4ELKA

Crystal structure of the hy19.3 type ii nkt tcr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
202
structure length
199
Chain Sequence
b'QKVQQSPESLSVPEGGMASLNCTSSDRNFQYFWWYRQHSGEGPKALMSIFSDGDKKEGRFTAHLNKASLHVSLHIRDSQPSDSALYFCAASEQNAQGLTFGLGTRVSVFPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hy19.3 TCR alpha chain (mouse variable domain, human constan
publication title Type II natural killer T cells use features of both innate-like and conventional T cells to recognize sulfatide self antigens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 36
structure length 199
sequence length 202
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4elkA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4elkA02
2CO6B 1N3NB 1ZGLA 4GW4B 5T1LD 2DOCA 4U2ZA 5HVGB 4PY8J 1NGXA 1FV1B 4PYHA 1B0WA 3BZFB 3KJ4B 5SWSD 4IOFC 3BD5A 3WS3B 1KBGL 5EC1B 5KS9F 1IFHL 5E2TL 4M1DL 4P2RE 1DQQB 1FFOB 5BO1L 3U1SH 3FFCE 2N56A 3UTPD 4YDJA 4Z7VF 2E9IA 4JAMB 3WIHH 3CK0L 2HH0L 4MCYB 1WAAF 3GSNA 1S8DA 4IOSD 1YYLH 1PZ5B 4LSTL 5IV2A 1FAKT 1YEIL 3FO9A 1WZKA 2AJYL 1S7WB 4OUUB 5KSVA 4K9EH 4XZUB 2BJML 1SYVB 2ATPA 2LV4A 5D5ME 5CKAA 2R23A 3JWOH 4GH7B 5DVOA 1N0LA 5ILTH 3RBSA 1UZ6E 1MJJB 1JPGA 3GI9L 1X6LA 3MNVA 3CFDB 4P5TC 4EUPG 4ZSOB 1RJCA 3O6LH 2HT2C 4JY5H 2B5IC 2OI9B 1H0DA 4GLRI 2YZ1A 2EDNA 1F90H 4UB0L 2ICCA 5DJ8B 4ZFOA 4NNYB 4CMHC 1DUZB 2Z35A 4U1KA 3OHXB 3IFLL 5D8JL 5HHOE 1NDMA 5HDBF 4GG6F 3QUMB 2ZOKB 4KWUA 3GIZL 4WO4B 4BSVA 1UFUA 4HS6A 1A6ZB 3PGDB 4P59H 3RVXD 4J3WA 1UJ3C 1WQVT 3HE6C 3QIUA 3FT2A 4PJ7A 1CU4L 2EZ0C 3LQMA 4TUOB 1QSFB 1KIUA 4MXVE 5JPNB 4Z78A 4Y0GA 4Z8FL 1D5MA 3TO4B 5JOEA 2NR6D 1V8HA 3O11A 3QUXD 4KK6C 5A1AA 4Y4KD 1A2YA 2DQTH 4PRBA 4PG2C 4D0CB 3DX9B 3QUKB 5IJKC 5AZEL 3SE4A 3I3EA 5ALCH 3W82A 4HZLB 1AQKL 3DURA 1NBYB 3OBAA 1WCQA 3ETBF 4XP1H 2EE3A 4PJBF 4NKMB 4XTRD 5JHDD 2YA2A 5C6TL 4PUBH 1WJ3A 3IT8D 4NBYB 4LIQL 5EU4B 3VXUA 1JGUL 3CH8A 4NJ9L 1UB6B 5ICXA 4LCCB 1PY9A 3TBWA 1HHHB 1NL0L 2QLVB 1JZ7A 2DM7A 3WFHB 4CVUA 3H7LA 1I9RL 1EUUA 5I66B 4JO4H 1DLFH 5F70A 4J12A 3BPOC 4APQC 4GRWH 3EO9H 1I7TB 3F58H 2RFXB 5FOBA 3HE7D 3S4SG 4NQUA 1HKLH 3MA9H 3K2UL 5E2WL 3VWKA 1X5ZA 1SYSA 1H15A 1XR9A 2NY5C 3ME0A 2GY7B 1B4JL 4TULL 3Q1SH 1QP1A 4QRQA 1FNGA 2Z8RA 4RGNE 3ZE2E 1HINH 4FQJL 3VG0L 1L7IH 5D2NC 3HNVL 4ODWA 2WUBL 3OKNB 1VB9A 3ROOA 2VLJA 3WUZA 3PWPD 4WWKA 5ACZA 3S37H 1RJYB 3CDYA 3MPCA 1MIML 1T6WA 2P8LA 2ITCB 1QR1B 5ISZA 3MRQB 4XCCL 2HLAA 4NUGL 1F4HA 4L4VB 3H42H 2QSCH 4PJXA 4X0KB 2XTJD 2ZUQC 5GS0H 1HWHB 5FHBL 3WJLA 4NFDA 3CDFA 5KS9E 1ITBB 5BMFH 3WHXA 1Q94A 2NZIA 3CZFB 4LKCA 2NXYB 4PY8I 4F7MA 3S36H 2G2RA 1NSNH 4Z7VE 4M62H 2H3NB 4BQ8A 3GMOB 4I3SH 4P3DB 5C2BL 2I60H 2ZUSA 3IFPA 4Y1AB 4OLWH 1DBBH 1L0QA 1OP5K 3LN9A 4YFEA 4FG6C 1OT1A 4QHUA 1KJVA 4KUCF 1QR4A 1QZ1A 3KPPA 2FJFB 1CDJA 4FQLH 3HC0B 5DVMA 2HFFB 5T3ZL 4JFFB 5EA0L 4PJIF 3IFNH 5INCB 3LQAC 4LBEB 3TF7C 4M7ZC 2UWEF 4TPRH 5C7XH 1H3WM 1NGZA 5EZJA 2R0KH 4YAQB 5ESVB 5DUBB 4RAVA 2BOCB 3QXAB 1CQYA 2O5XH 1F97A 4OI8A 1U93A 4OQTH 1FAIL 4JY6A 5MENA 2L7UA 5IQ9B 5F7FA 1TZIA 4MNQE 5HDBE 3R8BB 4M93B 5EU6E 1CGXA 3UTZA 3C09B 1TVBB 3G5ZB 3VFNB 4EI5B 1AE6H 2J6EL 4M43H 4MSWB 4LCYB 4OZIE 1TXKA 4Z0XB 3SKOA 3MR9A 3DUSA 2APFA 4X5WB 5ADOL 1BF8A 2O61B 1ZTXL 3D39A 4TVSa 1KXTB 3S35H 5E24E 5H2BB 2OR9L 4GKNA 3TWCL 4JM2D 1JHTA 5DD6B 5JPMA 1KB9K 2XXMB 4OZHF 4PJBE 3T2PA 1BJ8A 1NLDH 3D0LB 4LGPB 4YC2C 3BQUC 3MV9A 4KKLD 5EFIB 2BRRH 2J2ZA 1KC5L 1JVKA 4B7IA 1MH5B 2A9NL 2PCPA 1CFTB 1J18A 5I1JL 1T89A 4PRAB 4LLVB 1G7MB 2Z8WC 1GGCH 3SE9H 2BXYA 4O58H 4S11A 4D8PA 1T1YA 5E95B 3BKCH 1JBJA 4D9RD 5D71L 3HRZA 1YYML 1TQBB 3OSKA 1I8IB 3RZCD 5FXCH 4I18B 4ZO8A 1T03L 3AU1A 3EO0A 2CR3A 3QCTL 5CJOH 1TITA 3HFML 4LLDA 2JJTA 5FDWA 3ABZA 1UWEL 4PJCF 5FUOH 3HPLB 1NGYA 2Q7YB 3BXNB 4LLUA 4OF8A 1C08A 1IAOA 5I8OH 3WO3B 4OB5L 3IVKB 1A9BB 1D9KB 1JL8A 3WIIH 4GAGH 4FABL 2NYYC 5JZ7D 3SGDH 3RAJH 1G1CA 1A1MA 3PWLB 1CLYL 2BVQB 1QD0A 4P4KB 1OTUC 3NA9H 1AY1H 5DEFB 1MRFL 3AC0A 1T2XA 2ZPKL 4LCWB 4WFGE 1CGTA 3QBTB 3NMEA 3BYYA 3ZKXB 2WIIB 4QRPD 4NOBA 3SDXB 2GKIA 2R29L 5EN2A 4ZNEE 4HGKC 3C2AH 5JUEL 4L9LB 3LS5H 4OLZH 3QDMB 1ND0B 4KK8C 2NY4B 5KG9A 2PR4H 4RZCB 4HPOH 5KW9H 3ARFA 5E99L 3R1GL 1YMMD 4LCIH 4NKOB 1J8HA 3KS0J 2FZ3B 1BBDL 3WL9B 3ARBA 5F8QC 1JZ8A 3MACH 3DIFB 2Q87A 3FZUC 4S0TD 1FNAA 3D48R 4QGTA 1N64H 4PJ9B 4PJIE 5HHMB 3V5DA 5DD1H 5J12B 3ULSB 1S9YB 3B8SA 3ULUC 5I0DA 5MEQB 5D93B 3S5LB 5FO7A 4WFFD 1F2XK 3MV8E 4MA3B 5CWSA 3SN6N 2QV2A 5CAYB 3TO2B 3R8QA 4UV4L 3NBNA 1U58B 4X7SH 3QDHA 3BEVA 4M1GH 1DDHB 5K9OB 2UZYB 1P9MA 5T1DL 4LHQB 5IJVB 4PRIB 2DQDH 3I6KA 8CGTA 2NY5L 2UYLB 3V6FA 1NKRA 3U4AA 4MAYC 4JO2L 1R3HB 4LFHD 1XGPA 4O02L 1E28A 1QFUH 4EQ3A 3QIBB 1FZKA 3DI3B 4F8QA 5IEKB 1U36A 5F1IA 3U83A 5FB8A 5I0ZA 4Z7WE 1FVDB 3VXOB 2WM0A 4P2OD 1O0VA 2D9QB 4Q2ZA 3L3IA 1L0XA 2RCSL 3VXRA 4X8JB 4UMGA 5EULV 4XVSH 4GXVL 2CIKA 4OZHE 1NGWA 4AT6A 4KQ4L 3QXWA 4UUJB 4PJAA 2ZUXA 4PJ5A 3CFIC 2XTLA 4KDTA 3LZFH 4K2UL 5FA3A 2C3GA 2X4TA 5FO9A 1NCNA 1ZT4B 4D3CH 1UWXK 4Y2DC 5I30H 5TDOB 6FABH 3AXLA 2XA8L 4M8QA 3JWDH 5IB5B 3SCMB 5IMMA 4E9LA 1QFPA 3CDCA 