1USQA

Complex of e. coli drae adhesin with chloramphenicol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
139
structure length
139
Chain Sequence
b'GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
molecule tags Adhesin
source organism Escherichia coli
publication title High Resolution Studies of the Afa/Dr Adhesin Drae and its Interaction with Chloramphenicol
pubmed doi rcsb
total genus 25
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 1usqA00
1USZA 1USQA 2JKLA 1UT1A 2IXQB 2BCMA 2VERA 2W5PA 2JKNA 2JKJA 1RXLA 1UT2A
chains in the Genus database with same CATH superfamily
1L6PA 1UYWL 3I6LD 3MLZL 3NPSB 3Q1SH 1RMFH 3IGAA 3NRPA 4GIOA 5IEKB 3HMWH 3ILPB 5J13C 2MRYA 3FT9A 3EF4A 1E9OB 4Z95L 1UWEH 3JWNG 4W9HC 4X6FA 4EE2A 1MNNA 3PG2A 5FUCE 4JRLA 4M7KL 1T2QH 2KMWA 4L1SA 3QHZL 2AJXH 3BSZL 4N22A 4OVVA 5HYJD 4L0PB 2BNQE 3T2LA 3GF8A 1QYGL 3ALXA 4HGKC 4Z0BL 4LEXH 1JE6A 1I9IH 1DVTA 1GJWA 4PJ7E 1NIBA 1RUKH 3DYOA 4M4RA 5BZDB 1ZVNA 1DFBH 4RRPM 5CP3H 5D9SA 5C0GB 3TA4D 1HYSD 3HAEG 4TSCH 2ROXA 1AQDA 5HJGA 2IH9A 3P0VL 2ZXQA 2FDBP 4ETQA 2DDQL 3D50A 1RZQA 2ORBL 4OR1A 1B0GA 1QASA 4E9YA 4HGMA 3PP4H 3FNKA 4NUPA 2P9RA 1KIPA 4WK0B 3IU3B 3BGMB 1WUZA 4WHYH 2P8LA 4LCCC 4G9DA 3MRGA 1S3RA 1HOCA 3D0VB 3DHMA 4JFOB 3S88L 1UJTA 2X7LA 2ENPA 2Z92B 1BQLH 2WQSA 5CS7A 3TP4A 4H1LA 4AYBA 1N64L 1ZT4A 2ZCKH 3S3DB 3GMOA 4L1BA 3HEIB 5D5MA 2Y7LA 5E03A 1KIUB 4PW4A 4DW2H 3BRFA 1VACB 2TRYA 3HHSB 3PWLB 5DEGB 2W9DH 4LCIH 2I32A 3T5WA 4HSCX 3GK8L 2V2XB 5C0GA 3BHBA 4LK4A 3IGFA 2CO3A 4K5OA 4CC4C 1FV1A 2PXYD 3U9PL 3B9KC 5FYJE 3AG4B 3MRCA 4HETA 3O3EB 2MNWA 2A9NL 3QO0A 5HDRA 2J12B 1IM9A 1AC0A 2B20A 5D70H 4Z76B 5JPMB 4PJBB 5BPPA 5DU7A 1KXHA 2P8LB 3ZDYB 1INDL 1DQDL 2EE0A 3M1CA 3W0WD 5T1DL 3VGBA 3RWJA 3WNPA 2NNAA 3RB5A 2YPVH 5BV7B 3P4MB 2R69H 1OP3K 1N0LA 1CN4A 3EYVA 2N3JA 3NFPB 3VDCA 5I75C 4R90H 2WP3T 5E9NA 4B7LA 2VITB 4U1SA 4OVUA 1R5WB 3KBHE 1XB3A 1LMKA 5CU9A 2QLVB 4JQXC 1LP9F 1THAA 4AG4H 3PXJA 2W60B 1HX0A 2APVA 2A2QT 2IAMA 4UWQB 5KVDL 3I75B 4PJ8A 1QKZH 3KJ4B 1WPCA 1CVRA 3AGWA 3L2NA 4ZFZB 1DSFH 2X1PA 1CR9L 2XWBB 1RZJC 1KTBA 5BMFL 5F0MB 1X5IA 1BQHG 1VPOH 4UQ2B 5E9DE 2AAVA 3OKMA 5HPMB 2R0WL 1ED3B 1T0MA 4FG6C 4CDGC 1PKQA 4XXCA 1H6TA 5CD3B 2DLEA 2I26N 3TN0B 5IB2B 1Y07A 1B2YA 4HUKB 3P9WB 3D3VA 2LQRA 4PJ8C 3IJEA 4PB9L 4Z7NF 5I1HL 1R5WA 4KXDA 3JZYA 4HIEA 1OGAB 1Q1PA 4B9FA 1PYWB 3OLDA 4OFPA 4X6BA 4Y5YA 5DUBA 1NDGB 4JQIH 5MHSD 5GGRY 4FFWD 4WGWB 3K6FA 4Y8AA 3ZHDA 3BCDA 1PZ3A 5AL0A 4CN4A 4R2GC 1KYOJ 2W94A 1QYGH 1YPZB 4FNSA 3SDAB 4RRPA 4JHVA 3GIVA 1B88A 4DQAA 3MRRB 1BECA 3BZDA 3GXDA 1PKQB 4XPAL 4JO1L 1EDYA 2DM2A 3NSCA 3FTUA 4K4KA 3TJHD 1OY3B 2YLKA 4OLZL 5E4IA 2RQEA 1DSWA 3IK2A 3N6YA 1JZ7A 1EX0A 3ARED 2BVQA 4J39A 5GS1B 4FNLH 4M7ZC 1E28A 4PJFA 1KNOB 1U9KA 5CGTA 1GHFH 4H0GA 4J3OD 2AJVH 1IO4C 5JW5B 5C92A 4IBZA 2OTWB 3MRKA 4KTDL 1F13A 2JKIS 5MEQB 4ZMXA 2VDLB 2ZSWA 3SJVE 5IV2B 1B4LA 2WK2A 3CXHJ 4L3ED 2YAFA 1OAQH 2DQ6A 4IKIA 4PWEA 4LLQB 1H3PH 3CFCL 4N0CD 2V5YA 5E9DA 5FDYA 3ZDYE 3CH8A 5C7XL 3ATFA 3NQIA 4HULB 2VZTA 3L1OL 2G2RA 2EYSB 1BD2A 1C8QA 3C75A 5D1QC 3WFBL 4X98A 4G8FA 1JGVL 4KO6A 4OUUA 2J20A 3QC5X 4AEHH 1QMUA 4XO5A 1SN2A 2BXYA 1NCWH 2CU9A 5IT2L 1SPDA 3FUKA 5ELIA 3DUSA 1IBGL 5DJ8B 5CKAA 4ZMQA 2NY7H 2QBWA 1J8HA 2VXUH 5MEQA 5AVYB 3GPSA 3UTQA 3DX9A 4GRWF 5EEWA 1EO5A 1P9MC 2PXYB 3O4LA 3VI4F 2Y07H 4EI5B 5ICXB 5ITFA 4NERA 2VL4A 2MKWA 3I6SA 5AAWC 3I9IA 2BNQA 3KPSE 3VYNA 1BGXL 1RZKC 1OALA 1A1MB 4BELD 1C7TA 3QIWA 1WLHA 1V7ML 5C6WH 2UUDH 2FBRA 1CLOL 2UZYA 3S35L 1NANH 4BWUA 1P5UC 3QPXL 4CW1A 5CWSA 3JVGC 1BM7A 3W9EA 2DTSA 4PYHA 4NDMB 5JA9A 1J5IA 3KMDA 5E1IA 1N5AB 5C3LD 4JRYD 5DUJA 5C2UB 1J8HB 1MQKH 1OT1A 3GKWH 2JELH 3MRBA 4ZMTA 4DQOH 3V0DA 1A7PL 1RVFL 1JGLH 1S7WB 2WN3A 5TQ0L 5ITFB 3Q1EA 5T33H 3V4VH 3GMMB 2Q7YA 5BNXD 2N0MA 5CZKA 3T0AA 2E9GA 2YJLA 1I3GH 1MH5A 3C60A 5C9KA 1WG3A 5JXAL 3A67L 4JAMB 4X80L 1S9VA 1KBKA 3CFBA 5E2TL 4M00A 4R7NA 4H88H 1E4WL 1ZHBB 2R29H 4OH2A 5CBEA 3R4DA 4HUWA 4PJ9D 3FU0A 5LG6A 3MZGB 5CLTA 4BK5A 2COVD 2XY1A 4YHLL 5E95B 2EDRA 5HYFA 5K9KB 1PCSA 3S5LB 1UZ6F 2OM5A 3E38A 2P43B 3QWRA 1IKNA 4QD2E 2VDOH 3QH3A 5DZPA 3Q6FA 3TVMD 3RGBA 3O4LE 2DWYA 4J5VA 2DJUA 3BKML 2R9HD 2W65B 1MCQA 4IMKA 4NUMA 5A16A 5J1AA 5CHNB 1E3XA 4Z7VE 3AFLA 3SDCD 2EDTA 1AZUA 3DMMA 3HNTL 4O02A 2VZSA 2KZ1B 4XMXA 1MUJB 1IEAA 3ARGA 2JK5A 1EAPB 3EJQA 3CXDH 3KZ8A 4YMPA 3RZCC 2XKNB 4M7ZB 4RFNB 1MG2C 5TE6H 5C0JB 3W5NA 1XB8A 3QR1A 4MSWA 4H25B 4O5LH 3NZ8B 4TKWA 3SO5A 2A74C 3HR6A 4N2GA 2WD0A 3G6JE 3S5LA 1OD9A 3T0EA 4Z9KB 5FCSH 4AZ8A 4DCQB 3SZKC 4MXQD 3G6AB 4GAGH 4N6RA 5E00B 3HPLB 2WGNB 4C56D 3SQOL 3UJTL 2VDPH 2A99A 4Y16D 3E7JA 3NP3A 2Z6FA 4YS4A 4WO4C 1LWJA 5A16B 3ATAA 3NAAH 5D1XA 1NWPA 1TPXB 4WNJA 5HGDA 1LE9B 1NGPH 3EYQC 2UZXA 5D1QB 3DX6A 3TZVA 1QZNA 4J23A 3N50A 5T3ZH 1BBJA 2K3TA 3RY6C 4U31A 4M6AA 5H2BA 2IDQA 2P8PA 1LDPL 3L4VA 4F2MB 4LL4A 1G9NH 2FO8A 3R1GL 4HGWB 3WKPA 4ONOA 1BFOA 3TYGH 3DX1A 1P6FA 5CILH 3SPVA 1J9SA 2TAAA 5DI8A 2NW2B 4PRPE 2XG4A 1TNMA 3QDHA 3TBSB 5I6XB 3TNMA 2QPFA 1RK1B 2Z91B 5CSGA 4QJ4B 3TU6A 4UQ3B 3UJTH 