSA 4FQHB 4Y5XA 2AJSL 1IBGH 3EO1A 1P7QB 3W11C 1BD2D 1P1ZA 5K59E 5EBGA 1U8JA 3J7HA 4LCUB 4L4VB 5F7UA 4XGZA 4XNUH 4WUUE 2NY6C 3CDGA 3I6KB 4OM1H 4PJAF 5IHZA 5EPMA 2H41A 3PWPD 1T0MB 4JFDD 5ISZA 3H9SD 4OQ1A 1XGUA 1IEHA 3HE6A 4L8CB 3ULVL 1L6XA 3FT4B 1OSZA 5A3IC 4RCAA 3TP4A 1OW0C 4ERSL 1FFPA 1LO3H 1NCCH 5J12C 4J2XA 5BJTB 4HUWA 1NGPH 4XPFL 3MQIA 1S9WB 1DQDL 5H35A 5EUOE 3T04D 3TT1L 3EYFA 5IK3A 2BNQA 3KPRD 5J13B 1N5YL 4PTUA 5FUOL 1MFNA 3SDAD 3O9WC 5I75B 1T5XB 3B3IB 1MVUA 1W8OA 4WV1A 4YPGB 2GK0A 5KAQG 1GC1H 4KKNA 4NOBA 2D31A 3EJYD 3RVWC 4L9LA 4XCCH 2KZWA 3MMEA 2PTVA 1A5FL 3I9GH 3HZVB 3WFHA 1JGLL 2ZPKL 5KSAA 5FF6A 4AM0B 4ELKA 1KJ2H 4P57B 3TA3D 4IIQC 4ODBD 2R2CA 3ORJA 4HKJA 3VXTB 1RZGA 3VFOA 2VIRA 4MA8H 5HHMB 4KROD 1K9TA 1PBYA 3EHBC 1DQLH 3VMNA 3D9AL 3V9FA 2VISB 3DUUA 4TUJB 5F96H 1XF3B 1BQUA 5ADPL 4S1RL 3CVHB 1I7UA 5BQ7A 4JKLA 4LBEB 4PGBB 1KJ3H 4M9OA 2LAGB 4PRAA 4R4NC 1U9KA 4RQQA 2VDNL 2P5WB 1T83C 5ISZD 2H32B 5KVDL 3HE6D 3MTRA 1ZTXL 2I27N 1JGEB 2XN9B 3VDCA 2X7LB 1DE4A 3KYKL 1A3LL 2WW8A 4M61A 4U6HB 5FA4B 3DV6A 3MOBH 5FCUL 4JHBA 5DD6B 3TN0A 3T1WA 4I2XE 2Z8RA 4NNXA 5EO9B 2C1OB 4XP5H 1NDGB 2ZCHH 4J3TA 3TGXA 4J1UB 3FFCE 4HPYH 3MR9A 1FNHA 4UV4L 3NAAH 4K23L 3U7WL 2BNQD 1W0YT 4OZIA 1A6VL 3TYGH 3F5WB 3C08H 5GGTH 4UT9L 1DBBL 5MP6H 4NQSB 1RUKH 4BUHA 4GAGL 3KXFE 1RUQL 2OX5A 3T2NL 5F7EH 5I1CL 2MWCA 4YDVA 1G9MH 5AZEH 2DQIH 3L5HA 1QRNB 4Z7QE 2BVPA 5JLZB 4ISVB 4OSUL 5GGUA 1IKNA 4PJBA 3RNKB 4R97B 3IDNB 1ZS8A 5KSAD 1AQDB 4NO2B 5E8OA 4MD0A 4BFBD 3FKUS 3WNNA 3VH8A 3LV3A 3ULSA 2YXFA 2EE3A 3IDMA 1OGTA 1SYSA 2DYPD 3HZMA 2G60H 1W8NA 4IMLA 3RNQB 4RWHA 5ESVA 5C09D 2XTJB 3O2DH 3D85B 3C09B 4PJ7A 2Y06H 4FQQB 4NKDB 1FVCA 4J4PC 5IQ9B 4TVPH 3VGAB 4X5XB 2JB6A 3KWWB 4BJLA 5DUPL 2APBA 3T0XA 2PXYA 5E6YA 2VR9A 4YO0A 5DJDA 3GBMH 4QCIB 2XWBB 3EJJX 2ZSVA 4UZGA 3V6BR 3BEWB 4G6JH 4O58H 3G5ZA 5CILH 4QXTB 3EDDA 3LQAC 2A77L 3SDCB 1V5JA 4X4ME 4F7TA 2DB8A 1N6QH 3S36L 3AY4C 5EUKA 4KRPB 3ROLB 3TN0D 4WO4A 4HWEL 3RWFA 2QQNL 4LSUH 3W39B 5EZLB 1A3RL 4XBGB 4PB9L 4HWZA 2ADGB 5I17B 3EOBA 1YZZA 3BGFC 3IDUA 4LLWA 4PP1D 3U7YH 4ODVH 4HS8H 3CFDB 4LVHB 1FLRL 2M1KA 5D7LA 5C0ND 1TTUA 1T1ZB 4HIHA 4MA3A 2VXUL 1B0RB 3T4YB 4N8PA 1EGJL 5DVKA 2PO6C 5DYOB 1GL4B 1YA5A 2P45B 4NQCA 1BGXH 3BJLA 1CQKA 1IC5L 1C5CH 2Z31B 3DECA 3C6SA 3EO0A 2WIIA 2Z4QB 3FQXA 1RU9H 4J7RA 2GKIA 1ED3B 4X5WB 4XCYA 4N5UA 4X7SH 3SDDB 3FQWA 2NNAB 1QOKA 2V7NA 2X9YA 3F7YB 4FQXA 2X10A 5GZND 4JPKL 4Q74A 2VLLA 2V17H 3HUJE 3TH4T 1OSPH 2PXYD 2EKJA 1C8PA 5CJXC 2AEIT 1AGDA 3HZYA 4KJQD 1PX4A 1NMBH 2CH8A 4XAKE 1CLZL 4W68A 1OTTD 3KLSA 2J8UA 2BNRB 3OZ9L 4FA8A 4R96A 1MREH 5DQDH 2DWEA 3OJMB 1G9NC 1RZ8A 4HBCL 4OD3L 5I2IA 4PG2A 4FFZH 4YBLB 3WFDH 3OR6A 4ELMA 1A6AB 2OZ4A 2G75A 3MJGX 5JIHA 3H9ZA 5B39B 2EDYA 3EFDL 4KK6C 1JHLL 3V7MA 1CL7L 1I8IA 3IJSA 1UXWB 3QWOB 4YHKH 2UWEF 5D7LD 5DS8A 1VGEH 2EXWC 5F9OH 4YXLH 4WDIA 3L95A 1BBDH 2J4WH 5GHWL 4OQTH 5C0AB 3QNXB 5IUSA 2VZ1A 5JW5B 3MOAL 3FONA 1CK0H 1MI5A 4YBQC 2WBJA 2EO1A 5EOCJ 1WICA 3ZHDA 2ZKHH 4ZNEE 4NC0B 2AXFA 2R29H 4NQCD 2ITCB 3LKSB 2VE6A 5MEQB 3WN5C 4XTRC 2Q7YB 5IMLA 4PJFA 3L3JA 2P8MA 1J1OL 1W0VB 2QQLL 3LDBC 1WIUA 1QD0A 1NGXB 3RDTC 5D1QD 1ITBB 4PB0H 2Z93B 4PRHB 2Z91A 4OAWA 3W0WE 1VENA 4JM2C 1INQB 4AH2B 1IMHC 3U30B 3KPPA 2EDXA 4FHBD 4OFVA 3O3EB 3TF7C 4HLJA 3U36A 4G9FA 4H88H 3LSOB 3PL6C 5IVXB 5I16B 4HLZG 2DOCA 4WEBH 4LHUB 2O5ZH 1OP3H 3HI1B 4DKFH 4JDZA 4NZJA 1MRFH 1JWSA 3VCLA 4P9HH 4JQIL 2X1OA 1TPXB 5ALCL 1ZVYA 2WIMA 5JW4Q 1LP9B 3TJHC 3TNMA 2QTEA 4O02H 3VWJD 3QUXC 4AY0A 3OGCA 1ZHLA 3UTOA 3RWGA 3SE3A 4CVXA 4Z7VA 1TQCB 2Y36H 4DAGL 4QHNB 2NW2B 4GXUM 3V5DB 1RMFL 4YUEH 3SE8H 1FYTB 3MJ9A 4RGOL 3B9DA 3WFBL 1XF2B 4OBSA 4R90L 5INDA 4XVSL 1FGVH 4XNZB 2IAMB 4JJ5A 3MROB 5I9QB 5IEKB 1GOFA 4OLXH 4X7DC 2BVUA 2VLKD 2ZUXA 3RVVC 4F7EA 2DJSA 3MXWH 4XNXL 3Q5TA 4G43A 4N9GB 4QRPB 3TWCH 4F7CA 1UYWH 3G6JE 4M7LT 1MI5D 2XY1A 3K80A 4GRWH 2YPVH 3EOAA 4XT1C 1PZ5A 4Q6IC 1JPGB 3WFCL 3EFFA 4LCWA 4P0DA 3O4OC 5IHLB 3A67H 4L29B 3MRLA 5DR5L 1WITA 4JQVC 4DFIA 4PRIE 4BK5A 3ARWA 4M1CC 3GO1H 3U9PL 1FFNB 4G6ML 5C08A 4PJGA 5L8LB 1CGSH 