4ELKA

Crystal structure of the hy19.3 type ii nkt tcr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
202
structure length
199
Chain Sequence
QKVQQSPESLSVPEGGMASLNCTSSDRNFQYFWWYRQHSGEGPKALMSIFSDGDKKEGRFTAHLNKASLHVSLHIRDSQPSDSALYFCAASEQNAQGLTFGLGTRVSVFPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Type II natural killer T cells use features of both innate-like and conventional T cells to recognize sulfatide self antigens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Hy19.3 TCR alpha chain (mouse variable domain, human constan
total genus 36
structure length 199
sequence length 202
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4elkA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4elkA02
3WHXA 5T1MB 4LVOC 4NO2B 1H5BA 1LE5B 1S8DA 4IDLA 5DUPL 2NXYB 5E08H 5HHOD 1XF2B 4N90E 2AQ1A 4APQC 1U3HA 1EERB 1JZ4A 3M8OH 2H41A 3Q6GH 1RZFH 1EAPA 3HI5H 4U3HA 2HT4D 2BFVL 1JZ7A 4J6RL 4XAWH 3T4AB 4HGMA 4RFEA 3QULA 3IJSB 1D5ZA 3M8OL 2H2PD 3U4BL 1FZOA 3VRJA 1N2RB 2BSRB 3D39E 3QWOB 1KB5B 5JIIA 1NLDH 4V2BA 3RVUD 4ZYKB 2Y72A 4DN3L 1LDPH 1OSPH 3DSFL 3IRPX 3P9LA 4C57C 3MLWL 1PAMA 1X6LA 2YD6A 3DOSA 1G7QA 4E0RA 5D7LB 3ARFC 3ARGB 4QRUA 5TFSH 2FO4B 3B43A 4FG6C 1ONQB 5JOPE 2VR9A 4DN4L 4EXKA 3QDJB 4ACPA 5I1HL 1QEWB 2ZPKH 3BQUB 2X4QA 1LO2H 1Z6JT 4NRZB 3MJ7A 4JM2A 2NY0D 4AY0A 3O4OC 3VCLB 3ROLA 1IAOA 4Y2DA 5BW7C 1QBBA 4YHYB 2IAMC 4R97B 3FZUC 4PJ9D 1TITA 1DBAH 3ESVF 3ZYOA 2P5EE 4XP5L 2VLLB 2XNAB 4PIRF 1JZ5A 5HYJA 4RNRB 4F2MA 4KRPB 1RFDL 4BZ2L 5EU5A 3S37X 1MHHB 2YSSA 3AUVA 4ESKA 5FYKD 2VDML 1V3LA 1NCWL 1YYML 2NPLX 2OK0L 5E9DE 2Z93B 3O2VH 1QLEH 3EO9L 5HYJB 5IHBA 4YZFF 3VXUE 2KKQA 1U58B 5C0RL 1QPPA 5HVWA 4PJGE 5DSCB 2W0FB 4ZUWB 1G9ML 4AMKH 2BDNH 3KYMB 3O9WD 1MCNA 5IHZA 2L7JA 3RDTB 1F4YL 3DVNB 3UBXG 1YPZB 4HLZG 3BGMA 5BQ7A 1VB9A 2X4RB 4OZFH 1DVFC 4UQ3A 3C5SB 5CZVL 1QFWI 1Z0MA 5DQDL 3X11B 3V7AG 1IBGH 3BOVA 3D0VA 4ETYA 4FQIH 5D7IE 1G7HA 5J1TC 3VXPA 3TWCL 1PY9A 3CX5J 5C09E 5JO5B 3W2DH 5JMRA 2W59A 4MJIE 5SWQB 3UMTA 5C08A 3UYRL 3QDHA 4KAQL 2AABH 3BXNA 1A7QL 3MRGB 4HHAA 4PGDB 4MD0A 3D6GA 5DEZA 3FT4B 5FUOH 5HYJD 2MKLC 3MOBH 2FX8L 4FFVC 4I77H 2H26A 5IT2H 2QR0B 1XH3A 3OG4B 1LNUB 4FXKA 4Y2DD 35C8L 5AEAA 2HMIC 1X9QA 3TNNA 4CMHB 5JQHC 4LNVA 4DW2L 1UM6H 3I6GA 4GBXA 2C1PB 5IFJA 4OUOA 1U3YA 3NAAH 3PL6D 4ZFZB 4KHXH 4HUUA 1BECA 3MLSL 4YHZH 1AH1A 3ULVL 4OCXH 1XGUA 1BEYL 4YHKH 4LARL 5BV7B 3F5WA 3O3BA 2WIMA 4QCIA 3NIFE 2HP4A 3ZHDA 1MCSA 2YOCA 2JJUA 1N3NB 1PG7X 4NO5B 3RL2A 1J0JA 3O4LA 3MJ7B 2XZCL 2XFXA 3SKJL 2DM2A 3Q1SL 2YPLA 4C4KO 1CFVH 1IBGL 1BJ1J 1KB9K 3RA7H 2WLYA 1WF5A 5I9QC 5E03A 1L6XA 1YNKH 3LKSB 5D2LF 5IKCB 3MR9A 4QGTA 4N1CA 5KAQG 1QOKA 1FCGA 3BO8A 3GMMA 1Q9KA 1OP5K 3MV11 1H3XA 4OFKA 5HHOA 3AS0A 5IGXL 4HC1A 1OAKL 4U6VH 4MQSB 1ES0B 4L4VB 3R06A 3C5ZB 1FBIL 4HKBB 3TN0C 1U6AH 3VH8A 2XKUA 1AD9A 1F4WL 2GIYA 3DROA 3ZTNH 3EDFA 4ZTPL 4PGCA 5DHVH 4AJ0A 3ZE0F 1IAKB 1BP3B 1GGUA 1T1XA 4XNMA 5D2LE 2APXA 2NY7H 2EZ0C 1A1OB 2VR4A 4OCYH 1YMMB 1WT5A 1CLYL 1CDGA 4IDJH 3FN0L 1NC4A 1CGYA 4DVRH 4P5TA 1UACL 2XWJB 1NFDA 4RX4A 1FZKB 1XCTB 4KQ3H 2HTKD 4GJTB 5F89A 1S7VB 3RY6A 5DUBA 1F97A 1IC4L 1UEMA 1UJ3C 2AKRA 4NFDA 4MD4A 4FQJH 5D9SB 5C9KA 3ALPA 4ZO9A 5CJOH 4NRXA 3KVQA 5AZEL 3MRBB 4RMRA 1OGAD 3WJJA 3T0EA 5HHNB 4CDHA 4IMLB 2FGZA 4KJPC 3GMLA 3REWB 12E8L 5KSVA 3GSQA 5CJ5A 3K81A 3NBNA 3IETA 5D2NC 1JBJA 1AXSB 2XKNA 4G8EB 3WIHA 5HI3C 4X6CA 1M7DA 2DQHH 5I1DA 4PJ5A 1Y0LB 3OWEA 1MAJA 3K8LA 4I77L 1INQB 5C0CD 3DECA 4G9FB 1MLBB 3OJMB 2OXHA 2EIBA 4LSPL 3PWPB 2V9RA 2J8UF 5C0ND 4N0UB 5IBTL 5I19H 1B4JL 3DRQB 4XXCA 3BP5B 3MO1A 3HC0A 4MZ2A 3OR7B 4OLUL 1YY8B 2YWZA 1IEAB 1J1OL 4WI2A 5CZXD 4U1SA 4XZUB 3OGCA 5IM7A 1IM3B 1UZ6F 1HNFA 1JPGB 3TIDA 5GIRB 2X2YA 4MA8H 3PGFL 2F58H 2VOTA 4NC2B 4RMVA 3O6LH 5GGRA 5ITBH 1K2DB 2CH8A 3SDCA 3QQ9D 1IRAY 3L6FB 5HGGS 4XMKL 4FFVD 3I75A 4H0HB 1J8HA 1MOEA 2ESVA 3QUMH 4OZFB 5KS9F 2GCYB 3U7WL 1IM9A 3LCYA 2UZIH 1IM9B 3RJDA 3WXVL 5I1IH 3DO7B 1NUFA 1L6ZA 1KBGH 3BKMH 4S1QL 2DQDL 2IANB 1YJDC 4PTUA 1T80A 5ICYA 3W5NA 1DLHA 3QG6B 2R4RL 2QHLA 4NOFA 1GIGL 3PQYE 3E2HB 2XIDA 5TF1H 1KN4H 3PWNA 4UNTA 4S1RH 3WDIA 3WJJC 1IM9D 1EEYB 4JANB 3ZTJG 2X40A 2NNAA 1OM3H 5F1IB 1K4CA 3HKFA 3MLXL 2AERT 4MAYC 4ZUSB 1R24B 43C9A 2CGRL 4OFIA 2X4PB 1HE7A 4AENA 2JJSA 3VFVA 3ZKXB 1YUHA 1WQVT 5F96L 3WSQL 2EDRA 4KMLB 4LF3B 1IC7H 5CIPH 1J0KA 1RZ7H 3TP4A 1NFIB 1MCFA 2XRAL 5F6HI 3VXTB 3BVNB 1X5GA 1V05A 2AAVA 5LGJB 2YD7A 5JW5A 4E5XA 4RGOH 4IJ3C 4R96B 3SKMA 3MJ9A 3FN3A 1UACH 2ADJB 3IFOA 1EV2E 3RTQD 5L7XH 4XB7A 1IGFH 5C0CA 3I50H 4MNGE 1RZ8A 5ITFB 2BHZA 3VFMB 2NY4D 3QG6A 3S88L 2BCKA 3OB8A 1JF1B 2EDOA 1F11A 1CXHA 3ZT5A 4L8DB 1OGTA 5DD6B 4FHBD 5DMGD 3QUXD 3QQ3B 1XIWC 1AY1L 1S7RB 4U1JB 4WU7B 3EOTL 3WIHL 4MDIA 5A2FA 2ZCHH 3WS6C 5DWUL 2NY2C 3NTCH 1IZJA 3WXWL 3GMNA 1H3UA 2QSTA 5D5MF 3T0VA 2HFFA 2KZWA 3BKCL 3A6BL 4OCNC 1FPTH 3QEQA 5KZCD 5C0CE 1WBXA 4PJDA 4WHYH 3L5JA 4YE4L 1BOGB 5CJXC 4G6ML 4BSWA 4WV1B 4Y5YA 1ZVHA 3CVIH 1F3DJ 3K46A 1A4JB 4J4PC 1QRNE 4NJAH 3KS0H 4QXUL 3NFSL 3ISWA 3TCLB 5E6YA 3KNBB 1LGVA 3CK0L 4KVCH 4YDJB 2XWJA 4K94H 2D2OA 3FFCE 