4FTVB 4JRFA 1EZVX 4XMPL 3MRQB 1CD0A 1CL7I 2CJTA 1S2EA 4JE0A 5ID1A 2EACA 3PQYE 3UTPD 3ZQXA 2WLZA 5E1AA 4DPRA 4OM1L 3MRMA 2DM7A 3TESA 3SY0B 2P24B 2H6UA 3HG2A 2RALA 4XXDB 5EU5B 3ALPA 1QI3A 3GSNA 3ZKMD 3ULVC 1HZHH 1A9BA 5EBLB 1LO5B 1M71A 3OPZH 1J0JA 1JF5A 3HRZB 4HXBH 5L9DH 5DFAA 2FR4A 3NRQA 4OCLC 3D69A 4TQIA 1KIQA 3L2MA 5D8JL 4IMKC 1N9PA 4LVNC 3B9KA 3DVGA 4PLKD 2Z91A 3MLVH 4XPTL 4KKPA 5K33A 2ZOUA 4JRWA 1QEWB 3ZE1B 4DT2A 2WBJA 1Y18A 3PHAA 1N6QH 3RWHA 1QPKA 1MZZA 5GRJH 4J27A 4O5LL 4X4YA 1RUPH 3NPZB 4XC3L 2BC4A 2H4EA 2VR6A 2XN1A 4WFED 1T04A 3HA0A 5DHEA 1Z2KA 2ZQKA 3OD3A 4ZUWA 4EKXA 3WNOA 3HNTH 4FQXB 3DSNA 4X2UA 1OGTA 2Y7SA 3CSFA 2FWSA 2EXYD 5EU4B 4F15B 1HE8A 2L7EA 4XN8A 4Z77B 4ZO9A 3HRZA 3MLXL 1I1AB 5J13B 1QD0A 5GRJL 1GH7A 1UT1A 2KLTA 1WQVT 4HD9A 2JIXD 3WJLA 5E5MB 5JMOC 5KSBA 2DQMA 5M95B 1R9FA 4N8PA 3HPJA 4TQHA 3M17A 4F8NA 1C8PA 5EO0B 2NY3D 5D8JH 3B34A 4QRPA 2HFEA 5C07E 5HY9A 2WKLA 3O6LH 4V1DD 3VFUB 4HLEA 2ALWA 2FIKA 4N25A 4WI4A 2ZUSA 3W0WB 4KJPD 3WNIA 4WJ5B 1AQKL 1YEJH 2EJ1A 4RGND 2QADD 2X42A 5E4OA 2J57A 3ESVF 4OZHE 5HYJA 3FMGH 3NAAL 4HG4K 3GRWH 3FU5A 4KKAD 4J3SA 4XC3H 1NFIB 3QDMA 1BQUA 1CGSH 4FQXA 3VXPA 1P7QB 5D2LB 5EZOH 3II2A 2IFGA 3PL6D 3QW9A 3LY6A 1X4YA 4MAYD 3T04D 3ZYJA 3IPBA 3NK3A 3OGOE 4XNYH 3IJ8A 4XNZC 4Q9QH 4FADA 4PGDA 5EUOB 1MCNA 2C9PA 3HNSH 2DD8L 4KTEL 6TAAA 1QSVA 2APSA 3HLAA 4MRCA 5CFAA 3M86A 3EFFA 4PREB 3E2HC 4MQXC 1ZRUA 1EJ8A 4XNAA 1NBCA 4OD3L 1JD9A 5EU6B 5CBAB 1EXUB 1NOAA 5HHME 1TJHL 2IPUK 4PG2A 1JERA 4X99B 4LRNH 4L8BB 2NQCA 3NEEA 4HCRA 4NAQA 5H35B 1N10A 2WLMA 4LHUD 2AQ3A 2WXNA 4KOCA 4Y1TA 1NBYA 2P42B 3GIZL 3I9GL 4JFFA 5C0BB 4I18C 2PKDA 3BZ5A 3VVVA 1OGAD 3ETTA 4JMXA 3GJFA 1UVQA 3HZMA 4OLWL 4XBPA 3BMVA 1MNUL 1JFQH 5EUOA 4WCYL 5F1NB 5DWUH 1UB6A 1R3JB 4GNKB 4QHLB 4TNWK 1DQJA 2EE9A 1S5HB 2JI2A 2VIRA 3MRLA 3PGCA 4IBQA 3WCYA 3NSXA 2UVEA 3SPHA 2CGYA 4KI5F 3U4BH 2JI3A 2WZ0A 3U7AA 3WKNA 2X4OB 1EEZB 1N4XH 3KDPB 5CEYB 5IG7A 3CSTA 4N2HA 4TUKL 4EF3A 2MQCA 3WYRA 4Z7QB 2VSDA 5EBWA 4LNRB 2YBGA 5AAMC 3DX4A 1MAJA 3IMRA 2E9BA 2BMKA 4P5SA 3UP1A 2IQ9L 3E3QE 5H35A 4LSQH 1FAIH 2XTJD 4Q52A 5IFAH 3MREA 1WUNT 2HKAA 5EN2B 3LKRA 5HJDA 1CICC 4IOIB 3D48R 3NJKA 2XHNA 3LTVA 3PHSA 2Q8BH 1JOIA 1O6TA 2JB5L 2V7NB 4UMGA 5T1KB 4YGVB 1F90H 5INCB 4PWFA 4PJ8D 4M7JL 3D12B 1TZAA 1S78D 2OMXA 2LVCA 5FWQA 3MTRA 2PWEA 4A7GF 5C08A 3E8UL 2K7PA 3EDKA 4JN2B 1U6AL 4DP1X 1AR1D 1NKOA 1QATA 3A4AA 4HF5H 2ZG3A 3VI4B 1VEPA 2WLIA 2OAAA 2BVOA 4Y4HD 4YPGB 3QDGB 3VXMB 1M7XA 4BCZA 3ZKXC 5KYXA 1X9QA 4P4RB 1I1FB 3MREB 3SJVD 3A6BH 4G11A 2IV8A 2B08A 3LKRB 1AIFA 1PSKL 3FFOA 2DLHA 1U3JA 3O6FD 5T1KA 1THCA 3H85A 5F6IC 5I18L 3EUUA 1SHWA 3MV9D 3MLWL 2EH7H 3MMEA 4AGQA 4BKTC 3NABL 2A9MH 5EUOE 3SYAA 4LQFL 2E76C 2CRZA 3QP3A 4NQCD 3VFNB 2VW7A 5HHQA 4DETA 4XX1G 6FABH 1YY9D 4AIOA 4XMZA 2XZCH 4CILA 5C6TL 4LSUH 4AYFA 1OARL 1MWAL 2DQTL 1Q72H 3AWGA 2NY3B 3MO1B 2AJYL 1UKTA 1WWCA 2NCMA 4JO5A 5JDSB 4U0QB 1BQLL 1BVZA 1T5WB 2NX5E 4WENB 4XCEB 1DEDA 1WHOA 3L1OH 1PX4A 5FFGA 3RBGA 3H42L 3QDGA 3STZA 5A2BA 1QFWL 5I73C 1RURH 1ZHLB 2WKGA 5DEFB 4HJJH 5AW5B 2YAMA 4U1KB 4RGNB 3WFCH 3KYMB 1DQDH 1G1KA 2G9HA 1LO0H 1EHLL 3QEUB 1DLFL 3I02A 1P7QD 5EDXA 1URZA 4YXLH 1TTRA 2VQTA 1MOEA 3AITA 1N7ML 4R7DA 1G6RH 2Y1ZA 2AP2A 4XOBA 3LXAA 2VXUL 3MLRL 2I9LA 2F5BH 1CGYA 4RQQA 3PWVB 1FC1A 5GSRA 4NWTL 1TNNA 2OP4L 3GT6A 4Y9BA 1ZSDB 2IPTL 3KVDD 4OCYH 5DVLA 4HVBA 1O0VA 2BCKA 4D0BB 4CGTA 3X13B 3P0VH 4KHXH 3M1BA 1YN6A 2FZ3A 5FYLH 3T3PF 3ULUC 2BVTA 4JZNB 4OZIE 3NJXA 4KZ0A 4UU9B 1DSFL 3PHOB 4XP5L 1I7TB 3QEQA 2WWKT 4YR6A 1GZQA 2BXZA 3I9AA 2HXAA 3ZZLA 1HWWA 3MLRH 4ELME 1W8NA 5KG9A 1S7VA 1INEL 4ZUVB 2ZONA 1P0SE 4FYTA 1Z32X 2NSQA 5D96B 3QS3A 3VGDA 3IF1A 3LNDA 3L6FA 1XXDC 1J5HA 1U6AH 1T0NB 3MV8B 1ZHKA 1KTRL 5C07A 4WEBL 2WMPA 3Q01A 3O4LD 3SOTA 3IFNH 1E8YA 5B8CB 4HK3J 4RMUA 1NLBH 5DD1H 3BAKA 3DROA 3IMUA 1SDDA 3ARBB 4NQEE 3ZL1A 1PZ2A 2XWJB 4Y2DD 5G4OA 5GJSL 1KXQE 3AQYA 4B0MB 3MJGX 4PJ7B 5D7KD 1AMXA 1Q9WA 2EE3A 2VLRB 3PWUB 4OFYA 2AQPA 4YR6B 5BO1L 1Y6KR 2EH8L 3QI9B 3K71B 3MFFB 3V5KA 2G2PA 4O2FA 2ENSA 1SMDA 3HB3D 1CICB 2EH7L 4S2SA 2OL3A 3N1QC 2Q0ZX 2W60A 3BAEH 3DBSA 4ADGA 4JN1L 5DUMH 4ZXBD 1L3NA 1MJUH 2CSPA 4KVNH 1Z7JA 2VAAB 2CIKB 2KC0A 4HK0A 3NJHA 1FVEB 2AJUL 1HESA 1DJIA 2VO8A 1G9EA 4MFHA 2PCPB 5EIIG 1O6VA 2ZUUA 5D7SL 1CU4H 2BCMA 3IE9A 1SDDB 2WM0A 5IB1A 1D5ZB 3OKKB 2DYPB 5IUCA 4RDQG 3QXAA 3B5TA 3PREA 1WBZA 2I85A 4X5XA 3BSZA 3I2CL 2YUXA 4N9GB 4PB9H 4XPAH 4FQJH 4G3YL 3HAEH 3GZOA 3BP4A 4EPSA 4N3TA 2CHDA 2VDQL 4U1IA 5D1ZD 5KYNA 3SZ6A 4JDVA 4ODSH 5E0QA 2HUHA 1S78C 1N19A 2DQUH 5KVEL 4UV7L 1I1CA 1LQBC 3WAKA 4D94A 2EUVA 4Z0XB 3ZDXF 3RWCA 4BFRA 3HHMA 2BIOA 1HXKA 1YQVL 1JZ5A 3REVB 3GSVA 3X3GH 4EZJA 3NABH 1IL1B 3CC5B 3LRMA 1T2QL 2MQ0A 2BZCA 5GRUL 2JKNA 4PJAF 5EMYA 1PEWA 2FYYA 3Q8AA 4XNMB 4PG9B 4Q89A 5FGCB 1EO8H 2ENQA 5DT1H 4Q6IC 4UT7H 2GK2A 2DWDA 4Q14A 1E42A 2OXGA 7PAZA 3WUWA 4N28A 4X7SH 2LFGA 1ORSA 4LLYA 4BHUA 4NN7B 1WTLA 3TIDA 1UTDA 1FFTB 3T6QC 4OAWA 1I53A 5DO2D 2NYZA 1D6VL 2ATKA 3IAQA 1JVKA 4ZQKB 4RDBA 3RVXC 4FQQB 2NUTB 4LSPH 2XSKA 4P5TB 3VWJA 4OGXH 5PCYA 