2D7OA

Solution structure of the 17th filamin domain from human filamin c
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
111
structure length
111
Chain Sequence
GSSGSSGAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 17th Filamin domain from human Filamin C
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Filamin-C
total genus 10
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d7oA00
4OLEA 2YA2A 3ZHDA 2V9TA 2W38A 3VWKD 5GGTA 3RL2A 4NKDA 3QQ9D 4YXLL 3BKYH 3OAZH 3PNWB 2DI7A 4OT1L 4FZ8H 3QZWG 4G6KL 4X99A 3RWFB 2XQYK 4Y8DC 4G6KH 2M26A 3ZL4H 4PJFA 5LGKA 2APVA 1BREA 5L6YL 2F58L 3LZFH 5ID1B 1JNNH 2PYFA 1XR9A 2W0FB 4U3HA 3VD5A 3Q0HA 1WZKA 7FABL 4HZLA 4KC3B 4FZ8L 3NIDE 4BSVB 5ALCH 1AO7B 2ZJSH 1PEZA 5C8JB 2O5YL 5SWZA 2BC4A 3JXAA 4P4RB 4M61B 1RJYA 4KAQH 4Y4FC 5BO1L 3MO1A 2B39A 4LLUB 4LMQE 5MP6H 3K1KC 2ZCHH 3X11B 3O4LB 4OB5H 1G9MH 2P8MB 5I75B 4Y5XB 4OI8A 1Z3GH 2NR6C 5CEYA 1I1AA 3CU7A 1RK0B 4PJXF 1FRGL 2QJDA 3CXHK 1X5GA 5D7IF 2VLRA 2Y9RT 3DVGA 4ODXA 4MQXC 3ZL4L 2EE9A 1P4LA 3MJ7B 4HHAB 4YBQC 5ILTH 4HBQA 4W4OA 3VXUB 4F7EB 3DVNA 4WO4D 5EOCL 1NCCH 1MNUH 1FZOA 1RZ7L 1XH3A 3WIFB 4NNXA 4JZNB 5E9DA 5F9JA 4U1GC 1HYSC 3RY6C 3QIUD 2FO4A 4L4TA 3SE3C 1TTFA 4RAHA 2X4SA 5EULV 3L3JA 1FAIL 4JAMB 3VXMB 1R3HB 3GHEL 1U91B 1I7RB 2HFGL 1XGPB 3BP4B 3BFOA 5M95B 3H9YA 3QIWA 3MV8B 1JF5A 2X9YA 3HE6A 2ESVA 3QUMB 1CFQA 4DGYH 2E7LA 4HAGA 3O3UN 3RWCB 2IFGA 2NNAA 4JPVL 1BZ9B 3TT1H 5DO2D 1DQLH 1EDQA 4OF3A 2EXWD 5EO9A 1FIGL 5DMKA 2EYRB 4JZJC 3UAJC 1XGYL 4PGEA 3DX8B 3RWJA 1OGAE 4YPJA 5EH1A 4P2QE 4NQCD 3H0TA 4NQSB 3S3SA 4P57A 1G7IB 4MJ6B 1F4WH 1SHMA 4RISL 5DT1L 2J12B 4ISVA 5EG6C 5KSAC 1S9XB 1INDH 4D0CB 3NCCB 1NAMA 1JNLL 1QFWL 1B9ZA 3QI9D 4P46C 1MJ7H 3NZHL 2UY7A 1X4ZA 5AAWA 5D7IA 3P73B 4U1LB 2QADC 5D7LE 2PXYD 3QXUA 4FFZH 1ZGLM 3G6DH 1AD9A 3L3OA 4D94A 2XQBH 1XF3B 4QOKD 4MDIB 2X44D 3EW3B 4X6FB 3QPQD 1CR9H 1KELH 3WD5L 3UBXA 2SEBB 3TNMA 3Q6FA 5I15H 3P9LB 4HDIA 3VD3A 3BVNA 4FP8H 2C5DC 5BV7H 3V4PL 4YHZH 4OZHF 3O4LD 3TN0D 4I0KA 3RJDA 2PYFB 2W0FA 2VDMH 1PY4A 1NFDB 1CFTA 4ODUB 2B2XH 5GGQL 2FHFA 4GBXA 1HZHH 4PJIF 1M71B 2IQ9H 4FFZL 4R9HA 3MRPA 2YA0A 4D9RE 5SV3A 4MJ5B 1BFOB 1NC2A 4PJ9A 3QXWA 4L8BB 5EU5B 4FQLL 4CUCA 3OB8A 1Z9LA 1QRNA 1TCMA 4JHAH 1I3UA 5EZIL 5BJTB 1E28A 1TENA 2BNRB 2NZIA 3T09A 3CUPB 1XF2A 4M5YL 4QXWA 4KI1A 4X4ME 3VXRB 5GRWA 1JFQL 1UH2A 2NY5L 2QQLH 3D5OF 3CDYA 4KY1L 4MS8C 5TFSH 2P7TA 3MLUH 5JW5A 4UT6L 2MFNA 1QLEH 3MA7A 4YH6A 1JE6A 1TQBC 1QA9B 2GCYA 4AT6B 3W39B 3JV6A 3SY0A 1LDPH 2W60B 4WV1A 2FR4A 3MLZL 1U36A 3EYUH 4TVPD 1CD1B 3FTGA 1SBSH 4LCUA 3NIGF 3OR7A 2ATPB 5B8CB 2E6PA 4K3EH 4GG8B 5FYJH 5I8OL 1OAYL 1U8JB 4NOBA 2XN9B 5E1AB 2EH7H 2HKHH 2FEDC 3PWNB 1RUML 5LGJB 4Z7NE 3H9ZA 4D0DA 2HTLD 4TQEH 4OZIE 1GC1L 3VXOA 4M7LL 1YNTB 4YDJA 1YC8A 5DUBA 3RDTA 3KR3H 3C2AH 4AEIH 4QRRE 5T1DH 3HZYB 3IGAA 5CJXA 5KN5A 1QO3A 5FYLD 4KPHL 2E3VA 1AGEB 5KS9A 4F8QA 1N59B 5D6DA 3ZO0A 3V0VB 3BZDA 1T2JA 4M9PA 3PL6A 3S96B 3G5YB 1X5JA 4FQJH 2R1WB 43CAA 3AUVA 4K71C 1GHFL 3O4OC 2VXVL 4YDKH 3VWKA 3RIFF 4YHNB 1KCVH 4RDQF 1VGEH 4LSUL 4N8CL 1AKJD 2P5EE 3VG0L 4PRDB 1ACYH 2D7MA 3MV7A 1BVKA 4BYHA 2V2TB 2GJZA 3S5LA 5I8EB 3U9PL 4NQUA 1INEH 5BS0A 3FFCD 4XGZB 5D8JL 4UTAL 1V7NH 3PWUA 4N9GA 3VE0B 3MFFB 4YHOL 3TH2T 1QG3A 1TMCB 5F8QC 3B2UD 1PAMA 2EDXA 4MA3A 3BYYA 1D5ZA 2NY2D 4LVOC 3RY5A 4JFPB 4J23A 3UPRA 1UA6H 1A3QA 5FA3A 3SE8H 4U49A 2DBLH 1IAKB 5DRXA 1D6EB 3Q2CA 1MCWW 4JFDE 4X8JA 4M8QB 1QSED 1MCSA 1S7RA 4NRXB 5IROC 2JB5L 2OI9C 4XP6L 4KDTC 1G7HA 2WZPD 1NAKH 4JRYB 4WUKH 1U3HD 5J56B 3IJSB 4LU5L 5EU6A 4XX1E 4XVSH 4G6ML 2F53E 2VLKE 4UAOB 1BF8A 2VDML 3VRIA 1F8TH 3NCMA 1CD0A 4G9DA 3SKNA 5CP7A 1RK1B 5C09D 5DHVB 4BZ2L 4LEXL 4PRPE 3EHBD 3BP5A 2E5EA 5EWIH 3I6KA 3GBML 1GRWA 4P3DA 4R3SB 1R3JA 3E6HB 3FFCE 4PBVC 4APQA 4XAKE 5DK3A 1TCRA 1QRKA 1PZUB 5MHSE 2PYEB 2VLJB 4PBWD 4MNQE 2KL6A 4GAJL 3WS3A 3BH9B 4R0LB 1LO0H 1D5IL 3QDGE 4ODVL 1JPTL 3WLBB 3L3DB 3IJYA 1KIPB 3GUTB 3BE1L 1BMGA 4PGZA 4U1IB 5GISH 1MCNA 1PFCA 2NY5C 3X3GH 4I5BA 1TVBB 4EN3A 1CLZH 3CH1A 1GGYA 1F6AB 3I6KB 4JFFB 3MACL 5I8CB 1TNNA 2R29L 5HPOA 3SKNB 2CR3A 3LMJL 3O6FA 4R4ND 1HINH 3FMGL 4PG9A 1I9RL 3S36L 2W59A 4KI5E 4M6NL 1MLBA 5GGVL 3K74B 5GS0H 1IM9B 3MRNB 1FNAA 4J3UA 4UIMA 5F7DA 1NGZB 1SYSB 1JK8A 3QIBD 1YECH 5GGSB 3EO1A 1WWBX 4XBPB 4XPTL 2DICA 1P9MA 5EC2A 4C55A 3TV3H 5B39A 4MXWH 1Y0LA 3QUZD 3H9HA 2PO6D 3L5HA 5HPMB 5EZOL 4JGUA 2IPTH 4P9MH 3UJTL 1FL6A 2IALB 2ARJB 2EDJA 5FXCH 3P4MB 5I1AB 4OF7A 3EO1B 1CQKA 4XGZA 2OTPA 3MLWL 2AAVA 1ADQH 4BFIA 1Q0XH 2D03H 1SYSA 4MQXD 4GKNB 1RY7B 4RA0C 1SY6H 2CKNA 3HRZB 3T4AA 1EHLH 4X0KB 3GIZH 2N56A 1NMCC 2GSIB 4R0LC 4W4NA 4YHNA 4WI8A 3RVTC 1T6VN 2Y1VA 1LE5A 2NY7H 3O2DL 1KBGL 4RISH 4UT9L 4XT1C 5TDPB 3MODL 2DQFA 1PW3A 3HMXH 5F1SA 1G7PA 2Z91B 4PJGF 3GK8L 4NO0A 5FYKH 1WGOA 1JWUB 5F7NC 3RWGA 1OAUH 1FNHA 3MJ8B 1D9KC 3GKZA 1KTLA 5ESAB 4FQ2H 5JNYA 3CAFA 1JZ2A 2AJXL 3DV4A 4NO0B 1J1XH 4ELKA 3T4YB 2YPLB 3QDJD 5MP6L 1C5CH 2NYYD 5TDPA 5C0CD 1WBZA 3D0LB 4RAUB 2EH8H 3EYOA 4OM0L 4WY7L 2R1YB 3BW9A 4CVZB 5IT2L 5MENA 1ED3B 3E2HB 5F3BB 