5GHWL 1NC4B 3F7YB 2I26N 4JFZH 2MFNA 2XRAH 5GZOD 2AQ3A 4GKNA 5DJ2B 1NEZG 2RR3A 3FQRB 2PTTA 1OD9A 3GIVA 1SQ2N 1I9RL 4JRXA 4K7FB 2BSTA 3T0WA 2Y4SA 4LCIH 1V3KA 2IFGA 1V7NH 5E70A 4DZBB 5EUKA 4JM4H 1F3JB 3O0RL 4AEIH 3H7BA 4HPYL 2WM0A 1BIIB 3O3EB 1CVSC 5D93C 5LAXB 1FP5A 2DM7A 3DVFA 2GW5A 2O5ZH 5IF0B 4QYOB 4X4XB 4NN6C 4OD1L 4OGAD 5KTEH 4MMXC 3VFOB 1NMAL 1T6WA 3BAEH 4UI2A 4JO3L 3ARDD 4PJXF 4D2NA 3RHWK 3UBXA 1CIDA 1MCCA 4Y16A 2AK1L 1JYVA 5DZLA 4XMKH 2XG5A 5F97E 1MJUL 2APFA 4JLRB 3QA3B 2VDOH 4R3SA 4LAQH 1TZIB 3ALXA 4NQUA 4ODSH 4OKVA 3LQAL 5JR1H 5B4MC 4KRPC 4LHUA 1CK0H 3U6RB 3NIDF 1J10A 2FJFB 1Q8MA 5JDSA 2DWDB 5JW3H 1W0VB 3CC5B 1DBKL 2Z31D 2EDKA 4WHTA 1X44A 3K1DA 4OFPA 4R97C 3NACL 2ZJSL 3CNKA 1DANU 1RIVL 2DLIA 5T33L 4QWWD 3M17B 3HZYB 3NOIA 1J88A 1MFCL 1NKOA 4L3CB 4YDVB 1T21A 5CIPA 1SJVA 5JQ6L 5EA0H 1DQQA 2NTFB 1OLLA 4NWUH 3B4NA 3RGHA 1JHLL 2FLRT 3L7EA 1R3IL 2PR4L 2WZPD 3H42L 4P3WA 5JW4Q 1TTUA 3QI9B 4CVXB 4HKZB 1XIWD 4W4NA 4PBWD 3HUJF 4XGZA 4PGDA 3RY4A 3QUZD 3OGOE 4GLRH 4PRIE 4F57L 2APVA 3PDGA 5C08D 1ZT4B 2VLRA 4JPIB 4UT6H 1T2QL 4OCWH 4IS6B 5IV2B 1A02N 4RDQF 2H3NB 3JV5A 1KC5H 5ADOL 1LD9B 3QAZC 4MNGB 3RTQC 4L4JA 4JFPB 4WRLA 3GRWL 1DR9A 3V4VL 3C60C 4NC1C 3ARTA 5EC1A 4LOUD 5C09B 4C58B 1BGXH 1YEGH 3GMOB 1T03L 3MCLH 1S78C 3VGEA 5KBNC 3EYUL 2OSLA 3DI3B 3FO9A 3S4SG 4ZXBD 3V4PH 4NC1E 3RQ3A 4X7SH 2EDFA 3SCMD 4DQOL 4X6FA 3KHQA 2X4TA 5J9PB 4BFIB 1FE8L 5DD0L 3TYFA 4M3KB 1RJZA 2CLRA 3QUZB 5D70H 3IJHA 2YA2A 4JFXB 4KKLC 3S96B 4HUVB 4N5EC 1E4XL 4WUUD 3ARFA 3OKDA 5DFWH 1DEEA 5C08B 5IGXH 1JGLH 5DD5L 1HH9A 5GGSA 4NN5C 2EDEA 3MLTA 4PJ9A 1XZ0A 3THML 4DTGH 3OJDB 2NNAB 3P0YL 1HDMA 3Q5OA 4DKAA 2B1AL 3ZYJA 5IUSA 4L9LA 3MV01 4F37K 5HBBA 7FABL 5K9KB 4JPWL 3VFPB 1YPZA 1T7WA 3ULUD 4KZEL 3S34H 3F12A 4M02A 1ONQA 5FHAH 5T1KB 2N4IA 3C6SB 1NLBL 1K8IB 4LHQB 5EZOH 1F8TH 3KPQB 3ZDYF 4AIZA 1DQML 4N8VB 1M7IA 4XMPH 5F6IB 1N8ZA 3C08H 1IJ9A 4XNXH 2IH3A 1OGAE 5INDB 5MEOA 1TENA 3HZYA 4XI5D 2EDHA 5ERWA 1XCQA 4P57B 1UADC 4WHTB 3SKOB 3FMGH 5DT1H 3VWKA 4Y89A 3GSOB 5L2KD 3ARGC 1CS6A 3C2AL 5DDHB 4YZFE 5E1AB 3ARDC 2CUIA 3QULB 1MCOH 4WEBL 4GKSB 3DX8B 1T1ZA 1KCUL 1P7HL 3BWUC 5DEGA 3P9MA 2F54B 5GRJL 3TBTA 4YHPA 1IFHH 5F1KC 3KYOA 1U3HD 1J8HE 4G6JL 5HYFA 5DVLA 4JFDB 4J3XA 4PV8A 3LRSB 5E2TL 1JNLL 3SDAC 5C08E 4PRAB 2D0FA 4PFEA 1RZKL 1YEJH 1KJMA 5C92A 5KW9H 3D39D 3RX8A 2B5IB 1WLHA 1H3VA 3QEUB 1Q72H 2V5SA 4HFUL 1I8MB 4K7PH 3Q48A 1DBBL 4GRLC 2A6DB 3QO1B 4U1HA 3JWOC 4S11A 4F3FA 5E8DH 2CDEB 3CDGB 3NGBC 1NCDL 2FHBA 3PP3H 5D1QD 3CMOH 4L9DA 1TZGL 5TE4L 4MVBD 3O3UN 2CDEA 3CXDL 2Z4QA 3VRLF 2M1KA 1S5HB 4L1DA 4MA1B 4P2RD 4F7CB 3MYJA 3ZT6A 4MD5A 5BV7H 3MRLA 4RMSA 2YMXL 2GTZB 4N8PA 3X12A 2H32H 2HT2D 3QJHA 2XTLA 1RULL 4PRAA 1A6PA 1U3HB 2CXGA 2HA1A 1CXLA 4I13B 5FOBA 1XF2A 3LN5A 2JKXA 5F9WC 3BH9A 3OKLA 3WHXB 1I3VA 1Q0XH 2GTZA 4TRPL 5E56A 4WW2F 5JOFA 4KK8C 4ONGL 4MD5B 3IS1X 4DJMA 5K9OB 1KPUB 4P46B 2DYPD 5FYKE 2JJSC 3FB6A 2YWYA 5I18L 3VFSA 4ZDHA 3MGOB 4KZDL 5HGBA 2DRUA 4U0QB 4FQQA 4PS4L 4YHLL 1YN6A 5F8RC 1CN4A 3UDWC 3WFBH 2C4XA 5F1NB 3MRFA 4WFHD 4NZUH 5HI5C 5FF6A 4MWFB 2Y6SC 3QCVH 5C70A 5IB2B 3SEPA 1S3KL 4Z7UA 4ZTOL 3GMRB 3NZ8A 1I1YB 1OAUH 5CKAA 1UZ8A 1MHEB 4D8PB 2XQBL 4AEEA 1HINH 3LKNA 4NO3A 2DKUA 3DSFH 2GTWA 3WJLC 2X44D 3SE3C 3H3PL 2NY3B 1G6VK 3P9MB 3NZHL 4QRQA 3F7RA 3SDDB 1UWXH 4NQEE 4QKXB 3LKPA 1QFWM 2ZUXA 2XWTA 3WXWH 4E41B 1UG9A 4XPAH 3LPWA 4OFYD 4YR6A 4HEME 4G9FD 3GO1H 1HH6A 2PKDA 2IBGA 3L3JA 2V2TB 1L7TL 1KGCD 4ZFOA 5TE4H 2ID5A 2QR0A 1ZXQA 2M26A 3MRRB 3VXUD 4PR5A 2QTEA 3E6FA 3JTTA 3QHFH 5M94B 1G7LB 1ORQB 4OJFH 3IDJA 4ZAKB 3HRPA 3AXLA 2EECA 2R0LH 4TVSa 1VGEH 4JG0H 2GSGB 3PWUB 5MEOB 3CFBB 5FOJA 4Q9RL 1IAMA 1UXWA 2HTLD 5I1CH 4OV5A 1YA5A 2P45B 5D7KE 1RZ7L 2IPTL 3X17A 3QXAB 5D7IB 5BVJB 3DO3A 3H0TA 1ZT1B 3PXJA 2PTVA 1S3KH 4KHTL 4AEFA 5EZLA 4EI5B 4HKXB 3O11B 5F1SA 5L2KE 2D31B 1MF2H 3G6JE 3GMPA 3HZMA 1QKZL 5C0BE 1QFHA 1PKOA 3TCXA 3P4OA 3OBAA 1BMGA 3QXDA 3Q5YA 3PNWB 2OLDA 4Z9KB 5DVOA 3UTTE 4F57H 3QEQE 3BP5A 2YC1B 4G8GD 1DBJL 1WV7T 4U7KA 1MLBA 4WW1A 1QFWL 1SYSB 4QHKI 1NSNH 1E4WH 1LEGA 3CVHL 4RGNC 5ISZD 1JHLH 4F9LA 5JDJA 4WUUB 3MV8A 4WHDA 1QSZA 3W9EA 2X89D 5B8CC 4NZTL 1OPGH 2ZG1A 2NY4C 4G8GB 4P49A 1JCKA 4PGJA 5DQDH 4HLZH 5JW3L 2Y25A 4PJEE 2ILLA 4OM0L 4WWID 1X5ZA 3SKNA 1KN2L 4NQDD 3RVTC 1ZOXA 5B38G 2C1OB 2Z9TA 5BXFB 4KV5F 3B9KA 4MD4B 2AEQL 4MQ7A 3CFCH 4GLRI 1I3RB 1S9VA 5EORL 5TF0A 4XP4L 4KU1A 5SWZD 4LBEA 4MJ4A 4X9IA 1MCEA 1VENA 2A6JA 3FO0L 3M17A 3WLBB 2DWEB 3C60D 1JF6A 5BMFH 1NL0H 4YBHA 1KXVC 4DZBA 4GAGH 4PJAA 4YBLB 2NW2A 3NIFF 1EEUA 3RIAK 3PL6C 1EA9C 3GK8H 3DURA 2ICWI 1OQXA 4P2OD 2QQQA 3KPSD 2WWMD 3HG1B 1J05A 3BEWB 3QPXH 3D18B 4HG4K 1E4KA 1IGCL 3QI9C 4U1IA 1MH5B 1OVZA 2BJMH 2G75B 4WUKH 3MREB 1UXSA 1JV5A 2J4WL 3DX6A 3MRNB 4ZS6C 3WD5L 4OQTA 4HWBL 3RGVA 5GRVL 2W9DH 5D7SL 1RJYA 2AJ3B 3UPRB 1KENL 4OKVB 3B9EA 5K33A 2P8PB 1OW0A 2Y36H 5E5MB 4JLRA 1LQSR 3HG1D 3QH3B 4H8WL 3HC3L 5ALBH 2BOCA 5CHNA 5KANG 5LWYH 3UC0H 3C60B 1H3WM 1KPVA 3PGCB 5DI8B 1T66C 5EN2B 2OTWA 4KPHH 4M00A 4IRSD 4JZNA 3VXSA 1HHIB 2B1HH 2GY5A 3C8KB 4X8XA 3QNXA 5CLTA 1UFUA 2YA1A 4R9HA 