3INOA 1IGYB 1R3HB 1CE1L 2YEZA 3NGBC 1J0IA 4AH2A 2WVVA 4XO8A 5J1TC 2XA8L 1ROWA 3EO9L 4XRCA 4NUQA 2OMUA 4NFCA 5IFJB 3U4AA 3UPCA 2EDQA 4KKNA 3VRJB 5LGJA 4ZDHA 1I7UA 1K4CB 4MNGE 5GRUH 1BOYA 4CC1A 4YVUA 3TL5A 4Y8DC 4NNYA 5J6HA 1RJLB 4LLYB 1IQWH 1MCJA 1ACCA 5I82A 3TIDB 3IWVA 1G94A 2CRIA 4R90L 4I3SH 1BOGA 4ZW7A 3V4UL 4CMHB 1FLRL 3ILDA 4P3WA 5IJKA 1CXKA 4KQ4L 1P1ZB 2XNAA 1SVBA 2R0LL 1CS6A 4ZTPL 2EVIA 4PY7A 1INDH 4ZRGA 3U2JA 2GJZA 1IFHH 1U36A 3QQ4B 4HP5A 5DWPA 5EBMA 4ZMVA 3RWEB 1J1PH 1J9RA 1I1AD 4XVOA 5IBTL 3C8KA 5CLWA 5JHLH 1NBZA 4Y0GA 2Q86B 3L3DB 4LHUG 5I75B 3SD2A 2H9GA 3L95B 4WSGA 1Q8MA 3MLVL 4XPTH 3NN8A 1B9KA 1XH3A 2AQTA 3HOGA 1M2VA 2E0PA 3QUZD 1UM4H 2QTEA 3HW7A 3LZNA 5FF6B 4F8OA 4PVBA 3IGKA 5I8EA 3KPOA 3HKZA 1IAKA 3VFTB 1FNSL 1UKQA 2QEJA 3KYNB 2GSMB 2G9KA 2K6ZA 3UBXB 3V8OA 4DEPB 3TBBA 1P1ZA 2XNAB 2YRLA 1UB5A 3LSOA 3AREB 3TGXA 2QGBA 3O6KL 4NDMA 1MI5E 3V0WL 4PY7B 3V52H 3HR5B 4GO8A 4PS7A 1YUHB 2PO6A 5GS1C 2AJ3A 4EUPB 3P3TA 3MRBB 3ZTEA 4GQ9H 4I4WB 1SEQL 5KZCD 1N8OE 2NY6B 5SWSD 2GTQA 3FB8B 4FXGB 4Y1AD 4JY5L 3S48A 3TPUA 5L88L 2DQDH 2F7IA 3FW6A 4YDIH 1WAAA 2PPCA 2Q86A 3DK0A 3D52A 4E9XA 1E43A 1DJHA 2R15A 4KK8C 4J3OF 2G2NA 1ND0B 4GS7B 4OKVA 3DVFA 5E23A 4LBAA 3E9UA 1YMHA 4P2OA 3FQRB 1OWRM 1WEJL 4JAMA 3W9DA 5KUKA 1M3JA 2WYZA 1TTGA 3B6SA 5DVOA 4F9PC 4PJIB 4JKPH 4NPYA 3SBQA 2FJFB 2YRZA 5IHHA 4I85A 5F71A 3ZL4H 1G7IA 5FM5O 3NZHH 3HR5A 3K80A 4Z7OF 4KOBA 1V27A 3LXBA 1FFNB 2JTYA 1W0WB 4YHZL 3VE0B 4APQB 2QR0B 1CL7L 5B1JC 1BMWA 4LBEA 5HBBA 4BQ6A 1L3WA 1W72A 3V0AC 1Q0YH 4R5TA 4OT1L 3PS6A 4I1PA 4EI5C 1EHKB 4QHNA 4KI1A 1EAPA 4Y1AE 1I8MA 1HSBA 4Y4KC 4EUPH 2EYRB 3VX1A 3S3JA 43CAB 1QFWM 4NPYB 1HZLA 3V6ZA 3FO2B 2OMZB 1TTFA 3EDFA 3O11A 1J88A 2Q6WB 1MFUA 3MJ7B 4FQHB 4ZAKA 1JRHL 4HS8H 5EB9A 5TE6L 1X7QA 4AQ1C 1J0HA 2Q3AA 4LMQE 2CUAA 4GP8B 1KTCA 4JPWL 3UPAA 2APBA 4R0LB 2ITEA 4JRYB 3SYOA 3THMH 1FLTX 2FRGP 1E27B 4WW2C 3GMRA 1CD8A 5TFSH 4YFEA 2VDKH 3BAJA 1DVZA 1NIFA 4A04A 1MCSA 5AKVA 3RL2A 5CO1A 5KW9L 4R5XA 2AJZA 3C09B 2HG0A 4LRIA 3N1FC 1CDYA 2BPBA 3T9WA 1P7KB 1D5BA 3ZZQA 2IG2L 4BZ1A 3ECQA 4FI8A 2R2BA 2K3HA 2WCSA 2DH2A 3IWUA 4KROC 4O2CB 2X4SA 3FO2A 5L4IA 5LNGA 3VTAA 3MJ7A 4FQHA 3IDXH 1KGIA 1XGYL 2ZXAA 3F7RA 4K9EH 4O4YL 4PBXA 4QOKD 4XBGB 1XHHA 3PJSB 1TQUA 4J8QA 1YNKH 3Q9QA 5E8DH 5L2KB 1PIFA 2VABA 2W0FB 5SV4A 2Z31B 3LN9A 1TOXA 3NPSC 3LS4H 2R2EA 4O9HL 5TDOB 3RL2B 4F58H 5D9SB 4XNUH 3ZE2B 4W6WB 5IVXE 5DK0B 4ZNEA 2GI0A 1C08B 4DQOL 2R2BB 3RVTD 4OTXH 5FOJA 3T0EE 2N1KA 1SOKA 3CLFH 2A6JB 2KDYA 3BUQA 3OPZL 2X4SB 3EDDA 2V33A 3ZHLA 4JL2A 3BGMA 1A7QL 1B3JA 1S7UB 1NC2B 3KG5A 4PJEA 4EN3D 4YHPB 4Z3FA 1OHQA 2CJ3A 2BW5A 4IBTA 3HNVH 1N67A 1F3RB 4WEUD 1BMGA 1R3IL 3DRQA 4QRRA 4PMEA 1M7UA 2UWEA 4V2CB 2FIRT 5KSVA 4AE0A 3EYUL 5I15H 1KJ2H 1X5KA 3QQDB 1C12B 1HILB 4C56B 4G9FD 4H8VA 1ZANH 2OCJA 4N2LA 5IBLC 1DQLH 1FFRA 3MGOA 4PRHB 1X5YA 4QXVA 2F8XC 2K4AA 4KJYB 4LLWA 1ZLVK 1ACZA 5CCHE 4ORGA 4PS8A 1A0QL 5IF0B 2Z4QA 3KPSA 3NIGB 5I2IB 5I6NA 4U1GC 4WWKD 4NXSA 4PWIA 4YHKL 3ZLQC 1GGCH 2Y7OA 3REWB 4AGMA 4HYTB 3RIAF 4Y16C 2ZCZA 2VRQA 1EBPA 3CV5A 4JO3H 4PJEB 2H47C 3BO8A 2X2JA 2WSKA 2X4UB 3O6ML 2V37A 3ZYZA 3AY2A 2H32A 2E3VA 3WHXA 2MQ3A 3CTTA 3LIZA 4ZODA 2CO7A 3QQDA 1PY9A 1XTLA 5L8JB 3LVTA 2YZ1A 3O2WL 3RNQA 5EO0A 5HGHA 2WXOA 1KELH 1JHLH 2HFEB 3ARFC 4K2UH 3VFWA 1DVFB 2F53A 3VFUA 4KBPA 3EGXB 5BQ7B 2C9XA 5FGSA 3S96A 3RURA 1ZD6A 5FGBC 3FAXA 4GAGL 3VNZA 1F3DH 4UTBH 5IKCB 4YBLC 4YHNA 2WP3O 2P80A 2VXQL 2RACA 3OKMB 4H40A 1YNKL 2QHLA 4RWHA 2XDHA 1VKXA 2VYRE 1IFGA 3QZWG 4AM0B 4HWEL 5I1KL 1GVIA 5CD3A 1X5FA 3UERA 4YHML 4ZX6A 3RWGA 5ALBL 3MRDA 5IB4B 1T89A 2BP0A 4OLYL 2A6DB 3PRZA 4GAJH 1ECZA 4KY1H 3VJ6B 3L3HB 9PCYA 1SMOA 4YE4H 5JOEA 2RBLA 1AI1H 3VFWB 1YA5A 3CVHA 5EOCH 3U7YL 4GIPD 1KG0B 2ADFL 4EDWL 3AC0A 1T20B 2R4SH 1CD1B 3FSWA 4PJXB 4BUQA 1OWWA 1I7RA 5TDNA 4L8BA 4F8QA 1XZ0B 4FG0A 1HL5A 3JTTB 1H3VA 5IEHB 2D9CA 4PHXA 2WNXA 3HBGA 3IGUA 1VPOL 4HKZB 4NP4H 4BK8A 1SY6A 2APWA 2R29L 1ZXKA 1NQBA 3FH5A 4QEGA 5IBUB 5JHBA 1A65A 2IALA 3FT3B 2YPVA 3BP7B 2P5PA 3HJ0A 2QVMA 4LPUA 2QSQA 3CX2A 2JI1A 1MPAH 1A7OL 5B1KA 5KS9F 4LFHG 3KJ6L 3MODL 4U3HA 5L0QC 4YDMA 1SEBA 3WNLA 1UOVA 1KYUA 1DCLA 4BEIA 2X4OA 4E9VA 2RAMA 1U8MA 4K3JL 3L5XL 2D7MA 3CVHB 2QQKL 1QSEA 1V55B 4PJXA 3PWNA 3Q44A 1WFNA 3DIVA 3DECA 4WGKA 1SGKA 5D5MF 1UT9A 4AKOA 4OTXL 3PABB 2ZNXA 4QY8A 4UILL 5FYLD 3IKKA 2CLZB 4LLQA 5TF1H 5KBKA 3QUYA 2NMSA 4FMFA 1I8KB 4ABUA 3VXRE 4G8FB 3WEMA 2IALB 5DZJA 1H15A 3MCG1 3KPQA 5BS0D 5E4AA 4ONFL 3RJDA 4EIBA 1H8NA 4WDIB 4IHOA 3P54A 3DSFH 4A7SA 4JN2A 4FA6A 2GJ6B 2VLKE 4KQ3L 3HI1A 5F7EH 1YAIA 2UXGA 1SBSL 1UM6H 1WZ1L 2DQEL 3DOHA 1CGTA 1GGBL 4PFEA 4UT7L 1JWMB 3WKQA 2XPZA 1MCBA 4EQ2A 4YX2L 4BJLA 2NSMA 3DO7A 4XMLH 5FYJU 3WS3B 1YYLH 3AVEA 3PABA 1FZKB 3KLQA 1OF0A 4HA1A 4TTGA 4P4RA 3L9BA 1JHTB 4KK6C 3F3HA 4P4KA 4Q56A 1RZFL 1T5KA 4B9ZA 3WD5L 5E2UL 1EAJA 3HG1D 2CR3A 2CKNA 2DIAA 2IF7A 1LDPH 2Z1KA 3HTLX 1N7MH 4JPVH 1OM9A 2MJWA 3S36L 1LP9E 3UZEA 2BIHA 3WDHA 2E6JA 1IGJB 3L3JA 3QFDB 1XBRA 3WY3A 2H7WA 4RAUA 2P26A 1XBDA 5DC2A 3WTVA 3TNNB 3G5XB 1BCIA 1ESOA 3WTUA 