5F7MC

Blood group antigen binding adhesin baba of helicobacter pylori strain 17875 in complex with blood group h lewis b hexasaccharide
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
VQLQESGGGLVQPGGSLRLSCAASGSIFSGNVMGWYRQAPGKLREWVAAITPQGVPNYADSVKGRFTISRDNAKNMLYLQMSSLKPEDTALYYCNRLPNYRSWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Adhesin binding fucosylated histo-blood group antigen
publication title Structural Insights into Polymorphic ABO Glycan Binding by Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 26
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f7mC00
4KJYB 4I0PB 1JPSL 4HKJA 3C08H 4QWWD 2OS7A 5IMLA 3BH9A 4LSVL 2AEQL 2FLBT 4LCWA 4Y19B 1MHCA 3KJ6L 4Y89A 1T7YA 3OX8B 4CNIA 3ALWA 4YHML 2P8LB 2EIEA 4GKOA 1QNZH 1VPOH 4L4VD 2FBJL 3IDNA 4ZPVA 5B3JE 4IOIB 4Z7UF 3UTTD 2EDXA 1FLRH 4ZAKA 2X9XA 3R0MA 5GS3A 3KYKH 3ULVF 3NTCH 3X11A 4XNUL 2IGFH 4NNPH 1A6WL 3DROA 1DVFB 4I5BB 4MAYD 4M7ZB 3BP5A 3BP7B 4E9LA 4M5ZL 4GQ9L 4PJCB 5IR1A 2FGWL 2EC8A 1UXWB 3QNYA 2GTWA 4RSVA 1ONQA 1I1AA 4HK0B 2I9LB 1KEGL 1HHJB 3CU1A 4TSCL 4PGDB 4M6OL 4YWGL 3VD7A 4PRIA 4HUWA 3C60D 4MDJB 3L3HB 2FLRT 3CVIL 1X5XA 4JFZL 1RK1A 2FR4B 4OUUB 4JO3H 1U8PB 4C58B 3QR2A 3HRPA 3STBA 4Z0XA 4P46D 2DM2A 5DC0A 4NQCD 1R3KA 3DURA 3MLSH 3STLB 2MKLC 1JGVH 1L6ZA 4OZ4A 4DKAA 5HVHC 3RNKA 4PJIE 4PRPE 5CJXC 1X4YA 3QXDA 4N0CC 5I8OL 2UUDH 1CLYH 4B5EA 5JPNA 3KPTA 3QXAB 5B3NA 1T1ZA 1UEYA 3FQUA 4ZS6D 4HJGB 2P5WD 2CUHA 3N50A 1X5YA 1S7QA 3O4OB 4PJIA 4PRPA 1QSEB 2XWTB 5DJCB 3CIQA 4LSSL 3F7VB 1LILA 3WEXA 1A1NB 3NCYP 3FO9A 4DWHA 3K4ZA 3VMPA 5F6HI 4HJJH 1UCBH 3ZE2E 1VERA 2CQVA 4GRLC 3IU3A 4O2EB 3MQIA 3GJFB 1HI6B 3TYFB 4DKDC 3PWPE 4GAJL 2BNUB 2CSPA 2DQGH 2VDRH 5J9PA 3RL2A 3L5JA 3A0OA 3P9MA 5CD5C 4XT1C 1LHZA 2NTFB 1H0DB 4APQD 1VFOA 1XCTB 2GYSA 1JBJA 5JW4Q 4PJEB 3HTLX 2GAZA 3DRTB 1CZ8L 2PW1A 3JTTA 4K23L 3DPBA 4OLVL 2PO6A 5EU7E 5HYJD 5MEQA 1JTPA 1R24A 1T3FB 4X0KA 4AEHL 1PKQE 4NZTH 1V7NH 4P4RA 3BKMH 2WMPA 5D7LB 4CBPA 4K9EH 1D5BB 5FV2A 3W9DB 1IKFL 1FBIL 1BAFL 4RFOL 4K3EL 2CUMA 4NBZB 1CE1H 1BFOA 1H3PH 3OV6A 3CFDA 4HZAA 2DAVA 2AABL 7CGTA 1KJMA 1RUML 4V1DE 2OJZL 3RWGA 3UTZB 5I19H 3OZ9L 3TV3L 2YSSB 1LVEA 1ORSB 3BE1H 1DEEB 1FFQA 3OF6D 3GI8L 3KHOA 3ORJA 5F7DA 2X4SB 5D1ZA 4ETQB 5D9SB 4QRQA 1I75A 4DZBA 4V1DA 1CXLA 4Z76B 5GZOC 3F7YA 2E6JA 4LMQI 5TE6H 3WUWG 2J6EL 2LQRA 2JTDA 5JORA 2P4AB 5TH2B 2CK0H 1NDGA 2I26N 4OZGB 1FNSL 3MNZA 2JJTA 4I3SH 1AO7B 3GIZH 3SCMA 2NX5B 4Z8FL 3MV7B 3VXRB 3VXMB 2R1WA 4Y4KA 4XNYL 1OARH 4DZ8A 2VXSH 5FIEA 3BZEB 4NZUH 2W9EL 4W70A 3ULVH 2WW8A 1CDGA 1G7JB 1KCLA 4LARH 5F9AC 4P4KD 5JUEL 1RZKH 2AV7B 3IRPX 5HYFA 3UZVB 4G6FB 5FCUH 4BSWA 1G7LB 3U46A 5C07A 3WJJA 4IJ3C 1KNOA 2QLVB 3LDBB 2DYPB 4HGMA 3CFEA 1BD2D 3G9AB 3TZVB 4JHZA 2UV3A 1DBMH 3CFKA 4F7TB 1SMOA 4JDTH 4R7NB 4UU9B 5GRXG 4JM4L 1JGEB 2J88L 1BFVL 2HYMA 1UZ8A 3RIFF 2W0FA 1FYTD 4U2ZA 2GY7B 1BVZA 2MMXA 1JZ6A 3QDMB 4P5KB 1JUFB 2W65B 4ZD3H 3VFTA 3TFKD 1U8OB 1C16B 4HEPG 5E8EB 2GJZA 2HFEA 5KN5B 5D2LF 3G5VB 3ULVD 2CRIA 5A2IH 2YD1A 5HXMA 1HIML 4F9PA 3RU8H 1OAXH 1IC1A 3I6KB 1T0MA 5FYKU 3S3PA 5IT2H 1GGUA 1FZMB 3GO1L 4HHAB 4G6JL 3I9GL 1P4IL 2A83A 3B9KA 2Y7QB 2ZUTA 4EN3C 3GMPB 1KENL 2LU7A 4NYLB 5GS1A 3ARBB 3GBML 4X8JB 4NQXB 3IDUA 2YEZB 1A21A 4PYGA 1A9EB 3H42L 3OB8A 1XIWD 4K3JL 1FFPB 2A6JA 5BS0E 4NQEB 2OJEA 2BY3A 3W11C 1NCCH 5TQ0H 4YZFE 2X4TB 4NC0B 4PR5B 4JQVC 4NQDB 3QUZC 2VOTA 1LO3H 2V2WA 4RGNB 3BJLA 3S3JA 4YHOL 4M1CC 2YXMA 1MLBA 4U0RB 1RUPL 1RUKH 4MB4A 3DXAB 1Z9SA 1IC7H 4QT5B 3IAGC 1WAAE 1JZ5A 4XPAH 1IGML 1RQ5A 5EPMA 2EDTA 2B39A 3PJSA 3U4AA 1YC7A 3ZKXB 1F3JB 1I1FA 1U2CA 2CDEA 4XNQA 5D6CA 4AG4L 4GAYB 4HMDA 4RAHA 1C08B 1VDGA 3BDYL 3EDFA 4RISH 2CDGB 4BKLA 1NFDA 1M1SA 4X6CB 2VDQH 2VR4A 5IEHB 1H15A 4ODTL 2APXA 5HGHB 2Z0BA 5BVJA 4DJMA 1WAAA 2ZKHH 3ROOB 1GC1C 5E8OB 5ILTL 3SDDB 4YX2L 3QUYA 1ZA3A 3L3GA 4FQJL 4CRPA 3GSNH 5SWZB 5TQ2L 3J8F7 1KFAH 1U8MB 1RZIA 2D0HA 1CBVL 2VLJB 3WUZA 1KN2H 1DJSA 1G7PA 3KWWA 5GGQL 3AGVA 3UTSB 4W4OC 1U8HB 3LD8C 5AG9A 4NP4L 5AAWA 3UAJC 1YEIL 3MA9H 1AE6L 2VMFA 2RQ8A 4UIMA 1KIQA 3QH3A 1I1AC 4N0YH 1TZHA 2PN5A 5CJOL 1C1EL 3D0LA 3GJEB 4XVTH 4WTZA 1P4LA 5GGUA 1VFAB 5HVFB 1DLHB 3FRUA 3GGWA 3X14A 5C0JB 1RZJL 3TA3A 4ZOCA 2IQAA 4XP5L 3PQYE 4DGYH 1FFOB 3ECBB 5FB8A 4JQIL 2XNAA 3IFPB 1G7MA 3A6OA 5D70H 4PJAF 3OKEB 2L0DA 4LIQH 2A73A 3SN6N 2EDHA 1FAIH 4KROD 4V2BA 2Y9RT 5E5MA 3I6GB 4PJFE 2V9QA 3QDGB 5FDWA 4QHKI 5CZKA 5IQ7H 4HLZG 1U2HA 5HVHB 5CD3A 1KXVC 3MRGA 1ZGLA 3BW9B 4H20H 1G6VK 3VA2C 2IQ9H 1A47A 2EDBA 2FEEL 1V7MH 3BD4A 1MIEL 2SEBA 1P6FA 5BV7C 3V5KB 5DVOA 4JZJA 1BQLL 4PJFA 4XCYA 1NAKH 4KJWC 4YHKH 1GAFH 1YECH 5IP4A 2IAND 5DUPH 4AT6A 3QRGH 4MXQC 3LHPH 3LIZH 1BJ1H 3IRZA 3QZWA 3VH8B 1RFDL 5ALBL 1K8DB 1YZZA 5AUMB 5SX5H 1DLFL 1QYGH 2YHGA 1J12A 1QKZH 3L5HA 1QLFB 3OJ2C 2C3XA 1SJHA 3RI5K 5IW6A 3QJFA 3IKCA 2PETA 5JQHC 5E6IC 4LPVA 5J56B 2JCCA 2EXWC 2WBJD 4IM8A 5AAMA 3BQUB 3CVHA 4PJCF 3FONA 5JHLH 9CGTA 2JK5B 4NKMA 3U36A 1UQSB 3D9AL 5FXCH 1NCBH 5DTFA 1SM3H 1D5ZB 4PFEA 1EEZB 5E08L 3QQ4A 1S5IH 4KY1H 2EEBA 3JWOC 3VA6A 3PGDA 3EYSL 5DRNB 5C0GB 3QDJD 1YMHA 