2D7OA

Solution structure of the 17th filamin domain from human filamin c
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
111
structure length
111
Chain Sequence
GSSGSSGAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Filamin-C
publication title Solution structure of the 17th Filamin domain from human Filamin C
rcsb
source organism Homo sapiens
total genus 10
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d7oA00
4FQ2H 1I7UA 3MOQA 5FF6B 1T0NB 1L6XA 5IR1B 4IRZH 2DICA 4XAKD 1OTUD 4EDWH 2AVGA 4OB5H 5MEQB 4ZTOL 4WY7H 2VIRA 1J8HE 5F89B 4WI4A 4XXCA 2BNRE 3C5SA 2AXFA 3OB0K 1YMME 1VHPA 4WW1B 2HTKD 5KVDL 2VDRL 5ANMA 5EOTB 5FA3B 2N7AA 3JWDL 5FKPB 4OV5B 2VRAA 1LK3H 4IOFC 3LB6C 2GFBB 3EFFB 4KI5E 3RI5F 2IAMA 3WO3B 5C07A 4XXDA 2IQ9L 1ZLSH 4WCYH 3TO4B 4HLJA 4JPVL 2YSSB 4YX2L 4MA1B 1WFTA 1KB5A 5KZCD 5AD0A 1BVLB 4LLDB 4O9HH 4MQXC 2H2PC 2ZG3A 3K1KC 4XP9H 5E00A 4Y5XB 2R69L 3EYVA 4J6RH 1KJ2H 5FK9A 5AUMA 1HSBB 3HR5B 1BQHA 4WFFD 4MNQD 2DYPD 4E41A 3Q6FA 1JGDB 3OHXA 4P2OB 5GJTL 2IANE 3QWOA 2CLZB 5ITBL 4NN5B 3UTTD 5BVPH 4D9LL 1MQKH 5D4QA 1MAMH 1ZHBA 4F7MA 1A2YB 3U30B 4L9DA 3NPSC 5KBNC 4P4RA 4JG1H 4X80L 1XH3B 4WWKB 4NDMB 5AZ2H 5HVFB 4YFLF 1J0IA 3V0AC 2HRPH 2XPGB 4X9IA 5A16B 3S36L 1R3HB 3TVMB 1BQUA 1JL8A 32C2A 1I1AC 3P3YA 3L5WA 3D18B 3QCUL 3FCTA 4DFHA 4JY6A 5DZOA 4YHZL 3NTCL 1Z0MA 5D8JL 1TZGH 3QUYA 1G9ML 3Q0HA 3R1GL 4L8SC 5LCVL 2AK1L 1MUJA 3ARFC 3GMMA 4U1IA 1OW0C 3MLVL 3I9GH 5KN5A 4FQXB 3MA7B 4JM2B 4P59L 4KGJA 5EFIA 3RWIA 4F58L 1TJHH 1GJIA 1WC7B 1KGCE 3QDJD 3CXHK 5FYJU 4CN1A 2EDTA 4FQQA 2IC2A 4ETQB 3BVNA 3GBML 3KWWA 4LLYA 1G7HB 5EU6A 3TBSA 5BV7L 5F6IB 4ZPVB 4NNYA 2NY7L 2B1AH 4R9HA 1ONQB 4JDTL 4M62L 4MXVE 5AZEL 3FAXA 5GRVK 5E2UH 1P7QA 3MV11 4IBLT 3OF6A 5IB4A 1BJMA 4LGRB 5SWZB 4TUOA 3M17B 5CD3A 4WI5A 5I1GL 4L4TD 4PLKC 1ZWIB 2W9EH 1AGFB 2I26N 3MXWL 4OD1L 4KPHL 4XWOD 1KN2H 4X6DF 1MRDH 5DLMH 4YXKL 1EXUA 4ZNEE 1AO7E 4IOSD 1WZKA 3N06B 5JPNB 1D9KB 2O5XH 4OUOA 3VGGA 4LSUH 1MJUL 5D6DA 1M05A 1QHPA 1UM4H 5IF0A 5BV7C 5DQJB 2Y4SA 3VFGL 4R7NB 5LGJA 4APQB 1IAIH 4HZLA 3WFHB 3IETA 3S4SB 3SN6N 4JANA 1UFUA 4MAYD 2EO9A 2BJMH 4HJJH 2QJDA 3QCTH 3WIHA 3MNVB 2CKBH 5J9PB 3REVA 5GRWA 3VRJB 3PQYB 1CVSC 3HC0B 2L4OA 1RZGB 1A7PL 2A6IA 4RGMB 4OD3L 2VLLA 4I0PD 4CAGA 2FLRT 2CDFB 2NY5H 3BH9B 5HHNB 1M1SA 1WFOA 4ELMB 1N0XL 4N8VA 3C60D 4HK3J 2PW2A 3TBWB 5HYSB 4WW2C 1ORSB 3D25A 3KVQA 2ITDA 1INEH 4M43H 4OF0A 1HILB 2ESVD 1SEBB 2DMCA 4XPTL 1OARH 2BNRA 4LHUA 5C0NC 4MQ7A 3T3MF 1KPRA 1UA6L 5HHOE 2PYEB 4Z7NF 2BDNL 3DX8B 1RURL 1VSCA 5L6YH 5C08E 3KPSE 2CO6B 3DNKA 4L3CB 3DGGA 4YWGL 1NCBL 3MGOA 4LARH 4XHQA 1JPTH 2EDYA 1KSRA 1YEGL 4KMLB 5C09E 4JLRB 4B5EA 2GCYA 4QTIL 3GO1H 5F7UA 5FYJH 1OAYH 4GW1A 4I5BA 5EBMA 3K1DA 1VFAA 3GSVA 12E8L 4PJFE 2AJSL 5ISZD 2APVA 1G9NH 4PRDB 5FYLD 3R06A 3HLAB 4YDVB 1MCNA 4RMTA 3WXVH 3VXUE 1LVEA 1W72H 3MCKB 3SDCC 3V0VB 5H94A 3LEVL 3OX8A 3O2DA 2LAAA 4UUJA 2IANA 2FBOJ 3UYRL 3E3QC 3DURA 2DKSA 2YRZA 3DWTA 5CAYB 3BYTA 1QFWM 1KELH 5MENB 2WWKO 1MHCB 3SJVB 2WBWB 1I8MB 4KZDH 1KYOJ 2WZPD 1AGCB 3LQZB 2R1WB 1I9RH 4AQ1B 1YPZE 1A1NA 1NFDB 4HFWA 3DUHA 3PXHA 4NWUH 3WFBL 3OZ9L 1A3RH 2Q3AA 2NTFA 5IB3A 4DUXA 2OI9B 5IHLB 3ZKMD 3L95B 3F6LA 4HHAA 5C0CD 2F5AH 1PJ9A 1MFAH 1II4E 5JO5B 3ARRA 4MNQA 5EBGA 1CYGA 5FYKD 3UTOA 1B88A 4FNLH 3WIIL 5C0FA 1KEML 4BZ2H 1UENA 3QEHB 1K8DA 3FRUB 4ZTPL 3UTTA 1N8ZA 2AEQL 4F33A 4BM7A 2GT9A 3OKLB 4JHBA 1A5FH 4WENB 1UKSA 2Y07H 3S36X 1AQKL 4FHBD 4OCLC 4JCLA 1Q8MA 3PV7A 4IRSB 4WU5A 3I6KB 1IGJA 3U0TB 1WF5A 1C5CH 3P4OB 3JTSA 3JV4B 3MRDB 2NR6D 4Z7WA 1S7QB 4PGCA 4U1HB 4WHDA 1CF8L 1CDHA 4M9PA 1NGPL 4QRPB 5T3ZL 5I1EH 4UNTA 5EU7C 5J06A 1A7OH 4HKJB 3LRSA 1NMAH 4NQED 3CK0L 3TNNB 1OSZB 5D96B 5B4MC 4KDWA 4Z8FL 3DYOA 3S3PA 1BVKA 3RY6A 1UWXK 1KCRL 3O41A 4KVNH 2Z35A 4ZXBC 4JFOA 4YR6A 2CMRH 2GW5A 3HUJF 4CUCA 2F8XC 4R0LA 2JB6A 4G8GE 1YEEL 3HI6L 4R7DA 3RNQA 1C16B 4X7TB 2XTJE 1K8IA 3KPLA 4HWBH 5GS1C 4K2UH 5HDQL 1MNUL 3TJEL 1CGXA 2AJVL 4M6OL 1XIWB 1AY1L 5AAMA 1KTLA 2DQDL 3EO0B 4U1GB 3B43A 3BEWB 5C70A 4NFBA 1BQHG 1B6UA 4LVNC 3IDXH 5T1MB 3EBAA 5DI8A 1F13A 3NFSH 5FDWB 2MQ3A 1J05B 1RZFL 4MA7L 3DHMA 4XP1L 4L4TA 4OM1L 3I3DA 1EPFA 1PLGH 4Y16B 4XMKH 3RWHA 5TQ0L 1RZKL 5F9OL 3FFCD 5KSAC 3HI1A 5MP6L 3QUMB 4J4PC 2X7LA 5CEXA 1YDPA 4RCAA 3WSQL 3H9ZA 3L3DA 1KIUA 3WKMH 1PG7L 1D6EB 1ORQB 3VXSD 4PLJC 2ADJB 4K8RH 4PD4J 4JFHD 2ADIB 4MAYA 1KT2A 5DJ8B 3NFPB 1HEZB 3B9VA 3ULSB 3SE4A 5ALBH 5C09A 1YECH 4X7EC 3KDMA 4HPYH 1H3GA 5I1DA 4JKPL 4XC1L 3FQXB 2XYCA 4NKOB 4I0PA 3V9FA 1CDGA 3IRZA 1K5NB 1MHEB 1ZLVK 1RZKC 2X10A 3FFCE 4GT7A 3W39A 1OM3L 5EZIH 5BZWB 3IFLH 3ARZA 1MLCB 4HUUB 3QIUB 3EYFB 1AKJD 4PP2B 3GMPA 1DUZB 2ESVA 3FB5A 2WSKA 3D39E 5MEPB 2A38A 1SYVA 4O51B 1HSAA 2YPLD 4QCIA 5DZLA 4JFHE 2AK4E 3L3HB 4FXGA 2DQCL 1UACL 2ZCLH 3B9KC 2PO6D 5DK2B 3KYMA 1NGYA 4WV1A 2DD8L 1DR9A 4PRHD 3FO1A 4PTTB 1BWWA 3F6IA 4P2RD 3MGTB 3W11C 5ICZB 3WUZA 2J4WL 3ORJA 3BN9C 5ISZA 4NT6A 2LE9A 5L7XH 3RDTB 4YDIL 4JDVB 4KK5D 4HULB 2VLRD 5HY9B 4HEPG 1X7QB 3PP3K 1OSPH 2YS4A 2QV2A 3K4DA 1WZ1L 2VUOA 4PB0H 4XB7A 4UV4L 3CX5K 4MLIA 