3W9EB 2ZCHL 5TDNA 1A6UL 3HRZB 4FS0A 2C1PA 1B2WH 4UT9L 1VEOA 4MS8C 5C9JA 4YIQA 1LO3L 2FL5A 3NPZB 3QZWA 5JA9A 4R90L 5I1EH 1KXQE 4P4KC 4Y4FD 1S7QB 3IFLL 4X7DC 4EDWL 5J89A 4OM1L 2PYFB 4JKPL 2FDBP 3U0PB 1NGYB 3RKDC 2VNCA 3QUMB 4PY8J 1NQBA 2XXMB 3VGAC 2FJHB 3LQZB 3QPXL 3WIFB 3EYOA 1RK1A 1GAFL 1JWSA 3RIAF 4Y4FB 4AK1A 4MQ7B 1KPRB 3MA7A 4HWEL 4CUCA 1KYOK 5DYOB 2GAZA 3WFCL 4C56B 3BUTA 3G08B 3C09B 1NAKL 2CIKB 2P1YA 5FO7B 5LGHL 5HDQH 2E7BA 5B3NA 3TEUA 4P2QD 1NCNA 3UYOD 3GMNB 4I9WE 2PN5A 3QFJD 5DJ8A 1CDIA 4QY8A 4MDIB 4Y7MA 1UZ6E 4BH7B 1ORQA 2XQYK 5HHXH 3QNZB 2JJTC 3SDDD 4C56D 1RZKC 2IGFL 2IAND 5C09D 3U7YL 3MV8B 2VDRL 5ESVA 2AK4A 2GFBB 3L3JB 3UPAA 4P2QB 3VWJA 1MEXL 1Y18A 1HOCB 3I6KB 5DA0B 4CMMB 3LQAC 1DTUA 3OGCB 3KLHC 1M4KA 2YN3A 3D87B 3MUHL 3HPJB 4PRPA 1Q9WB 2HT2C 4NZDA 2F58L 4P2YA 1SJXA 2D4DA 4NQSA 1K3IA 3HC0B 1H3GA 3SGDH 4ZOAA 4JQIH 4ZUTA 5D7JA 3LMJH 2GTWB 1YMME 1CDHA 1FGVH 2OI9B 4QRTA 1FLRH 5FHBL 3GMPB 2XACC 1YY9D 3AVEA 4GRLB 5ENWB 2AS5M 1KG0A 1CG9B 4LLVA 3D2UA 1FQ9C 5F7DA 4AL8H 3H3BC 5F3BA 5HHOE 1ZE3C 3VFRA 4J23A 5F7YC 3ARGA 2A6KA 4XVJH 3HG1E 2E6PA 3OAZH 3PGFH 1KLUA 3LV3B 4ODVL 1D5BB 1DUYA 2CK0H 4XP5H 3VXRE 4JO1H 5LXGL 1W0YT 4CGTA 1IQDA 3AB0C 2UY7A 1KTDA 4P9HH 1N2RA 4JDTH 4NC0B 4ZAKA 3IVKB 1F2QA 1FNLA 3GKWL 5T5NF 1HXYB 3FT3B 3VFSB 4TULH 1VDGA 3MRRA 2W9LA 2J12B 1WFOA 4KKAD 4YHIB 5K9OA 2MWCA 1SJHB 4HAGA 3IFPA 5E6IA 1F4HA 3S35X 3BP7B 3TIEB 2VUOA 1CTOA 5GIRA 2VLKE 2Q6WA 3W39B 5EC2B 4Z78A 5JHDB 5JORA 5DRWA 4U1SB 3QUYA 3IU3A 2NR6D 4ODVH 1YECH 4IBLT 3QIBA 4P4KB 3MYJB 4JHAH 4ZOCA 3RVXD 2R2EB 3KXFA 3TO4A 1A6UH 3O45A 2HVJB 1FN4A 1P84K 1FNFA 3LS4L 4Z7WE 15C8L 1WICA 2BNQB 3FQTA 1FC1A 2ZKHL 4H20H 4M8QB 1IGTB 3O6FB 4WWKB 3QSKB 2ZUYA 4ELMB 3HNTL 4I4WB 4MXQD 3TJEH 4F3FB 3M45A 4OI8A 3ULUL 5E2UH 4GKZA 4MS8D 3VXSB 3IJYB 1BD2B 1J0IA 3FN0H 2EH7H 4W70A 1KB9J 3C5JB 3QUZC 4LLQA 3X14A 2ADIA 2BNQD 5MENA 1A1MA 3WFHA 4I5BB 4LKXB 1P6AB 3FONB 4JFEE 5GRXG 5EU7C 2YZ8A 2XPGA 2ZSWB 3EYVA 1SEQH 2COQA 1C7TA 2VL4A 5TPWH 4FQPA 1CXKA 1N6QL 1N6UA 4P2RB 3U36A 4H1LB 1VGKA 1HHKB 5KANI 1OTUC 3QCVL 3SQOH 1JV5B 1B6UA 4PRDB 1FFRA 5ETUA 3ZDZF 3BH9B 3OKLB 1HCVA 5DD1L 5ACZA 5C6PB 2YRPA 4M43L 5CEZL 4XPAL 2R23B 4X7TA 5IESL 1ZGLB 1U8PB 5KOVC 4AEHL 4NBXB 5IB1B 3EDDA 3N85H 1WC7B 4EBQL 4KKBC 4K9EL 2E9IA 5T5NG 4V1DD 1UT9A 4X5XA 1A6ZA 4XBPB 1GC1L 3PV7A 3N1MC 2BRQA 3VI4E 4HWBH 1WBYA 3SDDC 1MHPL 4P4RB 3WLBA 1L7IL 4F9PA 2Q76B 2VH5L 4RA0C 2BVOA 3AM8C 3TBVB 4JFFA 4IRJD 4XP6L 3UJIH 1YEKH 4OIAA 3I9GH 3EDEA 1AGFB 4D3CH 3DMMB 2AABL 1IQWH 5FECA 4MCZA 2JK5A 2X6MA 3T4YB 1DQDH 1KJ3L 1ZHLB 5GSRA 4GG6A 5A16B 1H5BC 3OKNA 2DTML 2XWBB 4M61B 2JJWA 4LCCA 1DN0A 1WAAF 1NL0L 5H94B 3GDBA 1JI2A 3GJFK 3PP4L 2ZUQB 3B9KC 4LLUA 1N3NA 4N8VG 2F9BT 4QHMA 3RDTA 5IB5A 5FB8B 2QBWA 2GI7A 32C2A 4YH6A 2ZP0T 1FIGL 4WHCA 2DQUL 1WZ1L 1TTGA 1AKJA 1HYSC 2GQHA 3QPQC 2CDGA 5DVNA 4N0FB 3MTRA 1IAIM 3AY4A 1AIFB 4D0BA 3RUGF 1R5IA 4ODTL 3B6SA 1G7MA 3MGAA 1S7SB 5IBUG 3WNNA 4N0FA 5JXAL 2IANE 3TJHC 2BRRH 1LE9A 4KI1A 4LU5L 2JIXB 2Y36L 4R8WH 4CRPA 4NDMA 2F74A 1DFBH 3CZFB 3RU8H 1CLZH 4MDJA 1QLRB 4R26L 3QXDB 4KY1H 1FORL 2AJUL 1YEIL 1Q94B 3F12B 4K7PX 2DB8A 3DVGB 3ULUF 4FFYL 1JNHA 3D3VB 5A40E 3CU7A 1F4XL 4G5ZL 2WMPA 3DTXB 4M4RA 4N0RA 1HHHA 2UWEA 3TA3D 1DZBA 4DAGL 4NM4H 3MRJB 4Z7OF 4U1GC 4XXDA 2EIZB 1DCLA 2W0FA 3SE9L 5D7LA 4BZ2H 2VDNH 2FLBT 4EUPB 3PHSA 4OF7A 5EU6E 3C8HA 1H0DA 4BYHA 3T0AA 1FDLH 3U2SA 3SY0A 5D7KD 5CMAB 5JHLL 1VPOH 3E2HC 4KQ3L 4JGMA 2R2HB 1WBYB 3FB8A 1A3LH 2IEPA 1W0WB 5GZOC 1I8IB 2ARWA 2P4AB 3S98A 2DWDA 5IQ7H 3QBTB 1F90H 4P2CG 2CDFA 5F9OL 1CD9B 5CWSB 4G5ZH 2PYEA 3BDBA 2V2WB 1IAOB 4PJFF 5TQ0L 3S37H 2O5YL 5EWIH 3ROLB 4JQIL 3U4EA 5TQ2H 3SDXB 4U49A 2KQMA 3U4BH 3DGCR 1RIUL 4ODXA 3VGDA 3VMPA 5KSUB 4RNRA 3P4MA 1F02I 1EK3A 2J6EL 2XWBA 5TDPB 1WISA 3HMWH 1ZHLA 3HR5B 4ENED 4XMLL 4XNZC 2DLTA 5IBLC 3MV9A 15C8H 3GEWB 3O6KL 2AJYL 3BE1L 1S9XB 5GGSY 4JPIA 2CKBA 5C0DA 1TFHA 1A6TB 3QIWA 1A6AA 3ARBC 1ADQA 3KWWB 4UT7H 3W82A 3KLAB 4FQ1H 1KB5A 1KJVB 4UIMA 1D6EA 1UCTA 2C5DC 1RZFL 5BZDB 2EICA 3PP4H 1RIUH 4GAYB 5AWNH 1WC7A 2A0LD 1E28B 4W6WB 4LSQL 1NMCC 3MRHB 1RUPL 3OKEA 1X4ZA 3CCHB 1QZ1A 1EAPB 4PJBE 3C6LC 4GRWE 4PTTB 3QO0B 1WEJL 2X4NA 4U1MA 4WV1C 4F7MB 5IQ7L 4MNQA 3LEVH 5D93B 5D1ZA 1QBLL 5KSAD 2JCCA 4ZDHB 5I1KH 3RWHB 3BT2L 1WEJH 5INCA 2EDTA 4CADB 3TV3L 3W0WD 2PO6D 4JFFE 4QRPD 2IGFH 5HGDB 1TVHB 4PJ8D 4J8RB 5C0BD 2X7LA 3VWJC 5A2LH 4KKCD 5F9AC 2CMRL 2FGWL 2YD2A 5CSGA 4P3CL 4KJWC 1TJHH 4XTRD 1KFAH 3V95A 1D9KA 3U1SH 4XCFL 3SGJA 5KSAB 1S9WB 2FIKB 5I8EB 3VJ6B 4I5BA 3LN9A 3BPNB 1F8TL 3O81A 5CSZB 4XPTH 4BZ1L 3RWEA 1RZIA 3HPLA 3X13A 2NX5E 5CGYD 3C9NB 5GZNC 1ZHBA 3LMJL 3EFDL 1D5XB 3LKOA 1T66D 2FX9H 5GGQL 4ZQKB 4ELKB 4L8DA 2PYEE 2ARJB 1QR1B 5GZND 3UJJL 2CR3A 4LU5H 4RFOL 2R2BA 4EOWL 5D2NA 1U8IA 3PDOA 4LCYA 2WINA 1RULH 3IFOB 3NIGF 4L8CA 5DS8A 2NY2D 1KULA 3QEHA 4EI5C 3DVIA 3VGBA 3GSUB 5BJTB 4F7EB 3O6MH 5GRJH 5F71A 4LLVB 4QTHB 1CT8A 1IC5L 5CKGA 1JZ8A 4NNXB 3G5XB 1KIPB 3V5KB 4QLRA 1X5AA 2F5BH 3RVWC 4JRYB 1I9IH 5C1MB 2F54A 2UWEF 4KUZL 2NY3D 4YDJA 2Q3AA 3M07A 3DX8A 4GQ9H 1DLFL 1OTUD 1P5VA 3TCLA 5F1IA 