1USQA

Complex of e. coli drae adhesin with chloramphenicol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
139
structure length
139
Chain Sequence
GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
publication title High Resolution Studies of the Afa/Dr Adhesin Drae and its Interaction with Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
molecule tags Adhesin
total genus 25
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 1usqA00
2W5PA 1UT1A 2BCMA 1UT2A 1RXLA 1USQA 2JKNA 1USZA 2IXQB 2JKJA 2JKLA 2VERA
chains in the Genus database with same CATH superfamily
5INCB 7TAAA 3DDGA 2A1WL 2AANA 5CJOH 1FL3A 1KPUB 1DYZA 1LYQA 3R4DA 3TT1H 3QR1A 3VXTA 2ATPA 2WQ8A 2XLLA 4AL8L 1IO4C 4Y7MA 1QKZH 1SJHB 1IBHA 1XSJA 1CDHA 1MI5B 4U31A 3OKDA 3VXPB 2CM5A 1OK0A 1D5ZB 1UT2A 3MRJB 4HS3B 4M5TA 5DO2D 5CSZA 1ITCA 5HY9A 2ZUTA 1H3UA 3IDNA 3EGDB 4UMSA 1R5IB 1L5GB 4L3EE 4DKDC 4G42A 5DURB 2LLNA 1R75A 2W59A 2H1PL 4OJYA 2JI3A 4ENED 5C0BA 3LIZH 2WSDA 2VMDA 2CAKA 1DQQB 3T71A 3FUDA 4PJFF 2OMVB 4XCEA 3DETC 3MJGX 2ZCKL 2CIIB 3T8XA 4L1BA 4NQEA 4OJFL 3T0EC 5EUOB 3IDIB 3FT4B 4F8QA 2AJUL 1DSFL 3MNMA 4LSSL 5GPRA 4H5SA 4DKEL 4GUPB 4XPGL 3LRSA 3GLZA 5CP3A 1U95B 1BVLA 5AOMA 2IBGA 3ML9A 2HG5B 4APXB 2IAMC 4ETQA 1GGUA 1H0DB 5C0DB 1OALA 1DBAH 4JGJA 2HFFB 1J1PL 1HEZA 3FQWB 3QEHA 4QD2E 4OCYH 4MS8D 1QAWA 5DJYA 3LX9A 1QFWM 3VXSD 5I1AB 2CJ3A 3DVGB 3SJVD 1A1NB 1WG3A 2PN5A 3MLYL 5JA9A 5E5MB 1EZVY 4HZAA 2CNYA 3N2JA 4IOSA 3CPLB 1KC5H 4G3YL 4NDMA 5MEOB 1NAML 2P47B 2GCYA 3QEQD 3BFQG 2FWSA 3P73A 4XMXA 5A16A 5EF0A 2IGTA 1FNGB 4H1LG 2EDRA 3K2KA 1HKLL 4PJCA 4GLRH 3MRLB 5L8KB 5F9WC 1IJNA 1IC5L 3B2VH 3IWVA 3WDJA 4ZTOL 2BWIA 4KZEL 4XBGB 3RWEA 3MSPA 2Y36L 4PJ5A 3T0DA 3EIFA 1CFVL 2G75B 2IDSA 5K93A 3V79C 2AVGA 3LYRA 3O8XC 1BOYA 1QATA 1U3YA 2XG4A 1YVLA 4OF0A 5DFVD 1GYAA 3D9AL 4Z76B 2Z31B 3VQ1C 1OCZB 3VXSB 3AY4C 5FXCH 3VDBA 3SJVB 4UQ3B 1EIBA 2C1OB 2CLVA 2VITA 4WO4D 3NA9L 2IPUK 3IU4L 2IV9A 4PRIB 1AOZA 1AACA 4EXPX 3RZCA 3S97C 1J8RA 4NQSA 1EFXD 3KPMA 2JWYA 3QEQB 2A74A 3UERA 4Z18A 4P2QA 4RFOL 2Q1EA 5DJXB 3ISYA 4CUCA 1XF2B 3T1WA 1N59B 1OARL 1NOLA 4ZDHB 1X7SA 3P4OA 4AITA 1JNLH 1AKJA 1JPEA 5I8KH 2R2HA 5EIIG 4CSSA 1XF1A 3FCUB 3B9KB 2WINB 1EEUA 5AENA 2P46B 4X99B 5GRWA 5JO5B 4E9TA 3LPPA 3ETSA 4H1LA 4G7QB 2YK1H 5B1JC 2W88A 5ECGA 3WIHL 3WLBA 2Z91A 1UYWH 4UWQB 4WO4B 4OVUA 4G71B 5KOMC 2UWEA 4QF1B 1P7BA 2WLZA 3BH8A 3OZKA 2IPTL 3MYZA 4N8CH 5GZND 3OPZL 3I2CH 2XC8A 4XWOC 4F9PC 1DUZB 3CK0H 2MQGA 3IPBA 5EZIL 3ZMEA 3BC9A 5DK2A 4F37K 1DO5A 2XVKA 1J9SA 3JV6B 3E9TA 5JMOC 3BVTA 2OR8A 2Y0SA 3NCYP 3RKPA 3T09A 3M1BA 1KC5L 1ZRUA 3BHBB 4G2AA 5C0CD 2X1XR 2Q3AA 2FX9H 2XN9B 4MCZA 2EABA 1H5BB 4N6RA 1NFDB 4Y2LA 2OTUB 3I85A 4QKXB 1J9CT 1R6VA 4JVPA 4IIQA 4NOBA 4OUOA 4DGIL 3FCSB 4IMKA 1ZT1A 2OZ4L 1AJ7L 4XH2A 1QLEB 1XGRA 3WNLA 4E68A 1M71B 3G3LA 4K8RD 4EN3C 5EZOH 2DI7A 1I8KB 1WISA 2FQFA 1V05A 2KZWA 4JKKA 1LEGA 4PD4K 1N3NA 4UT7L 5E2JA 1IAIM 3O9WD 5EIIA 3ZDZF 2AKRB 1U3JA 3KXFD 3MOBL 1AS6A 1UB6B 1A14H 2VLLB 2CJSA 5SWZA 3STZA 3VI3B 3BWAA 4KKLD 1OAZH 1S7XB 2XIDA 4XMPL 2GT9A 4YSTA 4PGDB 5T1MB 5HDQL 3OWRA 5AAMC 4AQ8A 1NKGA 3Q6GL 3WN6A 5B21A 3K0WA 3ZK0A 4BFBD 1O6SB 4NKQB 5C0CB 4TUOA 5C2BH 4QHUA 3IFNL 3OJVC 1JSYA 2I27N 3ABGA 1XF3B 1PBYA 3ABZA 3FU9A 4N2LA 9PCYA 1B0GB 3PP3K 4CVXA 1BIHA 4U4IA 4GRWF 4JJ5A 1KIRB 4Y1TA 4K5MA 3DJRA 4ABVA 1YNTF 4WI8A 2FWOB 4NYLA 1RULH 4GH7B 3RBGA 1YEHL 1BECA 4CJ0A 2YMXH 5I8KL 4LRNL 3V0AC 4YE4H 1YECL 3Q8FA 3ZTCC 2R0ZL 3O9WB 4P0DA 2JCCE 2W60B 3KXFB 4Z3EA 1NJ9B 1MRCH 2IWEA 2JB5H 5HTSA 1ZE3H 1Q9WB 1A9EA 2G0LA 3CXDH 2VRAA 3V0WH 2YC1B 3DWTA 3ZUCA 4J8QA 2ATAA 1UQSB 2UWEF 3ZSSA 1F18A 2UXFA 3LCYA 3CN4A 3VGEA 4WWID 3GSRB 3QCVH 2ED9A 3SY0A 3ZW3A 1TJGL 4N8CL 4HETA 3I2CL 1UASA 2JB6B 3ARFA 3OR6A 1FVDA 4HWUA 3KH4A 1GGBL 2WVSA 2BSED 1QLFB 4LBEB 5BXFB 2QVIA 5FHBL 3FCTB 1D9KC 3H9HB 2QPEB 5IKCB 1FNEA 3MI6A 2OTPA 3ATDA 3MACL 3UO1H 1NIFA 4WEBH 5IHHA 3QO0B 4HIEB 1QRND 5D8JH 1ASQA 2KLRA 3H9ZA 4R3SB 3OZ9L 3FT2B 1FFPB 2HH0H 2XQBH 2AXJA 3U1PA 3DOSB 4IQHA 2BVPA 1OF2A 1C5CL 2AJVH 3EZ8A 5TQ0L 1FFTB 3HR5B 3V4UL 2WBXA 4GQ9H 2XNAA 1E9OB 3D4YA 1CXEA 4TVSa 3BW9A 3RTQA 3U7WH 1W6WA 4D3CH 2X1QA 3N50A 3MJ9H 1WAPA 1JNHB 1WCQA 2JIXA 1UWEH 4LKXA 5AVWB 1P1ZB 5IBLD 3PJNA 2Q6WA 1N68A 4L0PB 4L2YA 5FDWB 3NPSC 1VACB 3MKKA 1F4WL 4GEIA 2F18A 1A14L 3C5SB 5DMJB 4B5EA 3SSGA 5C97A 4E9QA 4OLYH 5FKAB 3MLZL 2VABB 5LCVL 1V3LA 4PS8A 1KJMA 4Y19E 2FT8A 2JK5A 5IM7B 2PP7A 4F58L 4ZRGA 1AHWA 1M05B 2WN3A 4R84A 4G9FA 1QRNB 5G2NA 4HV8A 5CFAA 1FE8H 5C2BL 5DD1L 1K85A 4A7GA 1ET5A 2A77L 2BIMA 3S3JA 4BE6A 4LCIL 4Q9QH 3DJSA 1KYFA 5IMOA 3VFVA 2KLSA 5I1HH 2K7QA 2PUQT 1WK0A 1E6JH 2RB8A 1S7VB 3DARA 3GMOA 3K8MA 4JO3L 5I5JA 3WG7B 4LU5H 1RJCA 5DD6A 5J6SA 1RULL 4F8OA 5IMMB 4WW2A 1YNKH 2O93L 2GEEA 4MYPA 4G7VL 4PS7A 3LZOA 1SM3H 2QSVA 4AKPA 2YMXL 1LE5A 1MQ8A 2XBZA 4N5UA 3VFOB 4DUXA 1TUPA 2ED7A 4OLZL 4Y5YC 1PD0A 5DS2A 2GG1A 4H44C 2CMRL 5D93B 2JB5L 2YQ2A 1J05A 5DJZA 3JWOH 4JRYA 1NAMA 2RAMA 1OO2A 2YKKA 2Q7YB 1ACZA 5TDPA 1E9QB 3IDXL 1BF5A 2XZAH 2WAQA 4G6JH 3NTCH 5F9OH 4R7LA 5JIPA 