5CJ8A 1KG0B 1HIML 1JHTB 3D25A 1MFNA 5I66B 5ICXB 3B5GA 2AJ3A 2BDNL 1AFVL 3EJYC 4R6UA 3LCYA 1PJ9A 5TPWH 5IEKB 4OUUB 3ZE0F 4CMHC 3IYLW 1ZHBA 4WUUE 4Y5VC 2PW2A 5E2VH 2YSSB 4H0HB 4Y16D 1RZFL 1KB5B 1PZ5B 2WUBH 1F2QA 1SYVA 3CZFA 4ZAKB 4Q9QH 3BO8B 2XTJB 4IRJA 2IALA 3PP4L 1OQXA 1LE9A 1KCSH 5DMJB 4NFDA 5E99L 1I3GL 4GBXD 3MLPA 3WFDH 2P24B 2EYTA 2DMKA 1D9KB 3V7AE 4UI2A 3PWVB 3LQMA 4ZS7H 4NP4H 3OGCA 5BQ7A 1WT5A 5CWSB 3RVVD 4JREC 5CMAA 3IXAB 5K33A 3DURB 3U0PB 4D9LL 3LD8C 3ILPA 5FECA 4NJ9H 1NGZA 5BO1H 4M6OH 4MDJA 3I50H 3RWIB 2GK0B 4HIJA 3U0WH 3N85L 2R2HB 5IB5A 1VA9A 2NXZC 1H3VA 5IR1B 1KPVB 5F8RC 1X6NA 5SV4A 5E99H 3QG7H 1NDGB 4K8RD 4BQ9A 1YPZA 3VGBA 4QT5B 2BFVH 3T8XA 3F6LA 1FN4B 1R3KA 4KKAC 4X6FA 4B53A 4Y1AB 2HG5B 1M1SA 4FQLH 1NMBL 5TE6L 1TJHL 3WFHB 4HUVA 4TSCL 4KTDL 4PJ8A 5HHNA 2F74A 2H1PH 3P73A 4RMSA 1H3XA 3PQYE 1ODAA 1RZJL 3HPLA 5TGBB 1HDMB 2DLFL 4JRXB 4D0CA 1FNSH 1FPTH 5C0AB 4OQTL 5DD0L 1UVQA 5D6CB 3MRRA 3ZDXE 3LV3A 2D4DA 1G7IA 5CZVH 4NJAL 4K94L 3BKCL 5A16B 1YEHH 1S7TB 2H2SD 5CZKA 3QT2A 3O6ML 2H9GA 2P7TB 3LKSB 5DRWB 3WDJA 4NHCH 3TIEB 1D6VH 3TA3B 4F37F 1R3IH 4WEBL 2BOBA 4NN5C 1H3UA 1H8OA 1MREL 2YD1A 1C16B 4TPRH 4OLWL 1XF2B 3DJ9A 5D2LF 5DRNA 2ZPKH 5MERB 4F58H 4XP4H 4ZUTA 1TITA 1YYML 1FGVH 1JNLH 3TN0B 2C7UB 3GSQA 5EU6D 4ZS6C 3VXMA 1GVIA 3D9AL 3WN5B 4GH7B 3FO9A 4LCIL 2FO4B 4XMPH 2WBJA 2XKSA 4XNQA 3A0OA 2A77H 1P69B 2WQRA 1FIGH 1DLFH 2VDNH 3R06B 4F57L 3CX2A 3VG9C 1RZIA 1IKFH 2NX5D 5BW7A 1S7QB 1HZHL 5CZXD 4O51A 3QRGL 4LLDB 3MLSL 3R8BB 4BM7A 3C5SB 5DVLA 1B88A 3MJ7A 2ZUQC 5GJSL 2X4RA 2UVEA 4YHKH 2C1PA 5J7CC 4ELMB 2VLRB 5C09E 1IGIH 2L7JA 3F7YB 3ZKMD 4DZBB 2X9WA 1WWCA 5M94B 2HFGH 1ONQA 1K4DB 5HXMA 2AI0H 3QQ9C 3MLZH 2VLRE 2EE2A 5E8OB 1T22B 4EI5D 2JIXD 1N3NA 3GI9L 4JY5L 5FO9B 4XP5L 3U1SL 3HZYA 5KN5B 3RUGE 4X9FA 2FYYB 2HKFL 1NAMB 1WAAA 2Z8WC 5E8OA 3TZVC 4JFDD 4Y19B 5C07D 4HPOH 4KHTL 1FNLA 4K3GA 1JCKA 1P84J 5HVFB 3NN8B 1P4IH 4QRPB 5FGCB 3X14A 3OXRA 4MDJB 4PGEB 1EFXD 3FN9A 1PKQA 1EGJA 4K9EC 1BPVA 4XMPL 2FEEL 4JFHE 1P7KA 3KNBA 4HT1L 2XTJC 3B8SA 3TFKC 5HHPB 1CD1A 4I0PC 5C0RH 5T3ZD 1ITBB 5HGDB 5DJ2B 2DM4A 4JM2D 4PRIE 1S5IH 1RPQA 2H3NB 1QSFA 3HUJF 2WLYA 1CGVA 1T1XA 3KPLA 4J6RH 4IMLB 4WENB 2RFXB 4F58L 4HXAH 5SWZD 3SDXA 5T1KD 1RUPL 5IVXF 4NNPL 5JPNB 2MKLC 3D85B 1PLGL 3RTQA 5ICZA 1J05A 4PJGB 2NY2C 4E41D 1S7SA 1GOGA 1Q1JH 3QFJA 2FX9H 4L4TB 4PB0L 2Z35A 4U1JB 2HFFB 1GGBL 4GRWE 1A6UL 4JHWL 1DBBH 2G60H 1X44A 3BKCH 3VI4E 3LD8B 5DI8B 3MTRA 1F6LL 2Y25A 5D2NE 3MRLA 4M02A 4ZOBA 2X4NA 3HC4H 3SDDA 1KXQE 4OD2B 2W91A 4R2GB 1DQQB 2BSSA 1N5YH 1HQ4A 3HLAB 1KJ2L 2Z0BA 3M17A 3IDGB 3LQZA 3Q3GA 4RIRB 3U7YL 1NPUA 5IMKB 2NY4B 2PO6B 5C0ND 5HGGS 2Y5TA 1QBLL 3LEVL 1BECA 4LRIC 1BBDL 3IAPA 5FF6B 5LG1A 2ZOKB 1WCBB 2FB4H 4OCRH 4WI3A 3W0WE 5IESH 1NCAH 1KLUA 3D85D 3L5WA 4XVUC 4RQQB 3U9PH 1WAAF 4OCLC 5I1HL 5EOCJ 1GIGL 4HUWB 4E41E 5IW6B 3PXHA 4PJ7A 3DWTA 1VGEL 4LSUH 4S1QL 4HGMA 4FNLL 1MCRA 1QP1A 5HYQA 3QCTH 2JELL 2Y7QB 1DN0A 3UTZB 5I1LB 2ZOLA 2HJKB 3FO0H 3CXHJ 5EZJA 2OS7A 5I1HH 2NW2B 1T2QH 2E7HA 1ZA6A 2LVEA 5JIKA 4QYOA 3S35H 2FGWL 5E1HB 4YHLL 3DSFH 2YOCA 1C1EH 2J88L 4NUJB 5F72S 4M1GL 4KWUA 4YHIA 5KSBB 3N9GH 3B9KC 4P5TC 2DLTA 3L7EA 4PJAE 5FO7A 1P4BH 3STZA 4RFNC 3MV9E 4G7VL 2YD2A 3QEUA 3QDJB 4PJCA 1G7JA 5AZEH 2E7LC 4AEIL 4ERSL 4GG6E 4TSAL 1U8OB 1F11A 2FL5A 4TUJB 1KYOJ 4IOIB 3G9VA 3MRNA 1E4WH 2W65A 4K8RC 4QTIH 2CH8A 2ADIB 4QRQA 4TUKL 3MBEB 4HS8H 1V05A 4JE4B 1CFVH 3VH8B 4URTB 4JFFA 3HFMH 1OAZL 5FCSH 3MLUL 4F33B 4EN3B 3EO9H 1RUPH 4JM4L 4LLWA 4PJXA 4PJ8D 4XNZB 1VFUA 2R8SH 3EYOB 3GUTA 3LKNB 1DCLA 2IG2H 2V7NA 4JZJB 5MEOA 1WVZA 4WNQB 1OAQL 2F53B 1VEMA 3WLBA 1EJOH 5IBLC 3VWJD 1AC0A 1GL4B 4LEOB 5F7MC 4HUMB 2H32B 5FKPB 3MJ8A 1RZKL 1NMAL 1U8KB 1BBJB 3NPZB 1HWGB 4OIIH 4GKZA 1U41A 1G7PB 3PP4H 5CP7B 5IK3B 1T5WB 2OL3B 2UZYB 3HZMB 5DMIH 3O0RH 1G9EA 4X9BA 5C0JA 2YMXH 3V0WL 3D1MC 1MELA 1UH4A 3LSOA 5D93C 2G2RB 2WM0A 2P8LA 3HN3A 4KI5C 4RGND 4M6AA 1YN7A 3LKPB 3MBEC 3HI5L 1Q0XL 2D03L 3RWHA 1DSFL 1T04A 2R2BA 3WSQL 4GOSA 1UM6L 1DQJB 5DR5L 4EI6B 2DJSA 1HI6A 4WI2A 3INUL 3UJTH 1RIUH 5EU4B 5AD0B 2RB8A 4JFQB 4BZ2H 1WLHA 2MPAL 3RWFA 1F8TL 3BO8A 3AAZB 4W68A 3CZFB 4R97C 4ZAKA 1FC2D 4OZFG 3P9MA 5FM5O 4TVPE 3O9WD 1JRHH 2AJYL 2QQKL 4UAOC 1JMXA 2GJZB 5T3XH 5TDOB 2ADJA 4PP1D 5AZ2H 3RZCC 2HH0H 2AJVH 1BD2E 1QR4A 4M48L 2AJ3B 2JB5H 4WHDA 3R4DA 1EO7A 1AJ7H 1MWAA 1RJZA 5F7LB 5GGSA 2JF1A 5MENB 4ZYKA 2R29H 1IM9A 5F7DB 4JN2A 4PR5B 3W5NA 1I1FB 3HI1B 1IGJB 4EDXB 1HILB 2UWEA 1A22B 1FFPB 4LFHD 3FB8A 4FTVB 2VZUA 4FFYL 4JPVH 3TT1L 4AK1A 1TVBA 3G5VB 4OZGA 3BRDA 4O58L 3RAJL 1KIPA 5HVWA 3WO4B 2ICEA 5CJXC 2Z91A 1CDCA 2FX7H 4Y4HA 5IFAH 4LCYB 5F3HA 4KJWC 4QLRA 4UINL 1HOCB 3LKNA 4JZJA 5ESQB 4ODTL 4WI9A 3IXTA 3B6SA 4LLVB 4OGYH 4HWEH 3TV3L 3EYSL 1JMZA 3GGWB 3ZHLA 2Q1EA 4TSAH 3PV6A 4R2GC 3T0ED 3TT3H 3HI1A 3OAYK 1NLDH 3HRZA 2VQUA 1FYTA 4BFIB 3M1BA 2ESVE 4NRZA 5I8KH 4H20L 4HK0A 5IUSA 3GSUA 3QDHA 4KRMB 4R8WH 4NRYA 3TBVB 2Z31D 2XZZA 3BN9C 3HE6D 5DDHA 5JW4N 2Y36H 3N1GC 3MMEA 4X4XA 1DL7H 3VFPB 1A9BA 4P2RD 1PG7X 1OGAA 3HCVB 4IOSD 2BY2A 5DS8B 2QR0B 