2EXWC

Crystal structure of a ecclc-fab complex in the absence of bound ions
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Ion-binding properties of the ClC chloride selectivity filter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 34
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2exwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2exwC01
2IG2H 4JZJB 4UNTA 1FO0L 1EHLH 1TENA 1MREL 1G9NH 1LQSR 4QXGH 2R0ZH 3H3PL 5DQDH 3WHXA 1S9YB 3RY5A 4LCCB 1HZHL 3HI6H 4OD3L 1WAAA 1XIWC 1UWXK 1QQDB 3VRLF 5FUCE 5JLZB 4OGXH 4U6VH 3CDCA 1IGFL 3P0GB 1U8KA 2LABA 2VERN 2AEQL 4GG8B 4RDQG 4GJTB 4WI5A 4U1LA 5FV1L 2JB6B 3FHQA 4HAGA 4ONHB 5EZLA 2AK1H 2AJZA 4JN1L 5J12B 3U79A 1QSED 3SE8H 1RULL 1G7MB 3RPIB 4BFGA 1QP1A 3AS1A 1B2WH 2A6JB 2IAMB 2XFXB 4X5WA 5D5MA 1UWEL 4PRDB 3THMH 3D18B 4OQ1A 4FZ8L 1QSEE 4HKBB 4OCYH 3K2MC 3RZCD 5C09B 3QNZA 4JM4L 5FUZH 3ULUD 3V5KB 4L4VE 4RMUA 3NOIA 1MRDH 1G7JB 4X4XB 1IFHL 2GAZA 4P2OA 4IOSD 1ORSB 3N1MC 4HV8A 3QSKB 4U31A 4GQ9H 2R8SH 5IK3A 3K3QA 5K59F 2ICWB 1MY5A 5EU5A 5EOCJ 4Y4FA 3ZT5A 5JHDD 3BHBA 3MGTB 1WAAE 2FNBA 5DQ9A 2VZ1A 1U42A 3PV6A 5CUSL 1MWAL 2OZ4H 5JW4Q 4M6AA 1IC7H 3TBSA 3MV7D 1NFDF 3ZE1E 3W0WD 3STZB 5D7SH 4PRPB 3RNQB 1E0OB 3H9YA 3P9LA 4IIQA 1N64L 2XRAL 3AXLB 3B2UC 5HHNA 1KLGA 4AMKH 3O3DA 1T0MB 5HHME 1T2QH 3UJTL 4WNQA 1EO7A 1XGPA 4PG9B 4EI5D 5LVEA 4HPYL 3ZKQD 4F37K 3KYOB 2IWGA 1EHNA 1OL0A 1E4JA 1MHPL 4OCXL 1OQXA 5D5ME 4OZIA 2FR4B 4P2OD 4UNUA 1SVZA 1AY1L 3QDJA 4LHUA 2AABH 1CDCA 5K9OB 2JCCB 1EV2E 3S5LA 5C7XH 2VMFA 5CGYD 4Y4FD 1JMXA 5BCAA 3PXJA 5HGBA 3F6IA 1ZHLA 1A9BB 2JB5L 4G8GA 4LU5L 4G6AD 3MUGA 2IBBA 4R4BA 3R1GH 1YEFH 3DUHA 2NZ9D 3T8XB 4U1SB 2DQTL 1J1XH 2QHRL 4X7TA 2EIEA 2VQUA 2F19H 1GL4B 3FMGL 3IF1B 4UBDD 4QRUB 4E42A 1NMCB 4I3RH 2ERJC 2VDKH 3QDJD 4LHUD 3IRZA 4X4YB 2A0LD 3FL7A 4HAFA 1KGCE 3I2CL 1LEKB 5C0GA 3HHRB 2VDMH 4G8IA 2XIDA 2M8XA 5FV2A 3JTTB 4OZIE 5HI5C 1FBIL 4RQQB 5GRXG 5EO0B 4UQ3B 5CEZE 1P7HL 5B38A 1XF4A 4XNXH 5I8EA 4OJFL 4MGXA 4G8GD 4MQTB 4NNPH 2PCPB 2NNAA 2G9HB 3I3BA 4JAMB 4MVBC 2Z8SA 1NGPH 4LLWB 4TTDC 4X98B 4FQPA 1N3NB 1SYVB 1CIUA 