4RDQG 3U0TA 3L7FA 1FZJB 5HVGB 3SJVD 2V5RA 1CLOL 3P3YA 3CC5A 4E41A 2R69L 2KQMA 5IHBA 2R39A 4NQVA 5JNYB 2QR0B 3S4SA 1QR4A 3TWCH 1P2CB 2YPLB 4U1LB 2EYSB 2ITCA 3O3AA 4S1SH 3OKLB 2ICES 1ETZB 1HCFX 1X6LA 2BOCA 2F54A 1DCLA 2BNRD 1BVLA 3NACH 5D8JL 4OSUL 4ZFGL 1G0XA 3VGHA 4JRYE 3S88H 1K6QH 1E4JA 2O61B 2EH8H 5I8KL 4S0TD 3RY6A 5JW5B 5C92A 1A64A 5ESQB 4C55A 3ROLB 3EW3B 3LKRA 4TTDC 1JPSH 1WFTA 4NO3B 5I30H 3PABB 1KC5H 2AEQH 4ZFFA 3KJ6H 4WENB 1CVSC 2YPKB 5GJSL 3FZUC 4R4NC 4YHMH 1Z3GL 4F7PA 5LWYL 1MQ8A 2Q76A 2BCKB 4BA8A 2FBJH 1M7DA 1NCTA 1PZUB 4TRPL 5L2JA 4XC3L 5F1NA 2VWEC 2H9GA 3MGOB 2JJTC 3TESA 1SQ2N 5KSBA 2ZSVA 4QYOB 3MRPA 4UUJA 4XNUH 1A6WH 2C3WA 4JFHE 2DQIL 4CVZA 4FQXA 1XGRA 2VABA 2OL3A 1OTTD 5ISZE 3ALXA 5F3HA 5H94A 4M5ZH 4GQ9H 3TN0C 3ULSA 1NEZA 3UX9B 5CP7A 1FVDB 3FO0L 3IXTA 4YLQT 1WT5A 1IL1B 4KGLA 2RGSA 2W1NA 4AM0B 32C2B 3VXSB 3FFCA 1ZLVH 3EYFA 1KEGH 4TSCH 2XWJA 4M6OH 4YWGH 2E9WA 3MJ6A 4PJEF 3HZKA 4JFZH 3D3VA 3GKZA 2IBBA 3GUTA 4GBXC 4XXDA 4N8PA 4JQXA 1T66C 2O26U 4HPYL 1FQ9C 5DJDB 3MRQA 4L3AA 3H9SA 1MJ8L 3DMMA 2BNQA 3V5HB 1WBZA 3TIEB 4JFOA 2NY4D 5LXGL 5K9OB 2BVEA 2P5EB 1T22A 4HH8A 1UKTA 5DEZA 2OSLB 2KZWA 3EJZC 4MX7B 2Z9TA 3IDJA 3X13A 5F1IA 2XN9B 2DQJL 5DUBA 5HHVH 5T3XL 3VFWA 5I1GL 2XZQL 1CK0L 3VWKA 4MNHB 2FWOA 5JLZB 3H2WA 3REVA 1UJTA 4JFFE 5IHUL 5KVGL 1NGYA 2VDOL 3B9KC 3WDJA 4NDMA 5I1JH 3S35X 3SBWA 1HSAA 1R5VA 2FO4B 3RUGB 3S96B 2Q1EA 3RKDC 1NC2B 1WBXA 3B4NA 4LSSH 3VXUE 4JFQB 1FNLA 4BFEA 3F65A 4UAOC 4OZGF 3OTTA 5IFJB 4EOWL 5FM5O 4HSQA 4OFKA 2ZOKB 2HAZA 4YHZL 4NRXB 5E95B 4GAJH 1R3JB 3RVUD 3MFFB 3VXUA 4P2RB 3LN4A 4OQ1A 1MPAL 4IRJD 4XHJD 3MCKA 2HMIC 4XP9L 3FT3A 4PJGB 1B2WL 4O51A 4OQTL 4U1GB 4XVSL 2IADA 1T1WA 3TNMA 4RA3A 5HHNB 3I6LE 5HHME 1NBZB 1B9ZA 1DUYA 2FD6L 2QHLA 3PV6A 4G9DB 4K23H 3SDXB 3VFUA 4OLVH 2Y4SA 1JWUB 3CZFB 4I0PD 4LCUA 2IF7A 2DJ4A 4L8CB 1RZ8A 5ITBH 4F7EA 2H2PC 3B9VA 4NO0B 1T83A 2V5MA 1EXUA 3CSGA 4Y19D 1IKFH 1FBIH 1BAFH 3O9WA 4RFOH 4K3EH 1F3DJ 4D0CB 3SKUD 1W72A 4YNYA 1F4WH 3I3DA 4NGHL 5F7FA 1RUMH 4NO2B 4HMCA 5DMKB 2OJZH 5LVEA 1JYVA 4M6ML 4M9PA 2AERT 3HZMA 4XMKH 5DZOA 3TV3H 2C3VB 5F7WC 4XPFH 3GM8A 5KSVA 3GI8H 1G9EA 3V95A 1DVFD 5LGKA 1CXIA 3ARZA 5DD5H 4X9BA 3UXFA 3WNOA 2ZCHL 3NA9L 4NQSB 1DBAL 1MLCA 4LSDA 3WNLA 2LU3A 2E7HA 2VC2L 2IAMA 2ZZUT 3BEVA 1FNGA 3TJHC 3I50L 1FVCA 1MJ7L 4QXUH 1BMGA 3B9AA 1F90L 4EDWL 3DX7A 5D6DC 5HJ3A 4YXLH 1SJEB 4QF1A 2EYTB 3DX9A 3EJYC 3MRKB 1LDPH 4ONOA 1EZVY 4AIOA 3UYOD 3HMXL 1QLEL 4YHYC 3O2DL 1RVFL 2W9EH 1IC5L 2JJSA 3HB3D 4PGJA 4XCNB 2C9AA 3GJFH 2R2HA 3KG5A 3MRIA 2BSSA 5B21A 5IOPB 1WUNT 3PDGA 4RAUA 5JUEH 1Y6MR 1DFBH 4KDTA 3VGBA 4OZIB 4OFIA 5A2LH 4JM2A 1WFNA 4WI3A 2Q86B 5A2FA 4OB5L 1OT2A 3FQWA 1QQDB 3RNQA 4MJIE 4IMKA 2A2QT 5EOCH 4HWUA 1HK6A 2DLGA 3QP3A 3IXAB 3OKKA 2EC9T 5DD0L 3OKDA 1M7IB 4XPHH 1KCKA 1J10A 4JZJC 2FB4L 2H1PL 4JM4H 5DVNA 4X6CF 5EC1A 1BFVH 3T0BA 2CKBB 5DK2A 2VLKB 4Z77B 3GBNH 3BMWA 2Z31A 5SWSE 1MCLA 3B8YA 5BV7B 2V2XA 2PW2A 2W60A 1BOYA 2FJHB 3JTSA 1HILA 2FNBA 4L5FL 5IGXL 1HIMH 4Z9KB 3TBTA 1FNEA 1FV1A 3CDGA 3NN8B 5J13B 1ZT7B 4LLQA 1U58B 1SHMA 4HWBA 4G6JH 3I9GH 1D6EA 1P4IH 5IB4A 1ADQL 4UBDC 3WN5A 4JG1L 1KENH 5C8JA 3ARGA 4HLZH 4NUGH 5E6IB 2H26B 3H3BC 3GBMH 4PGZA 4Y88A 3B2UD 3GMNA 4PG2C 4Z7VE 1MCBA 1CFTA 4EUPB 1T4KB 1IM3A 2ENYA 3H42H 4K07A 4OZHE 4LVHC 1NMAL 1P1ZB 3ZHKA 2JB5H 2VZOA 4K3JH 5HY9A 2WINB 3P73A 3MRLA 5HGBB 1H8NA 2ESVE 4M7LL 3VFRA 4P2QB 1N3NA 1WTGT 5GIRA 3O6FC 1LE9B 5DMGC 1LEKA 1CU4L 5LG1A 4F2MB 1MFCH 5ANMA 1GGYA 4YHOH 5DFWH 1T2XA 4OZHA 3Q5TA 3WV0A 1U41A 3H9YA 3KPSA 3RIAF 3ESVF 3QWOA 4BYHA 4GRMB 4PGCA 3KPPB 1OWRM 4U1NA 1IKNC 2EYRB 5EWIL 2X4PA 3WFEL 5IQ9A 1FE8H 2F5BL 4KI5F 4KK6C 1KPVB 1T5WB 5CEXB 3ARYA 3LVEA 5ENWB 4NT6B 3IDGB 4WWKA 5E0QA 3L1OL 1WZMA 4AG4H 4XAKE 3MUY1 3HG1B 5C2BL 4ORGA 1T89A 4HWEL 2D31B 3O41B 3M1BB 1VFBB 5GSRB 3K8LA 3MZTA 1KG0B 4X99B 3SE9L 4JY5L 4OTXL 4WFGD 2AQ1A 2PYEE 2VQ1B 3P4NB 2B2XL 3Q0HA 5KZCB 3VXNA 1FFNB 2QV2A 4FQJH 4NM4L 1AO7D 4QRRB 4I18B 2NX5D 4DEPB 3MV7D 4HQQL 4X9HA 1HHGA 2Z8WC 3DARA 3VXMD 1LO5B 3N0PB 4YPGA 1OLZA 2BERA 3SQOH 5BV7L 5J57B 1CBVH 5TDNA 5GGQH 4WFFD 1WT5C 2DLTA 1YEIH 1QD0A 1AE6H 1P9MA 2VDML 2VIRA 3MRDA 5JA9A 5EN2A 5T1LB 2VXTH 4IHOA 3HZVB 3IYLW 4AH2A 5MENA 4G6FD 5CJOH 3TN0B 3ARFB 3D0VA 4X4XA 4EXPX 4HS6B 4KJPC 4YFDB 2Y5TB 3RWCA 3QI9C 5A2KH 5C1MB 1RZJH 3SPVB 3G08A 3TZVD 4JQXC 1VKXB 4LCIL 5I1HL 2R1YB 2J5LB 5C0CE 3U79A 2AK1L 3ABZA 5INCA 5CEYB 4GBXB 5I16A 4R2GC 3JWOL 2MHAA 3VXPA 5B39A 4HF5L 4IOFC 3H3PL 5E2WL 2QSVA 3TBYA 1LEGA 5C0CA 3RWIA 5A16A 1NDMA 2BOBA 3LRSA 5FECB 4PJHE 4OKDA 1Q9KB 3E2HB 1E27B 3EO0B 3MLWL 1MFAH 3PF2A 3SBWC 1WWWX 3IJHA 1A7PL 5TGBB 3ARWA 2Q8BH 1FG2A 3E1F1 1MIEH 3LN9A 4U1SA 4HXAH 1BQLH 3STZB 2IWGA 3OAYH 2P43B 2Z91B 3MJGX 1JWMA 3RJQB 3RPKA 4H26B 2ZP0T 5GSVA 3WL9A 1GZQB 5ALBH 1AIFA 3BGAA 4GW4A 1DLFH 4Q9BA 4Z78B 4UAOB 3FB6B 4NQED 2VKXA 3AROA 3NZ8A 1S7XA 1Y18B 3T8XA 4B41A 2EDRA 1DBJL 1KB5B 3QCUH 5FGBA 1YEGL 3D87B 4RGND 3LRHA 3QEQB 4K3HA 2N4IA 4NN5C 4K7FA 3DXAD 2J7LA 3L3DB 5E08H 2VKWA 4X9IA 4PJXB 3EYSH 1EK3A 4F3FB 2P44B 3FAWA 3U4BH 1SMAA 1CLOH 1T83C 1R5IB 