1QLRA 1OPGL 1QSZA 3L5WA 1DBAL 4KWUA 5DJ2A 4HKXA 3HS0A 4AGPA 1Z9PA 2VXQA 2E56A 3FRUA 4K8RD 4KK9C 4CGUB 1B90A 4PCTA 5E2UH 3TS8A 2VC2L 1MWAH 2X2UA 2FUQA 3B2UC 3GMPA 1H8SA 3V7MA 3ZN6A 1CDJA 2X44D 1B6DA 3Q2LA 3SKNB 4P4KB 1TTBA 2IANA 5DHVA 5DRNB 2RQ8A 3FFDA 2HJKA 4PJIF 3NK4A 1RMFL 1MW2A 3K1DA 4GRWH 4HWUA 4TQ8A 5F7BA 3TCXA 3KL0A 1TJHH 2NY6D 1TETL 1BIHA 3UDWC 5C2BL 3OF6A 3FF8A 4WNQB 1G6RL 3NDYE 2EDYA 2QSCL 4A2HA 1QQDB 3VGFA 4Y2NA 3A21A 2E86A 5AOJA 1YN6B 2FZ3B 2NX5B 1G84A 1YEIH 3L7FB 2AJUH 1QSFB 4YEFA 5BO1H 2ZUYA 3D07A 3VD4A 5C0AD 1QP1A 4XMKL 5T1MA 2CBMA 1IFHL 1LK2B 5C70A 2ZZUT 4GAYA 5K1NA 4FNUA 4LSRH 3LQZB 1HEHC 2FO4A 2GSIA 3QIBD 3HUJA 2A3TA 3QWOB 3IF1B 4E41A 4FJYA 3U4EB 4R26H 2G30A 4WHYG 1ZEAL 3C6LA 5I1JL 1GTNA 2JK5B 6FABL 4IGBB 1ZHKB 5AEAA 3J7HA 1EFXA 3HZYB 4G1EA 5C0EB 4PSRA 3DARA 4ACPA 1F45A 4NQUA 2C1PA 2DEWX 3BKCH 2GT9B 4G2AA 1JPEA 3X12B 3ARBA 1FAIL 3QDGE 2OQJA 4K3DH 4NQCB 4YSPA 3VA2C 1WIPA 3DK2A 1NL0L 2AXWA 3CN0A 5ALCL 3UBHA 5DS2A 1G43A 1R5IB 5AZ2L 3ZDYF 5C0IA 4KMTL 4TVUA 4U1LA 1QLEL 2ZD0A 3BW9A 3OBAA 3RKDC 3K71A 2DJMA 4O2FB 4I13B 4XVUD 1A25A 3VFOB 4UILH 2VLKD 1IGFL 4HAFA 1KN2L 3EJTA 3FTWA 5CCKL 4P49A 1UJ3B 1EDQA 4HMEA 1A4CA 1HSAA 3DX6B 3TZVB 1Q9KB 2HWZH 1EFXB 4V2BA 1V3JA 5AB9A 3Q0HA 1I75A 4NKMA 4KJQD 3GSOB 1B4JH 2H0JA 4EI6B 1JDDA 4R26L 4AVJA 5I1JH 4G6FB 2V5SA 5LCVL 4FHBD 4UF7C 1QLEH 5T1DH 2B3RA 5IB1B 1E9QA 5JHMA 4JFFD 2WN2A 5F7EL 3UTSD 4OZ4B 1BHGA 1Q94A 2PCYA 3GFUA 4Q0XH 1AVAA 2NZ1A 4MBRA 1SXSA 3KDMA 1EVTC 4PN6A 4U1IB 4EN2A 1EV2E 2HT4C 3QJFB 3BW9B 3I2CH 3BX7C 3VI3E 4OV5A 3GUFA 5D7IB 1T7ZA 1WBXA 4X50A 1DE4B 4ODTH 1HXMA 5EDSA 2MPVA 1LGVA 4LLVA 5E8EA 4YBQD 1LNUB 5EUKA 2Z35A 3C5ZB 4UV7H 2J1YA 2AV7A 3VD5A 5LVEA 4HJ1A 4JY6B 3QCVH 1XB6A 4YDNA 4PJDA 1NCCH 1G7PB 4Y9CA 1VZIA 2BSTA 2OMNA 4NS0A 3T0VA 2P24A 2QGDA 4OLWH 2E4FA 5IY5B 4OF0A 4A2GA 3IFOA 2Y5QA 3K8LA 3ZKMC 2A73A 3GMLA 4Z7UE 2IAAC 4F57L 4TV3A 2FSEA 3KPRE 4YNYB 4Y2DB 1EPFA 3NFSH 1YMMA 1LO5A 1E30A 2DQFA 1XX9C 4GB9A 2VC2H 3KGUA 3MRJB 4OFDA 2E7CA 3L1GA 3O0LA 4W9FC 4XODA 3CH1B 4KKLD 3SYQA 3MYJA 1S4IA 4K07A 1BV8A 3BQUB 3L4XA 5KVMC 4E0RB 3QI9D 1G7QB 3AQXA 3L16A 3PWPA 1YEIL 3IDNA 3B83A 4FNPA 4D0DB 2QFRA 2QADB 4HEME 2ARJB 4MNHA 2Z35B 2NUTA 1TKWA 3R4RA 2KZWA 3SODB 3L3GB 2H6PB 1SYVA 1NCDL 3PDDA 1M9WA 5IFAL 1BLNA 5KJ7E 4OGYH 1T04B 5MENE 5CAYB 2BSTB 2EKSB 3NACL 2FEEL 4PGEA 4JZJA 1TMQA 5GGRA 2HLAA 1E3ZA 1I7UB 1K4CA 5F7DA 1GMIA 5F93C 5BVJA 4NNYB 3CU7A 4KO5A 2FJGA 5LXGH 1DVSA 1MCCA 1F58L 5E6UB 4R97B 4UT6A 12E8H 1PX3A 3T4YB 4DZ8B 1PZBA 3HMWL 2FBOJ 3MUJA 4JMNA 5C0ND 5KYWA 4M43L 3CLFL 1VESA 5KS9E 4XTRD 2PR4L 3IDNB 1FCGA 3OZ9H 4JX0A 3SGKC 4HKBB 2KZBA 4JRXE 2FK9A 4HJSA 1E4HA 1P2CB 2FIKB 2BM3A 4D0CA 4O9HH 3W0WA 3II3A 2C9VA 1IM3A 5BV7L 5AG8A 4GUCA 1A7NL 2W07A 3TPKA 5HYJB 3ARWA 1BAWA 2NR6A 2JTDA 4P05A 5C0CB 2NQ3A 2B2XL 2IQAA 5IQ7L 4R4FL 3F7VB 3PIQB 3WL9B 2OYPA 2IWEA 4N8CH 1IIIA 5CJXA 1HHKA 4JM2A 2FJGB 4MAZA 5C0RH 3NJJA 2A9DA 2FBJL 2EVJA 3DSFL 3SE9L 3SDDD 1T7YA 5T5FH 2VSMB 4CMMA 5HGGS 5FGBA 4HHAB 3WFEH 1KGYE 1DQIA 1TJGH 3F01A 1RUML 1U95B 4HCFA 4UM8A 4YJZL 3GBNL 1VGKA 2VRAA 3P3SA 5G55A 2AJ3B 5I1GL 1KCKA 2FJHB 4KV5F 3VB8A 3QEHA 5LLIC 1YDPA 4WV1C 5IM7A 1QG3A 2CIIA 4FXGA 5C86A 4CRPA 3N06B 4B9CA 2N4IA 4DKEH 4RMSA 4JHBA 3RKDD 5JZ7C 4P5TC 2ZOOA 3ZE1F 1IAOB 1PLBA 2WO2B 4Y89A 5D6DA 4HEPG 2PCFB 4WK4B 4JFFB 1KJ3H 3MLUH 1T6VN 2CKBB 2PUQT 5DRZB 3UMNA 1OSPL 5ISZB 3GRWL 1ZGLP 2HJLA 5GGTL 3ML9A 3GJFB 2IH3B 3IXTA 1KGCE 4P23A 3X3FH 2F7PA 1U2YA 4DGIL 1HHIA 5F1NA 1YEDB 3LV3A 1N2RA 3EJJX 2OCFD 4WWNA 1KEML 3MRLB 3PGCB 4DGYH 4ETYA 5EU7E 4ECNA 3AWFA 2HFFB 4P2QE 5IREA 3ZQ9A 4D9RE 4XMPH 4NZRH 3LZOA 3IDJB 1G7IB 3OZKA 4PJHA 3ZMEA 3BGFC 3BQVA 1MKFA 1WGVA 2ZXCA 1FFOB 3QFJA 4MD4A 4YWGL 3SJVB 1IGCL 4MMXA 3ZR6A 1UOKA 2OSXA 3DETD 2X4PA 2FGWH 1NFAA 1U4EA 5AKSA 1LXMA 1BX2B 3UCQA 1YJDH 3HE6A 4JG1H 1DVFC 5AVRB 4KHTL 3P4LA 2ED7A 3OAUH 4YHZH 2WWNA 1W72B 5C0FA 4K71B 3QAQA 5D72L 2B4CL 5T1LA 2E7MA 2XQYG 1YY8B 1JRHH 1I8LC 1PDKA 2IPKB 4U6XA 1KGWA 4OM1H 3FFCE 3CDZB 2FGWL 3SBPA 1AY1L 3QR0A 1OE2A 3MV9E 4K73A 5I6OA 4RFOH 4H4NA 2ADGB 5E1GA 1OB0A 2MTPA 3FTYA 5HDOA 2VWEE 3LQMA 4KY1L 3ZT7A 2DKMA 3ZL2A 3GDBA 4YPGA 1DJSA 3VXTA 2WUCH 1YUKB 5AKTA 2ZYHA 3JTSA 1S9WB 1AIFB 1W8EA 5IB5A 2XQBL 1MXGA 1RZKH 3RTLA 3MBED 4X5QA 3WGUB 1GPOL 1Q90A 4FXKB 1A7NH 1YY8A 1RD6A 4X7EC 4XPFH 2X28A 2WZ5A 3FO9B 3LPFA 4PJ5A 3ZL4L 3QUZA 4NNPH 3QSKB 5TE4L 5IQ7H 4O2CA 3POHA 3ZKXB 2COQA 4PTTA 5J12C 4UT6L 1ZDSA 5E8NA 4A37A 4N1CA 1KBGL 3MRGB 4Y1SA 5DHMC 2XWRA 4IOSA 3W56A 2R8SH 4X9FA 2PPEA 1QPPA 1RCYA 4QHUB 2M8XA 4I48B 3QZBA 5E08H 3C9NA 1KF9B 3WO4B 5DEFA 4M7LH 5FO7A 2GG1A 3I85A 2CDEA 4PRIB 2FJUB 3MV8D 3JTSB 3ETBJ 4BV1A 4XVSL 1C5CL 4Y1AA 3PWLA 1CF8L 4N3UA 3O8XC 3GBEA 4JO3L 4NIKB 5DEGA 4C4BA 1FNHA 2DYSB 3D0AA 3BHBB 1E67A 3KBPA 1MQ8A 1O9WA 2D31B 2LAGB 4M5ZH 4CA4A 4NN5C 2O5YL 3GI9L 4XNUL 3O3EA 2TRHA 3B7SA 1MN4A 1X5XA 4Q9RL 1GCFA 3PNWB 4PTTB 1CFSA 2I07B 4EI0A 5A3ID 1M1XB 1TITA 1WZLA 4GRWE 3H0TB 4M61B 1FJ1A 3KEDA 1ZANL 4FQIL 1MCEA 3P2DA 4FXTA 4JQXA 1EQWA 4B27A 4M6NL 1A14L 4RVBA 4W9LC 4HZLA 3PXLA 