4ELKA

Crystal structure of the hy19.3 type ii nkt tcr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
202
structure length
199
Chain Sequence
QKVQQSPESLSVPEGGMASLNCTSSDRNFQYFWWYRQHSGEGPKALMSIFSDGDKKEGRFTAHLNKASLHVSLHIRDSQPSDSALYFCAASEQNAQGLTFGLGTRVSVFPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Hy19.3 TCR alpha chain (mouse variable domain, human constan
publication title Type II natural killer T cells use features of both innate-like and conventional T cells to recognize sulfatide self antigens.
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 199
sequence length 202
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4elkA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4elkA02
3UTSB 5I1DB 1AGBA 4ZFFB 3GRWA 5SWSD 3GUTB 1WBXB 5KVEH 2GCYA 2CIKB 5GRVL 1R24A 1BQLH 5HHMB 4YEEA 3RWJB 4QHKJ 4XWOC 4ELMF 3PQYD 3U79A 2VLME 2PTTB 4O02L 3HNTH 4P5TA 4HUWB 2VDOH 5CJQH 3U82B 2BOCA 5DQDH 3OSKA 4PJFF 1AXIB 3QUKB 1N64H 1Q1JL 5TJWK 3CMGA 2CK0L 1EH9A 2Q3AA 4U1HA 1IAKA 4XXCA 4X9BA 3HCVA 3MNWB 1K2DA 2V9TA 2UVEA 3EYQC 3K7UA 2C4XA 5IROA 3BWAB 3SDCD 4O00A 3EUUA 2J8UB 1ZANH 2CRZA 2NNAB 1MFBL 3LZFH 4AQOA 1VHPA 3PABA 2ZG2A 2Z31C 1ZMYA 2DLEA 4ELMA 2ZUYA 1XCTA 1RZJC 4MCYB 4DFIA 3BAEH 4NQCE 1UQSB 3ARQA 2Q87A 4X0KB 2EH7L 4AK1A 5KSVA 5BVJB 2HAZA 5D72L 4PJFA 3L1OH 4NRXA 4P5TB 4Y4KC 3NOIA 3AMKA 4JZOB 5SWZD 3GMRB 4MQXD 2O93L 4EN3A 3ULUE 2UY6A 2VLKA 5LCVH 1NGXB 4X80H 5TFSH 3O8XA 2OL3A 3L3KB 5ID1A 1X4ZA 5ETUA 2B2XL 1IAMA 1NCWH 2VXUH 2W65B 4F9LA 5MEPB 4M6NH 1WLHA 3HCVB 1YPZE 3CXHK 2L7UA 3LDBB 1S5IH 3ZT7A 3FO2B 2XNAB 1PKQA 4IRSD 1RJLB 3K74B 2VZVA 4LQ1A 4YXLH 4R97B 5E7BA 3P4LA 4NT6A 4UV4H 2RQ8A 2KL6A 1LE5A 3X3GL 4YBQC 4K3DH 4EDXA 1CICA 1H8OA 3EO0A 4R2GB 4TRPL 3TA3D 2BVYA 5ANMA 2X4UA 4F33A 5T3XE 5TH2B 4PBVC 4PJXF 4XNZB 1BWMA 4PR5A 2W0PA 2IQ9H 5T1KA 4OGAC 4PD4K 3Q5YA 1DVFB 1UVQA 1F4AA 2FR4A 3P3YA 3CCHB 1RUAH 1AY1H 2XTJC 3IFPA 3RL2A 4S10A 3P77B 3SKMB 5EDXA 4KJQC 3WD5H 1DUZB 1AQKL 1RZIA 4XVSH 1MWAH 4EN3B 1S7SB 1YY8B 2VKWA 1KLUB 3AREB 1Q94A 5DMIL 1XR8B 3O8XB 1DQDH 4MAYB 2OL3B 3DSFL 4HS6B 1YYMH 2BVPB 1QHPA 2RCSL 3NGBB 4NFDA 4P59H 3NCJL 4OZGB 4JFFA 4PBWD 4O2EA 3DX8A 1P7KB 4HXBL 4J4PD 4N0UA 4PJXA 2UWEF 3FMGH 1A47A 5FDWA 1G1CA 3BE1L 3EO0B 1F6LL 5F3HA 3SPVB 3BN3B 5HHOE 5ANMB 1QLRA 4F33B 5I76B 1G9NC 4NYLB 4PR5B 5I16B 4M93B 5T1KB 4EUPH 4EZMA 3MBEA 3QO0B 4HFUH 5CGYD 2QQLH 1HHGA 1AFVH 3D39D 3R06B 4QRUA 4YXHH 3OB0K 1KJ2H 3RIFK 4HIEA 3Q1SL 5BW7C 3T2QA 3I3DA 4G42B 4U1IA 3BP6B 4U1NB 4KPHH 2DQDL 5EU7C 1V7MH 5C9JA 1VGKB 1QBBA 3GSQB 1C5CH 4XP6L 1FGNL 3IXAB 4X4YA 4JQXC 1YMHB 4PJ8B 5E1AB 2UWEA 5F9AC 1FNFA 4HGWA 4O2EB 1NLBH 4I8DA 1W8OA 5BRZE 3BEWB 4PJXB 4P2RA 4Q74A 2PXYA 1LO3H 3VRLE 4MAUH 3DX7A 1K6QH 4M48H 3U36A 2VLRD 4NUGL 4XAKD 1K3ZA 1QFOA 2Q8AH 4Z77B 1U95A 4HKXA 4ZAKB 5GGTA 1IM3A 5LAXA 4W4OC 2J7LA 1BFVL 3T8XB 3RWGA 2VL4A 3EOBA 4MJIE 2JIXD 5TF0A 1TQBC 4OZ4A 4LQFH 3HB3C 3S36X 4N0FA 5I1JH 2O5ZH 4LLYB 1TFHA 3KS0H 5EC1A 4X4YB 3C6LD 1YEFL 2ARJQ 2BY0A 2Z8SA 2VDRH 4OKDA 4TUOB 3EO1A 4ZNCD 1KNOA 3QDMB 4P2RB 3KPRE 4PY8J 4KHTL 4L1DA 1V7NL 3DTXA 4YUEH 3D1MC 3N1PC 3CFJA 1B0GA 4O4YH 4M8QB 2R29H 4JKKA 2ZOKA 3DECA 5BS0E 4PRPA 5DTFB 4NKDB 1Q9OA 1UM6H 1FVCA 5DRNA 4NJ9H 2AXGB 5HI4C 2GSIA 3PP3K 1MFEL 5CEZD 4RAUA 3EDEA 4U31A 3O3BA 2XY2A 4ZD3H 2NX5B 5D7IE 4FQIL 3LKRB 5D5MF 1ETZB 2DMCA 1NMBH 1RSFA 2B20A 4GW1A 1BAFL 3ULVF 2CQVA 2W9LA 1P69B 4NZUL 1RJCA 5IVNA 3SE8H 6FABH 2F58H 2DYPB 3QJFA 1KELH 5CIPB 4DGVL 2D7PA 3TGXA 2EXYC 4OIIH 2X6MA 3MGAA 2AK4E 1Z9OA 5C1MB 3RNKA 1NGWB 1GOGA 3E6FA 3QQ4B 2XTJE 5GS1B 1ADQH 3CFKA 2UZIL 4P5MA 1LP9E 4QHUA 4ZOEA 4LLQB 4NM8H 5DD0L 3TWCH 3ZTJG 4P57A 4PLOB 1QLEH 3X11B 5IVXB 2EIZB 5GSRA 4Z18A 2A77L 1FCCA 3SE4C 3WHE0 1FVCB 4Y4FD 3QXDB 2EXWC 5D5MA 4PUBL 2XWTB 3SKUD 3QFJD 4I3SH 3MV7E 1HQ4B 1Z3GH 1HWHB 4BH8B 1FL5B 3EJYC 4ACPA 3E8UH 4JANA 2GY5A 3C8KA 3QSKB 4GMSL 2VDLH 4OQTL 4P9ML 4R3SA 2P46B 3IU4L 4WO4D 3MLWL 3KLAB 1YJDL 4JJHA 1CTOA 1WIOA 2G9HB 2V5YA 3R0NA 5E08L 4KDTC 4I2XE 4DW2L 3CFKB 2C26A 4J8RA 4WI2A 3BX7C 3KLHD 1HHIA 5B22A 4LHJB 1R3IH 5EU7E 1LEIA 3MV8A 4ONFL 3U4EA 5FKPA 5C0EB 1OAUH 3VG9C 2ATKB 2PO6A 4PG2A 4J3OC 4U6YB 4UUJB 3QDJB 3ZDZF 1KB9K 3BRFA 1DBAH 1NC4D 1MPAH 3T1FA 1G6RL 4XVTH 3JV5A 4LCCB 3MRRA 3LOWA 3OBAA 1FBIL 1FIEA 4JEGB 4QT5B 3C8KB 5KANI 43C9A 5C09E 1D5BA 2CIIA 4V1DA 3ZMRA 3VFSB 3ZYZA 4PP1C 4HC1H 4K94H 2C3GA 1XF3B 3Q6FA 1KTLA 3GKWH 1AH1A 4HHAA 2CK2A 2LFGA 3L3HA 1NCAL 4L4VD 2F5AL 2C9AA 3FCTA 5D1ZC 3QUYD 5L2KD 2R1XA 2ICWI 4I0KA 2R1YB 2GI7A 2NYYD 1IKNC 2VISA 4YC2B 1LEIB 1J0JA 1TDQA 3MV8B 4P2OC 2I60L 4UT9L 3FO0H 1BZQK 2DDQH 2H32B 2OP4L 1U6AL 4DN4H 5DO2C 1E6OH 4O02H 1JYXA 3MLRH 4K2UL 4YDIL 3O6FD 1U3JA 4OCMC 4Y2DA 4ZUVB 5HSFA 4FRWA 3PDOB 5JUEL 2RBLA 2CK0H 2A83A 2P8LB 2EC9U 2YPLD 3EDKA 4PREA 3MRKA 1K5NA 2FD6L 5F3BB 15C8H 3EYUL 5JZ7D 4RFEA 1AKJA 3L3HB 4N8VG 3WO3B 1JHLL 3GBLA 3O3AA 4JM2C 5IHBA 4LIQL 5ISZB 4U7SA 4PJ9D 4D0DB 3QWRA 1M71A 2GJZA 2NY3D 1IQDB 4PJ5E 2Q1EA 1NC2B 2BSSA 5AEAA 3S35L 1LE9A 4NHUA 1NDGB 2FIRT 5INCB 4OLZH 1UM5H 4Z7WF 2HYMA 1PLGL 5F9JA 3ZE2F 3CH1B 3MRBA 4KZEL 3WCYA 