4FZ8L 5FHAL 3HG1E 4C59B 2CKNA 1U8IB 3NCFB 2OMBA 3QUZD 3TV3H 4GMSL 1TJIH 3IDYC 1A7RH 4PJHE 3CPLA 4NUJB 1A6UH 5EC2A 5J13B 3DETD 1TPXB 1TVBA 3QNYA 2W9DH 3MJ7B 4O2CA 4O58H 3KPNB 4J3VA 3IDJB 4PRBB 3VCLA 1VFOA 1B2WH 4XMPL 1A3LL 1UJTA 3WO4B 5C0CA 5HI5C 1I4FA 2HFTA 4N8VG 3TT3H 3BMVA 3EOBA 4HUNB 1OAKL 1S78C 2YOCA 3BPOC 1XF1A 4LHUG 1KN4L 3KYNB 1U6AH 5E6YA 5E99L 5LBSL 1Q9OA 2FJFA 6FABH 1S7TA 1D6VH 3RTQC 5CBAA 3KPQA 1BOGA 4I48A 4XGZA 1XGUA 1H3XA 1CLZH 1F4XL 4LIQH 4TNVK 2PCPB 4YBLB 3QHTC 4S0TD 1A0QL 1QLFA 4N1EA 5GGRA 3MXVH 5JQ6L 1PYWA 2IPKA 4M5YL 4XVUC 1MFDL 2EECA 5K9JL 5HYEA 4XHJC 2KBGA 3VXOA 4NQEA 5FB8B 1OT2A 1JZ6A 4JZJB 1NCUA 4GUPA 2OZ4H 5KW9H 2P8MB 5CIPA 2XACC 4KUCD 3GMRA 4W4OA 2CGRH 2VDQL 3QUXC 4AL8L 2VZUA 3D87B 3PG2A 1I7TA 3S9DB 4CADA 2JK5B 1RUQL 4JRYD 4PIRF 4WDIB 1QFWH 2VXSH 1CFQA 3MA9L 5TDPB 3TZVB 1RK1A 2NYYC 5E1AB 1MRCL 1TETL 1MFCH 3FQWB 4MMXC 2V5MA 4OSUH 1Q1JH 4RDQG 4H5SB 1FFPA 4B7IA 1T20A 1J8HB 2I9LA 1CD1A 3MYZA 1F90L 4L1DA 2R0KL 4OCSL 1YMMB 5TDOB 5LWYH 3VDAA 1SY6L 2C3HA 1J0YA 4CKVX 2DLTA 4Z18A 1GIGH 5BOPA 4HKXB 2JJWA 4LLMB 4OZGE 3O6ML 4QGTA 5FIEA 5J56B 1HINH 3QG6B 5JDJA 4X83A 3WYRA 4OBSA 1PG7X 3FFCA 1JK8A 5GQBA 1T4KA 1J1PL 1F3JB 1MVUB 1WGOA 4M7JL 1RSFA 1MWAB 4CNIA 5LGKA 4Z0BH 5IHZB 3ZKXB 3TO2B 3VXSA 3D39A 2APXA 4ORZC 4OIIH 5IEKB 4RGNC 2P8PA 3EGSA 4QHMA 4L4VD 4FFVD 4Q9QH 3CX2A 2VC2L 2D9CA 3BP5A 3GNML 3QFJD 5IOPB 2VUYA 3IAPA 4YHYC 5IMMA 2ARJB 2VH5L 5EORH 1BQLH 5EB9A 3VFVA 1L4IA 2IJ0C 2X09A 4EI5B 3AREC 3QUMH 5C0JB 4IS6A 4JDZA 1ZA3B 2CIIA 1FDLL 3V4VH 3K4ZA 2E27H 3V5DB 5EIQA 4DFIA 4QXUH 1MCJA 5TE6L 5IQ7H 4KHXH 2Q7YB 3GKWL 4DVRL 2FB4L 4TVPD 3SE3C 4HG4K 1PZ5A 1H15B 4PJGB 4C4KO 3BPNC 3IU3B 5D7KD 4MXWH 4G9DA 1YEDB 3SGKC 2AJYH 3C6SB 4YEEA 1BEYH 2YPLA 3FQRB 4O2EA 4AMKH 1DBKH 1F11A 4LSSL 4U7KA 4J2XA 2PO6A 4HV8A 1VCAA 4HBCL 5IM7B 4MGXA 1GPOL 3MLXL 5CGYD 4XNZC 2FHFA 2Q86A 5ACZB 4IMKC 4PJHA 2IQAA 4PRHA 2AV1A 3V52L 2CLRB 1PVHA 3EDDA 4P2RA 4V2BA 2HLAB 4Q58C 4PRNB 1JGLL 2J6EL 1KUMA 5DJDB 2YD4A 5ITFB 3LH2L 2YWZA 4LNRB 2UWEF 4NYLB 1M7XA 1VKXA 2VLRA 1T2QH 3MFFA 5K9OA 1S9WB 2Y6SC 4KAQL 5HGDB 5TGBA 2FIRT 1PBYA 4DGYH 5I9QB 4Y7MA 3H0TB 1PDKA 5KAQF 4DCQB 1ED3B 3MRQB 1VA9A 3EZ8A 3BESR 4LCCA 2BSRA 4R90L 1JUFB 4L29A 4NZJA 3QPQD 4NP4L 3D9AH 3QUZA 5J12B 2DJ4A 3WFDL 5L8JB 1IFHH 3CFCH 4OZIF 3MSPA 5ALCL 1F00I 1XFPA 4JQVC 4JQXC 3B6SA 4M5ZL 1HK6A 4QXTA 3NA4A 4W6XB 4PJ5E 3QRFM 5F7WC 4X98B 3V6ZA 1VFBA 1IC1A 5F1IB 3T2NL 2UVEA 1NC4B 1AO7B 3JWOL 5SX5K 3HNVH 1EJOH 1OPGL 2MFNA 1CFBA 4K07A 4CW1A 5CEZH 3D0VA 3HMXH 1HHIB 1A6ZA 3EJYD 1LNUB 3SDXB 1IGMH 4ZFZA 2EDDA 3MR9B 3I6LE 1HHGA 4E42A 4KROC 1IGIH 4G8IB 3MOAL 5IIEA 5I0DA 2PN5A 4CVZB 3NVQA 4XPFH 5CJBA 1ZA6B 3PF2A 2EKSA 1YUHB 3G6JA 2YD3A 1CK0H 3O2WL 4LCUB 4CVXA 1NBVL 1DEEA 5I1LA 1HHHB 4YAQA 1H3UA 1T89A 5IVZA 2OP4L 4M93C 2Q20A 2DOCA 1U92A 3TCLA 3UBXB 5F9JB 3JWOC 2HFFB 1RJLA 4MA3A 2XWBB 2EYTA 5F6HI 1U3HD 2XN9D 4AEIL 3GI9L 3VRIA 3DLQR 3RZCD 2B4CC 1ZANH 1T1YA 4WFHD 3T0WA 1FZKA 3ARGD 5HHOB 5F70A 3BEVA 2R2HA 5CJ5A 3U2SA 3ZDZE 5C08B 3T65B 4PRIE 3KPSB 1JNLL 3H42H 1EEQA 3MCLH 3VD5A 2GSIA 3G08A 5JTWA 3BWAB 4X4XB 1INQA 4E9LA 4GAGL 3MYJB 2X4SB 1V3LA 4JRYA 3WIFB 3WJLC 3V4PL 1S9XA 1EEZA 5T3XH 3RWCB 1HQ4B 4HLZH 1M71B 5CKGA 2NY0C 3O3BB 1N7MH 4QOKD 4PJBE 1JMZA 3AY4A 4PGBB 4LEXL 4LDLB 4XVSL 4UOJA 2HRLA 3VXUB 4F7PB 5DJAA 1JYNA 2JCCF 4KZEL 4R4ND 5J0BA 1AIFA 2Z8WC 5GSRB 3QIBD 5DVMA 1WLHA 4XBEH 3GBNL 2FEEI 3VXRE 3CZFB 2OS7A 1FNEA 1CICB 2GAZA 4JPWL 4ZFFB 4HBQA 1EHLH 1EH9A 1MI5E 5HHQA 3C5JA 4QY8A 1A1MA 1FH5H 2DI7A 2WNGA 4R3SB 5LQBL 3HMWH 5E6IC 3WE6A 5DJCB 4FQ2L 3UJJL 4OM0L 5LAXB 5I1CH 1AR1C 4JO1H 1U0QA 5EULV 4Z5RA 3AS2A 3CGTA 2I25N 4BK4A 4NCC1 1R3JA 3HAEA 5EUOA 1Q0XL 1MFNA 3P30H 1OHQA 4F9LC 3QH3A 1S8DA 1F4WL 3MUY1 3QAZC 3WFEH 5EBLB 1HXYA 4Y5YC 3PWJB 3OR6A 5EO9A 3QFJA 1LK3L 3LB6D 3BKJL 2WINA 3HZMB 3QO1B 3W0WD 3OG4B 1UWGL 3V5KA 4JREC 2BVPB 1NJ9A 2RCSL 1C5DB 3MNWB 4CMHB 5IMOB 4PBVC 1XF5A 4FFYH 5I19H 4JKKA 3UTSD 4J12A 1OLLA 3W5NA 3PV6A 2DAVA 2WAHA 5HYJD 3MJ6A 3TA3C 4UB0H 3V6FB 5FA4B 2AEWA 4AT6B 1CZ8H 1LO4H 1S7RA 3U9PL 2JIXB 2FIKB 3DIFB 1UWEL 3CH1B 5ESVA 4HGWA 4GKZB 1N64L 4WUUD 1TITA 3LKSB 3SGDH 1FNSH 3VH8B 5SWSD 1L7TL 3RIAK 1FNGB 3ZE2F 4QHKI 2X4UB 1OWWA 5BVPL 1DCLA 1MQKL 4PR5A 3VGAC 1T7WA 1NKOA 4ELKB 2WBJB 1NC2D 1A9EB 3V7AE 4EUPA 3GJFB 4P3CL 4MDJA 4UT7L 4DKAA 2F5BH 3HCVB 4KQ4H 4JG1L 4ZOBA 4KHTL 5E2WH 1B4JL 5AZ2L 1IQWL 1D5BA 3V6BR 4PJ5A 1ZEAH 5IWLC 3LKOA 2NW3A 1KCSH 1N5YH 4F15B 4G8GB 4Y4FC 4DTGL 4XBPB 5DEGA 5CJQL 4FQIL 4GAYB 4IMLA 4Y89A 3DARA 5JXEC 1N5AA 3RVVC 1T1ZB 5IB2A 3HE7B 4WNQA 5DSCA 5HI3C 2YN3A 1GAFL 3D85D 4RQQA 1HOCA 2IH3B 4P46D 1U95A 5TE4H 1IKNA 5L2KD 3CC5B 1J5OL 1C7TA 3KLAB 3IF1B 3I9GL 2IPUG 4U1JA 3O3DB 3L7FB 3A0OA 5D5MF 5EUKB 1Y0LB 3TCXA 3ARXA 5I76A 4NRYB 2YA0A 1GGYA 4HWZA 5D7IA 4P5TD 4MDIB 3KPOA 3N1FC 1IC7H 5I8OL 3HRZA 5E8NA 1XR8A 1NCDH 4JFDE 1SMAA 5MI0B 3TJHC 4Y8AA 3OMZA 3VFWB 5HHVH 3KPRB 1UXWA 5JHDD 1UT9A 3WN5A 1RULL 5JPMA 2ZSWB 4QF1B 5ICYA 1N3NA 4G7VH 5C0BD 1VADA 2F58H 4PRIA 1KTRL 3STZB 2NZ9D 1NAML 1TJGL 4D0BA 3JUYA 1BX2A 5DHVA 