3MCKB 4G6JH 1QBLH 3GDCA 4WUKL 4OBRA 5DJAB 4CDHA 4R0LC 1OAZL 4BSVB 4LVHC 4YH6A 1GS6X 4XAWL 3J2PA 4LAJH 4LOEA 3RL1B 5DMKB 1HI6A 1CWVA 1L9QA 4LRNL 1F8TL 1U8JA 2X0VA 3BZEB 2FD6H 2YAEA 1WV7T 2VCOA 3UC2A 5D1ZB 1G0XA 4AWJC 4CC0A 1GAFH 3RIAK 4ISVA 3D3VD 2I60L 1JK9A 2DIJA 2IH8A 4PD4J 1QTPA 1R3KB 2BRQA 4TNVK 3T2NH 1P9MA 1U3ZA 3BO8B 4ZPVA 2EUZA 1TQBB 5FXCH 3ARGD 3PY9A 4LHQB 3V9FA 4HZLB 4A7GA 4G8EB 3MFFA 1R0AH 4J6RL 3GBDA 1R3LB 5K93A 1X7TA 2H32B 4S1SL 2NXZB 3EOTH 1QHPA 2OTUA 4JG1L 4AEFA 4HIPA 5SWSE 1LMIA 4S2SB 1ZDQA 5DJAA 2QVTA 3BH9B 4J3OC 3MROB 4Y5YB 2B9BA 1RY7B 2VXTL 3W11D 5IBTH 3EGXA 5BQ7A 4M02A 2NXYC 2ZYIA 3U6XS 3GXTA 2VDLL 3LHAA 3QPXH 5JUEL 5BS0E 5BVPL 3QG6A 4LSRL 3NSDA 2H8PB 1Q0EA 3HMXH 3AM8C 5GS3A 2DN7A 4NJAH 1ZMYA 5D7LD 3TONA 4UOW1 4AM0A 4XNXL 3BP4B 4GT0A 4HAGA 4QHMA 4ZSOA 5CN2A 4JFHD 1YPZE 4UMSA 4NM4H 4OB5H 4RA0C 1XAUA 3HFML 1H3GA 5EUOF 1A1OA 1J0YA 1KNOA 4S1RH 5IQOA 3VJ6A 4YSUA 1NAKL 4DP0X 3NMEA 5DQDH 1ICTA 5HDBF 2VT0A 4K9EL 4BFBD 5ICYA 1MFCH 2ZSWB 1S7RA 3SOBL 4BUHA 5L4FA 1ETA1 1XEDA 3LYRA 3BDYH 2E8YA 5AB2A 1G6VK 1T66C 2O5XL 2GW5A 3LOWA 1EGJA 5DD5H 2NY2D 2UX6A 2GTZB 1UXSA 2J1WA 1XF5A 2CRYA 3M8OL 4MWFB 1N8ZA 5CJ8A 3S4SA 3GXPA 5T3XH 3T3PB 4FQJL 3N2JA 2Z7YA 4OUUB 4KUCD 4KH2A 1I4FA 1OP5H 4XBEL 3GXFA 4JCWA 1OCWH 4GRLC 4HSAC 2E6QA 3OAYH 1OCRB 5KOMC 1QFWI 3QGVA 4ODSL 1AJ7L 1NGZA 3P11L 3MGAA 3GHPA 5AW2B 3QXVA 4AYMC 2Y25A 3CPLB 4PGCA 2D4DA 2V4LA 3MJWA 4X5PA 2P5WD 4AC4A 2WOBA 3U2SB 3ARDA 3UG5A 2FH8A 4HUCA 4F37F 4NXKA 3RTQC 3MA9L 5D1QD 1K72A 3IJYB 4M6ML 2VLJA 1MI5D 3WJMB 2B1HH 5FB8A 1GGBH 1HEZB 3MLSL 4J7RA 1JZDC 1I4FB 4F8TA 1QNZL 4O00A 3DV4B 4KVCH 4AM0Q 4TNWF 1H3XA 3BLPX 1DBAH 2X6UA 4PW3A 2CKBL 5F1IB 3NP4A 4IRJD 3X14A 2GJZB 3QQ4A 4QNPF 2VDML 4QXUL 3RWEA 4P2RA 4ATTA 3VDAA 3GGWA 4HX1B 4XNXH 3IJHB 4DOHE 3U2SA 5FPIA 2A9AA 3BAYA 3H42H 3BWZA 1CO1A 32C2A 3RZWA 2P80D 4PJ9A 2VLJB 5KVGE 4BK5C 5FB8B 5EZPA 4QTHB 4BE6A 1V7NL 5FF6A 1EZLA 2NXZC 3IFNL 2OS7A 3L3JB 4I2XE 1NJ9A 4ZT1A 3VFTA 2GIYA 2WINA 4RAVA 3QUZC 3UBXA 1QUPA 3NACH 3GJEB 4ODUA 5BW7C 2VN6A 3NZUA 4YDLB 1JZIA 1JFHA 2HVKA 4GKNA 2GC7C 4EKJA 5K9KA 2CG9X 2HRPH 5I28A 4KQ4H 2O5XH 4AQ1A 3RFRA 4G9FE 3VXQB 3B3BA 2F7OA 4NKOB 4MBOA 4OB5L 1PSKH 4P2RB 1JPSL 2EECA 4N85A 3GKWL 1M05A 2HJFA 3VXRA 3AMKA 1UWXH 4MMZB 4ZS6D 5ALCH 2R69L 5J1AB 2VN3A 1OVZA 3P69A 2DBLL 5DDHB 3DDGA 5MI0B 1CE6A 3BZ4A 3PP4L 5FX3A 4WWID 2NTFB 4MB4A 2X87A 2EC8A 3CHQA 4J2XA 5CCKH 5HHVH 3T8XB 2BY1A 1ZTXL 1KZYA 3GJEA 4LGPB 4ODUB 3AJ7A 5BS0B 5H4ZA 4IBSA 3NOIA 4UBDC 4KRPC 4ZO7A 3X2QB 3P9LA 4GUPA 3CJJA 4YO0A 2NDFA 5H94B 4OD1H 5T1MB 3JQOB 2HRPL 2ZX5A 2ZWYA 1GGUA 3BEVB 3K5RA 1ORQA 4DAGH 4LP5A 5DFVD 2WWKO 3P0GB 3QIUD 4HIHA 1F11A 4ZX3A 3HUJB 2F53D 3QCTL 4PGBA 2R1YB 4W93A 4K3JH 4WU7A 3MI6A 3LNGA 2E8ZA 2NTFA 1RHHB 4LQFH 2EYRA 4M1CD 1JXKA 3BWSA 1QA9B 1OOAA 2JLPA 2NY0D 3E80A 4JN1H 5DUML 2IPUG 1KLFA 5BS0A 4FJZA 3QJZA 2F2HA 5FO9B 3CFCH 3V4VB 1VGEH 3LRGA 4OGXL 4XCNB 5HHVL 3OKLA 1J5CA 3ES6A 3NIDE 1GY2A 4JM2D 5DHDA 3U9PH 3C8HA 3VYPA 1RUKL 4JFZL 1KWKA 4GP5B 5IROD 1PG7L 1Q9LA 3I3DA 1IAIM 1MAML 2QZ5A 2WNWA 1E8XA 5HI5D 2XACC 4M8QB 2Y0SA 4BFIB 2MFNA 4KNUA 1F11B 4S1DD 5BV7C 5HPOA 2LLGA 4NO0A 3LKPB 3U82B 2ZG2A 1P4LA 2FLMA 4AGNA 1H6EA 1KXTB 1PQZB 5E6IA 2IFFL 2Y06L 4B9YA 5AFAA 3I3BA 3MXVL 3QCUL 4LL1A 1CGWA 3DO4A 2V2TA 3WIHH 1JPTL 1FH5H 3NCMA 5J3HD 1HNGA 1MJJA 4N26A 1TF4A 4PBWD 1TYJA 3I6GB 1DBKH 5DHYA 1J86A 4QGTA 1CK0L 4OBSA 2ORBH 3BH4A 1RZFH 4XCNA 2AK4B 5L2KE 2G5BA 2VDRH 4WCYH 4L8DB 3OB8A 4KTGA 4L18A 1WS8A 2IGFH 4G8GA 4LCWA 3QDME 5E99H 4ZFOL 3QJFA 4NQED 3EH3B 5GGQL 2I9TA 4PRHD 2QSVA 1FN4A 2Y36H 1MF2H 5DURD 3VXOB 1PLGL 1KYFA 5IVXB 5L6YL 1WBXB 5JXEA 1CXHA 3QUYC 4IS6A 3WFBH 2Y5TA 2C5DC 4IRSB 3U0WH 1L0QA 4ZD3H 2IPTH 4OCYL 4FFYH 1AO7D 3M45A 5DJ6B 3WE1A 4AXWA 3L4UA 1Y18B 3SKJL 1W72H 3D8MA 4L1LA 4H0HB 3LMJH 5F3HA 2FECI 3GEFA 4LGSB 1LEGA 1OGAE 1V8HA 4Z95H 2HKHL 2QVKA 1AIZA 3HE6D 5F6HJ 3MJ9L 5C0BD 4MX7B 1JNHA 2DZEA 2XIDA 5CGYD 3OR7A 1KCSH 1D7BA 2UV3A 2A73B 4DK6A 1HINH 1Q1JL 4YHPA 4QRTA 2WXQA 1IQDB 5D7JD 5F7FA 2CA3A 3WV0A 3F8UB 4NEHB 3KBFA 2IAMD 4Z7NE 3BJ91 3BQUA 4PJCE 5F1SA 2OMVB 2FHBA 3FQ2A 4LASH 5K5YA 3PV7A 4XAKD 5ESQA 3GSUA 5KBDA 4JO1H 1WCBA 4LGRB 4DZBA 1ITCA 1KFAL 3MGOB 4AGLA 1EEYB 1E7UA 2QQLL 4NSKA 3WU1A 4C4UA 3X1FA 4H1LG 2ZWZA 3H55A 4LLWB 2VDRB 1SYVB 2XV2A 4GKLA 3LEXA 5CEZH 3EYFA 2X1XR 1NAMH 5DUPH 3ECVA 8PAZA 3OR7B 2FLBT 4KRPB 5G4MA 3VXPB 1IC4H 4CU6A 3OJMB 4OCWL 5IB3A 5BUPA 1CDGA 5MEOA 1IAIH 4XVTL 1SHXA 5J12B 4D2NA 2RTTA 4IK7A 5C07D 4RMQA 5C0BE 3BVNB 1KLUB 4MKTA 4ICWA 2MCMA 3T4YA 3WHXB 5AAWA 2OMVA 1U4FA 4JZOB 3TFBA 2A4CA 1MVUB 3AXLB 3D5OF 1SJEA 3F6IA 3H9SE 4W4OC 3WN5B 5GS2H 1K8DB 1X9RA 1TTCA 1XIWD 5SWQB 2VR3A 3WE6B 3UGEA 1JRHI 3BAWA 4G6AC 1QBMH 4YC2B 4ES9A 4UOW0 3NTCL 2AGJH 2KDGA 3RY5A 1AYRA 4RWYH 2F54E 2VC2B 4W6YB 3CZEA 4G6JL 4WTZA 2VKXA 3WFDL 2FSDA 2YD4A 4NI6A 5C0CA 1BQKA 1GOHA 2OR7A 3C6EA 1AS8A 3RX9A 3L5HA 4F20A 3GMQB 1AGCB 2XWTB 5HI4D 3DXAE 3PDOA 5FM4A 3H9HB 4U1MA 1ZLVH 4QXTA 2JLLA 2DJ4A 2ICWJ 1O7SA 3VQLA 4ZXBA 4BFFA 2CM5A 3SYCA 4FABH 7PCYA 1SYSA 4OLVH 4QTFA 