2XQBH 2AI0H 4EI5A 1TCRA 1UXSA 5EZJA 4L3EB 5TDPA 2Y23A 4G9FD 5FUCC 4XZUA 3MCKB 4OGAC 3LKRA 2X1WL 3MRHB 4PJFF 5F1NB 3TIEB 2Q1EA 3SKOA 3KLDA 4JKKA 3TO2A 1CF8H 5J1TC 8FABA 3GMLB 4UIMA 3U83A 5FYLH 1JWUB 2YOCA 4KKLD 4MQXD 5ICZB 4HK0A 2PTTB 3BO8B 1MCHA 3TPUA 4I3GA 4M1GL 4Y88A 3F62A 1JFQH 2GJ6A 2EH7H 3LEVL 4RX4A 5IEHB 3TM6A 5I1EL 4ZAKB 3VXQB 4GAYB 3DVGB 1CFVL 5D7JC 3QCVL 4KRLB 1A9BB 4R8WH 3TYFA 4L4JA 1Z6JT 4KDTC 5D72H 4ZOBA 3RZCB 2BSRA 4WTZA 1R3HA 2YD7A 4WHYG 4HS3A 1X4XA 1KIQB 4OGXL 5DJ8B 4P2QB 4YHZH 1XF5A 2W65A 1HKFA 1KJ2A 1S8DA 4E42B 1J0HA 3H3PH 1UJ3A 2F5AL 3OXRB 2OSLB 4Z7VF 4CU7A 2D7TH 2IPTL 3D3VE 5LAXA 3DVIA 2CSPA 1P6AB 1HDMB 1DN0B 1JYNA 1QSVA 4HUNB 3FN3A 1PKQE 1JHKL 3T4AB 4LCWD 1FNLA 1J1PL 1SM3H 4RGNB 2XWBA 4ONFH 3PWNA 4HSQA 2L7JA 5FECA 5GGQL 1G7MB 5EU4A 2RBLA 3GHBH 3NCFB 5C08D 1J0JA 3N50A 1VFAA 2XY2A 4EI5D 1YJDL 4GH7B 4MNGA 4QXGL 4XMLH 2B2XH 3AU1A 3DX7B 3UTSE 5B4MC 2A6IB 2BVYA 5JIPA 3X13A 4LLDA 3PE9A 3QEGL 3M17A 3T0AA 3NA4A 5D7IB 3BZ4A 4U1JB 1S9VB 1QFWH 5JHDB 2R2BB 2DLFL 2NZ9D 4YHML 3DURA 4U1MB 4EEEA 3HMWL 3QPQC 3U9UA 4XAWH 1HK6A 4JPWL 1EV2E 3NIGF 5GRWA 4GKNA 3O4LE 2GJ6D 3QIWC 4GMTL 1IQWL 1E27A 1CE1L 3HPJB 5ERWA 5FKPA 5GGTA 1BZQK 1BLNA 4RX4D 1WBYB 1FDLL 3DTXB 3P4NB 1T7VA 2VSDA 2MFNA 1I8KB 2C7UB 1JPST 2W0PA 1IAIL 2C4FT 4WI2A 1KIRB 4K7PH 4XPAL 3BIBX 1DBMH 2MKWA 4QTIL 3RHWF 5KS9A 1U8OB 4EI6B 1FP5A 1NGZB 5C3TA 1HXYB 3L5XH 1GGUA 5C7XH 3P9LA 5D1ZD 4AG4L 4PJIA 1UACL 5DHXB 4L3AA 1BFVL 3NBNA 3V4VL 5KVFL 4OZHB 3KPOB 1VKXB 5GZOD 3Q5YA 3ZYOA 1FHGA 3TBTA 4U1LB 1JMZA 2CUHA 3O2DA 4M3KB 4Q0XH 3WXWL 3T77A 5I1GL 5DA4A 4RFNC 4MAYC 1NDMB 3TZVA 1H8OA 4YDKL 2YA0A 1MCOL 3IFPA 1NANH 2F74B 4GRMA 2IFFH 4XVTH 1F90L 4PJAE 1E6OH 3ABZA 2FECL 2YEZB 5BVPH 3GNML 1E4JA 1KCVH 4KGLA 1JK8B 2AXGB 1LO0H 3HI5H 3MCLL 5KSBA 5D2NA 4WI8A 2FJHA 4X6BA 1PY9A 4M5YL 5JR1H 4HGWB 4UILL 1KN2L 8CGTA 1E4KC 4PJ9D 2VABA 5MENE 4W81A 3RGVA 4XNQB 3K1KC 4M7JL 5FKAB 1K8DB 1FNEB 2ADFL 4LARL 1GSMA 2OXHA 1F3JB 4LAQL 4F9LA 1U8MB 1VDGA 1WJ3A 3BN3B 3S96A 3MZTA 1L7IH 5BCAA 2I60L 3S37L 3GMRA 1CD0A 1S7TB 2EYTA 4N0CD 1JP5A 3LKQB 1WT5A 4HAFA 4LGSB 4XCFL 1W0WB 5KBNC 3ELAT 3VXRB 4J6RH 5B22A 2H2PC 4JN1H 5DT1L 1XGQA 2F54E 3AXLA 4XBPB 1H8SA 2FD6L 1T66D 1IM3A 5IOPA 1IGIH 3LMJL 5AYUL 4QRUA 5CZVH 2KDGA 5HHQA 3IKCB 4R7NA 2WUCL 5BMFL 5CGMA 4ODWB 2YN5A 3RIFF 5F9WC 2A2QT 3MBXL 1IAOB 4NOFA 3BISA 3KPRB 3RA7L 3SQOL 3BGAA 1PEZA 1HKLH 2ARJA 4ODSH 4Q9QH 4X8XA 3WHE0 4H5SB 3OB0H 2DKMA 4FP8L 5F97E 2E9BA 5E5UB 2GUOA 3DX9A 4MZ2A 4NKIH 4K9EL 3G6DL 4EKXA 5EIIB 4JRXA 2WANA 4GKOA 4MA1C 4Q9RH 2XI9A 3L7FA 1R5VB 4UDTB 4GAJL 5B8CB 3VFGL 2VXTL 3NA9L 1EFXA 2J8OA 3BIAX 3TZVD 2ZOLB 1PLGH 4TVPD 4U2YA 5C0DB 1A4JA 4NRYA 3P9MB 2P7TA 2GT9A 2Q8AL 5KS9F 2ZJSH 4XP4H 1MCCA 5CSGA 5FUZH 5I1HL 5FM8A 2FSEB 3N06B 1YY9D 1MCIA 1Q0YL 3HE7A 3CIQA 3L3OB 2YBRA 3C5ZD 4PRNA 4DQOH 2FATH 2VDLL 3QEQB 1MAML 5A2JH 5L2KE 5E8EA 4UTAH 3BP5B 5I8CA 2NW2A 3RGVD 4AEFA 5SWQB 1U3HB 5DMKB 5D70H 5CZXC 2VNCA 3EZ8A 5IW6A 5TF1L 5IMKA 4D8PB 4HIEA 1RJYA 3F8UB 4CMHC 5GS1C 3N85H 4QYOB 5F7NC 1G7HA 1U42A 3C6LB 5C0BB 1OGAA 2VXVH 4OFKA 4X4YB 1KTRL 2PCPA 4LEXH 1CDIA 2VLJB 3OX8B 1DZBA 4LLMA 4XCEA 1TJIL 1QKZL 4NHCH 3NH7L 3EBAA 4UIKH 5E6IA 5HGHA 4OQTA 3SE9L 4GBXB 5DLML 3X3GL 4BH7B 2VR5A 1FL6B 1Q9OA 4F57L 4J3WA 4A6YH 1JNJA 3QYCA 5E03A 4EN3B 4XPGL 3ILQD 2VDMH 4KGJA 3IAGC 2ICWJ 3PP3H 4K3JH 4NQXB 5GSVB 3NVQA 1KACB 5IB5B 3WKML 4X6EB 1MHPL 4ZFFA 5IB4B 2HWZH 2RB8A 4BSVA 4JRXD 5L0QB 2BDNL 4TSAH 2OP4L 3FO0L 4IJ3C 2NY3C 1EFXD 1S7SA 4QXUH 1N7MH 4QOKA 5DTFB 3RL2B 5IT2H 3T1FA 5FDYA 2OI9B 4G6FD 3KPNB 1II4E 1OL0A 2DYPB 1VFMA 2MHAA 5C09B 3RWIB 1T03L 4GG6B 5CD5C 3IS1X 5TE7L 5TGBB 5IVXF 4KUZH 3T0DA 1Z9MA 5HYJB 5LGHL 3MLRH 3U1SH 1SMOA 4WY7L 2PW1B 3E6HB 4CN6A 5DVOA 4ZPTB 3RX5A 3M8OL 2BY2A 3DO7A 3BMVA 4ZFGL 1LE9A 1KPVB 1LP9F 1OGAD 1F97A 2DQHH 5IFJA 1F8TH 3MYJA 1N6UA 4P46B 5JOFB 3O45A 3DMMC 5ENWB 2ZCKH 4ZS7H 1F4XL 3OJDB 4K8RH 2VKWA 1FZJB 3FB8A 1BF2A 4J8RA 2H6PA 4R6UA 2VSCA 2CRZA 2D03L 4FQIL 2NY7H 5E6ID 3SGKA 5J0BA 3IJYA 4NJ9L 2WMPA 1HCFX 1QSFE 2BJML 2ICEA 3LQZB 3WMSA 1AD0A 1I1AB 2CDFA 