2CKBL 3CVHH 4EDWL 2X4QB 1CDUA 1C5BL 2RIKA 1ED3B 3GB7B 4WJ5B 3CLEL 2N4IA 1FP5A 2I9TB 3DGGB 1RFDL 1P84J 5E8EA 1LE9A 5HVHC 4NQDE 5L9DH 5HVFB 2X40A 3LQAL 4F8TA 4S2SB 4IOFD 1KFAH 4ONHA 4QKXB 3MLTA 5EOTB 5JORA 1JHKH 3KJ6L 4D0BB 4RISL 5BV7C 3WE6B 2ZSWB 4HS3A 4PJCE 9CGTA 1J86A 4WUUD 4KTDH 5FYJE 5C07B 4RX4D 2AJUL 4YHYB 4MZ3A 3MLPA 1UH4A 5DT1L 3HMXH 1JYXA 3MOBL 1KUMA 1MWAH 2NTFB 4RGMB 2DKUA 3UJTL 3MO1A 1V3KA 3E3QE 3O6FB 5IIEB 2ATKA 4UT6L 4XAWH 4YNYA 5C9KA 2EDDA 4P23A 4RFEA 4KAQL 3O6KH 4P9MH 4XP6L 3G6JB 5I9QB 3RTQA 5A3IC 5J1TC 3P40A 4Y5YA 3RVWC 3KHQA 1YEJH 2EDBA 2HT2D 4ODSL 4OM1L 3GEWB 4TSAH 5KS9A 3AFLA 2OSLB 3BIAX 1A6UL 3OKOB 2ICWI 4EN3B 2ED8A 1PLGH 3T0EB 5HVWA 5L8KB 1U8IB 2PW1A 1HQ4A 4ELKB 4Z7VA 1C5DB 3FQUB 4U1NB 2FB4L 4JQIL 2ZCHL 4J6RL 1T04A 1WAAA 3MBEC 4I3RH 1MCRA 4ZODA 3TC9A 5GZOC 1T7VA 1JRHH 3KYNB 3HE6D 1NEZB 5C92A 1EJOH 3BP5A 3CH1B 4K7FB 3HZMA 2EZ0D 4ELME 2D4DA 3QRGL 4NCDA 3JTSB 1A7NL 4WUKH 2E6QA 1BEYL 2B20A 4NQSA 1ERNA 3ECBA 4X6BB 4YDKH 4L8SA 2ESVB 5GGVH 5D2LB 1RSFA 1IKNC 3GKWL 2NW3B 1U8KB 4HK0B 1AO7D 3ZSSA 3LVEA 3DVFA 3UZVB 1JPTL 1WGOA 3GKZA 4XNMB 3OPZL 4GG6A 3F6IA 2BXZA 3KDMA 1PZUB 2DQUL 5J3HC 4CBPA 4NWUH 4U1JB 5ANMA 5MHSE 3TNNA 4YHLL 2DM3A 1MHPH 3LS4L 5IW1B 3CFBB 4ENED 3PQYD 3X12B 5I15L 3C6LD 5DJZA 1A3RH 1P7QD 1CDHA 2NY7L 2YPVH 1N5AB 1BZ9A 4R7NA 3Q0HA 4HH9B 3LRSA 2JB5H 3TT3H 1KN2H 5D7JD 4R8WH 4N8PA 4OKVA 5C0FA 5L2JB 2HJKB 1EZVY 4JRXE 4QHLB 4QXGH 1DE4A 1DQDL 3KPSB 2BCKA 5DMJB 5CINH 5ETUA 3OMZA 4PFEA 4Q0XL 5C8JB 4HFWA 2YEZB 1BZ7A 4L4VE 3QHZH 1W72A 3ZKQD 1Y18A 2GTWB 3SO5A 5K9QI 3T65A 1EVUA 3CPLB 3HZVA 5E6IA 4NRXA 4YK4B 2PO6A 1F4YH 3SDXF 4NYLA 2QHRH 3MJ9A 4UI2A 1TETH 1S7TA 3PF2A 3CCHB 4Y5XA 3NZ8A 2BMKB 1QSZA 3ARPA 3BRFA 5T33H 1LNUA 5CLWA 4R0LB 2JB6A 5D7LB 1XR8A 5TH2B 1RULL 1I1AB 2IANB 1GAFL 3RNQB 4UAOC 3TA3B 3P11H 4Y19B 4JFOA 1WTLA 4JFFE 2XA3A 3DETC 3UDWC 4K3DH 1AD0A 1E4KC 4QRTA 5GRVK 3DMMA 3NFNA 4FQXC 5D7SH 4FG6D 5HDOA 3B5TA 5IB4A 2Q86B 1LDPL 1S7QA 1UJTA 4ZD3H 5IOPA 4NM4H 5DJCA 1TFHA 3BPNC 3FQWA 1NBVH 3L3GA 4Z7UE 1IJ9A 12E8L 5KSAB 1EPFA 4RA0C 4AY0A 3RPIB 1JWSB 3O2DA 1KLUB 1WV7T 1HDMB 1FSKB 4TQEH 3U9UA 4DKEL 3QNZA 5DA4A 2VIRA 2IG2L 4UQ2B 3UBXA 1JZ3A 4D94A 4MA8L 5JTWA 1E6OL 4NO2A 5DD3L 3IDJA 5ESQB 3WNKA 4AG4L 4EOWL 3RUGF 4WHTB 1D6EB 1JI2A 5D1XC 4GJTB 5CHNB 1NFKA 1G7IB 4KZDL 3SE4C 3DO7B 4CNIB 2YD2A 3DVNB 3VCLA 5E8PB 3QUMH 1FL3A 2O5ZH 2A2QT 2YBRB 3MRDA 1UXWB 3IF1A 1YEGL 5IW6A 3MV8A 2UWEA 2CSPA 1FLRH 2RR3A 4HWNA 1YMHA 4EI6A 4DZ8A 4R3SA 4DVBA 4O51B 4PJDB 5DFVC 3UXFA 2VZTA 5FM5O 5I71C 5FYJU 5BV7L 2R2BB 1LK3H 3IDXH 3VXSB 2R0WH 4KI5C 1F3DH 4M6NL 1HHJA 3O4LB 1EAPB 1EDQA 1AHWB 2P47B 4JKLA 4JQXA 3WNLA 3QUYD 5EZOL 4F33A 3GO1L 3VJ6A 4GRMB 1FORL 4P5KA 3GK8L 4RQQB 3VXNA 1NCUA 1DJSA 1CGUA 2JCCB 2VDLL 2R9HC 4MDIA 3S34H 2Z31C 5HYFA 4E42A 2ZUVA 3QI9C 4G42A 1BJMA 2FYYB 4O4YL 3QCUL 5T1MA 5DSCB 3IDYB 5IHZB 4H1LH 3O6ML 4IRSD 1ADQH 1KJMB 3WS6A 5HDQL 3D2UB 2R2EA 3NCJH 2P5ED 5EOCH 4UINL 5I1GH 3VXME 4WV1A 2P7TB 3U36A 3OAZK 4RFOL 1CE1H 3ULVC 3WBDA 1SEQH 5CP3H 1KJ2B 2Z8SA 3QO0B 3G6JF 4GW4A 1FV1A 3SDXE 3BZFA 4FNLL 2X6MA 2OYPA 3CNKA 1EERB 5B38B 2FWOB 2W07A 1EFXD 4XI5C 4ZOCA 3WS3A 3VDAA 3EBAA 4XMPL 5EC1A 3QDME 2OJZL 1TTFA 3QQ9C 1OPGL 2IQ9H 1DQQA 1FFOA 2V2XB 4NHUB 1XIWB 5E2UL 3AAZB 3T4YB 1CTOA 3GBLA 4G7VL 1VPOL 3G08B 5D4QA 4JAMA 4I0PB 4ZTOH 4MCYA 2JF1A 4ODTL 4YDIL 3K80A 1EEYB 1PZ5A 3UAJD 2E5EA 1S7WA 4OUUA 4N8VG 1ETZB 4XZUA 4QWWD 4GBXB 1SYVA 1G6RH 3VRIB 3IDMB 2WLZA 5GS2D 3SDYL 4HAGA 3WN5C 1FBIH 3W11D 1KN4H 4LP4A 1MJJA 5JA8B 3MLYH 3CFDA 3FZUD 2CLRA 4XNXH 1JHLH 4ZSOA 1IZJA 4GQPH 4PY7B 5D2LF 1ZT7B 5SWSB 2VWEC 3ULUD 1CLCA 4BZ2L 2GK2A 5DJ8A 3V4UL 3KLHC 1BBJB 1HNFA 4NNYA 2EEBA 3KR3H 4NCC1 5FGCB 1DUZA 3SDDB 3OHXA 3WFEH 2B1HH 2W1NA 1N6QL 3QUMA 2ZOKA 1NC2B 4WO4A 5C0RH 1C12B 4FZ8H 1MFNA 5GRWA 1A6ZA 3A67H 1UACL 1CGSH 3BI9X 3PGDA 1E27B 3MYJA 2QADB 1KULA 1MCKA 3Q6GL 4TUOA 1QSFA 1NGPL 3RUGE 5JPNA 3TO4A 4ONGL 4ZAKB 2PW2B 1BVKB 5FHAL 4Q7DA 4D0CA 5SWQB 3RDTB 3DX9A 3QUKA 4XAKD 5C0GB 4HZLA 3MRKB 1NBYA 3B9KC 1FC2D 1HQRB 3ZHKA 3BMVA 4UV7H 3NTCL 4NKMA 4XPHL 3MZGB 3MFFB 1YZZA 2FJGB 4CRPA 25C8L 5EU4A 1J12A 2X1QA 3IDNB 4EDXB 4MQXC 3O41B 5DGQA 2M1KA 1UB6A 1JN6B 1CFSB 4CN1A 4RBPK 1CXLA 4LCCA 1HHHA 1NAMH 4MVBC 4OD2B 3WFHA 4EVNB 4KROC 1MAKA 4JLRA 2V2TB 4Y2DD 1CDGA 3V6BR 4PB9H 5I66A 3T2NH 5AG9A 1TZGL 1JMZA 3MLWL 1I8LA 4GMSH 2VR4A 3U9PH 1I7TA 1FDLH 2RFXA 2OS7A 3T3PE 3ZKMC 1ZT1B 1J10A 5I1CL 3WFDL 3NFPB 5CP3A 1ZXQA 3OQ3B 4L8CB 4OCXL 3QG6B 3DLQR 3NCYS 1LEKB 1HNGA 1VCAA 2R56H 1MCCA 3BT2H 4BA8A 3L5XL 5JHDB 4TVPD 5IT2H 3GBML 1IGCH 1ZHLB 4NKIL 4UDUA 3OKNA 1X3DA 4DTGL 5IWLA 5CZVL 4YIQB 3LN5B 1RJYA 4KJWD 2QQNL 2F8OA 3GMLB 1JTTA 4YPJA 4OCMC 2ITCA 1B6UA 1U3YA 4F80A 3KLSA 3MRQA 4XNYL 4L4VA 5FYLD 4X0KA 3WMSA 4HKXB 1IGFL 1UM6L 3GGWB 5C08D 4CGTA 3HE7B 1LO2L 2IFGA 2VXTH 3CZFA 1N0XH 2Q8BL 5A3ID 1JNLL 2IPTH 2H3NA 3MLSH 2P44B 2R4SL 3GMOA 4HC1A 4P3DA 4QRRD 4XH2A 1RURL 1PG7W 2VDQH 4LPYA 3PWJB 1F58H 1N4XH 4Y1AA 1EX0A 1KEMH 3IAQA 5FK9B 3C9NB 3ISWA 3V8OA 1LO5B 2BFVH 3IJYB 1F2QA 1P7KB 1J0IA 4M5YH 4OCRL 5JOPD 1CTNA 3H0TB 2FJFA 1KELH 3HC0A 