3NGBC 1E6OH 4RFNB 4WGWB 2Y7QA 5DDHA 5ESAB 3RWEA 3OKEA 4ENED 1HH9B 35C8H 2V5TA 1X6LA 3ALXA 4MNHB 1KN2L 3BDXA 4UU9A 1ZHKA 2WUBH 1S7WB 5DF0A 1S7VA 2D31B 3ULVH 1OP5K 1LP9F 4LSUL 3FB7A 1ZT4B 2QQKH 3CXDL 2R39A 1ZLVH 4WWID 5KJRL 4EN3B 4JAMA 1U3HA 4NKMB 2XN9A 4Y1AE 4Z76A 1CU4H 2GY5A 2G9HB 4HJJL 3S34H 1MI5A 3UO1H 2CKBL 2NY4D 4YHPA 3MFGB 1Q9KA 4AY0A 1CXEA 3RKDC 4PJAA 1LQSR 5DD3H 3H9SD 4ISVA 3DMMB 3MRLA 2JELL 3N1MC 5KSUB 2E7LC 3QXVA 2EDOA 1QKZH 1P4BH 2EDWA 1OLZA 1X5FA 43C9A 4QOKA 3QQ3A 1EFQA 1OARL 2XFXB 1QP1A 1R0AH 1KNOA 1JF1B 4YXLH 1UH2A 1FAIH 2W9LA 2E7BA 4IOIA 3QIBA 2NNAB 1JHTA 2Z93A 3HE6B 4GKNB 1FL6B 5F7KC 3UXFA 3PHQA 1G7JA 3WS6C 1A9BB 3RWJA 2YD9A 3A6OA 4HDIB 2OL3A 1T03H 3KXFD 2DM3A 1A1OB 2FHCA 3DX7A 4KWUA 2WQRA 3WNOA 4OGAD 2ZUQB 2X1XR 5J1AA 1UQSA 4OKDA 3JTTB 5CLWA 3WXVL 1WAAF 2CD0A 1NCAL 1JGUL 1G6RL 4UNVA 1W72L 3FTGA 3GFUA 3NZ8B 4KJWD 3L3GB 3ZT7A 4X6CB 3ARBB 3QZWA 5ICXB 3B83A 3MRHA 5JW3H 2ZUUA 3MBEB 1JPSH 3W0WA 4CJ1A 1QO3A 2YD7A 5DVLA 5DURB 1FE8H 5C0DA 4P9MH 2DLFL 3MV7D 3UTSA 3JV5A 5IKCB 2VMFA 3W9EA 3P0GB 1PEZA 1I7ZA 5ESQB 4OLZL 4M48H 2I07A 5HGAB 3RVWD 4EJ1C 3T0EC 4AEHH 1WBZA 3T0XA 4R8WL 1MCOH 1G9NC 2C7UA 5K9KA 1WIOA 1KLGB 4YZFE 5CSGA 5A2JH 2VITB 4PJCB 1UG9A 1C5BL 4MCZA 4YPJA 4LNVA 4WUUA 4GW5B 5IVXE 4GXUM 4LF3A 5GSVB 5SWSA 2B7DT 5JDSA 2XWTB 3O8XB 4DUVA 1QOKA 5EC1A 1VPOH 1NGXA 3E3QE 5D1XD 3QHZH 2ZSVB 4TYUA 4I9WE 1IC5L 3DO7B 4ODUA 4OCNC 4KRPD 3MODL 4FMKA 3BD4A 4KXZH 4BSWA 4HUWB 4OLUL 1UB5A 3BZFB 5I16B 4XPHH 1KXVC 1I1AA 1MJJB 3OKDA 4XH2A 5KSBF 2ERJB 5DMYA 1S7SB 2OTUA 5GGSB 5JZ7C 1IEBB 5EN2A 4P49A 2P5WD 4LSQL 1OCWL 1A7OL 3HAEG 4GS7B 4Z7VF 4CDGC 3MROA 4I77H 1NMAL 3GJFH 3D85A 5C8JA 3G5ZA 5DTFA 2W1NA 4L8SA 3TO4C 3KYOB 3QB7C 3D1MC 1HE7A 2ZOKA 4MA1C 5FCSH 4JFEE 4YGAB 1OW0A 4FQLH 1OGAD 2FYYA 4X4MA 3SDDB 3GJEA 3PP4H 1IKFL 1S7XB 2WM0A 4OF7A 2ZG2A 1LEIA 4S2SB 5KG9B 1C08B 1CFTB 1KJVA 1FIGL 5DJXA 5A1AA 3ZO0A 4OZGB 1DSFL 3ULUL 5HVWA 3EYQC 4K2UL 4DKEL 5E95B 1LO5A 2PTVA 4R97B 4H0IA 4P2OC 4QRRD 1L9MA 4KKCC 3PWVB 2Y5EA 2OSLB 1OY3B 4NN5C 1W0VB 2IADB 3O6FC 4ZUWA 5EU7E 5T3ZD 3P9LA 4DAGH 5J89A 5JHDA 1XEDA 4WUKL 4PY7B 3U30C 4X5XA 5F71A 3DVIA 5C0BA 4P23B 4WWKC 5D93C 4HIEB 2HKFH 1FO0L 1YMHA 1TMCB 4JG0H 2ED9A 1PLGL 2ENSA 1AXTL 5FO9A 3SKNA 4XNXL 3RVUD 3TVMC 3ULUF 2VDML 2J5LB 3MV9E 4EUPG 1J11A 3VFSB 2PNDA 3U4BH 3RY5A 2DQHH 1FPTH 4BSJA 1EBPA 4XNQA 2WANA 4YHOL 1XF2A 1JBJA 1IM3B 4J4PD 3SEPA 2R0ZH 2DKMA 2EYRB 2LV4A 1VENA 2F74A 4X6DA 1NBZA 3ILQC 1VDGA 4TUKL 3KNBB 1A7NH 3KJ6H 4G6MH 2Q8AL 4JKWA 5IMLA 4OD2A 4RSVA 4GRLB 2FJHA 2FBJL 3EFDH 3N1PC 4F3FB 2VR4A 3CFJA 5DUBA 4FQXC 5EIIA 4JM2C 2AV7A 3IFNH 3VWJB 3P0YH 1A6TA 5ALBL 5CZVH 2Q6WA 3QA3B 2J3SA 3PGFH 5IV2A 1FZMA 3WUWA 4LSDA 1H3WM 4NRXA 1RFDL 4MJIB 4GKOA 5F6IC 4MJ5A 4WW2A 4JFFE 1MAJA 4UQ3A 1TCRB 2HG5A 2OQJA 1P2CA 4ZUTA 4LCWD 4QRQB 1P53A 2C3VB 4K7PL 3OPZH 2R15A 3QNZB 2BC4A 3OKNA 5TFSH 2FSEA 3MLSL 3BIBX 4NO0D 2OTWA 3N85H 5C0AE 2C4FU 3IDIB 4O4YL 4K8RC 4RNRB 2R2BA 5DHYA 5I8EA 3S5LB 1MHPL 1IAII 3HB3C 2VZVA 3UAJC 4PREB 3BGMB 3F7QA 4P2QE 3WLBB 1D5IH 2IH1B 4WEMB 2BXYA 1KENH 1J86A 5ERWB 3KLSA 4R4BB 1I85C 3EOTH 3OKMB 5GJSL 3KXFA 1RJZA 1BBJA 1IGYB 1HZHL 4MD5B 5GHWH 3PWPB 3BN9D 1D9KC 1H8SA 2BSSA 1DBJH 2P24A 3LQAH 2ATKA 1XR9A 1C7SA 4OFYD 1A4JB 2AQ2A 4Y4KB 1JYWA 1MLBB 4APQC 4LCWE 2ZZUT 2O5ZH 4K7FB 5BMFH 4N0FA 1JHKH 1JNNH 1MIMH 1LO0H 5FUOL 2XG4A 3EYOA 4PBWD 4Z7UF 4ZDHA 4DZ8B 5E08H 5JUEL 5C0EA 3GSWB 3KLHC 4XBGB 2MWCA 4RGMC 4RRPA 2EH8H 1T83C 1TZIB 43CAB 4RA3A 3TV3L 4XP4L 2F54E 2X05A 2ZUVA 3QUKB 3MV7A 7CGTA 3GUTA 4GBXC 1YEHL 3CSBA 3VGBA 3TBVB 3O9WB 2P49B 4ZYKB 4NNPH 2HH0H 4G9FD 3PXJA 4KKBC 1AQDB 3OGCB 2RQ8A 2KZWA 1I3RB 5EA0L 3PWUB 1T6WA 1FBIH 3IDMB 3VXME 2BK8A 2RAMA 3GSXA 1DQLL 5F44A 4B7LA 5D1XA 2YMXL 3TH4T 2E7CA 3WS3B 1DQTA 6FABL 1AXIB 1D6VL 5K93A 1WIUA 3LDBB 1DQJA 2DWEA 3JXAA 2BNUB 3RL1B 1NFKA 4NJ9L 4KQ3L 1JGEA 5GS0H 4BZ1H 1I8KB 4XNYH 4POYA 2FGZA 2R56H 4KMQA 1J0HA 3MV8B 4TSCH 1U8OB 3GEWB 3VXTA 4OKVA 5HDLA 4EI6A 1NLDH 3D2UD 4YHLH 1YEFH 1R3IH 1DVFB 1DFBH 5EU5A 4HF5H 3MOBH 2P5WA 4PJBB 3MO1A 3L3JA 2RB8A 1NFDF 2BVOB 4JQIH 3HPLA 4Z77B 3B9EA 4R96B 3QZWG 5LKNA 4LEOB 4LP5A 3VXRB 4ZXBA 1R5WA 2ARWA 3QQ4B 4XP6L 3QUXD 1PGRB 4CU7A 2OI9C 4XCYA 1N6VA 5JOFB 3EOAB 4EIZC 3SE9H 5GS1A 3CMOL 4GLRH 3FT2A 4Y0GA 2NYYD 5E5RB 4HS6B 4QRRA 1OAZH 4YDJA 1AHWB 2DS4A 3QXDA 4XTRC 3C5SB 1OP3K 4A6YB 1Z5LA 1I9JH 4IJ3B 4OLVL 3F58L 2G2RA 3DV6A 2YD8A 5LWYL 5DJ0B 2DQFB 3DJ9A 3LIZH 3MLRH 4D0DA 3X3FL 4IRSC 1EGJH 2EXWC 1XCTA 3NN8A 1KBGH 5GZOD 4DEPB 2R4RL 3PJSA 3SDAB 3WNNA 5J4MA 1MCQA 1OAXL 4JFFA 4J4PA 3PHOA 4N8CH 4N90E 4MSWA 2I5YH 1F6LL 1K9TA 2KZ1B 4J23A 1SJHA 4MHHI 4FQHB 1H3PL 5D96C 1T0PB 4OCYL 4OIIL 3OHXB 5FECA 1G7IB 8FABA 3AM8C 1QG3A 3MACL 4BFEA 4Q9QL 1QBML 3C8KA 1ZHBB 5HD8C 4LU5H 4S11A 4I8DA 3ARED 4P4RB 5F7YC 3PIQA 3V5HB 5DQDH 3QUML 3RAJH 3TN0C 2DQEH 5EWIH 1VFUA 4MCYA 3QEQE 2E27L 1XIWC 4J8RA 1V3JA 4ODWA 4QXUL 5D1ZD 4RFOL 2HVKA 5J8OA 3BWUC 5F8QC 2EE2A 4I3RH 4LCWA 5DVOA 5FFLA 1P7KA 2VQ1A 4MXWL 3OB8A 5EU3A 4RWYL 3BZ4B 1IZJA 4NO0A 4RGNE 4OCWH 4JY6B 1U41A 5BZDA 5DMIH 