4F9PA 2DI9A 3FTGA 1F6AB 3FHAA 1MHCB 5IROC 4APQB 5DJ2A 3QI9B 4YWGL 4NQDA 4PJXB 5HVFB 4YHOL 3IVKB 2B1HH 3ZMRA 3K1DA 3X14B 3LIZH 1HNFA 5E99H 1MCPL 5GGSA 3EJZC 3MLVH 3V52H 4F33B 3UAJC 2BSED 1GOHA 3VD5A 2P48B 4QOKD 5D71L 3WE6A 1CBVH 2FR4A 5BRZA 4RMWA 3BN9D 4PGEB 3VXMA 1TZIB 4O51B 5EU6B 1JV5A 3UMTA 1KIPB 1AXTL 5C0FA 1U58A 3CVIH 3VMOA 4ZUUB 4YK4C 2MTPA 1CU4L 4WU5B 3GJFB 3CXHK 1CR9H 1C5BL 5D96C 1XF4B 3HLAA 2AP2A 3RJDA 4Y1AB 3T0WA 2WWMC 4N1HB 3Q3GA 3TC9A 1VPOL 1P7HL 1E6JL 1R3JA 2C3VA 1Z5LA 3MXVH 5D6CB 1K3ZA 3S4SA 2DJUA 4Z7WA 4X7TB 4MQ7A 4GSDH 3QIUD 3U0TA 3JTSB 1S7RA 1J8HA 1OPGL 4MD5A 5C6WH 5FO8B 3RU8L 3FQRA 1QFOA 3KYAA 2UWEE 1A7OL 4PRBA 5J6GB 1JPTL 2IADA 3QIBC 3PP4L 1LO2H 4JLRA 1XR9B 4E5XA 4XVUC 4U1SA 5EZIL 5F6HI 1CDCA 3H9HA 1Q94A 5GS0C 5B38G 2Y5TA 4IRJB 2VXSL 3GBNH 1RULH 4JG1H 4EXKA 3IU3B 1WCBA 2Q6WA 4XI5D 1FFQA 4JFHD 5SWSB 2PTUA 4NQDD 4Y16C 1YEDB 1NAMH 2YEZA 3F7VA 1TVBA 4WNQA 3VXPA 4YAQA 5D7SL 4RFOL 1TJGL 1MCLA 4ZO6A 5FB8B 4JVWA 4EBQH 4XXCC 1P4IL 3TIDB 5CZKA 1RSFA 32C2B 3KLAA 3UROR 1K8IA 2DICA 3VXMD 3MRBA 5D1QB 3CFKB 2M8XA 4M00A 1NEZB 3ULUL 1IJ9A 1E28A 2OTWA 5I0ZA 5FV1L 5DK0B 1X7QA 5EDXA 1NBZA 3SY0A 1AP2A 2QEJA 1U41A 3DI2B 1CTOA 1KNOA 5FYLD 1A1OA 3PDOB 1F45A 1RK1B 1TMCB 3GMMB 3HNTH 1EA9C 3QHZH 4IDJH 4X6DA 3OKNA 1T2JA 2WSKA 1GIGL 3FT3A 1KCRL 3ME0A 3PHSA 2E7MA 5D7IF 4FXKB 4LPXA 1ACZA 4MNQA 5FO9A 5CFHA 1T1XA 3RQ3A 4BSWA 3DGGA 3KYOB 2E7HA 3HG1B 2W9EH 2UVFA 2XNAA 1B88A 3VWJB 2NY2C 4UB0H 1UWGH 4OZGB 3IKKA 3CFBB 3HI6L 1FNGB 1P4BH 2QBWA 5DUBB 1N5AB 4M6OH 3B43A 4FQPA 4QRQA 1Q0XH 2ORBL 2FB4H 1AGCB 1AGFA 4JFEA 1RZKL 1KB5L 4FNLH 1NC4B 3BUYB 3UTTA 1EEUA 1C16A 1FSKC 3F12B 4HKBA 5EOTB 5HXMA 1TJHL 2FZ3B 4PR5A 3RGHA 4YNYA 1J9CT 5IM7B 4YGVB 3F7PC 4N8VB 2HJLA 2C4FU 5I1LB 3IFOA 4C83B 4NT6A 4NNPH 4XNMA 3QEQA 3V7AG 4OLUH 1TNNA 5ESAA 3BKJH 4ZQKA 4JKWA 3QNZB 4HXBH 1IGJA 4O2FA 2UZIH 1QTYT 1RIUL 2W60A 2CIKA 4ZFOL 1A6UH 2E7LA 1ORQA 1Z0MA 3TT3L 1D9KA 3RPKA 4HUXA 1Q38A 1JNHB 2AKRB 4QYOA 5DMYA 3IT8D 1YDPA 2VL5B 5DD1L 2XOTA 3I6GB 3ILPA 4AENA 2YXMA 3UPRB 3LN5B 4HC1L 4MDIB 3K4AA 2CUIA 1QBBA 4JDVA 3VFSB 2DM4A 5I19L 3L7EB 1NUDA 3P11H 4LCCA 1MWAH 4MNQD 3Q6FB 4ALAH 3C2AH 1YQVL 2DIAA 4P59L 5HPMB 3ARGA 5J13C 1YECH 2CLZA 4JR9H 3ARBA 3AS1A 4P9ML 4X6EA 2I26N 4U6YB 4XX1G 4BUGA 3QQ3B 1U95A 5JUEL 4R26H 2FLBT 4XP6H 2VJXA 5DD0L 4LF3A 3VG0L 3BRFA 3O11B 1EO8H 4P2OB 4YX2L 4Z7UA 5F9JA 5FYJH 4JFED 1OAXL 1NFKA 4YH6A 4X4XA 3UTTD 4N8CL 5C07D 1QVOA 1QR1B 4WWKA 5GGVL 3DVNA 2EXYC 2X4PA 1S9XB 2IQAB 2AK1H 3GI9H 3ZZ1A 1XZ0A 1BIIB 2DQGH 1IGCL 1ZT4A 2FJGA 5HHME 1SEBB 3E3QC 5IW1A 4OCSH 4U1IA 1LNUB 3RWCB 1BZ7A 3N9GL 3UTQA 1QFUH 4Q2ZA 4M8QB 3V6ZA 4DKEL 4FABH 2HH0H 5L6YL 3KHOA 5JPMA 4YXKL 2RGSA 3BDBA 3VXSA 3QQ4B 3BH8A 1WWAX 5A40E 5INCB 1D9KD 2NCMA 3FB5A 3FO1A 3PGCB 1U93B 4H8WL 2P5WE 4XPBH 3TFKC 4YXHL 2XN9E 5GS2H 4OLZH 5JO5B 1ZHNA 4ZODA 4HJJL 2SEBA 1JUFA 3K2MC 3NIGE 3U82B 1KFAH 5DVLA 4OUOA 2ERJC 4RDQF 3TNNA 4KV5F 4U31A 3W82A 3L6FB 1XGYL 4LDOB 4QT5A 3KNBA 3IJHB 1EIBA 3RI5F 1V7ML 1Y0LB 3VDBA 1KLUA 4JB9L 1A7QH 4QRSB 1CICC 2VH5H 3JV6B 3ARGD 3EW3B 4E0RB 3CLEL 5B3JF 4X7FC 4H1LB 4NJAL 5HYSG 1T20A 3ARBD 2Q87A 5MI0B 2DMBA 4IHOB 3HPLB 4A6YA 5BS0A 1JF5A 4I77H 2H1PH 3V0AC 3MODH 1JWMA 1KB5B 3D25B 1PFCA 3G5VA 1ZEAH 3DETD 5CJ8A 1QRNE 4X8JB 2HTKD 5I30H 2B20A 5JORA 4M9PA 5LWYH 3MRJA 5AUMA 4KY1L 4KJWD 2AV7A 3WYRA 1ND0B 4I18A 1RZ7L 5EU6A 3PXHA 2F53A 4JHZA 5D1ZB 1IM9B 2C3HA 2GJZB 3VFVB 5J1AA 3UZEA 4CU6A 3H7LA 2W59A 3FQUB 2XTJE 3HB3D 2XTJC 3C09C 2NXZB 4ZFOB 1ZLWK 3ZKXB 3WFZA 2RCSH 4HDIB 2WK2A 1Z3GL 3MGTB 4MNHB 3TJEH 1HSBB 2QR0B 3BPLB 5D6CA 3RVTC 4NGHH 3ULVE 3Q5OA 4DZ8A 3ULVC 1SHMA 3VXNA 4GG6F 5LJYH 1DQTA 3SDCC 4ODTH 5E08L 1BQLL 2EIZB 1NLBH 4MS8D 5ADOH 4POZD 3LN9A 4PJ9B 2X70A 3SDYH 4KRPC 1IT9L 5I18L 4PREB 3SGEH 3VGBA 2V5TA 5HHVL 3EYVA 4S1SL 4IMKC 1GHFH 4GW4B 2VLMD 2DTMH 1YC8A 1YEFH 4MXQD 4D3CH 5HVWA 2KL6A 2YD2A 4F58H 2Y25A 2BNUA 1B6UA 2V2WA 5KSVA 2P8PB 1U3JA 4G7VL 4OZ4A 1B3JA 3RUGA 3QISA 6FABL 3X11A 3BDYL 3CX2A 1IEAA 3GSNH 4PGDA 1EHLH 1KJMB 3QDGA 5EOCH 4XVJL 3SGJA 1MHEA 2R0LH 4GKSB 2A9ML 3ZKNC 