3V5DA 2R69H 5GGTA 4DKFL 3SDYL 3O9WC 2YC1A 3TT3L 2EKSA 4NC1C 2GFBA 1PG7X 4LLWA 2ED7A 1C5BL 3X12A 4MVBC 2FSEB 5E6YA 4HUXA 4OJFH 1T7XA 4YO0A 2P1YA 1QVOA 3VDCA 1HXYB 4RNRA 4G9FE 1GZPA 5SWZD 2C1OB 5D8JH 3OAZH 4OSUH 4ZFGH 1RK0B 2NY7L 4JKWA 1AKJB 2GSIA 5I8KH 5F6HJ 5JO5B 5KANG 5F3BB 5ID1A 3M45A 2VLJD 3UJTL 2H8PB 1D3CA 4N5EC 5H37H 3UTSD 4RGMB 3GHEL 5E8PB 1XF3A 3V6OA 2NW2B 4G80B 5GJSH 3RZCA 3RUGF 1Z3GH 4P2OA 4Q6YA 5LWYH 4PJ7E 3TIDA 2BVOB 1XF2A 4TRPH 4ZUVB 4NHUB 4XC3H 4EUPG 5DEGB 3P11L 3RHWK 1QFWL 1WFOA 5C08A 3C2SA 4JY6A 1ZHLA 4BZ2L 3KPQA 1NJ9A 1XCQA 1ZT4A 4WU7A 5KS9A 1UENA 4GKZA 4GAGL 3FO0H 3C87A 2WWKT 2IH1A 3QG6B 4PJGF 4KDTC 4UV7L 4YDVA 3WS6C 5IUSA 2ZWLT 5C0AA 5DO2C 1AGEB 1ZXQA 1MHPL 1KB5L 2Y36L 1U9KA 4FZ8L 4IMKC 3QDGD 1A14L 1T2JA 4WFEE 3SDXF 5JHDB 5LQBL 2W0PA 4Y2DB 1S78C 3EKCA 3PP3K 1A6PA 4H1LA 1CGYA 3M17A 5DQJA 3EYUL 4KK5C 3QNZA 2DQHL 4HFWA 5HGDA 5EZJA 1RIUL 3VJ6A 4HPYH 2AJVH 3QRFM 1RD6A 4QHMA 1IM9B 2WK2A 4HZLA 1UB5B 1NMCC 1RZ7L 5BRZA 1HDMB 1HH9A 2Z31C 5GPRA 3I2CL 4NJ9L 5LXGH 4X4YB 1Z9LA 1JI2A 4JFDB 5HDBF 3SQBA 3QO1B 4F7CA 5D7IB 2DQJH 1VCAA 3D69A 1CK0H 1T21A 4HIIB 4HJ0C 2GCYB 4GRLD 4PV8B 1SJHB 3WN5C 2XFXA 1NFIB 1A4KB 1BF2A 3O3BB 3S97C 4GXVH 3GSQB 4ZODA 4ZTPL 2GSGB 1AHWC 3MLYL 2A9ML 4XZUB 5FKAA 3QIUB 3C2AL 4PRBA 2HLAB 5EZOL 4ZDHB 5CD5D 1QRNA 3W0WB 3BDBA 3L3KA 4YHZH 4HIEB 5TE4H 3CLEL 3F7QA 3IDIA 3BPCB 1MPAH 4EI5B 4LVHB 4XP9H 1H3TA 2ICCA 4OCWL 4R4BA 2QHRL 1WBYA 4GG8B 3DVNA 4FG6C 4GKNA 1B2WH 1CFNB 4ZPTB 4OQTH 1WWAX 4XVSH 1KGCE 3IDXL 3GB7A 1J88A 4OZIF 5CKAA 3DSNA 3O6FB 2AXHA 2B5IB 4I4WA 2CJUL 3RWFB 2V7NB 5ACZB 5KG9A 1HSBA 2FD6H 1SYSA 4OCLC 4WWKC 3TPUA 5I8CA 5C0IB 4FXKB 5ESAB 4X7TB 4CMMB 1A0QL 4MCYA 1SJXA 1H3XA 3OGCB 1H5BA 4WI7A 3C9NA 3FQXA 4WNQA 3OJDB 3MOBL 1I8MB 4G42A 4OIIL 4F80A 5D7KE 1JN6B 5CBEB 4P5TA 3BGMA 1PQZB 4LKXB 2LAGB 2R4RL 1EAPB 1HKLH 3QEGH 1FN4A 1GGIL 5GZOD 3D25B 3HCVB 5J06A 1QR1A 1S7WA 5ITFA 3UBXA 3WXWH 1PSKL 2H9GB 3LS5L 2PTTB 3LKQB 4OCRL 3U83A 4JB9L 1CE6A 3L95A 3PL6A 5JOPD 1N4XL 2C4FT 1GGTA 3OJMB 1AP2A 2FDBP 4JY4A 1J18A 3NA9H 1DBAH 4DKEH 1UWXK 4HPOL 4MS8C 1ZVYA 3UTPE 1PG7W 2NZ9C 1Z2KA 15C8H 1S8DA 3VXQA 2VC2H 4O9HL 1Q94B 3VXSD 2A77L 5F89B 1MJ7H 2E9IA 3L9RB 3TH4T 3VE0A 4C4KO 1TZGL 5CILL 4EDWH 2X5PA 3ARVA 3FFCB 3MRBA 3CVHL 5I74C 4GQPH 1M05B 3O2WL 5HHOB 1XF4A 1LP9A 3HMXH 3FRPA 1PZ5B 3O2DH 3BYYA 3QI9B 4FFWC 5SWQA 1EMTL 3UTQA 3N1FC 1H3UA 4O02L 3NCFB 1K5NA 3WIFB 4U1HB 1EEYB 4F9LC 4YK4C 3QSKB 2VXQL 3BKYL 4NZDA 5EO0B 3CXDL 4LCCC 2JB6B 4JFOB 2J8UB 5I8EB 2XN9D 4YBHA 1CIUA 3MODL 1U6AL 3BYTA 4PRHB 5ADPL 3AAZA 2FECI 4R7DA 1TVHB 5DD0H 4GG6B 2FB4H 5FK9A 4YFEA 4IBLT 2BY1A 5IVZB 4KDVA 4XTRC 2C3HA 4N68A 3V0WH 2MPAL 3VFPA 3DBXB 3MCLL 2OLDA 1IGCL 5E2UL 3ULUF 2LU4A 2GIYA 4WTZG 4L5FH 1MAKA 5IGXH 2RCSL 4M62L 3QCVL 3T2QA 4YGAB 1BQHA 4KXZI 1PW3A 1INQB 4P2RD 5EO1A 3DHJA 1RJYB 2YD3A 3QHZL 3LZFH 5FGBC 1ADQH 1Q9OB 4PV9B 1GC1H 3PDOA 2HVKB 4X4ME 3W11D 3GMRB 4HH9A 5EZLB 3TC9A 2WIMA 5HGAA 1IAMA 2ZG3A 3FT2A 3T3ME 2UZIL 3QUZD 1Q0XL 4XMLL 3OKMA 4X7EC 1YA5A 3HAEA 4NSKA 5F88B 3PHOB 4M1CD 1BIIA 1NMAH 5DWUL 1HINL 1LNUB 1RUAL 4YBLC 3K3QA 4X4MA 5F7MC 4QHKJ 2ZPKL 3QT2A 3EYVB 1T5XB 5JMRA 5C0DA 2GUOB 4NO0D 1MFEL 1N59B 5HI5C 1ZK9A 3L6FA 4KTDH 5C0BE 4XC1H 3NIDE 4RIRA 2ITDA 1A7NL 1O7VA 1U93A 4RZCB 2DM3A 4LSPL 3SKJL 5EWIH 1URLA 3WFEH 3DI3B 5ID0A 3BI9X 1A9BB 1XF5B 5I1LB 1T7ZA 3QZWG 5FHAH 4O58L 3FFDB 2E3VA 5C2BH 4L4VE 4U33A 5JMOC 5EC2A 2I25N 4HWEH 1O7SA 1FDLL 3W81A 2CRZA 3ISWA 3V6OC 2X1OA 3T4AA 5C9JB 3MRMA 5DJZA 1X7QA 4JY5H 4P2OC 1GRWA 4LEXL 2IFFL 1BOGA 1AD0B 1QEWB 5D1XC 5L8KB 3U2SB 2B2XH 5I15L 1MUJA 1S7UB 2XKNB 5GHWH 4NRYB 1A6AA 3UAJD 5HDLA 4NM4H 4JPKH 4KDWA 5IB5B 1E4WL 1I1AD 3UTTA 1FVCB 1ACYL 2A6KA 5EULV 5EBLB 5BV7H 3ZDXE 4QRPB 4QRUA 3KPLB 1NCWL 3FQTB 1A6ZB 3Q1SL 4MAYA 4JRXB 5ADOL 5DUML 5DF0A 4X6FA 3RBGA 4IMLA 1OCWL 4QLRA 4G3YL 1EFQA 1N2RB 3KXFB 1RZGA 2IPTL 3MLZL 1H3WM 2X4UB 1VGKA 3DRQA 3ZYZA 4NQCE 3UPRA 2D0GA 1LWRA 3KPNA 4PJXF 1JRHI 1JNHB 2FYYA 3C60A 1OTSC 3RY5A 5CP3H 4DQOL 2UWEB 1KTLA 2J8HA 2WNGA 3D39E 1TQCB 1JGUL 1IEHA 1E4XI 2V6HA 1P5UA 3P40A 2XICA 4ERSH 4EUPH 4LCIH 4PJDA 4KHXH 5I1HH 4Z7WB 1S3KL 3ZT7A 1ZEAL 4P46A 3T2OA 1GH7A 2EE2A 3RPIB 3GMOB 1YY8B 4NQCA 1MAJA 2VLKD 2XQYG 5IROC 1KN4L 3JWOH 5F21B 2ZSWB 4ZOBA 4EI6B 3H3PH 5E2WH 2P5WE 4HX1A 4KJWD 5T33H 4MJ5A 1IAKB 2NXZC 1CGTA 1I7RA 3VXTB 1MREL 5EIVA 3MLWH 3O3UN 1W72L 4LU5L 1A7PH 3ES6B 1FIEA 1U91B 2FO1A 2DTSA 1NEZG 2P5WA 1JPFA 2VISB 4PJBA 4YR6B 5E6ID 2JLLA 2EXWD 4J1UB 2GJ6B 2R1XA 1LD9B 1TIUA 2G5RA 2ENSA 1MFBL 3EDKA 4LRNL 1CDUA 2Y5EA 3WFCL 2XV6B 3NVQA 1AHWB 1U8LB 1MCPL 4P2YA 5DFVC 5GGRY 4AENB 4NFDA 1MIML 3LKNB 3ULUH 4ODVH 1RI8A 4PTTA 4PTUA 4XBPA 4UT7L 1DBJH 3IS0X 4MXWL 5DA0B 5E99L 1YEGH 3OXSA 2R29L 3TO4C 2ADIA 1C8PA 3TYGL 1MCWW 3BUYA 2XTJE 4WFHE 5DJ0A 5EOTB 4APQA 4PLKC 4HUUA 4HIJA 3MLVL 2DDQL 3SGJA 2AJZA 3ZKMC 2RIKA 5GZNC 1XT5A 5DJ6A 2ZCKL 1J11A 5FOJA 1H5BC 3HG1D 2CLRA 4GXUN 3MZGB 4XXCA 5E9DB 3KJ4C 5HYJA 1D5XA 5IK3B 3SDYH 5BW7A 4XNMB 3TT3H 1A2YA 5F8RC 3T0EB 1C5BH 4TTDD 1UZ6E 3MX0A 4P5TC 1ZVHA 5F9DC 4TNWF 3RL1B 3WXVL 1NANI 5KZCD 2PKDA 