2HFFA 1ACYL 1A6PA 3DGCR 1XF5B 2G60H 1J0KA 2J8UE 1URLA 2Y72A 3WEXB 1MRDH 1PSKH 5LBSH 4LBEA 3WFCH 2XTJB 1INEL 2IF7A 1QLEL 4YAQA 1OW0C 5ESVA 3P77B 1WUNT 3OR7B 3MNZB 2BOCA 2HFGL 2DLTA 1O7VA 1S7SB 3JVGA 3OV6A 3QXAA 3LKOB 1V7MH 5IQ9A 1OAUH 4DKAA 1GZQB 3NZHL 2AI0H 1IEBB 5CBAA 4L1HA 1SM3H 4GS7B 3WYRA 1TVBA 3G5ZA 3VFNA 4EI5A 5J0BA 1EMTH 3KXFD 1GSMA 1LO3H 4MSWA 1A7QH 4LCYA 3B2UD 4Z0XA 3IJSB 1CT8B 2JCCF 3GSQB 4A6YH 4X5WA 3SKJL 2O61A 1CE6B 3QJHB 2ZKHL 4XB8A 3ULVL 4DGYL 1HYRC 1J1XL 3QPQC 3JSSA 3PJSB 1DFBH 1JF1B 4I2XB 5CJXA 1BREA 5DD6A 5F3BB 1WIUA 2IBBA 4P9HL 1JNNH 3CMOL 1AD9A 5DMIL 2A6KB 1OWWA 5IESL 1FG9C 1LGVA 2WANA 4KKNA 3RWFA 1QQDA 5E70A 3D0LA 1J8KA 4L4TE 5JIKA 3WXWL 2GHWB 3OB0H 4CMMB 4OGZA 5EFIA 3ROLB 4U3HA 2KH2B 1MH5A 3TLRA 1CFTA 4F9LC 4MA1B 4LLVA 1G7MA 4DN3H 1GYAA 4WHCA 1IILE 5AG8A 2BSED 1KPUB 3PE9A 5JR1H 5EG6C 1QNZL 3PGFL 3QA3B 3DHMA 2VN4A 3NPZB 2FHFA 4XNZC 5BVJB 4NKDB 1I8IA 5ITFB 4I18A 3H9ZA 3L5JA 4HWEL 4UU9A 5D7LE 5LKNA 5F7MC 1QHOA 1SY6A 4QT5B 3MRNB 3GJEB 3TEUA 3INUH 4GAJL 4YBQD 5F1OB 5C71A 3QZWB 2DQJL 1XF3B 4I3GA 3QEGH 2F19L 2IGFH 4YUEL 3HPLA 1MAML 1ZANH 2Q7YA 4ERSH 3BXNA 3MUJA 1CXFA 5FO8B 2ICWB 4HBCL 2OXGA 4RGNC 4K8RC 1G0YR 1GOHA 2FHCA 4JFDE 4R9HA 4DGVL 3PWLA 1H3PL 3N1MC 1MCNA 2BVQA 3MUHL 2VSDA 3B8YA 4P4KA 2H1PL 3VDCA 5DEFA 4IRJD 4LCWA 1FJ1A 4WCYL 4YHKL 4UOW0 2WIIA 3RVUD 5KOMC 5F93C 5TQ0L 3SDXA 2VLMD 2YWYA 3KPQB 3P9MB 1QRNB 1WSST 4L9LA 4XVJL 2BNRB 4Z0BH 4JN1H 1SEBB 5GRUL 4FOMA 1ND0A 3WUWG 2VKXA 3FN9A 1G7JB 4RZCA 4OIIL 4NKOA 3VGEA 3WL9A 4HXBH 2HAZA 2EO9A 3EYSH 3DIFA 3D5OF 1XGTB 3QJFB 4PJ9A 1G7LB 3ULSA 1S9YA 1J1PH 3FO2B 5MEQA 1SBBA 2W91A 3S5LA 1YQ2A 4MA3A 1RUKH 5D1XD 3NIFF 1FFPB 3TO2A 4A6YA 2FSEB 1XF4B 1MIEL 1HCFX 4KRMB 2BSRB 2HP4A 5IBTL 3QEQB 1RPQA 3DHJA 5IJVA 4PRIA 2WSKA 3MRRB 3VXSE 4FQ1L 5CJ5A 2UYLA 4BYHA 1CN4A 5B39G 5GJTL 2XRAH 1R3HA 4AEHH 2W0FB 5AYUH 1U3HC 2E6JA 4DKDC 1YMMB 3QIBA 3UC0H 5GGSY 1OTTD 3Q6FB 5LWYH 2AEPH 4FTVB 5IEKA 2DDQH 2JCCE 1JZ5A 1FVDA 1T7XA 1CBVL 3ZE1F 2EEAA 4NQEB 3SJVD 4J3SA 3N9GH 4X8JA 1KPVB 4IIQC 3P30L 4X9HA 4BZYA 3C5ZD 4K3HA 3WSQH 4UUJA 4UNTA 1VGKB 2Z31D 2XN9D 1MFAL 5C0BD 4I0KA 3VGAB 3KG5A 3QI9D 3FAWA 3K2MC 2F5AH 1ZT4A 1RZIB 5TDOA 1NLBH 4G8IB 2WBJB 5IB5A 3SCMA 2YMXL 2E7LC 5K33A 1Z6JT 4FRWA 4MJID 1RUMH 2OL3L 4C57C 1AXIB 2X4QA 1ED3A 3GB7A 4WJ5A 4P2OB 3O4OB 4FQ2L 2EDTA 3DGGA 2I9TA 1XGQB 2Y6SC 5BZDB 3BRDA 32C2B 4S2SA 3V6OE 1A1NA 4MJ5B 5EOTA 1MHHB 2O5YH 4D0BA 4G3YL 3WE6A 3BPLB 2QKIA 2ZSWA 1DVFC 2DJSA 4BK5A 1XGRB 3TZVC 3UO1H 3W39B 5ALBH 1MI5E 1WZMA 2AJXL 5C07A 2F54D 3S3JA 5E03A 5IFAL 4GSDH 3U7AA 4P2QD 3N85L 2H6PB 3DMMC 1K6QL 5DD0L 5D1QC 2NTFA 4M6OH 2ZG1A 3QSKB 4XXCA 5IIEA 1Q0YH 1A3LL 4WI9A 4GLRH 3MRFB 4LOUC 3NAAL 4UIKL 4BUHA 4HZAA 4AK1A 2VDPH 4OCNC 4M9PA 3S3SA 4C56E 4NNPL 4I77L 3G6JA 5D1ZC 1RZ7H 1SBSH 3UTPE 4C54A 1ZLSH 2W65A 5GS1C 2VYRE 4OLVL 5CIPB 3MROB 1NANI 3U7YH 4M7JL 4N0RA 3ZT5A 1FYTE 2AV1B 2OSLA 3MRJB 4P4RB 3EJYC 4WUUB 3OKOA 4NCC2 4EN3A 3T0EA 3EYOB 1U8IA 1UCBH 4KQ3L 4ELKA 5B22A 4JZJC 1OD9A 1C5DA 3FQUA 4U1NA 3C08H 4ZNCD 2DICA 1BD2D 1BLNB 4NQCE 4U1IB 1XMWA 3T2QA 1IGYB 4OZGE 1U3ZA 3KYNA 3SGEH 3ILPB 1NEZA 4M6MH 5JDJA 1DSFL 4K71B 3CH1A 4K7FA 3IS1X 1QKZL 2PN5A 4Q9BA 5TPWH 4PRPD 1LEIB 2VC2L 5FECB 4HJJH 5J06A 3NIFE 3JTSA 1J0JA 4P5TB 4M61B 1MCOL 3VXTB 2V5SA 2EXYC 3BE1L 5B8CB 2P5WD 2ESVA 3RZWA 3V79C 1CD9B 2B5IB 1NUGA 2CDFB 5D2LA 2X1WL 4U3XA 1O7SA 1IC4L 1U8KA 4WI4A 1P4BH 3BO8B 4HK0A 4PD4K 3HI6L 4PPTA 4CMHB 1MJ8L 2P1YA 5EOQL 3RWEB 4MQXD 4JEGB 4XNMA 4BELD 1OTSC 2R0LL 4O9HH 3LPFA 4LSUH 1BQHB 4U1JA 4K8RL 4MVBD 2X7LA 3MRGB 4UDTB 1UJ3B 2EECA 3HE6B 4R97C 5DUMH 5IW1A 3CFBA 1J5OH 3X12A 2EICA 5FV2A 4DN4H 5JHDE 4POYA 3F5WB 4JCMA 1AIFB 4N0CD 4MB4A 3MGOA 1OCWH 3QQ4B 4TNVF 5K9JL 3V4VL 1EO8H 2CJUL 4JO1L 2XQBH 5L2JA 2HJKA 4QHLA 4QOKD 4M1CD 5DFTA 3KPSA 1UVQB 2XT1B 3OXSB 1UM4H 2DQGL 3S3PA 1AO7B 1CFVH 1MCDA 5DD5L 3MLUL 1YC7A 2MJWA 3EUUA 3HUJB 2YEZA 1RIVH 2XI9A 2GTWA 4DKFL 1T5WB 1R3LB 5DEGB 4HUVB 2QQLH 1FCGA 5CEZH 3CPLA 1JF6A 3X3GH 2OMBA 5CD5C 2DI8A 4S1RH 4OBSA 1F4WH 3T04D 2VH5L 3CCHA 2NX5D 3UYPA 2BMKA 4FQHB 3C6LB 5EU5B 5IGXL 1P7QB 3O8XC 3BPOB 5F1NB 4APQB 4OF3A 4FN0A 4R0LA 1MAJA 5D7LA 1WWWX 3O9WC 1I1AA 3T4AB 1TVHB 2IANA 3BKMH 3PWPE 2HT3C 4S0SD 3RNQA 1DBML 5BOZG 5KVEL 3QQNA 1MCBA 1MLBB 5HYJD 1PX3A 2P45B 4LSVL 4Y19A 4Q97A 2APTA 1G9MH 1U0QA 2F58H 4MJ4A 5D2NB 5I1IL 2V5MA 4MLIA 2XTJE 1MQKH 15C8L 4LVEA 4PBVC 5SWZB 1II4E 1I1YA 5JHLL 5MEOB 1FPTH 4KKAC 4X4XB 4HXAH 4HPYH 3LKNB 1UKTA 4JG0H 4LNVA 3VRJB 1OAXH 1RIUL 1MCHA 4JJ5B 2EKJA 4XC1L 5FKPB 2VL5B 5KSAA 2ZUQB 1M7IA 3H9YA 3BW9A 4DGIL 1JWSA 1RZFL 2VXUH 1KLUA 5E9DD 1HDMA 4JVPA 5C70A 1MJ7L 2VDNH 3PL6D 4XBGB 3GNML 4UQ2A 4X8XA 3VRLE 1YN7A 1BM3L 1T5XB 4XPBH 1CLOL 3LEXB 1W0VB 5ESQA 2FEDC 3TIEA 4WHTA 1LQSR 3KPRD 2IPUK 6CGTA 5HI3C 1D6EA 4H1LG 3UTSD 3BUTA 5CHNA 1G7IA 3RWJB 4TSCH 3DO7A 4CNIA 3DVNA 5E8PA 1A6AA 3VGBA 1UXWA 1MNUH 3QPQD 5F6IC 2DMKA 3G9VA 4M7ZB 1EAJA 4LKXB 3T08A 2AJVH 3BDYL 4O51A 4PJDA 2ADGB 2DTML 3DV4B 2R2BA 5F96L 2AKRB 4YXHL 1J0YA 2EDHA 4X6EB 3O4LA 5JXAL 4X6CB 1EAPA 4PRHB 1AHWA 2OZ4H 2YD4A 4OLYL 5HD8C 5JW3H 1PBYA 