4CADB 2DBLL 5IFHL 2Z31C 5I73B 2I25N 4OM0L 3SKMA 2F53D 3NCYP 4EQ2A 4PJXF 5KS9E 4YGAB 4PJEA 1D3CA 3LS5L 1JL8A 1LEIB 3MV7A 2E3VA 5A16B 4PFEA 3WFEL 3FO9A 1HHIB 1CG9A 1RURL 1TZHB 4M8VA 4PD4J 4D9QD 2W0FB 4JPIA 1VFOA 1TNMA 3BQUB 5LQBL 2J5LC 1WIPA 3OV6A 2RIKA 4TSCH 3NMEA 4F8TA 4UT6H 4JFQA 4NN5B 5I1KH 5BO1H 1CLYH 4K2UH 1NCWL 4QRTA 2DQTL 4R4BB 4K3EL 4AEHH 2BNRE 5IV2A 4M43L 2HFEB 2R4RH 3C5ZB 1FL5B 4Y8DC 1R3IH 3KPSD 1HQ4A 5DRWA 3LB6C 5ICYA 4ZYKB 2O5YL 4N0UB 5L8KB 4L1HA 4YBLC 4EXPX 5MEOB 1IAIM 5DA0B 4LCYA 5AG8A 4GW5B 5I8EB 4PG9A 2AGJH 2AV1B 1F02I 1GGCL 2FX9H 2H26B 5SX5K 5CP7B 3OF6A 2YUZA 2ENYA 5JW3L 1I9RL 2EDBA 4MLIA 3NCCB 1BBJB 4PUBL 5C0AE 3UTZA 4XBEL 1MVFA 1OF2A 2AABH 3F58H 3C8DA 3RVXC 1NAMA 4KMLB 3QDGD 1QA9B 1AD9B 4OJFH 4JY5L 1PSKL 4U1NA 1OAZH 3BZEB 4KI5C 3UYRL 1JTOA 3EOYG 5T5NF 3S35H 2XXMB 3VFTB 5CSBA 2Q20A 1VADA 3B2VL 4AEIH 4NO5B 3OJVC 2YWZA 4Y2DB 5HHXH 5L2JB 3RHWK 5SX4H 3RUGF 3U4BH 4OLVH 1UCBH 1G6RL 1NUGA 3V95A 2NY5H 4ODXA 4L8DA 3MV7D 3T3PE 3U30C 5IQ7L 3E6FA 3O6FD 3VFSA 3AGVA 5C0JB 5IVXE 1GGIL 1TETH 3T2OA 1JHTA 1MEXL 1ZHBA 4JANB 4X9FA 2O5YH 4LRIC 1XIWA 4WFHE 4M6MH 4UOW0 5KVMC 1HEZB 2NXYD 3LHPH 4XCNA 2D9QB 4L8SA 4N90E 2G9HA 2Z0BA 1BAFH 3D18A 3FAWA 5J57B 1TPXC 4DOHB 5H37G 4P5KA 1IGYB 4KI1A 1LP9E 1M7DB 3LEYL 5EA0L 2OXGA 2VZTA 1H15B 1RIHL 3Q1SL 1HHKA 1E4WL 1IC1A 1FV1A 1BOGA 4WW2A 3RL1B 15C8H 3KS0J 1DP0A 1TQCC 3KR3L 1PJ9A 1LK3L 3VJ6A 3RTQA 2HLFD 3UJJL 2JK5A 4G6AC 4ONGL 1FYTE 4UU9A 5AWNL 4KK8D 3WLBA 5CCKH 4V1DA 4JFPB 1J18A 4XNZC 1BQHA 2IAMC 2LABA 2OJZH 5HD8C 4UINL 3JWOH 5I9QC 2FL5A 2HP4A 3D0VB 3OF6D 4QHUA 5E2WH 4JM4H 3VH8G 1BQSA 4ZNCD 5T1KB 1I1FA 4OZGF 4IOFC 2YHGA 3TO4A 5TH2A 1XFPA 4OZFH 4S1DD 4BH8B 3ZTNL 1XCTB 1U92A 4JRYB 5CGYC 3SBWA 2R0WL 4I0CC 4LSQH 4MA7L 4O2EB 1K4CA 4W70A 1WEJH 3LZFH 4JG0L 4M4PA 3LD8B 3L3KA 2ATPA 4S11A 1AE6H 3V6OA 3BH9B 4OFDA 5DMIL 2YUWA 1OAKL 3BE1H 1VFUA 5JQ6L 4NZTL 4R2GB 3C2SA 4X6CA 3QO0B 1P69B 4N5ED 4R3SB 2J88L 1Z0NA 1MLCA 4P5TB 1GPOL 1K85A 4ZTPH 1B0GB 4KZEL 1ORSA 2AJZA 4WFGE 5C9JB 2DQFB 4OF7A 2YK1H 1YEKL 1N26A 3MRDA 1LMKA 2Z35A 4YFLF 4HKZA 2J3SA 1U8LB 1XIWD 1Y0LA 2JJSA 4HS6B 1QSEB 3MRIA 4QHLB 4RMRA 1A7NH 3UBXA 4PJDB 2IGFH 2B4CL 5JHLH 1R3KA 4DVRH 1NLDH 4NC2B 2IPKB 5TDNB 3OGOE 1MWAA 3C60B 3F7RA 4MJ6A 1JGVL 1NCBH 4XXDA 4XWGH 1KEGL 1VACA 3KJ4B 3PV6A 4GXUN 4KUCD 1S7UB 2KKQA 1I7ZB 1T2QH 3RTQD 1H3TA 2OTPA 3QUYB 3HR5B 4JQXC 4G6KH 5D6DC 4KJYA 4OD1H 3MRMB 2P5EB 3QIUB 1NGQH 3QUZA 1PGRB 2XPGB 3CNKA 1A2YA 4V1DD 3ARDC 1BM3L 4Z0BL 2A0LD 1C08B 2FRGP 2GJZA 1FO0H 2X6MA 5TFSL 1YNTA 3MLWL 4JO1L 4PS4H 4OKVA 5DD3H 3TO4D 2FIRT 1BFOB 1IFHL 4P48A 5EFIB 3NCYS 1QQDA 3I2CL 1MFEL 4RWYL 2R1YB 3BUTA 5IVNA 1F4WH 5I1JH 3MLXH 1IILE 4KKCC 4JY6A 3WBDA 5H2BB 2BC4B 5BZDB 4RGNE 4RGNC 3MACL 1ZANL 1KC5L 5JTWA 1RVFH 5KTEH 2YPKB 1F11A 1G6RB 1T1YA 3C9NB 1OCWL 4EVNA 2Q76B 3IU4H 1I1YA 1Q1JH 5IB1B 3PGDB 3IYLW 1NCDL 3L5WB 1CDBA 4U1HA 4NRXA 4PRPD 4TQEH 4HWUA 4I0PB 1A0QL 3ULUF 1TZGH 5I8OL 4MSWB 4I3SH 3DI3B 1JBJA 2NR6D 5DI8A 2ZSWB 3GSXA 5A2LH 3HHRB 5GRZA 1FN4B 5BRZE 5E5MA 5D7IE 3GB7B 2Y07H 1O7SA 1G6VK 4BZ2H 5JHDE 2H9GB 3L3IA 3ALXA 4RMTA 1BJ1J 3MV8B 4RMSA 1SJEB 3UO1L 3T8XA 3ZDYF 4TNVF 1CLCA 1MCBA 4QRRB 2NY6B 3BGMB 2X4OB 3S88H 5TQ2L 1MJ7H 3GIZH 4J3VA 1OOAA 3TVMA 3V0WH 3VRIA 4ENEC 5KN5A 2NY1D 3CK0H 1CXLA 3DIFB 5KJRL 4EOWL 2OJEA 3FO2B 5DQJA 2Y6SC 5CS7A 3QUZD 4ETQB 1MHHA 1FVDB 1LO5B 5CEXB 1AR1D 1JJUA 1AO7A 4PGJA 2DBJA 2A73A 5JW4R 5FYJD 1J8HE 1UM5H 2JJTC 5J12B 3TV3L 2XZQH 4HXAH 1DJSA 3Q48A 1J0KA 1ZAGA 5JQHC 4N0YL 3NCJH 5L7XH 1G0DA 5DEGA 3FQTA 3KLHD 5CBEA 1G7JB 5HHOD 2FBOJ 4IBLT 3P0YH 2ESVD 4PBWD 1JZ6A 1UFUA 1KTDA 2NLJA 4FZEL 3O9WB 3A6CL 2XG4A 5CINH 3AC0A 1KSRA 3PHQB 4F37F 1S78C 5C3LD 5BW7A 1X5XA 2HT2C 1JZ7A 1UM6L 3E8UL 1H5BB 1MFAH 1MIMH 4NYLB 4WFFD 3AM8C 1O5DT 2ZG2A 1GZQB 4L3CA 1J1XH 1UB6B 3CXDL 2NY0D 2HN7B 2B8OT 4YHIB 2L0DA 4LSTL 3S5LB 4X99A 4NRZB 5GS2D 3KGRA 2DKSA 3QXVA 4JEGB 4G8GA 3ARTA 4DUXA 4KMQA 3B5HA 4HJGA 3TCLA 4PV9B 3VFRA 3WLWD 4C59B 2Q7NA 1SJXA 4QY8A 4LMQI 2EH8H 2JCCB 2H26A 4U3HA 5D7KD 1X9QA 2XWTB 4MYWB 3CLFH 1CZ8H 3VXUB 1RQ5A 1FGNH 1YMMA 