4P4RA 1BD2D 5J6HA 3QIUD 5DD5L 5GS0L 2XT1B 2AI0H 4XHJC 3BSZH 4LSTL 4OM0L 4UT7L 5E6YA 2EDTA 2X40A 4NN7B 2VDKL 3FAXA 3I6LD 4JY4A 5BZWB 1FVEB 3UAJD 3TIDB 1LK3L 3UEZA 4DGYL 1WGOA 2YA0A 4KXZH 4FFYL 3TESA 1YY9C 4Q9RL 2NY2D 3LEXB 1KPRA 5E99H 2AV1A 1KIPB 1HN1A 3Q5OA 5CZVL 1MCFA 3V5HB 2DL2A 1AE6H 4Z7WA 4N1EA 3MV9E 3LV3B 2IPUK 2FATH 2PYEA 2VN4A 1LE9B 1M4KA 1Z2KA 1ES0A 4OLUL 1OCWH 3ALXA 4TOYL 1F6AA 3QQNA 4Y5VC 3TIEA 3X17A 1MVFA 5EZOH 4DVRL 3DX6B 3CJJA 4F7PA 1G6VK 2CDFA 4OF7A 3ARVA 1SJVA 5DEFB 1DQJB 2DQHH 1J8HB 1UJ3B 4ZODA 2XXMB 3DSFH 1MI5A 2YD2A 2YR3A 3MRNA 2RCSH 3NCEB 1MFDH 5JW4N 2P48B 5F9DC 5FECA 4EIGB 4M3KB 3OKMA 3I02A 4UMGA 4Q7DA 3TO4D 3W5MA 4OZHF 1KPRB 3BN9D 3IF1A 3DO7A 3D0VA 2AV1B 1ZLWK 2D03L 3N1QC 4R4FH 3OB8A 1KJ2B 2ZNWA 3Q3GB 4YBHA 3O45B 1BQHG 5EO9A 1GGCH 2G75B 1HDMA 1FZMA 1F6AB 3S5LA 2CRMA 5HXMA 2JCCF 2NY0B 4MXWH 3UROR 2IAMD 2V17L 3AUVA 1ZA6B 5FYKE 5IK3A 4FQ1L 2DMKA 3HR6A 5MEOA 1RHFA 1L7IL 2Z4QB 4UU9A 1MI5B 3E3QC 3VMNA 3DMMB 5LGHL 5J3HD 4IMKC 2IALA 3EDFA 4OZHA 2VE6B 4DZ8B 5EU3A 3I02B 4TNVK 4KROD 4MJ5A 1BX2B 4X6CE 2XY1A 1VSCA 5DHYA 1AC0A 3HC3H 5DSCB 5E6ID 1WT5A 6CGTA 1DBMH 3RY6C 3NIGF 3T0VA 4NUGH 3SE9L 3PF2A 5JXEA 5EO9B 4RDQF 5DC9B 3TJHD 1MCEA 1FRGL 1V3KA 1SY6A 3OB0H 3QEUA 4OLYL 1Z5LB 1MFCL 4M1DL 4ODXB 3RP1A 1NKRA 3C60D 3W2DL 5L9DL 1N8ZA 1HIMH 1WZ1L 2VOTA 1RJYB 1AP2A 1IKFL 4WY7L 5MEOB 4GBXA 1TXKA 1U8PA 3IXTA 4HCRL 1JF6A 1ORQA 1I3GL 3DIFA 5GSVB 1PYWA 3J8F7 4R96B 3UBXI 2AVGA 1S3KL 3LRSB 3GK8H 4M61B 5D6CB 5A1AA 1FO0L 2IAND 3MNZB 5DD1H 4U6HB 3GIVB 1HSAB 3U30B 1QYGH 4MJ5B 2A6JB 1Z9SA 5D1XD 2UYLA 3QEHB 2VQ1B 5D70H 3TYFB 1ZHKA 4UNTA 3O0RL 2NZ9D 5AYQA 5T5FL 4GAFB 4NBZB 3NCCB 5DJ2A 3MUHL 5CGMA 2IPKB 4UB0L 2JCCB 4XPAL 5I15L 4QRPD 2BERA 3PWPA 4U2YA 4MB4A 4U3CA 4XP1L 1RZ8A 3LB6C 2ZKHL 4EBQL 2XN9E 5TPWH 5EOCJ 1NUGA 3PJSA 1IZKA 4FQIH 1OLLA 3O4LE 1FNEB 1RK1B 5HHPB 4GRWB 1HNFA 4MDJB 4WFFD 4DOHB 1KIUA 1T5XB 4WTZA 1C12A 3ARUA 1PYWB 3IJHB 4H26A 4FQHB 3SJVA 1Z0MA 4M7LH 2D7QA 4OCNC 5FFLA 1KCVL 4GG6B 4XNXH 1JWMA 3H8NA 4BQ9A 3QUMA 2G5BB 2R1WA 4KK8C 4XCNA 3BW9B 5ICZA 2X44D 3K8KA 5FYJD 3S3SA 4KRPB 3T0AA 4FFZL 3QZWG 2ESVB 1N2RA 5JDSA 1FFQA 2BJML 2X70A 4MQSB 1MJJB 4LHUG 3Q2CA 2A1WH 2A77H 1RZGB 2PCPB 1KEGL 4Y1AA 1WFNA 2C1PA 1RZ8B 3B6SA 3GJFA 2R0ZL 1ZHBA 4AEIL 1BVZA 1UH2A 2X9YA 1LO0L 1XH3A 5ALCH 2KUTA 3JWOH 3P30H 5FYLL 2EKSA 2R2BB 3BKJL 3QFDA 3NIFF 1N0LA 4CNIA 3VFPB 2HMID 5I18L 3SCMB 1OD9A 3TLRA 2BNQD 4ZXBB 3QO1A 3B83A 1RU9L 4NGHH 4KJPC 2E9BA 4P3CH 3WNOA 4F58L 2A6DB 1UA6L 1ORSA 1XT5A 1JGLL 4NQSA 3ZHLA 3HFML 3EJZD 4LSPH 3KVQA 1O5DT 4FQ2L 5E2TH 2FHCA 3N50A 3MLPA 4YE4L 2XV6B 3OZ9L 1J0IA 4NQED 4E41D 2OJEA 4HUNB 4NJAH 1J1PL 4UOW0 4LSVH 4NQDB 3I3BA 1VFMA 4Y1AB 4UV7L 4P2QB 3E3QE 4LLWB 2AXFA 1LDSA 4PJHB 4FQPA 5C07B 4JKPH 2JF1A 2IMMA 1X5GA 3GI8H 4MNQD 4MA8H 1E4XH 1J1OH 1ZHLB 3O6KL 2F8VA 3VI4E 5ADPH 2WW8A 5IHZA 5KTEH 4PB9L 1ULVA 1B4JH 3AM8C 4AYFA 2XWBB 3KR3L 3WL9A 5F1KC 1JV5B 4H25A 4JFQA 1BZ7A 1DN0B 1EJ6A 1MAKA 3NCYP 4HWUA 1K4DA 3H7BA 1S78D 4JREB 4G6AD 4U1GB 3FB8A 3MOQA 5GGRA 4RGNB 4XBGA 2AXJA 3L5WB 2BCKB 2HJFB 5E9DD 1MIML 5BV7H 4ELKB 2OJEB 1FGVH 1WZMA 2E7CA 4YIQB 4C56B 5IESL 3PDGA 3PHOA 1CBVH 5D7LD 4DVBA 4QOKA 1XEDA 1IGYA 1WEJH 3PL6A 5D7SL 1VB9A 3OMZA 1MJ8L 5KG9B 3VG0L 5IFHH 1T1WA 2H9GA 1JN6A 5FM5M 1J1XH 2VO5A 4PJ7E 1SBSH 3FQNA 1UFUA 4IRZH 2X42A 3CD4A 4KY1L 4JG1H 2E7MA 4FQQA 2GUOA 3RDTA 5FHAL 4H25B 1JE6A 1BZ7B 4X99A 1UYWH 3WO4B 5F72S 3KPMA 3H7BB 1XR9A 5HGDB 3TN0D 3VXRD 1K85A 4MD5B 2XPGB 1FVDA 4ONHB 4KKCC 2A6KA 2MJWA 3MCKA 2WZPD 4BH7A 1CGSH 5D9SA 3LN9A 3VFTA 3A6BL 1ZA3B 5GRJL 4L4TE 4OJFH 1QOKA 4QOKB 2P24B 5FA4A 4NN6C 5DS8B 3WN5B 4FQXC 2J8OA 4X5WA 4KK6C 2CR3A 1RJZB 3EYVA 5IHUL 2R2CA 3GSRA 1FFNB 4FQLL 4LCUA 3DRTA 1OSZA 4WV1A 5DD5H 4OV5A 3VRJB 3FFDA 4LSTH 3WFBH 2WQRA 4E5XB 1WFOA 2BP3A 1Y6MR 2NXZC 2PW1B 5KS9A 1YEGH 3WXVL 3MSPA 3QUXB 1A6TB 3K2UL 4P2YA 3JTTA 5DXWA 5HYFA 4H20H 5CHNB 1LK3H 3ARBD 2VH5H 4G8GD 2LV4A 4OGZA 3KPMB 1YJDC 1ED3A 3QI9A 5DURB 5F1NA 1YMME 1T89C 1CDGA 2LABA 3TV3H 5CGTA 3U4AA 1AHWC 1P2CA 1W72L 5CZVH 3HE7A 1FN4B 3KYAA 3F6IA 2BC4B 3TF7C 3M45A 3Q6GL 2F53E 4B41A 4XH2A 5DD6B 2VWEC 1OGAD 4NO0B 3EHBC 1LD9A 3BYYA 2X1OA 3MJ9A 1FPTL 3T08A 4DUXA 4BELD 1HILB 5HGHB 5DDHB 3O2VL 3KYMA 1J05B 5CSGA 4DVRH 3ARFD 3OKEA 3DRTB 3NFSH 5SX5H 4LFHG 1Q0XH 3HUJE 1MFNA 1R3LB 3BZEA 4R7DA 1LK2A 1SEQL 1U2HA 1S9VB 1WCQA 2EC8A 2CUHA 1YEJH 1CXKA 2P5WA 3GRWL 3H6JA 3L6FB 3QHFL 4RGMB 4UINL 1I1AB 2QL1A 4GAGH 1PZ5B 4UIKL 3D87B 1HKFA 3ZKSD 2O26U 4NM4H 3F12A 4ZDHA 4HUUA 4LDEB 1QSEE 5HI5C 1RHHA 1DN2A 5DUBA 4PRIE 4U7KA 1KCLA 3VGAC 2YBRB 4R6UA 1WICA 4XH2B 2I27N 2J4WH 4Q2ZA 1EXUA 4KMTL 1KGCD 4XCEA 3VXSD 4ONGH 3K4ZA 5FA3A 2W60A 3OKEB 4EI5C 1VGEL 4NUJA 2VB5A 5IQ7L 2BMKB 1LQSR 3ZO0A 1JPFA 4C83A 4X98A 3FB6B 4XMLL 3RX7A 3OX8B 1YUHB 4D9QE 2DD8L 3DXAD 4HWBH 1A3LL 2K9UA 35C8H 5J13B 5IVZA 4YPGA 4HS3A 4YK4B 2LU7A 3KHOA 1YEIL 2J88H 4L3EE 1D6VL 2CRYA 5EO1A 2QQQA 3SN6N 1A1NA 4XP5H 4PJEA 4G6FB 4O9HL 5TGBA 5BMFH 5F7EL 2AJVL 4KMLB 4CAGA 5E70A 4JDTL 1U3HB 2F9BT 3VH8B 4AG4L 2X4SB 1TNNA 4M1GH 5D2LE 3ARSA 5KZCB 1KCRL 1VA9A 1S9KC 2LE9A 