3WJLA 2H6UA 2AK4D 3P4LA 5BVJB 3EYSL 4IHBA 3ORJA 3MGAA 2C8NA 3QUZA 5AVQB 3RP1A 3EO9H 2WLNA 2H9GB 4OD1L 5ITBH 2XBTA 5LGJB 3WNIA 4OT1L 1KN4L 4PRNA 1T3FA 3ARBA 3NIDE 2PTVA 3LHAA 2V8LA 4I88A 1E27A 1F3JB 1RK0A 2HVKA 4F9LA 2APFA 3MXVH 4MSWB 5LN8A 1SLXA 3CZGA 5HHVL 5EC1A 1A2YB 1O7VA 4M61B 1MIEH 3UCRA 1VZGA 3C9NA 3V6BR 1ZJAA 2FO4B 4BZYA 1L6PA 1NGYB 2XQBL 4JM2A 1ZHNA 4BELD 1G7IB 1N5AB 2X4SB 3MGOB 2AJVL 4UT9L 3TO4A 4QWWC 1BZEA 2KUTA 4FKKA 1ZGLP 2WXOA 3QZBA 2X0WA 1RFDH 3WL9B 4R26L 4F7EA 2AK4B 4GXFA 3WFCH 3TVMA 4DZ8A 5CINL 3CMGA 3T3PE 5I28A 3QNZA 2LABA 2ZP0T 5E6UB 3VWJD 2PABA 3DVFA 4F2MA 3PDDA 2G3ZA 3H7LA 3WTTA 3BKCH 3RHWK 2VMJA 3K71B 4FOMA 1KIUB 1SHXA 3JT2A 1A6ZB 4X8JA 3IDJB 3UC2A 4J27A 3PWVB 1A1MA 4HEPG 2WM0A 3HR6A 4RISL 4A7GF 4WFED 1MCCA 3QULA 1PFOA 3L3GB 5B3JF 2J5LB 3AS3A 1FE8L 3WIHA 1I85A 3CLFL 5AUMA 1A4JA 3T4YB 3M8OL 4QHKI 4B9IA 5I2IA 3CFDB 1BQRA 1I1AC 1OGAE 1Z9OA 2XWZA 5LUMA 4KHTH 3ROOA 3II1A 4WHCA 3PXHA 2VDOL 4HT1L 4OI9A 4AT6A 4WW2F 4DKTA 3AG4B 2X2HA 4UANA 2O5YL 3ZRFC 1RHFA 3GXIA 5GISL 2NX5A 2PW2A 3F6IA 3O3UN 2A6IA 4XN8A 4FA7B 3BVXA 5KYUB 2X1WL 2JE8A 4QRSB 1A4KB 4H4NA 4NUJB 3BYTA 1DQDH 5T1KD 4JZOB 3FQRA 3VWJB 5I6OA 4U6YB 2N4IA 3IT8D 4DP8X 3FULA 5TFSL 4TNEA 1FDLH 2X6CA 4PHXA 1O9VA 3JWOL 2E27H 1FNAA 4X80H 3RGVA 3KYMB 3EYFB 5CEXA 4XN2A 5D6CA 3PXJA 1UA6H 1IUZA 3IJYB 3KPRA 5F6HI 4F7PA 3FN0H 3OBAA 2YAEA 1KTKE 3DNKA 5BQ7A 2WQRA 3HC2A 4PJ8A 2OZ4A 1K4DB 3VRJB 3S36X 1AGCA 1BEYL 4U6HB 4AC2A 2NR6C 3ULUH 2Y1YA 3GWJA 1UCBL 5ITBL 1PCSA 2XA8L 4FFWD 4O2EB 4OJEH 1PQZB 1U8LA 1TQUA 5ACLA 1YUHB 3QJFA 5F1IB 4JPWH 3ARYA 5DQDL 1NBZA 2OM5A 4HEPA 1U3NA 2KDYA 4OTXL 4X7TB 1HNYA 3U9UA 4KH2A 1F4XH 2FX8H 3F7QA 3MBWA 5T1KB 2V33A 4PU2A 1BVNT 4JM2F 4KNSA 4ODXA 2YWZA 4P5KA 1LVEA 1QSFA 1ZV9A 4AEHL 3CFJA 2H6PA 2IH3A 1TTAA 1QTPA 3F12A 2WXLA 1HZLA 4DFIA 3OGOE 3ZL2A 5FW6A 1WUNT 4NQXB 3VSUA 5E4OA 2GC4C 3FQUB 3VFNA 4HFWB 3BKMH 4K7PH 1RFDL 3QG7L 4YZWA 3PHQB 4PYHA 2Q86A 2UYLA 3DX7A 2P7TB 4ZUTA 1L0XA 1FVCB 2ZUQB 1P2CA 3DOHA 3I3EA 4IKIA 2TSAA 4UZSA 3WSQH 3AACA 2L04A 3T0VA 3HB3C 4U1NA 2LR4A 2EADA 1SEBB 1GYCA 4M62L 4OD3H 5KSUA 5LNDA 4OZFB 4JQXC 4DO5A 3R7QA 2NYYD 3ZIMA 3N1MC 2EDDA 4Z7QE 4YHYC 4GW4A 5GJSL 1YJDC 1ZLSL 1KEGH 3QE5A 3GSXB 4YXHL 5FDYA 2P24B 5E00A 2N7BA 3CHOA 3GS0A 3NIFB 1MCOH 3OKOA 1HC1A 4ES8A 3LDBC 3QJXA 3KMDA 4KKRA 4OCMC 1DJYA 2ZUSA 2AXFB 4C56A 1G9MH 1UM4H 3BAEH 4H26A 3K2UL 4GKOA 1SF5A 5ANHA 1WAAA 4ZO8A 5KSBE 4UZGA 4NQDD 1CICA 4FE9A 5EDXA 3S5LB 3UAJC 3ZT6A 3FN3A 3AWEA 1HSAA 4GEJA 5MHSE 1SOQA 2E5EA 1YEEH 3INUL 4AYSA 2BNQE 2OV0A 2GJPA 2MOVA 4AYGA 1A7PH 2XICA 3C2SA 3ULVL 3R18A 1KFGA 2VC2H 1FDLL 4G8FA 4HUWA 4H8WC 2FJFA 3S7GA 5C6TH 3BT2H 2WJ7A 1HHJB 5KBNC 4LSRL 2E7LA 4AYDC 3X11B 3DGGB 4NERA 3PL6B 4WJ5B 4F33B 1DBBH 2AABH 3HRZC 3KGUA 4LAJH 5DK0B 3MNWA 1NGWA 3KWTA 2XCMC 2NW2A 1LQBC 3AAZB 2OL3L 3QC5X 5E6IC 3CFIC 1EFQA 4PR5A 3ULUL 4O2FB 3HHMA 3FU6A 2VXVH 2B2XH 2DH3A 3QIUB 2GI7A 3PP3H 2VDNB 4XOBA 4YFLF 1YC7A 5EWIL 3SKOB 4DP4X 1H3PL 1JTOA 2I7OA 2NY4D 5FO2A 1N0LB 1N2RB 4E5XG 1AXTH 5KOVC 1S3RA 2ADFH 3OMZA 1WFOA 4KJYA 2WTOA 5F7EH 1N67A 2H2SD 3OTTA 1T7XA 2EUVA 2IFGA 3ME0B 5FV2A 1GZHC 3KNBB 3D3VD 2PWGA 4FG0A 4WVRA 2MCMA 2W9EH 5LCVA 2BVOB 2GJ6A 2PYEE 2FYVA 4WKZB 1YPZA 4YHML 2C4FU 4BSVB 5C0JA 1J8HD 4B9ZA 4P3CL 3M1OA 4YO0A 4HZLB 3C5JA 4QOKE 4UAOB 2KT6A 4HGMA 2E47A 5FGBC 3SQBB 1FJ1A 2ZTBA 3HS0B 5LLIC 2CLRB 2ZCLL 2F74B 4K7PL 5I82A 3K4DA 3DX2A 3V0GA 2V7HB 1LL1A 4IMLA 5D7LA 2JJVA 1MUJA 3FO9B 1WBXA 3QHFH 1NPNA 3L3DB 3QZMA 4NRYA 4WJKB 1VSCA 4MA3A 2V6HA 5IF0A 5ID0A 1AC6A 2NY4B 4HUVA 4N0UB 2E75C 1FFRA 1N19A 1FZOB 5IUCA 3QIBA 4KUCD 4MJJA 2P26A 5C07E 1OTUD 5DLLA 5AVZB 5C9JA 3D3VB 1S2EA 5FO8B 2CIKA 2VM3A 3ILPB 2QDWA 1KXQA 5A3ID 4YVUA 4GKZA 3P02A 1G6VK 1XMWA 5DMYA 2YBRB 5EBGA 5LAPA 4YBLB 4ZUVA 1J8HB 1MCOL 2DYPA 1KENL 3E3QE 1UKSA 4ZW6A 4K5OA 5E1HB 3P0YH 4HP5A 4DESA 2XY1A 4ZMYA 2NXZD 5HD8C 4E5XA 5JHDD 4RRPM 2XVLA 1KXVA 4G7RB 4WFGD 3APDA 2ZKXA 4NRZA 3NACH 1SZNA 3E1F1 3EH4B 2VE6B 5I1LA 3DJZA 2XWXA 2NYZA 2O30A 2ZSVA 5LGHL 4LFHD 4L0YA 1RU9H 3Q13A 1YEEL 3QT2A 2HX8A 4OFVA 1S9WB 1RZIA 2IDUA 5C0AE 3AROA 1KJVB 1IB5A 1TQBC 4L29B 4XXWC 1J10A 3QG6B 3EADA 4ACPA 1BLNA 4MCYB 4I8DA 2BW5A 4GKSB 3ZYJA 5IGXH 4OLUH 1F2XK 5GS2D 4G9DB 2AABL 1HSBB 1AZNA 2DLGA 1J88A 2DWEB 4KK6D 4NLHA 5K33A 2QFRA 3MHZA 1MXDA 5DC4B 2H2PD 4UT9A 3NIGF 1YEDA 3MFFA 4X6DB 3ULSB 1MAKA 2ZXGA 3DVNB 2VXVL 2YAPA 4IS6A 5IR1B 1G7QB 4I2XB 2NXZB 3LRMA 2R1YB 4AC4A 5JHDB 2NNXA 3BVVA 1L9RA 1XD1A 3FB6A 4KOBA 4PRHD 4PWJA 4MNGE 2HLAA 1KB5L 1FYTD 4X6EA 3OMAB 1MZYA 8FABB 3IETA 5CJ5A 1YPZF 4FAAB 2XYBA 3K72B 3EFFA 3FUJA 2YEZA 4FG6D 1OAKH 2WZ0A 4G6FD 4TVPH 1P4IH 4IEFB 2NDFA 4M6NH 1NOAA 3QWRA 4I0PA 3B2UC 1I8MA 1OVZA 5HDWA 4Z9KB 1ZHBA 1J5DA 3MLUL 2A99A 1CGSL 1XCTB 5FCUL 1G9EA 3OKKB 4KI5C 4U0RC 4FHBD 1MVFA 3OJDA 1H8SA 4X4KA 3HHRB 3QHFL 1H8NA 3FO2B 4A7VA 1I4FB 5ETUB 5D1QE 4J8RA 5CEZH 4JFDE 1IT9H 4RMRA 3BYYA 1FI8C 4G11A 3WXVH 1KWKA 3O41A 4PRHB 3D39A 5E1AB 4L8BB 1HCYA 3VNYA 1RIUL 3Q8EA 1FYTB 5I71B 4WU7B 4JL1A 2E9GA 5EPMB 4XNYL 4R4FH 4M3KB 3WNJA 4G6FB 3L5JA 3FU7A 