4UTBH 2BCKA 1S7VA 3LQAH 1QLEL 1CGWA 2L4OA 4ODHL 1GZPA 5DJZB 1AGEB 2VZSA 3OKOB 3R8BB 3VXRE 2PR4L 4GKZA 1NANI 3GK8L 2VDRH 3AREA 2ZUSA 1KTLA 3ARFB 3GSNA 3WL9A 2HG5B 4MX7A 3FQNA 3CFCH 1LK2A 3KPRE 4LFHD 4OB5L 4PJ8A 5SWZB 1ZHKB 1AO7D 2X4QA 5EOQL 3SDAC 3ARYA 5CJQL 4AK1A 3DYMA 7FABH 1NPUA 3EJYC 1IQDA 5I8KL 3WJLC 3C5SB 3RPIB 2DMCA 3QCTL 4QHMA 1IGMH 4JREB 1QYGL 3CXDH 3KYMA 3NTCL 5B8CC 2ZNWA 5T5FH 5C07B 1UCTA 1WVZA 2X4RB 1F00I 3P4MA 5IMMA 1AI1H 5EC2B 1YYLL 1CGUA 1NBYA 3ZLQC 4IEFB 5EIQA 3GMNB 1YJDC 2R2EB 4QO1A 5E5RB 4HUVA 3MBEB 5TPWH 3O6LH 1X5LA 1OAQL 4XRCA 4RFEB 2XV6B 3V0VA 1NAKH 1HYSC 1FC1A 3O6KH 3QEQE 4JO3H 4LOUD 5J06A 3SE4C 4Z95H 5DGQA 1JGUH 2VDOL 3G08B 4G8GD 4JFYA 4DN4H 1L0YA 1HHGA 3ZSTA 3R1GL 3JWNC 4KTEL 4UMGA 1C1EH 3OHXA 1NFIB 5DHVH 2FH6A 4JY4B 5DRXA 5C0GB 4HKXA 4DZBB 3HE6C 4WTZG 5C0BE 5CHNA 2ZOKA 1YMMD 1JPFA 1I3RB 5GGRB 2VLJE 3T65B 2YD5A 5AD0B 1G9NH 1G0YR 1R0AL 1LEGB 3L3GA 3BKCH 4ZD3L 1MFDH 3V5KB 3ARED 4NNYB 2HKFH 1O7VA 1YEEL 2KQNA 4JDTL 2VC2H 5C0CB 35C8L 1KEML 4Z77A 3GGWA 5L88L 1FG2B 1OP5K 3R0NA 4FFVD 4PJ8D 1W72L 1ACYL 3UTPD 5CD3A 4L1DA 5DUMH 2QHRL 3FFDA 4QKXB 3OR7A 1M6OB 2NX5A 3IAPA 4XC1H 3BGFB 5FYKD 1OP9A 3QUMH 3K2UH 5L0QC 4D0BA 4G5ZL 2F5BH 4KHXL 1AXSA 1WC7B 1U8NB 4PV8B 3WO4B 3LN4B 3BPOB 4O5LH 1ZA6A 2EYRA 2O5XL 3ZKQD 1QLRA 3HFMH 4MJ5A 5GJTH 4P23D 3U0WL 2CGRL 1E4XL 1YEIH 2OI9C 4HJ0D 2ARJQ 4EUPB 2PYEA 4CU8A 5AAMA 5D4QA 4GG6E 3CC5B 1FFOB 5EO1B 3KPQA 2HLAA 5HGBB 1MCJA 2P24A 2R1XA 4M5ZH 1TVHB 3WUWB 1N0XH 1YUHA 3GJEA 3ROOB 4QWWD 5IJVA 5K9QI 1P7KA 3MRQB 5HYJE 2EO9A 1MRCL 5ALBH 5DMGD 4S2SB 5EU5A 5GJSL 4H26A 4Y5VA 1GRWA 4F7MB 5IHUL 1XGPA 4ZUVB 1CN4A 4JCLA 4HUMB 4Y4HB 1VEMA 2QSTA 5CUSL 3UEZA 5EU7C 2CMRL 4P46C 2XZCL 1KELL 2ADIB 1NCUA 2IMMA 4QF1B 3O2VH 2VLRA 2X4UA 3TN0C 3O8XA 1JZ3A 1YPZB 4PJ5A 1D5BB 1AKJB 5DDHA 1UT9A 5C6TH 4OZFA 1HWGB 5J6HA 5BZWB 5LVEA 2QADD 5FM5M 1EHXA 3IDGB 4PP1C 4Z76B 4OD2A 4YR6A 2P46B 1M71A 3QI9C 4K9EC 1AHWA 3CMOH 2DQCL 5GRUL 2A1WH 3O6MH 2ADJB 4PJXE 1W2KT 1DUZB 2FX7H 1N3NA 2NX5D 4HMEA 5E00B 3P4OA 2A6JA 4ZSOA 4DGIH 3ARRA 3IXAA 5F93C 4A2MA 1HXMA 5GIRA 3ZE1F 4HK3J 1FJ1B 1DQJB 1NUFA 1LE5B 3SOBH 1ROWA 1IKNC 5KSUB 4NUGH 3IF1B 1NKOA 1AGBA 5IB2A 1C7SA 1X5IA 5DJXA 1BZ9B 5EU6E 3QCUH 1N2RB 5ITBH 3G5XA 1BVKB 4M62H 4YC2B 1EO5A 1A6ZA 1F58L 3OTTA 5MHSD 4L9DA 3WN5B 5E8NA 4AMKL 4WUUA 1IGFL 2CLRB 3LDBB 3P73B 4Y1AE 5E8PB 3KPLB 4GT7A 1N4XL 2PXYC 5IVZB 2DD8H 5DJ6A 5JA9A 4XPHL 1EMTH 1C5DB 3TESA 1QO3A 4TSBH 4KJQC 4R4FL 2WBKA 5A2FA 4PJDF 4JM2B 1MLBB 1T6VN 1OW0A 1OAUH 1E4XI 1QPPA 2FX8H 1WF5A 2IG2L 4RAUA 3OKLA 3O3UN 3I6LE 2IAND 3FB7B 2R2HA 3KPSB 2EDNA 2VLRD 4YIQB 5HGAA 3G5YB 5EUOA 1FO0A 2J6EL 2IMNA 3QEUA 3O8XD 1RK0A 1QBLL 2AJVL 3X12A 2YKLH 3E2HB 4HZLB 4PJ5D 3ZL4L 4B0MM 3CUPB 3T0EB 2CK0L 1W72B 2HKHH 4DGYH 3H7BA 4HH9A 4BM7A 5TQ0H 1IZKA 5FA3A 3CH1A 3P0VL 4ZS6D 3RI5K 1LO4H 3SCMA 5EN2A 4DK6A 5SWSE 1M7XA 4JN2B 4YDJA 5EC1B 1J0IA 4KVCL 4NC1E 1T1WA 3LRSA 1UGNA 4P3CH 2D0GA 3D39B 5FHAH 1XGRA 4LHQB 4NBXB 1KJVA 2VTFA 3DX6B 4YHNB 1DQML 1WZ1L 3LS4L 2DLHA 4D0CA 1U8KA 4IIQA 2HJFA 5BXFB 4NQVB 1F4YL 1A4KA 3V4UL 5AEAA 1G7LB 5FEBA 3BP7B 1I4FB 1EEYA 2APWA 3QHFL 5D1QC 3S36X 2COQA 4G3YH 2FDBP 4GOSA 3WDHA 2BSSB 2EDWA 2APXA 4Q6IB 4YHLH 1Z9LA 1CT8B 3O4OB 2X9WA 3O6FB 4WUUD 2FHCA 3CFEB 4OV5A 3P30L 1MJ8L 3FRUB 3MA7B 1TVDA 2BOBA 4XP1H 2C4XA 3BP6B 3HKFA 4JHAL 2DLEA 4W6YB 1A7RH 4U33A 5A3ID 5LXGH 1PVHA 2OR9L 3HG1E 3QAZB 1PG7H 4JGMA 3VFWB 4I2XA 2BVOB 5K59F 3V5HA 3DXAB 4CVZA 1VESA 1UC6A 3DBXA 1EEZA 3VWJC 4OZGE 1SMAA 5E6ZA 2A9NL 3CD4A 5IKCA 3FFCA 4PG2C 3S3SA 2WNGA 2YR3A 1UWEH 2MQ3A 4I5BA 1WBZB 4WJ5A 3EOTL 5E2JA 1B4RA 4RBPK 2AEPL 4M7ZB 3WIFA 4UI2A 3WCYA 1XH3B 4ONHA 1H0DA 4ZDHB 3KXFA 1ADQA 1BOYA 4M6AA 3SCMD 2DQEH 3IS0X 3MLTB 4B7IA 4NP4H 4KHTL 4RMQA 3BRGC 3U0PA 3RWHA 4RAVA 4WUKH 3D69A 1BJ8A 1X5FA 1OD7A 5LCVL 2I9TB 3MRGB 2GSGA 3FRPA 4MJIB 4YPJA 2VERN 3W9DB 1X5AA 4KZDH 2GAZB 3LKNA 4NCC2 1DQQA 1T80A 2F58L 4UV7L 4J4PA 4ZMAT 4FQ2L 4DVBA 2H2SC 4MAUH 3VGEA 4N0RA 3BPCB 4UNUA 1OARL 5DF0A 2B1AL 5E2UH 1NL0L 4D0DA 1JNLH 1OM3H 1IC4H 3BAEL 3MRFB 5JMOC 5IBUG 4TULH 4HGKC 