3K1DA 4R4ND 5DRXA 3ULUD 4KJQC 1C12B 4OCYL 4QRRD 5D7IF 4Q97A 3A6BL 3HPLB 1CFVL 4AEEA 3PL6C 1KCSL 1I3GL 2BVTA 4U6HB 5FGCB 1B4RA 3OF6A 3CLFH 4ZFOA 4HW6A 4EKXA 3GHEH 4BSVA 4JKMA 4BH8B 5E2JA 4ZTOL 3WHXA 4D9QE 3TH2T 4KRNA 5DQDL 3EFFB 4F8TA 2BMKA 3TN0D 3DO7A 4L3EA 3ARFD 1QFWH 3QFJE 4HWBL 4MNGA 2BY0A 1XGPB 4OZFB 1CT8B 3PNWA 3QHFL 5BQ7B 3TNNB 2H3NB 4U1MB 4FQCL 1IAII 1VFUA 4JCLA 1F6LL 4R96B 1MJUL 5IM7B 5BJTB 4Y5VC 2HJFA 3C5JB 4MMZC 5ERWA 5I74B 5CHNA 3FQNB 4JANB 4FFVC 4GBXD 4AY0A 1BD2E 1F11B 4BFGA 3WO3B 4UI2A 5FOBB 2DD8H 4YC2C 4ODXB 4P4KA 1KB5H 3E6FA 3LPFA 4FZ8H 1J0JA 1A1OB 4P3DB 4LQFL 2CGRH 1A14H 3QISA 1FYTE 4YK4B 2COQA 5LQBH 1TPXC 3VI4F 4KQ4L 4WUUB 4XH2A 5FUOL 4LCCB 3EJZD 2DQHH 3U0PA 2P7TA 4Z7UE 3SY0A 1IBGL 4TOYH 3H8NA 2AJXL 3ULVE 3PWUB 1RZ7H 1UXSB 1NL0H 3B9KD 3I2CH 5T3ZL 1FYTA 2Y07L 3HS0A 4FQHB 4BH7A 2E6QA 1G7IB 2IALA 3KYOA 3RKDD 1A8JH 3VCLA 1MJJA 4Z7UA 5H35B 1ZMYA 1HQRA 4LVOC 1SYVB 4P99A 2EE3A 1Y0LB 4OLYL 1Q9LA 4JZOA 1N6UA 4QGTA 5SX4I 1E6JL 4WW2B 2AK4E 5T1DL 3ZSSA 2A6DA 1CXKA 4XMPH 2I07B 2AEIT 3BPNC 3LKPB 4JFPA 3QEQD 4ZTPH 4CW1B 4UMGA 5IG7B 2A9MH 5HPMB 5A3IC 2HMID 3C2AH 1E28B 2YPVL 1KJ3L 5CEZE 3KPRA 1JK8A 1NCDH 3VFMA 2HVJB 4XVUC 5DEFA 4OV5A 4UOW0 4BFIB 1XIWA 3CLEH 4C83B 3PE9A 1KCUL 1I8IB 5JW3L 1NBVL 2XZAH 3UBXI 2YKLH 2QHRH 4J3VA 3QWQB 5D5ME 1I1RA 5L6YH 4TVPH 4YBLB 3SKMA 2EIZA 3S35L 4Z7QE 3PWVB 5FYLE 2H2PD 4OCXL 4JFEB 2CJUH 4OLUL 4IOSD 4HUXB 3UZEA 4PG9B 4U3CA 2J8UF 4DUXA 5L7XL 1WF5A 1A0QH 2HFFA 4ELME 4QWWC 2ICWI 3SE3C 1I9EA 3AU1A 3T3PF 1T20B 4UDTA 3DIFB 4LRIA 4OIIH 1U3HC 1F13A 5FKPB 2P8MA 3BISA 4HAGA 3GSUB 4JAMA 3O6KH 5DJ2A 2R4RH 4Y8AA 4OGXL 1GGIH 3IDMB 1UVQA 1OP5K 1A7BA 1ZTXH 5D1XB 1UWGH 1PSKH 2A6IA 3LS5H 1OVZA 4HV8B 5IVXB 3TJHD 2XTLA 5I0ZA 4TVPD 4YIQA 4JGUA 1JRHL 5AZEL 1BBDH 4YGVA 1N4XH 3FB5A 4AZ8A 2EH7L 3TPKA 3Q6FA 5AYQA 3ARUA 4HPOH 2VLRB 4M7KH 2VZ3A 4JDVA 3GSOB 3GSXA 2PXYB 1CGUA 1FYHB 4O9HH 2A77H 1QHPA 3QJHB 1TZGH 5JIPA 3Q5OA 4GRWB 3RFZC 4R26L 5JHDD 4S1DD 5FV1L 1IMHC 4Y2DD 4WDIA 1L7TL 3O2WH 3E0GA 3S7GA 4K3DL 5ICYA 4HIHA 2F5AL 1RV6X 2E9JA 1PLGL 5FAAA 1DEDA 1EMTH 3MGTA 1IM9D 4O02H 4I0CC 4ORZC 1YPZE 4X5LA 1FZKA 3GMMB 1ZA6A 1CG9B 3GSNA 3MBEB 2VXQH 3BKYH 4QXTB 3CXDH 4JFDD 1YYLL 3MBXL 4PRNB 1E0OB 5JQ6L 2V9TA 4YQXL 1T03L 1R3HB 2PCPB 3MR9B 3MODH 2WIIB 5I75C 1U6AH 3FOMA 3EHBC 4C56E 1WC7A 4V2CB 4Y4HB 3U6RB 2YUVA 4ZS6C 1KPUB 2E27L 4N0FB 2X1XR 1YEKL 4FXLA 4Y4FB 2NXZB 3P77B 3VWJC 2MPAH 2VDPL 3WFBH 5FO9B 1SEBA 4M6NL 1TJGL 4UBDD 2XY2A 4KHTL 3QIUD 1IGCH 2IANA 4BQCA 5J1SC 4RQQA 2YRPA 1ITBB 1XGUB 2HA1A 1CWVA 1REIA 2OM5A 3QUXB 3W0WD 2HKFL 1PD6A 1IGFL 5EUOB 4KWUA 4LGSB 3GFUA 2ZOLB 3BFOA 4G6ML 4M62H 3QCVH 3N9GL 2BFVL 1X5JA 4UNUA 4LSRL 4Q9RL 3T0XA 3RVTC 4OD1L 3NZHL 3TLRA 3TP4A 4E41D 2V5TA 4H0GA 3QDJE 5AWNH 4ZUTA 1DQDL 1F4YL 4X6DE 3O6FD 3JWDC 5DMGD 3MNVB 2Z35B 1Q0XH 4XMLH 5B39G 3ZTJH 1FRGL 4S2SA 3TO4B 1F6AB 1UACL 4O2CB 4PP2B 4XXCC 5DSCA 5DWUH 1VGEH 1HINH 1D5MA 1RUAH 2DN7A 5DR5L 2UWEF 4URTB 4BFBD 2X4OB 3NGBC 2ZPKH 2DQDL 3IT8D 5BW7C 4KK6D 3SJVA 1ZLUH 4Z7WF 1MFEH 2BNRE 1KJVA 2ED8A 5EBMA 2O5XH 5ACMA 3KJ4B 4WU5A 3CSPA 4LCYB 1U8QB 2RAMA 1FL3A 1KELH 4LSPH 1W8OA 4MSWB 4MJ2A 3ILPA 2KZ1B 4O58H 4NNXB 5D2LA 5GJTL 3D18B 3PWPB 4GMSL 1FDLH 1YQVL 4P3CL 4NO5A 1WWBX 4P23B 4UDUB 1YMME 3QULA 1OF2A 2IFFH 4LEXH 4BZ1H 1C5CL 3OR7A 3OB0H 4FMKA 1EO7A 1YEJL 3QAZC 1A6TA 5MI0B 3JSSA 5I15H 3W5MA 5HHPA 4RFEB 3T0AA 3NA4A 5E03A 3BO8B 4GLRH 1PY9A 2H6PB 1EEUA 1E4WH 3FFCD 4KKLC 4J4PD 2ERJC 4Y1AE 1V05A 5HHOD 4R0LA 1MQKL 3C5ZB 3EOAA 1OAYL 1ZE3C 4UIKH 3N85L 4KJPD 1BIHA 3OBAA 4LEOA 1PKQB 3D3VD 1NCWH 1KCVL 1YN7B 3HE6B 3Q1SH 3QI9D 4LGPB 4XRCA 5AEAA 5ADOH 4L8DB 5DUMH 1KULA 1MCKA 3L5XL 4M8QB 1OCWH 3G6JE 3QDHA 4G3YH 1EHXA 1KV3A 1XH3B 3JV6A 2IPTH 4Y5VB 3MLZH 1UFUA 3HR5B 4HWZA 5DYOA 1I9RL 4ZQKA 3BZ4B 3C8KB 2BJML 5CSZB 1TVBB 5JXEC 3S5LB 3CUPB 5J3HC 3FN3A 1QPXA 1DANT 1AR1C 3F12B 3KYAA 5MEPB 4PREA 4YC2B 4WHDA 4IOFD 4DQOH 4PRHD 1JGUH 4KK9C 4HS8L 3G6JA 1OAUL 1EBPA 3ZDYF 2OR9L 1AXSB 2EO1A 2X4NA 4NC2B 4CU7A 1S3KH 1QLRA 2QKIB 4WJ5B 3NFPB 3AAZB 3IF1A 3LH2L 4LNVA 5FO8B 3QFDB 3T1FB 3QNXB 1BLNB 1KN4H 2BVQA 1DE4B 2ARJB 4E0RA 2ATKB 3TFKC 4M5YH 4R97C 4L9LC 2HT4C 2DWEB 3MPCA 2D03H 4GJTB 2CH8A 2A1WL 3I02A 4PRDA 4JZNA 1YEFL 1NGXB 1K4DB 1MREH 4HFUL 1WV7T 4LU5H 4LVOB 5DRZB 4P57B 4M43L 1R3LB 3G5XA 4MA7L 4ZXBB 1YUHA 3EOYG 2CDFA 4ZUWA 1QSFA 1IGIL 3NFNA 3MLUL 4HK3J 4DCQB 4NKDB 4MQXC 4LRNH 5I1AB 3S34L 3WFCH 4YDLC 3OAUH 4MCZA 1B4JH 5HGGS 1BZQK 1XIWC 1S9WA 4DAGH 3VRJB 1MIMH 1MF2L 1GGCH 4I77L 4H1LG 4K7PL 1OAKH 4UT7H 4JCMA 3VG9B 4MXWH 1HHHA 1QBML 4IRJA 3K4DA 4TYUA 2R29H 3NCCB 1TTGA 5JIIA 4GW1A 4D0BA 2DJUA 4PJAA 4N0RA 4ENEC 2UZXB 3O9WD 4XWGL 5TDPB 2FJGA 5GGSA 3MLVH 2DDQH 3Q6GL 5ELIA 2HJKA 3PHQA 3QCTL 2OZ4L 5GGVY 4X5WA 2UUDK 4MVBD 4G8EB 5FA3B 2FATH 1ND0B 2ZCKH 2B0SL 4QNPF 1T1XB 5IIEB 4KJYA 4LSUL 4I0PA 5JDSB 4XNXH 4MXVF 3VGAC 4CVUA 4NQTA 4Y19A 3G04B 4OGYL 3OX8A 4ONHB 4JFYB 2P8LA 3P2TA 3WXVH 1DN2A 1R5WB 8CGTA 4OCYH 4IOIA 5FO7B 1U3HB 5I1EL 3DHMA 2VXUL 1KCSH 1BX2B 3MACL 5BOZG 1L0XA 2G5BB 5CAYB 4R90L 5BS0B 4QRPD 3WLWC 2CLZB 2HWZL 3V2AR 