4HMDA 2X4RA 2M1KA 1A6UH 1D5IL 2R23A 4OFYD 4NUJB 2DTML 3EFFA 2R2EA 1CGUA 5TE4L 1GXEA 1GSMA 1F5WA 2E27L 3MUZ1 3HNVH 3BP4A 1AD9A 5GS0C 3UPRA 2YKLH 3INUH 1I3GH 4LRIC 4U6XB 4PRHE 3KS0J 3MRDA 1DBKH 3HC0A 3WJLA 3DARA 3GBNL 1S3KH 4WU5B 4UT6L 3FN0H 2EDXA 3CFBA 1BFOB 4GSDH 3ZKMC 5BQ7A 5J1AB 1UWGL 4D9LL 2V2XA 4LVOB 4U1SA 4WENB 5IF0B 4S1RL 5GRVK 5TGBB 2B4CL 4KFZC 5L7XL 1ZS8B 2JK5B 2UZXB 1CD9B 3CFDA 4Y19D 2ICCA 4LGRB 5IQ9B 1EA9C 3VXMB 5GPRA 1IC5L 1LO4H 5ITFB 1HH9A 1N6QH 4JPIB 3NPZB 1GYAA 5JPNA 3BIAX 2GK0B 2ZKHH 4L3AA 2MPAH 2X4RB 3B9KA 4P46C 5EOQH 4NN5B 1A21A 2R23B 2VDPL 4MMXC 1DANU 2CSPA 5DJXB 5ID0B 1JPSH 3K1DA 3JV6A 7FABL 5CWSA 3BP4B 4TYUA 4H8WC 5HYSA 2VLJD 4L5FL 1GIGL 2P47B 4L8BA 4FFVD 4O58H 5EH1A 2R39A 1G7PB 4R7NA 3OR6B 2YD4A 5I8EB 5DC4B 1GOHA 4NNPH 3RPIB 2HVKB 3WFZA 3BZ4B 3O6ML 2WBJA 3VXOA 2VWEE 4YHKH 1JYVA 4ZO9A 3LMJL 4I18B 1ZAGA 1DEEB 2IFFH 2CKBH 1IGJA 3KG5A 2ZPKH 4WNQB 1XGRB 3WE6B 1S7TB 4YNYA 4TVPD 1TTGA 4PJIE 3PP4H 5J6GB 4IRJD 5HGAA 1J0HA 1HH9B 4Y16B 1I85A 4F9PC 2LAAA 3GI9L 3GGWA 3CMOL 5DMKA 3B5GA 5E5MA 4PJDF 1CT8A 1CCZA 4AJ0A 3GSNH 3PWVA 4ODUA 1FYTE 1AIFB 3ULUF 3BFOA 5LVEA 3RVWD 3HNSL 3QPQC 5C0NC 4Z95L 4JFEA 4Q0XH 1UACL 2Z91A 4JPWH 4LP5A 1ND0A 5L88H 5MI0B 1SQ2N 3B2VH 2N1KA 1OPGH 1YNLH 5ERWB 4K8RD 1CXFA 1KPUA 3T4AA 4U1LA 4L9DA 2HJKA 3S88L 1NGPL 2E8YA 3MXWL 4LCWE 3BXNB 2JB5H 4D3CL 3OAYK 5D8JL 1S9WB 1MJ7L 3DROA 2NY7L 4XPFH 1XF5A 1JI1A 3GHBL 3D85D 2JJTA 2BX5A 2VZ1A 4YNYB 1EGJH 4O2FB 4Q97A 4OF8A 4Y5YA 4PJDA 4YFLF 3MRIA 4UV7H 4DEPB 4O51A 3BUYA 4A6YA 5IB5B 1R5WA 2NR6D 1AGFA 3JBG7 3WIHH 4YHOL 1NAMA 2EECA 2FDBP 3VFRB 4JO2H 5DHVH 1RURL 1BIIB 4POZD 3OKKA 5F8QC 1ND0B 3BMVA 2RHEA 3T1WA 5T3ZD 1ZT1B 1QR1A 2YPVL 1J8KA 4PGDB 2Q8BH 3IS0X 4G6ML 2PYFA 1A7RH 4I0PC 4HIJA 4ISVB 1VFBB 4LIQE 1TPXC 1VERA 1S7UA 4RAHA 5E00B 3DROB 1I8IA 3UDWC 5H2BA 4KK5D 4NQCB 4IJ3C 4K71C 4LPTA 5IFAH 3QEQD 5DQ9B 5IV2A 4PBXA 1ZGLP 5E8DL 1PG7H 4KGJA 1QSFA 3W0WE 4B50A 2V7NA 2PN5A 3MRIB 4QWWC 4KZDH 2NY4B 1DBJL 1FG2B 3MTRA 1OD7A 1NAMB 2X4PA 1C5BL 2DKUA 4H1LH 1YPZB 4ZPVB 1OSPH 3OKKB 4Y5XB 1D5MB 4ZUWA 2FSEA 4R26L 4NNXA 1T2JA 1NBZA 2PYFB 4HIJB 5HHOA 2EEBA 4OFIA 5LWYH 1S7UB 3JUYA 1MCQA 3IAGC 3MNVB 1CZ8H 4EDWL 2CMRL 1S7XB 5CEZH 1BBJB 2J5LC 3CU1A 5MENA 2NY6D 3HRPA 5DD3L 4ODTL 5AAWA 5IV2B 5ALBH 2FEEL 4NZTL 2DKMA 1YN7A 1JGDA 3ILPA 3QDHA 3TP4A 4M00A 3TT3H 5H37H 1ITCA 1SJHB 3DETD 3RVUC 5IWLC 2YA1A 1FNAA 4C59B 3VCLB 5D71L 1U8LA 4NO2A 3O2DA 5JIKA 4ZFOB 2JLLA 5F6HJ 3G6JE 5KSAA 3ARDD 3O6LH 2ZCLL 3OPZL 2HH0L 1YQVH 4OM1L 3KPSE 3WXVH 2V2WB 2GHWB 4C57C 5F7DB 3GSXB 3EOAA 3MJ8A 4APQC 5DJZB 5GQBA 4JFDA 3MGTA 4G80A 5DWUH 4P23A 5HHOB 3UTTB 2FNBA 3LQZB 1JIBA 4PGZA 4K7PX 3C87A 3OWEA 4PJGE 5DJ0A 5CEXB 3OKDA 5J11B 1XCQA 4J1UB 5F6IC 4BFBD 2OYPA 3FQWB 2ZOLB 3D18B 3R8BB 4JN1L 4QO1A 2QHRH 2WP3T 4QF1B 2P5EE 1EO8H 1BEYL 3CX5J 2VUYA 1QEWB 2IPTL 1T04B 2WWKT 3QWQB 3DJ9A 3AMLA 5BRZB 4KJYA 4M5YH 1IM9A 4UINH 5CCKL 3MODH 2X5PA 4QRSB 2F74B 5F9WC 1TVHA 3LY6A 4DQOL 1TJIL 1VFUA 5AWNL 5KVFL 5IEKA 4XC3L 1GH7A 5BS0A 3V4PL 3V6FA 1LP9F 1LWRA 5T1DL 1I7RB 5DRZA 5A2FA 3IDIA 4FG6D 1PQZB 4X7CC 5HVWA 4MJIB 2WWMC 4K3EH 1P6FA 4ZUSB 3UCRA 5J9PA 5FGSA 2VXSH 1TJHL 4KMTH 1T83C 3DX9B 5JQ6H 4HD9A 4RISH 3S37X 1LO2L 2DJSA 2Z31B 4FOMA 3ZT6A 1T3FA 4CJ1A 2QSCL 2HTLD 3EYSL 3CUPA 4HK3N 5EZJA 4XHQA 1MOEA 5FHBH 2FL5A 5T1LA 4F7CA 4ERSL 3FHAA 3SDDD 1SM3H 5AYUH 3KPRB 2AK4A 3I50L 3UTSD 3JV0A 3NACH 2Y36H 3X14B 2RGSA 1BGXH 4Y4KB 1LP9A 5CILH 1AGDB 4ZUTA 9CGTA 3OAUH 4JHBA 2FX8L 3FQXA 5BS0B 1M7IB 1P5VA 4KK9D 3QISA 4JDTH 2BZDA 3MJ7B 3C5SB 1CDUA 1BMGA 3RUGE 4HDIA 4OCRL 1SEBB 3ARGC 3MV7A 1FNGA 5J9PB 5D7IB 1IGFH 5F7KC 4LPUA 3WNMA 3IDXL 1BVKB 1D5IH 3GM8A 5HDQH 1V3MA 3RGVC 2VLLA 3D2UB 1T3FB 2J6EH 4GG8B 1T0MB 5EZJB 3ALPA 3UJTL 3QHZL 3FN3A 3ZTNL 1U41A 1RK0A 3SDAD 5IG7A 4HH9B 1HKLL 2ZSVA 1IGMH 3MREA 2XTJB 4I2XA 1MSPA 4BK5A 4MA7L 4QHLB 4UDTA 5DRWA 2HFEB 3AB0C 1KN4H 1LP9B 1GZPA 3U9UB 4LASL 1AO7B 1H8SA 3GB7A 4I3RL 4UTBL 2ZP0T 1I8KA 3KJ6L 4MD4A 4FA8A 1WWWX 4HLZG 1UADC 5GRZA 4P5TD 1W0WB 1FJ1A 1NMCC 2A74A 1I7ZA 1K3IA 2NLJB 4GUPA 4HDIB 1XAUA 1CG9B 4X9IA 3RAJH 1GAFH 3MV7B 4X6EA 5IW6B 3GIZH 5FYLE 4F37K 4PJBE 4OTXL 3V0AC 4OZFA 1FIGH 2YS4A 5C09A 5DK2A 4NRZB 3WV0A 4UNUA 3O4OC 3STLB 1K8IA 4G9FD 4KVCH 5K9OB 3OJMB 3NZHH 4J3UA 3RWFB 2GYSA 4L5FH 4MCZB 3TZVA 1PY4A 2KH2B 2ZSVB 5DJAB 2UUDH 4R2GD 1GGIL 1FZOA 2VR9A 1KYOJ 5DRWB 2V9RA 4P48A 1KJVA 1F11B 3GB7B 1ACZA 4ODBD 1DVFD 1IAIL 2MFNA 4N9GB 4IOFD 4MD4B 3WDIA 4M43L 4JPKL 3OJVC 4X6EB 3CLFL 4NIKB 1H3WM 3ARED 1P9MA 5HYEA 1QVOA 3GMLA 2EKJA 4MAYD 4YHPB 5E2VH 1X5IA 5C09B 4NBYB 3LQAH 1KXTB 4HIXH 1NBQA 4XXCC 1KIQB 1LO5B 2EDYA 5CZXC 2VLRE 2HT2C 1NFDE 5CUSH 2D7MA 4BSVB 2NW2A 2MNUA 2Z35B 5IROC 3OAZK 1WC7B 4WI4A 4M7KL 1INDH 3T3ME 5DVMA 3DUSB 1MH5A 5HPMB 1EHLH 2G2RB 3MV11 5DJCA 4M7ZC 1KJVB 1TQBB 1U3ZA 2OZ4A 3KPOA 3VXUA 3OGOE 5I1AB 1KC5H 4HK0A 3D0LA 2DQEL 3TH3T 2ZUUA 1KG0B 1MWAA 2MCPL 3FOLB 4WUUA 1JWUB 1KXVC 2DL9A 3MLXH 5EPMA 4J6RH 4EN3C 4KMQA 1QVOB 4YX2L 1MCWW 1RMFL 2O5XL 4Z7QE 4I5BA 1KENL 4F9LC 5I1HH 4PJ8D 2F15A 4QRRA 4Y4HD 5D6DA 2DLIA 3IJSB 4HX1B 5D96C 1FAIH 1TITA 4CVZB 