4D9LL 3DX8B 3CGTA 3DI3B 1OAUL 4OD2A 2X2IA 2G3MA 5F9JA 5LWYH 3GO1L 5DD6B 4L3EA 1NGWA 1T0PB 5L4MA 4HDIB 4N87A 1D9KD 3D87B 4YWGH 1WWWX 4MKMA 3BAXA 3FCUB 3NGBB 4XAWH 4GBXA 4LVOC 2UY6B 1SDYA 3THML 2F1EA 4E9QA 5CZVH 2WXFA 4R3SA 4MCZB 1JZ3A 3GI8L 2FYVA 4PLJC 2DQIL 3JTTA 2PCFA 4HMCA 3T0EC 1AO7E 3VQ2C 1RJYB 1BW8A 4L8SA 3SN6N 1Y7VA 2XN9D 5J11C 3MRFB 2AK4D 2IH3A 3IXTB 3QXWA 4IU2A 4WU5A 2DICA 5CM1A 2D7OA 3LD8B 1N5YH 1AGEB 3AG1B 2ZXDA 1YMMD 3N5AA 4FULA 2HX7A 4X7TB 3NFNB 3W0WE 5HDWA 2R56H 1E4XH 5IMMA 4N2BA 1OL0A 4K94L 3QXDB 1RK0B 2ZKXA 3HJEA 1G7MA 2BNQD 4YFLI 4NNPL 5DJXA 3S6CA 3VXMA 3KPMA 3IKCB 1ID2A 2WTOA 1TDQA 3MLTB 4QY8B 3ZYOA 1CICD 2BP8A 5GZOC 4JRXD 3WJJA 3F84A 4I5BA 4X4ZA 4TTDC 4G6MH 1BZ9B 4APQD 2AABH 3BPLC 5EG6C 1I8KA 1S9KC 4FG2A 4WI0A 3NJNA 2EINB 3DHPA 3FU7A 4AJ0A 1H15B 4OSUH 1UZ8A 4ZX5A 5IMKB 3LKSA 1KJ2L 4IHOB 3VFNA 1WT5A 1J18A 3IRZA 4P2OD 2ESVB 3CFKB 3QISA 2C9UA 1ML0A 3K7UA 4GKZB 4HPOH 1U58A 5D71L 3WXWL 4CAGA 2HTLC 2JCWA 5B21A 2EYTB 3AT0A 3CVHH 4GQ9L 4UIKH 5DVKA 5IHBA 3D4CA 3KPMB 1TZIA 5TPWH 4U6TA 1NCGA 2Y7QB 3T77B 5L88H 2RCSL 3NJMA 4YZFE 1VFAB 4HW6A 1XSIA 2NY5L 2VXVH 4OI7A 5EO9A 4AI7A 2OXHB 3FN3A 2VMJA 3SQOH 3OKEA 5KVFH 4NCC2 1NKGA 4NB7A 1AQKH 4LPYA 4ENZA 3HE7D 4OF6A 3PWVA 2YR3A 2Y22A 4FFWC 3KXFA 7FABH 3FOMB 2ICEB 2X4RA 4GOSA 4F2ME 2BOLA 3OR6A 4MQ7A 4NRZA 4X6FB 3EJRA 1A7RL 5D1XC 3RGVB 5J6GA 3GSWB 4GRLB 4FKEA 1QR4A 4IDLA 4S11A 1XCQB 1GZHA 4I9WD 3MACH 1TZIB 1GZPB 4D9RD 1SHSA 2APTA 1J1XH 1I1YB 3FQUA 1HQRB 4DVRH 4HS8L 1CI5A 5CLZA 3L9RB 1KJVB 5DRNA 4L8CA 2R69A 2XI9A 4A6YA 3L6FB 3I6KA 5E2VL 4YHYB 3ESOA 1BXVA 1ZLWK 3H3BC 4HIJA 3OZLA 2H1XA 1CGUA 1CPUA 2GSGA 3QZOA 4P0DA 4XN5A 3RTQB 4XXWA 1AGBA 4OJCA 2WQWA 2DPKA 3L1FA 4ZXBC 3PNWA 1GYAA 2D4FA 1LILA 3FOMA 2XWJA 2OZNA 4Y5XB 5I1LB 1N26A 2NX5A 4QAWA 2DAVA 1M1XA 4PJ7A 5LB1A 3U36B 2Z92A 5J6GB 3V4VL 5IJVB 4MD0B 3X3FL 4DGIH 4FA8A 3G6DH 4BM7A 1FLRH 5E6ZA 1CFMA 3EO9H 4P59L 5D5MB 2DEXX 5IHUL 3HZVA 5PAZA 4WO4A 2DW5A 2XRAL 4XH2A 1HAUA 3OG4B 4N0CC 5CEZE 5BQDA 3O2DA 3ZBMA 5B1AB 1IEBB 3QJHB 4M7LT 4KZDL 1A7PH 3HZYA 1JGDA 1JV5B 4G1EB 4GO6B 2M26A 1KFGA 3BZEA 2CLVA 4KROB 1XF4A 5DJCB 2DF3A 5EA0L 1D5ZA 3TO4C 1A2YB 3K1KC 4X9BA 4DP4X 4E42B 2WJ5A 3CFTA 4F8LA 3DIFB 4GPVA 1UEYA 5IW6B 3CE1A 3UOAB 1FO0H 4M1GH 3RWJB 1G0DA 2Z34A 1FBIL 3FQXA 3HI5H 4GMTL 2FQDA 3ME0A 2ALAA 3ABMB 3B7RL 3AABA 1Q0XL 4IGBC 3UAEA 3BFOA 3C5ZD 1CXEA 3HZVB 3OZ9L 1DUYB 3F62A 2CM6A 4P5MB 3A23A 1T5XB 2BVEA 4NQDE 4WSJA 3V52L 5MEND 4JQIL 3WO3B 4J1UA 1XSJA 2VXSH 5HDQL 1BM3H 3D6GA 4UT9L 4N5ED 1IEBA 3MROA 3QJHA 4UINH 2IOIA 4XOCA 1HJBC 1PBYA 5DUPL 1AOHA 4JFWA 1FL3A 3QB7C 4J3WA 3UIYA 1ONQB 3AY4C 5EORL 5MI0C 1DLHA 3GTTA 1UHVA 1KXQA 1Y1DA 1K8IA 2IDSA 5KANG 3UG4A 3LNFA 1WBYB 1ED3A 1T0MB 1AXTL 4AIZB 3N04A 5GGVY 1E5BA 1NM9A 2BP5M 2ZAGA 3NA9H 2YKLH 5T5FL 5F9WC 3W37A 4Y9EA 4QHMB 2KUTA 4OV5B 4HXAH 5EV7A 1VEOA 1X6LA 3TO2B 4HWNA 1JZHA 1UKSA 4CKQA 3GC3A 1EO7A 2KLRA 2CDFA 2KKQA 5H4YA 4TOYL 3T3MB 2VOTA 4GQQA 2ZWLT 1Z5LA 4MDJB 3HS8A 1WC7A 5AOLA 3FT4B 4DO5A 3ILEA 2AV7B 1AXTH 1DVQA 4RBPK 4P2CG 1E5YA 2CDGB 2LTQC 1ZLWH 1QR1A 3MXWL 5J1SC 5I16A 2NY1B 2X9XA 2FUTA 3HE7B 5DD0L 3ET9F 3AZUA 4JUSA 4PTUB 5G4NA 1P84J 1B0RA 4ZDHB 2EDKA 4RAHA 3FO1B 1H9DA 5AAMA 3STBA 4Z7WF 2WLNA 2EXSA 5K1VA 1OT2A 3FTSA 3AAZB 5DGRA 2WQRA 4FD0A 5DFTA 1AZCA 3O4OB 3BKYH 4A2MA 1BOGB 5DO2C 4X4MA 4AL8L 4FQCL 3VCLA 1G7LA 3TEZA 5DJZA 4NQDA 3VO0A 4NOFA 4D0DA 2X38A 1NGZB 4MZ3A 3SQBA 4UQBA 1CK0H 1TKWB 3FT4A 1OF2A 1L0XA 4RZCB 1E2VA 3MRKB 4RISL 4WV1A 2AS5M 3FU6A 5KBNC 1K3IA 1IBZA 5GSVB 3QCUH 3U30B 3SDCA 4PTUA 4H8HA 2H2SD 2H9GB 3OB0K 4IKLA 3VSVA 5F7DB 3DJSA 2NY5C 4X42A 3ULVD 4RDQF 4NWUL 2HG5B 4ODVL 4AGOA 2JKSA 3F2LA 4YGAB 4AVKA 4G8IA 1BEYH 4BCYA 3MV01 2J73A 2IADA 1T7WA 3NDZE 3DV4A 3IJ7A 3ZIMA 2XBDA 1F86A 1OZUA 1KOAA 4GAJL 4LKCA 1JGEA 1DN0B 3PAUA 3VXNA 1W91A 1Z9MA 2OW7A 5K9QI 2ZPKH 1OF2B 1OCZB 4QWWD 1QO3A 5I17B 4BQBA 1OW0C 1JZ2A 4TLUA 1YC8A 3OC5A 4PWKA 1JYWA 4QTIH 3ZGIA 1CFBA 5GSVA 4ERSL 3BXNB 1FPTH 1MEXH 3JV6B 3K0YA 3LHPL 3QZLA 2BFVL 2Z8RA 5CN3A 2FVNA 3FS9A 5DRXA 4BKLB 1HCVA 3B9DA 1A1MA 3UZVA 3FB6B 2F19H 4KXZI 2JJSC 5E9DD 5JOFA 3EKCA 3EHBD 4OZGE 4TUKH 4AYGA 1A6VL 2AXGB 4P07A 1SF5A 4ZTEA 3ZO9A 1USQA 3B6SB 3O3UN 4PJ6A 1ETB1 2UZYB 3EADA 4HHAA 4PJIA 4CW1B 2OK0H 1CLZH 1CBJA 1DN0A 3A5VA 1AXSB 2C3VB 3ENEA 3PAYA 2VJ8A 4U1JA 3PL6B 1KFAH 4KKRA 5I1CH 3VG0H 1QO3B 2QSCH 1B4JL 1FFNA 3QEHB 3KWVA 4PYGA 1INQA 2G75A 1BFTA 3ZDZE 2DLGA 2WBWB 3GLDA 4IU3B 1QUNB 4KI5D 3M7FB 4YFDB 3GQFA 4XZ4A 1SVZA 3VXRB 4LPVA 3VI3F 5D7SH 4MMZA 4MXQC 4AC2A 1CXFA 1SLUA 3E8UH 2J8OA 4N2OA 3BPOC 1NOLA 4FXGC 1ASQA 2B0SH 3UZVB 1T4KB 2XV0A 5T8IA 5KJRH 2ZCKL 1I8MB 1YHPA 1UWEL 2AXGA 1UM5H 3O3AA 3P77B 2BOBA 1KBBA 3D2UD 3F7QA 4W9KC 5B39A 2F19L 1B6UA 4Y4HA 4NBZB 3CCHA 1OCWL 5DMIL 3WN6A 1T7VA 1HNYA 4LHUB 1R1CA 2NRDA 3U1SL 4P04A 3S36H 3VUAA 4MDIA 3DLQR 4PJHB 2UYLB 4RIRA 2GBTA 5ECJE 2NY4C 3PUUA 4PJGA 1U42A 3DETC 4L2LA 2XN9B 4HIIB 1JZFA 3O6FA 5CJXC 3Q6FB 1WAAE 1BG9A 3IB4A 4R0LA 1HWHB 4AL8H 5F6IB 1WCQA 2OI9C 3EYOB 4N2AA 3DYMA 4JQVA 4WUUD 2YQ3A 4H13C 4WFFD 1I9RH 4EI5D 1HK6A 