1QEXA 1PLBA 4HXBL 5A2FA 5JPNB 2BVUA 3SO3B 1RMFH 1ZVSB 2O5XH 5DRNB 3SE9H 5I74B 3G5ZB 3VFUB 1F90L 3CDGB 1PGRB 3QARA 2EIMB 1UWYA 4ISVA 3EOBA 5D7JA 4ORGB 3SPHA 3NACL 5AAPA 5IB2B 3UAAA 5GRVK 4R97B 3EGXB 3FS9A 2OYKA 3J2PA 2DM4A 2KERA 1OP5K 1EAPB 5IBTH 4AYEC 2E9IA 1SXNA 3NABH 1A64A 3L16A 2TAAA 3U79A 2C9SA 1HVXA 4Q9BA 4YUEH 4FXKA 4KJPD 1LD9A 1T4KA 1U8JA 4JFYB 2J5WA 4PBVC 4Y4FB 5F3BB 1GC1H 3ZDXE 2YD0A 4P57A 5IGXL 5LVEA 4DGWC 4MB3A 2G0KA 1G9NH 2BY2A 2FEDC 2HRHA 3PLYA 4TLTA 4CA4A 2X70B 5TGBA 5L0QC 3TNMB 3S4SG 2V5YA 1ORSB 1ULVA 3SKMB 4EOWH 1BEXA 3EXJA 4FFYL 2N59A 4LOUC 1QFHA 3LD8B 3T2OA 4R7NA 3FW6A 1P5VA 1PZSA 3ARWA 4ZUWA 4NCDA 2VR7A 3I02A 4QAMB 1A7QL 1FL5B 4ONFH 1U8QA 4QI3A 1PIFA 1BD2E 3QZLA 3NGBC 5CS7A 5LAXB 4NQVB 1CLZH 3FTYA 1YEKH 5B22A 5HVGB 3ZRSA 2QVFB 3CDZA 1EHXA 1A4BA 1OAKL 1BJMA 2GJZA 4TVPL 5GIRA 1QTYT 3UTQB 1H6UA 2F8OA 4XP4H 3NZUA 2HVBA 1Z9SA 2VGLM 3TFBA 4UM8A 2ITFA 4PGCA 2D8KA 1IZJA 3PQYD 4JY6A 4NM4L 3WY3A 4ZTPH 3DURB 2DLHA 1EHLH 3N1PC 1A4AA 3SDXE 5HYSG 3HI5L 1ETZB 4WWKD 4C4BA 1CDGA 2FBJH 2VQTA 4YK4B 1OM9A 3IK2A 1P1VA 5E08L 5KVGH 3S36H 4FZ8H 1ET8A 4XVOA 1G6RB 2YD4A 5ESQA 3O0LA 4QCIA 3FHAA 4PI2A 4G80A 1JCVA 2Y7NA 3SKJH 5CJXA 1Z2KA 1XR9B 1OB0A 43C9A 3OB8A 2BZCA 2W65A 5A43C 3QWNA 1IE4A 5DUJA 2ZIDA 4JGNA 3S4SA 2RQEA 5HJGA 1A6TA 5T3XE 2O5XL 3WGUB 3SE9L 5D1ZD 2OL3A 3NCYS 5K39A 2BWQA 5DUBA 3UBHA 1WCBA 1HHIB 1NTDA 2H5UA 1PJ9A 3PQYB 1B2WH 2CK0L 4CVWA 2I07A 4BFIA 4KXZI 1JV2B 4WWKB 3Q3GA 2QTVA 3APCA 4HIHA 1YQVL 1RIVH 2KZKA 1NCCL 3ZSTA 1JGVH 4JLRB 2FECL 5E2WL 4OD2B 3WNOA 2I60L 2ADGB 2JTDA 2MTAA 3FO0L 4N20A 4WSGA 2YA0A 3B8SA 5E8EA 4AVKA 2CR6A 4RBPK 1BZ7A 4XODA 4OGYL 1RHHA 1G0YR 4L9LA 3SDDB 1CZ8L 1G9NL 4K3DH 5HYSA 1JPGB 5TE7L 5GGSB 4K9EL 3HNTH 5FUZH 5JW5A 2VQUA 2A4ZA 5FF6A 3MLWH 3PGFL 5D1ZB 2ZAHA 3KYOA 5LB1A 4XPAL 2HJKB 4JPKH 5E70A 2ZPKH 1J7VR 2DMBA 3WLWD 4CMHB 2X9WA 1ZEAH 4ONFL 2XHNA 4KQ4L 3SYCA 1M7IB 3MLXL 4P9ML 4YZFF 4AQAB 4TKWA 3ZKSD 3FTGB 3MV7D 3RVVC 3KJ6H 2W8CA 3AMKA 3FRPG 3L9RA 3M1CA 1T1ZA 2VLME 4HBCH 5FWRA 4MMXA 2VZTA 3CFKA 1T1XB 2VXTL 4K7FA 2ORBH 2BW4A 4ZO7A 1AD0A 3TFKC 1DN0B 2XACC 4Y88A 3V0DA 5ICYB 3MO1A 1OP9A 4KK9C 2F6AA 4GSQA 1T66C 1GMEA 3JZYA 5CM1A 1PL3A 4EI5A 2ZNXA 3MR9A 2AAVA 5I73B 3ULVF 4JPVL 1MCKA 1W0VA 5DXWA 4H8HA 3KLHC 5HHMD 4EIZC 5EO0B 2OJEB 4LHUD 2WYHA 3ECUA 1D5MA 4DEUA 4M1DL 3TO2A 2PW1A 5F0LB 3V6ZB 3MV7B 3S5ZA 4QEGA 1AR2A 1JZFA 3BLPX 1KBPA 3VAEA 5DEGA 1U8HA 3GTVA 4MDRA 4M5YH 4YFEA 5C0EB 2A9AA 3EYQD 3TBBA 3TZVC 4DP5X 4KROD 5KBLA 1KFAL 5IVXA 2AQQA 4JO2L 3ZTNH 4NC1E 3N04A 3OKNB 3RDTC 2UUDK 4GG8B 3KM1A 4OZIA 4YLQT 2NXYC 4UT6H 1IJ9A 5HVHC 2FB4H 2HP4A 1ETJA 4UILH 2EE3A 5DMKB 4GAFB 4I77H 3MLRL 2AGJL 3H54A 4LIQH 5J13C 1KB5A 4AVHA 1E3XA 3FRPA 3MJ6A 5IVZB 3CNKA 3HMWH 4AZ8A 2ZKYA 1A1OB 2GIXA 5B38B 3BPNB 4N2EA 3PYCA 2WOYA 5D2NB 4F93B 5HHMB 1JVOA 3IFPA 4KQ3L 4LHUB 3I84A 4U1JB 1J1XH 1UZ6E 2X44D 3HLAA 4XAWH 1U93A 3QXDA 2MSPA 2WUCL 2K3TA 3WMPA 3ZIYA 2D9CA 4LF3B 4IBWA 1H15A 3AZUA 4AENA 5I75B 3MLWL 3HZYB 1AO7A 1P0SE 4NP4H 2VSDA 1K2DA 3I9IA 5C0BE 4UNTA 3S3PA 1IL1A 5IQMA 5KAQG 2DLIA 4IJ3B 1OD7A 3PWPD 4NQEE 1DVFD 3O45A 2F7IA 2RD0A 2B1AH 3EHBD 3DYPA 1JNNL 1L9OA 2XV3A 2FATL 1KNOA 3DO3A 3KBPA 1QLEL 3II3A 2BY1A 3UACA 1BIIA 1BQKA 4XX1E 4KITB 1EANA 3RWJB 1RZFH 1MNUH 5ANMA 4L37B 3CHQA 4DPBX 4HKXB 3MX0B 5I19H 2C5DC 2O6CA 3E80A 2OQJB 5MI0C 4XI5D 4Y2DC 2NNRA 1INQB 3VO0A 2XWBA 5KVMC 2R56L 5B1BB 1A3RL 2P5WA 2R0WL 3GIZL 1BM3L 3BIKA 1IQDB 1MEXH 2B5IB 2GBTA 2NUPB 4MZ3A 4EVNB 2WZ5A 4PW3A 4RGNC 4PREB 1NCDL 3TV3L 3PWPB 2QKIA 5BZWA 2VLKD 2WC7A 2H32H 1MCBA 2IPKA 3NN8A 3WOVA 4BWWA 1DL7L 3EHBB 5IVXF 5HGBA 1ZHLB 5L88H 3EGSA 4N2DA 1ZLVK 4PJCE 3Q0HA 4F2EA 1WYJA 4OZIF 4GP5B 2WNGA 3ZTNL 2PWDA 4G1MA 2NTFA 2ADJA 4PJEA 4FFYA 2VR8A 2CO4A 1H9VA 5DLMH 1ROWA 2L3BA 3US0A 2DTMH 4PJ5E 3GUTB 4K8RL 1NCNA 1I82A 3HCVB 4PJDB 5HDBF 4XNMB 1GRWA 2HAZA 4HVBA 1DQMH 5BRZA 1MFNA 5JUEH 2FIKA 2G5BB 2WQUA 5D4JA 3MRFA 3ZDZE 3KGRA 4V1DD 1TENA 1AD9A 1V3KA 2BS71 1CGYA 1CUOA 2WQAA 4KKCD 1GA2A 4O9HL 4TNVF 3GNML 4PJHA 4DKFL 2I85A 4K4KA 1FPTL 5T3ZL 5JZ7D 2OR9L 2IIJA 3GINA 4OI7A 4XOEA 1CFSA 1KBBA 3JYBA 3US9A 3HZMA 2Q3ZA 5F7DA 4CDHA 4XAWL 3GBMH 4HUUB 4NZTL 5I1GH 4MQXC 1OT2A 4B7LA 4P2QE 2VLKB 2WSPA 3BZEB 2F53D 4PGBA 4L23A 4OGZA 4MMZB 4XZUA 5AB2A 5MENA 2VAJA 4JQIH 2JKSA 2BNUA 4GRWE 1X5AA 4NP4L 3JWNC 1D7BA 4E41A 4RAVA 5MP6H 3FB8A 5INCA 1V3MA 1R3KB 3LS4L 2J8UB 2NY2C 2EDWA 4FFZH 2PCFB 1KPUA 3DXAD 1OP5H 4GSXA 4HDIB 3O6LH 1CXIA 4ESKA 2DOCA 4BUQA 2NNAB 1ZIAA 1OOWA 1SJHA 1MI5A 1SXZA 5C0ND 1UXLA 3ETBF 3VXPA 5DK3A 3P9LB 2B14A 1D5ZA 3MRJA 4HS3A 2UWEE 1X4XA 1EBPA 2BHUA 3BGMB 2DF3A 2YAHA 2CDGB 1L5GA 1T7VA 1J12A 1BJ8A 2F53B 2W0PA 3EOTL 4I0KA 5F7AA 3WJJA 1DQQA 1QG3A 3GHPA 1WFNA 2HT2C 2OMVA 2ZWNA 2CJTA 3Q5OA 5JW4Q 1IC0A 2KZBA 1HT6A 1QOKA 2DQGL 3MRNB 3VRLF 2C7FA 2CIIA 4YL4A 1TZHB 3IDIA 3FT4A 5EUOA 5CUSH 1EZVX 2XWEA 4KNUA 4HBQA 1HYSD 1UM6H 3DXAB 2EO9A 4GUPA 1CO1A 1TZAA 3QQ3B 1KCUH 1U95A 4FYTA 4APXA 2HG5A 5DZOA 5L7XL 1PZUB 5L88L 4MBRA 1OCWH 5C0DA 1JUFB 5F7UA 1KGCD 4AMKL 1B88A 2HFFA 4JHAH 4WRLA 2OMNA 5KAQF 5F72S 4HCRH 