1USQA

Complex of e. coli drae adhesin with chloramphenicol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
139
structure length
139
Chain Sequence
GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Studies of the Afa/Dr Adhesin Drae and its Interaction with Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
molecule tags Adhesin
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
total genus 25
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 1usqA00
2JKLA 1USQA 2IXQB 2JKJA 1RXLA 2BCMA 2JKNA 1UT2A 1USZA 2VERA 1UT1A 2W5PA
chains in the Genus database with same CATH superfamily
5GHWH 3D0AA 1IEBB 4DO5A 4L37B 2VDKL 4WEEA 5AUMB 4NC1E 3TN0C 1XH0A 5A6IA 5FKPA 4K9EL 2B8OT 2Y3NA 3T3PF 1U3NA 4PRPA 1U21A 4JL1A 2R9HC 1DBMH 3TCTA 2H32A 2AXFA 1HI6B 4JG1L 3VI4F 4Y9GA 3UTZA 1NPUA 1AG6A 2NY2D 4RAUB 4PJDB 4XI5D 2Z64C 4YL9A 4NP4L 3S35H 3ULUL 4M7LL 2BNRB 3N42B 4R7NA 4UILL 2FBRA 3KM2A 4YHZH 1FBIH 1WFIA 3SBWA 1HNGA 2IFFH 2E8YA 1M57B 3FO0H 1NAKL 3SO5A 3DV6A 3IFLH 3LPWA 5IQ9B 1HJBC 1NCGA 1ACYH 3KDMB 5BRZD 2NDGA 5LVEA 4OD2B 3FH5A 3TBVA 1ZEAH 1IQDB 5F9OH 5I1LA 4J2XA 1DVFB 1UCBL 1I4FA 2FYVA 2IBGA 3OAUL 3ZYOA 4ACTA 4JRLA 1O9ZA 4HZ1A 2RR3A 3PL6C 1TJGL 2E47A 3MVSA 2COVD 3RVWD 4WW1A 2HMIC 4X6BB 3CDYA 1DDHA 4KV5F 4NQEB 1S7QB 1I3UA 4LU5L 4Y1AE 4BFKA 4DP5X 5CWSA 3WUWG 5LXGL 1IGTA 4PV9B 4IRJC 2BCMA 1AZNA 5T5FH 2A9NL 2E74C 2P46B 4TXVB 5T5FA 1FL6A 1KY6A 5D4QA 4DNLA 1NFKA 4JKPH 4QXGH 1KULA 2CDFA 5D72L 1RZGB 1AGFA 3QJSB 3BAJA 4JFZH 3V0WH 4AVKA 3GBNL 1IGCL 1JP5A 2O5YH 3PQYB 3HG5A 4U1HB 5JW4Q 2AQQA 1WBYA 3CNKA 4PJ5B 2K7PA 2W65A 3H6AA 1MN4A 4ERSH 1MFAH 1U8PB 3IDIA 2HKHH 3FQUB 4OJCA 4AGQA 3HNTH 1CU4L 1NGYA 1YPZF 4BQCA 4MCYA 4QF1A 2PWDA 2AQ1A 1F6LL 1GW0A 5JHLL 4WI3A 3D3VB 4DKFH 3WOVA 4R4BA 3I6KA 2IO5A 5JTWA 4OZGB 4F33B 3JV4A 1PPIA 2EEDA 3EJCA 3Q43A 1ETJA 4OB5H 2VDMH 4KJYA 3OMZA 1MCWM 3K6SB 4XO3A 1CN4A 1NGQL 1FF5A 1SXCA 2C3VA 3I6KB 5ENWB 4TL4A 4RMTA 1A4CA 5DMYA 1E6OL 5E7BA 4L9DA 4U0QB 3GNML 5DK2A 4LNRA 1GGTA 1YEEH 1MCEA 2HMID 1NGPH 3VFMB 1IEAB 5AAMC 1N2RB 2ERJC 2NNCA 2O72A 4PJ5A 5C08B 1NL0L 1OAJA 3MZGB 3NACL 1RZJC 3V8CA 3M1CA 4JFPB 3VXTA 3VD2A 1AHMA 3NSFA 3B2PA 1I8UA 3H2WA 4JDVA 1W2KT 3SDCB 5DEGA 4J3OC 1MF2H 3H9SE 3SJVB 3US0A 1SJVA 3ZRSA 2AKRB 4PJ8B 3S88H 3MQIA 1CLZL 1MHCB 3IAPA 4Y4HC 5KVGE 1ZIAA 4QTIL 2BY1A 2CLVA 3QJXA 4CSZA 4DQAA 2UZIH 1U93A 4JQVC 4QO1B 2RACA 2XPZA 4L4VE 5JXED 1LQSR 3FT0A 4ISVB 4NNXB 5DJAB 3LPPA 4LE8A 5HYIA 3WFEL 2YFOA 3VGBA 2B5IB 4JPSA 5C1MB 1MHHA 3INUH 1N3NA 4HEPA 4Y16D 4FA8A 5C0FB 4CDHA 1RIHL 1IQWH 1ICTA 2AQ3A 3UZVB 4M6NL 2B9BA 4FQXD 4C4KO 2OXHA 3KDMA 3NFSL 4XNYH 4XX5A 4ESKA 4MNHB 3P2BA 5CFAA 1DN2A 1ADWA 3QQDB 1XR8B 1LWHA 2F74A 1FNSL 3NCYP 5AYUL 1T21B 5ITBL 5DZNA 1U2CA 2ZOKB 1NGZB 3GMQB 3C6SB 3FL7A 2ALAA 3FSOA 3MRQB 3AU0A 3OHXA 4PJHA 1MCCA 1IUZA 3OL2A 2K0RA 3L2LA 1NM4A 3KBFA 4LCWE 4M8VA 4ANUA 4E0RB 3MV8E 2NR6D 4NHUA 3SGEH 4NX0A 4J3OG 3LKPB 4HDIB 4A6YB 3UAJA 1KG0A 5F88B 3V4UL 1SBBA 4CSSA 5CMAA 3F64A 3T71A 2X2JA 4D9LL 3FS9A 4TSCL 2VQUA 3NN8B 4NZRL 3NESA 4B95C 2XBTA 5CEZL 5TPWL 5A6MA 3BIKA 5BCAA 1FNEB 1EAOA 3KPNB 2MQ3A 3RZCA 2MSPA 4IKNA 2N0MA 3NIDE 4P46B 2DTMH 1KPRA 1RK7A 3VA2C 1AQKH 2WAQA 4F8PA 2NY6B 1NCHA 3K2UH 4OSUH 1UWXH 1SMAA 2GBAA 4HAKA 2GIMA 3FRUB 2EE6A 5J06A 4TNEA 3QO0B 4GUCA 4KX9A 3OGCB 3DPBB 4FF9A 3NZ8A 4KTDL 1INQB 2W94A 3VYOA 2F2HA 3AC0A 3CFBB 5FYKE 4QHNA 1P69B 4MJID 4PY8I 3CK0H 2UWEE 4JKWA 3EG9A 3C6LD 5DYOB 1UG9A 5E8DH 4JRXE 5FO9A 1EXGA 2ICWB 5LHDA 1DLHA 1T4WA 1X5XA 4J8RA 5AW9B 2PO6B 5IG7B 2R27A 1QBMH 3RDJA 3D4YA 1O7DC 4RAVA 2C4FT 3ATAA 5L0QC 1I7ZB 2CUMA 1BVKA 1HVXA 5SWZE 2IQAA 3S36L 4AYEC 4CU7A 1J5HA 2YLKA 1XT5A 3OLGA 3BVDB 3ESUF 1RLBA 4H26B 4HKZB 2E6QA 1SXNA 3BP6B 3PGFL 4DUXA 5JHDE 2P8PB 3U83A 4G7YL 2QPSA 3DMMD 4DGVL 5DHVB 1OCRB 2CDGB 3EYUH 4KXBA 4IW4C 5D7JD 1F8TH 5DWUL 2BWIA 1O7DE 4JPIA 5CJOH 2QFRA 4C56A 2AS5M 3QDJE 5AL0A 2RMNA 3U1SH 4A2HA 1UXWB 4JE4B 4N9GA 3U36A 2ESVD 4FHBD 1H15A 2ID5A 2VDQB 3C75A 4MTMA 1S9YA 3ETSA 3UIYA 4PP2A 1FVEB 2KZWA 4PJAF 2NQCA 3WIHA 2OW6A 3S5YA 4D94A 3CQFA 2LTQB 4HU8A 5I1JH 4PJEE 4M6MH 5G4MA 3KPSD 4K5PA 1UURA 1MHPH 2AI0H 3SOBL 3VRIA 4MCZB 4P2OD 1HC1A 2GK0B 1CGSL 1IBGH 3GGWA 3KLAB 1YZZA 3L3OC 4FQCL 3FQRA 4HULB 2KZBA 5F6HJ 1SJMA 4EO5A 3IU3A 4OLWL 1UWEH 3QWRA 2GTWB 4P4RB 5HI5C 1NLBH 2UXGA 3DUUA 2Y7QB 2XX0A 4IOIA 1DQQA 3P0VL 4XVTL 4JS7A 3IETA 3EGXA 5K9KB 2IH3A 2EYSA 4C54A 4MX7B 4NENB 5IY5B 1EHLH 2F1BA 3LZNA 4HS3B 1XF5B 2YA0A 2D0HA 3RVUC 3ZTJG 4ZNEA 1FZOB 1PJWA 1S7VB 4PUBH 3VYNA 2GCYA 2AQNA 2YAMA 3QXDB 5T1LB 4XVSL 2GJ6B 1PKOA 3IRPX 3IFPB 5F0MB 3TCXA 4PJ5E 4U6YB 3ZKXC 2JB5H 3WHXB 2FSEB 1ID5I 4LZKA 3SD5A 3EIFA 3QS3A 5F7FA 3SOTA 1P6FA 3BP5B 4FQLH 3CH1B 4YZFF 5CJXC 4PJ7E 4E9RA 4ZW6A 4N0UA 3RZCB 3HN8A 2ZX5A 1F2QA 1EXUB 1FNEA 3IF1B 4G83A 1LL1A 3O41A 2WXGA 3P3YA 4H1LA 5HDLA 3RG1C 3MODL 3DJZA 2R1YB 5EO9B 4HOWA 1D7BA 2N0KA 3MDJA 4Z9KB 3M6DA 3EH2A 1GGUA 3EKCA 1OW0C 3U6XS 5EF2A 1WAEA 4KHTL 2CJUL 4HS6B 2WP3O 3F58H 2VZ1A 3UCRA 3KXFE 3P30L 1SF5A 1VA9A 2D31A 2YEZB 2QQNL 3O9WC 3PGCB 3PXJA 1AP2A 4MD5A 3BCDA 