2BVOB 1JNNL 4RNRB 4WFGE 4EUPA 3O9WA 3HG1E 4LARL 4F3FA 1CICC 3F7YB 1Q9KB 4PJ9C 2DLFL 4F57H 2FZ3A 5DJ6A 5AAMA 1DLHA 3HR5A 1Q0YL 2D31A 3ILQC 5GS2D 4PJ5B 4TQEL 1T4KA 3CSGA 1X5LA 3B2UC 4ZAKD 2VZSA 3B8YA 1QPPA 2B4CC 2Q7NA 2YC1A 3FONA 4HEPG 4QNPE 4B7IA 3SOBH 3ISWA 4W68A 5EU4B 2Y7QB 2EDFA 1CTNA 5JQHC 3WKML 5DYOA 1DBJH 1X7QB 3BPLC 4RWYH 4I4WA 1K8DB 4FMFA 4QLRA 4ZUUA 1UZ6E 1G7MA 2ENSA 3DLQR 3QWOB 4MNGE 3IU3B 4FN0A 4FXGA 5DA0B 4G7VL 2O61B 1CVSC 3QDMD 3AS2A 1RZFL 1IEHA 3QRGL 3FJTA 5EBLA 4W6YB 2H6PB 2V5RA 3H9SE 1ZGLB 3HR5B 3MBEC 5I0DA 3REWB 1JRHL 4KQ4L 3MV9B 5IBLD 5DD3H 1AXSB 4GXVL 2R56H 3CDFA 4XPGL 5TDPB 3V4UL 3MOBH 1WWBX 3JWDC 2NX5D 2YSSA 2DQUH 2OMBA 4HJJH 3G04A 5CMAB 5GIRA 4XPBL 2D4DA 3EJJX 2X9XA 3MOAH 4TULH 5IJVB 4LLMB 4X7FC 3RL1A 4R4ND 4KKAC 4QCIB 2V5TA 3ARZA 3GMNB 2LU3A 3OGCA 5C0AA 3E2HC 3K1KC 1ACYL 3VJ6A 2BSED 5LBSL 1MCPL 1A1OA 2IH1B 1XF1A 3LKSB 2DYPD 1U8IB 5HVHC 5JLZA 3HKFA 5FYJH 2VXTL 4F7EB 3MLUL 2QBWA 2PR4L 2OTPA 4X7EC 4KTDH 2PXYC 3VG9B 2XRAL 3QAZC 4KI5F 1Q72H 4Z76B 1INEL 5C0BD 2RFXB 1F8TL 3ALWA 4JM4L 3GDBA 3SKNB 2YOCA 5I8OL 5JOPD 1H3TA 4JO4L 4PLNC 1HEZA 3FHQA 3QG7L 2GITA 4YDKL 2ZJSH 5C0JA 2DS4A 3LVEA 5HYIA 2YSSB 1LDPL 5I73C 1P7QD 1JGVL 2XZQL 3OKLA 4JPVL 3RL1B 1M05A 2FJHA 5JW3L 1BEYH 4K8RL 5L2KE 1KT2A 4HG4K 1LHZA 5GHWH 4G43B 3KYOB 5D1ZB 2GSGA 5FGRA 4HK3J 1A1OB 5IJKA 5C0RL 1ZT7A 3P11H 5IBUG 2Q7YB 1MREL 4Q9QL 1YEKH 4P2OB 4WJ5A 4PJFE 4X6CB 4NDMA 4LSQH 5IMOB 4N90D 5KN5A 2VLKE 2Y72A 3W39A 1KB5H 5JTWA 5FM4A 3IFNL 1GC1H 1NFIB 4TTDD 1U8QA 2WANA 2HG5A 3HS0B 3MRHA 1TIUA 3IT8D 2YPLE 3O11A 1CF8L 3QDJD 1MHEB 2IADB 1PKQE 1JMXA 5FGCE 4RIRA 3D6GA 2PTVA 2ORBH 5T3ZL 3MUY1 5KJRH 3O4LA 1UB6A 2H2PD 3CDCA 1A8JH 1S9XB 4PS4H 4FHBD 4JM2B 3EOTH 5I2IA 5A40E 1QKZL 3T4YB 5FUOL 2BVQA 4KDVA 4ERSH 4YAQA 2X4NA 3T77A 3BDYH 5HTSA 3V8CA 3GJEA 3F5WA 3QXAA 1B9ZA 3RA7L 2LQRA 5HY9B 2W0FA 3BKMH 4QYOB 3BD3A 2DQFB 1YDPB 2VAJA 4J3SA 2FX9L 1IT9H 4NKQB 2A9NL 3A6CL 4X5XB 1CE1H 1BZ9A 4Q6YA 3I6LE 1U8OA 3RNQB 3VGFA 5HI3D 2OM5A 2XN9B 3ULVC 3L7FA 1JI2A 4N8VB 4JFFE 3CLEH 4RIRB 4I9WD 5CZKA 2C3XA 1N5YL 3O4LB 4CW1B 3X3FH 5GJSH 4NO5A 4LAQH 1VACA 4KTEL 4PTTB 3W11C 4EI6A 5EZIH 1OM3L 1S7WB 3L9RA 2C5DC 4S1SH 3H42L 3VI4F 3DRQB 3L95A 3VFVA 4YAQB 2X4NB 2FX7H 2QADC 3QDAA 4WCYH 1FG9C 4Y5VB 4ODVH 4MA7H 2W9DL 3M17B 1LEGB 2W0FB 5ISZD 1MQKL 1P4BH 4GW4B 5GGSY 5GXBB 3CZFB 3MJ9L 5E8NA 1NC2D 5EC2A 3EFDH 2DJ4A 3MLZL 4I3RH 3H9HB 2HN7B 2PO6C 3GMQA 4PG2C 1U8OB 4BZ2L 3SDYH 4EIZC 3WLBB 4MLSA 2UWEE 1DUYB 4ZFGH 3L7FB 5DFVD 5DRXB 5EA0L 5LXGL 4XRCA 1CXEA 3RZCA 1MCRA 3L7EB 4D2NA 4FABH 1IBGL 4KHXL 1C08A 4OV6F 4Z7UF 4LLVA 3GMOA 2DI8A 5FO7A 3SKJH 1NCBL 1BQHA 4OFVA 4WHTA 4LBEB 4M62L 1MEXL 3ZE0F 4YHIA 4G7YH 3PGFH 4L3CB 2VC2H 1N26A 3OG6B 5I9QB 5IM7A 4LF3A 5L6YL 4WWKA 1F6FB 3U1SL 4U3HA 2D7OA 1SJEA 5E8NB 4KVNH 2FHFA 1MHHB 3BRDA 5ITBH 4DUVA 1NDMA 4M5ZL 4NZRH 1ZLUH 4Z7UA 4JPKH 4X4ZA 4Y2DC 5HYQA 3KPLA 1J8HD 4GRLA 1JGUH 2VZ3A 4HUVA 3OF6A 1REIA 4LLVB 3V2AR 3DVNB 3SEPA 3PHSA 2NY5H 4IEFB 1J10A 2J2ZA 5I1KL 1QBAA 3RFZC 4GAJL 2ADFH 4MQTB 1BQHB 5F1IA 1M7DB 1T7ZA 1DFBH 1L4IA 3GHEH 3HPJA 2P45B 2E5EA 5IIEA 3C2AH 4PRPE 1KN2L 4EOWH 5E8PA 1TVBB 4JCMA 4UDUA 5BO1H 1NGZB 1RIVL 1RZKL 3NTCL 4FQCL 4JDVB 4WUKH 5EWIH 3M1BA 3ULSB 3HLAA 1OTTC 4HJGA 1DR9A 4GKZA 1EEZB 3IDJA 1T20A 3X13B 3U2SA 5GISH 5ECJE 3PHQA 1N59A 5ENWA 1F4YH 25C8H 1JF1B 3C5JA 3I6GB 5L0QB 3L3OB 1CN4A 1EAPB 4K9EL 5ACMA 3MYJB 5EOTB 5CINL 2EE9A 2NY0D 4RX4D 4R8WH 5I17A 5DJYA 2Q6WA 4OCWH 5MP6L 5EUOB 1DSFL 1F4WH 4PPTA 1T03H 4PJ7B 1F90L 4MWFA 2WMPA 4JB9L 4R9HA 2NTFB 4LU5L 3DMMD 3ZT5A 1YEDB 4XMPL 1A7QL 2C3VB 4Z8FL 1K4CB 1KPVB 3HUJF 2OR8A 1CL7L 2JJVA 4FP8L 5C2BH 3THML 5I1CH 1I3RA 5GRYA 1DEDA 2L4OA 1CFVH 4G6JH 5D5ME 4AM0A 1IILE 4CJ0A 1WITA 3IDJB 2I9LB 1FZKA 5ENWB 1I9RH 4IDJH 3STZB 4L4TB 3HI1A 4M4RA 2RB8A 4U1MB 1FH5H 3IRZA 4KJWC 5J06A 5FUZH 1DE4A 2FBJH 3E6HB 5FCSH 2OR9L 3KPTA 1OT2A 2C4FU 4H8WH 3R0MA 3S5LG 4KAQL 4YGVB 1MJUL 1ZVSA 3ES6B 3KGRA 3WNPA 3HUJA 1EFXA 1KF9B 3MRLA 4MNHB 5D7KE 4OCSL 1ZLVH 1HHKA 1Q9LA 3H3PL 4HW6A 1MAMH 1S7QB 2FO4B 4QTIH 1G84A 2YD5A 3RI5K 3ARBC 3NABL 4S2SA 1AGEA 1I3RB 4WFEE 2DQTH 4JO3H 3I2CL 2V9QA 3I9GL 1YMMB 3DURB 2APBA 3BYTA 3QRGH 3TBSA 3UTPD 4TPRL 5BOPA 5GRUL 4XCCH 4LK4A 5FOBA 1QSEA 3K3QA 4DZBA 3H7LA 2PF6A 4N8CL 1FZKB 2NQCA 3UTZA 5IW1A 3CFEA 2XWJB 1CK0H 2CUMA 1JRHH 3D3VA 2F53B 4H0GA 4JFYA 1QNZH 3DOSA 5TE7L 5CEYA 3NZ8A 1KCSL 4PGCA 5EBWB 5FM8A 5TE6L 3ARFC 1CFSA 4CADB 2YD3A 4HUXA 3IDNB 1I4FA 4H88H 4JHAH 1G0YR 3QZWB 4N1HB 3BDBA 3HUJB 1MRFH 4M7JH 1S9YA 1NL0H 4LHUB 5E95B 4BA8A 4NQEE 2ICWJ 1MLCA 1CLZL 4QXGH 5E5UB 3SO3C 5HHNA 4L3EA 5K9QG 2R0LH 2PR4H 3CVHH 1CQYA 5K9KB 2BNUB 4TVPH 4KRPD 2XRAH 1RUPH 5GGVY 4ETQA 1WT5C 1QSEB 2ESVD 5I1IH 1F8TH 2XG4A 3DVGB 5C08A 4PRIB 1XIWA 4M1CC 3MLVL 4YEFA 2OTUA 3LPGA 4KTYA 5DFTA 4JO4H 4JFYB 3I3EA 3W9EA 3MRFB 1H3VA 3NZ8B 3IETB 5FF6A 1QRNA 4PGCB 3DI2B 4CL7A 5EORH 4OT1H 1WZKA 4X83A 1WBZA 5B3JE 1G9MH 5M7QA 3BD4A 1ZWIA 3IDYC 3FO1B 3RVVD 2XZQH 2H45A 1U58A 4GBXC 3HE6A 4HBQA 3U4BL 2EDLA 4WGVB 2DB8A 3QPXH 4NSKB 1ZE3C 1QR4A 1B3JA 3SGKA 3RWEA 3KXFD 4O2CA 3SCMD 1ITBB 5DUPL 4OFDA 