2BNUB 4NHCL 5GRVL 1LO0L 3JZ7A 5EC2B 4TNWF 3W11C 2ITCB 4WRLA 1UACL 2VWEE 2BCKA 3TCLA 2R4SL 1MPAH 1OTTC 3VXQB 4S0TD 3BEVA 4LPWA 4ODUA 4P2OB 4U1KB 5ISZA 2D0HA 3RWDB 3VXUE 4JFOA 1T04B 4Z8FL 1VESA 3RP1A 3WN5C 4PV8A 4UQ2B 5IBUG 3SQOH 4R8WL 2DQTH 3MQIA 2D7QA 4ALAL 3G6JB 3TNNB 4KUZL 2F58H 3LZFL 1EH9A 2COQA 2MJWA 4OCXH 3E6FB 5JR1L 3QIBA 4Q58C 2GIYA 3CLFL 1XGTB 1IC5H 2BMKB 3MGOA 3JWDC 5T5FL 1YMMD 4ZUSB 1KNOA 5JXAL 4J4PC 3IETA 3CDFA 3F7RA 1WEJL 4YFLF 4TRPH 5SX4I 3MLTB 1NJ9B 1T0MA 4PTUA 5KZCB 5FYJD 2BSRA 2LTQB 5AYQA 5F7HA 5CCKL 1K8IB 3SN6N 3SQBA 1FFRA 4R4NC 4F9PA 5INDA 3MR9A 2GITA 3RKPA 3MC0A 3TIDB 2EZ0C 2FSEB 2W0PA 3N1MC 3RWCA 3TYGL 3VFRB 5EBLB 3TO4C 4E0RA 1BAFH 3VFGH 4C57C 3HE6B 4RAVB 1A7BA 5GS1A 3T0WA 1BQLL 4YGAB 2HWZH 3BSZH 2IPKB 3VXPA 1WWWX 5HYJB 1B6DA 2MQCA 5C07B 4QRTB 1T66D 1A7OL 2XA8H 2WWMC 1W72B 3MV8E 2NY1C 1U8NB 3HS0A 4H1LG 3RVUC 1DR9A 1E28B 5AZ2L 1AGFA 4HIXH 3ULUL 4ZUWA 1UKTA 1NC2D 4PJ9D 1O5DT 5JTWA 4JZNA 5E9DB 5CBAA 1Q9LB 1TNMA 4JY5H 1ES0B 3GMNA 3MLXH 2GAZA 3G5ZB 3KYMA 4HSQA 5I0ZA 2XZQH 3EGSB 3SGKC 5FIEA 1DUZB 3OTTA 1CFTB 3DVGB 4ODXB 1EEZB 3X14B 4IS6A 4K23L 4L29A 2DM3A 4KRPD 3EOTH 5GRYA 1T4KA 1H3WM 2HJKA 4P4KC 1MCWM 5K9OB 1OP3H 1G9MC 2H6PA 4M4PA 4YFLI 3U48A 2KDGA 2FYYA 3WKMH 4YQXH 3IF1A 3MNZB 5J3HC 3X11A 4W6YB 1Q94B 4CBPA 4GLRH 1K4DA 1QFWH 1S9VA 2NY6B 1AD9B 3L3OB 4B41A 3ARZA 5D7IB 1AKJA 2H2SC 3FMGH 3S36H 5CS7A 4HIHA 1DLFL 3RUGB 4NSKB 4N8VA 1ZHLA 3MJ9A 3LQAH 1NFDE 4DN3L 3MJGX 4GW5B 4RWYL 4O51B 1QRNE 1OTUD 2CKBL 2A1WL 4GKSA 3FTGB 1DVFD 4XC3L 2OXHA 4MJ6A 2BRRH 1FLTX 1EZVY 2ZNXA 5I1KL 5FGCE 5HD8C 2I9TB 2GCYB 1X6LA 3HMWL 5FYLE 5KZCD 5D7SL 1S7WA 3WSQH 3EBAA 1MSPA 2HT3C 2Y4SA 1GGTA 1MREH 3R0NA 1AQDB 5IVXB 3F7PC 4G6FB 3VFWA 3OKLA 3MLXL 4P99A 1BQHA 3RTQB 5MERA 1CLOH 3ILQD 4I18C 3HS0B 2BOBB 4MSWA 4L8BA 3D18A 5EU5A 1I8MB 3EDKA 4LU5H 3UAJD 4XMKH 2XQBL 3ULUH 4PRPA 3F8UB 1B4RA 2VYRE 4NM8H 3HE7C 1J12A 5HYJA 1YA5A 3A6OA 3RY6A 1HHGB 3FFCA 5I1EL 5C09A 5F88A 3KPMB 3IS1X 4HKZB 3M8OH 1NFDA 4Q9BA 4GRWB 4XCCL 3O0RL 5C08A 3SDCC 4BH8B 4F8TA 3PWJA 1WTGT 3LS5L 4HLJA 4YHYC 5D2LE 2YUXA 4ENEC 3RUGA 4HIIA 4RSVA 5IW1A 2DL2A 4QCIB 5T1LD 1T0NA 2VXQL 3EFFB 2CKBB 5JOPD 2BJMH 4O02H 3GSRB 5KSAD 5F7WC 4RGNB 3PHOA 4MNGB 5D1ZD 4QHUA 4KMTL 1A64A 3VD4A 4XNMA 4XBEH 2ADFH 4XPBL 5FDYA 2A6KB 4ZFOA 3EJZD 4U6XB 2A6DA 2YA1A 5CBEB 4HUUA 4ZFOB 4MNGE 4OFKA 3FQWB 3QYCA 1K3IA 5HHOE 2PR4H 3OAZK 3OAYH 1F45A 3PWPA 5EOTB 3S88H 3V52H 5DTFA 4ZPTA 4H0IA 4BFBD 4KRLB 4RGMC 4X7TA 3KLAA 4G3YH 2GTZB 5C6TL 2VE6A 4RFOH 3O11B 1CIUA 3I02A 1Z5LA 3ETBF 2ZKHH 1CL7H 4BH8A 3WIIL 4GG6B 3LS5H 3FQUA 4QF1A 1H0DA 4Z0BL 4C56A 4WGVB 3N50A 4HKZA 4YX2L 2ZG2A 3FFCB 3VFNA 2DS4A 2GUOB 5CGMA 2DQGL 5GGVY 3ZE2F 1BZ7B 1UFUA 3NCYP 4EI5B 4JZOA 2UV3A 4XBGB 5CHNB 3B8YA 4NM4H 3BZFA 2K7PA 3H9SE 1F13A 2W9DL 3B9KB 2DIAA 1FL5B 2NY6C 5C0CE 4YGVA 4IOFC 2VOTA 5DJDA 1I7TB 1FH5H 1RJCA 4GBXC 4X4XB 4TTGA 4PJEA 1N5AA 5I1KH 1KCVL 4F15B 3C5ZD 5JUEL 5ICXA 4KUCD 2AK4D 1HEZB 2JJSA 5BZWB 1D5BB 3PGFH 4HCRH 4XMLL 1OP5K 3VFTB 2V2XB 5C0DA 3PUCA 4MGXA 3DVIA 4DGVH 5L88H 4KK6D 4FXGA 3AGVA 5HJ3A 2DJUA 2CIKA 2YPLA 4KXZI 1FC1A 4NQCE 4Z7WB 5E8DL 3EUUA 5HI3C 1A9EA 1QHPA 1A7QH 3TZVB 1NKOA 2WUCL 1FO0H 1OL0A 1JWUA 3MXWL 1T1YB 3VW3L 3G08A 2NY7L 3G6AB 3V5KA 2MTPA 4OLUH 3E0GA 3EOBA 2N7BA 3L3HA 1E0OB 1BIIB 2VR5A 1OB1A 3CFJB 4G8GD 4LSTL 1A1OA 3EOAA 2VQTA 1T7YA 4X9IA 2AV1B 1ZMYA 1A14L 3GO1L 3UYRH 1P9MC 2R1XB 2G60L 4X80H 4KZEL 3DX6B 4LK4A 3LRHA 1F3JA 2X2YA 4X0KA 1F4HA 1P7HL 4IRJD 1UWEH 4ZTPL 3U46A 2BX5A 1DSFH 1MCCA 4P2OA 3O6LH 1FBIH 4GKNA 5EU3B 3FOLA 3VXSD 2Z31B 4WEMB 1R5IA 5I1AA 4NQCA 3X13B 2LAGB 5B38A 4I3RH 2CO6B 2KKQA 5FUZL 5TDOA 4K3DH 1MH5B 2Z4QB 4DKEH 4GMSH 2Z4QA 3NABH 1KF9B 4MA1B 3GFUA 1Y0LB 1NDMB 3SPVA 1OAKL 3LEXB 1HHIB 1I3RA 5DRZA 3CVHL 4OF6A 3TBVA 4P46A 5HHXH 4Z7VE 4JFQA 1YEEH 1TPXB 4PJXE 4C59B 3U1SH 5J0BA 2ZP0T 1FLRL 3T3MF 5DJ0B 5DQDL 3ULUC 2NPLX 3QQNA 2NY4C 4KROC 3RWHB 1K9TA 2RJMA 2E27L 5I66A 5IM7A 1KT2A 4JDTL 3WO4C 4OGXH 3IXTB 4J3VA 1CCZA 4PB9H 3L3HB 4X6BA 5EBGA 4JM2F 5ESQA 1T7XA 1RIHL 3B5TA 2G5BB 5D9SA 5CJQL 4QHKJ 2WWKO 1IKFL 1J7VR 4JPWH 4FQQB 3T4YA 2R15A 4U7SA 5AWNH 2FBJL 2L4OA 5DD0H 4RFEB 2GTWB 3NIDF 5H37G 2DTMH 4XPAL 1JGVL 2D9CA 1MCQA 4ZO8A 5ALBL 4G7VH 2YS4A 2H1PL 2F8VA 1MRCL 4TN9A 5I30H 5C9JB 2VXUL 1NAKL 1Z9MA 2DQFB 2X1OA 2XZAL 1I9JH 4LPXA 4LVNB 1LEKA 1MAJA 3MV9D 1B90A 1E4XI 1CDJA 2LAAA 4WFGE 3B9DA 4JN1L 4RRPA 2UVFA 3BP6A 4KHXH 4WHYH 5DEZA 1YEDB 4R97B 1Z3GL 4PV8B 1ETZA 2DQJH 4N90D 1WBXA 5IG7B 4HCRL 4XMLH 1CVSC 2ZCHL 1DE4B 2DQCL 2OJEB 5CEXA 3UZEA 2ZSVA 1R3IL 4XPBH 3LOWA 4X8XA 2XWTB 3IFPB 4KXZH 4X7SH 1UXSB 1ZSDA 1X9QA 2J6EA 1K85A 4L5FH 4QTIL 2V9RA 2BNUA 2YPVH 1QSEB 1J10A 2WSKA 1OQOA 2P1YA 2VL4A 5AD0A 1M05B 4N1HB 5IJKA 5MEQA 1CDIA 1JUFB 2YRPA 1RZJH 4NNYB 5CEXB 5GS2H 2OJZL 3HHRB 2X89D 3VFUA 3VFSB 5IESL 4ONGH 1OP5H 1D5MA 4I2XA 4NWTL 1J1OL 5DDHB 3OJ2C 4K94C 1YPZE 3DBXA 2PTVA 4NRYB 5ETUB 3KYNB 5I1IL 4KUZH 1J9CT 4NRZB 3EJJX 5D1ZA 2ED9A 5FEBA 3KLSA 5DJ8A 4LHQB 4YK4C 1WAAE 3IKCB 3MOBH 2GQHA 3VXMD 3RIAF 3O9WB 3RL1B 4U3XA 5C0IA 3RZCD 1OT2A 