1E42A 5LBVA 3ZSSA 1MCIA 4P23C 1FGVH 4QRPD 2OJZL 4LB8A 3TO2A 3GIVB 3SYPA 5IESL 2UVFA 3OR6A 3A6BH 2YRLA 4PSPA 4HUVA 3K81A 1U8KB 3EJUA 4JY6A 2R51A 3TWYA 1PCXA 1RZKL 1MNUL 5EZPA 2WINA 1A7NL 5GISL 1LD9A 1ZLVK 2DYRB 4B60A 1JSYA 2MCG1 4LLVB 3C5JB 4UM9B 5DRXB 1LO3H 4CRPA 4LRIA 2VW6A 4WFED 1OSEA 5DQ9B 4YDIL 1PW3A 5KW9H 4A7GF 2NSMA 4MYPA 4C47A 5I1IH 3QYNA 3E1ZA 3ERXA 4MASA 1T66D 1TYRA 2OTWA 3FCBA 1ZV2A 5CBAB 4K5OA 2YK1L 2YMXH 4BQ6A 2BZDA 1ZY9A 1XCQA 2GABA 4K0OA 5BRPA 1H3GA 4JHBA 4LAQL 4NFDA 5EWIL 3AAZA 3GNMH 4PHXA 4NGHH 3CHRA 3AQZA 1UJ3B 1M7XA 4JG0H 3IMVA 3AB0C 3STZA 3FHEA 1F56A 2ZYIA 2C8NA 4IHBA 1KGCE 3GHBL 3TA3B 4NUPA 1UJTA 4K2UH 4XWOD 3K0WA 3ARQA 1FAIL 3KWWB 2UXFA 3QSKB 5DRZA 2DB8A 4HFWA 4F7MB 4NO0D 3WXWL 3EF4A 5E2JA 4Z3IA 1XGRA 3Q48A 1KPVA 1YPZB 4ODTH 3DK2A 4QTHA 3GLZA 2FATH 4NO5B 4PJFB 3MBXH 2X0WA 1IM3D 4G72B 3D2TA 4XN7A 1F45A 1WBZA 2AABL 3N43B 4XPTH 4IU2B 5DS8B 4N25A 5D7IF 1QO3A 2DQHH 2G0LA 2P24A 1IARB 1Y6MR 1IAOA 3GINA 3VX1A 5FO8B 3TESA 4WTWA 1IGIL 4XB3A 2FJFB 2V8MA 1P5UA 5GJSL 5EU4B 4EBQL 3AG2B 3CDZB 4R4BB 1H6EA 2BNQD 4NKOA 1EHXA 3FT9A 4R0LC 1OF2B 2VLKB 3KPLB 2IH1A 4DQOH 1EAPA 1VB9A 1G9MC 1Z3GL 4M1CD 1TFHA 4X50A 2OFQA 4N5EC 1MVUA 1ASPA 2H1PL 3OR7B 2XTSA 5KJRL 2JCCA 3HAEG 3W3BA 4CMMA 2CBPA 2NNAA 2V3FA 2I85A 4NPKA 1H0DB 4PJIF 3RNKB 1MJJB 1TZGL 3SPVA 5EEYA 4KU1A 4F37F 1KLFA 4AJYV 3NZHH 3TTSA 2ROYA 1L9NA 4HYTB 2ZKXA 4NO0A 1T83A 2FWOA 4P59H 3JQOB 3SPVB 4KMQA 5GGUB 4U4IA 1PSKL 2XTJD 4RIRB 3VYPA 5I24A 1YN7A 3DHMA 4Y1AB 3N5AA 5L2KB 3HR6A 1LO0L 2VXSH 3ARDC 1LEKA 1E4HA 1ZK5A 4NQEA 5FA4A 1UOKA 2O6EA 3ECUA 3MUY1 5DR5L 1HAUA 5IJCC 2CHNA 5AB2A 4GG6E 1BLNB 1MFEH 4L3EA 5ETUB 2E7HA 4FC3E 4NZUH 3MRDA 1P5UB 1FVDA 5LGJA 3AREA 4M8UA 1IQDA 3RY6C 2JV6A 3RGVD 3W1ZA 4AGNA 3FT2B 3P3RA 2DW5A 3GUTB 3RAJH 1Q9OA 3GK8H 3LIZL 3UTSD 3DX1A 1E4JA 4NAQA 3DLQR 1FO0B 2E27L 2ZKYA 3MYZA 4JZJA 4PRAA 4A2MA 1V05A 2WXRA 1SJEB 4PJBF 4D2NA 2CHXA 2L7UA 2QQQA 5I1CH 4P49A 1XF4B 3FUEA 4HIEB 4HWEL 4EUPB 4QCIB 3EHBD 1N59A 5EF3A 4XWGH 3Q6FA 3GBDA 2R1WA 3VGDA 1NUFA 1TQCB 2ZG1A 2EDHA 1OAKH 3CVDA 1RULH 4QOKA 3CFEB 2NDFA 3OAYK 4NDMB 5EBMA 2X6MA 4AUUA 4DK5A 1QZ1A 2VDPL 3KYKL 3QUMB 4HWZB 1JFQH 1JYNA 3WJLC 1ROCA 1A7OH 5GGQH 3FMGL 4P3DA 2MQGA 4N90E 1BBJA 4LASH 2Y5QA 4GAJL 2A73A 2Z31B 4X9BA 3ZDXF 4PD4K 3DIVA 1BQHA 3Q9PA 1P5VA 2Q8BH 3RE0A 4D0CB 3Q8FA 1OSYA 5AD0A 2YJLA 4XB8A 4P2QB 4YHOL 4ZZFA 4HJSA 3WN5B 1FORL 1NIDA 1SHXA 3I9GH 5D1XE 1AFVL 2O93L 2VLMD 4NBYB 2FUTA 1JVOA 2OS7A 3QPXH 4YK4B 3OSKA 1EGJA 2VR6A 4X5LA 1J5DA 4R96B 2FSDA 5GGSY 1NFDE 3ZMNA 5I0YA 5D1XD 4MA8L 2Z8WC 4FQIH 5FW6A 1MLCA 3Q3GB 2W07A 1PFOA 1Z32X 2BY0A 1K4DB 3P0GB 1FFOB 5KS9A 1UYWH 2F7OA 3MRMA 3NDZE 4KQ3H 3V7AE 5DA0B 3ZOAA 3E3QC 4OTXL 3TYGL 1P6WA 3QPQC 3DETC 1AXTH 1E4XL 1TKWB 3GXIA 3ILQC 3K74B 3O6FD 4JM4H 3QZWG 1G7HA 3RFZA 4BE5A 1NLBL 2W9LA 1CLYH 4BA0A 4F7TA 4PJCF 5TQ0H 3BZFA 3BH9A 1I3RB 2AJZB 3VWJA 5HDRA 2IWFA 4G43B 1TSRA 3ZDZB 1W8NA 2ITFA 2VISA 1UM5L 3D05A 3L1EA 1L5GB 1U3HD 3FT4B 4UQ3B 3RWHB 5JW4N 2EIZA 4RRPM 3LQAL 3MJ8B 4XX1E 4BWUA 3QW9A 1ZWIA 3O45B 4XN8A 3UPRB 4HJGB 4A67A 3TGXA 1JPTH 4K9JA 4HZAA 1INEH 5DO8A 1DEDA 2HCZX 1I9RL 2Q5BA 2WBJD 2YOAA 1I9JL 1XX9C 4GSDL 3FOMA 4UOZA 2NXZD 1IV8A 5FGRA 3IDXH 2HKFL 3BSZL 3O0RL 5AQ0A 1KIPA 1JF1A 4LLYA 3KBHE 2K6WA 3TBWB 4XBEL 3SDXE 2W0FA 1SJHA 5C2BH 5I1AA 3TASA 3QUXA 3GI9H 5E24E 1ADQL 1YNLL 3VXRB 5CN3A 4H1LG 1RK0B 3R18A 1UM4H 4LGPB 2UWEF 3TFKC 4N90D 1UZ8A 4XBGB 3X13A 5IJBC 4C59B 4U33A 4F5CE 4KHTH 3QZPA 5ISZE 4POZD 4ZMZA 4XN1A 1LO5A 1RZQA 4KK9D 4OCSH 3NCJH 3B37A 2P24B 3X1GA 1NCDH 4CDGC 5ID1B 3E2HB 3SGDI 4KY1H 1NSNH 3U1PA 4HWBA 1B2YA 4AL8C 4POUB 4QLWA 3BXNB 5I0XA 2W91A 3MMEA 1HHIB 1P4LB 2AXWA 2A38A 4Y4HB 4I18A 3V52L 2PTVA 4GP4B 2J6EL 3IRCA 4GO6B 5F3BA 2G5BB 2NNRA 3L1FA 5DHVH 4I48A 2XN2A 3TNMB 3ZTEA 5JOFA 3SCMC 2MPAL 3MFGB 1QA9B 5C0NC 1A4AA 3D4GA 4EOWH 2FIKB 3TT1L 3WIHH 1WD8A 4RAHA 4ZDHB 3FYIB 4PRBA 3M17A 2P8MA 3UADA 2JTYA 2A5UA 1FPTL 3MUGA 2P5WD 4JFXB 3MV7E 1G0DA 5FR3A 4PWEA 5D7IA 2VL5A 2ZSVA 4LCIL 2H5UA 3K3QA 1OP5H 2XFXB 1EXHA 1A7RH 2XA3A 4WFFE 5HSFA 1V10A 1CDGA 1ZLVH 5IW6A 2I26N 4G42B 3MA9L 2EKJA 4HFUH 4TQPA 1ULVA 4DKDC 3ETBF 2R83A 2I9TA 3LNHA 5DU7A 2WQSA 3QDGB 3BQUA 2J3SA 1N0XH 3VH8G 2BXYA 3UO8B 1U8KA 1JTOA 1PY0A 5EHFA 4ELMA 4WI9A 4NHCH 1RAMA 4DZ8A 2KC0A 1IIIA 2AABH 4N1EA 4RMUA 1BG9A 3VVVA 1JGUL 4FFZA 4O4YL 4I5BA 2BZCA 1DBKL 1G0YR 3PGCA 4MD5B 5CP3H 5HBBA 1OAXL 1Z9SA 2K70A 2ZSWA 5GJTH 1R3IL 5A2FA 3CDZA 4JQIL 3L3KA 4PJ9A 3TLRA 4F9PA 3JTSA 4AQEB 1TTBA 2CO2A 1HT6A 1YEWA 2CLRA 2EH7L 1IAOB 3NN8A 4UTCA 5FO8A 2IPTL 3QEQB 1FGNL 4RWHA 5CMAB 2EDWA 1MIML 2X7LA 5CJ5A 3NSYA 1E8ZA 1RURL 3PWLB 4RGNB 1KFGA 3GI8L 4GSQA 4U0RB 1BMGA 3IF1A 5C97A 3WEAA 4KDVA 2R0KL 2OCFD 1GGBL 4Y5VA 4LPYA 1UOVA 3HAEH 4P0DA 3RVXC 5D5MB 3FTUA 1KCLA 1QKZL 4EI5D 2ZUXA 1QBLL 4LL9A 1PZ5B 5HI4D 2WWOA 1QUNA 4LNVA 1GGIL 4GNKB 4HV8A 4OQTH 5CJBA 2LFGA 5T1LA 3MRCA 1N6QL 5TE6L 3Q1SL 2K8QA 1UJ3A 3OAYH 2GSIA 2ICEA 1LO5B 1AKJD 3FU8A 1JDDA 3KXFB 4TVPD 5GGSA 3WDIA 4G6KL 3BEWB 4Q89A 2X87A 5HHMB 2OR9L 5E6ZA 4M5TA 5HGHA 4BWTA 5K9JH 2VE6A 4KI1A 