4BQ6A 1HI6A 3JV4B 4CVUA 3D25A 3P30L 4QRPE 1ITBB 4Y19D 1QRNB 2XXCB 2XV6B 4RGNB 5EPMA 3S36X 3GK8L 1T22A 5FA3A 1OF2B 2P7TA 3U46A 4RIRA 2OCFD 1IQDB 4JRYD 4M4PA 4M5YL 3BIBX 3HUJA 2VABA 5EZIL 2VIRA 3ETBF 3QFJE 4WI8A 1K4DB 1CE6A 1BPVA 3CH1B 4GG8B 4UINH 2RAMA 4WW2A 4PRID 4K94L 1D9KC 3QDGA 5I1KL 3CSGA 3STLA 3S97C 3TBSB 5FCSH 4YQXH 1JK8B 4JKPH 3I75B 5T1KA 4JFEB 4U3CA 3VG9C 1K2DA 1RVFH 2FB4H 5IMKA 3DNKA 4I48B 4JN2A 3DXAD 4EBQH 2F53D 5FO7A 3KLSA 4QRTB 2FBJH 1AFVL 3QHZL 2R4SH 4K3EL 2HRPL 1QBMH 1R0AL 4LCIL 1G9NC 1PKQA 3D25B 4NWUL 4OD2B 4PJAF 5JQ6H 2VLME 4PJDF 3OJDA 3BUYA 1W72L 1QNZH 4HK0B 4NN5B 3MACL 1KCRL 5BRZA 1QD0A 4L4TD 5BZWB 2G9HB 1QRND 5IB4B 4ZUUA 4F7TB 4NSKB 2NY1D 4B7IA 2P5EA 3WN5C 4WI6A 3PWPE 5EU3A 5JXEA 4N90D 4K3DH 4MAUL 4UDUA 4HV8A 5DK2A 3F7VB 5JHDD 4WUUE 6FABL 4KUZH 1HIMH 3ULVC 1UA6L 1WWBX 4PJ7B 4M7KL 5IR1B 3SJVE 2VKWA 2PW1B 2YUZA 8FABB 2WINB 4OZIB 4WJ5A 2JB5L 3PHQA 5D2NB 5T3XL 1MVUA 3N9GH 3QRGL 4Y5VB 1DP0A 4LRIA 4XWGH 3BP6B 1YPZE 2HWZH 2W9EH 3W11C 3L9RB 1T2XA 1MAML 5T1LB 3H3PH 1W72B 3T8XA 4AZ8A 4Z7WF 4G7VH 2Y07L 1WTLA 4TSBL 4U1KA 1XGRA 4RCAA 2ESVB 2VDPH 1OB1A 1FE8H 4HEPG 1A4KA 1KELL 4JB9H 4JRWA 2I5YH 4K8RH 1VKXB 2LU7A 3GUTB 4YWGH 1KTLB 3G6DL 4PD4J 3DYMA 2N7AA 1FL5A 5I76A 4BZ1H 4XAKD 3NA9H 1MCIA 2A38A 5T3XD 4P23D 1DUZA 4NZJA 1P69B 3T09A 1FJ1B 1SY6H 3QIWC 4HH8A 1VFBA 2UZXB 3CFKA 1A21A 1BZ7B 1PSKH 2FL5B 2R0LL 4YC2B 1NDMB 2C3HA 4UU9B 5EIVA 2XKSA 1IC7L 1MH5A 4KK9C 3UJTL 1QSVA 1NCTA 3D18A 4M6MH 1INQA 2Z92B 3ZDXE 1Y0LA 5FKPB 1HYSD 3BT2H 5MEQA 1BFTA 2VDPL 1MFEH 1IEBB 1E28A 2YEZA 5EBWA 5JDSB 2FJFA 3HB3D 2QQKL 3CFKB 2OX5A 1WZLA 3O6ML 3ARWA 3HMWL 4V1DB 1C1EL 1LHZA 1KJVA 5SWZE 1MWAL 4JY6A 4HFWA 5FA4B 4XWGL 2YPKB 4UV4H 3QRGH 4Q6IC 1OAYH 3EO0A 5CEZD 3LB6D 3DRTA 4ZPTB 3VD7A 5D7LE 5F6IC 5FYJE 5B3JF 2MCG1 1BD2D 5FUCC 3I85A 5GRVK 5CD5C 1A9BA 4R7NA 4UV7H 3MV9E 3EO1A 3K74B 5FGBA 1BFOA 3ULVE 3R1GL 2BNUB 4UNVA 5DC0A 5DLMH 1KJ2H 1BVZA 2F53E 4EQ2A 4NN7C 1MCWW 2YD1A 2DICA 4I3RL 5DMIL 1A1OA 5EZIH 1UCBL 2VLJD 1FVEA 2FJGB 4GBXB 5IFJB 1ROWA 1LP9F 2O26U 2SEBB 1G6RH 1DQDL 1KJ3H 1VFAB 4RISH 1TPXC 4WJ5B 4CMHC 1QSFB 1NUNB 2HT4C 1PVHA 5C7XL 1GGYA 4NKIH 5EBWB 3S7GA 1R3HB 1RURH 5ICXA 4PJ8B 4JDZA 5E4IA 4Y88A 2I9TA 4ERSL 2MJWA 5IP4A 4GXVL 5DJ2A 5I1HH 1GGBH 4QHNB 4UT6L 5SWSA 5I1LA 2CUMA 4Y2DC 3F7YA 1T0NA 1UENA 2DIAA 3DUHA 2Z35B 3EHBD 4XHQA 1U8QA 1G7JB 3BEVB 4JM4L 2QKIA 2EIZA 3KYKH 4LVHC 3D0VB 4IHOB 5GSVA 3PQYB 1E4XI 2ICCA 1FBIH 5BXFA 1NFDF 2GJ6A 1FO0H 1SJEB 5CEZH 4RISL 1OAZL 5FYKL 2A9NH 4G80B 5IBLD 4HJ0D 4LPXA 5F9JA 1PFCA 3B5TA 4GAGL 1NLBH 4NCC1 2ZJSH 5GGUA 4DUXA 2L4OA 4ODHH 3HC4H 1QSFD 4JKWA 3CZFA 5DLML 3V9FA 3MLZL 4LMQI 4OF6A 3ULVD 4NQEA 3GGWB 4R0LC 2R56L 4ZPVB 4QXUH 3FHQA 1RD6A 2Z93A 1AI1H 4JJ5A 3V7MA 5CD3A 3CFBA 1U93A 3ZKXC 1M05B 2QHRH 4JVPA 1GGIH 1OF2A 3PWVA 3L7FA 4ZXBB 1UVQB 4KMTH 4OZIE 2XYCA 4ISVB 1KNOA 1G7PB 4DVBB 4D3CL 2ADJA 4XCCL 3U9PL 5IR1A 4U33A 4U2ZA 1B2WL 1X5HA 1BQLL 5A1AA 1R3KA 1DQLL 1XGTB 2N1KA 5F9OH 3JTSA 1AY1H 3BH8A 1X7QA 5F88B 3FCTA 4ZS7L 3AAZB 3IAPA 4QOKD 1BLNA 4GG6E 2V7NA 3D5OF 3R4DA 1JYNA 4JFHE 4E41A 4QXTA 3JV0A 4NKOA 2YBRB 3AMKA 1I7RA 3WFBL 4YDKL 3EYUH 3UTOA 3FRUB 5BMFL 1YN7B 1NMBL 2IFFH 2FX8H 4HS8L 4JR9L 4J3UA 4XNXL 2Z8RA 3WEXB 2OJZH 5HHVH 1P2CA 2BVOB 4I9WD 3BKML 3TBVA 2K7QA 2VXQH 3BGFC 5LGKA 1RJCA 5ID1B 4FN0A 4GRLD 4KK9D 2Q87A 1AXIB 5J1AB 1KC5L 5ADOH 1P7QA 3IDJB 4HDIB 3DETD 1MY7A 3EYFA 5HYSB 3ULVH 4P9MH 4L8SB 1CE1L 4PJIF 4O51A 4UUJB 2ZZUT 3G5YB 3U82B 2F5AL 4L4TB 3VJ6A 4LPUA 5IVZB 4CVZA 5LXGH 4AYFA 4QRRA 5DR5L 2CK0L 1FFQA 4OZHF 1LO4L 2C3VA 2PXYA 3PHOA 2APBA 3TT1L 5HXMA 2VZUA 2HFTA 3P4NA 2XWTB 3ULUH 4I18A 1A0QL 4X98B 4LSPH 1AP2B 3EHBC 2EKSB 5I8KL 2IF7A 1U8JA 3P77A 2CRMA 4OUUA 3BRGC 5E8DL 5I8CA 4M7KH 5F72S 5EOTB 4CDGC 1A3LL 3MA9H 1N6QH 4MNHB 1QEWA 2YD9A 4WU5B 2XTJE 2DQFA 2CLZB 3UYPA 5IW6B 1EFXA 1I75A 1MUJB 3X14B 4ZFOL 1M7DB 2BHUA 2YXFA 1YECL 4RA3A 5LQBH 1AXSA 3MODH 2NY6C 4POZC 5AG8A 2QL1A 4L4TE 4PJEF 4P59H 1G1CA 2VXVH 5CJOL 3V5DB 1AJ7L 5DQJA 3HHRB 1EMTH 1T6VN 2EO1A 2VAAA 5CLWA 1X5YA 3BN3B 4Z7OE 4RAVB 3X3GL 2EEAA 2XQYG 4Y4HD 4RFNB 1OTSC 4LAJH 1P53A 1LO2L 2VN7A 1VEMA 3NZHH 4FFYH 5HGBB 1U92B 2AW2A 1CXEA 2A6DA 2E27L 3QO1A 3RWIA 2CGRH 4N1HB 5EFIA 1I85A 5KSAC 1NCBH 2IQAA 4APQB 3BX7C 5DUBB 3RZCB 4RFNC 4P9HL 4X98A 1XF4B 5F89B 2JELH 2LE9A 1LEKA 5EBLB 2I60L 4P5TB 3RWGA 5LGHH 1NCBL 3GHEH 2BZDA 1FDLL 2EDBA 5TE7L 1LE5A 1JWUB 5KG9B 1NAKH 2R0KL 3T3PE 1H3PL 4LP5A 5DJ0B 1GGCH 3MRLB 2X7LB 1HQ4B 1ND0A 3H9SD 4HJ0C 4PRHA 1EO5A 4UBDC 4PJIE 1LO5A 5E1AA 1MJ8L 1MF2L 4ORGB 2D7TH 3T65B 5I74B 3ZSSA 2P8LA 4D94A 4QXGL 3BSZL 3MRDA 3STBA 4GQ9L 1YC7A 2BXZA 1FFPA 4P57A 3HZVA 5ALCH 4Z0XA 1EHXA 3MJ9L 5EO1A 1CU4H 4OI9A 2AK4E 3OF6D 5ID1A 1MRFH 1ZT7A 4XCCH 3U9PH 5EH1A 1JMZA 5IKCA 5ILTL 3H7LA 4LLDB 4WIQA 5HYSA 5E5RB 4P3DA 3ZE1F 2GT9A 3GSXA 3E6HB 5F3HA 4XPBL 3A6BH 2BY2A 3ARED 1KJMB 3ARPA 4P9ML 2JJTA 4JO3H 5AAMA 4Y1AD 5GS1C 2P5WD 3TBYB 3QDMA 2R8SH 1C1EH 4P48A 1MCHA 3MRQB 2BDNL 3TN0A 4L9LB 4OI7A 1AC6A 1TVBB 4FQ2L 5KS9E 5I8CB 1CCZA 4PRPE 3BH8B 1LO4H 1U8JB 3P77B 2XN9A 1H8OA 4R4NC 3KPLA 1GZQA 2ZOKA 3P4NB 1BBDL 