4BYHA 3QUYB 4L3EE 1EFXD 1DBKL 3B9KA 4PJDE 1NLBH 1MUJB 1IE5A 5DJZB 4V1DB 2ATPA 1U8NB 5C0RL 1L9NA 4ONFH 4P9HL 3RUGA 3CVHH 3UDWA 1X5LA 4FG6D 3OTTA 1FFRA 2D7PA 1XF4B 3JV6B 1LE9B 1F8TH 2NY2D 2EDBA 4OFYA 1QBLL 3KWWB 5D72L 1R24B 4HXBH 1T2QL 3U4AA 3BP6A 3TBSB 4MNGB 5GRXG 1I1YA 4WRLA 3ARVA 3R4DA 4LDOB 1KCVH 5GGVH 4DN3L 3U1SH 3VXMA 2A73B 1FZJA 3SKJH 4CDHA 4ZOEA 4G6JH 1DQMH 4Y8DC 2WIIA 2H3NA 4HX1A 1E27B 3UYPA 1UB6B 3VD9A 1MF2L 4ZAKD 2PXYD 2W0FA 2VDKL 1OTTC 3EYUL 5GGSY 4X0KA 4C54A 4FTVE 3S96B 5C6TL 3O45A 4ZFGL 2ZUWA 3LZFH 1A6PA 3QIUC 2V5SA 5HHXH 1INDL 1KIRB 3WUWG 3QO0A 2AERT 1S5HB 2M2DA 4G9FA 2FO1A 2MSPA 4PTUB 1FFNA 1U8MA 1CE6B 3DVGA 4DVBA 1EJOL 3NIGF 5AEAA 5DJ6A 4HZLB 2E3VA 3QDHA 4HXAL 3IETB 1HXMB 5HHMD 2VXTL 5J7CC 3LN4A 4I0KA 2Y36H 4IIQB 4HCRL 1OP5H 4Y1AB 4Z7OE 5TDNA 1KJ3H 4RZCA 4NJAL 2JJTA 2W91A 3REVB 1IGIL 2X1PA 4HQQL 3RTQA 1IT9L 3DOSA 4RIRA 3MREA 5D7LE 3RDTC 1MJ7H 3TWCH 1CK0L 4PJIE 4NCC2 2QTEA 3QHFL 3M1BA 5TH2A 1B90A 3DO3A 1Z9SA 3IGAA 1M7DB 1K6QL 5E4EB 5INCA 1F58H 2L7UA 3D2UA 2XKNB 3NACH 3LEXA 3T8XB 4ODVL 3K2MC 1H8NA 4F7CA 1AI1H 4GQ9H 1NUNB 3MRGB 3MUGA 2W0PA 3QJHA 1BD2D 4Z0XB 2OR9H 4FXKB 4GRWF 3FJTA 4Y2DD 3L7EA 4XAWL 5J13C 5E8DL 1TPXC 1YEJL 1G7QA 2YRPA 1S5IH 3TBYB 3MCLL 4GG6E 4NQXB 3VFUB 3QUXA 5EBMB 4RRPG 3CSGA 4BH8A 4I4WA 3WO4C 3TT1H 5IFJB 1F97A 5CJXC 5JNYA 4EXKA 5IJKC 4O5LH 4RA0C 2B0SH 3LKNB 5GISL 2VN4A 2VE6A 4NQUA 5DZNA 4LPYA 1OP9A 4K3GA 4JVUA 15C8L 4KI1A 3VRLF 3GRWL 3DURB 3WIHL 3DX9B 3GMNB 1S9YB 1JI1A 1JNHA 3QBTB 5T1LD 1UKQA 2GYSA 4S1SH 4YBLC 1RI8A 4N5EC 1MJ8H 4XRCA 5FGBC 2A6JB 5E6ID 1A1NB 2P1YA 5DMKB 3VD3A 1NGZB 2OJZL 1RIVH 5I1CL 3AGVA 4ERSH 1ODAA 5GGVY 1QFWI 1QZ1A 2IBBA 4URTB 1NEZA 4NO3B 4U1NA 4MNQB 1KTDA 2DYPB 3LMJH 2PR4L 4ONOA 4JZJC 1WICA 3QQNA 3SGEH 3KR3L 3I02B 1MEXH 5IG7B 1K8DB 1KB5H 3UTTB 5IVXB 1KFAL 5IBUG 1PX4A 3VXPA 1SY6A 3IFOA 4U3CA 1SJXA 1IAKB 1MPAL 1SBSH 4QWWC 3AREA 2B39A 4OF5A 1MWAL 3E8UH 1RZ8A 4O02H 3V79C 1U8KA 4MQSB 5TQ2H 5FHBL 1IGJB 4KDTC 4QXGH 3A67H 3QIWD 3TZVC 4M7KH 1BREA 3VJ6B 4CMMA 5D1ZA 3JTSB 3NH7H 3P77B 2ZUTA 3SOBH 3RFZC 1GGCL 5GRUL 4Z7WB 2D0HA 3SE3A 3EJZC 1AP2A 3EW3B 1QFUL 1T04A 5A2LH 2YA2A 5EOQH 3VWKD 5IHUH 3SGKA 3QXUA 1NPUA 5C9JA 1UVQB 2DQIH 3DXAE 1YC7A 1AXSA 4KI5F 3K46A 4OI8A 3LRSB 4GSDL 4NQCD 2R0WH 3SO5A 2LTQB 3DBXA 1BJ1J 1EFXA 3REWB 4PJ7E 2VL5B 3LHPL 1ZT7A 3R0MA 4OZ4A 1K4DB 1TFHA 4POUB 5E94B 4OGXL 4IMKA 4OTXH 4YR6B 4FTVA 4B41A 4R0LB 3JVGA 2NY1D 1ZK9A 5DD0H 3QP3A 4GG8A 5DFVC 3NCEB 1NFIA 3QDJB 5JIKA 1ZEAL 3Q3GA 4OLWH 3RNKB 1KCSL 1N5YL 1TCMA 4Y4FD 1S9KC 4U1LA 5IQ9A 4HUKB 4YUEH 3S37X 2DBLL 3EOYG 1RZJH 3RVVD 4HWUA 1D5ZB 2VISB 5HI3D 2UY7A 1KC5L 4U31A 1Q9LB 1JPFB 3MRBB 5JOEA 1W0WA 4ZS7H 4UQ2B 3UTZB 4AIZB 2B2XL 4EI5C 1QVOB 5TE4L 3ZE0E 4OF3A 4Q9BA 2VKXA 4ZAKA 4ONGH 4ODBD 1A6WL 3O4LD 4UT9H 2NLJA 3K74B 1K3IA 2YZ1A 3BXNA 1XGQB 3RWHB 2SEBA 3BN3B 5E1HB 4U1SB 4JQXA 4JQVA 4ESKA 3FN0L 5J6GB 3UPCA 5KVFL 3MRPA 3HI1B 2X2YA 2J6EA 3BAEH 1TTFA 2DQUH 2HKHL 4NKQB 4OZIA 2V2XB 2OM5A 3DRTA 4ODHH 3MV9B 3DYPA 1SYSA 4WHTA 5F7NC 1EHAA 1QLRB 5HHVL 1JF6A 3ZKSD 1NUGA 1RUMH 1AR2A 3C5ZB 4JKLA 3DUSA 5I1KH 1GGIL 1U8QA 4G7VL 2D2OA 2R23A 2D0FA 1JFQH 2PW1A 4LOUD 3NIFE 1AD9A 2FO4A 3O4LE 2O61A 1HDMA 2X42A 3IS0X 3ZDYE 1B3JA 1G7PA 4I0PB 3G5XA 2BRRH 2X9YA 5DEFA 3A6BL 4OF8A 4RX4D 3OAUL 2Z92A 1YQVL 2ILLA 4RGOH 1MFBL 2WUCL 3C60B 2GJJA 5I9QC 1R5IA 4F2MB 1PKQA 4X6BA 4D9QD 4MXVF 2ESVB 1ZVSA 4LLWB 5GGUA 3RIFF 5KSAB 2VDPH 1CLYL 5F7DB 1SYVB 1HSAB 5E9DD 3VA2C 1IM9B 5FGSA 2C1OB 2GUOB 2X9XA 3OKOA 2WIMA 5CS7A 3CSPA 1YJDH 1DLFH 3L5IA 2XV6B 1BD2A 1P4IL 1BZ7B 1HKFA 5GRJH 3S34L 5C0AB 1NKRA 4Y2DA 3CFEB 4XX1E 2G75A 3BW9A 5D2NC 1NGYB 4WV1B 3FO9B 3ISWA 5HGGS 4P2QB 2X6MA 5DD3L 4G5ZL 3FO1B 3DSFH 2Z0BA 1OF2B 3CCHA 1MHHB 1QKZL 3BO8B 5ISZB 3WJLA 1P4BL 3ELAT 4Y19D 4X7CC 2X4QB 3TFKD 1J87A 3X11B 4YPGA 1MQ8A 1JMXA 3ULVC 3FB8B 4O2FA 3AU1B 1PQZB 1FG2B 1FIEA 4YXLL 1QQDA 4FABL 3I2CL 5IW6B 3F12A 2NMSA 4RFEB 1Q72L 5IB1B 2P5ED 5KANG 2PYFB 4PG2A 5T1LA 7FABH 1H0DA 4XCEA 3L3OB 3LD8B 2XKUA 5I15H 2V2WA 1GZPB 3CPLB 2VDLH 4J3SA 2QADC 4OQTL 1HQRB 4MD0B 5E6IA 1BF2A 4IM8A 3HPJA 1TVBB 2XZQL 4JM4L 1JRHL 3NCJL 1TVDA 1SJEA 1KLUA 1CDIA 3UJIL 5LXGH 4L3AA 3O2DH 3C08L 1DBML 4F9LA 1I4FB 2NXYB 3C6LD 3NOIA 3DXAA 3FT4B 2MQCA 5I2IB 5CP3A 4HAGA 4JHAL 2VLJE 4Y5YA 5CKAA 5JW3L 2BOBB 1P5VA 3G9AB 2FJFB 1CXLA 3QI9B 1FE8L 3CFDB 4H8WL 4OZHB 3RY4A 4PJFF 4QTHA 5C6WH 1X4XA 3WFCL 5IESH 4DGIL 4UIMB 3F5WB 1XGUB 4XGZB 4M6MH 3IDYB 3QIWA 3TA3A 2CJUL 3QQ9C 1XGYL 3ESUF 4P3DB 4Z7QE 1JWMA 3UZVB 1CIUA 1I75A 2X1WL 3W2DL 4IDJH 2IGFH 1YN7B 1ZS8A 4D9RE 1JV5A 1F6FB 2IG2L 3VWKA 4OIAA 1EEYA 4ZODA 5BXFA 1CICC 3GIZH 2VXQH 2LFGA 4G80B 4HPOH 4GUPB 3FFDB 4K23H 4QHUB 1MVFA 4XVJH 1YPZF 1XGRB 2H2SD 1RUKH 3ROLA 3V6OC 3UC0H 1UC6A 2XRAH 2BSED 2VSCA 5FYJE 4YH6A 1O7VA 2IWGA 4UILL 1I7TB 1NCWH 4NIKB 5F6HJ 5HGHB 1F3DH 1F6AA 3D69B 5KOVC 1N6UA 1CFQB 4XPHL 5IWLA 4NOFA 3T0EE 5EO0A 2BVQB 4M61A 4Y4FA 1IC4L 4LBEA 1L6ZA 5D2LE 5JXEA 2VXUL 3LAFA 5JZ7D 1MCKA 5HI4C 2X70B 3SGDI 2YBRA 5F8RC 4FQ1L 2ADFL 1NEZG 4PRPE 4B53A 4CMHC 1U8JA 2CR3A 1IQDA 5L8KB 3J8F7 