1U8MB 3FQWA 3FZUC 4JMXA 2DJMA 4X4XB 3ZTDC 5I1AA 2RHEA 5HDRA 2Y2YA 3DVGA 1A1NA 1ID5I 5E5MA 5SWZE 4PJHF 3CPLA 4JO4H 5MEOA 2VL5B 1WFIA 4NBZB 1W0WB 3QZPA 3KLQA 4QXGL 4M6ML 2GUOB 1S7TB 4BQCA 3BEVB 3R06B 3SPIA 2G2RB 3SZKC 3QRFM 1FNGA 3ZE0E 4JDTH 3Q05A 2AJZB 3MRLA 3ALXA 1BBJB 3PFQA 4U05A 4XBGA 2V3EA 1BSIA 3M46A 2KPWA 3ZBMA 4XBPB 3NFNB 2G75A 1ZWIB 2IDTA 2BIHA 4OGAD 3WS6C 3RY6A 3QZWB 3C08H 3C5ZC 5MP6L 3P2TA 5HGGS 3PWLB 4GRLD 4UTBL 4Z76A 3VD3A 3KZ8A 2ZX5A 4I13B 3VXSA 3SJVA 4UQ3A 2A83B 2C1OA 4L0ZA 2DH2A 4HJGB 4BFEA 4PJ9D 2J56A 3O6LL 1VCAA 1MW0A 3N1GC 2XFXB 2ATKB 4PRIA 5AW0B 4HH9B 5TH2B 3QEQA 4XVJH 4LNRB 3V0JA 4PJIB 1IGFH 5DJXA 4RBPH 3UTSD 3X17A 1XF2A 2X4RB 4RA0C 4JCWA 5LQBH 3FU8A 4GMTL 1N59A 3ZTEA 1PFCA 4ZDHA 2P45B 1I3RB 2ZG3A 3AADB 3LZPA 1DZBA 4AV5A 3SGEH 1AAJA 4U2YA 3U82B 3ESPA 4RWYH 5E8PB 1N70A 4QXUH 4BD4A 1S78D 1XAKA 4Y16C 3VX1A 4ALAL 1HH9B 4UOJA 2UY7B 3B9KA 2WINA 1WZAA 2VAAB 3QXVA 3Q48A 4GRLB 3G6JF 2XSKA 4LOFA 2Y2TA 4U49A 4X99A 2YA1A 3LNEA 4E9SA 5CGYC 3LZNA 1UM6L 2XFGB 1A25A 2P5EB 4PJ9B 1IC7L 4WO4A 1RCYA 1C7SA 3B2DC 4ZW8A 2N0KA 1Q1JH 5GGVY 2XBDA 5HXMA 1ZTMA 4TULH 2ZXEB 1HKFA 3D06A 3VCLB 1OCWL 3MJWA 5F7MC 2X6VA 3UTSB 1MY5A 3LEVH 1DUZA 1AQDB 4P23D 3HLKA 5AB0A 2WVVB 1DVSA 4KKZA 1AGBB 3CJJA 3POHA 3S3CB 4Z23A 2D2CC 2NY5H 2WUBH 3JV6A 4NBYB 3LEYL 3T08A 2ZUWA 3UJTL 3TJHC 5JOEA 3IKCB 5LGKA 2JQZA 1E5CA 3BHBA 2XN9A 1H5BA 1NFDA 4NHCL 2OTUA 1XGTB 1HX0A 5HI3D 4G9FE 2Y5TB 3OKLB 5GGQL 1PX8A 3NA4A 1Y6KR 4KTYA 1IKOP 3DOIA 3FCSA 5CN1A 4JDTL 4S1SL 1ZHKB 2BJML 4FF9A 3OM3B 3S6CA 3KDMB 4KTEH 3QJOA 3V7MA 1PG7W 2VDNH 4YIQB 1I8KA 4WHDA 5BUPA 5GZNA 4KY1L 2IAMD 3GB7A 1KG0B 3QUGA 4U7MA 2AKRA 1X9UA 4A66A 3WNNA 2UUDH 1UB6A 2VLLA 4PP1C 2V7NB 3ARGD 4AW7A 1WICA 4GW5B 3VI3A 1S7XA 3RIFF 4PGDA 5T1MA 4ZW7A 2WN2A 1HL4A 3W9EA 4JRYE 3BH9B 3CVBA 3OKEB 2C7UB 4KAQH 5G4NA 1O6SA 2D03H 5C0CA 4WY7H 1EXUB 3N44B 2ODHA 2ZX9A 4Z0BL 4YN3A 1XF3A 4DO6A 4K94H 1B0GA 2IGFL 1BAWA 2YAQA 4FI6A 3T0EB 1KIRA 3BESR 4P3DA 3S3SA 1TJHH 2FWOA 3L45A 2E4FA 3KE0A 3C6LD 2UZXB 2V8MA 1QABA 2Z4TA 3F65A 3Q1EA 1P5UC 1YG9A 2UVEA 4X9IA 5E6YA 4DN4L 5JHLH 2AJSL 2IAMB 4QXUL 7FABH 5IQ7L 1LXMA 4R7VA 5K1VA 3O9WA 4JDEB 1KOAA 1AC0A 1Q72L 2W60A 3KXFA 5E8NB 5L9DL 1NJ9A 2FCBA 3O8XD 4KVNL 5CMAB 3QQDB 4N2OA 3WFEL 1Q9WA 5I0VA 5ISZE 1GPOH 2YC1A 5CHNB 3TWCH 1MVYA 1PTZA 2X53A 2XQYK 1UQSA 4OV5B 4Y4KC 1QNZL 3GSRA 5D7KE 4TULL 5DFWH 4R9HA 4V2BA 4TNWF 1IGTB 2FLMA 1TF4A 2JB6A 3D0LB 3AGVA 3D25B 5E23A 4KQ0A 2J4WL 4NT6B 2NLJB 1SVBA 1JTPA 1JD7A 1QLFA 2WKOA 4LBEA 4X0NA 5BXFA 2ZAGA 1T2JA 2FD6H 3FCTA 4N1EA 4HWZB 4BSWB 3H9HA 1ZPLA 5IKCA 5F9WB 3AXLB 4NZRH 2OSWA 5I30L 4C8XA 4ES9A 3QO0A 4NWTH 4OVVA 4HIEA 4F2ME 1KCVH 1SJXA 4AE1A 4S1QH 4LLQB 1NFDF 2YZ8A 4R3SA 2JELH 2VN5A 3WKPA 1TLKA 3BFWA 4JO1H 4HUKB 3FT2A 1FFPA 1MAJA 3LKPB 3O8XB 4X9YA 1WZKA 5FA3B 5DRZB 4UNVA 2QVKA 3TBSB 1A8ZA 1BFSA 2NQDA 5FAAA 3NCXA 1BZQK 3HR5A 5EOQH 4XE0A 3NFPB 4HWEL 1E9OA 5KJ4A 3ESNA 4KTEL 1XHHA 5J3HC 2BNQD 2VDNL 4DVBB 3IPEA 1JNHA 3BAWA 1ZLVH 3SYQA 3TS8A 1JHLH 1KELH 1P1ZA 4B5ZA 3BN9C 4FQ1H 4RAHA 5CF3A 3EO0B 1D3CA 1SYVB 3WTVA 1AZUA 2NX5E 3A21A 1VACA 4XWOD 5FDWA 3VW3H 3C5SA 3DVIA 4YSSA 4JG0H 4K3EH 3VI3F 2BSEA 4F8PA 3F7RA 3R19A 5T33H 2VABA 1JWMB 4DP1X 5I0ZA 4P99A 1EO8L 5IM7A 4ZXBC 2WXHA 2FWLB 2O5ZL 1V10A 1LILA 1M05A 2VDKB 3BPCB 1LO2H 3GXTA 5IHLB 1QRNA 5A2BA 3WAJA 3R7RA 1FC1A 4QNPF 2X10A 4GUOA 3KPRE 2EDTA 5F93C 4U1IB 5GS2H 1AFVH 2X7LB 4BK5C 2J6EL 2VN4A 1S7VA 2YUVA 3HEIB 5H2BB 1TJHL 1OM3L 4P04A 1JIBA 4M6OH 5IMMA 5DJDB 4M93C 3QNYB 2I26N 1BXAA 2RR3A 3O4LD 4P2OC 4F24A 3CIAA 4YHLH 1AYOA 4WI3A 3W5NA 1FNSH 4HFUH 5JHLL 1U8PB 3EBGA 3VFOA 2HTLC 1P4BL 1QPPA 1TZOA 2LHAA 3DJ9A 4ZS7H 4I5BB 4LDLB 1OPGH 35C8H 5AW9B 3OC8A 4DUVA 4FMVA 4BQBA 3TWCL 2Q7YA 1E9QA 1V7NH 1JPTL 1OLLA 5E2TH 4V2CB 3H1ZA 1QSFE 4GQZA 3SDYH 2L8AA 3IMUA 1DO6A 4H88H 5BVJA 2OLDA 5BO1H 1G7PB 1N6QH 4OCSL 2H9GA 1E8WA 5LWYL 5LGJA 3QORC 2K4WA 2WY3B 4WHYG 1SDYA 2WKOF 4N90E 5DVKA 1DJWA 1EXHA 2RH0A 3FHQA 4ZX3A 1X5FA 1F3JA 2PR4H 4OH2A 5DJ6B 5F96L 3LNGA 4EIGB 4K3JH 1C9SA 5IB3B 3BUBA 5J0BA 3O4LB 5E9DD 4MSWA 4ZQTA 3LKNB 4UTBA 4EN3B 5TDNB 5FO9B 4HCGA 1A2YA 4M61A 1HHGB 2C9VA 1FAIL 3IMSA 2FO4A 3GJFK 5IBUB 3VSQA 1NGYA 1AIZA 2E7MA 1JDAA 1R33A 2I9LB 1G7IA 3B9DA 1N5AA 1MRFH 1YEFH 2X4SA 1WTLA 2VZOA 4HOZA 3KL3A 3QUHA 4AGLA 4P48A 4HD5A 1S7QB 4C56E 3WL9A 2AK4A 1E4XL 4H13C 1GKEA 1WAAE 3CX5J 3RWCB 1YUKB 1I1RA 2BZ7A 3DX0A 3FNKA 5L6YL 4DFHA 4PN6A 2EILB 3CG8A 4PLOB 4AJVA 3P3UA 2DI8A 4RVBA 4GPVA 3MA7B 1FZKB 5T33L 3U4AA 1TEYA 3K71A 5I6NA 1KIUA 2EDBA 1A6ZA 4BRJA 3IDJA 3PWVA 4M29A 5E9DB 1OW0A 1MHHB 2IBBA 4EPSA 3A47A 3FUHA 3VFWB 3L3GA 2DM2A 4JGMA 2PO6C 4JFQB 3T4YA 3CFDA 3QJTB 1EGJH 1Y1UA 1NBVL 1AFVL 3MREB 1E2VA 1BAFL 3IMWA 4PWHA 3V52L 1R3LB 4WK4B 2D2OA 1OAXH 4YHLL 5KYUA 2DQCH 4QRSA 1A4KA 3R1GH 4KZ0A 4NUJA 4ZTEA 5IT2L 5K59F 4HJJH 4JZOA 3VWJA 5BZDB 1QFUH 4U6YA 4LCWD 3F7LA 3KCPB 4X2UA 4JY5L 5FA4B 2GJ6E 1B2YA 1AR1C 3SY6A 3KYMA 2ZJSH 1YPZE 2G60L 3EYFA 4CU8A 2N1KA 1J0YA 2FZ3B 3T4AC 4HJIA 1J5OL 4OZFG 3IJYA 3VVVA 5EH1A 4PV1C 3NAAL 3F5WB 1E4HA 1YAIA 2XWJB 5HHOD 