5HGBB 2VN7A 3RWIB 4ZXBD 5L8JB 4MJ4A 1VDGA 2GAZA 4PRHA 1KCKA 4ODSL 3WXWH 1I1YB 1JHKH 5F88B 2E6PA 3TCLA 5FB8A 1B0WA 2ZUVA 1CD1A 2MHAA 4XI5D 2HT4D 4L3EB 3HI5H 1N3NA 3HZMA 2NW3B 1KB5B 3C8DA 1FLTX 4GFTB 1P1ZB 2Y07H 4U7MA 3T0EA 1EHNA 3QT2A 4U49A 4MVBC 1S7VA 1EPFA 2X4QA 4FTVA 3D69A 4NQDD 2FBOJ 1F97A 5D2LB 4Y1AD 3OR7B 4P2QD 4HIHA 1R6VA 1A14L 5FF6B 2BNRB 4R4BB 1X5KA 5C07D 3OV6A 4PJIF 3SBWA 4XNMB 4OQTA 3IDGA 2IGFH 5ESVA 2AV7A 5DUMH 3S36H 3QUZD 4PV8B 1WK0A 3QIBA 3RWEB 3FZUD 4XX1G 3FKUS 3OHXB 1T89A 5IP4A 4DCQB 4NZDA 3U0WL 3V5KA 3KPPA 3KYKH 4OD3H 2IBZY 2W9EL 4HXAL 4Z7WE 2BSRB 1QKZH 1ZHNA 2PYEE 1C1EL 5EUKA 5FUOH 1UXSA 1H3PH 4PRAB 4RGND 3HZMB 1HQRA 3F58L 4GLRI 1OAYL 5LQBL 4HBCH 3BHBA 4NN6B 4QHKI 1B2WL 3ME0A 4FQXB 4ENED 1ZSDA 3G5ZB 3TEUA 1A4KB 3UO1L 4X7SH 1T1YB 4C56D 3D69B 4PJIA 4R0LA 3QNXB 1E6JL 4NKIH 3P4OA 3HRZA 1G6RA 2NXZB 5E2JA 3O2DL 3T09A 2CLZB 1IAOB 2ADIA 4JRYA 4XAWH 3S96B 5I1LA 5ESVB 4F37F 4G9DA 2J12B 4Z78B 3KPNA 4RGOL 1T66C 3QEGH 5F7FA 3V5KB 2CXKA 1X4XA 4PLJC 1AHWB 3UZEA 2OI9C 3RWCA 3HAEH 5EOCL 4RFOL 5KVDL 4L8CB 3PGCB 3UJIL 2WUBL 1OGAE 5JHLL 1UXSB 1IL1B 1X5ZA 3L3JA 1U0QA 1U8KB 4UBDC 3D9AH 4JN2A 1A22B 3UC0L 3LN5A 1TVDA 5F89A 1QP1A 1ZSDB 3SGJA 3VWJA 3CNKA 4IS6B 1U36A 1NBVL 1G7HA 2DQIL 3TH2T 5LGJA 4TSBH 4L8DA 3HRZB 1G6RB 4D8PA 4BZ2H 1HYSD 4WW1A 4ORZC 4OZHE 2VXVH 1ZK9A 3JV4A 4MQ7B 1U93A 3O41B 3RPKA 3ZZ1A 4ZYKA 1BWWA 1FFPA 4X7TA 5EFIB 1BVLA 1FYTB 1IBGH 4KHXH 4ODWA 4BZ1H 5F9OL 3VA2C 5GJTH 3QUXD 4TSCH 3DVIA 2R9HD 4K8RC 1AR1C 4NWUL 1CE6A 4IOIA 2P8MB 3EYOA 1I3VA 1KJMA 1MEXH 3VGAB 1C7SA 2D7NA 2CDGA 2Y5EA 3A67L 2HJLB 1I9JL 5DURD 5CD5D 4LCWB 3S6CA 1VEOA 3LN5B 3VXSE 2AABL 3HZKA 4S11A 1W0YT 3MUGA 4DKFH 3RVXC 3MYZA 4EI5B 3H9YA 4ODHL 2JJUA 5JPMA 1JNLL 2F54D 2YZ1A 5B8CA 4NO0D 4GH7B 3VFNB 3UZQA 4XCFH 1ZTXL 4JAMA 2K1MA 3PL6C 2DBLL 5IBTL 5INDA 4D0CB 1HZHH 5D4QA 5MEQA 4M5ZH 1OTSD 1DLFH 3LRHA 4ZYKB 3E0GA 4WI9A 1WCBA 3FQTA 2OCFD 3NIGE 3WUWA 2V2TB 1J5OL 3RQ3A 4GAJH 1VPOL 4XGZA 3RDTC 1I1AD 1S8DA 4IOIB 5BJTB 1FL3B 3G6JF 4FXKA 1FDLH 2QQKL 2CDGB 4BK4A 1J0ZA 3PWPE 2NY1C 4X8JB 2DM2A 3NTCH 3MA9H 1T1ZB 3HZKB 4OCLC 4PIRF 5KVGL 4QRTA 3TBWB 5FKAA 3VRIB 4Z7VE 2DWEA 3MLSH 4XC1H 1MVUB 2KZ1B 3LN4B 3J7HA 4AL8L 3W0WB 4PJGF 2CJUL 5J1TC 4K9EH 5B39G 3SJVE 4LOUD 1OT1A 3CU7A 5MP6H 3PGDB 5C0FB 4WV1C 1NGYA 3FQTB 5KVEL 4GW5B 5CJXA 2HT3C 3H2WA 3TBTB 3W9DA 4PJAB 4OBRA 3G6JA 1BQLL 1UM4H 4J12A 3VWKD 4XMPH 4EQ3A 2QJDA 4Y19E 3WFEH 4FXKB 4ZS6C 3X12B 3HNTL 2IBGA 2VDOL 5CJQL 5DQDL 5EBGA 3EO9H 3QI9C 2YMXL 3FB5A 2ATPB 4N0CD 4G6FD 3P4MA 3KWWA 1H9VA 4P46B 4XX1E 3HE7C 4U4BA 2M2DA 1U3HD 5FKAB 4MA3B 5FO8B 4JFHE 4G8FA 5T1MB 2R8SH 3P4NA 2FWOB 3TJEH 4GAYA 1Y18B 2AJUH 5SV3A 5KZCD 2YD6A 1F4XH 3GSOA 8FABA 5DHXB 1MCJA 1GGUA 5I71C 1ZANL 2YHGA 5I1EH 3NA9L 1BECA 3C6SB 3LZFL 4KAQH 4WDIB 3BPCA 3BAEL 4LP4A 2CO6B 2IJ0C 5A3IC 3BH9A 1OARH 5FYKU 3V79C 1WV7T 1FZJA 3KPSB 2HKHH 3PQYA 5E1HB 3L1OL 4EQ2A 5IMMB 1BBDH 2XKNA 5K9JL 3GSVB 4NPYB 3NCFB 3PE9A 1VADA 3FB5B 5GGUA 3MRCA 5LCVL 1J11A 2QV2A 1OAXH 3KWWB 1NCCH 4X80L 1FC2D 5TFSL 1N5AA 3RVTD 4PJGB 1JPTH 1NCWL 2VXUL 4Z5RB 3VXMD 1KEMH 4M6NL 2R4SH 4UQ3A 3SDXA 2DOCA 2YK1L 4XBEH 1S5IL 3RY5A 1R3JB 5EBMA 3CSPA 3SDCA 8FABB 4R90H 4RBPK 3FT2A 4YXLL 1EEQA 4NC1C 4UV4L 2P5EB 3FL7A 4HCRA 1U8MB 3MRPB 4K3DL 3B3IB 4HPOH 2HFFB 2OQJA 2IQ9L 3DHMA 1RUAL 3TFKD 1AY1L 3PWLA 3GEWB 4LSUH 4X6FA 5IT2L 3WD5L 5K93A 1G7LB 5DVOA 4DK3A 4PGJA 5SWZA 4XVSL 4O5LL 1MWAL 3GMMA 3MRCB 4XCYB 1CLYH 1E28B 5CP3H 4H0HB 5C0CB 2HLAA 5E2UL 2VQUA 5I8CB 1DQDL 1IQWH 2CR6A 1YYML 4PP2A 5A43C 1FFOB 1NBYA 4UQ3B 3DV4A 4P59L 3VXQB 2HVJA 3P9LB 4Y16D 2OL3H 2A6IA 3T2OA 4F7TA 4IRSA 5T3ZE 2BK8A 4ZQKA 4LLUA 4I0CC 3VMOA 3FMGL 4HWZA 4NN5C 3BEVA 4MZ3A 1SYSA 3TA3A 3QQ9C 4I0PB 4LNRA 4PJBF 4MD0B 2WIIA 1F4HA 2OQJB 1FO0B 2CPCA 4X6DF 4HFUL 5BXFA 5DUPH 2QQLL 4IJ3B 1AFVL 4K71B 3SDDC 3WJLC 4ALAL 4YXHL 3NFNB 5JR1H 1KJ2L 5F7WC 4WEMB 3PWLB 2CKBA 2EDHA 3VFGL 1NPUA 4XB8A 4XVJH 1V7ML 4RZCB 4IIQA 2GJ6B 4ZNEE 5E4IA 1C5CL 5E24E 1G7JA 1G7QB 4BFGA 1II4E 1UC6A 3RUGB 3QNYA 4PY7A 1Y0LB 5C0DA 2P49B 4WFHE 5KSUA 5KS9E 1NLBL 4TNWK 3GSNA 4HT1H 4LLUB 2DLHA 4J4PA 4MB5A 4X9HA 4WI8A 3B9KC 4I48B 5AZEH 4LPXA 5KAQF 1LO3L 4X6DA 4LNRB 2B0SL 4MAUL 1K6QL 4M48L 3BGFC 5BVPH 3WMSA 1NEUA 3AS1A 2Q8AL 1MRDH 2HWZH 2J5LB 3U0WH 3D39A 2A0LC 2NXYC 5IOPA 1U8NA 1A7NL 1L0YA 1NFDF 5AG9A 4AENB 2WK2A 2Y5TA 5GS2H 4NC2B 2VL5B 2WBJC 3OJDA 1UWEH 3U83A 4V2BA 3VFUB 1EGJA 2I07A 1TZHB 4LQFL 4JQIH 5I1JL 4NQCD 2VRAA 2A73A 1T21B 2O5ZL 5TDOB 3JWDH 2G60H 2VDRL 1I85C 2YPKB 3QRFM 3B5HA 3WIFA 4OI9A 3QH3B 3RTQD 1AGCA 2NY4D 4OLVH 4XBPA 4LLDB 4PJBB 1P4LA 5DHVA 2WAHA 3QCVH 1HXMA 4YUEL 4APQB 1UZ8B 2F8XC 5E8EB 5JIHA 3KNBB 2VLRA 3BT2L 4O4YL 4Z7QF 3GMPB 1NFDA 4KI1A 5J0BA 2R29L 1T22B 3QA3B 5EU5A 4NQVA 4YQXH 3WFHB 5JHDB 4QXTB 5IOPB 2HLFC 1U8NB 1UM6L 2B1AH 3MRJB 3PV7A 1JF5A 5F6IB 5I0ZA 4BSJA 4XXDA 5GGTH 4OGYH 3IFOA 1NMBL 4NC1E 1FNLA 1D6EB 4RRPA 4KQ3L 1CFNB 1E4WH 1RZ7H 3S4SA 2X7LA 3C6LA 1INQB 3SE8L 2F58L 2DBJA 4RMUA 3NCYS 4Y5YC 3G08A 3HN3A 1KELL 4HZAA 1AGCB 2JJWA 1DDHB 4OIIL 4H1LA 3LS4H 4L29A 4QNPF 3MROB 1ADQL 1MCBA 3TNNA 3CXDH 1ZT4A 5F9WB 