2MCG1 3UTSD 2MSPA 3QG7L 3O3AB 4OCSL 1TZGL 2IPUG 3TVMB 4JGJA 3GEWB 2AK4B 5DQJA 1EFQA 3IDNB 2FX9L 1W72H 2QSVA 1FE8L 4U1GB 1ZLUK 5C0BB 3SKUD 1UJ3B 1HXMB 2CRMA 3BJ91 3OBAA 1QNZH 5CSGA 5TE4L 1I3GH 1T3FB 4U2ZA 4G8GB 1FDLL 1EHAA 5C3TA 1SJHB 3AC0A 4CDGC 1S8DB 1KXTB 4QEGA 3GSWA 3EZJB 4NP4L 5DJ6A 1Q9WA 3V95A 5C70A 2PW1B 1EO8H 4GSDH 3TFKD 2X42A 3SY0B 3VGFA 1A7RL 1MOEA 4TULL 3BPCB 4UT9H 2LV4A 3U2SA 3MRLB 5E9DE 4DQOH 2YD3A 4ZUUB 4IRZL 3WE6B 5I75C 3ARFD 3C8KB 1KV3A 4HEPG 5DK2B 1D5XB 4G9FE 4ELMF 4PRBA 3CUPA 5DEFB 2F53D 3JV4A 1EUTA 2X4TB 4JFXB 5ISZE 4DTGH 5H37H 1N7MH 2PCPB 3GMPA 5C07E 1MIMH 4NZUH 1BFOA 3TGXA 3VRJA 3C5ZB 3BT2L 3MRGA 2YPLD 2IQAA 4LSQL 2I9TA 2V7HB 3H3KA 3LS4H 5GQBA 3ORJA 5DD6B 3QQ4B 2XZQL 4I8DA 1S7XA 5DD3H 4GKSB 5F1NB 1VADA 4ZDHB 3DGGB 3OKNB 4ZFFB 1P7KB 1MIML 3KNBB 4GW5A 3QFJD 4N8VB 1YEEL 3ELAT 3AROA 3U82B 4HJJL 4PJ7E 3TBTB 2EC9U 2SEBA 1MAMH 4XC3H 4XRCB 5AYUH 3TNMB 3ARFB 4S1RL 4KJQC 4NYLA 1RZKH 3S96A 2NY3C 4UOW0 4JVWA 4RBPK 2NX5E 4N5UA 4Q6YA 1XF3A 3PGCA 1L7TL 4ZFOL 3CH8A 1QQDA 4JPIB 5T1MB 4DKAA 4HULB 2XACC 1JYWA 4KK5D 3FL7A 1T22A 1TJIL 3BEWB 3TO4B 3REWB 1J5OL 5DD3L 3Q3GB 35C8H 3GSRA 4GT7A 5CJ5A 4LARH 4UNUA 5TF1H 1S9WA 5IW1B 2EYRA 2FECI 3G5ZA 3KYMB 1I7UA 1V5JA 2NY0C 2BVQA 1ES0A 4LEXH 1L7IL 1MIEL 1OP9A 3E3QC 2ED7A 1KIUA 2WIIB 3OKDA 3P77A 2OR9L 5MI0B 4JKKA 1KULA 4MQTB 4I9WD 3THMH 3DETC 1IT9L 3CGTA 3BKJH 3WFBL 3LB6D 4N0YL 5CLWA 1NFDF 2YD9A 3BP4A 1XGRB 5JW5B 2EXWC 4BA8A 3FRUA 5D2LB 4GKOA 3CLFH 1I8MA 1Y18A 2MHAB 2EDRA 3L3GB 3SKOA 3VXPB 2F8XC 1F3DH 2VXTH 3ISWA 1EO8L 4GSDL 4V1DB 2DQTL 4G3YL 1IC1A 4YHIB 2XZCH 5F93C 4GXUN 4MJ5A 1FZOB 3MRMB 1BJ1H 4OFIA 3WL9B 2ADGB 3FO0L 3LKSA 4DKDC 4HLZH 1QFWM 4UDUB 3W0WA 3S88L 5KVGL 3CZJA 3WIHL 4P2OC 2NCMA 1FZJB 4YHMH 4JM2A 4ODBD 3GBMH 3C08L 3AXLB 4PJBA 4DK6A 1G9NH 4HG4J 2DQCH 4JY4A 1I9IL 4PJDF 1E27A 5EOTA 1JHKH 1GIGH 4XCEB 1EEQA 3V4UL 3WXWH 1UJ3C 2DI8A 4PJIA 2KBGA 1SBBA 3QA3A 4GAYA 5D7JC 5HYSG 4WUKL 1MFBL 3ULUF 4HUWA 3SE9H 2I07A 2DQDL 4QHUB 5BW7C 4OFYA 2IFFL 5L0QB 1DVFB 3U7YH 3DTXA 1ZHNA 4J4PD 4P5MA 2CKBA 1N6VA 5KS9E 5HHMB 1LEIA 5LGHL 4XCCH 3T0BA 2ZKHL 1E6JL 3H9SD 1BBDH 1NLBL 2IF7A 4BK4A 4NCDA 4P5TB 4KKBD 5JXEA 4G8FB 4XCEA 4ZFGH 3H3PL 1FV1B 4YK4B 4ODWA 2HT4C 4JFYA 5BRZB 5B8CC 4DVBA 4XNYL 3LHPH 4UTBL 2FJGB 4QY8A 4G7YL 4OZHB 2ZCKH 1B4JH 3T77B 2XT1B 5HHMD 2ADGA 1BGXH 2FIKB 4XI5D 2HN7B 2AV7B 4P3WA 4PJIE 5BS0E 3V4UH 3QIUB 1M6OA 4JY6A 3IFOB 5C08E 1R6VA 3L3GA 5F71A 3SKOB 4WFHD 3MRFA 1ZA3A 3QDGB 3U0TA 5D2LA 1YPZF 2Z8RA 2HLFC 2VXTL 2NY5H 2QQLL 1WISA 4HW6A 1PD6A 4J6RL 3DV6A 2AXJA 4I4WA 4GRMA 1VPOH 2IAMD 4M1DH 3P4LA 1J0HA 1NEZA 3ZKSD 4DUVA 4NOFA 4OZFA 3QRFM 4G80A 3MX0A 4I48B 5EBMA 4JO2L 5DURD 1ZHLB 4WHTA 1XIWA 1NBVH 2B4CL 3OGOE 3DRTA 1QYGH 4YBHA 4PBXA 2EH7L 2YBRB 3I84A 1FZMB 1MHHB 1XGQB 3X12A 1UWEL 4ZTPH 4YR6A 4AG4L 1GC1H 4HWZB 3RNKB 4EI5C 4NO2A 4YDLC 3QHZL 4PV9A 1CQYA 3HAEG 1MJJB 1R3KB 1MCOH 2P49B 4MD0B 2EH8L 4PB0H 2OYPA 4OZGB 4FOMA 4HIEB 1JZ4A 1FZKB 5DJZB 1FYTE 2YZ1A 3PJSA 4M93C 4FQXB 4I3SH 5F1IB 5JPMB 3C6LD 5EUKB 3UC0L 5DJCB 3P4NB 3U6RB 4PLKD 3MO1B 3K4ZA 1CGYA 3PWLA 4C56E 2ZUWA 3GO1H 2W9LA 4IHOA 3G6JA 3TNNA 1YDPB 4HS6B 1AQKH 4MNHA 3CSYA 4M7ZC 1GAFL 4Y4HD 4G8IB 3ROLB 2Q3AA 3D0VA 4WFED 1MWAB 1HH9A 1RJZB 1YMMB 3NAAH 4FTVE 1XMWA 1Y6NR 1FVDA 2VZTA 5DUPH 3VFUB 3C9NB 3T3PE 1X5XA 2P24A 4YEEA 1B0RB 1EAPB 2X4PB 3O45A 5T3ZE 4P23A 5DEGA 5LCVH 2BCKB 4M48H 2XPGA 2BZDA 2ARJA 1IKNA 4NKOA 2J4WL 3KPQB 2OK0L 1UXSA 2CGRH 2DTSA 3E2HC 4H1LH 3WNOA 4DGVL 5L88L 5J6GA 3INUH 4PY8J 3CVIH 4P5KB 5FFLA 1GZQB 2ED8A 4PJFE 3UJJH 4CN1A 2YPLE 4K23H 4NO3B 3HI5H 3STLB 1OLZA 5IVOA 4UNVA 3SDAD 4L1DA 3T0VA 1U92A 3LKPA 3D87B 3HKFA 1MCHA 3PWPD 4F9LC 1L6ZA 2D2OA 5C0BD 1ZT1A 3D2UA 4WFFD 2DLFH 2VLRD 2YZ8A 4RAUA 4P2YA 12E8L 5K9QG 1L4IA 3IU3A 3SBWA 2MCPH 3GSNH 4QHMB 1Q9WB 3O6FB 3HZMA 4TSCH 1FNEA 5JNYB 1R5VB 4JG1L 5E9DD 5JR1H 4PJDA 5CEZD 5C2UB 2FGZA 4IRZH 3RPIB 1HOCA 4Y5YC 3ULVH 3IJYB 4HJ0D 4MHHI 1Z9OA 1VPOL 3ZE0E 1IMHC 5F1KC 3RRQA 1HSBB 3QWQB 4WHYG 3G5VA 3VWJC 4CKVX 1PQZA 5JQ6H 4U4BA 3BHBB 2DQUH 3MZTA 5C0IB 4JFOB 4WI4A 3RWDA 2DQUL 4N5ED 1VFOA 5D7JA 4PR5A 5B3JF 2YWYA 4ZG1A 3FN0L 5F9WB 4D9QE 4ZYKB 3L6FB 4U1HB 3ILPB 1BIHA 3H7BB 4NCC2 3AMLA 2N1KA 3TCLB 1NGQH 3CSPA 1U92B 3KXFD 3MOBL 3MGAA 3K0WA 4QHNB 4WU7A 2WP3T 5E7BA 2X41A 1GZQA 5JIPA 4Q9QL 3O2WH 1SJEA 2CSPA 4MA8L 2E9WA 4OJFL 1SJEB 3O3DB 5MEQB 4LIQH 1A9BB 3RTQC 1AC6A 1G9NC 5E00B 1FRGH 1Q9KB 5SX5K 3WDHA 1MNUL 4OD3L 5HDBF 3X13A 4NKMA 3S35L 1U3JA 3P0GB 4JKPL 3EO0A 4ZPVA 2XWTA 1T80A 4GXVH 3FB6B 4IOFD 1VACB 4KKLD 2XN9D 2BVEA 4U1HA 1NFIB 1IGFH 2PW2B 4M1GH 2X09A 2AJUL 4NO5B 4M7KH 1MF2L 1HI6B 1NEZG 5D7JB 3S34L 1K4CB 3LKRA 2NY1D 3PV6B 4XPHH 1IEAA 4XX1G 4P2QA 2OJZH 1AFVH 3GGWA 2PYED 2VLJD 5C7XL 1MQKL 3H7LA 1CXHA 1A1NA 1X7QA 4ZODA 2YHGA 1A4KB 2YXFA 3BWAB 1T2XA 1CTNA 4JVUA 1HSBA 5C0JB 3MGTA 3VXUD 5F3HB 4NN7B 4XPHL 3CMOL 4ELME 4S1QH 4U1SA 5JXED 3HZKB 5KVGH 4Y5XC 3RPIA 3F58L 4KDVA 1C7TA 3TH3T 2O5ZL 3V5DA 1KJ3H 1CICA 3V6OA 5L2KD 3SDYH 1KPUB 2AK4E 1TXKA 3UO1L 4H8WH 5E2UL 4OBSA 4WU5B 5DUBB 4MAYA 3PQYA 3CU1A 1MWAH 