1DVFA 4PGEB 4ZYKB 4I5BA 4JRXD 4WW2F 5CS7A 3ZE1F 1OWWA 3BP7A 5IBUG 4OFYD 4PJCA 4ZTOH 4N8CH 3KXFD 1ZHNB 1UXWA 5DMIL 3DLQR 4HWBH 4HK0A 2I9LA 4AMKL 4P9HL 1HHJA 4KUZL 4QHNB 4PGDA 4RMSA 3QHFH 3BUTA 5DO2D 4MDJA 1UGNA 3MREB 2F53E 5EUKB 1UWEL 4R3SB 1MRCL 2GKIA 4FQCH 4JPVL 2FR4A 1AGDB 1MJUH 1XEDA 4OUUA 2FX7L 1U8PA 5M94B 2DIJA 3RI5F 4CADB 1S78D 1VFMA 4KK5D 2AJSL 3STLA 4S1QL 1D6VL 3KAAA 2YK1L 5E8NB 1EO5A 2APBA 4KRLB 5K9JL 4JPWL 4H25B 4LLAA 3U4EB 4YDKL 4L8BB 3UBXG 3QWRD 3RGHA 2DQEL 4KQ4H 2R0ZL 5FUOH 1DDHB 1MFNA 3QXAA 1IBGH 2AJXH 4K2UL 4YPJA 4HJGA 3SEPA 1CGVA 1Q9WA 3QXTA 1WJ3A 1M6OB 1QSEA 1LGVA 2XWTA 2GJ6D 5B38B 3P0VL 5DJCA 5DHYB 1CF8L 3F7VA 1CD8A 3VWJB 5J6GB 1A1NA 3BKCL 3NIFF 1I9IH 4O2EA 5IVXF 2R9HC 2NNAB 3GJFA 1HI6A 3GIVB 3TYFA 4OLYH 1S7SB 1MELA 2BNUA 3FRPG 1E6JH 3PQYB 1S9VB 2VR5A 5T1DH 1MCOL 1MCRA 3DYMA 2VZVA 2NY3C 1W0YT 5E2VL 2R0WH 1MY5A 2NTFA 2ZUWA 1X5LA 3S5LG 5F1SA 1H0DA 2G75B 3AREB 1R3IL 1XCTA 3WS3B 2YPVH 4FG6D 3WJLA 4GRWF 3JUYA 4PJEA 1NUDA 3E6HB 1K8IB 3BGFC 3DRTA 4G8FB 4DN4L 4G5ZL 5JW4M 2R2BB 2HG5B 3BRFA 1T3FA 1KCUH 1ZKAA 2HRLA 3JVGA 5JW3H 4LPTA 4W68A 5D7LA 1H9VA 4EDXB 3T0ED 1D5BA 3W9DA 4FZEL 3DOSA 4U1JB 1MNUL 3C08L 5DHVB 1UJ3C 5MEOB 4OCXH 4CL7A 4TSAL 4WGWB 3WSQH 4OLUH 5JZ7D 4WWID 2WSKA 1WZ1H 3UTZA 1F5WA 1QNZL 1B88A 1VPOL 4G7VL 4A2MA 5L7XH 2YSSA 3AS1A 1ORSA 4LVNC 1DEEA 1XZ0B 1HQ4B 1BQHG 2X7LB 4JN2B 4YXKL 5HTSA 2X4SA 4ETQA 1MI5E 3ZYIA 5D9SA 4YXHL 4I9WD 1U8JB 2NX5E 5F7LB 1J7VR 1I7UB 3VXME 4Z76A 3S98A 4HULB 4KUCF 4MS8D 4PJ8B 2YMXH 5TH2A 4Y5XB 2NZ9D 4WFFE 4OZGA 1ES0B 2DI9A 2RHEA 3HAEG 3QAZB 5IKCB 1H8SA 1AO7A 1VHPA 2NX5A 2YRLA 3MV7A 5AZEH 4D2NA 3VXRA 3VXMA 2EH7H 2WV3A 3T4YB 1PDKA 3BZEA 2ERJB 1B0GB 3BT2L 3ZYJA 3QXVA 4G43B 1G7JA 4MNQE 3BHBB 4NWTL 1IARB 1NBYB 4Y16B 1KLUB 4G8IB 1ZHBB 4FFWD 4M02A 3IGAB 5ALCL 1X5IA 2AV7A 3CCHB 3U48A 1RAMA 4PJIF 1G7LA 4IRSC 4HGWB 4JVUA 3BVNB 4R26H 1L7TH 4JRYB 4WUUD 2DYPA 1JFQH 3VD4A 5GISL 1F02I 3TZVA 4HD9A 4XH2B 4F7TA 1KACB 2IPUK 4ZMAT 2CO6B 3CXHK 4R7NA 4UU9A 1F00I 1JGEA 1Y6NR 4R8WH 3V6ZA 1JZ2A 4RMQA 3QDMA 4K55A 4P5KA 1YYLH 3MBXH 2MCPL 2AS5M 1BZ9B 1JUFA 2W65A 4XTRD 1U8OA 1C16A 1B90A 5E8EA 1FJ1B 1UB6B 4ODBD 5KN5A 3ZE2F 5FUCE 3UJJL 3RVXC 4MJ6B 3G5VA 3FB7B 4L9LB 1W0VB 2V17H 3SE4A 3I6KA 2VRAA 1UCBL 1RHHB 4YEFA 3VFNB 1FZMA 1YEKH 3DVFA 5ISZB 4HHAA 1CDJA 4KKNA 4KVNL 1S7RB 2VDPH 4LK4A 2DF3A 1JWSB 2XPGB 5IMKB 2Y7QA 4HDIB 4AEIH 1IGTB 4NQEE 4M6NH 4PLNC 3GMPA 5L8JB 3F7RA 4NYLA 3ARBA 4QKXB 3JXAA 4XPTL 2BHYA 4X8JA 2HKFH 2K7QA 3QXWA 1IGFH 4NQXA 4D8PB 1EBAA 2YEZA 1CDHA 4G6MH 3N9GH 1A9EA 2BFVH 3MXVL 3RVUC 4LSRH 1FFPA 4Q9RH 4YDLB 4NQEA 4IRJC 4QGYA 4OD1H 3NZHH 2X4TA 4PR5A 5EU6E 4NQDA 2R0LL 4FFZL 4CU6A 1DQDH 5J12C 1F4YH 1AXIB 3HC0B 2X4RB 1OSZB 5E24E 1FRGH 4HWNA 3O6LL 1PBYA 5HI5D 3DXAA 4UOJA 5IHLB 1UACH 1H3PL 5I0DA 2H32B 4BELD 4QT5A 5DR5H 2GTZB 8FABB 2DQDH 2EO9A 2XWBB 1F3JA 4JFFB 4GAYA 2WM0A 1C08A 3QXUA 4M93C 2XIDA 2XI9A 1LO2L 5SV4A 2CDGA 4POZC 1ZAGA 4X6CA 1QFUL 5IEHA 1GGBL 2EDOA 4P9ML 5HGHA 4Y8DC 2LAAA 3B3IB 4H1LH 4OD2B 3ROOA 3OG4B 1BBJB 3UTSE 2FRGP 3KLAB 5E8OA 5SX5K 7FABH 5I2IB 3SDDA 1OAQL 3NPZB 5D1XD 5SWZA 5GJTH 3MSPA 1RPQA 4GMSH 3O6MH 1U8MA 1YQVH 3SO5A 3G6DH 4I3SL 2AXGB 2VLJA 2AEPH 5IV2B 2VLRD 4OKVB 4JKLA 1CN4A 3UTSA 1C5CH 1U8HA 1OARL 2PXYD 1YEJH 1IRAY 2VXVH 3I85A 3KDMB 4JE4B 5DZLA 4LMQE 3MRRB 4LARL 5HHMB 1EGJH 3GJEA 1VFAA 4JO2H 1DLHA 5FCUL 3BH8B 4WI6A 3N85H 2VO5A 5C0JA 3CGTA 1KCVH 1CXEA 4JHWL 3UC0L 4HKXB 3PWJB 1NGZB 2E8YA 1FFOA 3ECBA 3L5XH 2WANA 3IFPA 1TENA 4HUMB 1JL8A 4N1HB 2VAAB 1TJIL 3OKEA 5JPMB 1I9RH 4EIGB 2DBJA 3QIBB 4YBQC 5EG6C 2OYPA 5F70A 5HI3C 3T04D 4LPXA 3CK0L 3I6GA 3QDGA 3TBWB 4HS8H 1II4E 4XNZC 1OAUH 1PX3A 3RX7A 3TVMB 1BZ7B 5I76B 4Y4HD 1YN6B 3BW9A 2UYLB 4MYWB 1FNFA 1ZOXA 4OLEA 3LH2H 4Y4FD 2NXZD 3O4OC 1I8LA 1G7QB 3LMJL 3JZ7A 3V5KA 1HCVA 4I2XE 4D94A 3HUJE 5HYSB 1F8TH 3QUXD 4D0DB 4J3TA 2A1WH 3VH8A 3V7AG 1K8DA 5AUMA 3MV8B 3RRQA 3UTOA 1F2XK 1QLFA 3MUJA 2EZ0C 3HRZB 2YRZA 5LGJB 1LE5B 1ZGLP 4YZFF 5TE7H 3BP6B 1NGPH 1EJOL 5DFVD 1KT2B 3BQUA 4MA7H 4OF3A 4WO4B 1IEAB 2VLLB 5DI8B 1ZLVK 1IGIH 2JK5A 4QOKE 3MLUH 3SGDH 1UQSA 5FM4A 3WJLC 4IDLA 3TO4D 3S34H 4W81A 3HZYB 2BXYA 1D5ZA 1MEXL 1EEZA 4FNLH 2NY3B 4LHUB 4MJIB 1WAAF 3MA7B 1KSRA 1RUKL 5DRNA 5T3XE 2NR6C 3MRCB 1MF2H 3ZDZE 4PLKD 5C0GA 4I77H 1IC7L 2H41A 4XGZB 4K7PH 1XR8B 1JTOA 4PGBB 4HKZB 1EHLL 3ZKMD 1FZJA 2BVUA 5GZND 3G9VA 1FGVL 4ODHL 3BGFB 1QBMH 1WIOA 4LP5A 5ICZB 1IAOB 2MQCA 5JNYA 4HGKC 5F96L 2QR0A 5L9DH 2FX8L 3HHRB 1P2CA 2YPLA 4LLVB 4U1LA 2EYSA 1CFQB 4RISL 1T2QL 3OKLA 2F58L 1ETZA 5SWSB 4TULL 2GT9B 3Q6GH 3QCTH 2OZ4H 3O4LB 4WIQA 4RMWA 1G9NH 1UJ3B 2H45A 2B0SH 1AGCB 3PWPD 5FUZL 2XG5A 4KJQD 3TO2B 2O61A 4LSUH 5JW5A 1J0HA 1MRDL 5ESQA 1HWGB 3ROLA 3GSNL 4NO3A 1MCFA 3PABA 5F8QC 3SO3C 3KLHC 3PL6D 1KFAL 5F9WB 4GW5B 1PFCA 1ITCA 4OGYH 2YPKA 5JOPE 5BOPA 3IFOB 2BCKA 4U1IB 4TVSa 2ZNWA 4Z7VB 3MA9L 3MGOA 3Q3GB 5B8CB 5I1EH 2HTLC 4QYOA 3MACH 1U3JA 2HFGL 4Z5RB 2QQNL 1U92B 2ESVB 2HWZH 3HE6D 1HOCB 4YJZL 1S9KC 1CQYA 5F6IC 1FVDA 4DGYL 4L1DA 1IL1A 4AM0A 4FFVD 32C2A 3VXSA 2FJFB 4AMKH 5D70L 4LIQL 4PJFF 4X83A 5JTWA 1N5YL 