5FM5M 1MAKA 4XVSL 3VWKB 2VO5A 1HHJA 3D69B 4JRXE 3VXMA 3HE7B 2P48B 5TH2A 1CQYA 2DTMH 4RZCB 1YMHB 3B6SB 3U4EB 3MRPB 3VG9B 5C8JA 3MV7D 1MJJB 1LNUA 4FXKB 2NXYC 3QCUH 5CWSA 3OTTA 5IEHA 2FYYA 4G8FB 4X9HA 2WNGA 3NFPB 4MAYA 5T1DL 2EDLA 3IF1A 2EDDA 4J1UA 4LNRB 5J7CC 3TV3H 1M05A 3EYQD 4OB5L 5H2BA 5L88L 1HNGA 4LRNH 5FKAA 4HAFA 5CD3B 4NJAL 2NY5H 1GC1H 4NQCA 4EN3A 5T1LD 3EJZD 4ODBD 5CP7A 4RWYL 2JIXD 4N68A 2UVEA 5D8JH 3DMMA 3NA4A 2WWKO 4U1NA 1A64A 2VITA 3BW9A 4HCRH 5ACLA 2X09A 3VXRD 3WIFA 2M2DA 5F70A 5IEKB 3VG0H 3HE7D 4WFEE 3WLWD 4BQBA 4POYA 1KIUA 3T77A 1BLNB 2X05A 2H9GA 3FCTB 4EDXB 3MRCB 3B2VH 4RAUB 4KJYB 4WI3A 1NMCB 4Y4KD 4GW1B 3V6OA 2F8XC 2YXMA 3P0GB 5IEHB 5J6HB 2ITDA 3C2SA 3NCJH 5C9JB 3JZ7A 2DIBA 4HWBA 1FG2A 2R15A 3D3VD 5MEPB 4NM8L 4URTB 2J2ZA 5HI4D 2EO9A 4ZPVA 1NC2D 1CVRA 1EO8H 1KT2A 4AQ1B 3E8UH 2BOBA 4YX2L 2CRYA 3T2NH 5BS0D 5C71A 3KPRB 2PF6A 4Y5XB 2OI9C 1AQDA 3FB7B 4X5WA 3F7PC 1FVCA 1TVBA 3GM8A 4HS3B 4V2CB 3ZDZE 4JDTL 1FV1A 4K7PL 1I1AD 3QDMB 3F58H 3LN4B 1E6OH 1YC8A 3OSKA 5E5MA 5GSRB 4GG6B 3U9UA 3CXHJ 1ED3B 5C0AD 5HYQB 5EZOL 1MI5E 5J13C 5H37G 4QRRE 1MSPA 1YQ2A 3ARBD 1JF5A 3ULSA 4LGPB 1NLDL 1A6VH 1PD6A 2YEZB 3MREA 3BHBA 3R1GH 3ZE1E 2BERA 2RGSA 5IMLA 2DQDH 2FEDD 4XBEH 3PE9A 3TNMA 1XFPA 2WUBL 2X9WA 1IGTA 3O6FA 2R1YB 3P4LA 5L8JB 4K8RD 1NANH 4WUKL 4BUHA 5D6DA 1A7OL 3TO4B 3LIZL 3FFDA 4PBVC 3FFDB 1OCWL 1D5ZB 4XRCA 3MOAL 4KY1L 1G0YR 1OM3L 2X10A 4NJ9H 4JFQA 3A67L 4TN9A 3IDYC 3SCMC 2BVEA 5ABDE 1FRGH 1XMWA 3L95A 5E94A 4DK6A 3MGTA 2CLVB 3EGSA 5IW3A 1N0XH 2XI9A 4Z7VF 4WCYL 4A6YH 3VD9A 5HDBE 1TVDA 3ULSB 1UKQA 3SGJC 2P8MA 1DDHB 5HYQA 2UZIL 4JKKA 1MY5A 4Y5YB 2CJUL 4YFEA 4H1LH 3L5WB 4LKCA 4S1DC 3QXWA 1CFTB 5KVFL 1NCCL 2YPKA 4GFTB 4MHHI 4I3SH 1MQ8A 7CGTA 4RQQA 4M93C 3K1KC 4L3EA 1AE6L 2X4OA 4PJXA 3WFEH 5F1OB 5I1AA 4N0YH 3WL9A 2E9BA 2ICEB 3RZCD 3MLXH 2ZCKH 4WWKA 5F7DB 1MEXH 1X5XA 2R39A 3CVHA 3ALWA 5ITFA 4R0LB 3BWAB 3TVMA 5C0AE 2DLGA 1MWAA 4EVNB 4I0PA 3UTPE 2X4SA 3NA9L 3V0VB 2ERJB 2AJXH 4K3JH 4MX7B 1AC0A 5AUMB 3N9GL 3DJ9A 5J1SC 1T2JA 2MHAA 4YXKH 1RZJH 2LU4A 3MXWH 3V5HA 3P4OB 4WV1A 5GGRY 2DKSA 2VERN 5KVDH 5IG7A 4OZGF 4HUKB 4CMMA 4MB3A 1E27A 1PJ9A 1HXMA 4HIXH 4M6NL 3NCCB 1Y18B 4MXWH 3QEQB 1PZ5B 3D48R 4BSVA 3MUGB 4PGBA 2V6HA 5FV2A 2KPNA 1R24A 2AK4B 3QIUA 4DKEL 1WIUA 4UUJA 4YC2C 3TBSA 1BAFL 1VACA 4HXAH 4G6FB 5E9DB 3T8XB 4X8JA 2B1AH 1INDH 1CQKA 2G2RA 5IIEB 2HH0H 5KVFH 1EGJH 3RX7A 3RA7L 4Y1AB 4POZD 2IPTH 1RUKH 4JFEA 2RJMA 3L5IA 1QSEB 4OCYL 1XGYL 3BAEL 3FOLB 3T1WA 1HK6A 1CGSL 2YR3A 3G08A 4FQCH 3LV3A 4UZGA 2GAZB 4JREC 4PJCB 4ZD3H 3C6LD 4LFHG 5E8PB 4AM0B 3OAUH 1KPRA 3CPLA 5LBSL 1AO7B 4I2XE 5HVHC 1FFNA 4DUWA 3SDCB 1ZEAH 3MUGA 4PGBB 3GB7A 4OCLC 1GOHA 5IB3B 4XCNB 5FGCB 1ZHKB 1QBML 5HD8D 1R0AH 3TBWA 1IEAA 2P46B 5ADPL 4CBPA 4NQTA 5GS0D 5IVNA 3LEXA 2Y5TB 4U6YB 4IOFC 4RBPH 3M1BB 5C6TL 3HPJA 3I50L 4PRPB 1ZHKA 4JN1H 2R0WL 4PJXE 4QOKB 1Y6MR 5IB3A 2P47B 5IT2L 2CKNA 4Y8DC 5GS0C 1DLFH 1MFNA 1JGVL 1C08A 4KC3B 1U36A 2P42B 1F4AA 5J8OA 1KSRA 5J6GA 2ICEA 3GBMH 1D5XA 1OLZA 3IDGA 4RDQG 1EEZA 1PQZB 4PJCA 4NQCE 3WNKA 3W11D 3PDOB 4G9DA 1U8IB 1I4FA 1I3GH 3QIUD 5GGUB 5JPMB 1K6QH 1OTTC 1QR1A 1C8PA 4XP1L 1WFUA 4G42A 4Q7DA 5T3ZL 2MKWA 3KYNA 1ERNA 4WDIA 4OSUH 4TQEH 3WYRA 1SM3H 1VGEL 5HGAB 5I66A 3ZE2E 1RQ5A 5SX4I 4ZSOE 5IK3B 4P46A 2MHAB 1G84A 2QKIB 4OAWA 5AUMA 4JFZL 4Y4KB 1X5JA 3QIUB 4CADA 4X99B 1WUNT 1AQKL 3DX6B 3FO0H 4YO0A 4I0PD 4U1IB 1VCAA 4Q2ZA 4NNXA 1E27B 1RZJC 2CR6A 5I1LB 2BSED 1RUAL 5TJWK 1EFQA 1I1CA 1E4WL 3CVIL 4G6MH 3CFCL 3EOBA 1IGYB 3HFML 3SO3C 3DROB 3MX0A 1R3HA 3RWFA 3UJJH 4OLVL 3AU1A 3LKRB 1J18A 1F42A 3O6LL 3RWIB 1ZSDB 1MCWM 5HPMB 4TPRL 2UYLB 3U30C 3GBNH 3EJJX 5MHSD 2DD8L 3EOYG 5KN5B 2VRAA 2ARJA 3MRBA 3ECBA 2EXYC 4M6OH 3OAYK 2VLMD 2HVKB 1JVKA 3MFFB 5IMLB 1MFEL 4YFLF 2EC9U 3KHOA 3OJVC 3LKSA 1R5WB 1OTTD 4H26B 5I1GL 1RUPH 1MI5B 1OTSD 3ABZA 4G7YH 1UWEL 1V7NL 3CUPA 4G6AD 4DEPC 5L88H 4O00A 1D9KB 4S0SD 4Z77A 1KUMA 4UDTB 5E94B 4LSTL 4MA3A 1PKQE 3DI2B 3TC9A 2D03L 3N85L 1KIQB 4JFQB 5CBAA 1TJGL 4GKSA 4X4YB 5HGDA 1C5CL 1EAJA 4F9LC 5SV4A 3BPNC 1MI5D 1AD9B 2DJUA 3VH8B 2GYSA 5FDYA 3R06B 2J6EA 5C0GB 2E7CA 2FNBA 4PJHA 4HWUA 4N9GB 3IDIB 4MJIB 1N64L 4S1RL 1ACYH 3IGAA 5IMOA 1MAMH 3GM0A 3AB0B 5DHXB 4AIZB 4MVBC 1LILA 3MYZA 1B4JH 1ZLSL 3ARBA 1SEQL 4R7DA 1A14H 4PUBH 2AXGB 1F3DH 2EZ0D 4UNUA 1T3FB 4M1CC 1MCJA 3U9UB 2A2QT 2H9GB 3HE6A 2IQ9L 3D3VE 3QR2A 2MQ3A 3QDME 1I1AA 5C0FA 2NW3B 3HZMB 4M6OL 2YS4A 3L3HB 5DZNA 2BP3A 4ETQA 5CEXB 2IQ9H 1QFUH 1CICD 3A67H 1TNNA 1XF5A 4U0RB 4U1KB 4OGXH 3HR5A 2B1HL 3BIKA 3K2MC 3QNYB 1HSAB 4ZOEA 3ARFB 3OKDB 4C83A 1JHTB 3T2OA 4LIQE 3V6OC 2Q1EA 1FO0L 3RL1B 1T7YA 2Y7QA 4OCRL 3KPRA 1UYWH 1YEEL 2CRIA 4H8WH 5ALBL 3K2UH 1E6JH 2HLAB 1AR2A 2Q7YA 1KT2B 2CUHA 2MQ0A 4YPJA 2E7MA 1G7PA 3VH8G 1FL3B 1HILB 1MCKA 3LDBB 2NLJB 4QO1A 4MD0B 2J4WH 1EVUA 3K3QA 4OSUL 5CMAA 1TCRA 3HE7A 4LSSL 5D4QA 3ZZ1A 4AEHH 1I7TB 4FZ8H 1HQRB 5IB4A 4NCDA 3FN9A 4DOHB 4HK0A 3NAAL 4KJWD 4XTRC 4YX2H 3KPRD 2CIIB 5DHVB 5DJ6B 4ZSOA 4WVRA 5BV7C 4M48L 4NO3B 3VRLE 1BQUA 1DBKH 4F8TA 3QUKA 1ZHNA 3LZFH 1QG3A 3DVNA 4U1NB 5DK3A 5FECB 1RUKL 1J0ZA 5DK0B 4D9QD 