2HMIC 4FQLL 3MNZA 3D3VE 2NY6C 3MMEB 3O4LA 1OP3H 3WEXA 5M95B 4ODXA 2GK0A 1F4HA 3BQUB 1JK8B 1T4KB 4PJ9D 3K8LA 5D5MA 4X5LA 3N9GL 1UCTA 1EA9C 2FL5A 3OAZH 4WEBH 3U0WH 3FMGH 2GTWB 3AMLA 3H7BA 3BUYA 4J3WA 4U33A 2WBJC 2LVCA 5T5FL 4J7RA 3BD5A 2H9GB 2ED7A 4NBYB 1JHLL 2CIKA 2D7NA 3VFVB 1BBDH 4LLUA 4X6FB 3VI3E 2OK0H 2HN7A 3PGDA 2YKLH 3HN3A 4LPXA 3M07A 5HYQB 1I1FB 1TENA 2X4OA 3RVXC 3CNKA 3V0WH 4F15C 3BYYA 1T22A 1YEIL 5J6HA 1A47A 2DQHL 3GGWA 3ULUD 1AKJB 5H2BB 2R0ZL 3ES6A 3HE7C 1A7NL 4G6KL 5FYKU 4G6ML 1LP9A 4P57B 3AC0A 5JHLL 3ROOA 2MCPH 1F11B 5DVKA 5B3JE 2PO6B 5D7JB 3GMLB 2W65B 2QHRL 4NGHH 4ZQKB 1J88A 4YHYB 1NMCB 2IQAB 1NAMA 2AV1B 3C09B 5IJVA 2V9TA 2J8UE 5KAQG 2E7LA 2AW2A 4P2RB 2A83A 2XNAA 3QG7L 1FNLA 1TXKA 4Y19A 4QHKJ 4MXQD 5MI0C 1TTGA 1IMHC 5BJTA 2AXGA 2VLRB 4C56B 1CR9H 3MFFB 5I71B 2FLBT 3QRGH 5IW3A 4LKXB 5TGBB 5DWUL 3ZYZA 4MJ6A 4XCNA 2X41A 5TE7H 2VLJA 3BPNB 1ZSDB 4JRXD 5SWZD 3TYFB 5KVMC 4PB9L 3EYSH 3HB3D 3T77B 3GMQB 2P5EA 2AQ1A 3EDJA 1G0DA 4TRPL 1D5IL 1A3QA 1KENL 5JA9A 1QYGL 5CJOH 2CKBA 4E0RB 4JPIA 2LU3A 3BDYH 1FV1B 3QDGE 3L5XL 1QRKA 5AWNL 1AGEA 3LQAL 4KKAD 3WJJA 4OI9A 1V7ML 4X9FA 1ROWA 1G7LB 1EO8H 1LK2A 3UBXI 1VFBB 4EN3C 4YBQC 1JPGB 1A7BA 2IPTL 5FUCC 4JFXB 3RGVD 3VE0A 3D0VB 4OFKA 1WAAA 1A6ZB 5FCUH 5JIIA 5MERA 1I9EA 3BKML 3PQYD 3GI8L 4U6HA 5E08L 3MLWH 4K3DL 1HHGB 1KF9B 3DMMC 4LCIL 2VDOL 5IIEB 2RFXB 1OGTB 3MRCA 5F1SA 4YXHH 1DUYB 1H9VA 2FR4A 2EDXA 2EKSB 1NDGB 4N0CC 1QSZA 1A4KA 2VJXA 2CRMA 1HIML 4TSAL 4LVHC 5J3HC 5DD1L 5FYKH 1DEEB 3LQAC 1QR4A 4M3JA 4PJIB 3SDYH 2EC9U 1G6RA 4P4KD 1W72A 1NCTA 3HE6C 2EYTB 4JKMA 4M1CD 5GRYA 4JN1L 4HJGB 3I85A 5DD6A 1I9IH 3BIKB 4PY8J 4PJHF 3BEVB 4KK8D 4K94H 1ZV5A 4JZOA 3D3VA 3SE8L 1T0NA 1VEMA 5FF6A 5IR1A 4YHMH 3G08B 4KY1H 2ZUQC 4ELME 3BPCA 4QRSA 4X7FC 4TTGA 5MEQA 2JJUA 5E5MB 5CINL 4J3TA 3H3PH 1GGTA 4H88L 1F3RB 4GG6B 4YBHA 1S9XB 2QBWA 4WW1A 4HGMA 5GGQH 3EO1B 5EOTA 2PYEE 3ARBC 3MRJB 5FA3A 5DD5H 3TBTB 5FKPA 3DUUA 1PSKH 1DFBL 3IAQA 3MBEC 4YO0B 2GFBA 3EFFA 5MHSD 2GI7A 2NX5D 3V7MA 5H35A 2MPAH 3LVEA 3TO4A 1OWRM 4AG4H 3SJVD 4MA8H 2HWZL 2YSSA 5B22A 3T08A 3FQTA 5EOCJ 2DM7A 4Z7VA 4AYFA 1BVLA 4QXWA 2AGJH 1MIEH 4LLDA 1JYXA 3C5JB 3TIDB 5T5NF 4Y5XA 4H26B 2ICWB 5CILL 1FL3A 2Y9RT 4JFQA 5CWSA 4DGVH 1PY9A 2BOCB 2XQYG 5CZKA 2R29L 4S1DC 3PGCB 3HR5A 4KXZI 3P4NA 5GS0C 3O0RH 4ZO6A 4LPWA 3P4LA 3BGAA 1G0XA 1JGDA 1GSMA 1R3JB 2UV3A 3O8XC 4P2OA 4U1KB 3NA9L 3G5VA 2CLZA 1PY4A 2EDNA 2AABL 2F53E 3IAGC 5EH1A 5MHSE 4D3CL 4L4VB 1FYTD 2YR3A 2D7TL 1A2YA 1NH6A 1FORH 3QFJB 5IBLD 2WINB 1P5UA 2C1PB 2YUWA 2OLDA 5E56A 2R1XA 3LV3A 3ZDXE 5MENE 2CDGB 1P84J 4MVBD 1FN4B 1BECA 1XH3A 3LIZL 4NDMA 1BPVA 4G7YH 3G6JF 2XPGA 5A16A 2FEDD 2HFGH 1R3HA 4TQEL 2B8OT 3CZJA 4LIQE 2XZAL 2ERJC 1UXSB 3D18A 3EDEA 4JPKH 4OLXH 3TF7C 1ZTXH 3TNMA 4QRPD 2YPVH 4HWBA 5C1MB 2JF1A 4JY4A 2K1MA 4NZTL 5ESVB 4GS7C 2Z8RA 2G60H 2WQ8A 2VR5A 5DC0A 3H9YA 5DC9B 3IU4H 1IGTA 1E4XH 2HTLC 1EMTL 3AROA 4X7DC 1ZAGA 1ETZB 4FQXA 4JM2A 4KUCF 3SDDC 5HD8D 4OZGF 4LU5L 4PJ7B 1WC7A 2PF6A 4WFGD 1MREH 1BM3L 1QRNE 3RAJL 2D03H 4WFED 1G7HA 2FX9H 3MRIB 4X7SH 25C8L 4R97C 3WHE1 4ZPVA 1YNKH 2NW3B 4PGJA 4LGSB 1BFVL 3I6GA 1KG0B 1ONQA 4YHKH 2H1PL 1TQBC 5DEGB 4IMLB 1QUNA 1WZMA 3NBNA 1N5AB 1D5XB 3RVTC 1RVFL 5I1JL 4FFZH 3BSZH 4OCWL 5SWZA 5DMIL 3UTPD 4MZ2A 4P23C 4RQQB 3M17A 1HOCB 1XAUA 1KULA 3PWLB 1U95B 1ZWIA 2P7TA 3HFMH 1AGFA 1VGKB 4MB4A 4Y16D 4PLNC 5DO2C 3VMPA 5SV3A 1I85A 1FRGH 2J5LC 4ONFL 5DFWH 4U1JB 2WLYA 5E8EA 4HC1H 4XX1G 1IGFL 2QQLH 5AYQA 3WXWL 1D9KA 3P9MB 1UM5H 5ADOL 5D7IB 4UINH 1BP3B 5EUOF 5F96H 1QNZH 1D7FA 3F7VB 5DQJA 4R7NA 2R8SL 4APQA 1LO3H 2GITB 4U0RC 2R2CA 1KJ2B 2BY1A 4PJEE 1KCVL 4NM8L 2EYSA 3MNVA 1UXWB 3VWJC 3WD5H 3UJTL 3PQYA 4G6JL 2VERN 1DQML 1I1RA 4HIXH 4OLYL 1RZGA 4NQTA 4YIQB 2QQNL 5C07D 4QRUB 1UZ6E 1N3NB 1WBXB 1QSFE 5DMJB 4B0MM 1RPQA 2CDFA 3BH9A 5HHNA 3WLWC 1MCLA 1R3LB 2APBA 4D0BB 1V3MA 4ELMA 4POZD 3JSSA 2Z31D 4M4RA 5DDHB 3RPIB 1AH1A 3TBWA 5HYSA 1GOGA 1ORSA 3BKCH 4JVWA 1HILA 1SEBA 1NMBL 4LMQI 2AI0H 2DRUA 2XY1A 1OOAA 1QPPA 3FONB 4LSPH 4XCCH 5L88H 2BFVH 5JMRA 3WNPA 4P4KA 1R5VB 3P11L 4G42A 4W4NA 4L3CA 1CGSL 2P44B 4E41D 1P1ZB 4JAMB 1U3HB 2UYLB 1CXFA 1EHNA 5BW7A 4LLAA 3RZCB 4UOW1 4JLRA 3ARGB 3CMGA 4G3YH 3T3PE 4PJXB 1KJ3L 1HHJA 5ILTH 2X4NB 4LASH 2WWMC 1GHFL 1X9QA 1L0XA 3HLAA 4YDVA 4JO3H 4UMGA 1YY9C 4Y4KC 4LPUA 3TWCL 1CBVH 3MCKA 4NM4H 1E4KA 4LVOB 1ZT1B 4BKLB 2QKIB 2E7MA 3S8WA 3GK8L 3HNTH 4QOKB 3CSYA 2F19L 4F57H 3W9DA 2ZNWA 4NHCL 5CJ8A 2BVEA 2ZCKH 3T0DA 5I1AB 5CP7A 4HIJB 5IEHB 1CS6A 4NKIH 1A6VL 2WP3O 5CUSH 1MHCA 2Z93B 3SJVA 1I8MA 1GYAA 3U36B 3OKKB 1NFDA 1FP5A 2OL3B 5E2JA 2D3VA 1E28B 2UZIH 1QBAA 3B2VH 4UTBH 3QJFB 3O9WC 3HC3L 2YEZB 1KIPB 4U1MA 4WU7B 3L95A 3B3IB 2Y5TB 1RZ7H 5J1AB 5JO5A 3NPZB 3L5HA 1CE1H 1TLKA 2FX8L 4PYHA 4D94A 4O5LL 3MUZ1 1ITBB 1VERA 4N5UA 3VG0H 3QEHA 2IEPA 3O6KL 5JOPE 2HJFA 3RWGB 2CSPA 2A77H 5CEZE 3OKLA 1RV6X 1FYTA 3SCMD 4DQOH 3ZDZF 1CGTA 4BUHA 3WL9A 2CXKA 3LDBC 4JHWL 3U0TA 3P4OA 4BA8A 4GKSB 5GIRB 2P48B 5EOCH 4YDKL 3MRFB 5IBTL 1I7ZB 5HYJB 1S7QA 4U1HA 3FQNB 4NN6B 1RIVL 5D1QD 4PJBF 5F1OB 5GGTH 