2HRPL 1DZBA 3V8CA 5DS8B 3WFHB 4JPVH 2XKUA 3GMLB 5E00B 2FX7H 4ZOAA 1FPTH 1Z9MA 2DIAA 4IRSB 4PREB 1K9TA 1YJDH 2AXFB 1W0WB 4TSBH 2XN9E 1IQWL 5DJDA 4H20L 1J1XL 2CUIA 2IQ9L 1D6VH 2PYEB 3TIEA 3GKWH 2YK1H 5EO9B 3V5HA 3VXOB 5FFLA 4OLWL 3MROB 1V7ML 5K9OA 2P5EA 2BX5A 3WHE1 5K9JH 1NAKL 4YHKL 4JPWH 2OSLA 4P0DA 5DUPL 2DQEH 4MX7A 5LAXB 3VD3A 3ZT6A 2XN9A 3VI3E 4S0SD 4MNHA 3GMQB 5DLML 4MQ7B 3PWNB 5JLZA 1QOKA 4Z7NF 3IDYC 1QYGL 1QKZL 4DVBB 4ZXBD 3OWEA 2FO4A 3RUGA 3S96A 3O45B 5KAQF 3ARBC 1NC2A 3P0VH 2QTEA 1CF8H 5IEKB 2Z4QB 4P2RE 4JFQA 3LKSB 3T0DA 2PR4H 5D2NE 1CXHA 3HMXA 3WLBB 4ZNEA 5IFJA 3BKCH 3O2DA 3HE7C 3KLSA 4LPWA 4O00A 2KUTA 5MP6L 5A3ID 5LJYH 1NCBL 2ZOKA 3WIHL 4NRXA 4Y5YB 1GOFA 1AQKL 1J1PL 3CH1B 1S5IL 5CZXC 1R3JA 3GJFK 3FL7A 3ALPA 2APFA 3MFFA 4P2RA 1MCOH 4XVUD 4RMRA 1GXEA 5I1IL 4QHUB 3SOBH 4PJGA 4CJ0A 3IVKB 4U0RC 2ZG2A 3OHXB 1R3IH 1AGFB 2NLJB 3TWCL 1BVKB 2YBRB 5HHNA 1WVZA 4O4YH 1N0XL 1NBZA 5J12B 4DN4H 1DUZB 3RHWF 4G9DA 2MOVA 1IAIM 1OGAB 3SDXA 4QTHB 4PJHB 1JWUA 3CZFA 3NACL 4ALAL 4L8CA 5KJRL 3TBSB 3L7EB 4NO0A 3T65B 3V4PH 4F58L 5HYSG 1F3RB 4FZEH 1MNUH 5I30L 2P42B 1KC5L 2D7NA 4ODWB 5GRJL 1N0LA 4M93B 4D0CA 4TSAH 3SDDC 3DGGB 1FC1A 3SGEI 4NO2A 5DMKA 1U3HD 3GK8H 3K7UA 3AM8A 4YHPB 5HYQB 3KS0J 3L3OB 3LEYH 4G7VH 4PBVC 1ADQA 2C3VA 1C7TA 1FHGA 2CXGA 2KKQA 3KNBB 1G7HB 4YXKH 1Q0YL 4YHIB 1BFTA 4YXHH 4NQSA 2OMBA 1IZKA 1HWHB 4PRIE 1F97A 1FSKB 4WI9A 4XCEB 3W39B 2FHBA 4W4OA 2XA3A 2BXZA 1JV5B 4MDIB 1HHKB 1BWMA 5C0NC 1SJEA 1IQDB 4OZIE 2EYTA 1P84K 3MRKA 1TZIB 3B5GA 3BT2H 4H5SB 2E6PA 1GIGL 4XCNA 1J8KA 1G6RB 3MLPA 1RURH 1EEQA 3ZHDA 4NWTH 5IOPA 1MHHB 5ALCH 1A6VH 5I73C 4OZIA 3KGRA 2Q86A 4JVPA 4KI5C 4G9FB 4X9FA 1FC2D 4CVWA 4Q0XL 3O2VL 5CJQH 5EU3B 4K94H 1QQDA 1OQOA 2OI9C 2Y6SC 2X1QA 2IBZX 4YDJB 5GISH 5EFIB 3IXAA 4BSJA 2UY7A 1I8LC 1M7IA 5HHVL 2YUWA 3AUVA 3EHBD 3JWDH 4XNZB 4OI8A 3G5ZB 1N5AB 5I1JL 2CKBA 3CDFA 5F9OL 2VLKA 4PJ7B 4Z77A 2MCPH 4HCRL 1Q9WB 3VWJD 3HI1B 3VRIB 2V5YA 4XP4L 2FJHA 3UJJH 5DHVH 2VL4A 4PY8I 3NN8A 5INDB 1ZT7A 1GL4B 4MAUH 1U58A 3BQUC 5T1KB 2PYFA 4KVNH 1NAMB 2FEEI 3RVTD 2DQFB 5E6IA 2H26A 3EO1B 3TGXA 5CP3A 4DK6A 4XPTH 1MCHA 2BVYA 4S1RH 3FCTB 4EUPA 2YXFA 1T4KA 1FP5A 5T5NG 4KK8D 4OFDA 4HC1A 3MXVH 1P1ZA 4FXGB 2WINA 1AQDB 5HGBA 3GBLA 4P2QA 2OXGA 1HE7A 1WCBB 3BX7C 1CTNA 1LE9A 1DN0B 2R0LH 3ET9F 4FFZH 3HG1E 4G8GB 1Z5LB 4WEBL 5ITBL 4F2MA 4JG0H 4L9DA 4KV5E 2C1PB 3O6LH 4GRMA 3KPPA 1G6RL 2EYRA 1L4IA 1F4WL 2R2CA 1KPVA 1T5WA 5CEXA 5ENWA 4NT6A 3IDGA 2E7CA 3HG1A 4XMKL 1ZVSB 2OX5A 2D31A 3O41A 1LO2H 4XPFL 3M1BA 3OAYK 1VFBA 4L8SC 5GSRA 5DGQA 1KG0A 4X99A 1KTKE 3RGVC 1QFUH 5L8LB 2VWEE 1MWAB 2NPLX 3BEWB 1GGBH 4P9MH 4NRZB 5DD5L 4H88H 2YZ1A 2VQ1A 3SO3B 4PJ8D 4J3UA 3P4NA 3FQRB 1TCRB 1OAQH 3ARDC 2LFGA 1FFNA 1I7TB 2NY6B 5LCVL 5I9QC 4L3ED 4QRRA 4I18A 4JM2F 4B53A 4QXUL 1L9MA 1LO5A 3NCYS 4ODSL 2XTJC 4KKLD 4YXLL 3MV9B 4PB9L 1LDPL 4IIQB 3FKUS 5C07E 1O5DT 4Y16D 5T1LA 2ADJB 3HZVA 3TN0A 2CD0A 3ME0A 4PLOB 5F6IB 3ARFA 4TUKL 2VSDA 4HS6A 1DFBL 4JRYD 2Y5TA 3HMWL 4LNRB 5DD6B 1D5IL 5JXED 1QUNA 5EU5B 3SPVA 3ZLQC 5J3HD 2E7BA 1KXTB 4JHWH 3UC0H 1VKXA 2ADGB 1AR1D 4MWFB 2F8VA 5EOCL 4KK9D 2R1YA 1YYML 5KSUB 2FIKB 1H3GA 1TJIH 5CEYA 4GBXA 4XPHL 3C09B 4AIZB 1XR9B 3F62A 3OAZK 4NFCA 4OFPA 3V6ZB 3U30C 5AD0B 3CK0H 5KSAB 3V4UL 3GBNL 5IW1B 2HT4D 4KZDH 1KYOK 4JFHD 5FECA 2ICWB 4QTIH 1Q9KA 1FO0B 3JV4B 3MJ7B 1E27A 3EO0A 2H32H 5ISZD 2D2OA 5TGBA 3H7LA 2LE9A 3LMJH 3STZA 1WEJH 2XXMB 1FL5B 2V7HB 2WLZA 3IDYB 2Z91A 5GRVK 3CFBB 4K3GA 2D9QB 5E4EB 5BO1L 4N8VB 1P7QB 4Z7VF 3RWHB 3CMOL 1S5HB 4H26A 4NUGL 4ZO8A 1GZQA 1MWAL 4OZHF 5KVDH 4MQXD 4Z78A 3KPRD 5DC4B 4KZEH 2RJMA 5JR1L 3FB6A 3AVEA 12E8H 5JA8B 2ADFL 3HE7B 4KQ3L 1EJOH 1Y18A 4CDHA 3U9PL 2JB5L 4PRAB 1KB5A 1A4JB 4U1GC 4CN6A 3UDWC 4CN1A 1I1YB 4Q9CA 3QEQA 3AB0C 3MV11 1RSFA 1MEXH 3L3DA 1MFCL 1P6AB 4ENED 4PJXA 5HHXH 4MB3A 1NFDE 3MV01 4F3FA 1JMXA 1TJHH 5T5NF 1EHLH 4JFFD 1FE8L 1FGVH 4ODHH 1R5IA 1RJZB 4OI9A 2YN3A 3BIBX 5AZ2H 4RMUA 5F96H 5K59E 2VH5L 2FX8H 4DW2H 1YEHL 1T2QH 2F58H 2NW3B 2FSEA 4X5XB 4TULH 5IW3A 4CU8A 4EVNB 3AM8C 3NCMA 5K9KB 3DVGB 1HXYA 2EDWA 2C1OA 3HNTH 4UINL 5FYJL 1RK0A 3E3QE 5FUZH 2YD9A 1AKJA 1OGTB 1MRDH 4L1HA 3ZE0E 1ZWIB 2R0KL 5F3BA 5JO5A 5GGRB 3REWB 2CIKB 5FCSH 2H8PA 2D0FA 4OBSA 3OKNB 5E8PA 2BSRB 2NW2A 1QBAA 4G80A 5I71C 3SQOL 3WLWD 5C7XL 2DBLL 4TNVK 1LK2B 2BVOA 3HKFA 4ZUVA 4NHUA 3BZDA 5DEGA 2VXTL 2AAVA 3T2PA 4LVEA 2K1MA 2HFGH 5AYUH 2QQNH 4LKCB 3HI6L 1K2DB 2O5YL 3C6LC 1OD7A 3UROR 5D6DA 3B83A 5C0BB 3QG6A 2DRUA 2CIIB 2CK2A 2HT3C 1AGEA 2NYYC 1UM4L 1YNTB 3P4OB 3NCJH 5IJVB 1I7ZB 1N5YH 2HRPH 5CINH 1FAKT 1V8HA 3MRFB 4LPCA 4U6VL 1NPUA 2XZZA 5I73B 5JHDA 4Y2DA 5HVWA 4L4VB 4PJHF 2R23B 3KYMB 1YDPB 4XPGL 5DJ8B 4OGAD 2OI9B 2X1WL 1CQKA 3VFSB 1CLZH 3VFOB 1IQWH 1J1XH 1TXKA 3QPQC 1IM9A 5E7FA 4YHNB 1UB5A 4R9HA 1MFAL 4NM8H 1HDMA 1N6QL 3AS3A 4W6XB 4OLWH 2Q8BL 2A0LC 4X4YA 4HXAL 1KPRB 3FJTA 4JFDA 2QQKL 3QO1A 2IMMA 2JCCE 2ATPB 35C8H 2AW2A 5D7IA 3CXHJ 4NKOB 3MV8D 3FO1B 5J13C 1QTYT 4HIIA 4XBGB 3DX8B 5DLMH 2G2RB 2GCYA 3L3JB 5F7HA 1B0RB 4FQQB 4LLDB 2R9HD 4PV8A 1I1CA 1NFIA 1X4XA 1A4KA 2PTVA 2R56H 3O3BA 3F5WB 