1IAIL 4P3CH 1JYNA 3G9AB 4GRMA 4RQQA 1GGTA 4AYFA 1CK0L 4UILL 1MCIA 2K9UA 2EXWD 4LFHG 4ZO6A 3RU8L 4P2CG 3OR6B 2DIJA 3S88L 4H8WH 1ULVA 1IC7H 3FB7B 5IBLC 4FFVC 1PAMA 2FYYA 5IHZA 5DSCA 4B53A 2HRPH 3O2DL 5LJYH 2CMRL 4ZS7H 1DQML 1MUJA 1KJMA 3CSBA 3P4OB 1A7OH 3VGDA 3D2UA 4ZDHB 4ZUUB 1PW3A 2P7TA 3MLRH 4YC2B 3BQUB 1NJ9B 1KIPB 1EUTA 1KJ2A 3LKRB 3DSFH 3QO0A 4NDMB 4K8RD 1L7TL 2VXSH 1UKSA 1CFQB 3TJHC 4X4YA 2R2HB 2MSPA 4WY7L 3L3JB 2FWOA 5CMAB 4GKOA 5B38A 2GJZB 1ZLWH 3EYUH 4HT1L 3TN0D 5A40E 2L7JA 4HF5L 4L3AA 2V2XA 4KK9D 4NHUA 4JHWL 3AAZA 1GGBH 5DTFB 3T4YA 4PJEB 4YHPB 3G08A 4I0PA 3FO0L 3GM8A 1A7RL 4HUXB 1EEYA 2CUMA 1ZEAH 5HI4D 3BHBB 1ZWIB 1ETZA 2C1PB 4GBXA 3DBXB 2P5EB 3MJGX 5CZXC 2EEDA 3HZKB 1CFNB 3VRIA 3IDMA 5IVXB 1OAKH 3O2WH 1CF8L 4BQBA 1RZKH 1CZ8H 5FYKH 5LAXB 3P73B 3QR2A 4G9FD 4X80H 5I74C 4QRPE 2XYCA 4NO0B 1MCWM 1OAQH 5EZLA 1YNLH 3JV0A 3ZHLA 4PY7A 2CLZB 5CEYA 1WK0A 1ZT7A 4HWBH 5SWSA 3LPGA 2DLGA 3FB5A 4YZFF 1LWRA 1BBJA 1MREH 4YR6B 4ZUTB 3SDDA 4L5FL 4LF3B 1IGIH 1NQBA 1YMME 3ARED 1YNKH 3NABL 2W0LA 1E4XL 5GGQH 1NC2A 1C12A 1S9XB 4WI6A 5C09D 1E27A 3UPAA 3G5XB 2EKSB 1BQLH 1X4XA 2YRLA 4JRYD 4WFFE 4QRSB 1UWGH 5MEPB 3B2VL 4ZAKA 2PW2A 2BSTB 4UTAL 1BVKA 1VKXB 2YOCA 3BOVA 5JMOC 5SWQA 3RDTA 5C0GA 3KLDA 2VRAA 3NH7H 1HQRA 1IAMA 4AEIH 5HHPB 3MFFA 2FJGA 2O93L 2OR8A 4JQVA 3IDNA 4EDXA 3H6JA 3O41A 5TF1L 1JN6A 1CFSA 4F58H 2VISB 4OD2A 5ADPL 4LVHC 1JI1A 4EVNA 3CXHJ 3L6FB 2V2TA 4HV8B 5JIIA 4MAYB 5FYJL 2AABL 2ED9A 2YRPA 5E2TH 3WO4B 4I18C 3MRCB 5BO1H 4R96B 3F65A 1ZT1A 2HH0H 3I50L 2QTEA 2C3WA 3D85B 4XWGL 4L8CA 3L3HB 2H41A 7FABL 3QG6A 2X4RA 1LEKA 1Z2KA 2LABA 5FGSA 2Y6SD 3B3IB 2DQFB 5JHDA 2H2SC 1C5CL 2P43B 1ZHLA 2ICES 5LGKA 3CU7A 4OM0L 2D7OA 2VQTA 1D9KC 3RY6C 5DURD 4AL8H 1H3TA 4YIQA 2DQIH 5DZOA 1I85A 4YEEA 4OCSL 3GMLA 5F97E 4KV5E 1IKFL 1X5HA 4OKDA 3WXVL 4Y2DB 2AV7B 1QUNA 1N7MH 5IBUB 4HKXA 4Y4FD 4RWHA 4OSUH 3GGWA 1GPOL 4MXQC 3ARYA 3HE7A 2CK2A 5J9PB 3ZDZF 3V5KB 4WUUE 5DWUH 2NY4C 1JGEB 5HVHB 2FIRT 1SMOA 5JO5B 4YGVB 2RJMA 4CDHA 1E4JA 1U6AL 3PWJA 4Z8FH 4V1DD 4NFCA 3C9NA 1OM3H 1U8PB 1LO5A 3EKCA 3IJYA 2JJSC 5A2FA 1P7KA 5GHWL 3BWAB 2V9QA 3S7GA 2B2XL 1AR1D 4HH8A 4GW1B 1KYOJ 4MB3A 4PG9A 4YHMH 2W9EL 3RVVC 4JB9L 3GRWL 1XF5A 4EIZC 5D72L 3WEXA 5C6TH 1RK0B 2AJ3B 1X5LA 4P99A 3VH8B 2VL4A 1BOYA 4JRWA 2IBZX 3P77A 2I25N 2QSVA 1SJEB 4OV5B 3OR7A 2DQHL 3CXDL 3MNZA 2Q8AH 1S7SA 1UM5H 1U3JA 2Q6WB 4X98A 5TE4L 4U0RC 3LKOA 4D0DA 5I8EB 3QDJD 2D9CA 1GZQA 3GHEH 3G5VB 4UT7L 4ZUWB 1B2WH 1L4IA 2DBLH 3EYQD 1IEBA 4QRRB 3MJ8B 3SQBA 4XXDB 2A0LC 1IEAB 4KY1H 5F7NC 3IJSA 1CT8A 3GSQA 1NFDB 1AGEB 2M26A 5F71A 4Z9KB 2CKNA 2IH1B 2PYED 3GMPB 1CE6A 1OTSD 3QJHA 1CXHA 3C8KA 2AXGB 4FFWC 1B4JH 3PJSA 2YKLH 1JF1A 3BDBA 4I2XA 5TE7L 4DFIA 5JW5B 3GSVB 1N8ZB 3I84A 3FL7A 5F3BA 2JK5A 3QXVA 4FQJH 2A6KA 1VGEH 2WUBH 3AROA 4O00A 4R90L 2BVUA 1IE5A 3OGOE 1AO7E 1S7UB 2UZIH 2DYPD 4N8CL 1MIMH 4CMMA 2VKWA 1QEWB 3RL2B 3ROLA 5IHBA 3T2OA 2FLRT 2DF3A 4K9EC 1L9MA 4JGMA 5DRNB 4OZFB 2H32H 3QCVH 2XPGB 3C60D 3HB3C 3JWOC 2XZZA 3V52L 1JNHB 2EDLA 2ZJSL 5BS0B 2OLDA 1KPUA 1MFDL 4G8GD 3PQYE 3QA3A 4IOIB 3HR6A 3AB0C 1K4DB 3BH9B 5BVJA 4NKDA 5SX4I 5ITFA 3HAEB 1TNNA 4PJEF 2DLHA 3FKUS 2X4PB 4M02A 1KB5L 4KJPC 4QT5A 3MRNA 4N5UA 3GJEA 2KQMA 1JMXA 1DBAH 3V7MA 4NO5A 3QZWA 5IHUL 1XF3A 5TF0A 4Y16C 4Z77B 1UH3A 3O8XD 4NGHL 1A6VL 5IVXF 5IR1B 4LASH 4C58B 2LU7A 1JYWA 2AGJH 3O9WD 5FO8A 5FEBA 5EUOB 2ICWA 3EGSB 4W4OA 5EA0H 5T3ZH 5ABDE 4KPHL 2AJSH 4U4BA 1RJZB 4MHHG 3U4EB 4P46D 4U1SA 3WNMA 3O6FC 4YDLC 1FC1A 3NCBB 4FZEL 2NXZC 5BRZD 4KJQD 3WKNA 1JPSL 1OHQA 1TJIL 1MFBH 3T0WA 5I9QC 5JNYB 1VEOA 3I3DA 5FCUH 5ITBL 2PXYD 4WTWA 2C9AA 1UYWH 3AS2A 4KKAD 3KPQA 1V3JA 1QRNA 3UJJL 2GJ6D 1X5XA 3RA7L 4OIBA 1HHGB 2BNRA 3KPTA 1SEBA 1BVLB 1G7JA 2PTTB 4YQXH 5HPOA 1I1FB 4J3TA 5ADOH 4NZTH 1ZTXH 3MLVH 4AIXA 3C87A 1LMKA 1W0WB 4U1MB 4ONFH 5HYIA 3FQNB 1XGTA 3TWCH 1CR9L 3QJFA 5CIPH 1G7LA 3ULUF 3FO2A 5E2VL 4HULB 2AK4E 5E7BA 2GSIB 2UZXB 1CL7H 3MRBB 3K3QA 4LLQB 2E3VA 1CD8A 1R3IH 1O5DT 1FFPA 2Q1EA 2FSEA 4U1GC 4KXZI 1HI6B 2A9NH 3WFBL 4L8DA 1XF4A 2J5LC 2BSRA 5I1JH 1AGDA 1SY6L 3P4LA 3PABA 3QEQA 5DEZA 1JK8A 4S1DD 3KGRA 3MRRA 4LPXA 4TUKH 2LU3A 4TOYH 4M9OA 3CC5B 4UT9L 2W0FA 3S9DB 1Q9KB 1DQTA 1YMMA 3U6RB 2IPUG 4LMQE 4FTVA 2AW2A 5JQ6L 3B9DA 1T7YA 3ZYIA 1J9CT 5DRZB 1IM3B 2MPAL 2HKFL 1IAII 2R1WB 1J88A 4G5ZL 4CKVX 5GS0C 4NQEA 1YEEL 4ZFGH 5HD8D 1IAKB 3PG2A 3I75B 5I17B 1KPVA 3TBSB 4HQQL 3U0PB 1HSBB 5D1XB 4J4PC 1VACB 5C0AB 5MHSD 4NT6B 4OGXL 3FOMB 2FR4B 1FH5L 1NAKH 2W59A 4OB5H 4AIOA 1VGKA 1ITCA 1IC5H 3O0RH 2WQ8A 4JR9H 5IBLD 4WU7B 3GI8L 3PV7A 5J7CC 1RV6X 3UZQA 1M7DB 5I8CB 1DL7H 4G8IA 2WBJA 3E2HC 2ZCLH 1K5NB 2G5RA 4NNXB 3UBXI 2IAMD 1G7HB 3O81A 3UJIH 3L7FB 1P4IH 3ZTNH 4JRXD 4JFZL 2R29H 4P2OA 1IMHC 2Q76B 3U2SB 4ALAH 4XVUD 2C3XA 5BZDA 4OCWL 3S6CA 5HBBA 1X5IA 32C2A 3IETB 5L2KB 3TVMD 4Y88A 4M3KB 2FX8L 2NZ9C 4MJ5A 2XZAL 4ORGB 1MHHA 2VDML 1IQWL 2P5EE 2A38A 2A77L 5EO1B 2Z31B 1TNMA 2XN9B 3P0VH 3MREA 2GFBA 3W39A 3TA3C 2ZP0T 2WP3O 3QI9B 3X14B 5GRJL 4HJ0D 2H6PA 1S7XB 2J6EA 5TDNB 4I5BB 1DN2A 4F7TB 5CZXD 5DJ6B 5IVNA 3QG7L 3MRFA 4MJIB 2YD1A 2XV6B 5B3NA 1HKFA 