4GQQA 3GGWB 1KENL 3W5NA 3TH2T 5DZPA 5KVEE 3HE7A 5J89A 3FHQA 5HGDA 5HHQA 4I89A 1AIZA 1T0MB 4KJPC 4PRIA 1MFNA 5F7AA 4TTGA 1T89C 3QXVA 1KJ2B 2W88A 4LIQL 5F89B 1ET7A 3UEQA 5G5DB 3U4KA 4DZBB 3LHPH 4ZW5A 4JFPA 4JO2L 4I1PA 2VN4A 4KKBD 4XWGL 2NX5E 1I8MB 1EV2E 1ZWIB 5F6HI 1WHPA 4IBLT 2IGLA 1HCFX 4BM7A 1QSED 2XFXA 6CGTA 1K5NB 1UFGA 1VESA 5IB4B 2DLTA 3F00A 1P7KB 1TOXA 2ITEA 1BFOA 2VDMB 2QZ5A 1CT8A 4OZHE 4GP5B 3DRQA 3R06B 3O8XA 1QATA 1NEZA 3H9ZA 3QXWA 3EO9H 4KKCD 4Z7QF 3N55A 1CGXA 3ESNA 5F7WC 5MEND 4OZGA 3EJJX 4P05A 4F33A 4UQBA 1NIAA 3CFIC 3T0WA 3D3VA 4Z7WE 2IG2L 4KVPA 1SPDA 4BH8B 1TSHA 4PJGE 3BP5A 3LXUX 4JX0A 1U8PA 5J7CC 2DWYA 1B9KA 1F4HA 3X12A 5INDB 2WO2B 4LCCC 4ALAL 2VZ3A 3Q3GA 4G6ML 4M62H 2QVMA 4PCTA 5CBEB 2HT3D 1OL0A 1QWUA 3P3SA 1NPJA 3QIBD 1KJ2H 5DJDB 5E5MA 5E6SB 4E9LA 5JIPA 3W38A 1JI1A 1WA2X 2HFGL 1OO2A 2CO3A 3B6SB 4OLXL 5HHQB 3MOQA 3UBFA 5LXGH 3MFFB 1PTZA 2KBGA 2UXTA 4LESA 1NKRA 2AGJH 1G7QA 1TQUA 1X6NA 1BZEA 2JKNA 2RA1A 2RHEA 4I3SL 4N2MA 5T1MB 3W11D 1VFMA 1NIEA 5F0LB 4I2XB 4Q4EA 3MRNA 3WIAA 1Q9WA 5CHNA 4Z6AT 1EJOL 4QRPE 3FNKA 4PI2A 3FB7A 2SODB 2WVVB 5DMIH 2WBJC 3B5GA 3PFUA 1BGXH 3LKNB 1ACXA 3MXVL 2UY6A 3I6SA 2G3NA 4GAAA 3QFJE 2P8LB 4N9GB 4AYID 4ORGB 5I6PA 2KPNA 2C1PB 3UTPD 4MD4A 4Y89A 1XIWC 3NIGE 3DO3A 3VU2A 1RPUA 3UPRA 1M6OA 1KGIA 4F27A 3GXDA 2EIZB 1FUNA 1DBJL 1OF0A 2HFFA 4Z7VA 5HPMB 1NCCH 1JMZA 2BLFA 3VFGH 2AK4E 3HBGA 4NKMB 5DEJA 2G4EA 1FO0A 1HXYB 1DDTA 1KXTA 4N0FB 4YHLH 3W5MA 4N28A 5E2WL 5EZLB 3PREA 4O2EB 4N4YB 3QDAA 4L5FH 4NLAA 4RMSA 1ZDSA 4XXCA 5J6HB 4EVNA 5LBSA 4Q9CA 1B0GB 3JWDH 3QULB 5ABDE 2CQVA 1MPAL 1WDAA 2GBTA 3L9RA 1TKWA 1K8DB 2FLMA 2FT8A 2JWYA 3QORC 4KROD 4R7XA 5K1JA 1DLHB 1MELA 3BGMA 1H3PL 1KGCD 5E56A 5FA4B 4ISVA 1O5PA 4RSYA 1CDBA 2Z1KA 3FJTA 1NUNB 3AMLA 1HFUA 2ED9A 4OF7A 5H37A 2A0LD 1VCAA 5D7LA 3ASNB 4PVBA 1PLBA 5AKVA 1J1OL 2GW5A 1VFOA 1DYZA 1UGKA 2UUDH 4HLJA 3CSBA 4AMKH 2LAGB 2ZWYA 1G7PA 4TQ8A 4OLVL 1OGTA 4FTVD 5D4JA 1QPXA 2YRPA 3DOHA 1GW6A 3S3CB 2FT7A 4TTDD 1S8DB 3QIWC 3QJRB 5AD0B 2WXPA 1YEEL 4JAMB 4FZ8L 3VGHA 4OBSA 4FMVA 3QWOA 4RMBA 4QHLA 2I9LB 4MB5A 4YO0A 3AWEA 2PXYC 5KSVA 3KPNA 1KCRH 3H7BA 1JK8A 4P2QE 3GPEA 2LLLA 2Z7UA 1CL7H 1FSKC 1FNSH 4HWZA 2WQWA 3AWFA 4AQ1B 1MF2L 4ZDHA 4XN9A 3L1OH 3S88L 2B2XL 3E9TA 5C08E 3L4UA 1QI5A 3VXSD 4HIJB 1PD1A 2VQ1A 4DUVA 4MNGE 3DDGA 1N8ZA 3CWGA 1NMCB 4AVHA 1TMQA 4MS6A 1L4IA 3BZ4A 1MDAA 3CFQA 2OYLA 4Y16A 4UV7L 5M7QA 2QSQA 5B1JC 5GS0H 1T21A 3JWDC 2ZT9C 1W15A 4MHHI 4XC3H 3BXNA 3O2VH 3QQDA 4TKWA 4MNHA 1KIRA 1A4KB 1SXSA 2N01B 3OLIA 3TA3A 3ZE2F 4KRMB 2EDMA 2G3XA 4W9EC 1W6WA 2AV1A 2E5EA 4D3CL 5JPNB 2JQZA 5F1IB 3OMIB 1T7XA 5E2UH 4QRSA 3IMRA 4LDLB 1F97A 1TNMA 1T66C 2IJ0C 2O1AA 3MNMA 4G9DB 4LKXA 4MNQA 4XNQA 1NCJA 5B39B 4IMKA 1WPCA 3MLSH 2PPEA 3UAJD 4YLQT 5KYUB 1SLUA 3AROA 3GJFA 5B3NA 2ITDB 3EYQD 5KTEL 3OWEA 3WAJA 2PCXA 1K6QH 3V7AG 2Y2WA 1BVLA 1B6UA 4PJIA 3TBWA 1T2QL 4ZG1A 2R0KH 4O2FA 3QZWA 1L9MA 5ESQA 3FW6A 4QYOA 3RDTA 5CIPH 4R2GB 3RLSA 1KIRB 4JDVB 1XVSA 5KAQG 2HLAA 2NY5C 1MREH 4QT5B 3WCYA 3Q2NA 3K4ZA 5D71H 1GGIH 4P2RB 2VSKB 1MRDH 1RSYA 1GCYA 3OR6B 2JK5B 4JFDE 3CMGA 5DQDL 3DJSA 5DURB 4AX3A 3GSNB 4Y9EA 2MOQA 5DJ8B 3OKOB 2P47B 2CO4A 3GBEA 4GBXA 3S3SA 3QA3B 1DUYB 4Y4FA 5F1SA 1QFWH 1UD2A 3L4XA 1EAQA 5JUEL 1ZPLA 2D73A 3Q2CA 4HS8L 4EQ3A 3WE6A 3PJNA 1PEZA 4XOBA 3HZKB 3THML 3UGXA 1A1OA 5F7BA 4ZXBC 3DXAE 4TSAH 2HFEA 2BRRL 1MWAA 3C5ZC 3NIFF 5AUMA 1NC4D 1IEBA 1A6ZB 3C12A 5FUOL 5I9QB 2V17L 2P4AB 5ICUA 2BFVH 1H5BA 5KS9B 2QPUA 3QE5A 5E8DL 3N0PB 1FG2B 1Q1JL 2AAVA 1IGMH 2VJ0A 3ZKSD 1KBWA 4ELDA 5CGYD 4JHAH 4M5SA 4ODUB 1TO4A 3PQYA 2ZWZA 3L5JA 4DW2H 2WUBL 3HUJF 4K3DH 4F7CB 5B8CC 3IFPA 4Q7DA 5C07A 3VXUE 5I16B 5IW1B 1U58A 5ITFA 4PV8B 3STZB 2DYPA 7TAAA 3B34A 4D0BB 4OZFH 1A65A 2N1KA 4PTTA 4ODVH 4WUKL 2GY7B 4H8UA 2AK4B 4N8UA 3DIFA 1S7QA 1LE9B 1FYTA 3FQ1A 2W80C 2XX1A 4NI6A 2VZOA 4Z77A 2P9RA 4N2IA 3S34H 1K8DA 3IU3B 4M29A 4YDLB 3F7PC 3GXPA 1UOWA 5AVXB 3VE0A 3QULA 4MCZA 1RPKA 1ZT4B 2JIXD 1CF8H 3CFCL 4NKIL 5J6SA 2CBOA 3HG0A 4GAYA 3HUJB 4MB3A 1JNHA 1QRNA 1RZJH 5IQ9A 4JR9H 1N8OE 1N59B 2VMDA 4WRLA 4R2GC 2XBZA 3DVNB 2XTLA 4X99B 1ND0A 2FL5B 5GS1B 1VEOA 4GQ9L 4J3WA 2G3MA 2ZP9A 4G8AC 2EEBA 1N18A 3O81A 3TV3L 1E4XI 4O02B 4BBWA 1NFDA 4D9RE 1ECZA 4KI5C 3GBML 2PW2B 2CH8A 4J28A 1NMBH 2P8LA 4I0PA 2EH8L 1DZBA 3KWXA 4PMFA 3GUTA 1UZ6F 3P30H 2ZXDA 3VFSA 4ZT1A 1QSFB 3NJJA 4PJXF 4GIAA 4QRTB 1HHGB 3L2NA 1CICC 4CBZA 4BZYA 2C9VA 5C0RL 5ISZD 1UT1A 1WWCA 2YOCA 5ACZA 5K69A 4JW3A 2BJML 4L3EB 4NCC2 1NGWA 2EXSA 4U6TA 4CC1A 2VDNB 1E0OB 4MD0A 5EBWA 4GRWF 4O00A 2ZNXA 5DLLA 5SWQB 2ENQA 2YSSA 4BUHA 3GHEH 1LWJA 4IKJA 4ZFQA 3WN5C 4XHJD 1UWFA 3H54A 2DQEH 2CK0H 3DYMA 3WHE0 4HA1A 3RGHA 3TBTB 4KVNL 2ADIB 4NO3B 3WDHA 2MIZA 2EE9A 1XB8A 4DP1X 3FRPG 3BJLA 1OHQA 4HG4K 5ALBH 4HOZA 2EEXA 3X1FA 2H8PB 5CBEA 2NNAB 2VN7A 3S6CA 1FZKA 2D7TL 2OMYA 2CLZA 3B9KD 2HRPL 1ZVYA 1HS6A 4UNUA 5J6GA 1SNRA 5D93B 2VXVL 3TYGH 4B9JA 2N4IA 2DQGH 4PWKA 4XE0A 3ZSTA 3IDYC 4P46A 2Q6WB 1WZ1H 2YSSB 5IBTH 5DCCA 5T3ZL 2WXHA 4YK4C 2GTWA 3O2DA 5GRXG 2HVJA 4OV5A 4WTZA 2EVFA 5E08L 3FB8A 3P9MB 1XD1A 