1MCWM 2X42A 4JR9H 2FCBA 3GSQA 2GSGA 4QXGH 3QCUL 2BK8A 3CSYB 1JZ8A 4XZUA 3QIUA 2HLAA 1IC4L 4ZDHA 2NY3D 4LHUD 4E41E 5MP6H 4QO1A 4MJID 3W0WA 5DJAB 5E1AB 3T77B 3WIHH 4HIEA 1AQKH 1FIGL 1J1PH 3D39B 1ZS8B 3T08A 1C7SA 4PG2A 2MWCA 4N9GB 2AJ3B 3BPCA 4EI5A 3U4BL 2ZUYA 3IAPA 5I1IH 2F54E 4GG8A 1OY3B 3P9WB 2O5ZL 3N1GC 2AXJA 1CFNA 4ZPTA 4LAQL 2P48B 5SWSD 3P0GB 3O6FA 4IEFB 3F6IA 3RWFA 3O4LD 1N0XH 2P46B 2V7NA 5ACZA 4OJFL 2P45B 4R6UA 4LF3B 1RZFL 5C0IA 5H2BB 1UA6H 4FXKA 5ESAA 4X7TA 3PHSA 4L3CB 3FOLB 4CMMA 1IKNA 3OGCA 3DWTA 2YUXA 4ALAH 1CL7L 5KJRH 5IB1B 4F58H 1T04B 2L7UA 3OJDA 3AXLB 1X5HA 5KSBE 1I8MA 4CJ1A 2ZUSA 4P3WA 5GRJH 3PV7A 4PJ7F 1JN6A 5CBEA 4L8SB 3L5IA 5EB9A 3RWEB 3ULUC 1PQZA 4LKXA 3RGVB 3R8QA 1EAPA 4LQ1A 3D25A 3HCVA 4I18C 4DEPC 5FGSA 4XP1L 3O8XC 4O5LL 2J4WL 3B5TA 2PTTA 3LKQA 1BJ1J 1Q1JL 3ARDB 5GRVL 2ESVD 3KVQA 1Q0YH 3WKMH 5I9QB 1ED3B 3FFCE 3G6AB 1CGXA 3SKOB 2VE6B 4Z7OE 2APWA 4XWOC 2XTJB 4UB0L 3RBSA 3FN0L 3D3VE 4L4TB 3B6SB 1Q94A 3ARFC 1K4CB 1R6VA 4MA1C 1FGNL 3SKNB 1G0YR 5F89A 3L9RA 5HPOA 1X5AA 4RRPA 1A1MB 4J4PA 1M05A 2IG2L 3H9SE 5HHOA 2BNQE 1CIDA 2EE6A 4IRSD 1PZ5A 3ZL4H 2J5LC 1GIGH 3QI9A 2WP3O 3WIFA 4S11A 4U1HA 5ETUB 1EEYA 3EOBB 3HLAB 2AJVL 4NNYB 3GSRB 3L3IB 1ZLWH 4GG6E 5C6TL 4OM0H 4X98B 5KANI 1NCAH 3T3PE 1BJMA 5EO0A 2JB6A 3MXWL 4Q0XH 3O2VH 2J8UA 3CH8A 5I8EA 5IF0B 3S6CA 3E2HC 3D85B 5FGRA 4PRHA 3UO1L 3U30B 4PIRF 1A22B 1TVHA 2BY2A 3VD5A 3RVXD 1ORQB 1VACB 2FGZA 4GG6A 1ROWA 3BP4B 1RULL 5IVZA 2L4OA 5L88H 5DD3L 5F9OH 4XB7A 4LSTL 5L0QC 4HCRH 3DBXA 4ODUB 2VSCA 1QSFD 4OCSH 4XP4H 3T2NL 3V9FA 4GXVL 3QFJB 3BRDA 4GS7B 4KTYA 2EDYA 1JCKA 1WCQA 2AV1B 4XAWL 1OT1A 2CLVB 1S9YB 1INQA 1P7HL 1GYAA 1RJYA 1MH5B 5TE4L 1Q9OA 3GDBA 4PV9A 2HVKA 1BD2B 4GT7A 5EIQA 1WFUA 3GMRA 5EZLA 1OW0A 5C0EB 2YA1A 4KPHL 3BN3B 2N56A 5F88A 3PHOA 4PYHA 3AB0B 5H37G 1ERNA 1OGAD 4AQ1B 1LNUA 5E7BA 2Z92B 3AS0A 4NC1E 2JF1A 3EYVA 1T5XA 5FA4B 2GUOA 3PGFL 1MAMH 4P5MB 1N59A 4WEBH 5EIIB 3VFVB 1PX4A 3BIKB 3H3KA 4OT1H 4POZD 3FAXA 3LKOB 4RZCA 1G6RH 5DJXB 2OQJB 1A9BA 1XF5A 1DBKH 4ISVB 5I1LA 1JPTL 3VH8G 2ORBL 1HKLL 3QEGL 4ZO9A 2I5YL 3FFDA 3SE8H 2G9HB 5DVLA 3WXWL 3MNWB 4RGMC 1NMBH 3I3BA 2AK4B 5F7UA 5C9JA 2I9TB 1CDCA 2NXYC 1TTUA 4FP8L 3V79C 4LGRB 2R4SL 4LFHG 1AD0A 5KVEL 4QRPE 1QEWA 4DKEL 2AVGA 3U2SA 2IEPA 5IB3B 3L5WB 1S7UA 3D1MC 2XKNA 4NRYA 5I71B 4JRWA 15C8L 1EO8L 5LCVH 5E8DL 3QO0B 5IB5A 1HHIB 2DQTL 2BSED 2Z8RA 2E8ZA 1ZT1B 3V52L 5EBLA 4ODSH 5D7JC 1J05B 4QRPA 1ZHKB 2F74B 3KPLA 3D2UB 3FQTA 4A6YB 5FDYA 4PB9H 1A6ZA 1IJ9A 4XBEL 4JRXA 3MUZ1 5E94B 3QUMB 3TT1L 1A3RL 2GK0B 2NMSA 4OFYA 3C6LB 5TDOB 4B7LA 4BUGA 1N2RA 3KXFA 3NIGE 2ZCLL 2X70B 1BQSA 5F72S 2X4UA 4MD4B 4U7KA 1PEZA 1QPPA 4G9FD 4TUKH 3A6CL 1J86A 4PD4K 3AY4C 4S1DC 1VEMA 3HMWH 4Y2DC 1QFWI 3WS6A 1JNHA 1D5IH 1CICC 1DBBL 3R06B 4YBQD 2UWEA 5HI3D 1U95B 1MHEB 4ETYA 3S37L 4ELMB 1P53A 3RVVC 3RVWC 4LAJH 4PP1C 4Z7WA 1YYMH 1J9CT 3GSVB 4MA8H 4YEEA 3RPIA 3GMOA 1YY8A 2XRAL 4ZFZB 3HPJB 2WUCL 2GJJA 1J87A 2V9RA 1EFXB 4NFBA 1QSED 1KIPB 1IZJA 2ZSWA 3V0WL 5C0FB 4EI6A 3QIWC 4WI5A 2N7AA 3V4UH 2VAJA 1U8NB 5F7NC 2DB8A 3LV3B 3QWRA 1P69B 5DQ9B 1IAKA 1KXQE 2JIXB 3DV4B 3VXTA 2F8XC 4MD0B 5T1KD 4J3WA 3ES6A 1AY1L 1U91A 2EZ0D 3QBTB 3C5SB 3PP4L 5C70A 4I3RL 4YR6A 2VISA 1CR9H 2PYFB 3LZFL 3QIUC 1GC1L 4J1UA 2GJ6A 2AGJL 3T3MF 1LD9A 5BO1H 4JJ5B 4UTBL 3CMOH 4YHLH 1MWAH 1M71B 4WFED 1OB1B 1AHWA 4AYFA 1U8LA 1AC6A 4KROB 4AENA 5JR1H 4FABL 2DTML 1GVIA 4NUJB 5ANME 3LKNA 2ADFH 4KMLB 4EI5C 3KPSE 4KQ3H 1F4XH 3V7MA 2P24B 3SDCC 2JKXA 3U9PH 1AFVL 2LVCA 2NR6D 1P5VA 4G8GD 1YPZB 5D7LD 5T3ZE 3NIDF 2B5IC 2OR8A 2XOTA 4KTDL 5EOTA 4XC1L 3SGEH 5ECJE 2V2TB 3CPLB 4N90D 4C56B 3O11B 1ZSDB 3EGSB 5E9DA 1IFHL 5IK3A 5FHAL 3EYQC 4YDIL 1I3VA 4LLYB 5EOCJ 2VH5H 3C8DA 1KTDB 4XNMA 3RDTB 5IMOB 5FGCE 1XGQB 3T0EA 1YEHH 4HUKB 1V5JA 5GRWA 3KLHD 2QJDA 3QEUB 3RL1A 5IHZB 2WBJB 4UT6H 1C12A 6FABL 4UINH 5FYJH 3HPLA 5GHWL 4OGZA 2R0KH 4U6HA 1NEUA 4JPKL 2CKBL 3ZDXF 2HTLD 2EDKA 1B6UA 3VXRD 3MV9D 5C09B 5MENE 2B20A 3O8XB 2YD2A 4MJ4A 3RWJB 2HTKC 4P59L 4MB5A 3TCLB 3QDJB 4BH8A 4U7SA 5C7XH 5GS0C 2DBLH 1H3VA 1FO0H 4U6YB 4X6DB 4W6WB 5DDHB 3EFFA 2E7LA 4D9RE 4M9OA 3MRNB 4NIKB 4POYA 4J4PC 1PKOA 1XGPA 4OZFA 3BN9C 1RUQH 1CT8A 1KCRL 3V6FB 5BQ7A 5DHXB 3TNNA 5IFAH 6CGTA 2H3NA 4MA1B 4U1MA 2W07A 3HI6H 2O5YH 4X7CC 2DYPD 4R96A 4RAVB 1FL6B 1BREA 3OL2A 5BJTA 5IM7A 2VDLL 2BNRB 3C5JA 1JZ4A 2M8XA 1L9NA 3FQNA 4JANA 4ERSL 4DK3A 1JIBA 1F11A 3OXRB 5FYJD 3RY4A 4KHXL 4G7YH 4HC1L 1UM4H 5FOBA 4UQ2B 1P84J 1JNNL 4ODXA 1DQLH 2N1KA 1PGRB 3ZSTA 5KSAD 3QDMD 1HYSC 1FVEB 1HEZB 1A1OA 2KH2B 4P3DA 3QPXH 1P4BL 4F9LA 4U6VH 5HYEA 2IJ0C 4M03A 4XPBL 4WUUA 4XPGH 4QHLB 4LCCA 1LO4L 3O0RL 4AJ0A 5DT1H 4K7PX 5T33L 1YMMB 1X3DA 3B2VL 1T0PB 3PWUA 4GUPB 1N6QH 1UXSA 5TFSL 4FQHA 4TNWK 4AIXA 3C6SB 2QEJA 1G7IA 2QQKH 4JLRB 4JGMA 5IMMB 3ARBD 2OXHA 4Q74A 4EQ3A 2AQ2A 5H35A 4M3KB 4Y1AB 5L0QB 4QRTB 1SYVA 1DQTA 3MFGB 1Y0LA 2V5SA 3HE7D 2ID5A 3VFGH 1NGQL 3HC4L 4WW2A 4YAQB 2K9UA 5CZXD 3ULUL 1OW0C 5D7SL 2I07A 3LKPA 4ODVL 3H7BB 3U0WL 4NQDD 4CW1A 5EA0H 5IG7A 5HPMA 1U42A 1T7VA 1IC4H 3EZJB 1E28A 3BXNB 4S10A 1RJLB 3MJ9L 1FIGH 