4G6KL 2WM0A 2VLRB 4NM8L 1NFDB 3TWCL 5DMJB 2Q76B 4PJEE 3QULB 4IMLB 2BVUA 4QEGA 4UTAH 3REVA 1UZ6F 2X1PA 5JOFA 3EYFA 5CLTA 3HPLA 5H94B 5I6XC 4RWHA 3ESVF 3QP3A 3HG1A 3UTTD 1Z3GL 3A67H 4XXDB 4M9PA 3E8UL 3U46A 4PGBB 3RGHA 3GJFK 1KLFA 3IFOB 3M07A 5EO0A 2VDLL 4DTGH 2BRQA 2D2OA 2XTLA 2XI9A 2VSDA 5EU6B 3RU8H 5DMYA 3K46A 3FO9A 1T80A 3G08B 4U1KA 3WEXB 5I8KH 1E27A 4QHMA 4L29B 5IBTH 4YDVA 3QXUA 2WINA 3UTSE 5A2KH 2GTWB 1R5IA 5F93C 3O81A 2OS7A 4Y4HC 4Q6IA 5C3TA 1J5OH 1U8HB 5HHQB 2BRRH 5BRZD 4ZO7A 4PV9B 4WEBH 1OAUL 4XWOD 1YN6B 4Y4FA 3G5YA 1UKQA 3HG1B 1PBYA 4JJ5B 3L3DB 2AJZA 1DBAL 2C1OB 3QFJA 2QQKH 4QRQA 1MPAL 5KVMC 4XVTL 3ARGB 4F8TA 1A4JB 3ULVH 2XFXB 1O0VA 1CFTA 5J11C 1IVLA 5I19H 4HC1L 4WO4A 3BP5A 4K94L 5B38G 1A6WH 3RGVB 1UJTA 2QQNL 2ITCB 2CRIA 4MJID 1JNHA 3EYQD 4HKZA 3UZVB 1HHHB 4YFLI 4AIZA 4HKJA 5EIIB 1V5JA 4JFZH 3L3GB 3JZ7A 1HINH 3AROA 3HZYA 3AS0A 2Z31D 1AD0A 3AB0B 5KSAC 4MNGB 3AU1B 1A0QH 1U8JA 3PWNA 4BKLA 3S35X 5C8JA 3FO0L 2DDQL 3KPRD 3RI5F 4DN4L 1MFAH 2ICEB 3DYMA 5FYJU 1E6OL 4OLWH 4P23C 2AJZB 1NMCB 3MLRL 1NC4A 4Y4KD 1UWXK 5HYJB 1W72B 3H9SB 2YMXH 1UB5A 2H32H 4OZIB 4JY6B 3QNZA 4D9RD 3UYRL 5L2JB 4QXUH 1A3RH 3FRUB 4YDJB 3PG2A 5C7XH 5JO5A 1JK8A 5F7YC 2ITDA 3JSSA 3O4OB 4G9FE 15C8L 4JFEE 4XZUA 5KOMC 5CD3B 1W0VA 2V5SA 2H8PA 5GGSA 2ED7A 4L4VA 3KYNB 4X7DC 4YBQD 3NA9H 1BM3H 1AGBB 5L2KA 3QUYA 2YWZA 2YWYA 3D2UD 1AD0B 2DLGA 2BHZA 2GCYB 4OGAD 1UCBH 1R24B 2JKXA 4FFWC 4PRDA 1KOAA 5JIPA 4OLZL 1UM5L 2XTJD 1IGIH 3F7RA 5F96H 3WHXA 4KJQD 2V7HA 2BOCB 1NLDH 5LG1A 4PJDE 5K9JH 3O6FA 1UB5B 1AO7D 4AT6A 3G6DH 3Q48A 2AI0L 3QNZB 3QJHA 3BSZL 1A1MA 2VTFA 1YNTA 1EEUA 4U1HB 1IAKB 2HRPH 4HFWA 3WIIH 3HI6H 2YPLA 4YO0A 1A6PA 1QO3A 1K2DB 3MXVH 3MV7D 2YK1H 1PY9A 2ED9A 2Y06H 5D2NC 2J6EA 4QHNA 2QKIA 5J8OA 2Q20A 5E99L 4QXWA 1DANT 3PABB 1U42A 1JZ6A 1U92A 4M7ZB 5DK0A 4ELMB 4JY5H 1AE6L 1XCTB 2EO9A 4PJ9A 4HUKB 3IKKA 1A6AA 2FATL 4XTRC 3CK0H 4PTUA 1NQBA 5KSVB 5C6TH 1NEZA 1OCWL 1QSFE 4PJFB 4NRXB 1TENA 1NGQH 2AW2A 5EZOL 3ZKQD 4OAWA 3B9DA 5IT2H 1CVRA 1BD2A 3BPNB 3QIUA 1OP3H 4P0DA 4N5EC 4O5LH 2DQHL 2VLKB 3U9PH 4JLRA 1CIUA 1A1MB 5E2UH 5ID1B 5ETUB 5KW9L 5DEGA 3I84A 2YPLB 1QFUH 3AAZA 1MFDL 1JP5A 2AP2A 4K07A 1PKQB 5DT1H 2WLYA 4GKSA 5D96B 2E9IA 4QHNB 2ZSWA 3BZFA 4NT6B 1LE5B 2APVA 4EDXB 1CICB 2DWDA 4JKMA 2X4UB 4OZFG 1U92B 3ZKXC 2O5YH 4R4FL 4PJ9B 1OF2A 3NIDF 2NY3B 4HMEA 2EDWA 1UVQB 2FR4B 5MENE 1GGCL 2LTQC 4NRYA 4ALAH 3OKYA 4BFIA 2DQJH 3IFPB 3RL2B 1RAMA 3VFGH 4OAWB 4MXWL 2FIKA 1RZIB 3HB3D 1B6DA 4MHHG 4FZEH 1Q94B 3BPLB 4RSVA 4D0BA 2VKXA 3TO2A 5AZ2H 3MCG1 5ICXA 4JFFB 3DX8B 4LKCA 2X9WA 5DC0A 4X6BA 2VIRA 2ZSWB 4N0UB 5CJBA 3TO4A 4HSQA 1A9EA 2B7DT 5FDWB 1JTOA 3W82A 1D5ZA 3HC3L 5IB4A 3VXPA 2L7JA 4OSUH 1S5HA 4JFDE 2DWDB 5F3HB 3VFOA 1QLRB 3T04D 2B0SH 1DBML 3O3EA 3P9MA 2X4TA 1OQOA 1EX0A 1XGUA 4ZMAT 3MBEB 1F3JA 3F7VA 3TZVC 1HHGB 4NRYB 4U2ZA 3V4VH 4QRUB 4OLXH 5D7JD 4HIEB 5EG6C 1A7NH 5HI4D 1KJ3H 5DEZA 4U1IB 1HIML 2IAMA 2VDQH 3CGTA 1SYVA 5C9JB 2YD7A 2QSQA 4PJ5D 1HYRC 2AJSH 4LCYA 2YRLA 5CBAA 3E2HB 4FZ8H 5D1QD 4GRMA 3GK8L 1TJGH 4RMWA 2UWEB 4J23A 3TPKA 3V6BR 1KXQE 5DD1L 1JYWA 4HQQH 5HVHB 1P9MC 4HGWB 1RULH 2DI7A 2EXYD 1XGTA 1QYGL 3AC0A 4MSWA 1BOYA 1QA9A 5DK3A 2PXYB 1S5HB 3GZKA 3QAZB 5C0BE 3WNKA 5D70L 4F8QA 5E6IA 3DX7B 5JMRA 3DHJA 3U36B 4Q9CA 5JOPE 3BT2H 3FRPA 4OCYH 1JL8A 2YEZA 1U95B 5IMKA 4HKXB 3K80A 3MGOA 4XP4H 1IM3B 3C60A 5LAXB 2FEDC 3MLYL 1XMWA 5TPWL 2EXWD 2D0FA 3HZVA 3RWGB 3EOBB 4L9LC 3IKCA 4EUPG 4JHWH 4OZ4B 1A7OH 5I73B 1ZGLM 4N0FB 3MV9D 1DBBH 5D2NE 3QQ3A 5DZLA 1CXLA 3IGAA 5EC1B 4M7LL 4GRWH 3G5VA 4LVHC 2FB4H 2IANA 3D48R 4XNXL 3W5NA 3EO1B 4JZNA 3LPWA 4BZYA 1KNOB 4GLRH 5M95B 4GXUM 1CIDA 2P43B 3DTXB 5D1XA 5C0IA 5CSBA 5CJ8A 4YFEA 4WW2F 2DF3A 2XZZA 2HFTA 4N90E 4G6KH 5F7LB 3CFJB 1QBLH 1B0GB 1YEHH 5D6DC 2ZOKB 4KKLD 4XVUD 1YYLH 2EIEA 4PRPB 4QRPA 2A1WL 3LD8C 1Q9OB 4N0YL 5JW5A 4HAGA 3MGOB 3O9WC 5DRNB 3MRMA 2GSIB 3K4DA 4RAUB 3O3BB 1OWRM 4K7FA 5ALCL 3WDJA 3I75A 4Y88A 3JWOL 3P30L 4MXQC 4YR6A 2X89D 4GW1B 3G5XA 3OQ3B 3RKDC 3BGMA 4PP1D 4NGHL 4P3CL 1IFHH 3GSUA 3LEYH 3QJFB 1KV3A 3EGSA 2JJSA 5FYKD 4WW2A 4LSPL 4NCC1 3OTTA 5E2TL 4NQUA 1VFAA 4E42A 4PG9A 3RNKB 3E6FB 1X44A 3QR2A 2APTA 3T3PE 4PRNA 5D1ZD 4P5MB 3UJJH 3QUMH 1L9NA 3SE3A 4QHUB 4U6TA 4LSRH 5C0GA 4P57B 4NJAL 1NCTA 3OL2A 5GSRB 4I77H 4LSVL 5H35A 2DQGH 2WQ8A 1JWSA 5JW5B 4P2OD 2YXFA 5IEHA 3BH8A 3G6AA 1OP9A 5DO2D 4MS8C 4JKPL 5D5MB 5DQJA 3ECBA 2LU4A 3CFCH 4I9WE 5K59F 3GI8L 4PRBA 3WFDH 5GZOC 4MA8L 1E4XL 1J1OL 1X5XA 4JANB 5ADPL 3BO8A 5KTEL 4R3SB 2BNQA 3MACL 1B4JL 1T7VA 2VYRE 1CYGA 3JWNC 1T7WA 4XPHL 2QQNH 3VFWA 1FYHB 3FQUA 4NHCL 2QADB 5B3JF 1XF2A 4PRNB 1F3DH 4J8RB 4JM2D 1H0DA 3L5XH 5BV7L 4Z6AT 1HHIB 2CLVA 4NQEA 4E41A 1YZZA 1FGVL 1XGQA 1AJ7H 4MJ6A 1CBVL 5H35B 3H3BC 3U4EB 5FKPB 2WUCH 5IEHB 2PO6B 3WHE1 1JZ4A 1WEJL 1MF2H 5TDNA 1MHPH 1A6ZA 2FECL 5CJ5A 1AC6A 5IFHL 4JQVC 3RWDA 2BY2A 3LHPH 4LCIH 3T1FB 3FQRA 1BLNA 4MNQA 3MRRB 5E03A 1J1XL 1OP5H 1UXWA 4OD2A 1SBSL 1CI5A 4IRZL 4XHJD 4JRWA 3UYRH 3BO8B 3P73A 43C9B 3MFFA 1MUJA 2VAAA 1D5BB 2CIIB 3C09C 4V1DB 4JG1L 3AXLA 2JE8A 2XN9D 4I3GA 3V5DA 1MHCA 3Q6FB 3SKOA 1TQCC 