5D7KE 3BKYL 1UXWB 2AK1L 5KVDH 4YBLB 4Z7VF 4JCLA 1EBPA 3QEQB 3QZWA 4PGDA 3R8QA 5J9PA 3U4BL 5DMGD 3MREA 1XFPA 3N1PC 1EGJH 1F5WA 1PG7W 4OT1H 4P2QB 5DHXB 3T0EB 3WHE0 5HYJE 2D7TL 5IOPB 2DLIA 3NIFF 4OGXL 1JPGA 2HLFD 3HE7B 2EEDA 5I16A 1Z0MA 5HYJD 4O2CA 5BV7L 2BOCA 4NZRL 2AS5M 1K8DA 5E2WL 3FRPA 1YY9C 4FXKA 1A6UH 3MYZA 3AS3A 4MAUL 2G75B 1OGTA 2FDBP 2VZOA 3VXRA 3WEXA 5E8EB 4RMQA 3QNZB 4ONFH 2B0SH 1QSFB 1GGIH 5CILL 2RAMA 4ESKA 3K80A 4CMMA 5HHPA 5T1LA 2X6MA 2R0LL 3B2UC 1AY1H 1KENH 5GGRA 4F57H 1A7OH 2NY3B 5DHVH 3JTTB 3LH2H 4FFVC 4MJIE 1PKQB 4FABL 4X5XA 3MLYL 4HIXL 4PJ5B 1F4WL 3KJ4C 5JORA 5D2NB 3O6KL 5H94B 3KJ6H 1TJGH 4YAQB 2Q8BH 4XI5C 1E6OL 1XT5A 2FD6L 1ZHKB 4D0BB 3P11L 1AY1L 5CGYD 1AHWA 4UDTB 4BQCA 1P4IL 4HUUB 4PLNC 4PJ7B 4XP4L 2OI9B 2VZSA 5J13B 3VI4F 4P5MB 2E9IA 2JJSC 1ONQB 2V5MA 4HX1B 3S9DB 5TJWK 4N0CD 2NTFB 1N4XL 4LVOB 2VLLA 4LBEB 5B4MD 3LHPL 2R0KH 4M4RA 2F54A 2AI0L 4V2CB 1FAIH 4GG8A 4RNRB 1S9XA 4RIRA 3T0DA 3I75A 3GRWL 2ATPA 1RZIB 4WTWA 1HSAA 2FR4B 3DYOA 4YNYB 2RHEA 2X4UA 4NQSA 4OLUL 2P42B 2X40A 1CGWA 1RZ7H 2O93L 1MHPL 3DX8A 3RWJB 1MVFA 2KH2B 3OKKB 4JDVB 4K55A 1ZLWK 1IGTB 4OTXL 2D3VA 3RHWK 4TNWK 1OVZA 1OAXL 2ZUTA 3GSQB 4M7ZB 4NKQB 4AYFA 4IBLT 1S7SB 2JJVA 1BAFL 3VFGL 5IVXA 1T7ZA 4Q74A 3GJEA 4ZS6D 3ARSA 3F5WA 3CCHA 2HN7A 4HC1H 4KVCH 1FGVL 1I7RA 4PLJC 5HHQB 4OB5L 5BMFL 2BVOB 3OKKA 2UZXB 3T3PF 5DD1L 1VDGA 4P23D 3F6IA 2P5WD 4K94H 1ZAGA 5JUEH 2NW2A 5F9AC 4TNVK 5DJ2A 4RBPH 4U6YB 1HSAB 2R0WL 3QAZC 4NHUB 1FV1A 4U6TA 2GI7A 4PYGA 5EZLB 3I75B 5CGYC 2DWDB 1NGWA 5HYQB 7FABH 5D1QA 4ERSH 4HDIB 2V17L 3TN0C 1MJ8H 2AP2A 5I74B 1YDPA 5H2BB 1CK0H 3QEGH 5KSAB 1YMHA 4K07A 4UQ3A 3FOMB 1UB5A 1BZQK 4F7TB 1E6JH 4MNQA 3MRCB 1N59A 5CINH 3REWA 2DBLL 2CDFB 3QUKB 2I26N 1UA6L 3QCVL 5FF6A 2B5IB 1M7IA 1IT9H 1A7PL 4GAYB 5DJZA 3KS0J 5FO9A 4C58B 3LPFA 4NBYB 5T1DL 1FQ9C 2PO6A 1RUAL 3OF6D 3PGCB 4GFTB 5AAMA 1A5FH 2R4RL 3LQZB 1UB5B 5D7KD 1E27B 3KVQA 4V1DD 3VXOB 3MYJA 1JF6A 3UDWC 3X12B 1CDYA 1EEYA 4U7KA 2GJ6A 4BSWB 2ADFL 1DANT 1GYAA 4OD2A 5HYSA 3G6JF 1KJ2A 1DBBL 4W6XB 4KMTH 4HKBA 1NCTA 5D1QB 3OPZL 2P5WA 4YFDB 1RVFL 2DWDA 4UOJA 3MRMA 5DI8A 5HI4D 1QUNA 3RBSA 4Z9KB 35C8L 2IBZY 4KJQD 4U6YA 4WV1B 1CGSL 4F80A 3EYUL 4F15C 4O58H 1EVTC 4OKVA 5CP3A 2PXYB 3LN4B 3S5LG 1YEFH 1OM3H 3SGDH 5ICZB 3DV6B 4ODHL 3UZQA 1D3CA 2XG5A 3MFGB 2GSGB 2NXYB 2FD6H 3CPLA 3U0TB 1LVEA 1XF1A 4Q9CA 5J4MA 3V6FA 1G6RH 1W8NA 3IFOA 2EDFA 4DGIH 4EXKA 4Y4KD 5BJTA 4PLOB 4PJBE 4WVRA 2XV6B 5L0QC 4MMZC 2LFGA 3SHSA 2VL5A 1NC4A 3C2AL 4JO4L 2HYMA 3C60C 1KENL 3WFBH 1R5WB 1BOYA 1MEXL 2AJVL 3S3JA 1DBJL 3TESA 1WFTA 3CXDL 4L3EE 4ODTH 4XCNA 1KJ2B 5CILH 2F9BT 1JRHL 1S9YA 2AJYH 2FX8H 2QQKH 2XNAB 1EEYB 1X4XA 1RIUL 5CD5D 1WBZB 4TSBL 4A6YH 5B39G 3KLHC 2DYPD 4NN5B 2HAZA 5CJOL 1MCBA 1I9EA 5DC0A 2XXCB 2AGJH 1LK3H 1CD8A 1EMTH 2GJJA 1ORQA 3K8MA 5GS2D 2K9UA 5E94B 3QULB 1HNGA 2AVGA 4UU9B 2CDFA 1U8MA 1I1YB 3CVIL 4G6FD 5KG9B 1T89A 3ZSSA 3MCLL 3MRHA 1PYWB 5JHDE 1D9KD 1P7QA 5EB9A 4F7PA 4G6JL 5SWSB 3QG6A 3QWOA 2GT9B 3R1GL 1NCBH 2OTWA 3QA3B 2NW3B 2D31A 2DKMA 4GAGL 5A2IH 2A77L 1Z2KA 3QO1A 4TULH 1R3LB 2OQJA 3FONB 4KJWD 1OSZB 3KLDA 1FL3B 4XC1L 5IQ9A 2EXYD 5IWLA 1KIQA 4JR9H 3ZKNC 4U1KA 1IC7L 1BOGB 4Y2DB 4NQDD 3SDCB 4DGYL 1BQUA 2VDKH 3FKUS 1MCIA 3QI9A 4J3XA 4PJFB 1IAII 4I2XE 3V6ZB 3GIZL 4WI5A 2DAVA 3QPXH 1CLYL 3HC0B 3TBWA 3IXAA 2BRQA 1A02N 1UM5H 2J8UF 2J5LB 2ESVB 4I2XB 5IIEA 1EMTL 4JB9H 3BXNB 1NBQA 2H8PA 4JB9L 4PGCB 3CDGA 1EVUA 3VFMA 3H9HB 5FKAA 1YJDC 4PYHA 2YPKA 3BWUC 1EV2E 4KKNA 2EZ0D 4CGTA 4KDWA 4I3GA 1LE9B 1E4KC 3QPXL 1HKFA 3QUYA 4L8SC 1ZWIA 2AW2A 1N2RB 2QQNL 4AIZB 3MOQA 4RGNC 2R9HD 3W2DL 1UWGH 5AZEL 3BOVA 5EBLA 4XC1H 3EKCA 4OD3H 4IEFB 4YO0A 3STBA 4CW1B 3BP6B 4JFED 5JHLL 4ONGL 4MVBD 3L3KA 3CH1B 4LGSB 4LRNH 3BE1H 3BW9B 2AQ3A 5J1TC 4Q9RL 1GOHA 2R0LH 3BIKA 5IBLD 1CLCA 1G7MA 4PREB 4J3TA 1ZV5A 3G6JE 1CDGA 3OKYA 1NGQL 5K93A 4Y89A 2QL1A 5FV1L 5D8JH 2ARWA 3CFCL 3I2CH 2WANA 3U7WL 4AENA 1A4JA 4KK8C 1U95B 1KPVA 5F1OB 3HZKA 3QUZC 3D3VE 4FQQA 1BQHG 4FTVA 3UTSA 3FB8B 4NQED 1ND0A 1YEHL 4QHMA 1TETH 1ZANL 4UBDC 4A2LA 4G9FA 1P2CA 1HILA 2UWEB 4HIJB 4CJ0A 3ARFA 1MRFH 4OGAC 5T5FH 2VH5H 3MOAH 4HFUL 4ZS7L 5D1ZB 1WZ1L 3NFNB 2AJUH 1AD0A 2CRYA 4POZD 3B2VH 2J6EL 3C6LB 3NPSC 5KAQG 2VXUH 4CMMB 1BFVL 4MJ4A 2VZ3A 3QXTA 2JK5B 1IC5L 4UB0H 2IGFL 2ILLA 1SM3H 3OJDB 2AK1H 5KVDL 3ZE2E 1SM3L 1XF4A 5MEND 3VWKC 2VABA 5CD3A 3U79A 1H5BC 1V7NL 2EICA 5IKCA 5DZLA 3GMPB 1JI1A 3IFPA 1C08A 1XF4B 3LEXA 5E00A 3SQOL 5KVFL 4K7PH 2ZSVB 1TLKA 1G9ML 3HE7A 2XYCA 4JLRA 4ODSH 2AEPL 3BDYH 4OAWA 4YPGB 2A2QT 5IV2B 4NWUH 4X7SL 2HLAA 3ZKXB 1CFNB 1PEWA 2V6HA 4MB5A 3TVMC 1FFOB 3V7AG 2GYSA 4LASL 3C6LA 3TH4T 5KBNC 1B2WL 1EPFA 2D0GA 1FG9C 4OCSH 4JFEB 1AXSA 3MV7D 1IGML 1OD9A 4HC1L 3IDJA 3MBED 3LKQA 5BS0D 5CUSH 2Q6WB 5EA0H 3L1OH 2AKRB 5T5NG 4XVUD 3QQ3B 1A4JB 1A1OB 3EOAB 3TYFB 1INQA 2IWGA 3SGEI 2AABH 5DLML 1HH6B 4OTXH 1KFAH 25C8H 1MFEH 3FJTA 4HJGA 1IEBB 1QSFD 4N9OB 3TA3C 4P59L 1KTDB 3FT3B 4LCYA 4NT6A 4LIQL 4MQ7B 4P23C 3VGDA 1I1AC 3ARUA 3WMSA 5E1AA 4EQ2A 5FYLL 3HE7D 4ZQKA 3DYPA 15C8H 2PNDA 5C0FA 3KPSA 5BZDB 