3PHOB 2HVKB 2AXJA 4BH7B 3GZKA 3VD7A 4PBXA 3SE8L 5DC9B 4XB7A 3H9SD 2NY5H 2VTFA 5F88B 1S3KH 5HHXH 1DQLH 1MJUH 3CVIH 2IFFH 3HI5H 5CIPA 3MROA 1FSKC 3RHWK 3U1SL 4TNWK 4P4RA 3MRJA 2IBGA 1R6VA 5DMGD 2C5DC 1E4XI 3WIHL 3OTTA 1BZQK 1FO0H 3EYOA 3OF6A 2HLFD 1NFDF 1YYLL 2ENSA 3BD4A 5CD3B 4K9EL 1P84K 1IGYA 3JWOL 3ILPA 4GXVH 1S9WB 1ZE3C 2XQYK 3B4NA 2APVA 3ULUE 3AGVA 3HRPA 4KQ4H 3HMWL 3SGKC 2YUVA 3WN5B 2BVEA 3CDGB 3MA7B 5FECA 4OIAA 3BP4A 4Q9CA 2AXFB 4P5TA 4JY5L 4M61A 4ODBD 5CP7B 1F90L 3PV6A 5T3XH 4U6XB 2CDFA 5GGUB 4XCEA 1K2DB 2CKBH 1R5VB 3BO8A 2GITB 2NY1D 4I0CC 1JYVA 4YLQT 3X3FH 4P59L 2ENYA 1BD2B 5C0DA 1BQHA 2WAHA 3T3MF 3KYAA 4UDTA 3BSZH 1UJ3A 4XAKE 3HE6A 3LQAH 2DQEL 1IGML 3VFOB 2X09A 4DQOH 2D7PA 1KCUH 3VMNA 4PRPB 2DQTL 4RRPG 3F5WA 2YPKB 3TIDB 3K4AA 7CGTA 4ODHH 2A74B 4X83A 1A6WH 1AIFA 2GTZB 3SQOH 1FRGL 4LARL 5ALCL 3P2TA 2AJUH 4PG2A 5EUOF 5C3LD 5IJKA 2P5WB 4XP1L 4WNQB 5JLZB 4PUBL 1DN0B 3ARDC 3B9KB 3T0VA 4MQTB 2HJFB 5E08H 2P46B 3OXSA 1AO7A 3CMGA 3WIFB 3QB7C 3HUJA 1KEGH 4MXWH 4YHIB 1T5WA 1X9QA 1R3LA 3BZDA 4XP6H 5DEGA 4P5MB 5HGHA 5GSRB 1KENH 4JO4L 1DLFL 5ID1B 4KROB 4V2BA 3ZSTA 3EO9L 5AWNL 4FQHA 5EU5A 1JPST 2QHLA 1XZ0B 4TVPE 1XIWC 5F1NA 4APQA 1HKLL 3MA9L 4POUB 3S8WA 1TDQA 3LPWA 43C9B 2ZCHH 3F7VB 3IXAB 4NHCH 3T4AA 1TVHA 3V6OC 3L5HA 3QIUD 3L95B 3ALXA 3Q1SL 4QOKB 1MLBA 5KVDL 1HINL 3HG1D 3TBYB 4KHXH 2A1WL 3KYKH 1CDIA 3H3BC 5D2NA 5FYLE 4JHBA 1A7NH 2PKDA 3RIFF 1IEHA 5DJ0B 5F7EL 5SWZA 5C08E 3MCLH 5MEOA 4PGCB 4F3FB 2Y36H 5T5FH 4X4XA 2APBA 3H42L 2QSCL 3LKNA 3VRJA 5GS0L 3RVVD 2NX5B 4JJ5A 4OD1L 3PP3H 3VXUD 5FKPA 2W60B 4OGAC 1D5IH 5BMFL 4QRRE 4XPAH 1IM9B 3TNMB 3S36L 1YEDB 3OPZH 3FONB 1NSNL 4M62L 4XBGA 4PJFB 1NFDE 5JOPE 5HYJB 4XPTH 4DZBA 3JWDC 2I60L 4JPKH 4P2RB 3NACL 2HTLD 4OLWL 3BP6B 1DBBL 3FFCB 1EH9A 1T5XA 3LEXA 5DHVH 2X10A 2CKBA 1T22B 1BJ1H 2OL3B 4LHUG 2MCPH 1YECL 1LO0H 1W0YT 4FQLL 5I1KH 1NCBH 2ZUUA 5D5MB 2YN3A 5GJSH 2E27H 2BVPB 1MVFA 3L1OH 4W6WB 4LQFH 2MHAB 5C7XL 1UXSB 4Y2OA 2HJLA 5GGRA 2R0KL 4U0QB 2NW2B 1WLHA 1BFVL 4LKXA 2VLJD 2K7QA 2O5XL 1T6VN 2ADGA 5E9DB 5HHQB 4OQTL 5HGDB 5EIVA 4X4ME 3KXFE 1KTDB 3GHBL 3DV4A 4DCQB 1MF2H 4HEME 5DJYA 4LDOB 1BFOA 2AKRA 1NCDL 3BD3A 4X6EA 1UB5B 1AE6L 3CZJA 3ARZA 4M43L 3HB3D 4PRHA 4X6CA 4H0IA 5HHOB 4LGSB 1KIQB 2NR6C 5KBNC 3S96B 5J1SC 3QUXC 5HXMA 4Y4KC 2LTQC 3UTSB 1CD1B 5DZNA 1RULH 1ZVSB 5H37H 3S35L 4ZOBA 3DX8B 1GAFH 1FFNB 4HIJB 3FB7A 4EZMA 4XTRC 3D25B 4LK4A 5EUOE 4L3EE 4QTIL 1NLDL 2X4OB 2MNUA 3P4OA 1G7PB 2BRRL 4M6AA 4ZUUA 1NUDA 1F45A 1H9VA 3BQUA 3RY4A 2P49B 1NJ9A 1KIPA 1FNFA 3LKRA 4LPTA 1GGCL 4PGBB 4O58L 3SE9L 5DO2D 4G9DB 2VERN 3ARXA 3BKCL 12E8H 4OT1L 3UTTE 4LLAA 5F1KC 2R2HA 5CMAA 3L3JA 2GJZA 1KCKA 4QHNB 1ZLVH 4XNZB 5MEND 2NXZD 3CSGA 3MRPB 2F74B 2MKLC 3GJFH 3LRHA 1PG7X 3SY0B 5DTFA 1M7XA 4EBQH 5CJOL 4PJEA 4YHPA 5FM8A 3MCG1 4EXKA 3IAGC 4KC3B 4HUXA 4AG4H 3KPMB 5FUOL 2VDOH 3BHBA 1ZWIA 3W0WA 2C1PA 2XZQH 2FLBT 3DBXA 2P5EA 4OLUH 1I9JH 3HZKA 1CFNA 4PJHB 5I8OL 5IVXA 4U2YA 3WIIL 4GAGL 1Z9OA 1H5BC 1Y0LB 4NKQB 4RGNB 3RAJL 4HUMB 4C4KT 1CLZH 1YEGH 3P73A 2C3HA 3RI5F 3M8OL 4NO0A 2OCFD 2VLME 3NA9L 1AY1L 5EPMB 2CLZA 4FFYH 4Q74A 2KL6A 2HRLA 5I18H 3OWEA 3MLZL 5BV7H 1KV3A 1ZVHA 4YR6A 1DBKL 4ZUTA 2Y7QA 4LF3A 1I4FB 2D2OA 1OGTA 2R69H 3LIZL 2B7DT 1EHAA 3C2AL 1CGWA 4OLZL 5GGVY 3OJ2C 4LU5L 1S9XA 1HOCB 4OAWB 4HPOL 3T0XA 5KW9L 3G5XA 3I9GL 5GGSB 4EUPB 2EKSA 4ZOEA 5EDXA 4IMKC 3MACL 2ITDB 3MODH 4QRSA 1F4AA 1KJ2L 2VXVH 4L8BB 2BSTA 1VKXA 2NLJA 1PVHA 1A22B 4G9FB 5DD1L 3MSPA 4O4YH 5GS0D 4PBWD 3GMMB 2VITB 3OZ9L 5HDQH 4X9GA 4U7SA 5ENWB 5IG7A 2CIIB 5HHPA 3C8HA 2P8MB 4M1GL 3RKPA 5SV3A 1AGBB 1IGTB 4PR5A 4RFOH 5DQJB 3M17A 4GW5B 2DQDL 4W6YB 1HE7A 3RFZC 4KFZC 2VISA 4CDGC 4UQ3B 2V5YA 4FNLH 3UTQA 5C09B 5F9DC 1QFUL 3L6FA 3PP3K 3SJVE 4MAYA 1BF2A 4XMPH 4YJZL 4GMTH 1MCPH 4MNQB 1U3HB 1RZGB 3L5IA 3P4MB 4WHYH 4OGYH 1OLLA 4OJFL 5EU6B 4R96A 4W81A 4J1UB 4PGZA 1NC4A 3NCYP 4JM2C 1WIPA 4OZIB 2XN9E 4QY8B 3D85A 1J1OH 2NY3D 3L3HA 2VSCA 4XVSL 4K7PX 1EHXA 5C0BE 3WV0A 3ARFD 5ECJE 1K9TA 3B3IA 2DQFA 1J8HD 4IIQB 1TVDA 3I02B 4KKLC 2NZ9D 2EDOA 4QCIB 3LZFL 1NBZB 3FB8A 5J13C 3GJFA 2WWMD 4NBZB 2AJZB 3F7RA 4PJBB 4D3CL 5I30L 2XNAB 6FABL 3S4SB 3SO3C 3JWDL 4Y2DA 2AV7A 3RZCC 3CVHL 3QISA 2IMNA 4KMLB 4HJGB 2D7MA 5DC0A 1LD9B 4HLZH 4Y4HC 1EGJH 5J9PA 1I3UA 1XEDA 2P8PB 1MFEH 4PJFF 1UACH 4HBQA 1KFAL 2F54E 1HEZB 1JGEA 1KG0B 4ISVB 1JF5A 4QF1B 4P2QE 5JO5A 3IFOB 4YGVA 1NGPH 4KTDL 1RVFH 4ONGH 4TRPH 1DVFB 2JELH 3TZVB 4KKCD 4OBRA 1AQDB 1U8PA 5FHAH 1JFQH 3LN4B 5JZ7C 3BWAA 3HMXL 3VXRD 1MWAL 1RHHB 5SX5K 2EDEA 5IB3B 2FX9L 4XAWL 5D1QB 5EBWB 3NTCH 1KXQE 4AZ8A 1CDBA 2G75B 1RK0A 1WFOA 2AJ3A 2Z92B 1MCEA 4XCYA 3LH2H 4PJ5D 4YXKH 2WZPD 3QFJE 3VH8A 2BVYA 1SJEA 4WTZG 4OV5A 2JLLA 5E6YA 3GSNH 3MTRA 2Q6WA 1YEJL 1A5FH 2OTUB 1ORSB 4HS8H 1YNTB 5F21B 5I8EA 5GS1B 4E41A 3G5VA 4ZUWA 4PRDB 1MHCB 4TSAL 1CGVA 4QRRA 3MJ8A 1BIIA 1ACZA 3UROR 4O5LH 4QXWA 4XXDA 1PLGL 1IEAA 4V1DB 3MLWH 1FL5B 3RWIB 2FH6A 1ZLVK 2X9XA 3ET9F 3OKMB 4PRPE 3GJFK 4I3RL 5I1CH 1NFDA 2IH1A 1RUAH 3CAFA 3GMPA 4JZJB 5IUSA 3EFFB 5AYQA 1JRHL 3MUZ1 4MXVF 1EJOL 3I6GB 2AXGA 3AMLA 1C7SA 5FUCE 2P5WE 4AEFA 