1KTLB 1P84J 4S1QH 4UAOC 4HHAB 2HFGH 1UYWL 3PNWA 3O4LD 3DV6A 1F00I 3FT4A 2XA3A 1XF2B 1H3XA 3NVQA 4DKEH 3FCTB 1H0DB 3EOYG 1CGSL 2R1XB 2VERN 4HKBA 5E9DA 5IJKC 3NFPA 4KI5C 2DIAA 3VXUE 2VISB 4JFXA 4OJFL 2Z92A 5D7LA 1EEYA 4WUUE 4YHNA 1VEPA 1AQDA 1A6ZB 3OXSA 3IJYA 4UQ2A 1J8HE 2VDML 4Y2DB 5DZNA 4OD2B 4K7PH 3GNMH 2ENYA 3WFBL 3P73B 2VAAB 2A83B 3KPQA 1YEGL 1MHCB 1NCUA 2H2SC 4QRRE 4PREB 3MRKB 1K5NB 4H20L 2BY1A 4JDZA 2VH5L 2OR7A 4RFEB 1B88A 1AKJB 1GGBL 4Q58C 3TN0A 3VXRA 4AEHH 4PLKC 3TV3L 3O3AB 1N0XH 3ARPA 1WBYA 1M71B 2GJZB 2FGZA 2BSSB 4NHUB 4OKVA 1UEYA 3BUTA 3TVMC 5ICYA 4YZFE 3O3DA 5F9JB 3WS3A 4GMTL 3MRBB 3CDGA 2EYRA 4P4RB 1NJ9A 2BOBA 5J6HB 3CX2A 3NFSL 2Z93A 1Q0XL 4XNUH 1ONQA 1YEEH 4YXKH 4CGTA 1J0YA 2MQ3A 1BF8A 5KW9H 3LIZH 4JY4B 1YEJL 2ZUXA 1OAKH 4KV5E 3LKNA 1XFPA 4GAGL 4JR9L 4JDZB 3QUZC 3ARBA 4G8GA 4TNWF 3DGGA 4LSDA 4NM4L 3DBXA 3S37H 1C8PA 2ZNXA 5GGQH 4NO3A 3MO1A 3K0WA 5E2WH 4Z7WB 3GO1L 2D9QB 2R0WH 5E94A 2PYEB 3VFMA 4OIAA 2PW2A 4OKVB 1OGAA 2J4WL 4CDHA 1ES0B 3BDXA 1P7HL 1I8LA 5I9QC 3TIEB 2WBWB 2KBGA 4ONGL 1Y6KR 1N7MH 4F7PB 2EYRB 1G1YA 3ARFA 2CDFB 1BFTA 4A2LA 2DRUA 3B4NA 2BHYA 3MQIA 2H26A 4KDWA 3DUUA 5C0AE 4HWBL 1D9KD 3ZYOA 35C8L 5L8LB 3MRNB 1WAAE 3LKNB 4EXKA 4BM7A 4EXPX 1IC1A 3ARBB 3RZCC 5FECB 2J88L 3OKMB 1WWCA 2P8PA 3UTPE 3BKCL 4XP5L 3IF1B 3ZKNC 3DO7B 2AK1L 3D0VB 4GO6B 5BMFL 1YC7A 4URTB 4M1GL 3BESR 1OHQA 1JHTA 1HDMB 1MCOH 1FZMB 3U6RA 1T1XA 3S5LB 3LB6D 4EKXA 4WWKC 3VXSA 1A6UL 3ARFB 1CXHA 3AVEA 1WIPA 4ZS7H 4RAVA 5IK3B 4L4TD 3LSOA 5CBEA 4FS0A 2X4OA 3HNVL 4UU9B 5L0QC 3DXAA 1NCDH 2YKLL 3INUL 1D5XA 4Z7VF 1OGTA 3DPBA 1DBKL 2HTKC 3QIWD 2IALB 4OZHB 4KI5E 3FN0L 3ZE1F 2CGRH 4GSDL 4GRLC 5EU3B 3SO3B 2W07A 3R1GH 4KK8D 5DHYB 3PWUA 2ZCHH 3WUZA 2ESVE 4OIBA 2GFBA 1PSKH 5B21A 4Y7MA 4BJLA 1HH6A 4L8SA 1LO4L 1FQ9C 1N6QL 3QEUB 4HULB 3U6RB 1YMMD 4LSSH 3TT1H 1YQ2A 5CP7A 3VXSB 1S7RA 3MLYH 2MPAL 1N8ZB 5EOQL 4OFYA 3IDYB 4C4KT 4OUOA 1AP2B 5KOVC 1JPSL 4Z7VA 4GBXB 1U8PB 3IXTB 5FK9A 2F53D 3KXFE 2J1KA 4LEOA 4M02A 1ORQB 3BZDA 3DIFB 4NQXA 3LEVH 1RIHL 3T2PA 4O58L 1RI8A 4Z0BL 4UILL 1RIUH 4KJPD 1NH6A 3CSBA 3V0VA 4CMHC 4NNPL 1DL7H 4YHKL 3VGHA 2A9MH 4E0RA 2IFFL 2CKBL 2UYLB 4ZO6A 4LHUD 1Q9WA 1ZHKB 2ZPKL 4EJ1C 3VD7A 3IDMA 2QR0A 3P0GB 4Y19A 3RHWF 3ZL4H 5DJ2B 3PP4L 3FOMA 4BSWA 3KAAA 5E5RB 3PWPB 4G8EA 1OAQL 4N0YH 4QTHA 4PJHE 1KFAH 1VESA 3HMWH 3PP3H 3N85H 5CP7B 4NZJA 1QSZA 5C9KA 5MHSE 3PJSB 4PRID 4Z7VB 3GSNL 3LRGA 3IYLW 1WTGT 2GT9A 4Q0XL 1QQDA 3L5HA 4JPWL 1C12B 4H26B 5L88L 3SJVB 4RMVA 3B2VL 1QHOA 1OPGL 1YNLL 3V7MA 1DQMH 4OGXH 1JWMB 1T7YA 5EN2A 2JB5L 3QUMB 2R1WB 3OKOA 4XCNB 4AMKL 4E0RB 5ICZB 4D9QD 4XPFL 5DJDA 3MRQA 3VWKC 1Q9WB 4HIIA 1N2RB 3CVHA 3TNMA 3IDMB 5JDSB 1EGJL 4Y19B 2X70B 5SV4A 1JGEA 1HXYA 4IRJA 43CAA 1MNUH 2HKFH 2CXGA 2J3SA 2EYTA 1RFDH 2C1PB 1LGVA 1ROWA 3N9GH 3B6SB 3GJFB 4IHOA 3KDMA 2EDDA 4TSAH 1IEBA 1ZHBB 5CSZA 1CGTA 1XH3B 3WIHL 3QDGD 2EKSB 4NQTA 3QFDB 3DGCR 4YHZH 4JO2L 4YHLH 1IMHC 3A6OA 4CNIB 1A2YA 2BNRD 2XQBH 2N7AA 3PWJA 3QO1B 3MACH 4F80A 1FL6A 2Q8BL 2OI9B 4XPHH 4KGLA 1A7RL 1BHGA 1ORSB 4NQSB 5DLMH 5TF1H 1M6OA 1QRKA 1KCUH 5E8OA 4JKWA 5HHXH 4NHCH 4KKCD 4LMQE 5IB3A 3NAAH 5IFAL 4HIIB 5DMGC 3LS5H 4J3XA 3TNMB 3GSWA 1IEAA 3D85A 1H8NA 1PG7L 2JB6A 1IE5A 43CAB 4K3JL 1OVZA 5A16A 2CLRA 4M7LT 1NUDA 4KZDL 2AXFB 4IHOB 3KDMB 4Z7UE 4FQXD 2ARJA 1L6ZA 1YECH 4KK6D 4U1JA 3UTQA 2ZUQC 2YD1A 4U0RC 4RA0C 1XIWC 3ULUH 4A6YH 5I30L 2RAMA 1OSPL 4LRNH 1EERB 5IHZB 3ZE0E 2NXZD 1NAMH 1FL6B 2EDNA 1R5VA 3WL9B 3L5JA 4HV8A 4P4KC 1MIEH 4JFQB 2ZG1A 2Q86A 5KS9F 3HE6C 4NC0B 5LWYL 1NANI 4V2CB 4WI6A 3SGKC 1K4DB 2IWGA 3LAFA 3Q5TA 1CZ8L 3FB8B 5GGRB 4XBGB 5CEZL 5IB3B 5IUSA 4KKBC 3TPUA 3MR9A 3QEQA 5T3XH 3D85B 2DM7A 1RVFH 1EUUA 5ALBL 1MRCH 4Z7NF 5FO9A 1EZVX 2F54E 3PHOB 5A2JH 3TT3L 4UOW1 4DVBB 3EHBD 5AUMA 1IGYB 4NCC2 3PL6B 3ETBF 3EKCA 4ZNEA 3UTQB 5B4MD 2C7UA 2CDEA 1G7IA 1T1WB 2H9GB 4ZTPH 1JN6B 3T0EC 4X4MA 2VDMH 2AJYH 3ABZA 3FQNB 4TUJA 3O6LL 3JWOC 3QG6A 1YQVL 5DF0A 3LKQA 4BFEA 2R0KH 3BKYH 4XPTH 3C08H 4FQQB 3SBWC 2GUOB 5F1OB 4NNYA 1CFBA 3RDTB 1CDIA 1BOGA 1CR9H 1CWVA 5DWUL 2EDEA 4X99B 1FYTD 5FXCH 3QIBC 4ORGA 1XR9B 1GGBH 2NY1B 1FVDB 5JXAH 4BH7B 2A6KB 3MCKB 4NP4H 4CN6A 4CVXA 1GRWA 5HI5D 5D9SB 3VFTB 5FO9B 4KUCF 4NCDA 5B39A 1IGTA 1WTLA 2FYYA 2AJ3A 4LCWD 1XZ0A 5AUMB 2QHRL 5FA4B 1WUNT 4JZJA 1EO8L 4LFHD 4X5WB 1MCWM 1TCRA 4DFHA 3EYVB 4GMTH 2CDEB 3GSRB 4EI5D 4LCUB 5FYKL 1OSZB 4WV1B 4OV5B 4PYGA 4P9HH 3F62A 4TUJB 1HHJA 4R0LC 3FFDB 4CU6A 3ARDA 4F7MA 1MCIA 2BSTA 4MZ2A 5KS9B 1I1FA 4M5YL 3MODL 3ZLQC 3JTTB 2MQCA 1AXTH 4JR9H 2OLDA 4YWGH 4GKOA 4GKNA 4K7PY 1ED3B 3QI9B 3RKPA 5F1NB 4OFPA 4NFCA 4ZO8A 1G0DA 2GKIA 1IC4H 1P2CB 1J88A 2WV3A 2IG2H 3HE7B 3D25A 5ESAA 1MCHA 2R69L 1PX4A 4PJEF 4S1DC 5B39B 3GO1H 3D3VE 5BV7C 3EDDA 1XZ0B 2F5BH 1LD9B 4K3EL 2VXSL 3FFCD 5I71B 4KH2A 5JQ6L 3KYMB 3SGJC 3TC9A 4RISL 3VWJC 5GZNC 3PV6A 4MX7A 5IB1A 2XKSA 2E9WA 3W0WD 2BFVH 3RTQC 3BZEB 2BSTB 4R7DB 5GS0D 2OK0H 2WLZA 5FHBL 1LK2B 2YUXA 2P5WB 1SM3L 5AYUL 3ELAT 3NACL 1RZJH 2Y36L 4XNQA 5CJOH 3MJGX 3ZKMD 1BGXL 4TN9A 5CILL 3F12B 3V0WH 4ZDHB 2QLVB 1CLCA 3JTSA 3BKCH 3OAUL 1CDBA 4HUUB 1RHHB 2AK1H 3MC0A 