2HVJA 1NSNH 5J6HB 4BFIA 1HYRC 2VDNL 2DLFL 3MO1B 1NUNB 5GRZA 4C83A 1I8IA 5F93C 2VERN 1JHTB 2LTQC 3LCYA 4EZMA 2ARWA 2O5ZH 1UZ6F 4LAQH 1OLLA 3PWVA 5L2KB 4KMTH 4JFEA 1JGLL 4Z95L 5T1MB 3PIQB 2XKSA 2EDFA 4PG9A 5J4MA 1RZFH 4YE4L 3V6OE 3SDDD 1KIRA 1HN1A 1CFSB 3MLTB 1UM6L 1UKSA 3WUWB 3WDHA 3DVIA 1CD9B 1X5ZA 3S36L 1E6OH 1I4FB 1BEYH 1D9KB 2MNUA 1CL7H 2BVPB 1CDYA 4PY8J 5BZWB 3WDIA 1T20A 1FFRA 3DIFA 3CLFL 1DQQB 1SY6H 2RR3A 5C08E 5EBGA 1Q38A 5FKPA 2NY2C 4EBQH 5CLWA 2KDGA 3GSUA 1GOHA 2D4DA 2NXYB 5HD8C 2VLRE 3EFDH 3MUGB 2XQYK 3IDMA 5KS9E 2AKRB 1C5DB 4XP1H 5D1XA 4O5LH 2J4WH 4HV8A 5IVXA 1Q1JH 2XG4A 4WHYH 5C0AE 5C0ND 2WAHA 1BQUA 4JO1L 4XI5C 3BJ91 4DUWA 2VLRA 5MHSD 4E42B 5C0BD 4UB0H 3GSOA 2QSCL 5D7JB 2PXYA 4QRSB 2IMNA 1NC4B 3FN0H 3QJHA 3VRLE 1FGNH 4F37F 2W91A 4U6TA 4N1CA 3RJDA 2DD8L 4GLRI 4Z0BH 3DX6B 1TQCC 3LQAH 2IG2H 1ZLUK 5BRZE 3U1SL 3DTXB 4N9OB 2F19H 4KI5D 3NFSL 1P7KB 2CGRL 5ABDE 1BM3L 1KLFA 1IE5A 2R2EB 5C3TA 1A3LL 3EYOB 4RMVA 2Y6SD 1CICB 1EERB 1A5FL 4F33B 4JKPL 4TOYL 3GMMA 1AD9B 4QXTA 1CG9A 5C6TH 3MBEA 4OD3L 2ZUQC 3FTGA 43CAB 4XHQA 4PRNA 1NL0L 3UJIL 1JHLL 3MXWH 5D1QC 4QY8B 2HJLB 5IROA 1PJ9A 1R3HA 2PCPA 3MR9A 4KMQA 2WIIA 3UO1H 3WFZA 3QIWB 3CFJB 4Y4HA 3U6RA 3OB0K 1KPUA 4N0FA 5EUOE 4X6EB 1RULH 3P30L 3WO4C 3IU4L 4Y4FA 3P77A 1QRNE 5DD3H 3X3GL 1EGJA 3BQUD 4LSTH 3OR6B 5FO9A 3RTQC 3FT4B 1KYOJ 4KKBC 4LFHD 3BD5A 3MYJB 4XMPL 3T2NH 4LLUB 3K8KA 1IGYB 1XGUA 3EDDA 2IH3B 3F8UB 3QUXA 3O3DB 5EUOA 2F53B 3MRHB 5DK0B 1BJ8A 2ZOLA 3D39D 2Y06H 2ICEB 4XAWH 3TBVB 2DKUA 1NCDL 2B7DT 5DVMA 4WY7L 5D5MF 4K71B 5D4QA 4Z7QF 3NABL 4WW1B 3LN5B 2XZAL 3SDCB 5I1DB 2YKLL 4KPHH 4WHTA 1JF1B 2YPLD 3FO2B 3OKOB 4TVPL 3WNNA 3MNVA 2Z35A 5L6YL 5FYKL 1IEBB 1F6AA 3TO4A 4O2CA 4PP2A 5EDXA 3EDJA 1N7MH 1JGDB 4N0UB 2YS4A 2X4OA 1RIHH 3MLXH 4ELMF 4IDJH 3PGFH 2D7TL 5E4IA 3T0EC 2XY1A 3OJVC 4F57L 3AFLA 3RZWA 5F7EH 4J2XA 5FF6B 4LCYA 1J8HB 1U8QA 3IJSB 5JZ7C 3RGVD 3TM6A 1XMWA 4MSWA 1CD1B 1JPTH 3O6KL 1LEIB 2ORBH 4NNXA 4H0IA 2VLME 2I5YH 3ARDD 3D18A 3PWPA 5JXAH 1ZTXL 1UWGL 5DXWA 3H0TB 4P23A 2BSTB 4UDUA 4FP8H 2LABA 3QA3B 1BBDL 3CU7A 4NJAH 2XTJD 2R4SH 2E7LC 5KVEH 4L4TD 4WFHD 3M8OL 5JDJA 4M7KL 4RFEA 1VESA 1LP9E 3KPOB 1EO8H 1LK3L 2D7QA 2OP4H 5E8DH 3BO8A 2OCFD 4U1KB 2H6PA 2D7OA 5J1AB 2DQTH 2HN7B 4X6BA 4HKBB 4DVRL 4GKSB 2FHCA 3C5ZA 3V52H 3R0NA 2Q3ZA 2VB5A 1PKQA 2VL5B 4PS4H 1YN7A 3HE6A 3WD5H 3KR3L 3SDAB 4XBEH 4ZUSB 4L8DA 4D3CL 1ACZA 5KBNC 5DJYB 3TT1H 1A3RH 4M8QA 1YPZF 2OZ4A 4RBPH 1XH3A 2ZCLH 2DIBA 4Y5VA 1JPGB 4DGIH 3HR5A 1G1CA 4WV1C 2FH6A 1WZKA 4GH7B 3BZ4A 3C8KA 4MA3B 5CSZA 1TVBA 3A6CH 3S5LA 3CUPA 1KJ2B 2P5ED 4C4KT 4F15B 3F12A 1MVUB 2HLFC 1DBBH 5LKNA 5MEPA 2GITB 3D85D 1N6VA 3S37H 4HLJA 1AXSA 5EBWB 3ZT5A 4KKCC 4FN0A 2QKIA 1MI5B 4WJ5A 1D7FA 3NFPA 1NLDH 5FO8A 4LL9A 3QFDA 1NBQA 2XRAH 2Q7YB 3T1FA 3QNXA 2WUCH 4D9QD 1BLNA 1RY7B 4J3SA 1U8KB 4CAGA 4OLXH 1DE4A 2ARJA 2ATKA 4XCFL 1NC2D 5ICXB 3B9EA 3QFJD 3WFBL 4F7MB 2DWEA 3WNKA 3PWLB 5CJ8A 2IPKB 2JE8A 1NGXA 3QB7C 3VG0H 1K4DA 4M1DL 4WW2C 1AY1H 1CTOA 1TDQA 3P4MB 5DRZA 1MRFL 3O3EB 3PP4H 4FS0A 3I84A 4MNQB 4I3RH 1R3LA 3BWAB 4P57A 5DVKA 4ZXBA 4M61B 4NPYB 4PY7B 1T0NB 4UQ3B 3HR6A 4X6DF 4N1EA 2AGJH 5KTEL 4UTBH 4DCQA 3DYPA 3MRJB 4Q6IB 4NKDA 1I3UA 5I1AA 5AWNL 3GSWB 4R4FL 3VRJA 4FABH 2DTMH 3QQ9C 3MC0A 1UG9A 5CEZH 1RJCA 4FQ1H 5GS0L 1VGEL 1AFVH 3LS4L 4QCIB 1XGTB 3W5NA 4HXBL 3V4VH 4GSDL 4M00A 2AP2A 1OP3H 2FZ3B 1T6VN 5IJKC 5TDPA 4A6YH 2LTQB 1EZVX 2O5XL 5HI4D 2YUZA 3BRGC 3QUMH 3H9HB 2BC4B 5FYLH 2A38A 1HH6B 1KELL 4G8EA 5FA3A 1ND0A 1AJ7L 3DUSB 1T1XA 5IIEA 1IFHH 3V8OA 5JDSA 1KJ2L 2AK4D 4YDIH 4J6RL 2QSTA 5D2NC 4MD5B 3G04A 3UTTE 4ONHA 1IGJB 4JFYA 4TUOA 4CVXB 4XVJH 2UVEA 3SE3A 1R5WA 3M07A 4BZ1L 2B8OT 1MCIA 6FABH 5CEZD 5B22A 4O2FB 5FO7A 1U3HA 2NY2B 4PJ9C 1S9XB 3GEWB 1BX2A 4KRMB 3X3FH 4K7PY 1DL7L 2G5BA 2CKBH 5BS0A 3LEVL 2CLZA 3D2UD 2DWDB 5IB2B 1YNLH 4PGEA 4ZYKA 3IJYB 4YUEH 1G84A 4P59H 5EU6B 4UIKL 2PXYC 3G6JF 4YFLF 3C6LD 4JPIB 5FYLD 1ZHNA 2X4QB 1HXMB 3QYCA 2ZNXA 4ZO6A 1L0YA 1K3ZA 4PJDE 4QHNA 5CIPB 4PJ5B 1KCRH 2HT3D 4BK4A 2NYYD 3MREA 5IBTH 3NCBB 5EUKA 4R3SA 3TJEL 2K7PA 3BZFB 4M1GL 2AJUL 4OCMC 2VZTA 1AGDA 4ZAKC 1WTLA 2VDLH 1N8ZB 1JYNA 3PGCB 2CMRL 4CADA 5CMAB 3JUZA 3MLRL 4I48B 5CWSB 4CKVX 3MBEC 2FEDC 4HC1H 1EFXD 1VA9A 1JNNH 5E8NA 3QPQD 2O93L 43C9B 5DRWB 1P4BH 2A0LD 4H25A 2WQ8A 4JEGB 3U4EA 4M5YL 4L8BA 4M48H 4XPBH 2YD8A 4LBEB 1KB9J 2JIXD 4PJBE 2ZUQB 4Y4HC 2YWYA 2D03L 1LO4H 3O0RH 1DDHA 5D1QB 2DQCL 3MJ8B 4Y4FC 3AS2A 3B2VH 3ZTJG 4JN1L 1OQXA 1G9MC 5TFSH 5F9JB 1M6OA 4OI7A 5LBSL 5B38A 4OF7A 5DHYA 4BQ8A 3WO4B 3BMVA 3QUXC 3VWJA 4OF6A 3WCYA 5J6GA 3U7AA 4RRPG 3RTQB 2YA2A 1EUTA 3K2MC 5C3LD 2NNAA 4OF5A 1R0AL 3GIVA 3TH3T 3P9LB 1NLBL 1S7SA 3OAUL 3LSOB 5GRYA 1B4JL 1NGQH 3PQYA 4DAGL 1S9VA 3HC4H 3LEXB 3I75B 3CX5K 2BDNL 1GGCL 1NCUA 3ARTA 4P2QD 5D7SH 2DMBA 1OAKL 4HS3B 3U0WH 2Z93B 5TJWK 4OCNC 1MCEA 1U8IB 4KRPC 5E6ZA 2FX9H 2RFXB 2G75A 5EU4B 5HYJE 3AREA 4JDZB 3WS3A 3MMEB 1N64L 3DV6B 3MJ9H 1KLGB 3E6HA 1K8IA 1QO3B 1AI1H 4G8FA 4C56D 1AGBB 3FMGL 2VDNH 4H8WC 2DLFH 4JFXB 2R2BA 2HG5A 1EJ6A 2FATL 5GGVH 2WUBL 3RDTD 3EBAA 4TN9A 4EDXA 1FZOB 4XNXL