4M8QB 3D2UA 4F7PA 4XAKD 3BI9X 5I18H 5I1DB 3WKQA 4M7ZB 2P5WE 4S1SH 1QO3B 5EOCL 3M1BB 3AACA 5I6XC 1QFOA 1YUKB 5CGTA 3TN0D 2DDQH 4DTGL 2FNBA 2VDOL 2B1OA 3STLA 3P02A 2AXGB 3L9EA 1ODAA 4Z8FL 5C0DA 3L4YA 1NBCA 4RQQA 3GSWA 4ETYA 2KKQA 4OLVH 1T4KA 1LEGA 5SWZB 1C16B 1P84J 1DSFH 5GSVA 1I8KB 2F74B 2AEWA 2QMJA 3BP6A 1ORSA 1EQWA 4K9EC 4NWUH 4ETQB 4U1MB 5JW5A 1QSEE 2Q8AL 1L9PA 4MMZC 1BJMA 4R84A 3V5DA 3U48A 3DGDA 3WMSA 1OOWA 3ZZSA 1JD7A 3RVVC 4N9OB 4X5XB 3WD5H 4JMXA 2IFGA 2K3HA 4KKPA 4AV5A 2R7EB 3HG4A 1LEIB 2QVFB 1RUMH 1VRSA 3REVB 1NBVL 4JFFD 4Q9QL 1R5IA 3KXFA 2V2XB 4HD9A 1KT2B 3NCCB 4PTUA 3RY4A 3SE3A 2K4AA 2HLFC 4RGOL 5JPMA 2DQTH 1ZGLP 5KVFL 5DVOA 4N85A 1WE5A 5PAZA 3NPZB 3N43F 4ETQA 1IM9B 3FTXA 3OKLB 4L5FE 3HI6L 5T1DL 1W0WB 4HKJA 1FC1A 1E8WA 3QEHA 5AENA 5EORH 3O2VL 3TO2B 4R5XA 1QHQA 2BW5A 3HHMA 1M3IA 1HCZA 1AIFB 2IGFL 5KG9A 2XOTA 4RX4D 1Y18B 1FNFA 1YEGH 1XSOA 4G8GE 1CGSH 1XH3A 1THAA 2E27H 1JTTA 3N1FC 5F7NC 4G8IA 1ZIBA 4R7DB 4WFGE 1QQDB 1AHWC 4QR7A 4TVPE 3MNDA 3MRRB 4FCAA 3CVHB 4PJHF 4KNTA 4R0LB 3MJWA 1XH3B 4F91B 2D4DA 4FQHB 4NN5B 4Y5YA 4YXKH 1P9MA 2E4TA 3L3GB 4LVHB 2W1NA 2E7LA 1MY5A 1J5CA 2EXYC 4CJ1A 3PDDA 1ZTXH 1RULL 4OFVA 1XCTA 4GRLD 5AVWB 1G6RL 3NCXA 3GSQB 4H20L 3F6IA 1IAKB 5DR5H 3VWJC 4PWJA 3NCMA 2HKAA 2ZOKA 2VTFA 3EH3B 4H0LC 4IK7A 4P2RA 3NFPB 4Z7OB 2RCSH 3OKLA 1V3MA 4GRWH 1S9KC 4YVUA 2WQAA 3ZT7A 4Q9BA 1QFWI 3KS0H 4AY0A 3LZFH 2R23A 5KANI 5I5IA 1UXSB 1XF1A 1ZT1B 3KHOA 3V6ZA 2NY4C 3CFDB 4L1TA 2ERJB 3HBQA 4JKLA 4PAZA 3LDBC 3PE9A 4M4RB 5EO0A 3RVTD 4BSWA 1TQBC 2EEAA 3SPGA 4S1DD 1AD9A 3N41F 2GT9B 2Z91B 3JWNH 4H88L 2GEEA 2FR4A 3B7YA 4L4TE 4UIMB 1JWSB 2DWTA 3QJUB 4QRUB 3QQ3A 3ALWA 3KAAA 3DKHA 4XXCC 1JHLH 1UD6A 2OQJB 5I0DA 5GRJL 3IFNL 3E1F1 1FG9C 2AV1B 3G04A 4HMDA 1OVZA 4JB9H 5BZZA 4LLAA 1ORSB 3S0PA 2VDQH 2WBKA 2IDFA 2H45A 1PLGL 3DV6B 2EABA 2BSSA 4LSRH 4OLYH 2XZCL 1OPGH 3HPJB 3GMOA 3MV7D 3SZ6A 3B7RL 5J9PB 4PHZA 2XWBB 2XZZA 4TVPL 3NPSC 4ZMAT 3BKCH 2WGXA 3FO2A 2NTFA 3ARGA 4XMWA 4E41A 5IVXE 2D4FA 3SQBA 3WS3A 4YDKH 4X2UA 3VD5A 4GAYB 1X4XA 3D5OF 5BO1L 2WZAA 4MBOA 1EGJL 2ZOWA 4L3EE 4JFVA 5CEZD 4K7FB 1ZA3B 3O3DB 3FUFA 2B39A 3FO1B 1UB5A 3OZLA 3UDWA 4W6XB 1QR1A 4OGYH 4PV1C 2A6KB 3H42L 2WKOA 3MV8D 3SDDD 4AC4A 2R8SL 1DEEB 1ZVNA 4AVIA 4HXBL 4PGEA 1FV1B 3FYEB 1JZEA 1GTNA 1BQLH 3ZKMC 4K8RC 2AK1L 4C56D 4F8TA 3WTSA 3DX8A 3ZL4H 3V9FA 5DDHA 4XXWC 4AXWB 4KHXL 4UZGA 1DBML 4XPHL 4CN4A 3H8NA 1OLLA 2FX9H 3QZMA 2AANA 2MNJB 3GBMH 2V9TA 2LR4A 3MGAA 3RFRA 1HJCA 5DC2A 2Z92B 3NJLA 3O3UN 4NT6A 1V3LA 5FO7B 5SWQA 4UI2A 1E5CA 3IJ8A 3QJTB 2Z93B 4UQ3A 4NB7A 4E42A 1S9WA 4MXQC 4X6BA 4XP4L 3BPOB 3GEFA 3O3EB 4YDNA 3GSRA 5I75C 4HPOH 2Y69B 3L9RB 4G43A 1ZS2A 4XMXA 1O5DT 1EBPA 4YS4A 5IJDC 2XYBA 4HEPG 3U46B 2QPFA 3VFSB 1CXFA 4OJYA 1NIBA 4A6YH 1F6AA 3C60A 3MBEA 1ZV9A 1QEXA 1AYRA 2BNUA 2I24N 4NIYE 3D09A 5KJRH 2YKKA 1E9OB 3CPLB 2WNXA 3BVVA 1TQSA 4LMQE 4EOWL 3V4PB 2FK9A 4GJTB 4XMPH 3UTQA 1YNLH 1XGQB 4HG4J 2ROXA 4AITA 1CXEA 3BIAX 4W81A 1P7QB 4F8LA 2R2HB 2A9NH 4HJ1A 5A16A 3KPRD 4DVBB 1QRNB 1RV6X 1S2EA 1TPXC 2QELA 3ISRA 5I1HL 3MOBH 1RUPL 1OGAD 4EJ1C 4BUGA 3WNJA 1OCZB 4WV1A 4PRPB 5TF1H 2Y22A 3BZ5A 2HRHA 3W39A 2BIMA 3B2UC 5DHYB 5BZWB 1VACB 4W6YB 4Y88A 2NY0B 4XCCH 5I76B 4LSVH 2WSDA 4RDQF 1ES0A 2PF6A 5E8OB 4OCRL 4EXKA 4TRPH 5B3JF 1Y07A 1VEPA 4WO0A 5JIIA 4NZTH 2HWZH 3S35X 1K3ZA 4IS6A 2A9AA 4ZOAA 2BWDA 3ZQXA 1T7ZA 1KBPA 1GGCL 5CJQH 4KJQC 3RBGA 3WKML 1NBZA 4PJ8A 5SWSB 5J11C 2Y7NA 1RLWA 3OQ3B 3FB5A 4U7KA 2J7LA 1J9CT 4K8RD 4R4ND 3HR5B 1DVSA 1RKRA 4PU2A 2QGEA 3DECA 5DEZA 2FQDA 2R1WB 5E5MB 1WWBX 3ILPB 4LSSH 1KN4L 1UKTA 1H5BC 1OV8A 4HIEA 1F86A 1IT9H 3LKRB 2WKGA 3VGAB 4PGEB 3SE4A 3X12B 3NA4A 5FEBA 3MACH 2J72A 4JFTA 4DGIH 4NQUA 2GBVA 4N2DA 1U8QA 4XVUC 1JZ8A 3P73B 2YBGA 3GBLA 1UD5A 5FM5M 1QR1B 1NL0H 2PWFA 1X5HA 1JFQL 4PWGA 1W0VA 1ZLWH 1J5IA 1T3FA 3HG1D 3D39B 4FZEH 5IVNA 2DWEA 5HJGA 3ZDYE 1R17A 5CD3A 1RUML 1CFQA 4HHAB 3NVQA 4ZYKB 3CX5J 3MV11 5I17B 2DS4A 2QQLL 3CXHK 1SBSH 2TSAA 5LNEA 4G9FE 5BRZB 4E2OA 3FO0L 2EACA 1OP5K 1HESA 4FG6C 3D0LA 2PCPB 3MLZH 5FDWB 3EFFA 2I07B 3FFCE 4BUQA 3HC4H 1OSZA 4L4VB 3ARVA 5E9AA 1P0SE 1PD0A 3VXMB 4P9MH 3BUTA 3HI6H 2NLJB 4QXWA 2WUCL 4U49A 1A5FL 3CDGB 5DRWB 2JI3A 3B1TA 3ZUNC 5A1AA 3BPCA 4NQED 2NY1D 3GD1C 2J25A 4K8RL 3BFOA 4OF0A 1HHKA 2DWDB 3BPNB 4N26A 4A7GA 4G7VL 2B1HH 1AGDA 4NI3A 4R4NC 1AGCA 2H2PC 3CFKB 4V1DE 4U31A 3R8BB 5K9JL 3F5WB 4KJQD 1MVUB 3OR7A 3CHQA 4PLJD 4P5TA 2KHAA 4B53A 5J13C 1MFBH 1KV3A 4YHMH 4A39A 4GG6F 2V6HA 2DMGA 3RWFB 3G6DH 2IH1B 2F54B 5T1KD 1DDHB 4J27A 4E41B 5JLZA 3PQYD 4YHZL 4ABWA 4MDJB 3EOTH 1Q8MA 3IDMA 3U4EA 3LKSB 1QG3A 2D2OA 4I7ZC 4CJ0A 1V54B 4OQTL 5JPNA 3IM1A 3VD0A 1MW1A 3HBPA 3IXTB 5GS2D 3SDXB 3ATFA 2F19L 2I60L 2KPWA 3D3VD 4XVJL 4YSRA 3AXHA 1KYOJ 5ANMA 3H0TA 2VNCA 1J8HD 4WHYG 1LILA 2OZ4A 1DSWA 5I6XB 4G7YH 5IB3A 2Y6SC 3BZEA 1WT5A 5EOTB 4H4NA 4UV4L 4MD4B 4WUUB 2OI9B 1J9QA 4XBEH 3GMNB 4GI9A 4RNRB 1FWXA 2VQ1B 5C2BL 2VN6A 3B5HA 3WIIH 2JTDA 2XWJA 2D2CC 3ZBMA 4F9LA 4CN6A 2QJDA 2CU9A 2WVVA 5I1JL 4LIQH 5D7IE 2EXWD 3AAZB 3MPCA 3MJ9A 1TUPA 2FUQA 2QSTA 4OZ4B 4X6DB 