2L4OA 3VRJA 1RUML 2DQTL 4U6HA 3HG2A 1NCBL 1C5DB 5DRXB 4NNYB 5KANG 4S1DC 4UDTA 5DJAB 2BSCA 4KU1A 4HWNA 5D7LE 4O2EA 5M94B 1PQZA 4TQIA 2EEFA 3S35X 4HHGA 1MOEA 1YUHA 4L2LA 1F58H 4ANVA 5F1IA 4FNTA 3S5LG 1P7KB 3CXHJ 3E6FB 4X7TA 5JOPD 2P8MB 3FUIA 3HKFA 4N9OB 2MIZA 4BFRA 1F0LA 4NNXB 5A2AA 2XVGA 5T1KA 3N42B 3W57A 2OAAA 3L17A 2EDNA 3GKWL 3CDFA 2Y6TE 1WH0A 4LCWB 2OMXB 4M7LL 4MXQC 4QYOB 4XMLH 1MIML 3NPSB 1CGXA 1KXQE 3C2AL 1XCQB 4L05A 3SGJC 4JY4B 2QEJA 3QRBA 1NCGA 4NQXA 2D3NA 2ZWSA 2LVEA 3OXRB 3AT8A 3FQUA 1O9WA 4GQPH 4HFWA 1JHKH 4PEEA 3A22A 5J1TC 4MA1C 3PHQA 3V0EA 5HHOB 1A66A 1DFBH 2P7TA 3BMWA 5FYJU 2YPVL 1FVCA 4XO5A 3KBFA 2X42A 5I6LA 3IMBA 1BAGA 1CYGA 5G5DB 1YEGH 4NO5B 5JO5A 4M4PA 2NNCA 4EEEA 3AQXA 1NLBL 4OZFA 1GYUA 3KLDA 3Q5YA 1QUNB 3OKYA 1WIOA 4PLKC 5ITFB 1XH2A 5DHXB 1HXMB 2XRAL 1E5YA 3GSXA 4JRXB 5C1MB 2P24A 4Y5YB 2WGXA 1DLFH 3K6NA 4PS4L 4XP9H 1MF2H 2AXFA 4OZ4B 7PCYA 1WFTA 3AS2A 4RWHA 4EKJA 1M2OA 5KYNA 2F0CA 2WSKA 3PNRB 1FA4A 1NLDH 4QWWD 1NCWH 3LJ3A 3S5LA 1G6RL 5ACMA 1IM9D 4YQXL 5ACZB 2YLHA 3GSNH 2WLLB 4G7YH 2D7TL 2ZX6A 1PEWA 4PI0A 2J21A 4G8EB 4ODHH 1GS7A 4PUBL 1NGZB 3ILEA 2OJ1A 4NZUH 4NO3B 1QO3B 2E7DA 3QDAA 3L9YA 1HHJA 3Q01A 5F7LB 2F5BH 3X11A 3DGGA 3PL6A 4WJ5A 4F33A 1CGWA 1RUAH 3GC3A 5CLYA 2ICWJ 2ZP8A 5DK0A 4JPSA 1KJ2H 1HDMB 3AAZA 3TBYB 2P42B 4K3HA 3BRFA 5FUCE 4O2FA 1HNFA 1I1AD 3GDCA 3QIUA 5EB9A 4DP9X 3SKOA 2XTJE 2CGRH 4HJEA 3P11H 1N0LA 1A3ZA 1LEKB 1N2RA 4Q58C 3MOAH 1RZGB 1YEIH 2OP4L 4BYHA 2E46A 1I9JL 4FG4A 1IM9B 3ME0A 4X5RA 3KNBA 2WXJA 2HRGA 2BVOA 3D39E 2G3XA 4UAHA 3OHMB 4WKZA 3UZVB 1W72B 1YO4A 3OXSB 4LPVA 2DEYX 5T3XD 4BSVA 1MCJA 2JJSA 1X44A 4HZLA 5I5RA 3ARXA 5HPMA 2I9TB 3SQBA 1P84K 4QRBA 5IJDC 1XSIA 3M7FB 2Q8BH 2WLKA 1SQMA 1R9FA 3HS0A 3K91A 4W4OC 5ELIA 3TA3D 4DT2A 4Y1AB 2CLRA 2J6EA 2F74A 4AZUA 3F7YB 2G2NA 2HXAA 5D70L 2V7HA 2CQVA 1MPAL 4KKAC 3FO9A 4MASA 1WA0X 3NRPA 4LQ1A 3L3DA 4POZD 1I1AB 2NR6D 1JXKA 5D96C 5JHLA 4NC1C 4N0UA 4XP6L 1GGYA 3HZVB 1FZOA 3L3HB 2Y1ZA 1QA9B 3C6EA 4CADB 3DIDA 5IFJB 5GJTL 3L95B 3D07A 4ERSL 1NANH 1RVFH 1TQSA 3D3VA 4LFHG 5FO8A 3ILPA 2CPUA 1G0DA 3CFCH 1WJ3A 3RVWC 4Z95H 1SJEB 2YBRA 5D5MB 1J8HA 2BDNH 5LDSA 4NGHH 4R7XA 2GQHA 1ML0A 1IBYA 3QDGB 3IYLW 3W11C 4ODBD 1JTTA 3DC0A 1BF2A 1T89C 2JFCA 5ICZB 3NJMA 1P7HL 2OMTB 3BE1L 1I8LC 2VE6A 2ODIA 4OZHB 2APSA 5ILTH 2JKTM 4BHUA 2ZOUA 4K73A 4Y9EA 3QA3B 1GIGL 4PV8B 5M7QA 4ODHL 1S9WA 4X7EC 4EDXB 1J0IA 3W38A 1KJVA 3UBGA 3VG0H 4L29A 4WFFE 1GS6X 1A6WH 1AZRA 3QG6A 4PCKA 4MQSB 4MCYA 2Q7AA 4YZFE 4F8LA 3TBCA 1ZV2A 3CXFA 4GKSA 1JZ6A 3H4FA 4ZK8A 4G9DA 2OR7A 4KVCH 1HSBA 4XNXL 2DWEA 4OM1H 3U4BH 2ZWZA 1ZIBA 1HTYA 3JZ7A 4RMWA 5AG9A 1NBCA 1Q90A 2VOTA 5JIIA 2LQRA 1FF5A 4BXVA 4GUCA 4X6DA 3ULSA 3X3GL 4U2ZA 2GYSA 5TE4H 5DGQA 5IR1A 3ARPA 1WWCA 1G7QA 2VXSL 3DI2B 5CNHA 3VXMD 4I2XA 1BQHB 2R1YA 5JHDA 4LCCC 5IW1B 3BXNB 5KW9H 1ETB1 3MOAL 3H56A 4F7TB 1CE1L 4PJFB 5IHUL 4XVTL 2GVYA 3P4MB 2K0RA 8FABA 3ESMA 4XHQA 3K72A 3ULVE 1XGYL 3L3OC 2KI6A 2YOCA 3Q2CA 2GBUA 1KGJA 4FNPA 4IEFA 4JKLA 4XO3A 2BO0A 4Z7WB 1Z6JT 5IROC 2XXGA 4O5LL 3ETTA 2OW6A 5D6DC 3CE1A 4YPGB 5EO9B 3WKYA 2C3VB 1S5IH 3HB3B 1XCTA 4GAAA 3OKKA 3NDYE 4J3VA 2DRUA 1CBVH 3EW3B 4YHYB 2YAFA 1QBBA 3ULUE 1CYWA 4FLOA 3E8UH 5E6ID 4HJTA 4Q0XH 3ALWA 5FYLD 3LDBB 3FO2A 2DLFL 1I4FA 3B83A 4KUZH 4UBDD 2R0KL 1WWAX 5ETUA 1ANUA 4PJAB 4LLAA 3PJLA 1KGIA 2ITDB 2AP2A 4PRHA 5E1AA 2X4OB 2VXUH 3P54A 4L8BA 1FYTA 2BVTA 5DHVH 4WU7A 1F4YH 1FGVL 2DN7A 2JI1A 1EK3A 3MPCA 3HAEB 5EPMA 2XWTB 3RVTC 3SOBL 1KGYE 4P5MB 3S9DB 5JXEC 1CC3A 5JPNA 3VU1A 3GJFH 1ZVSA 3HN5A 4LEXH 5DRNA 1LNUB 1H3XA 3CN1A 3G5ZA 4B0MB 3QRGL 1T5WB 3VFUA 3NSCA 3CDGA 4J3TA 5IB2A 3RZCC 4ORGA 2ENYA 3K74B 3V2AR 1RAMA 3V8OA 3EGXA 3ATFA 3SBQA 3HRZB 2IEPA 2BNRD 4U6VH 1EAPA 2FO8A 3PWNB 5E6IB 3O6ML 4AYBA 2F1BA 3EJZD 1QBLL 3QCTH 4FQ2L 4MJ2A 4XWGH 1NGPL 5J57B 1LO5B 3RTLA 3QIWC 3MYJB 2HKFH 3OQ3B 2UZIH 4KUCF 1S3KL 2X3BA 3EH5B 3GK8L 4FQJH 1CMOA 5AAWC 4JFYA 4H20L 1FBIH 4Y4FA 4Y7OC 5F3BA 3BUTA 4JFZL 2EXYC 3NEOA 4JM4L 3P0VH 4GG6F 4NZFA 1U91B 4FQXC 5JMRA 4D9LH 1PZ3A 2X70A 1XB8A 1I9EA 3PHOB 1QLRB 1MFEL 3TNMA 3SKMA 1INDH 1ORSA 1Q38A 1RZKH 4LLVB 2FGWL 1IGYB 1QWNA 4JFFD 1VFBB 3I9GH 4YWGL 3B5TA 3SYPA 3BH4A 1J0JA 1RKRA 3L5WA 4MKMA 4JFVA 1AZVA 1BFTA 2YPVA 4HCFA 1NSNL 4I0CC 1FL5A 2ZONA 3VM5A 4YDKL 5LAXA 1RUPL 2BNRB 1WLHA 1BZ8A 4NQVA 4O58H 3FCBA 3V0HA 3CVHH 4TQEH 1FQ9C 3VGAC 5AYTA 3UTQA 3SE3A 5BV7C 3NCJL 1NCJA 4GQQA 4KMLB 3T9WA 3UBFA 2BHFA 1WWWX 5TPWH 2JLLA 2W5PA 5CFHA 1EEQA 2Z34A 3DURA 5HYIA 4P9HH 1U8NB 5KSVB 1ETZA 5IVXE 1KB9J 1CBVL 1PLGH 3U6XA 4FN0A 4LGSB 3BDYL 5T1DL 4OFPA 3WXWH 3X3FL 2XKUA 1LM8V 2EIZB 4OZIE 5IFAH 4JFFB 3W9DB 4LLUB 4IMKC 1G6RA 2YGQA 1IAIL 5JXAL 4BBWA 4KUZL 4W6WB 1F1GA 4LSDA 5GGTL 3Q9PA 1Q9KB 5AZEH 1ICTA 5HDBE 3S35H 3LQAC 5ENWB 2QHLA 1SUJA 1NIEA 1XR9A 3VG9B 3Q1SH 4HK0B 2OJZL 2PWFA 3B5GA 3LS5H 4WJG3 4XNZC 3G6DH 2QPFA 3AW5A 5LBVA 2AEQL 4NFDA 5DS8B 1DEDA 1TQBB 3BUIA 3Q8CA 3B2UD 2YR3A 4IIZA 1AKJD 1HHIA 3PQYA 1DE4B 1S46A 1CD1B 4OCNC 1I7ZB 4N26A 2HG0A 2WZPA 3VWKC 4W9CC 1AO7E 1JV2A 4KI5D 4WWKA 4FQHB 2DIJA 2NMSA 1QASA 1DBJL 2Q3XA 