5GS2H 3N1QC 4OTXH 1KLFA 5EORH 5JHDE 1K5NB 3VDCA 4NO0D 1NCUA 3K7UA 3MV7A 5D2LA 1OAXL 1UXWB 2VABB 5J3HD 4OV5B 1BFVL 1BD2E 4UV4L 1J5OH 1URLA 4LL9A 4K23H 3HE6D 3KR3H 4XWOC 3TZVA 3VXMD 3LAFA 3D69A 3SBWA 3AXLB 5ICXB 4HIJA 1RZGB 2HMID 2DJ4A 4YHKL 1WCBB 1CLCA 3S8WA 4KDWA 1ND0B 4PRHB 3R0NA 5DJ0A 2Z8WC 2UV3A 3TO4C 4NKQB 5D72H 2QSVA 1P4IH 1CGSH 3WS6A 4JM2B 1BVLA 2BY3A 3AREC 3PIQA 1XT5A 3RUGB 1H5BB 2YD5A 3MBEB 3O6FC 1YEKL 2XA8H 1S7UA 4GO6B 3V6FB 4LLQB 4NCC2 2B2XH 2DS4A 5D6DC 5I74C 5F7KC 1A9BB 4R7NB 2O93L 3B2UD 2Q8AH 1CFSA 4GKZB 1OP5H 4X4XA 2QQLH 2HG5A 3DBXB 4OCSL 1WIOA 5DFVD 4ELMA 1RJLB 5HI5D 4JY5L 4PLKD 3PDDA 5A3ID 2OMBA 4NHCH 5B21A 1RIHL 4ZYKA 3ARXA 1OARL 1TNMA 4MA7L 2ED9A 2R0WH 5F3HB 4S2SA 5EU6B 1P4IL 4M93B 1AXTH 1OSZB 1M6OA 1TPXB 5CP3A 5ELIA 3RWFB 3BMWA 3X13B 3G9AB 3QIBB 4P4KA 4PRHD 4ZTPH 4X6CF 2AEIT 3FQRA 2OZ4H 2BK8A 5AWNL 4GKNB 5KG9A 2JF1A 4HQQH 5ACZB 4FTVA 1YEHL 2A83B 1OHQA 2IAMB 3VFUA 3JWOL 4ORGA 2AI0H 1N5AA 4F7PA 5J57B 3DYOA 3QWRA 2PO6B 4KDTA 2YD8A 4XC3L 4LLMA 3QHFL 5INCB 4UTBH 5KSBA 1JHKH 2HFGL 2HTKC 2ZUWA 4Y4HA 1U8HB 4L8BB 4ALAH 1B0GB 1N7MH 4K55A 4OZHB 4OIIL 4ZO6A 4YHIA 3L3DB 3VI3E 3ZSTA 3BN9C 3W9DA 3AGVA 3I6LD 4PJBB 4XNUH 3QQ4B 5HYEA 3R8QA 3FHAA 1RUMH 3C6SA 4JZJB 1EFXD 3ZYIA 2BX5A 2WUCH 5HGHA 4WFFE 3KAAA 4WCYH 1QVOA 4A6YL 3EJZC 1U9KA 4XP9L 1KIRB 5TFSL 3QIWB 4HIXL 4M6NH 3WD5H 3O2VL 1NBYA 3O2WL 5IROC 3DV6A 1S9XA 4BZYA 2X9XA 5D7JB 3UTPD 3MNVB 2R2EA 3KXFB 3HZKA 3G04B 1UC6A 1AR1C 3BVNA 1ZLUK 4PJEA 3V6FA 3MV7E 3QUYB 5JPNB 2YK1H 2IADA 3WFCH 1A7PH 1I3GL 5BVPL 4P2QE 4NQXA 3RY6C 2PO6C 3S96A 4QRRD 3FQUB 5BZWA 2ATPB 5DEGB 3PABB 2WUBH 1RJZB 2CLRB 2OR9L 5KVEL 3NCMA 2ICWA 3BUYB 2QSQA 5F96H 1ETZA 3CFJA 4YGVA 4RMTA 2PW2B 5E1HB 5CBEA 3GIZL 2IC2A 4KVCL 1CDUA 1YQVH 4P5KA 1T7ZA 3KYNB 4RGND 4AIXA 4XCYA 3T04D 3V4UH 2FR4B 1QRKA 5JR1L 1I1RA 3TF7C 2P5WE 2Q8AL 4G8IA 2HJKB 5GGTH 3D0LB 1TTFA 5EC1B 3L3KB 1R6VA 5C86A 1CF8H 3KPQA 5L2JA 1ZWIB 4KI5E 2B0SH 1T1YB 5GJTH 5LVEA 5CJXA 1U2CA 1IILE 4N5ED 4OF3A 4XNUL 2V5MA 4JFED 1Z9SA 1HHHB 2UWEB 1P7KB 4J4PD 5FGSA 1MHCA 3DUUA 1LK2A 4JHBA 3WUWG 3DUSA 4QOKA 4ENEC 1JZ3A 3T1FA 4MSWA 1N7ML 2NY5L 2CIIA 3MC0A 4W68A 5B38A 1FYTB 2HJLA 4LHUG 3OXSB 3GRWA 3MROA 5DJYB 1QBAA 4CN6A 4HWNA 3MZGB 5IFHL 3FT2A 4M6ML 3WUWB 2HRLA 2V7NB 3WDJA 3G5XA 2FO1A 2VQTA 5T1DH 2DDQL 2XZQH 4JFXA 3HA0A 2OR7A 3QFDA 4TVPL 2W0PA 1VADA 4LK4A 5BJTA 1FCCA 4MB4A 4JR9H 1KJ2A 1MNUL 1AGEB 3FQWB 4PJXB 4JZNB 1KCVL 1L7IH 4J12A 3TO2B 1QSFA 4KHXL 2VLKD 2VC2H 5FB8A 3TVMD 5KVGH 3MXWL 4WFFD 3CDFA 2XY2A 3DX9B 12E8H 4NQDB 3KPTA 4FQHA 2G2RB 5F7WC 3L5WA 1JN6A 4FQ2H 3I3EA 5LCVH 2E6JA 3MV8E 5D9SA 5IVXE 3ZYZA 1KXTB 2IH1A 1T89A 2KBGA 4LSVL 4L3ED 1EGJA 1RZIB 4M43H 3RGVB 1DQJB 4PJHE 4YUEL 1KPVB 4O58H 3U0WL 3WN5A 2JJVA 4XNYH 4XCEB 4BUGA 5IVXF 5CD5D 3ZHKA 1OAXH 1SBSL 3QH3A 5SWSD 2F19L 1SJEA 1TLKA 1YNKL 3QXTA 3MSPA 2DN7A 5FA4A 2FZ3B 5CGYC 4OZIF 2Z31C 2FEDC 3SDAA 4O2CB 4X4MA 4X5XB 4XNQB 3GO1L 1KF9B 1JFQH 2J8HA 3LZFL 5BS0B 2XTJB 1MIEL 1EJOH 3L3GB 4PRBA 4MNQB 3O3DB 4R0LA 5HHOB 4Y4HC 1J05B 3BEWA 3BKCH 3S5LG 4PTTA 4U1MB 4Y4KC 4L5FH 1SM3L 3NTCL 5EIIA 3JV6B 3ILPA 3L3GA 4PRBB 4DEPB 5I1JH 1FO0B 3TFKC 4TNWF 1HHKA 3DWTA 3CVHH 4FNLH 1J5OL 3WIIH 5D2NE 3OPZL 4JHZA 2XN9E 1WBZB 2R2CA 1B90A 4RQQB 3HS0A 2BVPB 4MLSA 5KVGL 3W0WE 2E3VA 3EYVB 1GIGH 4JO4H 1PX4A 4BH8B 5L7XL 2E27H 3S9DB 4YXHH 3UTTB 1RIHH 3HS0B 3UBXB 2BNRB 1VESA 5ALCL 5GRYA 3B9AA 5IJVB 4U7MA 4NZUL 1QKZH 2V5RA 4D0DB 1WZMA 5C0AA 1DVFB 3UAJD 2D9QB 2R29H 3L3OB 5AD0A 2RBLA 1CIUA 3QCUL 3OJ2C 2Z31B 1DEDA 4HJJH 5DJAA 2YRLA 1U3JA 5IBUB 4LDEB 1H3PH 2VLJE 1B0RA 4PREB 3SDXA 1A7NL 5E4EC 3CSYB 1B9ZA 4Y5VC 1FORH 3MLSH 4PB9L 3C5ZD 5IOPA 4MB5A 4W6YB 2AXFB 1FGNL 5JZ7D 1QFUL 5FK9A 3HNVL 5E4EB 4ZNCD 3FFCD 4P23A 2Y9RT 4PG9A 1PYWA 4HV8B 5DK2B 5I1JL 1NFKA 5I8KH 2V9QA 2Y06L 1L9MA 1MLCA 4Q2ZB 1OD7A 3LDBC 4NSKA 3BP7A 1TQBB 2WBWB 1G7HB 3SPVB 4XXDB 4KAQH 4FP8L 1JNNH 5D7IA 25C8H 3O9WB 4HH9A 3UTZA 5GS0H 2DMCA 5EG6C 3NH7H 1U8LA 2OL3H 3T1FB 3V4UL 1ACZA 1LP9A 4L3EE 3NH7L 4WTZA 5JNYB 5EU4B 4LIQH 4XC3H 5SV3A 1SBSH 2HT3C 4J3VA 2XOTA 2B4CL 4HMCA 4PJHF 2HN7B 3FKUS 5KW9L 1S7RA 3J7HA 3U30B 4XPHL 4GH7B 3VXOB 3GSVA 4FQXD 2JIXA 3MNWB 1KJ2B 1B0WA 3CSBA 5T1LA 1SEBA 4NQCD 4EN3D 1IC1A 1LO0H 3EOAB 3KPOB 1S7SA 4LARH 3O41B 2CD0A 1UWXK 1KG0B 1LEGB 1UWEH 3QISA 1T22B 5EU3B 3PHQB 2P5ED 2VXUL 2D7OA 4GMSH 2ITDB 4XCYB 1DSFL 1HEZB 2I60H 2PW1A 5D5MA 2YC1A 2E7LA 2D4FA 4MAYD 4PR5B 4U6YA 4DFHA 4PYGA 4CU8A 4PV9A 1PG7L 3P73B 4LRNL 3ZMRA 3N0PB 3QP3A 4KGLA 4LLUB 2FRGP 4HUMB 3PWPA 2OL3A 1A7BA 5H94A 2R69L 1LK2B 3DXAA 2DJSA 4HJJL 4OZ4A 3RAJH 4OLYL 3OKNB 4M61A 4XPHH 3BQUA 1EXUA 1P7KA 4JVUA 4YLQT 4HIIB 43CAB 3QDJA 4UTAH 5T1KD 4PLOB 2VQUA 2FX7L 1H8NA 5SX5H 3G04A 4M62H 1G9MC 3E6HA 3LEYH 4HZAA 4TUOA 4DGYL 4QRQB 1PKQB 3RPKA 3N50A 5HDLA 3EDJA 1J1XL 3LKNB 3QG7L 2MCPL 2NX5A 2G5BB 4GW4B 1GHFL 5DJ8B 1ZV5A 4TYUA 4JFDD 2P5WA 5MERB 6FABH 4OZGB 1I1YA 4UILL 5D72L 4U3XA 3HZVB 1NDGB 4PTUB 1CWVA 3NGBB 3WIIL 2ZNWA 5HHQB 1A6ZB 4XBPA 3T65A 4BFGA 4Y19A 4DCQB 3WO3B 3LSOB 4QNPF 4G3YL 1CDYA 1WWCA 1JGLL 1ETZB 3CFJB 5ANMB 3IJSA 2EE3A 1QNZL 1BM3H 1WVZA 4TNWK 