2E4FA 4YGVB 3FFCD 3CN0A 4UMGA 1J1PL 4IJTA 4AYFA 5JDSB 3H7BB 4QAMB 3WTTA 4OZIA 3G5ZA 3FO9B 4N0YH 1Z9PA 1QLEL 3UG5A 5DEFA 5IGXH 3RPKA 2CAKA 4BEIA 5C6TH 3AS2A 4N22A 4YC2C 3D08A 4PJBB 5I23A 2VDQL 3N44F 3OHXC 1CICB 1FZJA 4NO2B 3QORA 3O3AA 2PTTB 4ZSOB 3ZKND 4CSPA 1CWVA 1F1AA 5FYKU 3MTXA 3A5VA 2ZP0T 2IDCA 2BS8A 4QHUB 2BNQE 1N9PA 5TD4A 1JV2B 2GTQA 4EEEA 1BYNA 1IC7L 4IU3B 5AOJA 1PJ9A 1TVDA 4CA4A 4X5WA 4MGXA 1YMMA 5D8JL 5HHXH 2DLGA 1JZ2A 1K3IA 3B3BA 5DK0A 2WYHA 2G30A 4B9CA 4IEFB 3KYMA 1T0PB 1N0LA 1B0GA 4P5KB 1KJ2L 3MGTB 5D7SL 1KWGA 5IHHA 1I1AC 2MTPA 4HUWA 2GJ6E 5IVOA 4HISA 1JPFA 3PJSB 3DO7A 3MOAH 2ZOOA 5B22A 4WEBH 4MXVE 5L88H 4XN5A 2XRAH 2QQNH 2JXMA 2G5BA 3SE3C 4YPGB 4OM1L 4XPHH 2CHDA 4KXAA 1PAMA 3BN9D 5FF6B 5DVNA 4FJ6A 1F3RB 4U6YA 5E8NB 2FBJH 2WOBA 5TPWH 5JO5A 2NXZC 4AEHL 5IOPB 1EPFA 4ENZA 3P9WB 2FO1A 3VFVB 3V0AC 5ANHA 2XY2A 4Y19E 2QMKA 4NSKB 3U4AA 2UX6A 2EZ0D 4U1JB 3FB8B 3P9MA 4F7PB 3K72A 4TYUA 3O3BB 3B1UA 3AXLA 4BDVA 2H9GA 4K7PX 4KUCD 5BV7H 5K9KA 3K7UA 4FFYH 1FE8L 2IPTH 1U91B 2GSMB 2KH2B 5FECA 3ES6B 4EI5C 4LOFA 5KVDE 1JPSL 3MRIB 5HYQA 2NX5B 5D2NE 2AQSA 2OMTB 4LDOB 3WFDH 3AUWB 3DX9A 1RMFH 1QKZH 1FVEA 4KGLA 3MLVL 1GIGH 2OCJA 3JVGA 4X0KA 2X4UB 3IBOA 3DGGB 1YC8A 3NFNB 2GI0A 1U30A 4DP4X 1KCWA 4YDJB 5F9JB 5FGSA 5FOBB 3UBXB 5DUBA 5I26A 2XWXA 4QRQA 3O6KL 3DMMB 1OWRM 4ZTOH 4R8WL 2VZSA 2DQIH 3MLPA 4S0SD 4OFYA 2XN9B 1BVKB 4J7RA 3BO8B 4TRPL 4IYKA 4PJAE 4ZMQA 3GRWA 1OP3K 2C3HA 2I5YH 4LMQI 4GBXC 2AF2A 3L3KB 5D96B 3ZZLA 1KBKA 1HYSD 2P44B 3ZGHA 4YDIH 3VWKA 5FHBL 4ODBD 3KS0J 4DKAA 4YQXL 3KPPA 4PJFE 2W60A 2EZ0C 2KT6A 3AG1B 4IU3A 5IFAH 4HCRH 5DC9B 3SOBH 1BZ9B 1FH5H 4YHIA 4BELD 2XFGB 4NN7C 3CFJA 3ULVL 3VUAA 1PIGA 2JI1A 3NPSB 4DEWA 4Z7VF 1JL8A 3KLSA 3WY4A 3KL3A 1MLBA 2ZXBA 1SQMA 4FLSA 1NCWH 3DTDA 2CM6A 2HLFD 4WFFD 2J5LB 1GZQB 4HUNB 4FFZH 2GUOB 3ARGC 3EYUL 1QBBA 4PJFF 4IRZL 1UT9A 4KI5D 2AVFA 1U2HA 2ADYA 1ETZB 4WJ5A 5CJOL 4E9VA 2ODIA 3L95B 2EP6A 5LNDA 2B59A 5C0AB 5D7IB 1JPST 3NJGA 3P1VA 3DRTA 4KKLC 4XGZA 1JS4A 4FQLL 4TNFA 3TJEH 1S3RA 3GTTA 2XVKA 4M6ML 1U58B 3X3GL 2LU7A 1TQBB 3JUZA 3R0MA 5IB1A 3DETD 4ALAH 5MI0B 3Q6FB 1X7TA 3JUYA 4M7JH 5C6PB 4X9GA 5HGBB 4KZ0A 4AQ8C 2VO5A 4JRFA 5KS9F 3UOAB 5IMMA 1BWMA 1BEYH 4PRNA 3LQMA 3TTYA 3VXOA 4EZLA 4BFOA 1HL8A 5KVEH 2QTEA 2EO9A 2YAFA 2VM4A 5I19L 2C4FU 3QNZB 2AGJL 3H0TB 4HOMA 4AQAA 4F15B 1FC2D 1HDMA 3FK3A 3WBDA 4GKNB 2FQFA 2Y6TE 3K46A 4LKCB 5AVVB 4QY8B 3U79A 4KO6A 2V5TA 4NRZB 4JFOB 5LGJB 2ZXAA 3MYJB 2EKSB 1EDYA 5EF1A 3A6BL 1T1YB 4HIQA 4Z76A 1MCPH 1WAAA 1PSKH 1BLNA 2AERT 4Y4FB 3G5YB 1A3RL 4GBXB 4HKXB 2KYIA 4RWYL 2XN1A 3IBEA 4FRWA 3KZ8A 4FNRA 1MG2C 4XMKH 1MI5A 5G4NA 5DSCB 4G6JH 3EDJA 4HX1B 3BQUC 3QG6B 3ABGA 1DN0A 5JXAH 4MA1C 2W92A 1I7UA 2X2UA 3GLAA 3M7FB 4R83A 3SDYL 5H35A 4IGBD 1CYGA 3FUJA 5E5LA 3V4VH 1SUJA 5LQBH 3LH9A 1P4IH 4JRYB 1H6UA 2HRLA 2WWMD 1CR9L 1PQZB 5E8PB 1U8NA 2R2EB 4WK0B 6TAAA 4G59C 3DDFA 1E65A 1PX4A 2ZUWA 2ZUTA 4Z7UA 5AZ2L 4NN6B 4RFOH 2JKXA 4OVUA 2BOBA 5EZOL 2W95A 2Y36L 4FQJH 5GRVL 4AT6A 5BXFB 1R19A 4ZO8A 5TE7H 3QG6A 1FGVL 1HL5A 2VLKA 3KPLA 1KBVA 2V2TA 1ZMYA 4HKXA 2R4RH 4UUJB 1OTUD 4M6AA 3ZXAC 5BVJA 5PCYA 2E9GA 5EIIB 3ZW3A 4ZUWB 4NZDA 5HGAB 3GZPA 4NRZA 5GIRB 3LNIA 1OM3L 4KXZH 1GCFA 1IFHH 1MCWW 2VDPH 2YAHA 4MAUH 4PS4H 1KBGL 4FYTA 3UTSA 1UWGL 3UAEA 4U1NA 3HLAB 5INCA 3D18B 5E51A 3UO1H 2Y2YA 5JXEC 1CB4A 4JE0A 3S98A 1FFOA 5D4HA 1XGRB 2VLKE 2ICEC 1FFPA 2A3TA 2Z35B 4UT6L 5TDPA 3U9UB 4Q2ZB 5JOPD 1OT2A 2EDQA 1PZBA 2OSYA 3MRKB 4G8FB 2EO1A 2CCVA 4HIJA 5GIRA 5KSBF 1DCEA 2IANE 5A2JH 2X4PB 4UCFA 5EU7C 2Z8RA 4P3CH 4AUYA 1BZ7A 5EC2A 3O8XD 4DEPB 5HXMA 3KBPA 5E00B 5EU6B 3UTTE 3H9YA 3QQXA 3L1OL 2NSXA 3W11C 5FFLA 4X80H 2K7QA 1KTDA 1CJYA 1I1AB 4QJ5B 3SGEI 1JRHI 1S6NA 2CO6A 5IEKB 2ORBL 2QDWA 1BP3B 3NK4A 5HYSA 2CDEA 4PLKD 1ZD6A 3CVIH 1QPPA 2FLBT 4LLVA 5MEOA 2XC8A 4LLWA 5BS0B 4S10A 5L88L 1J12A 1IGIH 3MUHL 1RCYA 1UQSB 2OKMA 3HS9A 1SJXA 4U1GB 3W9EA 2VUYA 4ABUA 3QDME 2YGQA 1P7QA 2NZ9D 4D8PB 2FBJL 1GOHA 1E7VA 4LP5A 1DN0B 4DO4A 1P4UA 5B7EA 1ZKAA 4JY5H 1UCBH 3BGMB 3OAUH 3G5YA 5I5RA 3TIEA 2FO8A 2LGNA 4JL2A 3LRMA 2VDOH 3DC0A 4AJ0A 4NUJB 1AR1C 4FFYL 3F3HA 2CUAA 5IKCB 1TLMA 3K6FA 3BMVA 5LBSH 2HT2C 5F70A 2R9HD 2XDHA 3L3HA 4NM8H 2CIIA 4XPAL 1VIWA 3BFWA 5BRQA 1AQDB 4GPVA 3WFZA 4BZ2L 2BC4B 4I3RH 3NA9H 5JA8B 4P06A 4X6FB 1HILB 1URLA 1BLIA 4OY9A 1I1CA 1K4DA 2JCCE 3QDHA 1OAQL 5H37H 1IBDA 1YECL 4MNQE 2X4UA 3DI2B 4UTBH 3RQ3A 1G7JA 4Z23A 4X98A 2FWOB 5C0CD 1VGEH 2NW2A 5I15H 5J3HD 1MRDL 5C09B 5DO2D 4A7QA 3O0LA 1TXKA 3DSFL 5DQDH 4IQHA 4AL8H 5BS0A 1SM3L 1MQKL 2WQUA 3T3PE 3N0AA 4JFSA 1QTPA 3IJSB 7PAZA 2YHGA 5F6IB 1PGRB 3F2LA 5E2TL 4Q58C 1YN6A 2ADGA 2QADB 3THMH 1XXFC 3EGXB 2J6EH 1T1ZA 2FWUA 1KJVB 3EUDA 4NKOB 2AAAA 2WO3B 4P4RA 2DAVA 5HTSA 3SKJH 4XH2A 4OCNC 3FO1A 3OWRA 5A2BA 4U1JA 4FAAB 1ZA3A 3O3DA 4NWUL 3ZVVA 3QCUL 2V5RA 4XPBH 1LVEA 1E2WA 1F4YH 4PGCB 4UT7L 3V5KA 4LHJB 2I7OA 1IGML 3NACH 1T1WA 4JHAL 1YEGL 3VFTA 2IPUG 3HRZB 4JG9A 4KTYA 2WIIB 5C0IB 4FFWC 4UM8B 4HPHA 3CLEL 5CLTA 3L4WA 1FZMA 3O6MH 2E3VA 2VT0A 2Q7NA 5IQMA 1FBIL 2B0SH 2AQ2A 3CMOL 4OFPA 4C55A 2BSSB 