4U6VL 3OLGA 1A3QA 1N9PA 4FLSA 4QXVA 4HOXA 4ZD3H 3QCTL 2Z4QB 2ZYIA 4JLRA 2AC0A 2KQMA 1K3IA 4OD2A 3H7BB 4DPAX 2ADGA 5IVOA 5C09D 3HMXL 1F3RB 3O4OC 4PWGA 4LCYB 2WLIB 1N6UA 4QRRD 1FFQA 4HHAB 1CIDA 5BVPH 3BQUC 1IVLA 1MWAH 4EUPB 2VUKA 1I7UA 2VW4A 1JPGA 2H47C 2BFGA 1FWXA 3GS4A 3E1ZA 4JKPL 5GGSA 2WIIB 1SQ2N 2CM6A 4F5CA 3IGAB 2W9LA 5ANME 1YNTB 3JV0A 5J89A 3GSWB 5D1ZA 1A6AB 3DTXB 1ZXKA 5GRUH 2HJKA 3S3BB 2R4RH 3TYFB 5ADPL 2DQHL 4LEOB 1FZJB 1M7IA 4U0RB 1F45A 1B6UA 2P5WE 4O58L 4AQAA 1OGTB 3FTGA 2R29H 3ECVA 3C87A 1OSZB 1II4E 5A2LH 3VRLE 2G30A 4D9RD 4AMWA 1R34A 2F7OA 5EOCH 4WWNA 1G1OA 5I15L 3AM8C 1TLMA 5B38G 1T1XA 3T0BA 4BCXA 3BVUA 2MQ3A 4QRRB 1J5IA 1SN0A 4DO4A 3MLSL 1X7QB 4LHUG 2DWSA 1DN0A 3BFOA 3I6LD 2OYMA 3LRLA 5GS0L 2J88H 2FEDD 3PF2A 4JL2A 5ICYA 2TRHA 4PJEE 5DC0A 1OE3A 5IFAL 3BIAX 5FUOL 5B1CA 3S48A 3ESOA 1JXJA 2A9BA 4LOUD 5BRZE 3LN9A 4C47A 1S9XB 1LO0L 1IBGH 4WO0A 5EO0A 2C26A 1UJTA 2OJEA 4K7PY 3TCTA 4N68A 4PJHE 4HLZH 2Z92B 2E6PA 4TVPE 1TO4A 3LRKA 4IJTA 4WTWA 2YO3A 1OXYA 2R15A 3MV7A 1E5BA 3M86A 5DFTA 3V6ZA 1H3GA 4L5FL 4DK5A 1UD3A 3MLVH 4S10A 4CNIB 5C0EA 2FEJA 1OCOB 1G9HA 4JFEE 4BK8A 3T6ZA 4WCYH 3NZHL 3PPEA 1SDAB 3OKNA 3KYNB 4TXVB 4GG8A 5MENE 2B4CH 1D7CA 5I1EL 3KM2A 2QV2A 6CGTA 2EDJA 5KWYC 1GZPB 4YBQC 1PG7L 4IBTA 2YEQA 1YHPA 5DMKA 4E41E 5FFLA 1DJSA 4Y9GA 5L0QB 1FUNA 1E2ZA 3PS6A 3U7AA 4FCHA 1F86A 2X6AA 4UQ2B 2WXNA 5IVZA 4N2HA 5ES4B 1DQKA 1A1OA 5B38A 5D2NA 4C83B 1Z9LA 4GI9A 3ARTA 4LHUA 4CL7A 3D34A 4U1JA 4MJ4A 1MI5E 3L5XH 3UG3A 2CGZA 4Z8FL 2YXMA 4BGLA 1E2WA 2YSSB 6PAZA 3BAJA 4X6BB 4LF3A 1NIBA 5CCKH 4JGUA 3F58H 1FGNH 3HZYA 3ARSA 1CLOL 5TJWK 3K6SB 1NBYB 2LW3A 3CC1A 2MHAB 3BD5A 1FNHA 4N86A 4EQ2A 4L1LA 3BZ5A 4I1NB 2EXWC 3QUZC 2HFTA 1YDPB 3NQKA 3IGLA 1HHKB 1F97A 3MA9H 5EUOE 1KJ3H 2XG5B 1Q94B 3JWDC 4J3OH 4B9GA 1BVKB 4NJ9H 4DK6A 2VDRH 3WD5H 3O0RL 3QHZL 4ZUSB 2QT6A 3CX2A 3SPGA 3IFOB 3MBEC 1T83A 3EOAB 1Y7VA 4LL4A 3RWJA 3S8GB 3F84A 4L37A 2LU3A 3CV5A 4QUOA 1URZA 3C8KB 3GSOB 1MFBH 3MX0A 4HKXA 4ZMLA 4GT7A 4KK5D 3SDAD 2OQJA 1LP9B 1INQA 1AI1L 1V54B 5BW7A 2GEQA 5JNYB 3F64A 1NGQH 2IDFA 1R0AL 2AQSA 1DBKH 5T5FL 1IBGL 3VXNB 1IQDA 1RZ7L 3BKYL 5CBAB 2A4CA 2H26B 2NUPA 5JR1H 3FAWA 4EVNA 4PREA 2HRPL 1BFVH 5H4YA 4R7DB 2CH8A 3PWPA 4NO2B 4J4PD 4MAYC 3RVVD 3KWVA 2CBPA 1M1SA 4AE0A 3MLVL 1TQWA 1ZHLA 4N2NA 2JKIS 4KNTA 1OHZA 5C2UB 2CRZA 2WWKO 1GJIA 1JGLL 2JJTA 2X9XA 3OPUA 1EDYA 3FH7A 3L3KB 3W39B 3GUTA 1UD8A 4HXAL 5I1KH 4Y4HC 3HCVA 3TFKD 4PJDA 1ZVYA 4XNMA 1ZA3B 2CG9X 1CBJA 3BZDA 4KK9D 4NN7C 2G5BA 1T66D 1WUZA 3OJMB 3SDAB 3UABA 5EO1B 2HTKC 5LXVA 3A6CH 1I1CA 3GI9H 25C8H 2B3RA 5CR8A 2ISDA 3VXSE 1CR9H 3SJVE 5JPMC 3PAYA 1GS8A 1EA9C 2AMGA 2BVQB 2RALA 1XGQB 2IFFH 4PRIE 5LXGH 3KLHD 2AJ3B 1CTNA 4ICWA 4O02H 4MDIB 4AWJC 2O5NA 3QEQE 4HUUA 4IRJD 4F91B 2IAND 4M7JL 3MRRB 1QNIA 2VLKA 2VDPH 1CFBA 3KYKH 3BZEA 1G84A 4B97A 3RGVC 2R39A 4MMZA 3MBXH 3IDUA 3VA2C 1CB4A 3RAJH 4R8WL 4BIKA 2XX0A 2B08A 5E2UL 4FX5A 3F6JA 3TZVD 4YSQA 5HHXH 5F3FA 3SPVB 1ADQL 4GNKB 4J23A 4P4KC 3RDTD 1JZ8A 1RUQL 2R2EB 1KEML 2OK0H 1BW8A 2NXYD 3OAUH 1R3KA 4BCZA 5C0RH 1C08B 2J8UA 4O4YL 1AQ8A 3CLWA 5GGTA 5EBLB 5HYFA 2PCFA 4TSCL 4TMPA 3U2JA 3J8F7 4HDIA 1L7TH 4V1DA 4BEIA 4LSPL 2J1ZA 2FSDA 3FCGA 3V4LA 2QQKH 2NNAA 4PJBB 3FTVA 4YEFA 5AYUL 3P9LA 1TCMA 2A7BA 2VW6A 2D3LA 3WTXA 3BGMA 3VFSB 4E9YA 2CDGA 3FOMB 1E4KA 2LT9A 4IRJB 2IANB 4XPTL 3OJ2C 1AY1H 4JR9L 1JZHA 2F53A 1REIA 1R5VB 3FTZA 1A65A 5CLWA 3K1KC 5AEAA 3APMA 4KRNA 2EIDA 3TZVB 3CGTA 2PWHA 1QQDB 1IBBA 3BP5B 3QAZC 3MRNA 3QZWG 2NCMA 4GAGL 4UM9D 3RDTB 1TZHA 3FYEB 1M7UA 2VDKL 1LWRA 2NXYB 3LZFH 3HMXA 5HVHB 2XN9E 2Z93B 4AM0Q 3DXAA 1W2KT 1S7SB 1PZCA 3KHQA 1NFDE 4XP1H 3QQ3A 2YPLD 5J13B 1NMAH 2CJUH 3O3AB 3O6KH 4XNBA 1RH8A 3QUMH 5I8OL 1CURA 3UADA 1BYOA 1JUFA 3LMJL 3PAZA 1KTJA 3GHBH 4IU3B 3GPEA 4O2CB 3G08B 1F2QA 4LSTH 2GTWB 4FD0A 4Y5VC 4PJDF 1U8MA 2L0DA 3GBEA 3RZWA 4X4XA 1ZS8B 3RIKA 3KYAA 1CQYA 4A2GA 2MQ0A 3H4HA 5IIEB 3DPBB 4ONGH 3ZO0A 4ODWB 2WKLA 3GI9L 4Y2DD 4NQCB 2VL5A 1GGTA 4XCCH 3VI3E 1W0WA 4DGYH 1BFOB 2GUOA 5ABZA 1S7TA 4UM9B 3BEVA 1ASPA 3R06A 1RZJH 5C0CE 3MRCB 4NUGH 2G2RA 3V4PH 1WZ1H 4QNPE 2AJZA 4S1RL 2FWUA 2YPLB 1BBJA 4DN3H 4P46D 4NJAH 4XBPA 1VCBC 3NFNA 1N5YH 4PRBB 4RX4D 3NVQA 3T77B 4YEEA 3B9VA 4ZS6D 1ZWIA 4YDIH 1THAA 3F62A 3QZWA 5KVDL 2WD0A 2J8UF 1JZ5A 1FORL 2AQ1A 3PWLA 2OX5B 2EE2A 4OB5H 1QSFD 4HC1L 3Q06A 1DTUA 2A83A 3KXFE 4FFTA 4HJGA 3LHPH 4N25A 5HI4C 1F3DH 4CDGC 2XFXA 2ATKA 5MI0B 1RLWA 1XCWA 4Y2DB 2QQKL 4HH9A 4KK8C 4RMBA 3SOTA 5T3ZE 4OLXH 5TH2A 4GSDL 4OSUL 1GH7A 2VJ0A 4LNRA 1TYRA 2N7SA 3WO4C 4PJIA 3BP4B 5CIPH 4A7TA 2F61A 1RI8A 2YS4A 2X4RA 1A6UH 2SODB 3MGTB 1MJ7L 3LZLA 3WENA 3IDMB 1WFJA 4RGNB 15C8H 1T5XB 1I3RA 3NJJA 4LLWB 4UOW0 2CUAA 2EVJA 4I3SL 1NCIA 2K7PA 3P3TA 5CN2A 3DTDA 4DOHB 4P46B 1JL8A 5E8PA 1NDTA 3DHUA 1ZANH 2XYCA 4HJ1A 1HH9A 4FNLL 1VKXB 2UY7A 4Y1SA 2VAAA 4GRLA 4UI2A 3H42L 4XN9A 5EA0H 2HX7A 1VERA 4I89A 2P5EA 4EKXA 1P6FA 4PJ9A 1SHMA 2RMNA 1OAQH 4G5ZH 4YDLC 4AH2B 3GXUB 2E6JA 2CJUL 2ZSWB 2X0UA 2AVFA 4G59C 4NI6A 1Z3GL 5DR5H 3IXAB 4UMGA 3VCLA 4QY8B 2YIHA 1ZE3C 3WEBA 2PWEA 3UTSA 