5KS9E 4A6YL 4JFPA 4QRPA 5K9KB 2GJ6D 4GLRI 4HKJA 4QT5A 3UPRB 4WUUB 4U6VH 1NANH 3TNNA 1OSZA 2WWKT 2VXVL 3LMJL 1JWUB 2A6DA 2QQQA 1DBAH 3AM8A 2BY2A 1NGXB 1MEXL 4FFWC 1RU9H 2DQJH 2K9UA 3X13B 5AAWA 3TPKA 4KUZH 1NC2B 1SBSL 2F15A 4K3EH 1CD8A 1Q94A 2C4FT 4KJPD 1C16A 1N0LA 4X7TA 1WSST 2H26B 2WMPA 3MJ9L 4TVPH 1T5WB 5TQ2L 4LAQH 1I7RB 3A67L 4AEFA 2Z91B 3ILPA 1ADQL 3EO0A 4XXCC 1HYRC 1FGVH 4K3JH 3BEWA 2W0LA 4M6NH 1JN6A 5T3XE 1HI6A 1J8HD 1CD9B 3X17A 2A9ML 5EOQL 4IJ3C 3WDHA 2BNRD 2R4SL 1YMMD 5DGQA 5T1MA 3GSOA 1AD0B 1QSEE 1B0RB 2H8PB 3QFDB 4Q6IB 1J1XL 3MROB 5FDWA 5I8CB 2R0WL 3D85B 1J05A 5C8JB 2AJUH 2COQA 4KI5D 4P46B 3DRQA 2ZOKB 4PS4H 1AFVH 5L2KB 4Y16A 1BFOB 5BS0B 3FOLB 4PRPB 4XMLH 4W6WB 3BE1L 4DEPC 4JHZA 1LO2H 3T0AA 3GJEB 3VGFA 1UM6H 4HWEH 3QUMA 5E2VH 3EHBC 2FATL 4A2LA 4S0SD 3WMSA 4RMWA 4P5TB 1WWBX 1D6EA 1ORQA 3B8YA 2ADJA 4W70A 5I18L 2EE6A 4M1DH 3IXTB 2ADIA 2FWOB 2H32B 4QHNA 5TPWH 3O11A 1XZ0B 5B39B 5DJ8A 3NFPA 1HEZA 5FM4A 3ULSA 1NCCL 2IAND 1V7NH 5JHDB 3OL2A 3C87A 2CPCA 4XVTH 4X5XB 4EI5D 3BGFC 4JJ5A 2EIDA 1NBYB 3RPKA 4NKOA 4Q0XH 1K5NA 1MHEA 3L9RB 3UMTA 1KIQB 4UT9L 1YMHB 5BZWA 2Z31A 1MAKA 3SKNB 3MJ8A 3QIUA 2ZP0T 3EYFA 1XCQA 3RWFA 4ZSOB 1DUZA 1YEKH 2MOVA 3E1F1 5JLZB 4NWTH 5HJ3B 4MS8C 4DW2H 1F42A 4H25B 3LKPB 4X6DB 1NBZB 5BO1L 4HUXB 3L3HA 3Q6GH 3QUYC 5F3BB 1JF5A 5DK2A 1RZJC 5DUMH 4OD2B 4NHUB 1LEGB 3O6FB 5DHVH 2O26U 4HW6A 1GVIA 4C55A 2E5EA 3V4UH 5SWQB 4E5XB 1MY5A 2NY4B 3MGTA 1IBGH 2A6KB 2Q8BL 5JORA 3RZWA 1LDPL 5E03A 5M7QA 4I3GA 1FZMB 3T04D 2QLVB 3H9SB 3RDTA 1ACZA 5D93B 1AGDB 5HY9A 1KGCD 1X7QA 5BQ7B 4PJGE 2J8UB 1RHHB 1RIUH 3KHQA 1RUPL 4GAJH 5F7MC 1P2CB 1H5BA 4YFEA 4KKNA 5GZNC 1JTPA 1P6AB 1G6VK 1Z9MA 4EOWH 4F8QA 4GO6B 1EUUA 4LRNH 1U3JA 3ESVF 3HMXA 1U8IA 1PKOA 1YJDL 4WO4B 1PZUB 4D2NA 4NC0B 4HCRA 4UT6H 1XGTB 5KTEH 1G84A 3MJ7A 3KXFB 5I8KL 3KPNA 2EKJA 1BBJB 3IDJA 4PRBA 5KVEH 3KYKH 4AIOA 4I18A 4N9GA 3IXAA 3MRNB 5C86A 4FP8L 2ATKB 4HH9A 1DL7L 1AO7D 4UZGA 4S1RH 5CJXA 1WBYA 3QDGB 1QFOA 5HYSG 1CL7H 4JO4L 4U6XB 3RHWK 5ECJE 5GRZA 1BOYA 5LGHH 1GL4B 4HT1H 4N0FB 3KYNA 3HNSL 4IIQC 4NZRH 5CMAB 3HZKB 4M7LH 1F2QA 3LEYL 4PG9B 2CK0H 3X14B 3SCMA 2OL3H 2FNBA 1YJDC 4WVRA 4FQCH 3CIQA 2PCPA 5D2NE 4OCXL 4X5WB 3K2UH 5FUZH 5JXAH 2VDLL 2X89D 5E4EC 3INUL 3EUUA 2X4TB 5DMGC 5D1QA 5D9SB 4D8PA 2GJ6A 4ZPTB 3SDXE 3ULVE 4XP5H 1KCUH 4OQ1A 4XNUH 5FB8A 1H3TA 5HHOD 3LKQB 1LGVA 3GSXB 5C08D 3S35L 2AAVA 3KPSD 2P8MA 5D1XB 3FQUB 3GRWA 2ADGA 2DBJA 1I8IA 3DVNA 1RD6A 5C09D 4KJQD 3PABB 3NZHL 4WDIA 4KRPB 5DJ2B 1Z3GL 2DWEB 5TDPA 1OTUC 4WW2F 4ZTOH 1JGEB 3GSNL 4TPRH 5E1AA 3MLZL 3FQWA 5TJWK 4H5SA 3VXTB 3VXUD 2V5RA 3GB7A 2VDRH 4OKVB 5KVDH 2HTKC 4GBXB 1J8HA 1WCBB 3JWDH 1I3GL 2R2EB 5ADPL 5TDOA 1YMMA 3IKCB 2EEDA 4ZO8A 1ZHLA 2CRIA 4PV8B 4L8CA 2E9WA 2P5WB 2IQ9H 2X9WA 3I50H 1WTGT 4N0YL 2VN7A 4JPVH 2CLVB 4YX2H 1M6OB 4ORGB 4U6YB 3ARPA 3SGEI 2VL4A 1FL5B 4HKXA 3AB0B 4LLMA 4D0CB 3UROR 1RIHL 3QG6A 1OGAB 4HD9A 3RU8H 3NABL 1R5WB 2R69H 1E4WL 1SEQL 1TZHB 1F3JA 4MJ2A 3UC0L 1MVUA 4J3OC 3ARDB 4XCYB 1MWAA 1HWGB 3QULB 1T1XB 4BFIB 4YZFF 5D71L 5IHZA 1DP0A 1WJ3A 3HUJB 3ZT6A 3FT2B 2D7OA 3FO0H 5IVXF 4F7TB 2YPKB 5GJTH 2EDKA 1UYWL 5ITBH 2EXYD 4D9LH 4YFDB 1YN6A 3CAFA 2ZG1A 1I8LA 2ARJA 3DV6B 3MBXL 2F53B 4EI5A 4BFBD 1KB9J 1ZA3A 2AXJA 4X80H 2BZDA 3U9UB 4WHYH 3Q1SL 3FB6B 5I73B 3NAAH 3V6OE 4OUUB 3S36H 2HT3C 4LSTL 5C0GB 2Q7YA 2G5BB 4FQJH 2NXZB 2JIXD 2H32H 4QO1A 2Z4QB 1H15A 1IEHA 3GHBL 3IU3A 5CGMA 1MY7A 3QCUH 1AGBB 4HKZB 2XTLA 4MSWB 5C2UB 4PUBL 1NSNL 4YHZH 3FQRA 5D8JH 4G8FA 1G9MH 3R1GH 4KV5E 5LCVH 2LTQC 3M45A 4TSBL 3ZTJH 5IM7A 8FABB 3VW3L 4YNYA 3MLVH 4NQDE 3FO2B 4RAUB 5ACZA 1JZ8A 2CLRA 1YNTB 4MD4B 4R0LC 2HLAA 1XF3B 4PRNA 5F21B 1BBDL 4CJ0A 4PRAB 1ZKAA 3P4MB 3F7YB 4IDLA 3GBMH 4LNRA 4NYLA 3CDFA 4XPGL 4G8GD 3H9HA 2XTJD 1S9WA 2MHAA 5HGDA 1QRNB 2ID5A 2DTMH 2NY7H 3CFKB 3TYGL 5AZEH 4JDTH 4M62H 1YYMH 4Q2ZB 3H0TA 4KC3B 1ED3A 2VQ1B 3MRQA 4X4ZA 1CXIA 4C83B 1JUFA 2DL2A 5BZDB 1T2JA 1BWMA 1T5XB 3BP4B 3U7AA 5I1GH 1C1EL 4F7EB 4LSVL 1A7QH 2DDQL 1RJCA 3MXWH 4OD1H 3VXQB 2BCKB 3IVKB 2DM4A 2FH8A 4KPHH 1H3VA 1YY8B 3THMH 4XWOC 3HZYB 4C4KT 4YXKH 3L3KA 4Q97A 4M7ZB 2W60B 4X98A 1EUTA 4JR9L 1ES0B 3TN0B 4ZNEA 1NC4A 1AO7A 1N6QL 1VB9A 3VFGH 4JO2H 5E5UB 1TIUA 1LNUA 3SDXA 4LSRL 3QRGL 2J8HA 3C5ZC 4DKFL 4MAYC 4BJLA 3MR9A 5C2BH 3H7LA 3SKOB 1FZJB 3GZKA 4G8IA 4XCFH 3V2AR 4EEEA 1WK0A 4PJEB 4I2XE 1GRWA 4CVZA 5E8OB 5IFHL 1ZA6A 4HIHA 1BFTA 3IDGA 1VACB 2EZ0C 4HS8L 4I0PC 4LCUA 1YNLL 2HJKA 4KVCL 1N0XH 3CDGB 2DTSA 3C60C 1QSFB 2X89A 3O3EB 3O45B 1L7IH 4NUGL 3R8QA 1HHHA 3BUTA 4XPTH 5E6ZA 3WV0A 5ETUB 1FVDB 5F9JA 1UA6H 2HFFA 2XWBA 5DT1L 1XT5A 2BDNH 3MUJA 2BXZA 1RURH 3KPRE 2ZCHL 2LQRA 3D39D 4YWGH 1NCBH 4R2GB 5HHOA 2DMBA 1CGWA 1YEGH 4MX7A 2AK4D 3G9VA 5FCUL 4GJTB 5C08A 4QTIH 3KPSA 4WV1C 4BSVB 3VGDA 3O3AB 1FLTX 3BWAA 3MLWL 5TDNB 4YE4H 4OI7A 2AJSH 5TF1H 4I1NB 3MYJA 2X4SA 2VDNL 3FT3B 3WIFA 4RIRB 5FKAB 4PJFA 3RWCA 3WHXB 4OQTA 1HQ4A 1N4XH 1M71A 1PFCA 3O3BA 1X5KA 2XQYK 4UTAL 5DUPL 1BIIB 4PGBA 1DDHA 5FYKL 3CXHJ 5INCB 3VXUA 4F7PA 1T0MA 2V17L 3LSOB 1GGBL 3UYRH 5GSRA 3ZZ1A 3LEXB 5FUCE 4XC3H 3CZFA 