3T0EC 3HUJB 4OZHA 2F54D 3PABA 1MJ7L 2V2TA 1ZS8B 2FIKA 5GS3A 3OF6A 1J1PL 4KMTL 3MJ8B 2QLVB 3OAUL 5DGQA 3MGOA 2IAMD 1AGDA 4J6RH 1UM6L 1XR9B 1O0VA 2OTUB 4GRWF 2J7LA 3WO4B 3V5HB 2PYFA 5FO8A 4RGMC 4HBCL 1CDCA 2VXSH 3K4AA 3H9SA 3L1OH 4YDIL 1CFQB 3J8F7 3UTSB 1AQKH 4L4VA 1XR8A 5JHLH 3MLYH 2V2XB 2R2BB 2VXTL 4CU6A 4UTAL 2Q3ZA 3GKZA 3OKKB 1AGBB 4IOFD 5K9QI 4BQ8A 2AP2A 1EX0A 4OLYH 3MCKA 1HKLL 2D03H 1UM4L 1BZ9A 3GSUA 1TQBC 4OKDA 1JZ6A 4M03A 5JUEH 1QUNA 2CKBH 5IHUL 8CGTA 5I1AB 4HS8H 4Z18A 3QNXB 4TUKL 4XPGH 1HHGB 3G5ZA 4OLZH 4HZLB 2VZSA 2OTPA 2YMXH 1T20A 4Z7NE 3WNOA 5BV7L 1BZ9B 9CGTA 1EFXB 4LCWE 4M7ZC 1XAUA 1ZT7B 4JQXC 5DMGC 4NN7B 1FZJB 4YXKL 4UV7L 4M7LL 3CDGA 5KOMC 1I7UB 4UMGA 4XVUD 3O45B 1T4KB 1FNEA 4DN3H 1GPOL 5JLZA 3CIQA 1E4KC 4KTYA 1Y6NR 4QRPA 3W0WA 4APQD 1S7VA 4LPYA 2DYPB 4OFDA 4PJ7F 5E8EA 1CF8L 5CSZA 1U8NA 5EUOA 4EI6B 1S5IL 5KSAA 1A7QH 1TZHB 3IFNH 1IL1B 2A83A 3LRSA 3DGGB 1DBBH 3MGTB 4MNQD 4KQ4L 4Z7UF 3B2VL 4QHUA 3MOQA 5DRXB 2ZUVA 4P59L 5CZXC 5CEYB 2VDMH 2HT3D 5HHMD 3NIGE 3TIEA 3RZWA 1RFDH 4IRZL 2RFXA 3WCYA 1I3UA 1XF4A 4GMTH 5DUPH 1CBVH 2R69H 3CMOL 3WUZA 5L8LB 5BZDA 1NCCH 4XNZB 1C16B 1MVFA 4KH2A 1D6EB 5MP6H 4XPTL 3JWNC 4IIQB 2NXYD 1YNLL 2R2HA 1MCOL 1N0LA 4YGAB 3U0TA 3LKQA 2JCCE 2VJXA 3MRGA 4HHAB 5SX5K 1CFNB 2YUXA 3BXNB 3JWOH 1JRHL 1YEHH 3OKEB 1RJLA 2Y06H 1OAYL 2CK2A 2W65A 5KTEL 1TJIL 1UWGH 2NZ9D 1X5LA 4KDVA 1QLEL 3EO9H 3QZWG 4X6BB 3UTQB 5IFAH 2CLZA 4B0MM 2H8PB 4KKAC 4LCWD 1BAFH 1I8LA 4LVNB 1IT9L 3QCTL 4GSDH 3LHPL 1BVLB 3RUGA 3OB0K 1OP3H 5K9KA 2B4CH 1CGUA 5BQ7B 2N7BA 5IJKC 3C2AH 3UO1H 1QTYT 2EKJA 4JG1L 3P73A 1QLRA 4LSQH 1W2KT 4BKLB 5BS0E 2E9JA 2BXYA 1NPUA 5D7JC 5TGBB 4JPVH 1RZGA 3FQXB 1T0MB 1WITA 2A74B 1T0PB 2L7UA 4WO4D 3PWVB 1HOCA 1R5VA 5D6CA 1TCRB 4YBQC 1XCQB 4IMKA 5C07D 4WGWB 3FB5B 1RHHA 4C59B 2NLJA 4QHLB 4ONFL 5EA0L 4I3RH 5DURB 5FHAL 3WKMH 2OR8A 4KKNA 4Q6YA 1K8DA 3I02B 3PJSA 4X6FB 4Q6IB 5D7LD 4QTIH 2A77L 4L1HA 5KAQF 4XMLH 1X4YA 4Y2DB 5MP6L 5JIKA 3FT4A 4LSUH 4EI5D 3MNZA 2EH8H 4N0YL 1KCRH 4HLJA 5GS1A 2NY4B 3NIDE 1MRDH 3DTXA 4DTGL 2E6QA 2W9EL 4KK8D 4Z76B 2OS7A 1NGXA 3AS3A 4ODUA 3SGDI 4DWHA 4N8CL 5TQ2L 5EZLB 4EI5A 5BW7A 3T4YA 3A6CL 4HKZA 4CVXA 4KMQA 2DMKA 5C0JA 4OLWH 2EDNA 4OIIH 4S10A 2I9LA 4XT1C 2H3NA 5BRZE 1R3LB 3G6JB 5IV2A 1CICC 5CP7B 2EIEA 3DMMC 3LD8B 4LCUA 1J1XH 4KRPD 4BSJA 1MLCB 3CMGA 5FO9B 1WGOA 2ZG2A 3AAZA 4UINL 5IHZB 1VERA 3ELAT 3UO1L 4D0BB 2VISA 2Q86A 1FL3A 1FAIL 3QIBC 4ZUWA 5GQBA 4X6DE 3PJSB 2VDNL 4TTDD 3GJFH 3MBXH 4NO0B 2BJML 4NJ9L 4HG4J 4TOYL 3V2AR 3FAWA 1ZGLA 2OSLB 3FO9B 2XZZA 5AZ2L 1VA9A 1JGUH 4PLNC 4K3JL 1FNHA 2R4SL 1ORSA 4BK5A 4OBRA 4TOYH 2AJZA 1DN0B 5DF0A 1I9RH 1JPST 1XF3A 3GGWA 3PP3K 3K80A 5H37H 2UY6A 2EE2A 4V1DE 4FFZH 1BFOB 5HHPB 4JCLA 4Z8FL 3O4OB 4L4VE 2ZG3A 1IGJB 3HAEG 4OB5H 1ZA6B 2AEWA 2Z91A 2BRRL 4JFFB 4Q9QL 1I7UA 1OQOA 4F15C 2NW3A 2ZSWA 2F54E 1LVEA 5C7XH 2BVPA 4D0CB 1A1MB 5E2VL 2ENYA 3VXQA 4WENB 1MELA 1QLFB 4QRUB 4HBQA 4V1DA 2XA8L 5ADPH 5T33H 3TESA 1FO0A 4TSCH 3S5LA 4KGJA 4ZXBC 1JWMB 5FF6B 3QHTC 4Y8AA 2HVKA 3JV6A 3VG0L 5JIPA 3JSSA 3NVQA 1BOYA 3DPBA 5SWSB 1BBDH 3CX2A 4WGVB 3T2NL 3HUJE 1AGBA 3BD3A 2A0LC 1NBVH 1U8OB 3PWJA 2V2XA 4ZO7A 4QWWC 1IC5H 1FN4B 1Z5LB 5I19L 4M5ZH 3UTSA 1CXIA 1IGIL 4XNQA 5E00A 3P2TA 1OAZH 5IB1A 1WWWX 1D5MB 4HULB 5AYUL 2B39A 2NYYC 1EHLH 5CILH 2X41A 4IEFB 1CI5A 4OGYH 1FVDB 1K6QL 4ZS6D 4KRLB 3V6ZA 4M62L 1X5FA 1VKXA 2J8OA 3MLUH 1HSBB 1I1AC 2A9ML 4X99A 3QXVA 5LG1A 1KYOJ 5E8EB 1I3RA 2O5ZL 2E9WA 4JGUA 1LWRA 4FABH 5GJSL 2FX9L 1G9NH 4P5TC 1JGDB 3B83A 3IJYA 5JLZB 3SE4A 2ENSA 3JUYA 5L6YL 2D0HA 5DJCA 5CJQL 3SKNB 2ADGB 2OR9H 4G42B 5KVEH 5LAXA 1UEYA 1PDKA 1D7FA 5KN5A 4XCFH 5DA4A 5IROA 4HWEH 1Z2KA 2BNRD 5TF1L 1DJSA 3QIUC 1M71B 4KUCF 2UYLA 8FABA 5F7LB 3MQIA 1YEFL 4DN4H 1UWGL 4E5XB 4F58H 4HPOH 4LASL 1RMFH 3DX7B 2CRZA 5C0EB 2IMNA 3O2DH 4H5SA 4PP1C 3ULUE 1Z9LA 3KS0J 2BCKB 1DQMH 4WU5A 4MNHA 1EXUB 3RVTD 2Z8VC 5JORB 2Z0BA 5HJ3B 4KRMB 2ZCKL 4MJ6B 3FTGB 3MROB 3OXSA 4LP4A 1IEHA 3O8XB 3V6OE 4F8QA 2G60L 4OAWB 1PLGL 3BQUC 4OGAC 5IK3A 1OP9A 4CN1A 3RVWD 2FATL 2AJSL 4HUXA 4U0RC 4I8DA 4ZAKD 3GSOA 1GZPB 4JGJA 2JB5H 1MIEH 1QSFE 3ES6A 4PJDB 3RDTC 1KTLA 5DQ9A 1NJ9A 3RVXC 1YUHB 3E3QE 1KTDB 4UAOC 4HUWA 2WQ8A 1G7IB 3TT3L 3H9ZA 5HYIA 4L4TA 3O41A 5DJXB 2NX5D 5E2JA 3RRQA 3O8XD 4WNQB 2GSIA 5IJKA 4Y16C 4O51B 1ZWIA 4L8SA 4N8VA 4EIGB 3AY4C 3L3KA 3MBEC 5E8NA 3FT3A 4JHAL 1UGNA 3MRIB 3SN6N 1WAAE 4Q9CA 4QY8B 4M7LH 3CX5K 3W5MA 4XPBH 5DMKB 5EIQA 4H25B 4DOHE 5C0CB 5IFAL 4X6DB 4YDLC 1GGTA 3TIDB 1QA9B 2A73A 4OZIA 3WMSA 5IW1A 1OCWH 3EJYD 4R96A 3SKMB 1J9CT 3FRUA 1YY8A 4NQSB 4KJQD 1S7XA 2YBRA 3OX8A 4PJ9B 1J8HB 3EDKA 3O8XA 2FIRT 2LFGA 3E8UL 1F00I 5HD8C 1IAIL 4I2XB 3ZKMD 4FQJL 4JRYA 4PJ8C 3SHSA 4XHJD 2VE6A 5DJDA 4TSBH 4YR6B 3BKYH 4PJGA 1GZPA 4R8WL 5FFLA 3VWJD 5L2KB 1PYWB 4PJIA 4ZUTB 4I2XA 2DD8H 1T83A 1GH7A 3OX8B 5FUOL 4IDJL 5TE7H 5J4MA 5FXCH 2CO7B 3SDDA 2XKNB 1X3DA 4BFIA 5KSBE 1IT9H 5E8PA 4TRPH 3OZ9L 4O5LL 3V0VA 3ULVF 1J1OH 2F8VA 3ARQA 4K71B 3B2UC 4YIQB 4NGHL 4KQ4H 2EEDA 3H9HA 5HI4C 1WFTA 5B3JE 1U93B 4HWZA 3BKJH 3T3PF 4JJ5B 2H6PA 3Q3GB 2ITCA 4UIKL 3V8CA 3RI5F 4U6HA 3BESR 