1ZLWH 5DUBB 3WUWG 2P42B 5C08E 3WLWC 3WDHA 3BVNA 3TBYA 2I24N 2FCBA 4Q2ZB 3GBMH 1QRNE 1EXUB 1JZ2A 1IGFL 4XCEB 5TQ0H 4RFNC 5EB9A 2IC2A 1A7PH 4P46D 5FA3B 2W60B 1KTRL 2V5MA 5HDQL 4MX7B 4C83B 1JPFB 5BZDA 2J6EL 4X98B 5B8CC 2H3NA 4JRXD 4PJCE 4QY8A 32C2A 4FNLH 5IVZB 3SDDA 4YPGB 4HS3B 1EFQA 2IMNA 3UTSA 3BQUD 1OTUC 1IGML 5I1DA 3VMPA 4XNQB 4HJ0C 2C4FT 5I66A 2L0DA 4ZFFA 3GUTA 1KN4L 1WBXA 3C5ZD 3AY4C 5EO1B 1ERNA 1A1NB 2CIKA 1A5FH 4PJEB 1E4JA 4RQQA 4B7LA 1KLGA 3KPSD 3T0EE 1Q38A 4FTVE 1L7TL 3ARRA 4HUWA 3RAJL 1GAFL 1OY3B 3GIZL 4LAJH 3QUKA 4OCXH 3ZSSA 1WF5A 5EZLA 12E8L 1FIGL 2DTSA 4GT7A 1DQLH 1MCDA 3EFFB 2R2EB 2R2HA 5TQ2H 4KUZL 3MNWA 3MCLH 3QPQD 4KVCL 5C0ND 1AD9B 3BWAA 3S97C 3UPRB 3NZHL 1PKOA 3SDDB 3MRDB 1RIHH 2P5ED 2EZ0D 3HC0B 1G9NH 4Z0BH 3SDAA 2WSKA 4UILH 5F8RC 2ZCKH 5I66B 2NNAA 4WTXA 1I9IH 3CFBB 5BQ7B 5CJXC 2EDJA 2V2XB 4MCYA 4U1SB 1BQUA 1UQSA 1TZGL 1P4IH 4X0KA 4RQQB 1KLGB 4HPYH 5BVJA 3CFDB 4HS8H 5BOZG 1CDCA 2VZUA 1A6VH 4JZOA 4ONOA 3GMRA 5ADOL 5JA9A 1OAQH 5JPNB 3HC4H 5EZLB 3T0BA 1NGXA 5C0CD 1BREA 5E2VL 3B9KB 3L3KA 4JRYE 4JVPA 3LQAL 1TETH 2W65A 2UVFA 4HIXL 4G3YH 2R2HB 5MEPA 3B9AA 5GS3A 4OZFH 2I5YH 5CUSL 5HHVH 3NCMA 2MOVA 3BGFB 3JV6B 3P0VH 4LL9A 2OXGA 3FO2A 2XNAA 5CWSB 4G9FA 5HYSB 1RJLA 1MY5A 3AGVA 3ZDXF 2UV3A 3BIBX 1INDL 4L8BB 5FV2A 2DQCH 2NXYB 3SDAB 2LAGB 4R7NB 3RWHA 3P40A 4OZGF 4WHDA 1EHLL 1E4KA 4I0PD 4KRLB 4LEXH 5TH2A 3T2NH 2WBJB 3VXOB 4YBLC 4LGPB 4AMKH 1MCLA 1DVFA 1KC5L 1IGJB 2E6QA 4UIMA 3CCHA 1M1SA 3S3PA 2APFA 3ARTA 1VEMA 4JO1H 2E7HA 3MLXL 1Z0NA 3CX5K 3P77A 5CP3A 3SKMA 2Z9TA 4J6RL 1DUZA 5HGAB 5HD8D 1S7SA 1YY8A 2BVTA 1KLUA 3AREA 4QWWD 2GJ6D 3GGWB 4OLEA 4MA1C 1XR8A 5DMKB 4MAYA 2FGWH 5E5MB 3N1GC 4HS6A 2BVPA 1CT8B 3WJJA 5I1HL 1KBGH 2AQ2A 3PWVB 4ODUB 5FGBA 5L8KB 1EMTH 4N68A 4OZGA 4G9FB 3SDCC 4JFEB 2Z91B 1P7KA 1EBPA 1FAIL 1CU4H 3RWHB 4YHYC 3SPVA 3UXFA 1KPUB 1HWGB 5I76A 3DUHA 3T4AB 4U1LB 4NYLA 2HJKB 4F57L 5I16A 1Y6NR 3QO0A 4UIMB 1XF5B 3R06A 1FLRH 5J7CC 1JPST 1F3DJ 3K8MA 2OZ4H 4G42A 1RUKH 3BP6A 4U1NA 3SOBL 4K3JH 1QBML 4MQXC 4Y5YB 4PJDB 3LH2L 1VGKA 4M8VA 4O51B 3RVUD 3GSQA 1JFQH 3BUYB 4ZTOH 3U48A 1GHFH 4RWYL 4KKNA 2QEJA 4A6YB 1FNSH 5GGVL 3IXAA 4DAGL 1R5WB 1AGFB 1YMHA 4PJ8A 4JCLA 5E1AA 1JVKA 3BOVA 5I30H 3CZJA 4IRSC 4Y4HA 5FYLD 2D7TH 3BEWA 1QR1B 3U7YH 5I6XB 3TA3C 1PFCA 4APQD 2Z0BA 2K7QA 3UTTE 3LQMA 3N0PB 1I8IB 5H2BB 4Z77A 3V52H 1UGNA 5JHDD 1EO7A 3SGDI 4OB5H 4ZAKA 3MBXH 2R56L 1QSFB 3T8XA 2AS5M 3MOBL 2DQUL 1Z6JT 4HJJL 2QSVA 2V7NB 3MOAL 4TULL 4IIQC 3ZYIA 4WIQA 4LLYA 3BI9X 2W59A 2XZAH 3TYGH 2X4PB 1SMAA 2P7TA 4ZG1A 3ZTJH 5FYJL 4Y4HB 4TUOA 4ZUWB 2FSEB 3QDMA 4J4PC 3SY0A 4KTDL 4NNXB 2PUQT 3MJ6A 1NBZB 5KAQG 1HK6A 1Q72L 5DR5H 3UX9B 4BQ6A 2Z8RA 2EH8L 1YA5A 1WVZA 4MLIA 3OXRA 4M8QA 2N7BA 1NSNH 5CGYC 1UENA 5A2LH 5DTFA 4NKDA 3GKZA 1T0PB 5B38A 3M8OH 5MENB 2ZJSL 2AXGA 2R4RH 1CFQA 1V05A 1YN7B 5IVXF 1JGDB 3ILPB 3V6OA 2NX5A 3VU2A 4TUKL 2JELH 3LKRA 4LPCA 2WWMD 1ETZA 5GHWL 4AIXA 1U8LB 5FYKH 2I25N 5FCUH 4NO2B 5SWSE 5EU6D 1JPGA 2P7TB 3HHRB 1KYOK 3EAKA 3MA7A 2DYPA 4RRPG 5KSAB 1EV2E 5CIPA 3S4SG 3P11L 1YEKL 2WP3O 3SY0B 1MCNA 3WNNA 5I75C 2VXQH 3PQYE 1NGWA 3QQ4A 1GPOH 3EOAB 3MJ8B 5GS1A 5JA8B 2KPNA 5C0BA 4JFDB 3MGTB 4G80B 3CXHJ 4H1LG 4P23B 3OXRB 4LSQL 4LLQA 3CPLA 1P53A 4D9RE 5ESQA 3X11A 2WWKO 3CFIC 1KB5L 2EIZA 5IVXA 1GC1L 5B38B 5D7JC 2F19H 5DJ0B 2R15A 3OKDB 1CFQB 1QZ1A 4WFGD 3QXDA 3CVIH 1VENA 3HG1D 1XCQB 2R69H 2XWTA 3SDXE 3PIQA 4PD4J 1HQ4A 1QD0A 4BH8A 1FL5A 1P7QA 2EE6A 3ARGD 5KANG 5IFJA 4XMKH 2ORBL 5KJRL 2B39A 2AEIT 1PX3A 5D2NA 3AFLA 3WSQH 4PS4L 3C6LC 5D1QC 3EOTL 1JPGB 3KLAA 3RGVD 2K3TA 5LGKA 3MA7B 5H37G 3B5TA 2G9HA 2B1HH 4KJYB 4JHZA 1CS6A 1IM9B 3BDYL 2XZCH 5C0BB 1TVHB 3QCTH 1OLZA 5SWZE 1AO7E 3BKML 3CPLB 1C7TA 3FAWA 5ESQB 4NWTH 5IEKB 1AI1H 1IT9L 5HHMD 3T3PF 4Y0GA 1XGYL 2EDKA 3VW3H 3IFLL 5C0EA 3V6FB 1CE1L 2ATKA 5IW3A 2AJXH 4U6YA 4UUJA 5DRZB 2RR3A 3QDJA 3RBGA 3IDIB 3PIQB 5HYJD 1P7QB 3CLEL 3H9SD 5SX4I 5IFJB 4LCCA 1QUNA 5ACZA 1DQTA 3HMXH 4QT5A 4WHCA 3X3FL 5GJSL 1FV1A 4L1HA 5D2NB 3G9VA 5DVNA 4LAQL 3B9EA 1W2KT 5EZIL 3VFSA 1J86A 1FE8H 4CU7A 2MCG1 1XF3A 4S1SL 1YNKH 4G5ZH 4LPYA 2MKLC 3CUPB 2ICES 2FL5B 5T1LB 4F7CB 2FX7L 4WCYL 2AK4B 4ODVL 5F7MC 4HWEL 5I1GH 2R1YA 1P4BL 2EEDA 2XA8H 4Q6IC 4ZUTB 3KHQA 4KKLC 4XVUC 3EFDL 1X5FA 3FQXB 2NCMA 4Y4FC 2H32A 3SDYL 2X1QA 4ZFGL 4X4XA 2OSLA 1L7TH 3SQOH 3F7QA 1PAMA 1FNGB 4MJ2A 4DUWA 5ACZB 4ZUVA 5DFWH 4FABL 2AGJL 1FV1B 12E8H 3PDOA 1TCMA 2OJZH 2P8LA 4X6DE 4LVNC 4FQJH 4WO4C 3SKJL 1BJ8A 5CZXD 1GGTA 2VLLB 2HT2D 4KUZH 4U0QB 3ZKXB 5F3BA 4LPVA 4OF0A 3D39E 4G7YL 3PGFL 2VC2L 2LTQB 1GZQA 1RK0B 4S0SD 5IG7B 4TTGA 3MREB 4I2XB 4UDTB 3KLHC 1JZ8A 5ISZA 1GZPB 4D0DA 1JNJA 1IQDA 1NC2A 4KVNL 1TZGH 1NDGA 5ITBL 1I8KB 5INCA 4NZRL 1FJ1B 2A74B 1I7ZB 3CH1A 2OSLB 4GUPB 4X4XB 3V6ZA 3DYOA 5GRXG 5ADOH 4EN3D 3KLDA 2VLKD 1Q1JH 1JGUL 4OZFB 3O8XD 2NY5L 5DK2B 5FUCC 2ADFL 5BZWA 1FVEA 4XAKE 3UP1A 2APXA 1DFBL 3TIDA 3GHEL 4Z7OE 1VKXA 1K8IB 3C2AL 4N5UA 4EOWL 3NPSB 3TZVB 1GZQB 5BO1L 4WUKL 5EWIL 3LEXA 1CICD 3QUYC 3ZYJA 1FZOB 1MFBH 1KIPA 2ERJC 3V5HA 2NYYC 1EHXA 4L9LA 5T1KD 5GISL 1F4YL 3LV3A 3U7AA 25C8L 3ILQD 2EH7H 4M03A