5DK0B 5HYEA 4NO5A 4Y2DD 1IBGL 5FB8A 5E08H 3QEQE 1CLYH 4NNPH 1J5OH 2YD5A 3VJ6A 3HMWH 1PVHA 4MCYA 4Y19E 2GJ6D 3A6BL 5GGTL 5DRXB 3O2VH 2LTQC 1G6RB 5ADPL 2F5AH 1KB9K 2CRIA 5GHWH 4MS8D 3ALPA 5KSBA 4AM0A 5F6HI 4M43L 1EJ6A 5ANME 5EIIB 2VAJA 2APBA 4M43H 4FQXD 1ZK9A 2HFEA 2I5YH 3I6GA 1VB9A 4X98A 4I3RL 4Z7QE 3MV7B 4HWBH 4PJHA 5DHYB 2XN9E 4ZOAA 3KPSE 4AEFA 5J6HB 3A6BH 1JHLL 3MSPA 1J87A 2AERT 5E0QA 5JDSB 1AGBB 5LQBL 5D7JD 3FO1A 3RKDC 1PX3A 3QI9C 4TYUA 1XGUA 4Y8AA 6FABL 3IKKA 4X6DA 5D1XD 1PSKH 1OARH 3VXSA 3JWDL 3QDME 1YUHA 3HAEH 5DYOA 1JZ7A 1J86A 4PG2A 3FQWA 4FQ1H 2EDLA 4RGNE 4LSPH 4U6XA 3TBYA 2W07A 3RIFK 4ISVB 3UTPD 2VR9A 5DJAA 1CL7L 3M17B 1T21A 1JN6A 1E4KA 3IDIB 5I17A 1G6RL 5EBWA 4DGIL 2K7QA 1CS6A 2A83B 4ONHB 5BVJA 2A9NH 4JQIL 2XTLA 5GS1C 3MLYH 4P46D 3QUYC 2IADA 4L8SA 4QCIA 1MI5E 4GQ9H 4HAFA 2XN9A 4OFYD 3LDBC 3ARVA 4UDUA 1G7HB 3W0WB 3SDYL 3V0AC 4M8QA 3O81A 3UCRA 3BMWA 1CFQB 1BJ8A 1RULL 4LDLB 4YIQB 2EIZA 3CK0H 4QRQB 1MY7A 1MFCL 4AT6A 3BPOC 4GRMB 1WTLA 3RJQB 1HHGA 3SJVD 4UTAH 4RGOH 1W72L 1DUYA 4HS3A 1UB6A 3SGJC 3CSBA 5JPNA 1FH5L 4R96B 4X9GA 4Y4FB 5TQ0L 1OTSC 4L3CB 4Z77B 3ARFC 4N8CH 5EWIL 4LSTH 3S37H 3QIUA 1TQBB 3STZB 4L4TD 2VITA 2HMID 4JRYE 2AV7A 3OKDB 3P77B 2WIIA 2BNQB 2EXYC 2HT2C 2DLEA 4CMHB 3CIQA 1CXEA 1I7UB 3OSKA 2APTA 3X17A 5FOBB 4QNPF 2VLKB 2W0LA 4X9HA 4YE4L 1MI5A 4DEPB 3I9GH 2H2PC 5KSVB 3VA2C 3U46B 1RURH 5BRZA 5IB3B 1KIQB 4OZ4B 1WT5C 4MA7L 2Q20A 3U6RA 1CGUA 4LKXB 3GMRB 1P4BL 4UMGA 5E56A 5JPMA 2AABL 2AV1A 3EDEA 1AGEA 2A6DB 1WQVT 1CF8L 5C0NC 5K9JH 4JKMA 4PJAB 3ZT6A 5TPWL 3SJVA 3MRKB 4OCNC 1T7WA 2AXFA 2N7AA 3C09C 4M7JL 2I07B 3ARBB 1SBSL 2H26B 5LGJA 1IC4L 4GLRI 1NL0L 3QULA 4IDJH 2VKXA 4PJIB 4XNZC 1A9EB 2JB6A 2QSCH 3JWOL 5IMKA 4FFVD 1DVFC 4FNLH 3QXVA 4FZEL 5EZLA 1T03H 2VR4A 4G80B 5C08B 4YZFE 2ZSWB 2BSSB 3RDTC 3AXLA 4PJBB 3W39A 5I1CL 1LO3H 3KPMA 3PABA 4WHCA 3OQ3B 4ZFZB 1EAJA 1OW0C 1D5BA 4FTVD 4E9LA 1RI8A 4Z0BH 1BFVH 3VXNA 1RURL 4OKDA 4ZFGL 4WFEE 4CAGA 5KOMC 3F5WB 4LSSL 4HPYH 4ZUVB 3LRSB 2VITB 2VQ1A 1VERA 3C5JA 5IB2A 3VFWB 1G0XA 4LVEA 3AY4A 4M7LH 5GZNC 2B1AL 4RFNB 4RDQG 2MHAA 4ZUVA 3H9SA 3WHE1 1IZKA 3BZFB 3O2DA 2C3VB 4L3CA 2XRAH 3L7FB 4LHUB 4YXLH 3IT8D 4B7IA 4JZOB 2RIKA 4XBGA 4IMLA 5F7EH 1M71A 4XXCC 1N0LA 1RMFL 4OBRA 1EFXB 3J8F7 3VMNA 1JZ6A 4QRUA 3U7WH 2XOTA 2XY2A 1IL1A 2Z8SA 4PJCF 2KPNA 3WNLA 5E7FA 1W0WB 3UPAA 1LP9F 2YXMA 2JB6B 3QEHB 4POUB 4Q2ZA 2AEQH 1AGDA 2EKSA 4EBQH 2E27H 4KZDH 2DD8L 1LEIB 5BXFA 3NCYS 4LCWE 2H26A 4WW1B 3DUSA 3LPWA 4PJ8B 5GRZA 1KTRL 3BGMB 4X6CA 4HXBL 4OZGE 1WBYA 3ALXA 4GW4B 1JGEB 3BI9X 3ARGD 1TDQA 2GJ6E 5KSUB 1NGPH 3P9WB 4BJLA 4ZTOH 4OLZH 4CADA 1U58B 5BOPA 2VDQH 4NCC1 1N64L 2PN5A 4HUKB 2HKFH 4FN0A 4H5SA 5EDXA 5C08D 2X1WL 4XTRD 1RU9H 5JHDB 1KIRA 4OQTA 4N1CA 4H88L 3RX5A 1L9NA 4KHTH 3WFCH 5KSVA 2J5LC 4X80L 4KZEH 3W9DA 3MNWB 4LVNC 5EU7C 1ORSA 5E4IA 2ITDA 5D4QA 4LF3B 4HZLB 1FBIL 1HCVA 4LDEB 2CIIB 1U3HC 1ZLVH 3ALWA 4JANB 3T04D 1SEQL 4MAUH 3HG1D 2XRAL 4A6YL 3BMVA 2UUDH 4R26L 4XVSL 5HGHA 4PJ5D 4AJ0A 5D93B 3KPOA 1LO5B 1QSEA 5KJRH 4X5WB 4RMRA 3I3EA 3L7FA 1IGCH 1KB5L 1A7QL 2N4IA 2YEZA 5IMLA 2FJHB 2ICWB 3F65A 4JFZL 4L3EA 3MCKA 4GAGH 3ARGA 3QUML 4N0UB 3AB0B 3MRDA 1FCCA 5F21B 4I1NB 5IEKA 1ZGLA 4UZGA 3TO2B 4HD9A 3FO2B 5LBSH 1QBML 1YNKH 4WO4A 2VUYA 3L1OL 1F2XK 2A9MH 3VXUA 4HK0B 4F7EA 1EXUA 4RX4D 4ZAKD 3SE8L 4HHAA 2PO6C 3KHQA 1MUJB 4MD5A 4NC0B 3BX7C 4CNIA 2BSRB 3F7QA 4Y7MA 5LVEA 3EO9L 3OHXA 4JM4H 2CDGB 1QVOA 1HCFX 2V9QA 2XWJB 3AREB 3NA4A 2BY0A 1QFOA 1A6TA 4OZGF 1KNOB 5FCUH 5IJKC 1J18A 4F2MB 4HUXB 4NT6B 5E8NB 1MQKH 4ZO9A 2LU7A 2VKWA 4GXVL 3I6LD 1UWXK 3O3AA 4KKBC 3S34H 2AKRA 3HTLX 4PJHF 1KJVA 1ZHKA 3BDXA 3I9GL 2HTKD 4GMTH 2FWOB 1X5AA 5IR1A 4Z7UF 2Q6WA 4UB0L 2GHWB 1KFAL 4WW2B 1IEAB 3WUWG 2R2HA 5I1JL 2PXYC 2D7OA 4F7CB 1IGJA 4EDXA 1J11A 4KTDH 3WXVH 1TQCC 4M00A 5ICYA 5FECB 1NAMH 3HC3H 2F5BL 3BAEH 4H1LB 3KYNA 3U0WL 3GMNB 3EDJA 1FFOA 4FZEH 5IVNA 3O9WC 1DQMH 1Q9KA 1UM4H 1NDMA 2R4SH 3PWVA 4ZUWB 4HC1A 4XVTL 4LMQI 1HHHA 4TNVF 5FV2A 1URLA 4IRJC 4RMWA 1JJUA 1U8NA 3QR2A 4QHNA 4WU7B 1IQDA 4MCYB 4LLYA 3CK0L 4OQ1A 1UB6B 1CYGA 3H7BA 3ME0A 2CRZA 5ICYB 5HDBE 1HQRA 3C60D 4P2RA 4P2OD 4EKXA 1SQ2N 3VXRD 3FQTB 3U4EA 5I8KL 1M4KA 3O4OB 4NO0D 5LWYH 4HQQL 1JHTA 3CC5B 3D25B 4QHLA 5INDB 4KRNA 4LAQL 3MREB 4XAKD 5C9KA 1T3FA 1ED3A 3B6SB 4LLVA 3TP4A 1H15A 3WNPA 1UJ3A 3MRQA 5ALBH 4DKEL 4NQDA 5ACZA 5BCAA 5I1IH 3RVVC 4Z8FH 3Q6GH 1OTSD 1A6VH 2VC2H 2JJUA 3LN5B 2JJTA 4GW1B 1NJ9A 1U95A 3MOAL 2ICEB 4WFFE 4F2MA 2OR9H 1OARL 5CFHA 2NX5B 2FECL 1ZLWH 1VFMA 1RIHH 3NIFE 1OAYH 5CSZB 4ZUSA 3FAXA 5DD1H 2X9XA 2ERJC 1FJ1B 1CXKA 5E5MB 1N4XH 3BIBX 3DI3B 5GGRY 3LKQB 3MGTB 4HLZG 2Z8VC 5J89A 2BVYA 3KPRD 3ZDXF 4S10A 4NQVB 3SDCD 2WMPA 1NCNA 1MUJA 1MFCH 3QCUL 3QIWC 3MJ9L 5JDSA 3IDYC 3TPUB 5GGUB 1OF2A 2AJXH 3CC5A 2JCCF 2I5YL 4PS4H 4KMLB 5E70A 2HLAB 4H20H 5IMMB 5DHYA 3SE3A 5JHLH 4NQDE 3GHBL 4DUXA 5AG8A 4GRLB 2R2CA 1P6AB 1U8OA 3FB6A 5T3XD 1PKQE 3EYQC 3KXFB 4NKMB 5EPMB 1IQDB 3HPJB 4N0YH 1CE1L 3A6CH 1W0VA 3SDAB 3WKML 1OT1A 2O61A 4I18A 3KWWA 4F7MB 2YK1L 1QLFB 4LPVA 3NFPB 1S5HA 1U8IA 3OXSA 