4H2CA 1AQDA 1JZEA 1YY9C 3SCMC 4TNFA 3IRPX 2WVVA 1Q0XL 4B7IA 2I5YH 1AGBA 2H0FA 2DM3A 4TQ8A 1U3HD 3KD4A 2PYFB 4ZMXA 3L2NA 4AI7A 4NO0D 4ONGL 1E4WL 3NDZE 1BYNA 3IKCA 1NC2D 2ARJB 5DZPA 2K3HA 2C3GA 2HT2D 3ZT7A 2IH8A 1ORQB 1WZLA 1HH6B 2VNCA 1QI3A 3OAYK 1XGTA 2DYSB 1QRNE 2Y5TA 3OKLA 1IIIA 3QP3A 2MRYA 4NUGL 5B8CC 3KR3L 2B1HH 2CXGA 5DT1L 1KYAA 4R4NC 1ZHKA 1P6WA 5E7FA 3KDMA 5KANI 3QAQA 1QSVA 4YIQA 2G3NA 1RZ8B 1KG0A 4ZO9A 4YDIL 1PY9A 2FNWA 4OQ1A 5F21B 5AVVB 5GGRB 5IEKB 4KKPA 1J5HA 1WA1X 2G5UA 1KCRL 2V7NA 3FZUD 2C34A 1CLCA 2HX9A 3L3JB 4GW5A 3VFGH 1U3HB 2I32A 3QPXL 5T5FA 5K59E 1K4CB 3P30H 4NN5C 4NO0B 4TSAH 3BPOC 3BH9A 1NC2B 3M88A 2C7UA 3IFLH 1EXUA 2VRKA 5GS3A 3H0TB 5K69A 3FHEA 1UH4A 4BFGA 2AMUA 4GAJH 5D7LD 3MMEB 5DUPH 3T0EA 1OZTG 2DTSA 2WBKA 3F7PC 1MXGA 1SLUA 3TJPA 1QZ1A 3NIGB 2YD5A 2OI9C 4CGTA 5FOBB 2YRLA 4NX0A 4F1ZA 1PDKB 2UZXA 1E5UI 1TCRB 4WTXA 5JIMA 1MN4A 3DK2A 3THML 3CFNA 1PAMA 4YDZA 5F9AC 2M83A 3B1UA 2V2TA 2IAMA 1HXYB 1OLZA 3RU8H 4KV5F 4JDEA 1PS3A 2VISB 4LP5A 5E8NA 1NKRA 5CMAA 3QQDA 3RL2B 3C5ZD 4APQC 2WHVA 4N0CC 5CHNA 5ALCH 3UTPE 5I1DB 2N01B 2ZWYA 2LAAA 4FP8H 5AW1B 5I1CL 2HVJB 5T3XH 4HGWB 4MA8H 4UV7H 5L4IA 4OV5A 3BSHA 4MD5B 4XN5A 1EVUA 3D52A 4KPHL 1IGTA 1WD9A 3JWOC 3ZKMD 3D0LA 3D25A 4NT6A 2NLJA 3RWDB 2AK4E 1TZGH 2EQDA 1BF8A 4PJGB 3LNIA 4BSWA 4HWZA 1ADQA 4A6YB 4Q14A 2EH8L 2YSTA 3AXLA 3KL5A 1T1WB 4FQQB 3T3MF 3DX8B 4HMDA 1X5YA 5HP5A 4DIXA 4LLQA 3CN0A 3VXUD 4QJ4B 1CK0L 3V5HB 4TL4A 5CU5A 3LKPA 3O8XA 1LTXA 1NCHA 2DIEA 4Y16D 4U33A 1XFPA 3C5ZB 5DRZA 5EOCJ 2GHWB 5FA3A 3TBSA 3VYPA 2Z7WA 3HZKB 3AY4A 1FV1B 1ODAA 1ASOA 3UZQB 3HHSB 1X5HA 3NFPA 3TTYA 3H9YA 2QHRH 4KHXL 3Q7JA 5LHDA 3LB6C 4ATWA 2QSTA 3EO0A 1SYVA 1O7SA 2F08A 2WYIA 4O00A 2RFXB 2RQ8A 4FQIH 1PZ5B 4BHUI 1N7MH 1T2QH 1YRKA 5ESVB 3KPPB 3RB7A 3IDYC 1W72L 3P30L 1GGCL 3BPCA 3N44F 5TE6L 3TJHD 4MRBA 4BWUA 1XB6A 3AU1B 3EBAA 3VXUB 4Q6IC 5J5EA 4NAQA 2FHFA 4UTAL 1FO0B 1KCSH 4U1IA 5IBUG 4Y16B 2GB2A 3PUCA 3C09C 2X7LA 4WFEE 1FFNB 4AQEB 1SYSB 5A6MA 5JQ6H 5H2BA 2H0EA 4TN9A 5BS0D 5B1JA 5EEYA 1SOSA 5AL8A 3ZQWA 3QNYA 3UC0H 5DWUL 4NCC2 1QSED 2PNDA 4GXVL 2DBLL 1E4XI 1J1OL 2Y2WA 2CPCA 2MPAH 1U8PA 3E7JA 5CZVH 3PE9A 1U3ZA 3IF1B 5J6GB 1G43A 5D4QA 4I5BA 4F9PA 1NUFA 3KPLB 4J6IA 1JK9B 1ID2A 3NJNA 4XT1C 4DWHA 4PP1D 3V55A 1NCUA 4R5XA 3WFBH 5GSRB 3MNZB 2A9NH 4MA8L 5I16B 3D09A 2XTLA 4GSRA 5KBPA 4BUHA 4GT0A 2BP3A 5CJXC 1Z66A 5EBMB 1U30A 1G7PA 5EU7E 5G4MA 3B9AA 4P5TD 1FLRH 3LH9A 4X6FB 3QS2A 3H6AA 1RJLB 2FK9A 3L7FB 3ZX1A 1LEIB 2Y69B 5E8OB 2Q10A 1TSHA 4BZ2L 4K9JA 1JRHL 4MCMA 2XKNB 5BS0B 5EF1A 5DJ6A 4ZMWA 5KVEL 4RRPG 5JIKA 2HLFC 5IB3A 5J9PB 3LKOB 3NH7H 3O4LA 4RGOH 5DC2A 1QSEB 1TTBA 4HF5H 1TETH 3LKNA 3ULUC 1XIWC 3BZ4B 4XRCB 5TDNA 3WIFB 3WEOA 4I85A 4EN3A 4LSUL 5FO9A 2ERJC 4HC1A 1HHGA 3NFSH 2ZCHL 2WZAA 4OW6A 3T2LA 4BFKA 3C60C 1JPFB 2DZEA 4Z7VF 4ODVH 1YNLH 2I9LA 3TGXA 1LO4H 2HT3C 3NIFE 1WZMA 1R17A 1KBKA 5AAMA 1S7QA 4QO1B 1EV2E 3ZYZA 3EBHA 5EIQA 2EIBA 4W93A 3RWCA 2BP8B 4ZOAA 2B20A 4BZ1L 1EMTH 1RPKA 3S88L 3I6SA 4YHZL 3L8QA 4PPTA 3MA7A 1FZKA 1ESOA 1JJUA 2K6YA 3GEFA 3QJSB 4UDUB 3ZTJG 4HCIA 1VLXA 4XCFL 4R2GC 4KMQA 1T03H 4G6KL 1TEGA 5E9DA 1MHHA 4AIOA 1EPFA 5CP3H 3QUYC 1A7OH 3VFWA 4LSVH 4A04A 4AYID 2VMCA 4JFQA 5ADOH 4ZFGL 2UXVA 3MREA 4HUCA 5EU3B 5JQ6L 1UM5L 1XMEB 1QBMH 5HYQB 2EYTB 4XC3L 4LVHC 1R3LA 1UOVA 2VMEA 4RRPA 3L9EA 3RLSA 3VYOA 1BG1A 4ZAKC 3O2VH 1YN7B 1TVBB 2HKHL 2NNFA 3GHEL 3TT3L 4Y4KB 1HOEA 2FX7H 2MPAL 2XZQL 4DP7X 1A3LL 2X4TB 3EO1B 1Z7JA 1DJXA 1G9MC 3SDCC 4ZMZA 1HL5A 5BZDA 4L8DB 3BN9D 4DK3A 2PXYC 5D71H 3KCPA 5ERWB 5FA4A 3RYMA 3HNSL 4H25B 3T6VA 3VUAA 4L4TD 2FSEB 3S34H 1YZZA 4FNRA 2FZ3A 1MFVA 2A9NL 4ZXBD 2GKIA 1OSPH 3IJ7A 1A47A 3F5WA 2XWJA 3T6XA 1I9IH 1EAOA 4KXZH 1C5DA 2YAOA 5DRXA 4DGVL 4NNYA 4J3BA 3BCFA 1ACYH 5DJAA 4H8UA 4L3CB 3ABLB 3OAZK 4KMTH 5HJDA 1DDHB 1KYOK 1WHOA 3MU3A 2ROYA 1MLCB 5GGVH 5C07B 3D4ZA 1A6VH 5EOTB 3QR2A 4NWUL 3U1SL 4WTQA 5FYLL 1P7KA 4N0UE 3E6FA 1FVEB 2G3MA 4P2OD 2P8MA 1MG3C 4A2HA 2J2ZB 1DBMH 1MFAL 4NNXA 4LPTA 1F6AB 3DRQB 3GEWB 3NJLA 2HTLD 3VGGA 4FA6A 3MLTB 4NPJA 4LCWA 2OMXA 3P0GB 3D3VE 4QYOA 4QHLB 3HKZA 2LE9A 3KBHE 1A5FL 1XCQA 2QTEA 1JFQH 4MNHB 4L4TB 4N9GB 2ZXWB 4LGRB 3WFZA 4JY4A 1UT9A 1I7RB 1U33A 1J8HE 1FIGH 1RIHL 3CBRA 4WFHD 3OXRA 4ZXBB 1BHGA 3LPOA 4GRWH 4PLJC 4HSCX 2V5MA 4ZUUB 1ITBB 5HHOA 2H6OA 1G1CA 3B7TA 4EN2A 4LB8A 4AQZA 3O6FC 2Q87A 4QRPB 3UBXB 5DD0H 5IESL 2EE6A 2DQUL 4WWOA 2CHZA 4PJ6A 4NO5A 4ONHB 5CP7B 5G5DA 3HG4A 1PY4A 5FECB 4H1LH 4M93B 2J43A 4QHKJ 2HKAA 4JN1L 1QUNA 4P2OB 3W2DL 4TOYH 4LSVL 5ITFA 3VXOB 1IFHL 1HXMA 2R27A 3NT0A 2CBMA 4JRXA 5D2LB 4Y5YA 1J8KA 3ARVA 3OAYH 4DAGH 5FIEA 3GO1H 1DQLL 4OZ4A 1F1AA 1VGEL 3T2NH 5J6HB 5KYXB 4D7PA 3GZKA 3G9VA 4X6DE 4EI5D 3L08A 2MWCA 3GMLB 1S7UA 4I2XE 4KO9A 5JHDE 1J0HA 5K9JH 3UEZA 5D1ZI 5ACZA 2F19H 4LLDB 4G70B 4WFGE 2WLLA 1MG2C 2K8MA 1LLAA 1WT5C 3NJXA 3EJTA 4G8EA 4FC3E 1NGZA 3P9MB 3T1FB 3AG2B 1QO3A 3QORB 4NO3A 5D71L 1BBDL 2GTZB 5F6HJ 3VB8A 1K6QL 4KJWC 1Z9PA 1WTGT 4PJXB 3NRQA 2CUIA 5CR1A 4XB8A 5JIHA 3RIAF 3VXQB 1TIUA 1OSPL 1ZSDB 3MZTA 2O6EA 4MAUL 1HDMA 3TBYA 4J6RH 1KGWA 