4GUPA 4G80A 4JZJB 1A7PL 2CJUL 4X4MA 2JCCF 1JNNH 1ONQA 1MCFA 4J3XA 2OTUB 1WZKA 1FORL 3AY4A 5FDWA 4MQXC 3RY6C 3PUCA 2ILLA 1DBKH 4HHAA 4GLRI 3GJFK 3FFCD 2FBJL 4CMMB 5IP4A 4HMDA 1AC0A 1FZOB 2ICWA 1VERA 4P2OC 5H94B 2EDEA 1HINL 1MFCL 2DDQH 5IG7B 5JXAH 3K74B 3KXFD 2R8SH 3EYSH 4EDWL 3X17A 1ZT1B 1S3KL 5GQBA 2PO6A 4ZUSA 1KN4H 4JO4H 1RPQA 3UBXI 2BVTA 4JHWL 2Y9RT 1MSPA 1ZGLP 4ZUTA 4QTHA 5DZLA 4M6NL 2E6QA 1KENH 4LU5L 4OCRL 2PYFB 4P3DB 1ZSDB 2BVQB 3ES6A 1AY1H 1P4LA 1VSCA 5HHNA 4HUKB 2PF6A 2J12B 3QXDA 1WWBX 4S2SA 3ULUE 4IS6A 4ZO8A 1NGWB 3ZDZF 1KPRA 3LAFA 1U8HA 1UQSB 3S4SG 4HQQL 2FWOB 2FO4B 5E9DB 4FZ8H 3UC0L 4CW1A 3ALWA 3P9WB 3HUJA 5I6XB 1MY7A 2BFVH 5CJXA 1SBSH 3C8KA 2O93L 5DHVA 4A2LA 2EDQA 2G5BB 3ZDYE 2GTZA 2QHLA 4LLYB 4LNRB 1YEHL 2NYYC 3BHBB 3RWJA 1S5IL 4U05A 1XT5A 2R0KH 5BZWA 3EGSA 3PWJB 5F7HA 1IC7H 1I9IL 1DCLA 5CEZD 3UPAA 3QJFB 1E0OB 2DQDL 1U8IA 3TH2T 1DBJH 4TOYH 4NM4H 4XNYL 3CDYA 5MI0C 5DQ9B 4YQXL 3G9VA 5DJCB 3GHEL 3PWVB 3OKDA 4XMKL 1RZKC 3LKPB 1NBVH 4DTGL 3L1OL 4KPHH 4ODUB 1EUUA 3QQ9C 2XQYK 3BKMH 1Y18B 1F3DJ 2NY4D 1QFPA 1HSAB 1J12A 3QUMA 4G8EB 2Z92B 4X0KA 1F2XK 1HOCB 2CIIB 1INEH 3SHSA 3LQMA 5GSRA 1QHOA 2PO6D 3EDKA 2WINB 2X4TB 4ZPVA 3CFJB 5D1ZC 3IDXH 1CD1A 4G42B 4MCZB 4ZNEA 1A6WL 5HI3D 1PDKA 4M48H 1UJ3C 4ZTOH 4NIKB 3AS0A 5FOBA 4LLQB 3ZKXC 5F9WB 4Z8FH 5HHOB 2BMKA 2ESVB 1CFNB 2H8PA 5FK9A 1G7QB 2AJYL 4QEGA 3RDTA 4ESKA 3NN8B 5FYKL 4R0LA 2OK0H 2AEQH 1JI2A 2VKXA 4M7KL 3HCVA 3DUSA 4GRLB 1LQSR 3W0WA 4WCYL 3MFFA 5EO0B 1UM4H 4H0GA 5HJ3A 3PG2A 4Q97A 1NJ9A 5KVEL 1MELA 2YMXL 4GMSL 3PL6A 5CIPH 5F7MC 2E8ZA 2XXCB 5AAWA 3GSRB 4DWHA 4WVRA 1RJLA 2VAJA 3TPKA 1DSFH 5J8OA 2VDKH 4PJ9C 3VXOA 2HTLD 1NSNL 4XAKD 3OKEB 3QH3B 1DBAL 2P42B 5JDSA 2G2RA 2P4AB 4FXLA 2RFXA 2EDHA 3F6LA 5IESL 3LEXB 2EYSB 3DV4A 1Y6KR 4GG8A 5J11B 2VQ1B 3RKDD 3QUXA 3VRJA 1KBGH 1N0LA 4KTDH 4N0CC 5DJ0A 4LKCA 3VWKD 3GSUA 2RHEA 1YPZF 4CMHB 5K9OA 4P4RA 4P2CG 4M7LH 4X6FA 3QEHA 4KVNL 5EBWB 5GPRA 4W4OC 3MRNB 2HMIC 3AAZB 1I4FA 4G8IB 3IDIB 5I73C 1AJ7H 2X44D 3G6JA 4LCIL 4YBQD 1WWCA 5I15H 3MNZA 5T1DH 4CJ1A 3SGEI 3ZYIA 2MOVA 1UVQB 4XTRD 1WZMA 3I3EA 4FQJH 2AK4B 1KULA 3HAEH 3K81A 1V3KA 4FFYL 1J5OL 2X4SB 3OKKA 3RDTD 1RUAH 3MNVB 1SEQH 4NFBA 3W0WD 4H8WC 5CMAB 1T22B 3OXSB 1DUYB 5F3BA 3OB8A 4NN5C 1A1NB 4FRWA 3DRQB 1JF6A 3SJVA 4JPVH 3O2WH 2BVOA 1YY9C 1N8ZA 4MXWL 3PL6D 3BEVA 4WW1A 5EULV 3P77B 3FOLA 3C5ZC 3O3BB 3QUKB 2I07A 1YEJH 1C7TA 1D5ZB 5EZOH 1F6LL 1L7TH 3O3AB 5GS3A 1IL1A 4N0UE 5D8JH 3RGVC 1T04A 3UXFA 3FOMA 1N59A 3KS0H 3PWLB 1IE5A 1KG0A 1EFQA 4JM2F 4YBHA 4C57C 4U7SA 5ICXB 3MUJA 3V6FA 2YPLD 3TBWA 4JAMA 1X6LA 1CXIA 3WNMA 2HYMA 1MRDH 5D5MA 3QZWA 2RJMA 3BXNB 4IRSA 4UDUA 1F2QA 3CPLA 2R1WB 1FPTL 1EEQA 3Q6GL 4Q6YA 5D7JA 2DLTA 5L9DL 3B9KD 2V6HA 1WISA 2QSCH 1YY8A 4KDTA 1KLGB 2XA8H 4KDWA 5JPNA 1PEWA 3MRRB 4F7PB 4X98B 5CGTA 3GUTA 3EYQD 4ZO7A 5ID1B 5E2TL 5IF0A 3OWEA 1RZIB 4H25A 3DMMB 3HC0A 3QPXH 3B9VA 5GS0H 2APFA 4G8FB 4JZNB 1K2DB 4XP9L 5JIIA 2MQ0A 3L3HA 3D3VA 4XWOC 2DIJA 3ILQC 1WFTA 1MCKA 5DJAA 5EU3A 4PJHB 1K5NA 2ZUTA 1XCQA 3HN3A 4C4KT 3KPMA 2D0FA 4PY7A 1SYVB 4JFXA 4KMTH 4NUJA 2GQHA 5C0RL 4PRID 4OCYL 3VGGA 4M03A 3GMPA 1HZHH 4ZOCA 4YFDB 4M1CD 4UQ3B 5I76A 4NM8H 4FQCH 5I74B 3U46A 1HH9A 1ZGLB 4P23B 5HHPB 1AIFA 1PX3A 3S37X 3UPCA 1QBML 1CD8A 2XIDA 4NZUH 4DOHE 3QG6A 2QKIA 4NSKB 1EERB 5HY9A 5ACZA 4OGAD 3UTSA 2GTWA 1R24B 3NABL 3BWAB 2OQJA 4P3WA 1H3UA 4CGTA 1NC2B 4IRZL 1HIML 3MRPA 1GGYA 4HIIA 3MUHL 1RUMH 2P1YA 2H3NB 5D1XA 1JRHH 4CRPA 4Z78B 1YN6B 2VXQH 43C9A 5IBLD 4XB8A 2F8OA 4XC3H 5DRNA 1T5WA 3EKCA 2YSSB 3WSQH 1I3GH 4Y2OA 3PWUA 1G7PB 1JPSH 4PJCB 5H8DA 4RISH 3QIWA 4OT1L 4NPYB 3RWEB 5EBMB 4IRSD 2R56H 5EG6C 2RQ8A 2X05A 4WHCA 1DFBL 2C9AA 5D7JD 3MV9B 2V2XA 3MJ7B 1EX0A 4FG6C 4ZXBB 1FIGH 4JRYE 2Z8VC 1KCLA 5E6IC 4IOSD 3B6SA 2JELL 2V9QA 4RZCA 2QADB 1LD9A 1JGDB 3LD8C 4AIZA 2QQKH 3NFPB 5C71A 1EJOH 5E8DL 1LDPH 3GSOB 4POYA 2DWDB 2VMFA 1I8MB 1INDH 5FO7A 5D5MF 3D3VD 3AS3A 5GGVY 1I7TA 3T3MF 4GW1A 3OAUH 1RZFL 3NPSC 3QDAA 5EWIH 4OCWL 3QXUA 4OUUA 5JZ7D 1YNKL 4MAYA 2W92A 3WEXB 2X41A 1U8PB 5ESQA 3IDYB 4WU7B 1CFBA 2KH2B 3MREA 4PJAA 