2WNGA 1XB6A 5AZUA 5HGGS 4A68A 1OZUA 4GRMB 4YHOH 4YXHH 1R5WB 2LOEA 3FT2A 4H26A 2XPYA 4HKZA 3Q1SH 1P1VA 2FZ3B 2LU4A 3VJ6A 1P6AB 1ML0A 4BCZA 2ILLA 4AYSA 1FVDB 1KEML 1M7DB 1S9VA 3QAQA 3KGSA 3HNVH 1R9FA 1INEL 3VAEA 2FX8L 4IEFA 4UIMA 3TO4D 2AJSL 4KK8C 1RIHH 2YA2A 3TBYA 4OGAC 4PH8A 4YSDA 3UBXA 1TJIL 2OR9H 2IXQA 3UPAA 3L5IA 4HZLA 4YBLC 3VI3F 4FFVC 2Z7WA 1DQJA 3L6FB 2NYYD 2BRQA 1HSBB 2BWQA 1V3JA 2YPKA 3VXRD 3UDWC 3F7VA 2PABA 4L23A 3LX9A 5TQ0L 3NSXA 4LLUA 1SEBA 4PJEA 5CEYA 1YEDB 4OF8A 2Q76B 3UPCA 3OLDA 5SX5K 3LHPL 3C09B 1JK9A 2YQBA 3QI9D 4FXGC 3RRQA 4Q6IA 2G9HA 1G5AA 4AE0A 4OCSL 2BVQA 1JYXA 1CU4H 1OF2A 5F7EL 1NAMA 1HL9A 2EDRA 5JMRA 3HA0A 1QBLH 4GI6A 5CU5A 5J11B 1TTUA 1Z66A 1T1YA 2AXJA 3G5VB 1YEIH 3I6GA 4W70A 1SOXA 2XZQL 5JDSA 3G7TA 4LSRL 4K55A 4PJ9D 2LVEA 3QUZC 2Y3AA 4ZAKC 2EVJA 1Z5YD 3QIUD 3LN4B 2VDML 4QRBA 1RHHA 1MWAH 4PB0H 2A74A 2OSLB 1SMOA 3CH8A 3OBAA 4PJDE 4Y4KC 5E94A 5TFSH 5KVMC 4LLMB 4YFLI 5IMLA 4UU9B 4N0UB 4YDKL 5IMOB 5BO1H 4LPWA 3CH1A 1CR9H 3NGBC 3SGJA 4A7UA 2JXMB 5AWNL 2NY2C 4FXKB 5AOKA 3GO1H 2X70A 1WRFA 4UU9A 1QSEA 3NJVA 2DM4A 2JKWA 4TTDC 2VXVH 1LP9E 3NCJL 2OL3H 5DS1A 3RTQA 4PJ9C 1MJ8L 4FABL 4HUWB 4JFZL 3LEVL 3V0WL 4HW6A 1O0VA 4FL4B 4F9PC 3WTXA 2WN2A 5G2NA 2WYZA 1XBDA 5B1BB 4AQEA 3MA9H 1U95A 5I8KH 2AJ3A 5I18L 4Y4KB 1DQQB 3P3TA 1Y6NR 4S1SL 5EOCH 1NAMB 3FH7A 2A83B 2GJJA 4XOAA 1Z1WA 4WDIA 4ANKA 5D2LB 4M93C 4Z0XA 2J4WH 4HAGA 2E6JA 3KPMA 5FYJD 2JB6B 3P11H 2WINB 4KY2A 3NFSH 3VWKC 2AKRA 4KNUA 4UZSA 5EN3A 4EF3A 1RIVH 2X9XA 3KL0A 4JY6B 3ARFB 4XP4H 1QOKA 4ZUVA 1YEFH 2XWZA 3Q5TA 5I8OL 4HPOL 1EWHA 1NBQA 1PFCA 3QEQD 3ZDXE 3APDA 1JGDB 2UVEA 5KBKA 5D7KD 2CR0A 1CYWA 1XTLA 3JV6A 5GGTH 8PAZA 1IZKA 5E6UB 1MHPL 2QLVB 4LHUB 2X38A 1ZHBA 4WENB 2VJXA 1PZCA 4JHVA 4N2AA 3M1BA 2WLZA 5GS0D 4YHNA 4FLRA 1I7ZA 3HE7C 1OEZW 1AO7B 3CUPB 3QQ9C 4ZNCD 3CBKB 2APBA 4JO3H 4M8QA 3SKMB 2OP4L 2FIKA 4AM0Q 1A4BA 2W0LA 3CN3A 4HIHB 4RFOL 4W9KC 3ABLB 3SGKA 5FOBA 5IF0B 1H3PH 3TNNA 2XV6B 2XXGA 3NJIA 4UBDD 3TNMA 4QF1B 1DQLH 3DK0A 4N86A 4NOFA 5BUGA 3RHWK 2N7AA 3IJ7A 3D87B 3MRLB 2BSRB 1N4XH 2X5PA 5IW3A 3K1KC 1D6EA 3WEXA 4OZHB 4HU2A 5HHMD 5J5EA 1ASQA 3QHTC 5ECJE 3QWRD 3TPUB 2J73A 3A4AA 6FABL 3UBXI 3VWKD 4LF3B 2BSTA 3U7AA 1FJ1A 3HMXH 4EI6A 4G6FB 3ULSA 1QD0A 2DI7A 2V0AA 3EBAA 3GZOA 4IBVA 4P5SA 4HIPA 3BAYA 1OALA 3HW7A 4XBGA 3IETB 2Q7YB 5KBNC 3LS5H 2WCSA 4MMYA 5IROC 1TIUA 5B38G 4WO4C 2AJXL 1ZE3C 2ED7A 1KN4H 2B3RA 4OFYD 4NPJA 5J56B 1SGKA 3RGVC 2V7NA 3A22A 4QTFA 3GLEA 5T3XH 1AH1A 5GS0C 3EJYD 3SQOH 2XY1A 3NJFA 2WM0A 3F01A 5A3IC 2WHVA 4PJIE 1IX2A 3QZBA 4YDZA 1J5OL 1R34A 4JFEA 3MBWA 3R7QA 4DKTA 1S7XA 2P5PA 1EFXA 4TPRH 3T65B 3FAWA 4TM9A 4AL8L 2LE9A 1OSZB 5MENB 4XAKE 3B8SA 1HILA 4NPYB 2Y06H 1KENH 5GS1A 1ZV5A 2BP5M 3FONB 4YUEH 5DFTA 5DK3A 1SLXA 4UQ2A 3FSAA 1WCBB 1YSOA 3C8KA 1GS7A 1JZIA 1KB5H 4V33A 4Y2DB 2WVSA 4JGUA 5GRUL 5HYSG 1JXFA 2IH8A 5D9SA 5KUKA 5HYFA 2KUTA 1UH2A 1HZLA 5IUSA 1KUMA 2Q20A 1QW8A 1DLFH 3QIBB 1I3VA 3SY0A 5I71B 5CKAA 5IIEA 3MBED 3MXWL 4Q0XL 1CD9B 4QOKD 1FIGH 1GYCA 3Q2WA 3SPHA 3OGCA 4UOW0 4KJWC 3D30A 1G7MA 2DRUA 3ARTA 2OTUB 1LXMA 3II2A 5LGKA 4WO4B 4FNQA 4X8XA 4GAGH 4U0RC 4X42A 3JWOL 4TNWK 4N8PA 5DI8B 5JXEA 4IDJL 2OTUA 1CMOA 1A1MA 4PCYA 5FX3A 3EDEA 1OHZA 3ZO9A 1BOYA 4JFDA 1E4KC 2X4QB 2WXNA 1BQHB 4PRHD 3FQ4A 4UIKH 2DYPD 4PREB 1BGXL 5D55A 3UJTL 1R4XA 5GJSH 5KYXB 1A6ZA 2ZCHH 2BVOB 3AB0B 4D7BA 2JJVA 1BJ8A 2XKSA 3K1DA 3SKOB 3E80A 3TEYA 1G1OA 4J39A 5FUCC 5TK2A 3JWNE 2DKUA 1AZVA 3C8KB 2YD3A 1RUAH 4Y8AA 3TOPA 1PLCA 4I3SH 4U3HA 1WEJH 3MROB 4ZFOB 3Q01A 5IK3B 5FW7A 2ZE0A 3FQUA 3DARA 5CILH 1OCCB 3V55A 3D18A 3OZKA 5JNYB 4WHTB 1MPAH 3QJQB 3IPBA 2FNWA 1IB5A 4DK3A 1JZJA 2EVHA 3L17A 5LAXA 3I3DA 2PR4L 3LEXB 4KXDA 5IHUL 1UH4A 4K3HA 5GS3A 5D2LF 2VXUL 1X9UA 5LGYA 4G2AA 1YA5A 1ZHKB 3GSRB 1FFNA 2V2TB 4PJ7F 1AKJA 2XPGB 3WL9B 1BX2A 5F9WB 5B39A 3DBSA 4N8CH 4MXWL 2R69A 2K8MA 4DPAX 1I1RA 3QFJA 1IKNC 1DVFA 4QWWC 3U2IA 4OJAA 4FZ8H 3U30B 4JG0L 2EUWA 3BESR 4OD2A 4KZDH 1RPQA 1CE1H 2M8XA 3E38A 2MTAA 1DVYA 2YAPA 4EI5A 3CDGA 4E9XA 2VLME 3GRBA 3E2HC 3PFQA 4MVBC 2FIRT 3B83A 3Q7JA 2ARJQ 2YIHA 4ZW7A 4WWOA 3UZQB 3VXMA 2EUVA 4N0YL 4N2CA 3T04D 3VXSB 1LYQA 5IGXL 3GSQA 5I73B 4HX1A 3QUYC 1ZK9A 2ZF9A 3EO0A 4ODTL 1VKXB 2OMVB 1PY4A 3KYKH 4L8SA 5D1ZA 5F9WC 5JW4M 2ZICA 2VC2B 5HHPB 1Q94B 2JH2A 2F9BT 3D8MA 3MRJB 4L8CA 5EFIB 3K6SA 3SCMB 1OAYH 3ZX1A 2XRAL 5CD5C 5DJXA 5HYJD 3QAZB 3B56A 2OMUB 4YR6B 3EXLA 3CZLA 3L3JB 4S11A 1KTJA 1HNFA 1YMMD 1CQYA 5CR8A 1JK8B 1ZHBB 4R3SB 4RGNC 4IKIA 4HP5A 2XG4A 4LSDA 3UTOA 3GSVA 4H7VA 3QWOB 4FOMA 4AEHH 2ESVA 4B9GA 3A24A 5DHEA 3MV9A 4Q9RL 3GHEL 2PLTA 3WELA 4JDTH 1KTLA 2EDYA 1L3WA 4JO4H 4XCNB 3FU3A 3WJMA 2GIYA 3ZDZE 5BV7C 1PYWA 5IFJA 3VQMA 3ZDXB 4Z7VE 1EBAA 3VFRA 3BGFB 2QT6A 1AGBB 1QFPA 2JB6A 3MOAL 3HUJE 1OT1A 3QQ4B 4F5CA 2P5EE 3BP7A 1MRFL 3KEHA 4JFQB 4BA8A 4ZXBA 2DJSA 3BSGA 5CWSB 1B3IA 2LTQC 2XNAB 1GY1A 2GAZA 1QASA 2WNWA 2YC1B 3D07A 4MQ7B 3ZZQA 1FSKB 1NAMH 2NQDA 4KXCA 1Z0MA 4UV7H 4E5XG 4WNQB 3MO1B 3FU5A 4BSWB 5JIQA 3QIBA 4KH9A 1GIGL 3PP4L 1ORQB 1J9RA 4WWKC 4WV1B 3X17A 4YBLB 3F7KA 3L16A 5D9SB 3FN3A 