3QUXC 4GKNB 1IBZA 4JUSA 1W8EA 3O3DB 1OKEA 3VI4B 3DIFB 5INDB 1NBQA 3VMPA 2FIRT 5I5MA 1LEKA 4RLDA 5AD0B 3BKJL 4NHUB 1NWPA 2RCSL 5ALBL 3RY5A 1RZGA 3D5OF 3ZJAA 5I1JH 1GJUA 4OCWH 5FYJL 3BX7C 2VZVA 2GITB 4F2FA 1IM9A 1BXVA 3CFBB 1IC1A 3N42F 3JTTB 4FI8A 5F7WC 3L48A 4KKBC 4PRHE 4FXGC 3UZVA 1BGXH 1F3DJ 1W72A 3OXSA 1BWWA 1FYTE 2DQIH 4FULA 1DLHB 2GK0B 2NSMA 3DHJA 2EYRB 1FH5H 3B4NA 5I24A 5F7BA 2X41A 5JW3H 3KGTA 2G9KA 2I9TA 1DUYB 1NMBL 4UTAA 3UZEC 1FIGL 2XZCH 3VXRD 2GBVA 4AGOA 1HOCB 4KRLB 4Y1AA 3F7YA 2XV6B 2FUQA 1VPOH 1KTBA 2GUYA 4N2FA 1T5KA 4EZMA 2PO6B 2DQDL 4K23H 3GF8A 4XPBL 1D6VL 3K7UA 2WLHA 1I1AA 2AQRA 3CBJB 2IADB 1FSKC 1NUNB 1EUTA 4KJQC 1BQHG 4MXWL 4N5EC 3HZVA 1A21A 2PTUA 2IWFA 3L3HA 1U8KB 5DHYB 1QA9A 4CADA 5IFJA 5CZRA 3HC3L 4LDEB 4RGOL 3AXHA 4PTTB 5AVSB 3U7YH 3L95A 3TL5A 2CUMA 2W9DH 3ZU8A 2X89D 4TOYL 1AP2B 1NL0L 1SRDA 2E9JA 4UIKH 5DA4A 5DMGC 2VSCA 4X9HA 1SJEA 4HPYH 4WTZG 5D5MA 4YPJA 3UJJH 1RK1B 3AFLA 3PXLA 2V9TA 3GO1L 1SY6L 1GTFA 4G6MH 3EFDL 3QDGA 3IRCA 2OMZB 4X6CF 1AR1B 2DWXA 3EFOB 5ICZA 5IP4A 4KGJA 3TASA 3VXRB 4LLYB 3T4AB 2OMTA 3TA3A 1HEJC 1QYGL 4JPQA 2R0LH 1ZT7B 2VDMB 2P5WD 4OZHA 4BZ2A 5AOIA 1JV5B 3IWUA 1BQSA 3RE0A 4AQOA 3SPCA 3QA3A 4PV8A 4JJOA 3IJSB 3V6OC 2A1WH 5CEYB 3RVUC 2NR6A 1VB9A 2YFNA 3LXAA 4EDXA 1WDAA 3SGKC 2DMGA 4AL8H 1C12B 2J57A 1HHHA 1SXCA 2OMUB 2WXIA 4ODUB 4MXVF 5JTWA 3FMGL 3HIZA 3TCLB 1G1KA 3OF6D 2I69A 1IM3D 4I3RL 2APWA 1NANI 3VD1A 2CO3A 3UAFA 1WIPA 2XN1A 3AXIA 1UWXK 3HAEG 1TTFA 3B56A 4M43L 4P4RB 5E1QA 1EXGA 1AS7A 3UYOD 4MJID 3DV6B 4X83A 3WN5C 3PPSA 1GC1C 2H1PH 1P7QB 2VXQL 5F7FA 4TPRH 2EEDA 3TBTB 5KS9B 1BQHA 2NZ9C 5IW1A 3BXNA 4PV9B 4BZ1A 2FT7A 1G9NC 2QADC 4F7TA 2IVFC 4PJFA 5DZAA 3A4DA 1CGUA 3P4MA 4HUXB 2ZCKH 1VIWA 5DO2C 2EVFA 1XBDA 1D5IL 2FE0A 4MA1B 4OJFH 1BCIA 5IOKA 1ONQB 2AJUH 1DSFH 4FS0A 3VJ6B 4LSSH 3ZHDA 3IMVA 3VGFA 4WTZA 1E8XA 4DKEH 4Z7WA 4NENB 3QFDB 5DD5L 4YPGA 5EO9A 5D72L 5HYJD 2VQ4A 1JZJA 2IQAB 2C3VA 4IKLA 3VFPB 4JZJC 2MPVA 1IM3B 2Q76B 4HA1A 1KMGA 1CD0A 4JQXA 1J1PH 1JGDA 2VL4A 3A67L 2FLRT 4X9BA 4K55A 5CZKA 3PQYE 1IVTA 4BDVB 1JAEA 4XMTA 1VDGA 4LARH 4MJIB 4X5QA 2X12A 4M9PA 4XMWA 4X7DC 1IGJA 3CHXA 5KUKA 3MLYH 3ZE1F 2HCZX 1W8OA 4PJAA 3FUMA 4Y9FA 4G3YH 4HS8L 2ITDA 2X4OA 1NAMH 1FG9C 5H94B 2BHZA 1R1CA 3ZZLA 4FMKA 3UAJA 4M56A 5I5IA 3HAEA 5D5MF 2VDLB 2XWTA 4JDZB 4FDWA 4MS8C 4P5MA 2GJJA 3CSTA 4AGMA 1HKLH 1JGEB 1FG2B 3D18B 1IC5H 1LNUA 4KZEH 1T5WA 1CDCA 3GI8L 1Q0YL 2Y36H 4F5CE 5T1JA 4Z77B 1L9QA 4XHJC 1CFVH 4OZHF 1CLVA 2MFNA 5KYYB 2EIKB 3F04A 3HRZA 1IKNC 4DERA 5HDOA 4Q9CA 3PWNA 4KKAD 5E6IA 1JE6A 4PGJA 3D9AH 2DD8L 4FLHA 1LO5A 2CKBB 2CNZA 5I8EB 3MYJA 1IAII 1HWGB 1B4JL 2EDOA 4MJ6B 1M6UA 3NA9H 3IU4H 3N55A 4RFNC 4EAEA 2RJMA 3IGKA 1L9TA 5I0DA 1M57B 5CXPA 1ECYA 3BEWB 1KGUA 5FYKD 2GW5A 4KZDL 2AQ2A 4B41A 1EDQA 3CH1B 4L4JA 2B1OA 3UIZA 5DF0A 2OA9A 1U91A 2X4PB 3FQ1A 4RFOH 1GZHA 3PHOA 1QLRA 5EORL 1GGIL 4LLVA 1IGYA 1OARH 3RVWD 1GCFA 2BS8A 3QQ9C 1T7ZA 1VFBA 1TU2B 5GGUB 4GI8A 1C16B 2UVFA 2X9YA 4TPRL 3IJEB 3LXCA 3CSPA 4WO4C 4X7SL 3W11D 3OLEA 4CW1B 3CFEB 1KACB 3OKMB 1QHOA 4W1TA 3PV7A 4RH4A 5KJRH 2BNRA 1ED3B 1MSPA 3OMIB 5FKPB 1MELA 4Z7WF 1FHNA 3NMEA 3F3HA 3G6JB 3WIHH 4FG2A 3M6DA 5D96B 4JB9L 3CHRA 2WXGA 2P43B 3MV7E 2VB5A 4JFPB 5HHNB 2IPTH 3I9PA 4XN1A 3FT3B 2W07B 3EF7A 3OPZH 3RX7A 5D7EA 1U8NA 2XWCA 3IRZA 5KSVA 4EUPG 4UV4L 2B15A 5EZIH 1EERB 1QRKA 1CDIA 3QDMB 2EIZA 1F4HA 5IWLC 2JLPA 4LARL 4JFFA 3W9DA 4LLUA 2Z31D 1L9MA 3I9AA 3REWB 5I66B 5GQBA 3I6GB 4PJAF 2NQ3A 3OAZH 1HQRB 1DJHA 1Z5LB 4PRID 1Q9KA 1WGOA 3RL1B 4LOVA 2G4EA 3R4RA 5B1AB 2WWNA 5ENWA 3ZL1A 5DTFB 5GZNC 1ET7A 2Q5BA 5GS1C 4HK0A 1P6AB 2VWEE 3P3YA 5D2NE 5HHME 1T0NB 4DGIH 1SF3A 1UXWA 4Q6KA 3INOA 2OZ4H 1N4XH 1AJ7H 2W92A 5DS8A 5IROD 5C0BB 2GJRA 4XXWA 4U6TA 3TF4A 2NCEA 4L8SB 4KVPA 4PH8A 1DE4A 3RFZC 5F44A 1CD1A 2ITCB 3ZDYF 3AGWA 1I7ZA 4UT7H 4FQHA 2BCKB 2E7CA 3T65B 2F5AL 2Q2LA 1MDAA 3MOBH 3B9KD 2N3JA 2Z4QA 3D85D 1GYWA 3S96B 1E0OB 3H7BA 3VTMA 1QWUA 4XMPH 4FTVD 5HDQH 1TZ8A 1HE7A 3U6XS 3Q6GH 2FYYB 4LCCB 1JERA 2WLIA 4LCYA 4N4YB 4B27A 1OWWA 3CU1A 4ELDA 4HHAA 3IFNH 4G43B 4QRAA 4U1GC 1P9MC 5EU6D 4GP4B 4EUPA 4ZMVA 3HBGA 2WIIA 3MV11 3RVTD 5B7FA 3L3OB 5F8RC 5JXED 1YNTA 2Y7MA 5A2CA 3GSWA 3NCBB 1A6AA 1R3IL 3DTXA 3LQZB 1Z0MA 1YEHH 1E42A 1PW3A 2R9HC 3TYFA 3Q44A 4LRNH 3TEYA 3IS1X 4LEOA 1YECH 1FZJA 2R0ZH 2XN9D 4NUQA 4UU9B 5F71A 4W9JC 5KJRL 2Z35B 4YHNB 3LSOB 5C3LD 3APNA 1SN5A 1OGTA 3WNMA 3D85B 1OSZA 4W6YB 2L7UA 3BVNB 3QIWD 4FTVB 4GXUM 5C09A 1WQVT 1QW9A 1J8SA 3NZSA 4K7PX 3PWPE 4UYQA 5AL0A 1SVCP 1LDPL 5D4IA 5BOPA 4QRRA 5DYOB 1TJGH 2PP8A 1X7QA 1SY6A 4GP8B 4JRLA 3U9PL 5IOPB 5EU6B 2A4EA 4ABUA 5L2JB 3GDBA 1GGBH 2DEWX 4FQXD 3DV4A 1G4MA 4WIQA 4MZRA 1RPUA 1MHCB 1WS8A 1VADB 2DV6A 5FHBH 3QO1B 4PJDE 2ICEC 3PGDA 4HX1B 5DYFA 3MACH 1S9XA 3RFRA 1NM4A 1E9PB 4K0OA 1MCHA 2BSTB 4AK2A 3OQRA 3OZ9H 1PIGA 3CZUB 5DZJA 2Z92A 5E2VL 4GUQA 3UROR 3NJVA 4IBLT 5J8OA 2IG2H 2IBZX 5FFGA 4RAUB 1N4XL 1C5CH 4CNIA 5TQ0H 3QIWB 3MUJA 3V4UH 4YHOL 4MNQD 2VLKE 3OVUB 3G5WA 5ESAB 1JF6A 4FFVD 3CPUA 2ZZUT 4LL9A 3KYNA 4EDWH 3DUUB 4FABH 3EUUA 3WKML 1CYXA