1HQ4B 1A5FH 1GW0A 2F8VA 5D2NC 3ZHKA 1II4E 3FSAA 5T1LB 2H3NA 4WU7B 1PZDA 1BVNT 2YGQA 3BC9A 5BZWA 5ITBL 1GGYA 1QEXA 5HGAA 3WXVH 2VH5H 1FYTD 3CWGA 3K4ZA 4AEIH 4FL4B 4XE0A 4YSDA 2JJUA 1AZVA 3D2TA 5C3IA 4FFZA 5F70A 1S3KH 4OF3A 1U8PA 2YAQA 3CQPA 3T3PE 1SXZA 5JOPE 3Q5TA 1CQYA 4DCQA 4HT1H 4I0PD 3VMOA 1OLZA 5ES4B 4G7SB 1GTFA 3V5HB 3VQ1C 4R7XA 4YDLC 3VRLE 1R34A 3MLSH 2F61A 3FQTA 4P2RD 2Z31A 1NANI 5B3JF 5DTFA 3TBWA 1E3FA 2YIHA 1RZPA 3UH8A 2WBKA 1HH6B 2L4OA 5FKPA 4TL4A 1KXTA 1PQZA 3QUMH 1T1XB 1NGQH 1V7NH 1BBJB 2X1OA 5KSAA 3ECUA 2AEPH 2JKRM 3BP6B 3KS0J 3TLRA 2A6IA 4HJIA 2DI8A 4U7KA 2ICWA 4HGWA 5F6HI 5J11B 2JCCF 1SM3H 2IO5A 5GRZA 3T8MA 4PJDF 5FHBL 2MPAH 1DN2A 1CIDA 5HHNA 1NC2A 1FZJB 3PPEA 4GKOA 2X3BA 4Z3JA 5B7MA 2F08A 4IYKA 1QFUL 4N8VA 3EGDB 3U7WL 1XR9A 3BPNB 3BT2L 2VGLM 4AIEA 1FN4B 4Z7WB 1C16B 4HS6A 2V3FA 1I8LA 3ZE0E 1G4RA 5I18H 5KSVB 3FPYA 4CSSA 4M5YL 4U3SB 1L9RA 3WNKA 3MUZ1 2ZOLB 1AXIB 1ZAGA 3P3UA 1JF1A 2BK8A 4HC1L 1XH1A 4L4TB 4LSUL 3RGVD 3CSYA 3FQNB 4YDJB 1GIGH 4AW4A 3DWTA 4XWGL 3BWAB 5FKAB 4RMVA 2HT3C 1TSHA 4XCFH 4G7YL 4KC3B 4KRMB 3MRHA 1JK8A 2FECL 1DQQA 2KPNA 5FCUH 5IK3B 3AACA 5T5NG 1N6UA 1XDTT 5KEZA 4QYOA 5EIIB 1FZJA 2G0KA 1A9BB 5FYJH 3EGSA 4M7KH 2FNWA 1MCDA 1XR9B 4Q9BA 1C16A 1AJ7H 2A77L 3VM7A 4BDVA 5D2LE 3RDTA 4F9PA 3JWOL 2J6WA 4JGMA 4NKIL 3TZVC 4AYSA 4UZUA 3FCSA 5I1EL 3NJIA 4YIQA 3QUMB 3TYFB 2DDQH 4PJAE 3D2UB 4EAEA 2APFA 5C6TH 5IROC 3UYRH 3GI9H 3TN0D 1MIEH 2V5TA 1JK8B 2NYYC 2V2WB 3ULUD 1Q0YL 1EJ6A 2QJDA 4IM8A 5HI5C 5KZCB 1ZJBA 3PHQB 5MEOB 4Z7NB 3GNML 4FC3E 3VXSE 4G8EA 2D7TL 1A9EB 4TUUA 2Z7ZA 5C08E 2YAOA 4EO5A 4YSEA 3O6MH 5LBGA 3RDTB 4IRZL 4JANB 2FBJH 3RPBA 4XPHL 1SJEB 2ADJA 5IJDC 4B7IA 5CEXA 1EZSA 2ARJQ 1XF2A 2XVBA 1ASPA 1B0WA 3DGGA 1O7VA 3ARUA 4HJUA 4L3CB 4NPJA 3RDJA 4Z3GA 3RUGB 4K2UL 4FL4C 3EJPA 3F7LA 3OLEA 4P99A 4AUJA 3W11C 1KB9K 3MHZA 4N0UA 4NHCL 2Y3AA 2D3LA 2A6KB 1UASA 3ATDA 3LH2L 1WA0X 1MNUH 2BHYA 2HT2C 4K94H 4BGDA 1AGCA 2XWTA 4IRZH 3MFGB 3BIKB 4GQPH 4Y19B 4M9PA 1J11A 4Z7VA 4ZXBB 4H8UA 1YSOA 4APXA 4ZSOB 1IILE 1MCOL 1BBDH 1HYSC 1A9EA 3T09A 4YHMH 1R5VA 3QCVL 4ZFFA 4K3GA 3OQRA 1AY1H 4M6OL 4WHCA 4L4VE 2PTTB 1UD6A 5D6CB 1CDCA 2JIXA 1K6QH 1TVHA 2AVFA 3QJXA 4IIQB 4N0FA 4JFYB 1FNGA 4YXKH 5GISL 1CDBA 4LOUC 4MHHG 2CJSA 2H0PA 3KPNA 5D7LA 4DERA 3PWNB 5IMLB 3VDBA 2E7HA 1FYTE 2BSDA 4Z7OB 1LE5B 1L9SA 1MI5B 3MOAH 3VRIB 1OT4A 2AEWA 2D03H 3QNYA 1T03L 4MCZA 3QIUA 5DSCB 1HC1A 4RESB 5C0BA 2XFXB 1QAWA 4RETB 3BIKA 1M7IA 4NKDA 3Q8CA 4HUUA 4LARH 4AT6A 4FG6D 4Z7VB 4MMYB 4HHGA 5DD3H 2NR6D 1JZ4A 1GIGL 5FYKL 3MUGB 4AVHA 2OSLA 3UAFA 4QLRA 1QTYT 2Z0BA 4LLUA 4ZMPA 4WDIA 3BIBX 4OF5A 5CJQL 1ZIBA 2ZKMX 1AANA 3KPPA 2VXVL 4CMHC 5E94B 1KBGH 1KC5H 2A74A 2VDQB 5IG7B 1HHJB 1QACA 2QTVA 1JWMA 1F4WL 4QHKJ 1MVFA 1QTSA 3KM2A 4L4TD 4HFUL 3FYEB 2DTMH 5FO8B 2R59A 4N2CA 1RPUA 3BKMH 1XGYH 1BAFH 1LEKB 3OG6B 4P2YA 5FYKH 2H1LM 3ZDZF 5TQ2L 1ZWIA 3P0YL 4YC2C 4IOIA 1ETZA 3VVWA 3DJRA 3F5WA 3L4ZA 3WJMA 1KN4L 2XZAH 2JSFA 2OJEA 5F7AA 3AREC 3TO4A 4ZNCD 3EJZC 1HEZA 3D0LA 4B0MM 1S8DA 5AKRA 5EOCJ 2BWQA 2IWGA 4GSXA 1KCWA 5C08B 1MIEL 3E1F1 3TNNA 3VAEA 3MPCA 2DTML 3WFEL 1A3RL 5TH2A 1QWNA 4JPWH 3CFKA 3E6HB 1ZIAA 3OHMB 1CIUA 1U58B 2OTPA 5E7BA 2YPLD 4P46A 3QPQC 4GLRI 5EBGA 2BVOB 1KEMH 3QUGA 4DGYL 2YPKB 43C9B 5KVDE 3S3PA 5HHXH 5LCVH 2R8SL 3GMPB 3QORD 4RRPG 1DDHA 1W15A 3ZT6A 4DVRL 4XE5B 1VFAA 3EG9B 2WYIA 2E9JA 3TT1H 4DN3H 1KCRH 3T2QA 4WFEE 1TJGL 4L29B 2ADIB 3HG3A 4A2DA 5IJBC 3K5SA 4G6FD 1PY0A 5HYSB 1GSKA 3OKEB 4YQXH 4IBUA 4JREC 4N5UA 1FQ9C 4ETQB 4QXWA 3NJVA 4RAVB 2NZIA 4Y4FC 4G9FB 4Z3IA 4F7PA 4LDOB 5TH2B 4ZS7L 4CSTA 1PD1A 4X6DA 1GCYA 1X5GA 3LD8C 3OB0H 1TTAA 4X8JA 4UANA 1ET5A 3F12B 2Y23A 3O4OC 3OR6B 1GGIL 3L7FA 1SOXA 1OCOB 2X9WA 2FWOB 1FSKB 1EEQA 5L7XH 4URTB 2BLFA 1KULA 4M6OH 1ZT4B 3CLEL 4LARL 4WWKB 1KGXA 4FFYL 4DGUA 5GGSB 3WENA 4MCYA 3EG9A 1YPZF 1A14H 3L9RA 5FAAA 5FHAH 4R6UA 5B3JE 3NIFF 3CLWA 5LWYL 1RUQH 2V2XA 4HXBL 4UM9B 1NCUA 2EIZA 5DD1L 4FLHA 5E6IC 5HYSA 2VMDA 4AK2A 3AU0A 2YEVB 4HPOL 2MPAL 2C1PB 5C1MB 1YECL 3SB3A 4PS4L 5JR1L 1KBVA 1KZQA 4D0BA 1K6QL 3VXRD 1RULH 4FYRA 2DQDL 4XB7A 3L3OA 3TEWA 1QRKA 3PWJB 4JZNA 5KBLA 1A66A 2ZUWA 4J12A 2WXMA 2WLKA 4UQAA 4UU9A 5H94A 2Y1YA 8CGTA 2IDTA 1FNSH 1E65A 3NCJH 2X40A 3KLLA 1DFXA 1ORQB 1UUSA 1QRNB 1UZGA 1MJUL 3BDBA 4PBDA 2VLME 4XH2B 2GEQA 5CF3A 4HC1H 4N2EA 2MHAB 4PW9A 5FUCC 3SE8L 4YHOL 1Q9KA 4LFHD 5B4MC 2N0KA 1JGDB 1CLVA 2VL5B 5E2TH 2B1AL 4YSCA 5B38B 2X89A 4ZFZA 1AFVL 5I9QB 2XWBA 1BZEA 1LO3H 3WBDA 4AX3A 1A2YA 1D7CA 4WHTA 1OSZB 3MRPB 4MNGA 1JNLL 2YK1L 3D09A 3L3OB 4Z7AA 2AI0L 5EIQA 2VLRA 4ELKB 1FG9C 4FP8L 3KDMB 4NJ9H 3I50L 4TUJB 5T1LD 4S1QL 4R2GB 3C08H 3X11B 3WO4C 4KKQA 2E9IA 3ABZA 5D7IA 4POZC 1J8KA 1Z5YD 2K4WA 2PP7A 3RGHA 1DUYA 1DE4A 1PNDA 3UXFA 2LU5A 3L4CA 1LHZA 1I9EA 1TLKA 2O6PA 2DWEB 2R0ZL 5DC4B 5LBSL 4MJIE 4DSYA 1A4BA 2YD2A 1EK3A 4NC2B 1OP9A 1NDGA 5C09E 4YOKA 3DV6A 3BD4A 1EEUA 5JIHA 1WFOA 2Z4TA 2CGRH 3IU4H 5EEVA 4WI5A 1E90A 5FC9A 4JFPB 5CSZA 1FL5A 2HUEA 2O6FA 3C2SA 3H7BB 5C08D 1RAMA 3I6GA 4S10A 2QT6A 1HNFA 3H3PH 5A40E 1OSZA 4MNGB 3SOBH 2DWTA 2AK4A 