2BCKB 5FYLE 1DJXA 2O5NA 5C0RH 4UQ2B 2F54E 1LNUB 5AW8B 5AW3B 3RWIA 3HKFA 4HGKC 2GSGA 3QVAA 1N5AA 1CLVA 1B0IA 2B77A 2WUCH 2CMRH 3GSXB 3NFPA 4LGRB 5D1QA 4WZ9A 4AENB 4Z8FH 3HAEA 3R7RA 3T4AC 3GXTA 1M6OB 2F1AA 2JLPA 3K8KA 3KPPB 4FXGB 1NCOA 1NC4B 3WNKA 1C5BL 4TSAL 4HWEH 5B1KA 1XEDA 4ANXA 5IMKB 3IMSA 1FNAA 3WO4B 4XNZC 2Y5TA 2H32B 4I0PD 5FHBH 4P04A 3WTUA 3AU1B 2A6DA 3OG6B 2CNZA 4Q6IC 5FYKD 3IPFA 2XIBA 4Z3HA 2AJXH 2AMGA 4H0HB 1MDTA 1G87A 3NCEB 3KPQA 2GFBA 4K3DL 5I66B 1A25A 1Z5LA 4YX2L 2DQGL 1BAFL 3TVMD 4TUOA 2J1KA 3DROA 1UA7A 2ZYSA 3CLWA 4ZX5A 4HJTA 3V4VA 4JFYA 2HPOA 3UAAA 2JKSA 4L4JA 4R26L 3GB7B 1J5OH 2BOCA 5I0ZA 1HYSC 1FORH 1SN5A 3I9GL 5I0WA 5JDJA 3ML8A 4NNYA 5E0FA 2WXMA 3BWSA 4I0PC 3IDGA 3QZOA 1B3JA 1HH9B 1D6EB 3QJVB 3NG5A 5GRZA 2Y06L 3U2JA 1R3KA 2ZAGA 1HSBA 2WXIA 5INDA 2DN7A 2VXQL 1E50A 5IB5B 1BBDH 2VH5H 3IK2A 3P77A 5DC4B 3RWDB 2MCPL 3BAEH 1FCGA 4E41D 2R0LH 3MBEC 2FECI 2JIXA 3RTQC 2L7EA 3O3BA 4M43L 2X9WA 1VEMA 3LN5B 3MRGA 3ABZA 2BMKA 4PM1A 5ICYB 5H94B 3HZYA 3GMPB 4CU6A 1CS6A 4WWKD 2ENYA 1FYTD 3B3IB 4BINA 1GKOA 4LEXL 1F18A 1NOLA 2YPLD 2WOYA 4X6EA 5AB0A 1NJ9B 1Z9LA 4E5XA 4M5YH 1U8LB 2ZAHA 2PYFB 4TS6A 1ZTXL 2XHNA 5ISZB 4JY4A 5FWRA 1I8MA 4DK6A 4YPGA 3HPJA 3KBEA 4HJ0C 4OZFG 5C0DB 3S5LA 3FHAA 2PYFA 2C9PA 3N1MC 5C71A 1IC7H 3T77B 2YD0A 5IM7A 3A6OA 4JPKH 1UD4A 3GMPA 2V7NB 4G9FD 1OB1A 1WITA 2D7OA 5D5ME 4FS0A 1KXVC 4JO1L 1J0IA 3MRGB 2FEDD 5CJXA 1F13A 1O6SA 1KPUA 5ELIA 2GTZA 3GMLA 4ZTPL 5BW7C 4NLHA 4Z7NF 2EH7H 3VG9B 3ZE1F 2IDUA 4ONFL 3TV3H 1FGNH 1X5KA 3IE9A 4QDGA 3SZKC 5JHDD 4HBQA 5AVZB 3VFWB 3MLRH 3VMNA 1QRKA 5DXWA 1WLHA 4MAYC 2ZOTA 3ULSB 4LXFA 3BEVA 2FJGA 1QX1A 4XMLH 3SDDA 2R23B 2C9SA 4A55A 1IAMA 1TFPA 3QRBA 3RTQB 3GJEB 1NSNL 5GZOC 4E36A 4XNBA 4QJ3B 2K78A 3IKCA 5I16A 3CHPA 3SBRA 3WJMB 3PS6A 2XZCH 2YN5A 3K5RA 3VMPA 2YXFA 4HJJL 5BOZG 3RPBA 4WCYH 2ZX6A 3H7LA 2AJVL 4QGYA 2B08A 4WJKB 4KV5E 4WTZG 4WK4B 4D0DB 2M1KA 2ITCA 1G6RH 3SDCC 3SSGA 3TN0B 4CW1A 2CK0L 4RX4A 2HB0A 4ES8A 1KB5A 2VLLA 5LKNA 3CXDL 4MAYB 1S46A 3ULUE 4MNQD 4U1KA 3JTTA 2VLRE 2D03L 3T8VA 2E0PA 2FHFA 1HINH 3HFMH 4MJ5B 2IALB 2H3XC 4ZUTA 3A6CH 2VDOB 4L0YA 4NUJA 1EZLA 5MEQB 1FIEA 2FEJA 1CFSB 4U3XA 3RNQA 4WI4A 4XX1G 4B5ZA 2IDSA 3EJQA 3H42H 1CLCA 5MENE 2ZAIA 1B6DA 5B8CB 3TH4T 1OD9A 2XN9E 1IC4L 1CE1L 1AJ7H 3HG1E 2JK5A 2EXYD 4YHYB 4HC1L 2DQMA 1EO8H 4RGNE 4JNXA 3WD5L 3VI4E 4FTVE 2GSGB 4HFUL 3W9EB 1ZVSA 4NAMA 1KB9K 5AW7B 4BFFA 4DH2A 1USZA 4KHXH 1J1XL 5C6WH 1JYWA 4X80L 3JSSA 2PWEA 4JCWA 4AV0A 1U3JA 1TR7A 3VQ1C 3Q8CA 2MFNA 3OKDB 3RUGB 1IAIM 5BO0D 5F8QC 1F58H 4H25B 3RPIA 3CD4A 2VMEA 3V0DA 4DUWA 1JGUH 3VI3A 5FDYA 2Q7AA 4Y5YC 1B88A 5D7EA 3LIUA 2MCAA 2Y2TA 3AVEA 1YMHA 4BHUA 5FCSH 5CGMA 3BRGC 2YD6A 3VMOA 2CPUA 3BD4A 4Z3GA 2FECL 3UG3A 4V11A 4Z7QE 1AGBA 3KR3H 4J4PD 3JT2A 2FZ3A 3VJ6B 2LLNA 1EGJH 2JJSA 4PV8A 5IM7B 3U7YL 2O5ZH 2ADFH 4C4BA 1MCOL 3CJJA 3NEEA 2DH2A 2IOIA 5C08D 3VXSE 3PXLA 4ENEC 4QNPE 2GEQA 1T6WA 1H3WM 4F9LC 3CHOA 1WAPA 1N2RA 3N3EA 3U0PA 1KCVH 3ZT5A 3KPOB 4JKNA 4U1NB 1BSIA 2CE6A 4FLQA 3HRPA 3GMMA 4RGOH 4TLSA 3ZR6A 2VDPB 4GRLB 3FT3A 3MOBL 4WGVB 1RUPH 1V55B 5DMGC 2OA9A 3IT8D 2BERA 5E6YA 4KTGA 4OI9A 4TULH 4LCYB 4DT2A 4DERA 5EFIA 4ZUWA 3RIAK 2P5WA 4TNGA 4WHDA 1GMEA 4NQCE 3G9AB 1W16A 3UAJC 2VXTH 3RWDA 4BFIB 2BVQB 1JGVH 1SM3H 2X3BA 3QUXB 2Y07L 4HHGA 2P26A 4NZTL 4AGOA 5IB5A 1JYVA 1HOCB 3HCVB 4P4KB 4IDLA 2DQFB 2IAMB 4L1HA 4M5ZH 3VU1A 4KITB 5E95B 5TDOA 4HPYL 3G08A 4PRPE 3RJDA 4Z7WB 5DZ9A 4FQ2H 3S4SG 4JFED 1G9MH 3HS0B 2NT1A 4P2OA 2ZCKL 2NW2B 2YPKB 3FTGB 1HU8A 3L5XL 4JBSA 2IEPA 3S37X 4GG6A 3V4VB 2KERA 9CGTA 4I3RL 4EZJA 4JGNA 4KQ4H 4MHHG 3PWJB 1IAII 3ESMA 5EBWB 3ZDWA 5IIEB 1AS8A 4XNAA 4GO8A 1IRAY 4YBQD 1HKLH 2E8ZA 1O9VA 2BX5A 4XNQB 3KPQB 4Y5XA 4RSVA 4J8QA 5D1QE 1XXDC 2CJ3A 4HWUA 3Q9QA 4CC4C 2RALA 5ESVB 1RSFA 3F7RA 2WCPA 3A21A 4X83A 1E4WH 2IMMA 2OMXB 1ZGLB 5E2VL 2QV4A 1S7RB 1VFUA 3JZ7A 2YA1A 2H32H 3OB0K 3BKCL 2CUIA 2NYKA 4FMKA 4PRHA 4P46D 4XTRD 3U2SB 3GSOB 3HS0C 2E9BA 1X9QA 4OUUB 3MNZA 1DP0A 4QHMA 4FGMA 1HHJB 4APQB 1M7UA 3CSTA 2AJYH 1COBA 1IKNA 3MRMB 4KXZI 2NY6D 4GW5B 1BD2E 2W0PA 3OG4B 2XTJE 3L2MA 2EILB 4GFTB 3UACA 3HRZA 4YHKH 4NZ8A 4FXTA 1N5AB 3WV0A 4ZBJA 1H6TA 3B7TA 5AZ2H 5JQHC 2FYYB 4JM0A 5GRJH 1C08A 3ASWA 3NYKA 4G7VH 8CGTA 3HE6B 4JJHA 3BLBA 4UT9H 3U46A 2R0LL 1XF3B 2SEBA 3PAYA 4XCEB 4XODA 1VHPA 4GKZA 5GZNC 3TZVB 4JHZA 4M48L 2FVNA 2J2ZB 3E6HA 4LIQE 1FI8C 2IVFC 1YMME 5AG8A 2H6PA 5TTRA 1VFAB 1WS7A 4MSWB 8FABB 5EO1A 4XVTH 2NY6C 3VRJA 2J2ZA 5J1SC 3FCSB 2DLIA 1BA9A 2XG5A 3W0WE 4XB7A 2XA8L 3HE7D 1H9VA 4XE5B 4BQBA 5DMIL 1S7UB 5ITFB 4MLSA 2WMPA 2XCMC 2YUXA 4X0NA 4OBRA 2W81C 5C07B 5C09A 4UT6H 4F7CA 3AM8C 3AMKA 4X98B 1W8EA 3G3LA 4ODUA 2JB5L 4Q2ZA 4D9RD 1BIHA 2BSRA 4X4KA 2ESVB 4HUXB 4OU3A 4WKZB 5CN2A 2FHBA 4M1DH 4GSXA 4Z0BH 4DOHB 4X8CA 3WU1A 3PWUA 5BS0E 2VITA 1ILUA 3DA0A 4KKBC 4PJ7B 3MX0A 1EJ6A 1ACZA 1QUPA 3O11B 5EA0L 1YG9A 2WANA 4FNTA 3ECBB 1QSZA 2PYEB 4PLKC 5IKCA 5JMOC 5FCUL 3KHQA 4FI6A 1CT8B 1MXDA 2EDEA 3MRDB 4G80B 5GGRB 1J8KA 3AADB 3NIFB 4PJ8C 3EGDA 5T1JA 2ORBH 2OMVA 2WZPA 3ZE0B 5CUSH 1E5AA 5J12C 1WUZA 