4RMQA 5JW5A 1ONQA 1N8ZA 5GS3A 2YPLE 4WUKL 4NKIH 1IVLA 4CW1A 4PJIB 1S7UA 3EAKA 3VGAC 4YDKL 3RL2A 1QEWA 3OG6B 5GGVL 3VA6A 5C0IB 4F37K 3PDOB 2WUCH 1Q72L 5DRNA 4V2CB 3U0WL 2V7HB 4OZFA 5TDPB 2XPGA 4JVUA 4OLEA 4XNYH 1JNHA 5BS0A 4UIMB 1IKNA 3KAAA 3VXQB 1IGFH 4P23D 1A14H 1BX2B 5E5RB 3PWVB 1QSEE 3DRTA 4IOIA 1EFQA 3RTQD 1K4DA 3BH9A 4YHNB 2AEWA 3X11B 4NWUL 1XGYH 2IPKB 4TN9A 2DL2A 5CFHA 4KK5C 1I1RA 3HAEA 1C1EH 2KZ1B 2E7CA 2QEJA 3FRPG 3HS0B 2LAAA 2X4PA 4L3CB 5C6PB 1OP5H 1A3RL 4R97B 1RURH 5B4MC 3T1WA 3U30C 4Z7WB 2YPVL 1X7QB 3DJ9A 3TJEH 1S7VB 5E1HB 2VZUA 4Z77A 4R7DA 1JTPA 3TT3L 5IR1A 4PJHF 4YEFA 4R8WL 2DYPB 1QRKA 5IK3B 3MMEB 5EUOA 1YDPB 2AQ2A 1D6VH 4QXGL 3SGJC 5BW7C 3EOTH 3ZE2F 1FNSH 4GAFB 1PDKA 5CINL 3U4EA 1INEH 1I9IH 3LCYA 3QHZL 1MI5D 2NX5E 5F89B 4G8GB 1PKOA 4KHTL 3LHPL 3OAUH 5JNYA 1F4YL 1FGNH 2QHRL 1LILA 1F4XH 1TETL 2ZWLT 2P4AB 4PJFE 5T33L 4FXKB 1HHGA 5HYJE 1BVLA 3RGVC 4OGAD 1FCCA 4C56D 3O8XB 2PTTA 5HY9B 1I1FA 1EEZB 2YA1A 4UNUA 3O9WB 4NQDB 1B6DA 1RU9H 5J4MA 5C0ND 5MERB 4PGDB 3ULVH 3DOSA 4H26B 5HHNB 3P11L 1W0WA 1UZ8B 4U1MA 5FYKU 1FYTD 5DJAB 1GIGL 4K3DL 4P46B 4PJCB 4K71C 2IQAA 4OCLC 5D9SB 3UDWA 5D7KD 4P9HH 4HD9A 1E4KA 35C8L 5IESH 2V9RA 3VFRB 4FQXA 1Z3GH 2EDFA 2GSIA 3MRBA 5DK3A 1IAIM 4NQCD 2R1XB 2Y06H 4LLQA 1T20A 3QDGE 4XBEL 2BRQA 5B8CC 5E9DE 1JGLH 1HI6A 4JDZB 1NBVL 4F7CA 3FQXB 4OTXH 1T66C 2NPLX 5H35B 2ZUTA 1D5XB 1S9VB 1EHLH 3WJJC 1I75A 4TQEL 3CC5A 3BN3B 4K07A 1QNZH 1CDCA 3PGFH 1AJ7H 3BGMB 3JV4B 1Q9KA 2E7MA 3U6RA 3KPRE 5E6ID 4H20H 2DBJA 3UTSE 4HWEH 1FFQA 2ZUWA 5DRZA 2JJWA 1IM3A 1GXEA 4OZIF 4MWFA 4MMXC 3IDIB 1IAKA 4JG1H 5I17A 3TH3T 1LP9B 3TBSA 3U0PA 1HSBA 1MAMH 5D1XA 1VACA 5C0AA 4NT6A 2O5ZL 3FOMA 4G80B 2FR4A 2GJJA 3N06B 5CS7A 2HWZL 4LPVA 1KT2B 4ZUVA 4ELMB 5KANG 2YUWA 4WU7A 1CXEA 2MKWA 3ARRA 5F6IB 1UEMA 1A47A 4DGVH 1M7DA 5C1MB 5I8CA 3BFOA 4Q9QH 4UNVA 2H1PH 1AKJB 3KYMB 1K5NA 4NNXA 1LK3L 3IDXL 4KVNL 2GK0B 2R0WL 3L7FA 1Z0MA 4ZO7A 4WCYH 1N6VA 4Q6IC 2H2PD 2FIKA 4ENEC 1R5IB 1T2QH 1OP3K 3TP4A 2FCBA 3C6LC 4ZQKB 1GGYA 5GRUH 1R0AL 1P5VA 2FX7L 3VFVB 3QPXH 3WCYA 4K3JH 3IETA 3V6ZA 5L2KA 2OK0L 1VFUA 3S34L 4ORGA 5D7JC 5L7XH 4JO3H 1NCAH 3RIFK 2BOBB 2ZOLB 5ICZB 1YY9D 2GIYA 4MNGB 4PJHE 5EO1A 2BY3A 2Z31A 2XN9A 3BISA 4GQ9H 3GSXB 4LGRB 3QI9A 1ADQL 1ZOXA 5IEHB 4JFEE 3X14A 3NCJL 4N9OB 4WW1B 4IHOB 5TDNA 5AAWA 4F7TA 4YE4H 3EO1B 5DJ6A 5JW4R 2V17H 1CE1L 3SGDI 4JRXB 4MJIA 1SEQL 1FZOB 3PHOA 2HVKA 3ALPA 4MMZC 4BH7A 5IBTH 1AI1H 3QWOB 2DAVA 4XHJD 1RUPL 2X1XR 1HIML 4MAUH 1WCBB 3OKEB 5F88A 1K8IB 3WHE1 1YPZF 2VDRH 3DYOA 3DYPA 4NWTH 2IQ9L 1GGIH 2P48B 4ZXBC 2A73B 5GGTL 3SDAC 2CGRL 1YQVL 4ZTOL 5FOJA 5CD3A 3ARGC 1GC1H 3MGTB 3L5WB 5F7DB 4G9FE 1KCSL 3P30H 3HR5B 3MBXL 1FBIL 3EW3B 3MLYL 4YH6A 1I7UB 4OFYA 5IF0B 3CDGA 3WN5A 3MA7A 1T80A 2FNBA 1NUFA 4Q58C 4XNXL 1JHLL 2AXFA 2ADFH 1UWXH 4PYGA 3H9SB 5CP7A 5I74B 4JN2B 1KB5B 3WKML 4RMWA 3QUZC 2NY2C 4U6XA 3BJLA 1ODAA 3KR3L 5GGUA 1R3JB 2DLFL 5C09E 1N6UA 2B1HL 3OJVC 4K23H 4M7LH 5E5MB 4ZFZB 3WFEL 1R5VA 2GITA 1Z9MA 4WEBL 4AH2B 1TJGH 4JRYE 4Z7UB 5C0RL 4KJYB 5IVOA 1CGSL 1RMFL 2J8OA 3P0YH 4ZOAA 1BD2A 5F3HB 1U41A 2ARJQ 4JANA 5I75C 3BH8B 3ARWA 2CRYA 4WEMB 1WFNA 4QGYA 3VFOA 4Z7WF 3DWTA 4ZPTB 4PRPA 1ZAGA 4MA7L 4NZUL 4JKWA 2YPKA 3TIDA 1QO3B 3B6SB 1XF2B 2GTZA 5J11B 3QEUB 3GMNB 5JQHC 2DKSA 3JUZA 2OR7A 2P5WA 4CVWA 4WNQA 5JLZA 4YX2L 3VFSB 1DN0A 3B9KA 4U6HB 4PRNB 3VI4E 2HJFA 1A3LH 3NAAH 2YK1H 3WIFA 4UIKH 4J23A 1ZGLB 1MVUB 4YHIA 1NAML 4I77H 4OLXH 4P5MA 1QFWM 2V6HA 3QUYC 1G0XA 3CSYB 5GSRA 1N59B 2CLVB 4LVHB 5FCSH 3T2NL 5ID1A 1KJ3H 5T3XE 3U9PL 1Z5LB 1FDLL 5IFHH 1XZ0A 4XMLH 3CSPA 4WO4D 1S8DB 4FXGB 4Y4HD 1FIGH 1FIEA 1TENA 4HFUH 3EDKA 2R56L 3BT2L 43C9A 3F7VA 3IXAA 4IRSC 1OARH 3L95A 3RI5K 1A0QH 4JKPH 1IGCL 4QOKA 1QSFD 4U31A 4U6YB 2ARWA 4X7DC 3TBYA 4CU7A 1DSFH 1UT9A 3TO4D 5C9JB 1QKZH 3PP4H 2ED7A 1X5YA 3MRIB 4P48A 5I76B 2VC2H 3VMOA 4KVCH 1F5WA 3TH4T 3IRPX 5EIQA 1A4KB 2DKMA 5TJWK 4F3FA 2F8VA 3VXMB 1CVSC 4ZFOB 1OAYH 1VERA 2F53A 3PDDA 4Z7NE 2W9DL 4U1KB 5DLMH 5DHYB 1YPZE 1IM9A 2VXTL 4LRIC 3TNMA 1OD7A 1DBJL 2WINB 1N0XL 4V1DE 1YEDA 4HS6B 3FONA 3UYRH 1HYSD 2IPTL 3A0OA 2R0LH 3UAJC 3MLSL 4JE4B 5JW4Q 1Q9LB 4JPWL 4QWWC 3WD5H 3H3PH 3ARQA 4P2RA 1F58L 1N4XL 3HG1B 8FABB 3JWNC 3BP6A 5EO0B 3FFCA 1KEML 5EBMB 1A7BA 2C4FT 3W11C 1LP9F 2BFVL 3EFDH 1INQB 1T22A 1ES0B 1U91B 4NRYB 2OL3A 4M5YL 3FOLB 1JRHI 1KELL 4D9LL 5F7HA 3DURB 5K9JH 4X7TB 2G60L 4JPVH 5D5MA 4I4WB 4ELMF 3H9HB 1MRDL 2DD8H 5LBSL 2BVPA 3WFCL 2MHAA 4N1CA 1UXSA 3QDJE 1OVZA 3ILQD 1OW0A 2QR0B 1F3DJ 5HHQA 5HGDA 2H45A 1KTDA 4DKFH 1V7ML 1LE5A 4DCQA 1OAUL 1ZLUK 3O3BB 2EYTB 3A6CL 4U0RB 4MCZB 5LQBH 1SM3L 5SX4H 3OJDB 2FGWH 2PYEE 1UB5A 5F7LB 3NIGE 1F8TH 3WO4C 1LO3L 4PTUA 5HHOA 4PJ8C 1KIQA 5IGXH 3VGFA 4NSKB 3S96A 3L3KA 4X99B 3JTTB 1CD1A 5CCKH 4NJAH 4NPYB 1ZVSA 3DX8A 1F11B 2BP3A 4PP1D 4KK5D 4PLJD 1FFNA 1DFBL 4HIJA 3RUGB 4Q9RH 4MD4B 4Y1AD 2DJUA 4LLWB 5EOCJ 4ODWB 4MJ2A 5B4MD 2X4OA 4QXTB 3IKCB 3QXDB 4S1SH 4LDLB 2QQKH 1G7PA 4NUJB 5HGAB 2X4SA 3K4ZA 1RZ8B 4G8GE 5JHLH 2JIXB 3VD5A 3WDIA 2B0SH 1EHNA 4DN3L 3QFDB 1IBGL 3BIKB 4PGBA 4F9LA 3ZTJH 1RIUH 4XC1H 4G9DA 5JR1L 2EDQA 1HXMB 4IRZH 