4F7CB 3HE6D 1CICA 1K4CB 1U2CA 2P45B 2FJGB 3MLUL 3LD8C 3CVIH 2YA1A 3R0NA 1B0GB 4HUVA 3DGCR 3RUGF 3HG1D 4R3SA 1ZGLM 3NCYS 3T4YB 1U91B 3WFBH 5DJCA 3OZ9H 2XQBH 2MMXA 1QPXA 4KY1L 5LAXA 4EVNA 1YPZA 1NGQL 1PD6A 3ZKMC 3HI5H 1MCDA 4LMQE 3H3PL 2NXYC 2BERA 4OCRL 2O5YL 5T1KB 2OJEB 2BRQA 4HFUL 2FH6A 3WIIH 3EDFA 4Y5VB 3BHBB 1RMFL 3ARYA 3C2AL 4ZTPH 3HS0B 2AEQH 2WLZA 3HZMA 3QO1A 4QGYA 2BVPA 1FGNL 3QDME 3QI9C 1C5DA 1MOEA 3MNWA 5IMOA 1AQKH 5F1NB 3ZL4L 1MH5B 3F7PC 1JNHB 5IFAL 4F80A 1PG7W 4S1QL 2X4PB 5EBWB 5HSFA 4K94C 2HT2D 2G5RA 3V6FA 5FA4A 3ARWA 4P5KB 2NY3D 4AT6A 2NR6C 3OJDB 2JIXA 1KEGL 2FIKA 3DIFA 1IAOB 4WI3A 5FO8A 3CH1A 2PKDA 2A0LD 4M00A 1CF8H 4M8QA 5T3ZH 3TIEA 3VH8A 2L0DA 4X6CE 3O6LL 4U1NB 2N4IA 2AKRB 4LRIC 3RX8A 5KS9B 2X4UA 1ZLWH 4KDVA 5E2TL 4ELKA 2WBJA 2JJSC 1KCRH 3QNXA 3GJFA 4FXLA 3HCVA 3VXPB 3IFOB 4CVWA 4OZFB 1YEEH 1VGEH 3HI6H 4JFZL 4HGKC 4GMTH 2W0KA 5A2FA 5HDQH 4NC1C 1CFVL 1MNUH 1U8KB 3G5YB 2AJVH 3TJEH 4M6OH 1AY1H 4ODTL 1J7VR 2DQDH 4G8GA 4XBPA 4PJCE 4NRZB 2QSQA 4GAYA 5DR5L 2ZPKL 3VU2A 1AP2B 3HE7A 4JJHA 4HUMB 4DN4L 2IALB 3S6CA 4W68A 3C2SA 2IH3A 1MRFH 2HTLD 4OT1L 1WISA 3IU4L 5CBEA 1E4XL 2FEEL 3CC5A 3CFBB 2JB5L 5D70L 1RZFH 3KLAA 4XP1H 3IF1A 4OM1H 1QSEB 1MCWM 2AEPL 1ZT7B 5TQ0H 5F9OH 5EUKA 1Y0LA 4OZ4B 4NQSB 3RHWF 3CDYA 4NRYA 2OR7A 3BQUC 4ZOCA 3SQBA 1KPUB 1MREL 3DHJA 1EIBA 1NGWA 3BFOA 3S98A 3WSQH 3BRFA 4ZD3L 3PWNA 2NY2B 1PG7H 5J1SC 3Q3GB 3VFWA 4Q9RL 4YHKL 2J88L 3KPRA 3BH8A 3STBA 1DQDH 2UWEB 2ZSWA 4QF1A 3O81A 1AE6L 3I75B 3QPXH 4P23D 1DANU 4L9LB 4NSKB 1LD9A 4ONHB 4JKPH 4XC1H 5BCAA 5C6PB 5ESAA 2PXYB 2V2TA 3OB0H 4MNHA 1FRGL 3EO9L 1OM3H 3OSKA 3Q5OA 4HC1L 5D6CB 1HKLL 2QQLL 1UM5L 2UZYB 3KYAA 3OR7B 4OZIB 3G6AB 1SYSB 5K59E 1T6VN 4NKMA 1NL0L 3ALWA 4GRLD 3ET9F 2DQCH 1UACH 2E7HA 2G9HA 1HYSD 4PJDF 2PO6C 5D7JC 5ACLA 3VWJD 5D7SH 3ZYIA 3IYLW 3UZQA 2AK4A 4PV9B 5HHMB 2A1WL 1A14L 2DD8H 4FRWA 1CG9B 1ACYL 5ENWB 1NMCC 3C09C 3DMMA 5KSUA 4QHLB 2J4WH 3BRGC 2DLEA 3DI2B 4HKBB 4KJYA 1EERB 3P40A 5EIVA 4CU8A 5I71C 4Z95H 3AXLB 2DWDB 2AI0L 4L1HA 4KTDH 1S7UB 1Q0YL 4X6BB 1JF1A 5GGUB 4XCCL 4DKDC 3JUZA 1WZ1H 2VLKE 2NNAA 4YHNA 3QXTA 1QLEL 3LS4L 4UV4H 2YC1B 2ZOLA 3QEGL 3HE6A 3N1GC 4FZ8H 4OFDA 4R4FL 5FHAH 2EIBA 4OGZA 3OKOB 4GMSH 3JZ7A 3QUZC 2GHWB 4HIIB 3F7RA 3CU7A 4HDIA 4Y2DB 3DECA 3VXNB 1A1OA 3HG1A 4TOYH 2G75B 3BW9B 5I30L 1RJYB 3PL6D 4FQPA 4JVPA 1CLOL 4MJIE 1QEWB 3CCHB 4Y4KD 3JTTA 3NCYP 4XMPH 4JO3L 1A3LH 5DA4A 4Z9KB 4LPVA 3FZUC 4PJ5D 5B8CB 1DN0B 1F4AA 3L3GA 1OAKH 4X6CA 2HFEA 4YPGB 3VFRB 3ARBA 4NPYB 5ICXA 4PJ8B 4O2FB 1WQVT 1KN4H 2EDHA 3KS0H 2WW8A 5E99H 4F57L 4NZUL 5LBSH 1REIA 5MEOB 3U6RB 4MWFB 4Z7OF 2AJZB 2EDQA 5CSZB 4ALAL 5GS2D 3S88L 4A2MA 5CUSL 1ERNA 2JCCB 3SKMB 3I6LD 1F4XH 3HA0A 3W82A 2D7QA 5CFHA 2Y25A 3PWPE 4G6AD 4PJIF 2V2WB 5ESQA 1A0QH 2EC8A 4M4PA 2EH7L 1J18A 3O9WD 4UTBL 1U8HB 5D2NB 4M5YH 1MFDH 1KPVB 5CEYB 1T89C 5K9JH 3L3IB 4GW5A 3ZE1E 5GSVA 2XWTA 3O8XA 4WJ5B 3ZKND 1MCCA 5E7BA 3U83A 3VFMA 5FM5M 3HZVB 4G8EB 2MKWA 5I1HH 2BNQE 1Y6MR 2B4CL 4BH7A 3DO7A 5GXBB 4LAJH 2JTDA 3IJYB 2BVUA 3B2UD 2VDQH 1YYLL 1MCRA 4AL8H 5DEZA 5HVGB 4PRID 4OGYL 4AENB 4HUWA 5HPMB 2XA8L 1RUQH 1AJ7L 3MLYL 5B3NA 4DZBA 4N0UB 1HH6B 3QXAB 5JW4R 3MA9H 5CD5D 1MFEH 2YXMA 1MJJA 5EOCL 1DQQB 3V95A 1MRCH 1TETH 3W81A 1U3ZA 2HLFD 1JWMB 1S7SA 3K80A 2QADB 4EIGB 1DVFD 5GGTL 5GGSA 1S3KL 1IEBA 4H1LB 1JV5B 4DK3A 3PUCA 3VWKB 1F90H 4XNMB 4XT1C 1U8PA 2R0KH 4OCSH 3T0VA 4AJ0A 4U6VL 1EEYB 3BT2L 1CGVA 3KYOA 5DRNA 1SY6H 3STLB 1OL0A 3RRQA 2W38A 1G7MB 4NQCB 4OZFH 3OAYK 1DBAL 1EAPB 3VXRD 1RU9L 3FL7A 3SDDA 1RK0B 1S7XA 3O6MH 1MI5D 1W8OA 2FD6H 2FZ3B 4KUZL 5DRWB 5KG9A 1C08A 1G0YR 1CFTA 3CX5J 2AJ3B 3ROLB 3H3BC 1J1PH 4ODSL 2IFFH 5F3HA 1C8PA 1DEDA 3MV8E 4M7JH 4OZGA 2NY1B 4CN6A 4PGDB 2DLGA 2X40A 1CVRA 5IB5B 2QSCH 3PWVA 2OSLA 2YUXA 1W0VA 2IADA 4NO2B 2XG5A 4HSQA 2VC2H 1ND0B 2VZ3A 1IGCL 3GNMH 4FFVC 3H8NA 4PY7A 4QRTB 3VH8G 1FVCB 1HNFA 4YC2B 2YBRB 1CXKA 3MRMB 3Q2CA 1U8LA 2VH5H 4J1UB 5DFTA 5ID1B 5JIPA 4IRJD 4P23A 4DUWA 4AIXA 1F4YH 3LPGA 4HIEA 3VFOB 1E4XI 5IP4A 1FFQA 5CHNB 1A02N 3LS5L 5TE6H 3VFSA 3SDAD 3GM8A 3GKWH 4Y4HB 1J1OL 1IM3A 4DVRH 1JYVA 2FB4H 2VABB 2EYRA 2E6QA 2ORBH 4IRZL 3KNBA 5D5MB 5EO1B 2OTPA 4EDWL 4OB5L 4QKXB 5ANME 4UIKH 4WY7L 5F7LB 4GRLA 2HVJB 5TPWL 4F3FA 4LSSH 4ZMAT 4PJ7F 1CCZA 1CWVA 4HBCH 3VWJA 4F37F 1V7NL 3MLXH 3QT2A 4IOFD 5CGYC 4XVTL 5F97E 5FOBB 2EC9T 3V52H 5DQ9B 2CIKB 4NQDB 1ZLSL 4WCYL 4LLUB 1JGLH 1FC2D 4JY5H 1IAIM 1MCEA 2HN7B 2W92A 4MJIA 1BGXH 3LH2H 5HDBF 4MQXD 2H2PD 5FO7B 4O9HL 2NY6B 1TCRA 5C92A 3ECBB 4XP9L 4KAQH 1KV3A 1U93B 3OXSB 4J6RL 1KJ2L 2C3VA 4G6FB 3GGWB 3QNZA 4QLRA 1WWWX 4JZNB 3IDIA 2ARJQ 3S5LA 4R90H 5EZLA 5FDYA 1JNJA 4PREA 5E9DB 1G1CA 2YUVA 5DUML 2IH1A 3GSQB 3ZE0F 3QPQC 3PNWB 1URLA 5ERWA 3WFDH 4HK3N 1A22B 3OKMA 1IGYA 3V4UL 1MAML 5ALCH 1W0YT 4M5ZH 4MD5A 1IBGL 2C26A 1SVZA 2NZIA 3PWPA 3PL6A 5J57B 1NAMB 5DXWA 1CIDA 4Y4KA 4FN0A 1MLBA 1T21B 4JFYB 2HRPL 3T2NH 3EDKA 2ZUXA 4EDXB 4ZS6C 4X99B 1OPGH 4K7FA 2C3WA 3VI4E 1RIUL 2RGSA 1UWXH 1I1AD 1ZHNB 1XGPB 1DE4A 4GAJL 3HTLX 4JFDD 1BZ9B 4WTZG 4LL9A 3LKRB 1F5WA 3U7YH 2GJZB 2EIEA 