4X4XA 5FYJD 4QIRA 1BYNA 3OKYA 4OCXH 2J6EL 4TQEL 3KAAA 3EJYC 2OMYA 1B4TA 4CVWA 1CMOA 1EBAA 2NW3A 4Q0XL 2XXGA 1PKQE 2ZSVB 2N7SA 1BDYA 1BPLB 3ZE2F 2Y2TA 3LRSA 2CDFB 1UEMA 3BGAA 4F5CA 4CNIB 2YXVA 4IKKA 4BZYA 5I8KH 5IR1B 3K2MC 3ZIYA 3E9TA 3L5IA 3SDXB 3CD4A 3GSVB 2N59A 3LNIA 5F3HB 3SCMB 3CN4A 3W3BA 4BZ2H 1SLVA 3FH7A 5BUAA 3VGHA 1BJ8A 3WXVL 2EVFA 5LKNA 4WFHE 4UOZA 1L9PA 1LD9B 3P30H 4XZUA 4J3VA 1DBML 5GGRB 2YD6A 3ZTDC 2XU9A 3DGDA 4HG4J 1QSED 3QO1B 3RNKA 2PNDA 2KT6A 3HZKB 4ODVH 1J1OL 5EN3A 5JHLA 2G2RB 4PUBH 4QRUB 5ADOH 3U6XA 5J0BA 3VWJC 4HCGA 5FLVA 1M7DB 1DQTA 2X4QA 3QJTB 2YOCA 1XR8A 3GJFH 4OAWB 3U4BL 3OHXA 2P3YA 4P3CH 3QQ9C 5HYJE 3KCWA 4NSKB 4HKJA 3LEYL 1AG6A 1HTYA 2ERJB 1EFQA 3D39D 3VFMA 3QUML 3ISRA 5B7EA 2NZ9C 4P23C 3UGUA 3L3KB 1ZHNA 1R4XA 4KUCF 1TETH 1WRFA 1S7QA 1TEYA 1O9ZA 1LD9A 3VFGL 1FNLA 4FNRA 5LJYH 3EXJA 5ACLA 3WEXA 3OHXC 1RKRA 3GLEA 4KPHH 1R19A 5C0NC 1ODUA 2RJMA 3AQZA 4YDKH 5TE7H 2JXMB 3D7PA 3A6BL 3MZTA 4XTRC 4X0KA 4CMMB 4JBSA 3N44F 3K8KA 4Z0BH 3BAIA 5AW0B 3FUIA 2DM4A 5T1JA 3RUGF 2FWLB 5JIKA 4OM0H 1N5AA 3ASNB 3HBPA 4PSPA 1N18A 4P3CL 4KVNL 3NIDF 5DMIH 3LXUX 4X9GA 3S5LG 2XPGA 3QHZH 3U2IA 4Z5RA 5K9JL 5K9QG 1MRFH 2R2HB 3L3DA 1EWHA 3EJCA 5IHZA 1ERNA 1UCTA 2CKBA 3GMQA 4PWGA 3OV6A 3US0A 4M5ZL 2B0SL 3IXAB 5BRZE 1LEIB 4YAQB 3M88A 3FB6A 3LHPH 3QA3B 4IEFA 4B60A 4F8PA 4ZI8A 5KN5B 2YWYA 5I8KL 2JXMA 3NG5A 3T65A 1IAKB 5AVWB 3DX8A 2IAND 3KYNA 5CBEB 4XOAA 3U1SH 1EHNA 5AW6B 2ED8A 3DRTA 1RZ8A 3EOBB 5AYUL 4KNSA 2WVTA 2QMJA 3WSQL 1NEPA 4EUPA 1PFCA 2R51A 4FLRA 3OF6D 3FUJA 4MJIB 4CJ0A 2XPGB 1QUNA 4JFEE 5AYQA 3O2WH 3UTTA 4P46C 3A4FA 1T6BX 2WCPA 3VXUB 4OFQA 3WEAA 3IDMA 4OKVB 4YXLL 4I3GA 2IVFC 4UOJA 4FDWA 1AHWC 4JO2H 4M03A 4O02B 1LEIA 4XP5H 3QUXD 4P2OB 3AS1A 3DBXA 3MA7B 1KIRA 5SWZE 4GO9A 2J8UF 3U83A 4IKJA 5DS8A 1NPUA 1PNCA 2VNCA 1C5DA 3K8MA 2DKSA 3K46A 4XB8A 2QKIC 4RNRA 1XGRA 4F7EA 2FX8L 3NZ8A 4EQ3A 4I0KA 5IMMB 2L7QA 4GSQA 2R1XA 1W0YT 3T0EB 3B9VA 1KV3A 1ZVHA 2XN9A 2XZCL 1UZ6E 1CC3A 3FPXA 3ZRFC 2VLRE 1BA9A 3HPLA 3IKCA 1KB5B 4B50A 2XYBA 3ORJA 3VXTB 4D7BA 3OPUA 1N59A 1U0QA 4E9TA 4DK3A 4TTDD 1L7IL 5DCCA 1CG9A 2H3XC 2XV6B 4HJJL 4NO3A 3QJSB 5GZOD 1VFBB 2J1KA 2H26A 3PV6A 2H3NB 1O5PA 5BZWB 4LP4A 2B59B 2J4WH 3G5VB 1E0OB 5C09A 3K6IA 5JQ6L 3QUZB 2XBZA 2CK0L 5EEXA 3N43F 1E4XI 3MOQA 1XGRB 3IRCA 2EIJB 3U30C 5CJ5A 4F7TA 3OJVC 4NWTH 3VFVB 1X7QB 2Y2YA 3KVQA 3VGGA 1XQ4A 2V3DA 4TYUA 1EAQA 3RX7A 2VUOA 1KN2H 3C9NB 3FONA 2AJSL 3GD1C 3QNZB 5I6PA 2IQ9H 3CIQA 4P9HL 1E27A 3HN8A 2JWYA 4Y7OC 2NT1A 5AZ2H 1YEFL 1ZS8A 5BZDA 1VFBA 4MJ6A 5HVWA 4OGZA 4IRJA 3UO8B 4M7JH 4P5KA 4URKA 3LPWA 1DQVA 1N3NB 1FDLH 4LVNB 1VIWA 1GS7A 3P4NB 2OL3H 1P6AB 4JPKH 1GJUA 5AWNH 2I07A 4NZDA 3PQYB 4N8VG 4XBGA 1K4DB 3L08A 4QR7A 1A4JB 1F3DJ 3L9EA 1T66D 4H1LB 3B7TA 1T1ZB 3ZHNA 2CMRH 2QPDB 4Y5VC 5GGSY 3WGVB 3BSZH 1DJXA 3FQUB 3Q9PA 3Q1SL 2BSSB 1KJVA 3WDIA 5FR3A 1ZS8B 4L8CB 3GBMH 4EBQL 2BY3A 2P7TA 4KMQA 3K2UH 4AENB 4UI2A 1JZGA 2W59A 3TH4T 1FV1B 4L3AA 2D7QA 5DMKA 1KB9J 3IPFA 4LPWA 2CBTA 5F44A 4PRBA 1GGCL 4NO0D 3MBWB 4XBEH 3GTNA 4JG5A 5JW4Q 1VJSA 2VAJA 4PR5A 5CMAA 3H56A 1BQHB 4PRIE 3SQRA 2SEBA 4FNTA 4X6EA 5F7MC 4QNPE 3MRHB 3PQYA 4MNQA 4PRNA 1K4DA 4A7TA 2FB4L 2YO3A 1SQ2N 3EH5B 4XAKE 3CZLA 3Q8FA 1PPIA 2XWXA 4MD0A 3DGCR 4NO2B 3C5SA 4JKWA 2A4EA 4Z7QF 1U93B 3RWDA 2ZJSH 3WLWC 4CU8A 1NBVL 5DC9B 4FZEH 2VZ1A 4G8GD 4LCWD 5EC1B 4ZOEA 1VF5C 2YMTA 2P7TB 5F96H 3I74A 3T71A 5ESAA 3BH9A 4OIBA 4L37A 2P5WB 4UTAL 4CN6A 3JWOH 4C56E 1HL8A 1UENA 4I3SL 2EO1A 2Z3FA 1MLCA 4I2XA 1JNNL 4IJ3C 1SN0A 1JAEA 2W0KA 5I1EH 1W6LA 1I82A 2OZ4L 2EVGA 1ZTXE 1R33A 4OFIA 3CMOL 4J4PD 5KVEE 3G5ZA 1MCWW 4QOKB 1DEEB 1IGCH 4GXUN 3V6BR 1QI4A 1NLDH 2X1WL 2XLLA 4NQSB 3HLAB 3IYLW 4IRSC 2VDPB 4V11A 1A1OB 3QUKB 4PREA 4J1UB 1SY6H 2NY1D 5JIQA 4GEIA 4GFTB 1DP0A 1EXUA 3RY6A 3FB7A 5ICYB 4XCFL 3SDDA 4F57H 3FTXA 3TJPA 4H88L 5IOPA 3LH8A 5AVUB 2IV9A 5F9OL 3GS0A 1MHPH 4FOMA 4Y2DC 3SGDI 4U3CA 5I74C 3MR9A 3SE6A 5DR5H 3DX0A 1KCVL 1MDAA 4XP1L 3UTTE 4U7SA 3CK0H 4FCHA 1UG9A 3H6AA 3IMSA 1FGNL 2BSCA 3G5ZB 3H2PA 4DF9A 4HFUH 4KHTH 2AEOA 3NSYA 3KLHD 3HAEB 3HCVB 1UB6B 3WNMA 4NQSA 1DQJB 4NM8L 2B1OA 3CFUA 1SXAA 5F7KC 4PJFB 1S6NA 2YD9A 3X3GL 3HB3C 2VM9A 3KYAA 3L3HA 1TVHB 2X12A 4WFHD 5D71H 5SX4I 3WXWH 1IAIL 5JW5A 1WC7B 4U05A 4UV4L 1K85A 3RUGE 1BVKA 1ACYH 3AXHA 1UC6A 1XGQB 3MGTA 1SOSA 4LNRA 4MYWB 3ZSSA 3QJOA 5D1QE 5TJWK 5LGHH 2PP9A 1M42A 2FB4H 4UIMA 2HVBA 5CP7A 4OKDA 1XGTA 1RUMH 2E7DA 2NY2C 5TGBA 3ROOA 5C7XH 2CNYA 2J56A 2KZKA 4NLHA 1NCBH 4O2EB 1NBVH 3QFJD 5E51A 3IJYA 2O26U 4X6CE 3C2AL 5HD8D 4OJFL 4MMYA 3V0HA 3KHOA 1K5NA 3BFQG 1I9JL 4LCUB 2OSLB 3E8VA 5BV7H 2J5WA 1F4WH 3RYMA 3NEXA 3SO3B 3HKFA 4DP9X 3VCLB 3NZSA 2QKSA 2ICCA 1SEBB 3KPPB 4QKXB 3QDAA 3EYUH 1H5BB 3V4LA 3FO0H 3ARFA 4PVNA 4CC4A 4V33A 3TVMB 1ZOXA 1OAXL 4KV5E 1QFHA 3T6WA 5JHDA 1OTSC 4Z8FL 3R1GH 4MZRA 2OR9H 2VTFA 4MXWH 1D9KA 1EERB 3GGWB 1IGTB 3SE9H 1I1FA 2MOQA 3GUTA 3BQUD 4XN4A 5A43C 4JY5H 1T21B 1TYRA 3F5WB 1YNTF 4KDTC 4Y19E 4ICXA 3RWFB 5T3ZL 4GG6A 1AGFB 4LCCA 1F5WA 3D0LB 3QIWB 4X7DC 3LKNB 5CZVL 3JT0A 4DOHB 1HKFA 5IMOB 2WINB 3RRQA 4GUQA