3WHXB 1AC6A 2BK8A 1RZFH 4TSBH 2PTVA 4QHNA 4LSQL 3TYFB 2BSSB 3AB0B 3ZZ1A 3MRPA 2F74A 2X89A 1KNOB 3DO3A 3PWNB 3SY0A 3BZEB 1BM3H 4DFHA 3DV6B 1NFIB 3QEGL 1QPXA 1YN6B 2IGFL 3KPMA 1DANT 1W72H 1ZANL 4ERSL 3MJ7A 4U6TA 3RGVD 4Y16B 3O3AB 4KJWC 1PKQE 3SDCC 2FD6H 5BRZE 1U8QA 2VAAB 1Y0LA 3MJ9H 5EIIB 1KCRH 3ZKSD 3NOIA 4PGEA 3P9LB 5EZJB 4KMQA 4P57B 4YDLB 2XOTA 1QG3A 5EPMA 2GJ6E 3BDXA 2VABB 4G6FB 1H3XA 5IVZB 2DL9A 2NXZB 2EH7H 2PYFA 3CUPA 2R0ZH 3G5YB 1T0MA 1FE8H 4N8VB 3U7WH 4M7KH 1JTOA 5BQ7B 4Z7UF 2I07B 4WHYG 3UTZB 5EWIH 1RIHH 4Q6YA 4Z0BL 4JN1L 3TPKA 4E0RB 2WWKT 4MZ2A 2EIZB 1HOCA 1T66D 3F62A 1IAIH 4ODUB 4YWGH 1N5YL 5GGSA 4EUPA 1CK0H 4HXBL 4HK3N 1LP9E 3EYSL 2ITDA 2F8XC 5JIHA 4R6UA 1BWWA 4KGLA 1WF5A 2CXGA 2GT9B 1F6AA 2J88L 5JPMB 4OFIA 1J1PL 3GMMA 1WFTA 4GRWB 2NY6C 3O2DH 1RUKL 4I9WD 1DQMH 4U1LB 3OAZH 1LVEA 5ENWA 2CIIA 5IROC 2P8MA 2PCPB 2XWJB 4OZ4B 1AGBA 1IGTA 2J8UB 4OFVA 5DQJA 4U1GB 4HLJA 4GW5A 3AS1A 2J5LB 3EZJB 1G9MC 4HLZG 5CSGA 5FF6B 4R4ND 2XRAL 4AEHL 4UQ3A 4WY7H 3HRZB 3B2UC 1H8OA 2FATH 4WHDA 3UC0L 2I5YH 1QBLH 5LWYL 2AEPL 3AVEA 4MNQA 1U3HA 1RZGA 3P4MA 2DDQL 4HF5H 3SEPA 3EO0B 5EU6A 4G6KH 2L0DA 2B8OT 4K3EH 4J1UA 3BKYH 3FO0H 2FH8A 4OQ1A 3RWGB 4MNGE 4OZIA 1A7RH 4QY8A 4LSSH 4F57L 1NGYB 4J8RB 1AP2A 2QSTA 1JZ4A 4IIQA 1IAOB 3WSQL 5H94B 3I02A 3V0VB 5MP6H 4QCIA 1NBZA 3H7BB 5KZCD 1FVEB 2BHZA 4ZS6D 3OB8A 4PJ9D 2B39A 2AJZA 2WWKO 4PJBA 4CADB 4AENB 2XNAA 1NLBL 1Q0XL 4L4TB 4HKZB 3S4SA 5DJDA 1PY4A 3FQRB 1AFVL 2GUOB 3LMJL 1V05A 3E2HB 1RQ5A 4MLSA 5J6GB 1I8MA 2E7LA 3FMGH 5B3JF 4HJGA 4JM4L 1LD9A 3NABH 3S97C 2P8PA 4YBQC 2D7QA 4PJ7F 5EZIH 1YEHL 3ULUL 3IS0X 3RL1B 2EIDA 4YFLI 1HEZA 3CXHK 1KG0A 2EDWA 1J8HB 4ISVA 4I8DA 4X9FA 4QF1A 5I6XB 4Y5VC 1PX4A 4ZXBD 1OGAD 3SDAD 4NFBA 1DVFA 3B2VH 3BYTA 3TZVA 1AQDA 4GSDL 3LN4A 3RKDD 2Z0BA 1P1ZB 1RHHA 3ARGD 3L3OB 3H9SE 2FGZA 5IB3A 1Q0YL 5EBWA 5D1QA 5DYOB 2FBOJ 2G75A 4IRJC 2Z92A 5BZWB 1QYGH 3FRUB 4L4JA 1WWAX 4G8EB 4H8WC 2VDPL 3RVUC 5IMLB 4RBPH 4JZNB 4JFDB 1JWMB 5AZ2H 5TF1H 1RZ7L 1ZLSL 2VUYA 5D1ZA 2CO7B 2OTUA 1ORSA 2AK4D 1YNTA 3D0VB 3ZYZA 5GS1A 3U7YL 2JTDA 2GYSA 1MHCA 3QUZD 4PRDA 2NY2D 5CEXB 2Y07H 1OP9A 2AABH 2L4OA 5F1IB 4OF7A 5FB8B 2BDNL 1FL5A 4ZNEA 3RWIA 1UCBL 3DNKA 3NIDF 4BM7A 3L3IB 3C08L 3VXRB 3EDFA 4JZJA 4XWGH 3EFFA 7FABH 4JFYB 5FKAB 4M4PA 5GRYA 5TPWL 4JHZA 1XF1A 2VR5A 5C07D 4PJIA 5EBLB 5C0IA 1DUYB 3PDOA 4MB5A 4TVPL 2V7HA 5IFJB 3TFKD 5TDPA 1P4BL 2CRMA 3BMWA 1ZHBB 2NY0D 2UUDK 2XXCB 4UIMA 2FBJH 1OTTC 3VXQA 5ICYB 1L9NA 1BX2A 5JMRA 3KWWB 3PWVA 4YPGB 3JV6A 3PDGA 4O9HL 5KVFL 5C6WH 4YHNA 4LSUL 4XNUL 3X11A 2IPKA 5ACLA 4MD0B 5L8LB 5F7UA 5DUML 1NMBL 4WDIB 3BAEH 4KMTH 4TTDD 5FYLL 3HS0A 1J5OL 4L3CA 4N68A 3C5ZC 2FJHB 3KHOA 3T3PF 3V4PL 3GSRB 4Z7WA 1U6AH 3T0ED 1X7QA 5LVEA 1YEKL 3LEYL 1OAZH 1S7VA 2PUQT 1QFWH 3OKYA 5KAQF 2DYPA 1EO8L 5GHWH 3IU3A 2D03H 2P24B 3VU2A 2XQBL 5IK3A 5CBEB 2ERJC 1YDPA 1PEWA 4OZHA 2HG5B 1GHFH 1UM4L 3ARDB 3HC3L 5D72H 1CFVL 3FN0H 5F89A 3O3DB 2QQLL 2DQHH 5KVGL 4Y5YB 3X3GL 1N3NA 3GDBA 2ESVD 1T1XB 1KGCD 4MQ7B 4S1RL 5B3JE 1F4WL 2OP4H 4N90D 2ORBL 5KAQG 1T7WA 4KTEL 4M5ZH 3IGAB 2VJXA 4PJ7E 4FXKA 4TUJB 3HG1E 3OKDB 1ROWA 3O8XA 5HY9A 4J3XA 1EEZA 3BKML 3SKNB 3O9WA 3DXAD 4NQDA 5MERA 4F15C 4PGDA 4NN6C 1EJ6A 1UZ8A 4XP9L 1JPFB 1S5IL 1G9ML 4PJCA 3QHFL 2BERA 3MRMB 3J8F7 3SOBH 3ZYOA 2F58L 1R24B 5TE7H 1NH6A 2XWTB 4GRWF 4YGAB 5D9SA 1MI5B 1SVCP 3VW3H 3VXUE 1KCVH 3VFRA 3WUWB 2R1XA 5T1LB 1FPTL 2CK0L 3MQIA 2OQJB 2J8UF 4HXAL 5EU3B 4JG0L 4U1HB 1OAXL 2CRZA 4HC1H 4LLYB 3KPSD 3B5GA 4JDZA 3H8NA 3FQXA 3EJZD 1RY7B 3QWRA 4M48L 2BHYA 4JCLA 2ZG3A 5MI0C 1DQJB 5H35A 1D5XA 2VXUL 4XGZB 4C56B 1MFDH 3BGMA 3JV4A 3DX7B 1BOGB 3B9EA 3TNNB 1QA9B 3NIDE 3HN3A 1P53A 4OCYH 1FYTB 5F44A 4KZEH 4XPBL 1SQ2N 3S98A 3IXTB 5DVLA 3IDIA 2FHBA 3CVHB 4PJ8D 2EE2A 5AEAA 3G6AB 1CG9B 2WQRA 4DUWA 4LRNL 1I1AD 4NQCB 2VLJE 5B39B 4OZGB 4BFEA 5FUCC 4G80A 4J2XA 2WIMA 4Y19D 1KT2A 2WBKA 3CFCH 5DQDH 3DSNA 1BGXH 4ELMA 2J4WH 2MQ3A 4G6JH 5EO9B 5JXEC 5F7WC 4NN5C 5C0CD 1Q1JL 3MXVH 3NFSL 5KTEH 2AJVL 5LXGL 4PJXE 4HGWB 1Y18B 5I19L 2EDYA 4FZEH 1AKJA 3KYMA 1ZV5A 5D6DC 1TJIH 1UA6H 2GK0A 4JZOB 4RWYL 3O2VL 4O2EB 3TT1H 3LKQB 2X1OA 5ITBH 1MWAB 2OZ4L 3DUUB 5KSAD 1ZSDB 5JW3L 1R5IA 3GRWA 4ZQKA 1RUQL 1I3VA 3DVIA 3REVB 4BFIB 1QTYT 1JJUA 1OT2A 1U8MB 3VFVA 3QXUA 3QUXB 4Y4KB 1AXTH 4N0CC 3ARVA 2LTQB 4KDWA 3G6DH 1AH1A 3RRQA 1IGJB 3BWUC 4H8WL 2BOBA 2ZOLA 5ICZA 1IC7L 1V7NH 4LVOC 1EO7A 2R4RL 4MNGA 4M1CC 3GSXA 1TJHH 3I2CH 2HRPL 1YJDH 4ZS7L 5IEHA 1A7OL 5E2VH 2D7TH 3MLRL 4WW1A 4IHOA 3BN9D 4J3VA 1OB1B 3EO1A 4HDIB 4ZTPL 4JRXA 2MOVA 1FZOA 3SDCD 5MENE 3QWOA 1SY6H 1QR1A 1TMCB 2VXSL 4N0YL 5ESAB 4LMQI 5FGBC 1K4CB 1WCBA 3GBNH 3OKEA 5FUZH 3EYUL 1JV5B 3V5HB 1K8IA 4UT9H 5CILH 3WNPA 1P6FA 2RHEA 4LSDA 3HI1B 4RIRB 3E8UL 1GGBL 2A73A 4YXLL 3D39E 2AK1H 3E6HB 2EIEA 1TTUA 2MPAH 2HKFH 5DGRA 1ZEAL 4RAUB 3KPLB 4LDEB 1HILB 1T83C 3MGTA 3L5WA 4HG4J 4PB0H 5F7DA 1AXSB 2K7PA 1OAKL 3O2WL 3PWPB 3HR5A 4GRWE 2HYMA 4I1NB 3HC4L 3VMPA 5CEZD 3PNWB 1GRWA 3MV9E 4OGXH 1I7UA 1H8NA 2EC9T 5IF0A 1H5BB 4X7EC 2HTKD 4JFFA 1INDH 1BIHA 4X80L 5J6HB 5DUPH 1JCKA 1RK1B 3NN8B 5INCA 1EEUA 1OAQL 3VXPB 3GI8H 