5KVGH 2FJFB 2HFFA 4PGCA 3PWJA 3QFJB 4ORGB 2NTSP 1I9JL 3S6CA 1L9NA 1U8QA 1FH5L 1U91A 1QSEE 5MEPA 4C58B 4PJDE 4FQLH 1E4KA 5HSFA 4LSPH 4FTVB 2VYRE 1S7XA 3WIHA 1QNZH 5MENA 3HC3H 3DROB 2X89A 2PYEE 4HFUL 3C60C 1S5HB 4K3GA 5B4MD 3GI8L 4OIIL 3UTSD 2DLGA 2E6PA 5HYFA 1DEEA 1ETZB 4LRNL 5C8JA 1OB1A 3BIKB 2VDPH 3E0GA 5F6HJ 4O4YH 4JO2H 2ZWLT 4PLOB 5KAQF 1CGVA 1I9EA 1P2CB 5D1XD 4KAQL 3MLYL 3QFDB 1HSAA 4HX1B 1YMHB 4AT6A 4TPRH 2P5EE 3QIUC 1G7IB 3O4LD 3QIWD 3HC4H 3QXAB 1YNLL 1NFDB 2J2ZA 1OTSC 3H6JA 4OTXL 2F54A 2W9LA 4LSVH 4Q58C 1MJUH 2AJ3B 3SKNA 1BX2A 2EDLA 3DRTB 2NTFA 5F70A 1YYMH 3QG7L 3TBVB 1HI6A 4NQEB 4DGVL 1FNAA 2YC1B 1AH1A 4MLSA 3MO1A 1SY6L 4QNPF 1H3PH 1YEGL 3QO1B 4U6TA 4F3FB 2V7HB 5E94B 5E95B 1C12A 2CLVA 1T0NB 3VFPB 1EVUA 3WHE1 1OAYH 3W9EA 4HV8B 3PHOB 1ADQL 5F7DA 5JXEA 5LGJA 3FMGH 2HRPH 4MAYD 1FNSH 5E2VH 4JFZH 3S8WA 1M7IA 1K6QL 1HHJA 2XT1B 4ZFZB 1MUJA 1FSKB 5DK3A 3K8KA 2IPUG 4L5FL 4OFPA 5C2BL 3NIFE 5T1LA 1HILB 1VEPA 4I0PC 4MXVF 5GRXG 1DDHB 4R7DA 1OQOA 1H3VA 1OTUD 4U6VH 4YLQT 5IGXL 3V4PL 2R9HC 5CEYA 1FRGL 4FQ1H 5L2KA 5MEND 3LKOB 4NWTH 2X89D 3VE0A 3MV8E 1FNFA 2DM2A 3SGDI 5SX5H 1A9EA 2IH1A 1Q9WB 2H32H 4TRPL 4HWBL 3MLUH 3MLZL 5GS1A 4QRRE 2F19L 4I48A 1YN7B 3C5JA 5DK2A 1MQ8A 2K9UA 1BEYH 3G04A 2LTQC 5TDOA 1CXKA 5DWUL 3BT2H 2JB5L 3UYPA 4TUKL 1KXQE 5LG1A 2AJUH 4HCRH 4ZUWA 5TE4H 3QULA 5ANMB 2B39A 3CSYB 1VFBA 2A83A 3BWUC 4NZDA 1F4HA 4F2MA 3IGAB 4ORZC 3CSGA 3U7AA 3HNVH 3AFLA 3OKMA 5CEZL 1ZLSH 4KU1A 1D5MA 1K4DA 5GISL 2AJXL 4K7FB 1FBIH 5T3ZH 1XGTB 3NFSH 25C8L 1PAMA 5HGGS 1IAKA 4NBYB 4GXVL 3IFNH 1QEWA 4GQPH 2YS4A 4NO0A 4X7EC 5T33H 5IIEA 1KPUB 3GSQB 4KQ3H 4P2RB 4KQ4H 5JMRA 4FXGA 2W9DL 5HDQL 3VFNB 5IB3A 1FZKA 1WGOA 3WS6C 1CFSB 1ZT7A 3WD5H 1J05A 5IMOA 2HRLA 1FE8L 1H5BC 4AIXA 2A6KA 5JXED 2O61B 3O0RL 3B9EA 1WFOA 3QJHA 4NQUA 3GMQA 2AJSH 5CSZA 3UX9B 2ITDB 5CIPA 4LNVA 1LEKB 1M4KA 1MPAL 5DMJB 5T1LD 3GSVA 2MPAL 3D2UB 2B4CC 1HNGA 1FVEA 2ZNXA 2GYSA 4YHPA 4Y19B 1D5IL 2QL1A 1A6TB 3K7UA 1KIUA 2JCCE 2XACC 2ZG1A 3N0PB 5HYQB 3IB4A 4I4WB 3R06A 3ULVH 2GCYB 1BQHG 3HZKA 3VXUE 5CZXD 4G9DB 4ERSH 4P4KB 3DX8B 2IALB 3MOQA 3MV01 4XPFH 2N4IA 1JF1B 1DQDH 4L8BA 1GGBL 3PQYB 3TT1H 3ARFC 5D2LB 1NGYB 2BOCB 4G8FA 1U6AL 4PRDA 5DJYA 5SWZE 1ZWIA 1N5YH 5FUOH 1T89C 3HS0A 3BSZL 4C56B 2ERJB 2BSTB 4EZMA 4LQFL 4TUOA 2FIKA 5MERB 1QSFA 1GCFA 3AVEA 4TYUA 1SBBA 3L9RA 1ZVSA 3AMKA 4PTTB 1A5FH 1CICB 5IROA 1CLOL 1MH5A 2FO1A 2VRAA 4Z18A 3H8NA 1JGLH 2DF3A 2ZPKH 1FZMA 3F65A 4JREC 3WS3A 1ZLVK 3MGOA 3HAEA 5C07E 2E6JA 2X9XA 2YZ8A 1A02N 4IOIA 3ZDZE 2FEEI 3VD4A 2DAVA 4LEOA 3UBXG 2XFXA 4NDMB 12E8L 3ZO0A 3BESR 4HUUB 2VDQL 3MBEC 4LKXB 3ARUA 3O3DB 3D9AH 3WXVL 3BKYL 1RJZA 4HIXL 2FYYA 5ADPH 4S1RH 5C0IA 2IQ9L 2E7LC 2A74B 2X4NB 5K9KB 4DUVA 5I66B 2VDNH 5GGSY 1MF2L 1MJJB 3TBSA 3RWEA 3FCTA 5KVDH 1ZTXH 3STZB 2A6DB 4MCYB 3KYKH 1A3LH 1XR8A 3IETA 1UZ8B 4U1GB 5FCUH 5FV2A 4P5MB 4U6XB 1J10A 1S7WB 2GITB 3GMOA 3DSNA 2UWEA 4UV4H 1HE7A 5C0CE 4K23H 3U7WH 1A6VH 3PDGA 4JFFB 3RWDA 1S7QA 5A43C 5I1AA 3JVGA 3QIBA 3ARGC 3CCHA 4UT9H 1DBBH 4I3RL 4MQTB 4GAGH 2CDEA 4BZ1L 1BVLA 1RUQH 3T2NH 5I1CH 1GAFL 4O2CB 1I8LA 3AB0B 1QSFD 2ZP0T 3L3DA 3BP4A 2Q8BL 4MDJA 2A38A 3CFIC 4JKPL 3SO3B 4QXWA 2HTKC 4OSUH 1FAIL 2P8LB 2JKXA 2NY4B 4Y16A 3WO4C 3REWB 3BVNA 1KT2B 2D3VA 3BPOC 1JI1A 5DVNA 5ID0B 4LSRL 3PGFL 3KYNB 1Q9KA 1IEBB 1DVFB 4XXCA 3KJ6L 4PJHF 5DHYB 2MJWA 4BZYA 3K4ZA 3D48R 3CMGA 3GIVA 3RAJL 5C9KA 2PN5A 4OI7A 5BV7L 5DUPH 4MWFB 3PNWB 3STLA 2D4FA 3D0LB 4XH2A 3WHXB 4HT1L 3ZE0E 2RAMA 2IBZY 1X5YA 2E27L 3BZFA 2C1PA 4HIJB 5ELIA 5HGDB 2A77H 4L4TB 3KDMB 1DTUA 4LFHG 4Y4HC 4UQ2A 2GHWB 5ETUB 3NACL 2UV3A 3S36H 1Q72L 4EDXA 1T0PB 5T1MA 3WNPA 4HEPG 2J5LB 3MRKB 4MS8C 4NHUB 2OMBA 2V9RA 4POZC 5F88A 4HWEH 4DN3L 2YD9A 3FT2B 4RNRA 2WUBL 2QQNH 3DO3A 3DHMA 1YPZE 1A3RH 4LGPB 4PB9H 1R5IB 4S0TD 3IXTA 3MJ8B 1CFTA 1AXIB 5F89B 5DSCB 4Y4FA 2ATKB 2WLZA 1X4YA 4LLUB 4LK4A 4PJCF 4E41B 4MXQC 3O41B 5ECJE 3S34L 3MRCA 4FS0A 5C86A 4UOJA 2OS7A 1FLRH 3QIBD 1EXUB 1G1YA 4OKDA 2EE9A 5D9SA 3QDJB 4WO4D 1VGKA 2B0SL 3CSBA 5KG9B 3JTTB 2VXUH 3VWKB 1CDHA 3ZT7A 2GSIA 1BECA 3LY6A 1NMAL 