1QACA 4O4YH 4QHKI 3EOTL 4PJFF 1I7ZB 1B0GB 1U8PA 3LIZL 1A0QH 1MLCB 2WLZA 3LS4L 4XB8A 3ARDC 3UYPA 3I02B 4PD4K 3OG6B 3BQUC 4E5XB 2CDEB 1LHZA 3SEPA 1X5KA 5FB8B 4X7FC 4QRRD 4NZUL 2ZUQB 3IAGC 4O9HH 5DK0A 2LABA 4DZ8A 2DM7A 3KYKL 2AQ1A 1CD9B 2ZOLB 3QJFB 2Q8BL 2C4FT 1C7SA 4IRSD 1DZBA 2IAMB 1MJ7L 2BVPA 1DBMH 4WDIB 2EYSA 5IHUH 3ULVD 2A6KA 25C8L 5DA4A 4D9QD 4HGWB 2VDNL 3C6SB 5CEZH 2OR7A 4MNGA 4IIQA 3BSZL 3ZDYE 1YNTA 3GMLB 3KJ6L 1A7RH 3ZDZF 1MAML 3ARTA 1WIUA 1T0NB 4JFHD 4AIOA 1RIVH 2XA8L 2CUMA 3TZVA 1N0XL 3TJHC 5LXGL 3MNVA 3QNXA 2CUIA 4JO3H 5IW3A 4FFWC 3NACL 1FFNB 3PWJB 5CIPA 3VRIB 3OR7B 3OAUL 3MJ9H 4FXGB 4LASH 2W60A 2XTJD 1NMCB 5HI5C 3LPGA 4NC2B 5E08L 1JPTH 3DXAD 5CZXC 3P0VL 1LK3L 3PDOB 3BD5A 4Z7UA 3JTSB 1ZVYA 5CEZE 2IH3A 5KSBE 4L4VD 1K5NB 4Y4KA 2BNQE 4UTBH 5ANMA 4G6MH 1UM4L 1QEWA 1S7VB 1IVLA 1ZA3B 1KB9J 4MSWB 5CD5C 5CZVL 3CFIC 2EDHA 2HFFA 4XAWH 1RQ5A 2CMRL 1L0QA 1C5BL 1MHCB 2VIRB 4W81A 1MEXH 4XHQA 5LJYH 4NBZB 5D7LA 5A40E 5DO2C 1VKXB 2YKLH 4P4KB 5IHZB 3UPCA 3GSXB 1UADC 3SDXB 3MFFA 3BQUD 1KN2L 2ARJQ 1T1XB 4GBXB 1MFAL 5IQ7L 5I8EA 4ZFZA 1RZFH 1NCWH 2CLRB 1H3PL 3K2MC 4R7DB 4NN7C 1MRDH 1H0DB 3FQUB 4QF1B 2DOCA 3CNKA 1NCDL 3KDMB 2NXZB 4BKLA 5I1LA 1HXYA 2J8OA 1CI5A 3VWKB 1D7FA 3TM6A 2P5WB 4G8IA 2DBJA 2GY5A 4HMEA 5IFJB 3KLAB 2R0WH 5CSBA 3OXRB 1BJ1J 3G5YA 4XAWL 1NUGA 1ZHNB 4AZ8A 2WBJD 1PYWA 4XVTH 3L5WB 3PDDA 3VU2A 4IDJL 3SJVB 5EUKA 2GK2A 4GKZB 1ACYL 1EBAA 4ACPA 5KS9B 3QXAA 5D1ZC 4NGHL 3ZE1F 4KGLA 4LEOA 2Y5TB 4ZO7A 3QUKA 4MD0A 5IF0A 1ADQA 2M1KA 5KSUA 3GMRA 4MNQB 2VWEC 4I0PD 1RUAH 4LLMA 3V8CA 4PTTA 5IHBA 2MMXA 5FDWA 1WBYB 3V6BR 1HQ4B 3HLAA 1YMHB 4WNQA 1QBLH 3H0TB 2OL3L 4K3JL 5H2BA 3QCVH 2YBRA 4GQ9L 5BXFB 3CMGA 4G43B 1YEGH 4KV5E 3ZLQC 4OGAD 1JPSH 1AGDB 2EKSB 4WHTB 3VDAA 3WIIH 3H8NA 4WO4B 3P3YA 1YYLH 3S37X 4MX7A 2Y72A 5GSRB 4C4KO 4YE4H 1NEZB 2EEBA 3HMXA 3H3BC 3QUYD 3MA7B 4L3EB 1A6PA 4NDMB 3U30B 1BEYL 4YHYB 4KQ4H 2ID5A 2ICWJ 1PSKL 3SGDI 1HN1A 2E7MA 3QDJA 4XWGL 3VFVB 5FYJL 5J1AB 1QBAA 1UC6A 1BQHB 4O4YL 4LCWB 2H3NA 4U7MA 3ZE1E 4HXAL 5HGDA 3LRSA 3RGHA 1IZJA 4AEHH 2CIIA 4KHXL 3T77A 3QUXD 4MAYD 3S4SB 1MCPH 3CVHA 4S2SB 2FJGA 3BPNB 2DDQL 3PABB 5ENWB 2P8PB 5F7FA 4D2NA 5HYSB 4JG1H 5JHDA 4ZO6A 4Y16A 5KVEH 4H5SB 4HJ0C 1HINL 4LLMB 4K3DL 3FONA 3ZTNH 1TFHA 4POZC 4J7RA 3MACH 4Q0XL 4HKXB 3QG6B 3QWOB 2X5PA 4QXUH 3E1F1 1P7QB 2MWCA 3DTXB 1QSZA 4P0DA 3MZGB 5JIHA 3PP3K 3MLWH 2AGJL 3BT2H 4BFEA 1UCBH 1CLOL 5CJOH 3BH8B 4HGKC 1UCBL 2CPCA 3GI8H 1OY3B 3K46A 1NDGA 4Q2ZB 3REVA 4NIKB 1K2DA 3VRLE 2DYPA 3IVKB 5F7EL 4OQTH 3DX9A 1ZT4B 4PD4J 4JY4B 3GJFB 1FLRH 5HHOD 1I1CA 3X3FL 1IL1B 3NOIA 3VDBA 4WW2F 4QRUB 1DEEB 3HUJB 2NZ9D 2VLKA 2IANA 2BVOA 3DURA 2HJLB 1TPXC 2CJUH 5DF0A 3NZ8A 3OZ9L 5BQ7B 4HPYL 3V0WH 1HHJB 2KZ1B 3DMMA 3ZT5A 4GMSL 3ECBA 1WITA 3B9EA 5FUOL 1FAKT 1TZIB 4QWWD 3VFPA 4NQXA 1XCQB 4UV4L 1QNZL 1WFNA 1YYMH 3VGHA 1UQSA 4EDWH 5DZOA 4JRXD 3MROB 4M93B 2OR8A 2H9GB 4I3SL 4HMDA 1XIWC 1ZKAA 3O8XD 4Z76B 4IRSA 5A16A 3AS2A 4Y2OA 3QH3A 4NN6B 4HS8L 3GMMB 4FQHB 5H8DA 2EO9A 5HGAA 2NY1B 1WUNT 2HRPL 3AU1A 4YXKH 4X7CC 5EFIA 2J1KA 5FHAH 4LOUD 2AEPH 3BDYL 4Z5RA 3UTTB 5C7XH 4U2YA 1FGNH 5C0EB 3UTSE 3NCEB 4TUKH 1AHWC 3D0LA 3DXAB 1KLGA 1MF2H 1EGJL 1PBYA 3MYJB 4HBCL 1KCSL 4BZ1H 4PTUB 4Y4HB 4M7LT 3Q1SL 5DVKA 5GXBB 5DQJB 3IETB 1X5YA 1YEJH 5INCA 4LAQH 3RWGB 4Y0GA 2IAMA 2B1HH 3S97C 3RPKA 5EN2A 2VLMD 2PUQT 3GJFH 4GAFB 2X4QA 3QNYB 3BWAA 1U2CA 4V2BA 1PG7H 4JFEA 3BKML 1A1NB 2R0ZL 3QO0B 3TJEH 1LNUB 1NBZA 1CFNA 4HEME 5T3XE 5CBAB 2HRPH 3T2NL 4WWKD 4Z7QF 3TZVD 1D5MB 1J8HE 4TVSa 2V5RA 2R69H 5HYFA 1B6UA 3BEVB 5MHSD 1AGFB 4X98B 5D1QD 1M05A 5D70L 1C08B 2FIRT 5CAYB 3EO0B 3WEXB 3VH8G 2Y23A 2K1MA 4X99B 2MKWA 1ZSDB 1SYVB 2VABB 5C07A 3QAZB 4BELD 1JGUH 4JO1L 5DS8A 4CVXA 1V3JA 1KSRA 2E9BA 1FIEA 5LGHH 3HCVA 1A3LL 2C4XA 3IB4A 5DEFA 1H3GA 4ENED 2YUWA 4JN1H 5F9OL 3UEZA 2EDDA 1WBXB 5GS0D 1IARB 1NLDL 5TE6H 2ORBH 1P53A 5I18L 1WZMA 5D1XA 5DFWH 3L6FA 4JRYD 4KRPC 3QUMH 2MNUA 3THML 1IAOB 1HIMH 1ZT7A 3ULVF 5GGSY 4YFEA 1DQDL 2QKIB 4I0PA 1GZPA 5E2TH 2VO5A 5FOJA 1KTLB 5CSZA 5ESAA 6FABH 1JGDB 4FP8L 3V5DB 5CP3H 2R0KL 4S1SH 4EOWH 3ULVC 2Q8AH 5BMFH 5FGBC 4MXQD 5CLTA 3V8OA 3HNVL 3BDBA 3E8UL 4Y1AA 4EEEA 4FFYH 1IEBA 1E6OH 2AK4A 4NQDB 1HH6A 2EYSB 1YPZB 4OSUH 4DN3H 1GZPB 3EYFA 5EORL 5SX4H 3TLRA 4JQXA 2VERN 4I13B 2VISA 3GNML 3RI5K 1MAKA 3IDJB 4LRNL 3BKJL 5KVEL 1N8ZB 4MJIB 1HYRC 5I1EH 4S1RH 3W0WD 3T2OA 4RX4A 2EIBA 3F12B 4FS0A 4JRYA 1S7UB 3MLVL 3DROB 5GGQH 43C9A 2V2WB 4O9HL 3S98A 1RUQL 4LHUG 1NUDA 5T1LB 4XXDA 3GI9H 5DZNA 3OGCB 3HB3C 2VMFA 4OAWB 4YPGA 5GGTH 4PJHE 3RBGA 3FB7A 1MQ8A 3NFPA 1VFAA 2OP4L 4I18B 3FB5A 4DN4H 4CVXB 4YJZL 3PIQA 3GI8L 1NANI 5ERWA 5EPMA 2IH1B 1UM6H 5GJSH 3IS0X 1ULVA 3ZYOA 1S7UA 3RZCB 1K8DB 1ROWA 4ZXBB 1AGCA 4X5LA 5I16B 2GW5A 3QUZA 4Z78B 1CE1H 3A6CL 3IFNH 5TDNA 2JK5A 5EO1B 2DI9A 1ZXQA 2BSTA 3WJJC 1XAUA 3LKOA 3SKMA 1V8HA 1U9KA 5AYUL 3MXVH 3RWEA 4P59H 3TPUA 3GKWH 1UGNA 3UP1A 3T1FA 1BVLB 4LNRA 3QDMB 1A3RL 4L9LB 4NQVA 5J8OA 5IB4A 4G9FB 1JYNA 5L2JB 2FLRT 2I25N 3GHBH 4J3WA 2BNRD 4U6VH 1BQLH 1RZGA 1A6ZB 5A2JH 1WCBA 2Q86A 1GGIL 