3H9SA 3LY6A 1C16B 4JN2A 4HWBL 1KB5A 3D2UD 1OLZA 4MHHI 2NY6D 5DUBA 1R3JA 1JE6A 1H8SA 3PL6C 2RQ8A 4ZFZA 1HK6A 1UQSB 3RIAF 3RGHA 3F7YB 2ARJB 5KN5B 1F3RB 1YNKL 1TPXC 4KKBD 5GGQL 4AH2A 4Z7UA 3A6BH 4KJYA 5F7YC 1LDSA 3TBVB 5GISH 3FO1B 5D96C 3SHSA 5F3HA 4FQPA 2ZSVB 5L88H 3BH8A 4HK3J 2XKNB 2JJVA 2BNUB 2FX8H 5DS8B 2XZAH 5A2LH 1UWGL 4HIIB 4E42B 4I0PD 1WZ1L 1QO3A 3B6SA 2VZOA 1XF2A 3QNYB 4D9QD 4LNRB 5H2BA 3QEUA 1A7PH 3GMNA 3M07A 3NH7L 5TQ2H 2APXA 1WEJH 4GBXD 2MQ0A 4UZGA 3VFSA 4AEIL 4U6HA 4UTBH 2OBGA 1MVUA 1WC7B 2EYSB 3NCCB 4L3ED 4DK6A 4F58L 3SE8H 4PRAA 4JPIB 1MCSA 1NMAL 4WI3A 3CSYA 3MOAH 1N59A 2CLVA 2B1AH 3RY5A 3UEZA 4BFGA 3SDDD 2EXWC 1Z5LA 4BFBD 1PG7H 1YUHB 1J8HE 4XPGH 1NC2D 2MTPA 3UTTD 4FXGA 5E8OB 1TCRB 1EZVX 1VENA 4JM2B 2QADD 4Z95L 4FXLA 5T1KD 5CUSH 43CAB 4OI9A 2DIAA 4U6YA 1NCCH 4G6MH 5C9JA 4ZAKD 1E0OB 3HMWH 1MY7A 3MRIA 5I76A 4AL8L 4XCFH 3T1FB 2DQIL 2CLRB 5J13B 3IVKA 1A9BA 1D9KA 5JDSB 3RDTD 3P3YA 3RY6A 1A4KA 2LFGA 4AMKL 3U4BH 2J7LA 2X9WA 3VXMA 5DR5H 1N7ML 3SO3B 2X4UB 5T5NF 4XT1C 4ZYKB 4OSUL 3TN0C 5I1LB 1FNHA 4F7PB 3RZCB 2BVTA 1SJXA 5DHYA 1FL6B 4JREC 1BFSA 4KK9C 3IU4H 4Y4HB 3ZLQC 2WINA 2J1KA 5DWUL 1WT5C 3MYJB 5E8DH 5LCVH 3U46B 4OD3H 5HI4C 4LHUD 3KPNB 3QDMA 1Q9LA 1OQOA 4XP4H 3VXRE 3HG1A 8FABA 1OY3B 2DQEH 1IGMH 5EO0A 5EBMA 2DQCH 3N1PC 4JFQB 4U49A 2FZ3A 5T5NG 1OM3L 3HNSH 1INQA 2JJUA 4PJAE 4PJ5E 1ES0A 1U91A 4NRYA 4BZ1H 5K9KB 1FRGH 4LARH 3FOLA 4OZGF 3SGEI 5I1AB 2JJSA 3MFGB 1BQUA 4YHML 4NM8L 1F3JB 4X7TA 4X6DB 3JBG7 3QIWC 4I4WA 3H9HA 1MFCH 1HWGB 4CN4A 1RI8A 3LB6D 4FHBD 3N50A 3ZTJG 4DAGH 1U58A 2P42B 4MNHB 1DDHA 1UM5L 2Q8AL 5K9OA 4QRPB 1WBXB 3AREC 2QR0A 1S78D 2YUXA 1XCTB 1W8OA 3GHEL 2OJEB 2EYTA 3O3BA 2VDKL 1B2WL 2DBLL 4JLRB 4H1LB 5DMKB 4MCZA 3K4DA 3OJDA 1PD6A 4KRLB 1X5JA 3CLFH 4FQIH 4KY1L 5AWNH 3A6OA 4MD5B 4FP8L 4NSKA 2LE9A 1JWUB 5I1HH 3E0GA 4LPWA 1RD6A 4X99A 3JTTA 5FYKD 3ZHDA 5LGJB 3VXOA 4NPYA 4ZFFB 4HUWB 4K7PH 1F11A 4L9DA 1P4LB 2YKLL 5IMOB 3QH3B 3M1BB 3RUGA 5KVDH 3UYOD 4H88L 4MD4A 2QSQA 4LLWA 1VGEL 4UDUB 2A1WH 2ZZUT 3IKCA 3QXDA 4QXTA 1NCTA 4QXUH 2UZIL 4BKLB 4NC0B 4NUJA 5HGAA 3WIHA 1GOFA 1RZ8A 5F7EH 3GM0A 5F8RC 2JIXA 3KYOB 3QCVL 5E94B 1G84A 2VR9A 3QFDA 1G6RB 1VFAB 3BIKA 3EDEA 4K94H 2C1OB 2WBWB 4OD1H 3I85A 1XCQB 1HXMA 2DM4A 1P5UA 1EV2E 5AD0B 3TYFA 2BSSA 1QACA 3MRHB 5IKCB 2IH3B 1KNOA 1WAAE 3PWNA 4XH2B 3BZEA 1DBAL 5F9JB 3MXWH 3NACH 3DV6A 3DVGB 4GRLC 1NFIA 4G6AC 3U30B 1YN6A 1QVOB 2AVGA 4LASL 4OF5A 1T1ZB 4Y16A 2V2WB 2AGJL 1YECH 1M05B 3O3AA 4LSPH 4GXUM 4FQCH 2AJSL 1BMGA 4URTB 2VAAA 5EIIA 4IJ3B 3UBXG 3P9LA 1I7ZB 3QEHB 4Y4FC 3O6FA 4P57A 2YD9A 1BFVH 5HDLA 4CVZB 4S10A 4M00A 4DVRH 1MFBL 2VABA 3QT2A 1RAMA 4NP4H 5IVZA 1M71B 5FCUL 3GHBH 3G5YA 1PYWB 4N8VA 1UYWL 4GG6E 1FVCB 3J7HA 5CBAB 5BQ7A 1NCDH 2I07A 5JW4M 3PGCB 5ANME 2XIDA 2W38A 3QFJD 1J11A 4E0RA 2EIZA 3BP7B 1K85A 3GSWB 4YQXL 4ODUA 3CFEB 3RGVB 4LEXL 4XPFH 4NZTL 5D7KE 1RZJH 5CZKA 3MLVL 3VRLF 1AR1C 2AP2A 3U48A 1NAMB 4ONFL 5IQ7H 1MPAL 2GT9A 1AD9B 5GGRY 2ID5A 2Y4SA 4QTIH 1I3GH 3RWFB 3QHTC 1QQDB 1CL7L 3AY4C 4U1LA 1R3IL 1LEGB 3ESVF 3K8KA 2XWJA 4OZ4A 2J8UA 1H3VA 4X6BA 3V8CA 2ADIB 3EYQC 4TUKL 1IZKA 4TOYL 4GUPB 1E6JH 2VMFA 2YPLD 3Q5TA 2NW3A 2APWA 5JXED 4A2LA 4OT1H 5FF6A 3JUYA 3DUHA 4UU9B 4HGMA 1G9NH 2H26B 3QQ3B 3PWUB 1QRND 2YN5A 4LAJH 4ZFGL 3W2DH 2BNRD 3RWGA 4JM2F 1QSED 2CPCA 4X5XB 5H8DA 2B4CH 3FHQA 4J8RA 1WBZB 2DLEA 2Y23A 2BC4B 3CFKB 1N5AA 1IT9H 4KUZH 5H94A 4J4PA 1NAKL 4HH9A 3V0VA 3DI2B 2BX5A 3H7BA 1REIA 3BKJH 4LVNB 3THMH 3O0RL 1IC5L 3HNTH 1T3FB 4JR9L 2EH8H 1FVEA 3C60C 4LSRH 2CR6A 3OJMB 4CADA 3CIQA 2AEIT 3M8OH 5HTSA 3WDJA 4AENA 1DL7L 4L4TA 4HKZA 5C8JA 2ZCLL 3FQRA 1ZGLP 3UJIL 1P4IL 2V9TA 3ZTNL 2GUOA 1FJ1B 2VXQL 3MLZH 3ZT7A 1RJLB 5J6GA 1CICC 1DBKH 2ICWJ 3IKKA 3L3DB 3QEQD 3LIZH 1FGVL 5EB9A 4ALAL 4Q6IB 3QRFM 2UV3A 3LD8C 4LU5H 3PQYB 4WFED 3RL1A 3B43A 5J56B 3I9GH 2MCG1 2X1PA 2M8XA 2MMXA 4FTVD 4OQTA 5TH2A 3P0VL 5D7JB 4W68A 2HT4D 5KZCB 2X42A 1KJ2H 4R26H 1NGQH 2VE6B 4NQED 4P46C 3TA3A 5M94B 2HKHH 1P1ZA 4X6DF 3L3OA 2UWEE 5HGGS 3OZ9H 2PF6A 4KJQC 5DYOA 1PQZB 3JXAA 4A6YB 5BZWA 3FRUA 2Q86A 1JP5A 4G8EA 3WLWC 2PXYC 4Y8AA 5I73C 5IMLA 4MYWB 4JHAH 4JZNA 4JFDA 1JWMA 1YEFH 3RWHB 2Q3AA 5F9WC 1E4WL 1FZJB 1S3KL 5HHXL 1DQLL 1MJUL 3CVIL 2IFFL 2VQUA 3HI5L 2IC2A 2AEQH 3D0VA 4WFHD 1Z9SA 2WBJD 5CEXA 3RPIA 3QDGD 1J05B 1J7VR 4ZXBB 4IBLT 1FO0L 4OJFH 1OGAB 3SDAB 1HHKB 5T3ZD 4XX1G 1R3KB 5L6YH 3VWJC 3EHBD 2VLRD 3ARGB 1CI5A 4JFYA 5FKAA 4WVRA 1B0GB 1NCWH 3K7UA 2YSSB 5F9OH 2WW8A 3SE3C 3D87B 1YY8B 4JY4B 4YFLF 5TE6H 3SGKA 2XWBB 4C59B 1KLFA 2YBRA 4S1DC 4GAYB 5EBLA 4PS4H 4GG8B 2N7BA 4OFDA 5T3XL 3TM6A 5F1SA 2AK4B 4YO0B 2WNGA 1DUYA 3AM8C 3DPBA 1DEDA 5IFJA 3QUZB 2NY2B 3AS3A 1K8DB 2O26U 1NKOA 2BY1A 1ZHBA 2M2DA 4IDJH 5ICYA 3VXSA 3KWWA 3X3FL 5I1EH 4IDLA 3BPCB 4RMUA 4YPGA 1CFBA 5EUKB 4P0DA 4MD0A 2CDGB 3BSZL 4NQXB 1QOKA 4XP5H 1A1NB 4DUXA 4WDIA 2A9ML 5I75B 4YHZL 5GQBA 4DQOL 1KCUL 5DVKA 3ZL4H 2QKIB 4BJLA 2FJHA 2VOTA 2JCCA 3GSRA 2MWCA 4XMKH 1D7FA 4ODHL 1A6WL 3OF6D 3SQOL 2NMSA 3EYVB 4KRNA 5ERWB 3W5NA 3FJTA 2F5BH 1U8NB 2P24A 5FM5M 5HHVH 5CBEA 4ZSOE 3LKSB 1BAFH 2FX9H 5E08L 2HG5A 3ARDA 3LEVL