4XVSH 2WBXA 4N1HB 5EIQA 4RBPH 4P2YA 1A3LL 3AQDA 1EUUA 3NFNA 4WY7H 5E1AA 5T1LD 3SDXF 4ZPTA 4NXKA 5DD6A 5DMJB 2WCGA 1I8IA 4UDTA 5DTFA 4LT7A 3QZNA 1A7NH 1N68A 1PG7L 4NC0B 4ZMNA 1KCSL 2DBLL 5K93A 5EPMB 2XI9A 2E7DA 3DI3B 1KELH 1WG3A 5DJZB 1V3KA 1OQOA 2WW8A 2NY1C 2Y24A 5F97E 4PQXA 1CFTB 3TFKD 5EUKA 2NUPB 1QTYT 1JWSA 1EAPB 4W4NA 3WKMH 3IS0X 2L7JA 3ME0B 2Z91A 1K2DB 2QVKA 4F2EA 4MMXA 3BRDA 2DD8L 4QRSB 1LJMA 4K23L 3RKDD 1CTMA 3LRKA 5KBMA 1G7QB 4LCYA 5D7LD 3AZUA 1ASOA 2OL3L 2GSIB 2ICEB 2WV3A 1MJ7L 1XO8A 4KVCL 2XWRA 5TF1L 4JEGB 4G8FA 5J1TC 1U8CA 3BUYA 3S4SA 1R3LA 4EDXA 2WLLA 1YECH 3LKOA 3HG1B 4XNDA 5KYNA 3D39D 4GS7C 1UEYA 4TNVF 5DJ6B 3FULA 2P5ED 4BSVB 3HHSA 4ZFFB 2BSBA 1THCA 4P5TC 1OAUL 1MZZA 1X5FA 4ODVL 1PEWA 4GT0A 4GLRH 4CVWA 3RUGE 5JIHA 5A7EA 2RQ8A 2V2WA 3IDJB 3L7FB 1DQLL 2FH6A 1Z6JT 2DQHL 1IL1B 2UZXA 3SE8L 3DRQB 3R06A 2F68X 3QEQA 3DRTB 3P0YL 2VDRL 4MDRA 3MJ9H 3CTTA 2IGTA 4HEME 3CIQA 5KYXA 3P4NB 4ODSH 1Y18A 5C0BE 4LOUC 2IH9A 4QHPA 5J8OA 1TZIA 3CSGA 5L8LB 3E0GA 3GHBH 4K7PL 2O5ZL 3REWB 4UB0L 1N10A 2AXHA 5L6YH 2F1EA 3NDYE 3ABKB 5JORB 2PO6C 3FTSA 2QGCA 1Q9KA 1W72B 4J3OF 2PNDA 2JKIS 3IU4H 4X6DE 3QK0A 2APTA 4ZUSB 4Q4IA 1KZQA 3AS0A 1IU1A 4X5QA 1BD2A 4JFHE 3QXUA 2VRAA 5I30H 3N50A 1EZUA 3T08A 3UJJL 3F7YA 4G42A 1E3XA 3NRFA 4QXUL 4PJBE 3SY0B 3JVFC 4O2CA 2O30A 4OM1H 4OR1A 4AYDC 1KGJA 4DFIA 1PY9A 2ZKHL 5G55A 5FKAA 3UH8A 3SE6A 4PW9A 3BWUF 2OPCA 4GXUM 1K4CB 4R8WH 3LD8B 4OT1H 12E8L 2ZPKL 4OGZA 2BNQB 1XV8A 6FABH 1IL1A 2B5IC 2UZXB 4H0IA 4AQZA 5HY9A 4IOFD 5T1KA 4WUUD 3O4LE 2DQEL 1ZE3H 4XCFL 2V5YA 5A2AA 1SYVB 3N6YA 3TT3L 4F92B 4QMEA 1TZAA 2VAAA 3EZ8A 2J21A 1X4ZA 4DCQB 3V0HA 1PAZA 4UQEA 1ZANL 1T7VA 1TLKA 4MXQD 5KSAC 2CIKA 3RL1A 4KDTC 4HPYH 2BIOA 5F7DA 1V5JA 3DGGA 3FFCB 5LN8A 4Y5VB 1EUTA 2WIIA 3IB4A 4FQPA 4JMNA 1JXGA 3QJOA 1O6TA 1NOFA 1R3LB 3PWLA 5L9DH 1RHHB 1JRHL 2VSMB 1D7DA 3I75A 2WSKA 2GVYA 1AQMA 2OX5B 1CICD 2CO1A 4HUKB 2EDBA 4C56E 1KF9B 4OF5A 1MFEL 2P5EA 3LNDA 1RJCA 5KVGL 3IWVA 5BPPA 2NY4B 3PAZA 2EXTA 3BLKA 4NRYB 1R24B 2ZUVA 1EJ8A 4GRWE 3DGCR 4CADB 1UA6L 3RGVB 3CIAA 1OB0A 5I1AB 3KLAA 1O6SB 1PNDA 3AQXA 3HB3C 3P40A 5EC1A 4QHKI 1A7BA 2RH0A 4U4BA 1UM6L 4Z95L 1TETH 3FSVA 1GZHC 4G5ZH 3W9DB 1TJXA 1UZ6E 2IBZX 3ZJAA 1OTSD 3WEXB 4MA8H 1MKFA 4YHIB 3ZTCC 2VDKH 2ZCHL 1DVFC 3EHBB 2RAMA 1OAKL 4C58B 2XVGA 5HDQL 2P80A 3N1PC 2YXWA 4OCYL 3B7SA 1U3ZA 5FB8B 1I85C 4JY4B 3ZQ9A 3RVWC 5CLYA 5D2NB 1II4E 2VAAB 3MRPA 1J88A 1MW0A 2KZ1B 5EBLA 2HVKA 4HGWB 4NP4H 1D9KD 4GUQA 4D7PA 5KBPA 3BH9B 2R59A 4GAJH 4IBUA 3RIFK 3WY1A 1DJYA 3JWOH 5E7FA 4B5EA 2VR7A 1N0LB 3FSWA 1FL3B 4GQZA 4O58L 3VXQA 1NCWL 1NTDA 1SOKA 4PGZA 1QFUH 2MH4A 4F1SA 5T33L 4LCWD 3JV6B 4WI6A 2HPTA 4FQQA 3ZMEA 1NFDB 2E9IA 2WXQA 4G6JL 4X5WB 1YY8B 2PR4H 4IRZA 4RVBA 3S5LG 2YGNA 4Y4HA 2CKBL 3F7YB 4ZQKB 3C8HA 4TQIA 2BS71 4HCRA 3MV01 4Z7NB 4ZUVB 2HJKB 1Y1DA 1ZT7B 1NEPA 3G9VA 4L8DB 5D7SH 1MCNA 3ZE2B 4I4WA 3IAGC 1NC2A 2J20A 3LSOB 2HKFH 2H0PA 4HOXA 43C9A 5C0ND 4NO2A 1Z7JA 4PS8A 4OAWB 2EYTB 4N6QA 5HGHB 1HAWA 1BXUA 4Q52A 1REIA 3MNVA 3HI1A 4JFUA 4J23A 2YAEA 4LSTH 3VO0A 1H9DA 4X9HA 1LE9A 3WKPA 1YN6B 3K72B 2R4RL 4P3DB 4LQFL 4LQ1A 5EC2B 2HZHA 1LDSA 2WTOA 3N40P 4PTTB 2OX5A 3BD3A 5DHYA 5BZWA 1HXMB 2C1OB 2XJLA 3QUXC 3S7GA 2C3GA 5FWQA 3G6AB 2OL3B 3CFEA 4NDMA 2NRDA 5EU5B 4OZIF 1AZZC 1IBYA 2O6PA 1FLTX 5I8EB 1G7JB 3C08H 1U2YA 3L3IB 3OTTA 3QC6X 3RILA 3HOGA 4WNJA 4IHOA 3BCFA 3OHXB 4PJHB 4W68A 4N8CL 4ZOEA 1NGZA 3HZVB 3V4PH 2NXZB 2EEFA 3LB6D 4W4OA 1WISA 2VABA 4A37A 1BXAA 5I6KA 3RWIB 3PV6A 5DLMH 3U6RA 2D8KA 5D1QC 1MWAB 4A7TA 3BFQG 1Q9OB 3LEYL 3TT1H 2J8HA 4JPWL 4KZDL 2VLJD 4X7TB 3Q8BA 3HIZA 5KUMA 2BIHA 5IFAL 5HP5A 2APFA 4RFNB 1J05B 2ICES 1CDHA 2VLJE 3ULVD 3LKSA 1LO2H 3TS8A 5BVJB 3DWTA 2OMBA 1NDTA 4N0CC 4LSPL 3KWVA 4O5LL 1WAAF 1GMIA 5BUPA 4WQOA 1KSRA 3QCVH 3S3PA 4L29A 3SPCA 4W9DC 4X8JA 3EJTA 4X4YA 1UVQB 2F15A 3JTBA 3Q13A 1CPUA 1MFDL 1T5WB 1C12B 3CZFB 5EN2A 3QORB 3VXTB 3ALPA 3REWA 3IGAA 5IW6B 1E3FA 1MAKA 2LW3A 3DSNB 4WSKA 2IXQB 1FVCB 4NQVB 5E4EB 4BFIA 2XG4B 2V5SA 5L7XH 2A6KA 1KB9J 1SDDB 4ZO7A 1FDLL 4GEIA 3IGLA 2P5WB 5ITBH 4I1RA 2VJ8A 1A7PL 1S9VB 1WV7T 3T2QA 5GZNA 4G6AC 2Q8AH 1CYXA 4JLRB 2VYRE 4YIQB 4AGPA 1FFRA 1CXHA 1EDQA 1OE2A 2GB2A 5C9KA 3MRJA 1FIGL 1RIUH 2OM5A 2A9DA 3B9DA 1YEHH 1KJMB 1CO1A 3EO0B 1WP6A 3V4UH 3EJZC 2JCWA 3ZYZA 2GHWB 4O9HL 5MHSD 4HUXA 4WKZA 2F58L 4XTRC 4XN2A 3HG1A 3GFUA 1NKOA 3VFTB 4OLZH 2X1XR 1JF5A 2Z31C 3KWWA 1DR9A 3SDAD 2FJHB 2IWKA 5DHXB 2CKBB 3GXFA 4G7QB 2BY3A 3D52A 4P8QA 4M8RA 5E9DA 4QRPA 1CBJA 4HETA 5H2BA 3D69A 1OCOB 3N06B 3EGSA 5HVWA 3TXAA 5GJTL 3V6OC 1TYEB 1U9KA 2NY5L 3TONA 2KS0A 2HTLD 4JRYD 3ZE0E 1M4KA 1BHGA 3EJRA 4LLDB 4DN4L 1FNGB 3CHXA 4JFWA 3VI3E 4EN3C 3ARBD 3MUUA 3ULVE 4NQVA 5FIEA 3KW7A 4DWHA 1QEWB 3DSNA 3QO1A 3O4LB 4XCFH 5C7ZA 5GGUA 2EJ1A 5C0AE 5I1LB 2DQCL 2DLHA 4EPSA 4B9PA 1FA4A 3BW9B 4CNIB 1LD9B 5DTFB 4P5RA 1CIUA 1U8NB 3II3A 4L0PB 5LBSL 4DVBA 1HKFA 2A9MH 3KYOB 2VMCA 3P2DA 4PRHE 3QNFA 1H8NA 1QBML 2A6IA 5SV4A 3NCBB 2X89A 3QUML 3WG7B 4DGUA 4ORZC 4BFBD 3SDDC 3BRFA 4A2LA 4B9FA 3Q6GH 4JUSA 5DSCA 4ZFOA 5B8CA 2OYMA 3KNBB 3SDYH