3C5ZC 4PIRF 4QXTB 4KRPB 1QFHA 4LSQH 4LDOB 2GFBA 3IJHA 4M5ZL 4NGHH 1RZGB 2QKIA 4I0PB 4FQCL 3J7HA 3TO4D 3OWEA 3IDGA 2XI9A 2NZ9C 4V1DE 3ZMRA 3PG2A 3FN3A 5D71L 4DTGL 4UIKH 4D0DB 4LPYA 4XTRC 1ZS8B 1BGXL 4JFFD 4PRHE 4D8PA 2YUZA 3SGJA 4Y5YA 5F89B 3ARBC 3JWNC 1F6FB 1LP9B 1G1YA 1IAKA 1ZVSB 4JJ5B 3BUYB 1NC4B 1I7TA 4JLRB 5FK9B 5IFHL 1F3DJ 1YYLL 1X5IA 2Z35B 4RMUA 1FP5A 3EAKA 1CF8H 3VWJA 1FL5A 1QA9A 1J05B 4PJGA 3V4VH 3ZSTA 4JFPA 2XKNA 3KS0H 4OCYH 3GMOA 1I9RH 5C6TH 5L2KA 1SMOA 4JO4H 4H8WL 5C0CB 3QDGA 2B4CC 4OM1H 1BZ7A 2QHLA 4DFHA 2P43B 2YPKB 1LO3L 2BNRA 5LWYL 3B9AA 4L8CA 3UDWA 1NGXB 1JNHB 5B38B 1RVFH 4NQTA 2FIKA 4EQ3A 3MRPB 5TE4H 4OZHA 1YY9D 1NL0H 1A47A 1BFTA 3QDAA 3T2NH 2B5IC 4X7TB 3QCTL 3SDCA 5ABDE 4N0CC 3NN8A 4OZIB 1F3JB 1KCRL 2AQ2A 1I4FB 4NPYB 2DYPB 2VXVH 5TQ0H 1T5WA 3B43A 4PJEE 1KCUL 5I8CA 4PRIA 4BFGA 1CWVA 1NCDH 1M7IB 1BIIA 4UV7H 1S5IL 5IW6A 1N3NB 4L9DA 4XNMB 1I1RA 3HI6L 2JTDA 4OCYL 3MRCA 2UUDK 3CJJA 1DVFA 5IJVB 3V5KB 3PHOB 4D3CH 3MPCA 1QLRA 1U8MB 2V7NB 3RY4A 2ZOKA 4IRSC 4C54A 5I1JH 3PWNA 4LLWB 1SMAA 2WNGA 3DRTB 2VN4A 2VUOA 4HIIB 4P3DB 4POYA 5IHUL 1NGWB 1C1EL 5DHVA 4NKIH 1AXTL 4JM2C 3FHQA 4I48A 4WIQA 2DQIH 2CDGA 4NM8L 2CMRH 4LCUB 3IU3B 3VGEA 5L9DH 2ADIA 2HKHL 4EIGB 3GSNL 1CU4H 3NA9L 1VGKB 3WXWL 2WAHA 4TVPL 1F11B 2FL5B 1H9VA 1BHGA 1FG2B 3L5XH 2KQNA 1PY9A 2OM5A 4DAGL 2D9QB 4N5EC 2BRRL 3LIZH 2VL5B 3K8KA 3MBXH 1CDUA 2H8PB 2KUTA 1RULH 3L7EB 1NFKA 4UT7L 2F54D 5IMLB 5DFVD 3O2DH 1FG2A 2BERA 5DEGB 5JZ7C 4QKXB 3LN4A 3LEVH 2B7DT 2C26A 1VGKA 2ZZUT 1ITCA 3TPKA 3RU8H 1KEGH 3CLEL 1EHLL 3IVKA 3BGFC 4LF3A 1K2DB 4JG0H 1OSZA 1HH9B 4XHJC 4NBXB 3MCLH 3VXTA 7CGTA 4N0RA 3SO3B 2X4QB 3BH8A 2GJ6B 3MUZ1 4FMFA 5EZOH 3DYMA 1SY6L 1VSCA 2AXFB 3PWLB 2H41A 5FDWB 3WNKA 3MRHB 3PWPB 1U2HA 4ZAKC 2ICCA 1YNLH 4QGTA 1LD9B 4J8RA 4PJAA 4HFWA 3IGAB 1EUUA 5JQHC 2CR6A 1YY8A 1CU4L 3WFZA 1LD9A 1ZEAH 4J8RB 2OBGA 4LKXA 1XZ0A 4PJCE 4LLUA 5ISZD 4Z95L 5IB3A 4PUBL 1FFQA 4JG0L 4P4RA 4YC2C 1DQQA 4FABH 5GRJH 2ENYA 1YEGL 5ENWA 1NGPL 3MXWH 3K8LA 2QEJA 1CVRA 2VDQL 5IBUB 3U0PA 4OLVL 1U3YA 2JJTC 5CWSA 3R1GH 4C4KT 1JZ3A 5I76A 2DDQH 4OZFB 5I1DA 5T3XL 3W9EB 3MA9L 3PHSA 1WWAX 2VDRL 4APQC 1F42A 2EYTB 1J8HD 2AEQL 5JW4R 4ODVH 2E8ZA 4HMCA 5ID0B 1LMKA 5IVZB 1EFXA 1RFDH 3IFLL 2HWZL 3V6FB 5HGBB 3FRPG 3EJYD 3HZVA 3MROA 1LDSA 1C12B 3X3GL 5B38G 4N0UE 5SWQA 3CPLB 3UC0H 3DRQB 3TVMD 4NDMA 3FQRB 3WYRA 1UH3A 4NQXB 2YSSA 3U83A 4XWOC 5IGXH 2ZJSL 4JJHA 3RIAK 5DJYA 15C8L 3D3VB 5FM4A 1T5XA 4LAJH 5DK2A 5FAAA 4Z7WF 2BXZA 3IDMB 3UMTA 5FO8A 3WE6A 3VXNB 1T83A 2B8OT 1TQCB 1JNNL 1LEGB 1DEEA 3HUJA 3U2SB 5F97E 3L9RB 1NGYB 1T20A 3NZHH 3QFDA 1YMME 1JZ5A 1F4XL 5DSCB 5F9OH 1T89C 1JWSB 3PQYB 4M1CC 4X6EA 1SVZA 5D6CA 1S8DA 1KJ3L 3BEWA 3TO4A 3DV4B 1FO0L 5CEYB 3B2VL 2YC1A 4L3ED 1ACZA 4NN6C 4HFWB 1MCPL 4M62H 4PRNA 2ZUSA 5E6IA 1T03L 5C0BA 5T3ZH 2NXZD 5JLZB 1A3LH 5DJXB 2A6JB 1FDLH 2R2EB 3ARDA 4KK6C 1M7DA 4P49A 5ELIA 4M61A 1KCUH 3IDNA 3BN3B 2BVTA 4MD4A 3GRWA 5IBTH 3TVMA 2H45A 1FHGA 1X7QB 3DUUA 3D69B 3GBNL 4IJ3B 4LLDA 4LPCA 5CGTA 1D6VL 2AJSH 2R69L 3BKMH 4YWGL 5K9JL 5K9QI 1UACH 5EU7E 4H0GA 3LKRB 2AXHA 3U36A 2CK0L 2FATH 3T4AB 5F70A 3IDUA 4TVPH 2DF3A 3MRJB 1EEZA 5KVFH 1NFIA 3ZTJH 2HP4A 1ZLVK 4LCCA 2UWEF 2EE3A 3QIBC 3WIHH 4YDIL 4BZYA 4D9RD 5E03A 3DBXB 5HHVL 1Q9LA 5BRZD 3WKNA 3WXVL 4AL8L 1FNSL 3TN0A 3CFDB 1OAXH 3QEQD 4OJFH 3W81A 3FB5B 5F96H 3VFSA 1ZVHA 4YXHL 3VFOA 1D9KA 3C87A 1MRCH 4F7MA 5KANI 4HUNB 4GJTB 3FB7B 4PRBB 1C16A 3ARRA 4XXDB 3OKEB 1WICA 1UKSA 4P48A 1F4XH 4JREB 1FO0B 5C0GB 1TIUA 4NZTH 3KXFA 5DRWA 1FGNL 1QTYT 1KEML 4RZCB 3ARDD 5AG9A 5C3LD 5I73C 3GRWH 4OLXH 2MQ0A 2CK0H 1DE4A 4LVHB 1OCWL 1ZHBB 1YQ2A 4F9PC 4MJIA 1TETL 1ZANH 1S3KH 3RAJH 1RUMH 4AQ1B 4PP1C 2VISB 2VDLL 2FSEA 3GSWB 3LAFA 1UM5L 1KXVC 3EYFB 4KTYA 5F3BA 5GGUA 4WJ5A 3F62A 5IFAL 2EKJA 5A3ID 4KKCC 1J1XL 4DOHE 3QB7C 1CL7I 3BIAX 5HI5D 4MAYB 3FT3A 5FYKD 5DUML 5KAQF 1G6VK 2NY0B 4P2QD 1JYXA 3MLTA 1W8OA 3BRFA 1CICB 3LQAL 3T8XB 4XVJL 2A9NL 1U6AL 4JQIH 4Z7UE 4LPUA 2BVPB 3S4SG 1N6QL 1I85A 2Q86B 2A38A 5I30L 4PRIB 5JMOC 1BWMA 1JL8A 1XGTA 4GW1A 4TOYL 3LH2L 2F54E 3SO5A 3VXSB 1LWRA 1MHPH 3RL1A 4NYLB 5D2NA 3BPLC 1I75A 4K71B 3HC4L 1BVLA 4LNRB 4X5XB 3QCUH 4HWUA 2EDYA 2EIDA 3PDGA 2B2XL 5J6HA 1YEKH 4W4OC 3U4EB 1LGVA 2BSTB 5IV2A 1K4CA 3W5MA 2C3GA 3PL6D 3GMQA 5ITBL 5DFVC 5I19H 1U8HA 1JGLH 1M7XA 1YNLL 3DMMC 3I6GB 4U0RB 4PPTA 5HDQL 1C5DB 4UIKL 4XPGH 3QNZA 2ZG1A 4RCAA 5I71B 2VDPH 1DQDH 5E4EC 1IGIL 2ITCA 5EIQA 4LLYB 4FXKB 4Z18A 1CR9L 3WD5H 1FVCA 2BVUA 2Y06H 1NUFA 3PHQB 5T5NF 3O3BA 2VDRH 4DWHA 5J11B 2X4TA 3S5LB 5J12C 1VFAB 1EA9C 3GM8A 3KPRB 3P40A 1TTUA 1K6QH 1ZVSA 4JJ5A 2CKBH 4QRSA 1S7VA 3BD4A 3ES6B 3NFNA 4CVUA 4Q6IB 3M1BB 2IH3B 2BHUA 1KACB 1BQSA 4WTZG 3V5HB 3EFDL 2JE8A 2R1WA 4LLQA 2OMBA 4ZNEA 1N8ZA 3GBLA 1PDKA 4DVRH 5JXEC 5C0FB 3FAWA 3I3BA 3KHOA 1RJLA 2VXSL 5CIPB 2VDOL 3FCTA 1IBGH 4ZQKB 1F90H 5ACLA 4F3FA 1KPUA 3DHJA 5DVMA 4QTHA 3GSVB 3BZ4A 4U1NB 4WWKA 3NMEA 4I5BB 4IDLA 1HXMA 4XNXH 4X6DE 2GY7B 1JWMA 1U3HA 2D7NA 1IM9D 1WV7T 4UOW1 4EUPA 4TSBH 3FQNB 5EO0B 5IB4B 3U7AA 1OTUC 4QRPD 2DM2A 3MRQB 1H8NA