3UJTL 1EGJH 1FLTX 4N68A 3SDXB 3PIQA 5TE6L 4O9HL 2XWJB 1QLFB 3BW9B 1PYWB 5IJKA 3GRWL 4D9RE 1T4KA 4K7PY 4Y16D 3GKWL 1IC5H 2JIXA 4MGXA 5EBLB 2WWKO 4RIRB 2CKBL 4FQHA 3NCEB 4WTWA 4YC2C 1P7QA 2WV3A 4Y8AA 1HHHB 2DQJL 3ZT6A 4JPKH 4LCUA 4L4VA 1HQRB 3I6KA 1VA9A 2I9LB 1Q9LB 1LILA 1T0MA 43CAB 5BVJB 2JJVA 1SJVA 4WEUD 4L8CA 1SJHB 2OL3L 1CLZH 3FT4A 4MD4B 2EE6A 3OZ9H 4FQXD 1DLHB 3QRGL 5T3XL 5B38B 1D6EB 4LIQL 4DW2L 5BJTA 4HBCH 4EQ3A 1A22B 4OD3H 4BKLB 1S9WA 4OCMC 3HMXL 1MFBL 2C3XA 2Y7QB 2I5YL 3QDMB 3E2HC 3NZ8B 3T0EE 3T0EC 4Y4FD 4RRPA 2YPLB 3EFDH 1FL3B 5GGRY 1T5XA 3B3IA 2NY2D 1DL7L 1JHLH 4YPGA 1CL7H 1RFDL 2XRAL 1Y6MR 5GHWH 1RUPL 3WKNA 5M95B 2HJKB 1A14L 3MOAH 3HZVA 3D39E 3B9KB 5F3HB 3EYOB 4AM0A 1CD9B 4PLJD 3INUL 4P57A 3SGJC 1RHHB 4P49A 4K3DL 5I1DB 3HRZB 2JIXD 2PW2B 3VXTA 1J1OH 2QQLH 3ECBB 1PQZB 2HVJB 2DM3A 5FGBC 4BFEA 1UB5B 3IFLL 2WBJD 4KKAD 1ZGLM 5BV7B 4UAOC 1P7QD 2VISA 4TUJA 1XF3A 3S7GA 4MB4A 5KANI 2V2TB 2VITB 3CVHA 4WHTB 2DL9A 5F1IB 2C3WA 3O6FC 3EYUL 4LBEA 4PGBA 5K9JL 4Y4KB 1S9YB 2P5WA 2R0ZL 5DXWA 2H32A 2IWGA 3ZTJH 2XN9A 1JGEA 2Q86B 3DPBA 4HF5L 4CNIB 1CFQB 2IBGA 1CXFA 2X7LA 4JQIH 4B7LA 4Q9CA 4U6HA 4LLVB 2XTLA 5CWSB 5ALCH 5FA4A 4N0FB 3M1BB 4PP2B 4LSDA 3H0TB 3I02B 5DD6A 3QAZC 3SJVE 3MYZA 1OP5H 5EO9A 3DXAE 5FUCE 2C1OA 4HCRA 1NDGA 3WIHL 5IR1B 4J1UA 5DRZB 3PABB 5JOPE 1BJMA 4FMFA 4DAGH 4OBRA 1RMFH 3F5WA 2YRLA 1RI8A 2HLFC 4RGOH 1CGXA 3WFBH 4NQSA 4M7ZC 4KK8C 4R90H 4XVSH 3E1F1 5CBAB 2D7QA 1GGTA 3VFUB 1PY4A 2ED8A 4M1DL 3DVFA 1QRNA 5D5ME 4NKOB 4XNXH 3CH8A 5JLZA 4ISVA 5DURB 3T3ME 3RNKA 4S1DC 3IDNA 4NWUL 1AQDA 4NO2A 5KW9L 3NPZB 3H42L 3ARDB 5AZ2L 3WFCH 1I7RB 3HRPA 2CKBB 1HH6B 4MJIE 2UVEA 5DR5H 3WJJC 2CK2A 3VI3F 4OLYL 2D9CA 5HHMD 2R69L 3RNQA 3D85A 4BFIB 2HVKB 4JZOB 4FQQA 1B2WL 4NKDA 3QNYB 3U9PH 5IQ9A 4G6MH 5DD5L 4X5XA 1KOAA 1PKQB 3CZFB 3KWWA 3DSFL 4X9GA 3QWQB 4QCIA 3U6RB 2OL3B 4S10A 3BEWA 4OLWL 4QXTA 2P5WD 3WNOA 2GITA 3TFKD 2Z8SA 4XPTL 4ONOA 4JZJC 2XN9D 4GQ9L 3SDCA 1QPXA 4Y5YB 2WAHA 1OT2A 3QP3A 4OZFG 3TBYB 5JW4M 4H20L 3ROLA 4RSVA 1T21B 4M1GH 5D93B 3DYOA 2EDKA 5JIKA 3W39A 5EZLA 4XBGA 2ADGA 5I17A 3U2SB 1R5WB 3SPVB 3MNWB 1T3FB 3LEVH 1ZKAA 1G0XA 5I1EH 3CFDA 1CFVH 3GFUA 3QCVH 5D2LF 1T1ZA 1F3DH 3QA3B 4QNPE 2DI8A 2W38A 1MIEL 3BJ91 1B0RA 4YZFE 3T4YA 2C5DC 4OGXH 1L0XA 4G7YL 5DYOA 1FYHB 3TO4C 2F5AH 2AXJA 2YA1A 3OSKA 2IPTH 1CE6B 1JZ2A 2Z31A 3HTLX 3G6AB 1OWWA 3SBWC 1V7NL 2Z4QA 1JHKH 5LGKA 1J1PH 1P9MC 1I75A 1ED3A 4LVNB 4X5WA 3V6OC 2X1PA 1N64L 4MXVE 5DO2D 3SDDA 4U2ZA 2XTJD 2NNAA 3D85D 5GGQH 3F7YA 2VQUA 3V2AR 5E9DE 2FGWL 1J0YA 5I6XC 4ZOEA 1M05B 4Z0XB 2NW3B 1YJDH 3EO9L 4QXGH 2MCPL 1DN2A 3UJIL 5DFVC 5HYSB 3MLSL 3A6BL 5IFAL 2EE2A 2FLRT 3RY5A 2BNRA 4NZRL 3QEGH 2NR6C 5E1AB 3DJ9A 1RZJL 2DLFH 1B6DA 4YHMH 2CDGB 3OJ2C 3HMWH 4KRPD 4Z9KB 1A1MB 3ARZA 2Y4SA 4JPWH 4CVUA 1BD2B 3CU7A 1A6AA 2IH3B 3NGBB 4GMTH 1IQWH 4F80A 1CE1H 2XKNB 1NCAL 3ULVF 1WBXB 3VGHA 5B39A 3REVB 3FB6B 1WQVT 1FDLH 1UG9A 4HPOL 3PWPB 4JFDB 1JN6B 3QWOA 1UXWA 4NKMB 2NY1C 3H9SB 4YE4L 4LDEB 1IAIH 4LASL 2WP3T 3ARPA 4XPAH 5C0AA 3QNXA 3C87A 4QTIH 1AR1C 4I9WE 5JW5A 4X80L 1ZA3B 1BIHA 4AG4H 1UACH 2J7LA 1BFVH 3V4VH 5KVFH 3JV4B 3QBTB 2VAAB 2ITCA 3LKSA 3ZKND 5MEQA 2Z31D 2Q7YA 1D5XB 3KLHC 2IBZX 5HHOE 3BMWA 1W0VA 2ESVE 3WXWH 3ZKSD 5I1GH 1NGXA 4Z5RB 2Z93A 4HFWB 3SDAB 3QB7C 4PRHA 4YDKH 2FEDD 4GRLC 1MCOH 3SDDD 1TIUA 4RGMC 1INQA 3MUGB 4AH2A 2CO7B 1F90H 1QRKA 3O3EA 3GNMH 5LBSL 3MCLH 4DCQB 2UYLB 3LSOA 5IVXA 5I16A 4M5YH 4UILH 4OIAA 1KN2H 4LHUA 4LRIA 2NY0C 2PNDA 3HI1A 4B41A 2CUMA 3TA3B 2R23B 2EDRA 4M7JH 3CAFA 1MCNA 3HNSL 4NO3B 2BNRD 2ADFH 4LARH 1BMGA 3IDJB 1A3QA 4LAQH 3WLWC 1LP9A 1R3LB 4UOW1 4KROB 5J11C 2EKSB 2E9JA 1KCUL 4RBPH 4Y5XB 2EIDA 5D7KE 2I60H 3S37H 3EO1B 5I1IL 1M1SA 3WIIL 4QHNA 4FFWC 1P1ZB 3V5DA 2MMXA 4XCFH 3OPZL 4K7PX 1A7BA 4OGYL 1U8JB 1BF8A 2J1KA 1FYTA 3LH2L 4XGZB 3RIAK 5DT1H 3CDGB 4LSSL 1XF2A 2FD6H 3JUZA 3LMJH 5AYUH 5IHZB 2IAMA 5EPMB 2DQUL 3MROA 2X1QA 5IEKA 5ISZB 2WUCH 2EZ0C 5BMFH 2QV2A 2LVCA 1EGJA 1XGUB 3HE6B 5EORL 2GY7B 3MBXH 4OCXL 4UT7L 5JOEA 3FRPG 3RA7H 3RBSA 3SQOH 1OSZB 1JIBA 1PQZA 1JZ8A 4N9GA 4QRPA 2V5RA