3U4EB 3GSWA 4XCNB 4XBGA 4JN2A 4V1DE 3M8OH 5DK3A 1RUAH 3MOAH 43CAA 5HGBA 5KSVB 1U58B 2P5EB 3GIVA 1TZGL 3NIFF 3N0PB 1UH4A 3ARFD 3QUKA 3ZDYF 4GQPH 3O2WH 4MYWB 1KJMB 5E8PB 4I2XB 3RBGA 3X3GH 1NBVH 2VAAA 2APWA 5BRZB 3TBVA 3O9WA 4ZYKA 5KVEL 3GHEH 3KYKL 4MLSA 1TJHL 1AQDA 3OGCA 3NCCB 4F9PA 4NO5B 4MNGE 1CT8B 1I3RA 3RQ3A 1CL7L 3PWUA 1FZOB 3IDMA 4AEIH 1U3HC 3GI9H 2H41A 3ZSTA 4HG4J 5EZJB 3RZCC 3C6LB 1CFSB 3MUHL 5T33H 2B1AL 4Y1AD 3ARGC 3WS3A 5E2UL 2P8LB 1KYOK 2CK0L 1JNLH 4ZFOB 1A6AB 4WI9A 4HS3B 2BNUA 3RL1A 5F7FA 1DLHB 4PLKD 3MRCB 1I8KA 3MCG1 3V4PH 2W9EL 3KGRA 3BRDA 4LVOC 1N2RA 1U8OA 3B5HA 4PY8I 5DMGD 1MRDL 5DLML 1DVFA 4XVSH 5CP3H 4KZEH 1BHGA 2O5XL 4UDUB 4R4NC 2I24N 4PJBA 3GBNH 1UM4L 3QIBC 4GW4B 4P99A 4JPWH 4XNUL 2BVOA 4Z77A 2CDEB 4R96A 1IAIL 4LEOA 3K4AA 3VXRA 2BJML 5DD6B 3QQ4A 4LLQB 4Q7DA 4XB8A 4L8BA 2BMKB 2ICWI 3QCTL 5LQBH 2YN5A 1J8KA 2QL1A 4QYOB 3U0PA 2ICCA 3MLPA 5FGCE 5JOFA 3EOAA 3UJJH 4OM0H 1UJ3B 3BPCB 4AM0A 1T1WB 4QRSB 3BZEB 3SKUD 2HAZA 4H1LH 5DK0B 2NY5L 1Q0XH 4WTWA 1QTYT 4TPRL 4C57C 4HS6A 1AHWA 4P3WA 4OJFH 3U7WH 1F4WH 2Q3ZA 5F88B 3CD4A 1C12B 5T5NG 4A6YA 4AH2A 1INEL 4LVHB 4M43L 1HN1A 1MSPA 5HDOA 1GCFA 3DUUB 5C0ND 2X1QA 3BKJH 5I6XC 1UWGH 5DJ0A 5KSBB 2DQFA 2RCSH 1NANI 3I50L 2LVEA 5H35B 4IRJA 1CDCA 5L6YL 1EO5A 3FQTB 4Z7VB 1LDSA 4LARL 1JPTL 3QDMB 1IEAB 5A40E 3PP3H 5L9DH 3RU8L 3GO1L 5FYJL 1OAYL 1FL3B 4Z7QF 3SDAA 4NN6C 4XAKE 4JFQB 1DJSA 5CWSB 3VGHA 3U9PH 3MJ9A 1UWEH 2RJMA 5HVHC 1N64H 4PJ9B 2NY5C 3P4NB 3KAAA 3KPMA 1G9NL 1ADQA 2YK1H 4X6EB 4FQHA 1L7TH 3DROB 5LJYH 2F8OA 3FO0L 1G7IA 3G5VB 1PAMA 3SDCD 3NFNB 3JWDC 4LCYB 4LQFH 2N7BA 4G43B 4P3CH 1LEKB 4UT7H 4JB9H 2R1XB 2LABA 3LV3B 4I9WD 3V5HA 4R26H 4KHTH 3IJSB 2DI9A 1B4JH 1IQWH 1KELL 3NAAL 3DX6A 2C3GA 4KZDL 2HT3D 3VFNA 1CTNA 1I9RL 4FQJL 4DTGH 4NWUL 3P2TA 5CJQH 4BFGA 4FQIH 1A3RL 1P4LB 5D2LF 1NQBA 4PD4K 1CDJA 4WFFE 3TNMB 4MNQE 1GZQB 4JY4B 3BZ4A 4X4YB 1GAFH 3OV6A 4Q6IC 2F5AL 5CZXC 1MFAL 4ZUSA 3UTTE 3DVFA 1IGTB 4P46C 4FNLL 4GRMB 5DJZA 4V1DA 1J5OH 1U8NA 4JGJA 4BELD 4BZ2L 1T7YA 4JFED 2PTTB 3AS3A 1A5FL 1XF4A 3JV6A 1LE9A 2Y07L 5IW1B 1FO0B 1OB1B 4P5TC 5I8OH 2QEJA 4Z7WE 5IUSA 2GSGB 1R24A 2A74B 4YHIB 1C5CL 4MNGA 5JW5B 3IDNB 2DTML 5DRXA 3I6GB 1YYML 4LDEB 2A73A 4JFDA 4HK0B 1RULH 2E9JA 1FCCA 3X12B 2UZXB 1G9MC 5I1EL 1JWSA 4Z78A 1E27A 5C0IB 1UB6A 4JRXB 3DSNA 1WUNT 1NAMH 1TJGH 5B4MD 4YDLB 3P73A 1EEUA 2NZ9C 4KK9C 3VI3F 2P7TB 4M3KB 1A7QL 3ARFA 1N59B 3S96A 4ENEC 4ZXBD 1BAFH 4KVNL 1KIRA 3G6DH 3THML 5E8EB 2WV3A 4GFTB 3QDJE 2CMRL 1S5HA 2M26A 4AEEA 3MV9D 3QCVH 2ZWLT 4PTUA 3CXDH 1CE6A 4HWBL 4PGEA 5KJRH 4U4BA 4JO2L 4ZUUB 1BQSA 2V9QA 1TQCB 3NCMA 4NNXA 1FJ1B 3C5ZD 1HXMA 4IIQA 3RGVB 5B3JF 5C2BL 1TQBB 2EYSB 4Y1AA 4BQCA 2O93L 2NY4C 4XCFL 3S5LG 1K2DB 3IDXL 4L4TE 3FKUS 4EZMA 2JELH 3NFSL 2J8UF 3GSUB 4Z7UB 2EZ0D 2R0LH 4JCMA 2I9TB 3SY0B 2E6JA 4RAVA 1R3KA 4XMKL 1M7DA 4OAWB 1L7IL 5KSAD 5H37G 2XKNA 4LLVB 3T8XA 4JFFD 1IM9D 3MRGA 4WI8A 1M7IB 1CL7I 4PLJD 4P4KB 3WKML 2B1HH 4G42B 3TEUA 4Z0XA 4FXKA 3MC0A 4JM2F 5C0AD 4WO4C 1U9KA 3KLDA 4K8RL 5GS3A 4U0RB 5ID0B 2VLKB 4UBDC 2J12B 1ITCA 5HHPB 4P2QD 3TBYA 4NQXA 3VFUA 1FAKT 3CDCA 4YE4L 1HHJB 3ZHDA 1YECL 5TF1L 3WHE0 5I1IH 4HPYL 4OGAC 1Q9WB 2QSTA 2VO5A 5IFJA 1Z0NA 5B21A 2EDEA 1NCAH 1JGUH 1G6RH 1N4XL 2ESVE 3LKNA 5EZIL 2H6PB 3IFLL 2KDGA 4KJWC 4XWGH 3CVHB 1U2HA 4NBZB 3CSYB 1FNFA 5DS8A 5DYOB 3GSRB 4XC3L 3W9DB 2ICEB 3DX9A 3GMNA 1S9YA 2Q76A 3UTQA 5CP7B 2NX5B 2JJVA 2MNUA 3B9KD 3LPWA 3CVIL 4TNWK 2DLFH 2ZCLL 3LN5A 1P7HL 1Z6JT 2EIZB 5CCKH 2A6JA 1FLRH 5DMKA 2F54D 4OLZH 1FVEB 3D0LB 1I3UA 4YJZL 3Q5YA 5ISZE 1NGZA 3C8DA 2XQBL 4N68A 3SQOH 1D5MA 5L2JB 5FYLE 3RVWC 5A2KH 4R8WH 3W11D 1HWHB 4U1MB 1C5BH 3GSNA 4M7LT 2NXYD 2C5DC 3HI5L 4NO3A 5L7XL 2DYPA 2GEEA 2LU7A 3I02A 3SDCA 3T09A 5IG7A 2R1YA 5IVXA 5D1XC 2VQUA 2HJFB 1IC5H 5EDXA 4NQVB 3VXMD 3QI9D 2QR0B 1OSPL 3K7UA 1FYTB 2LU4A 3V8OA 1X5IA 1IAKA 4PB0L 5DJYB 3WL9B 4L8DB 2BNQB 3MODH 4ELMF 4KRPC 1T2XA 4WI2A 5LVEA 5SX5H 2V7NB 5IMKB 4OLUH 3DTXB 3VJ6A 1TJIL 2FX7H 1A7RL 3PDOB 3P77A 1RZIB 1A6UL 2EEAA 2JLLA 2P47B 1BVZA 4YFLI 2RR3A 3ZYJA 2NTSP 5DRZB 3EZJB 5C0CE 4O58L 2W9DL 3FHQA 5EPMB 4JFPB 1UVQA 5FYKE 4LSQH 1OCWH 5HI5D 3RL2A 1B2WL 2DL9A 4QT5B 1BJ8A 4UOW0 3PE9A 4XI5C 3REWA 3TT3L 2VL5A 2DKUA 2A6DB 3KG5A 1S78D 4RMVA 4LKCA 3AB0C 3IFPB 1QR1B 4OZHE 2FECL 1K4DA 1VFMA 2BX5A 5E94A 1IKFH 1U6AL 3NIDE 1HCFX 4JFEA 3RJQB 3ARDC 4CL7A 1FIGH 2X4RA 1SJVA 3RTQD 3BJ91 1VGEL 1Q94B 3QDJA 1DSFH 2GTZA 3ULUH 4GMTL 4TUJB 2CO7B 3OAYH 5INDA 4DKEH 3RNKA 1P9MC 1CLZL 4LIQL 3ILPB 3T4AB 3KPPB 3MXVL 1D5ZA 4XVUD 1FFOB 2VISA 1JN6B 1IL1A 1HI6B 4K71B 3WBDA 1Q9LA 1JPFA 3MRBA 4NQEE 4WUKH 4XHJD 4UQ2A 4U7MA 3UTZA 5EU4A 4AIZA 3ZDXF 3GSOB 1QVOA 1MRFL 2RIKA 3WNMA 2IMNA 3K81A 4EQ2A 1FO0H 5I73C 3DRQB 2YD5A 3ZKQD 1XGQA 1AXTH 4XNXH 2VDMH 4U1SA 3RIFK 2NXZC 2OZ4L 3RVUC 5KW9L 1DBBH 3BQUD 3TPUA 5J6GA 1KACB 4YHOH 4XPAH 4NC1E 2CGRL 4X9BA 2V2XA 3MV9A 3V7AG 1I7UB 4TUKH 2Q8AH 1QFWL 4EBQH 2VXSL 2VZTA 4N90D 1SM3H 1QLRA 2E8ZA 2VIRB 4U05A 4QHNB 1MFCL 2FBJH 3B9AA 3C5ZA 3O11B 2AXFB 1DQDL 1Q1JL 4OSUL 3ZT5A 1E6JH 5ANMB 3EIFA 1UKTA 3QPXL 1WWAX