2JLLA 5I1GH 5CZVH 4WI7A 1JPSH 2DQJH 3UZEA 3PV6A 1RHFA 3NACH 4YK4B 2EYTA 2ERJC 1AJ7H 5IJVA 5I16B 4OD3H 2BNRA 1CZ8H 1KB5H 3PGCA 5GGRB 4WEMB 1KLGA 3IU4L 4NNPL 3NFNB 2QQKH 3NCBB 1J87A 1I9JH 1SBBA 1NGPL 2CIKA 4ODSL 4X7CC 5GRWA 3UJIL 3Q1SH 4DGYH 1EHAA 1PX3A 4U2YA 3ZDXF 3LEYL 1KPUA 4NGHH 4XC1L 5DD3L 1YYLH 4LFHD 2H1PH 6CGTA 4F7PB 1G7JA 3RWHA 3C5ZA 1NSNL 3KGRA 4I0PB 4UB0H 4K3GA 4YQXL 3LN5B 3V6ZB 4CJ1A 1MCPL 1ITCA 4HF5H 2W60A 5C07E 3TGXA 4YXHL 1BJMA 1EJ6A 5F8QC 4PJ8A 1BF2A 1P4BL 1M6OB 3VXSD 4FFZL 3RIFF 3SE9H 3UTSD 3U6RA 3GSQB 1P9MC 5GISL 2C3XA 3N1PC 1LK3L 3VXQB 4HIHB 1TZIA 3L5XH 4R3SB 1J1PH 4RMWA 1Z3GL 1YNTB 1CXFA 1D5IL 1TXKA 4GAFB 2HAZA 1MNUH 3MOBL 3BD4A 3WHE0 1RUQH 2YKLL 2CKBB 3MBXL 2HWZL 5AD0B 3S5LB 4IOIB 2IPKA 5H35A 1DDHA 2AJ3A 4XVUC 5LBSH 5L8KB 1CLZL 2PUQT 4P5MA 1LDSA 1V3MA 1L4IA 5I1EL 2ZUQC 3B9KB 4B53A 4L8SC 1XGUB 2ADFL 2DMBA 2IFFL 4NKMA 1Z9OA 1FNGB 1JPTL 3K2UL 4LSRL 1GYAA 3BRFA 2R0ZL 3FZUD 5DRZA 2MCPH 3QG7H 1WFNA 2VLJB 1FVDA 5FV1L 4ODXB 4M1GL 2Y1VA 1CU4L 3B8YA 3NCEB 3HNTH 4P2OA 1OAKH 2V2WA 4KUCD 4YXLL 3P0YH 3TH2T 5EUKB 4EOWH 2PYEB 4MA1C 3A6CH 1A7RL 4JFDE 5DDHA 2CDFB 2JCCB 4S0TD 3RAJL 1WIPA 4NPYB 1P4LB 1XIWB 3T3MF 5MEQB 5TE6H 4YHMH 5DO2D 4JAMA 3TNNB 3BO8B 2A6JB 4M6AA 1N0XL 5D7IF 4FZ8L 5D2LB 5D8JL 3DURB 1RAMA 1FRGL 2PYED 3VRIB 4LVNC 3DYPA 1RK0B 2DQIH 2V9TA 5KVDL 3VXUB 5I30H 4KWUA 3IDYB 3SCMB 3S88H 4LSTH 1IARB 4Z7WA 2W07A 3MUY1 5ILTH 1QLFA 3V4PL 4ONFH 2ORBL 3MRJA 3SQBA 3UDWA 3RP1A 2GK2A 5J13B 4GS7B 1CL7L 1L9NA 1A6TA 4ZFGL 3P9WB 3ZHLA 1JUFB 3KJ6L 1NGWA 3CFDB 4Z5RA 4JFOA 5JW4N 5DHVA 1QBLH 3V79C 1DQJA 2VLKA 5CZKA 5I17B 5GGTA 1K85A 3VFNA 3MLTB 3UPCA 2C3WA 3UZVB 3I02A 3OHXB 4UQ2A 3S6CA 5IQ9B 3ZKQD 3G6AA 1AE6H 1I7TA 3RWDA 1HH9B 1UQSB 5GGSB 1XF3B 4S1SH 1V5JA 2IWGA 5MEPA 3F62A 4G8IB 5H2BB 4EUPG 1A5FL 3HFMH 3VU2A 4J1UB 4X6EA 5CINL 4FTVE 3OB0H 1OP3K 5MHSE 4G8GA 5DO2C 2UUDK 2ZUUA 3ESUF 2DQGL 1NBZB 1P6FA 4NNYA 4F80A 5IB5B 2Y7QB 4QF1A 2HKHH 5FO9A 3T77B 2H32B 5C07A 2V5YA 4WW1B 3FQNA 4WO4A 5E6ZA 3HNVH 2AJVL 4R6UA 1GGIL 4HKXA 1R3LA 3D9AH 3Q6GL 4LQFH 3R0MA 3VXPB 4JFPA 2EYSA 4JO2L 4ODWB 2DQEH 2XN9B 2NY5C 4GOSA 4HXBL 4O4YH 2CPCA 1AHWB 5FGRA 4J3WA 1Q1JH 3RDTD 3T2PA 1T1WB 1FIEA 4BELD 3ARVA 5J11C 3HAEB 1NGXB 4UIKH 4NRZA 4I48A 2NCMA 4MCYB 4ZFFB 4LCWA 2CJUH 3LKQB 2IBZY 5IWLC 5L0QC 4ZNEA 4X6BA 3UTQA 2C7UA 2AXGA 1TQCC 1ZT1A 5F21B 4S1DD 3MUJA 4Q9QH 4JFYA 1A6VL 3HCVA 4HGKC 1S7WB 1YJDL 1QHPA 2GCYA 5LCVL 4S1SL 4YDKH 2OZ4L 1MJJA 4ZFOB 2ARJQ 3D0LA 2X1PA 5E0QA 2MPAL 3MRFB 1MHHA 4OBSA 4JB9L 4XPFH 1YN6B 3LRHA 3ES6B 5GRUH 3WE6A 3OKMB 3DGGA 4KKCC 5TGBA 1GAFH 2HTLC 4YGVB 4TUKH 3SO3B 5CBEB 2WP3T 1T04B 1KCKA 4RRPA 3HR6A 2RFXB 4TUJB 2HLFC 3QA3A 3RTQB 3BYTA 1JNJA 3RGVC 5IVXB 3MRQA 2Y23A 5I6XB 3QEGH 4AIOA 2O5XL 5D1QB 4NIKB 3WFEL 1UJTA 2IADB 3S36H 3X12B 4UT7L 3CUPB 2EDYA 1FL6B 4APQA 5C0EA 2EIDA 3VFOA 3F65A 4UT9H 4WO4C 4E0RB 1WK0A 1R5WA 5FGBC 1BBJA 5TE6L 4L8CB 3V52H 4PY7B 3SGKC 5EU7E 5FYLE 2NXZB 1TMCB 3SQOL 1CR9H 2BVQA 2Q76A 3UP1A 1FZJA 2OP4H 4ZS7H 4GQPH 1FIGH 1L0YA 1G6RA 5MEND 4TQEL 3RWCB 2PCPA 3MRDB 5DJCB 1MCBA 2HG5B 3BGFB 3HE6C 4RSVA 4K2UL 2DTSA 2VTFA 3OKOA 3FB6B 3HMXA 3KLDA 5H8DA 4NQVA 4BK4A 3QWRD 5F7MC 1BFVH 1QHOA 3MFGB 5E24E 2NXZD 3CLEL 1KEMH 5B8CA 3VFGH 1MQKH 1MFAH 4LDOB 1A14L 2F5AH 4PUBL 4FTVD 1NCAH 4QHUB 5DRXA 2EDWA 4P23C 1WJ3A 3BP4A 3RKDD 1XR8B 3KPRE 4PJCF 4XVTH 4L4VD 1U8NB 5EUOB 4EI6A 3GZKA 3BZ4B 4N0UE 1VPOL 5B39B 2EKSA 5HY9A 1CGTA 4U6TA 4TSAH 1HYRC 1BREA 2LABA 1T03H 4WDIB 2Z4QB 2IAMA 1FFOB 4FTVB 1Z0NA 1G6RB 5ERWB 2L0DA 3QJHB 4NM4L 1NMBH 4WTXA 1AGCA 2BVQB 3PUCA 4FQLL 4HX1A 2NX5B 1I4FB 2F8OA 1A6WL 1T20B 4Z7UE 3RBGA 1KJ2L 4U1JA 2B8OT 1F13A 2A6KB 1A2YA 4PJ7E 5A2KH 4R4BA 4PLJD 3EYSH 3ARDB 3D39A 1NDGA 3EIFA 4WFGD 3REVB 3VE0B 4LPVA 1J7VR 4KV5E 3QUKB 4JFDA 4FQCL 5L9DH 1XGYH 4S1QH 1JRHH 3ROOB 1MFDH 1PEZA 4TUJA 2VL5A 2ZCLH 4EEEA 1I8MA 2DDQH 2XZQL 3ARGD 4QOKE 4X7FC 2EYSB 4ODWA 3F5WB 1EUUA 4QCIB 5B22A 2D7QA 3BYYA 1Q0YL 1IKFL 3PG2A 1NFIA 3D2UD 3MODL 2OTUA 3QDJD 5J12B 3BQUD 5BO1L 3VWKD 1X6NA 3W39A 5MENE 3SKOA 3HLAA 4G43B 2DQUH 4NBYB 2OL3B 3TZVD 2R56H 3PWPD 1ORSB 2V17H 2OZ4A 2OJEA 1JTTA 5TDOB 2GFBA 4PJBF 3RNQB 2VDQL 3G5VB 4FP8H 5CP3H 2FECI 2QSCL 4MXWL 4NO0A 2DQTH 4R2GC 4LEXL 5IW1B 1MJUH 1I8IA 5J56B 1Q72L 4HFUH 3O8XC 3H6JA 3LPGA 4OZHE 4JQVC 2EE9A 5E99H 5MERA 3WFDL 1LP9E 4K71C 4XP6H 4JO2H 1P2CB 1AFVH 4KI5C 2IANA 1N4XH 4NQEB 3PWLB 5CSBA 4FFWD 4C56A 3MNWA 3OHXA 4MJ5A 4UQ2B 5IQ9A 1YN7A 1E6OL 4FQXA 4KTEL 2I9LB 5E5UB 4MA7H 2K1MA 3QWQB 4NUJA 3EYSL 3QFJA 1EVTC 4KXZH 3IDNA 4IS6A 2VZVA 1ZKAA 5EDXA 1IGCH 4YEFA 3MRMA 4U6XA 4PGEA 4QXGH 2PXYC 1NGYA 4OCRH 3GI9L 1T3FA 2VXTH 2EXWC 5E8OA 3VWKC 3C08L 1R3KB 4ZFGH 2VXVL 4Z7WB 4CU7A 1KFAL 5BVPH 2MPAH 4P3CH 1U58A 2YK1L 2Z35A 3NABL 4NP4H 4YNYA 1V7MH 3CZJA 5DMIH 4HUVA 3FB5A 1II4E 2DIJA 3GMOA 3CDYA 3CK0H 2AGJH 3O9WC 1L7TH 3FFCA 5IWLA 1NEZB 2X4OB 4M7LT 4KKLD 1NFDE 5C0IA 4D9LL 1KEML 2Y6SD 3MRKA 1PG7W 4IMKC 1A0QH 4IMLA 1CICA 3TJHD 2AJSH 1FG9C 2VLRD 3T0EB 1LP9B 1ZT4A 1A7OH 4HGWB 5DRZB 4M7ZB 2GJ6E 2UUDH 5FYJD 1KGCE 2RB8A 2BFVH 2H8PA 3G6AB 4FRWA 5D70L 5CFHA 3QUXB 3SOBL 4LSUL 2A6IA