2X9WA 4OKVA 3FONA 5JA9A 2XA8L 4G8GE 5BW7C 3VI3F 4XP9H 3ULVH 2XZAH 1KCUH 1YEEL 2QQKL 3CVHH 2Q7YB 5DJYA 5KANI 2YBRA 3KPPA 2MQCA 3MFGB 4FZEH 1F8TH 3HZKA 3BT2H 3WXWL 1JF1A 5IKCB 4Z7UA 1QPPA 4NKDA 3OZ9L 3BAEH 1OF2B 2WBJD 5DMGC 1I85A 1I9IL 1OP9A 2NLJB 1X6NA 4E41D 3D9AH 1JV5A 5E99L 2NY1B 4QRSB 3O2WH 3IXTA 1T1YA 1ZANL 4Z7OF 4GAGL 4U0RB 5FF6A 2B20A 1VEMA 1NCCL 3CXHJ 3V4PL 4XHQA 1HHJB 4JQIH 2VUYA 1A1NA 1BD2B 4JZJA 4BZ2H 3BD5A 3BD3A 3MV01 3RDTB 5IMLB 4ERSL 2FLBT 2VXTL 3CSGA 5TDOB 4LARH 4N0UB 4KKLD 3ARFC 3LZFL 4Z7QE 2HTKD 3D69B 5ADOH 1S9YA 4LCCA 1IZKA 3N06B 4FXGB 5ALCH 3RVUC 5A2LH 5I1KL 1N0LA 5DEFB 1QQDA 4YHNA 5JLZA 2CIKB 5HYSG 3HMXL 2EE6A 2ICWJ 2NTFB 1KOAA 3W9EB 4GG8A 3QFJB 4NQEE 2CD0A 4Z7UE 3STLB 4DKDC 2B1AH 5BVPL 5DHVB 2JB6A 4ONHA 3WUZA 4ZFFB 1C5DB 5A3ID 4KMTH 4U7KA 1KBGL 4MXQC 2QADC 3RPIA 5K9QI 1T21B 3BJ91 2H32B 2A6JA 4G42A 4X7EC 1VB9A 2IAMA 2XFXA 4KXZH 4PRDA 3MRDB 3D18A 2ZUXA 4EIGB 3HFMH 5E2UH 5EN2B 3TT3H 3WJLC 4W70A 3SOBL 5C09A 3X13A 1Z3GL 5MERB 1U8OB 4M6ML 3K8KA 4GO6B 3RBGA 3BP4B 1G7JA 3GSNB 4X4XA 1J1OL 3EHBD 4GW1A 4JDTH 4G8EB 4G9DB 5AWNH 3HCVB 4G6KL 5DURB 4ODXB 2ICWA 1HHHA 1KJ2B 4XNZC 1MH5B 2AK4D 1WICA 1U6AL 1ZHKB 4OM1H 3VXQB 2G2RA 3MGTA 5INCB 4KRLB 5F7WC 4PGCA 3GNMH 5FO8B 4KZEL 1U91B 4CN4A 1OB1B 4PRPA 3RNQA 3BQUB 1X4ZA 1D5IL 4JDVA 5IFAH 1JRHH 2IAMD 2W9EH 3AXLA 4WI2A 4HLZG 5IVZB 1TFHA 5EWIH 5DD5H 4PG9A 3REVB 1NGYB 3KYOA 4YHKL 3TJEH 5GJTH 1TCMA 2C3HA 4QO1A 3L95B 4RA0C 2FR4A 3KDMA 4JFQB 4YGAB 5HD8D 3U9PH 4NZDA 1DQLL 3PHOA 3NIDE 5C09E 5JPMB 4YE4L 2JCCA 3CFDB 4XPTL 4Y4HC 1X9QA 4KQ4H 2D0HA 5DZLA 1PG7H 4LLYB 1UVQB 4KVCH 4WFEE 1T5WB 5TDPB 1A9BA 4F33B 1MQ8A 3VWJB 2BX5A 1NAMA 5HI4C 3HR5B 4M6NL 5LBSH 5A16B 3T8XA 1Q0YH 1U8LB 1ZSDB 4LOUD 3NGBB 5B39A 4Z0BH 5CJOL 5FHBL 4PRPE 4NHUA 4K3HA 4IRZL 5DO2C 4TNWK 1NFKA 2JKXA 1FO0B 3IF1A 4QRUA 4KK5D 1EIBA 4UTAH 3NTCH 1T4KB 3KJ6H 1I7RB 1LO0L 1S7WB 1AGCB 1PJ9A 1ULVA 1XF1A 4R90L 4HF5H 5FYKL 3JTTA 2OTWA 2BERA 3HZVA 4OT1L 5EO0A 4UQ3A 4GG6F 4R3SA 4NM8H 3FO1B 5E1HB 4I9WD 3QDAA 5LGKA 2PCPA 2G9HA 4JAMA 3GSRB 3H9SE 5J13B 3T0EB 4LLWA 4X98A 5IB4B 1N3NA 3BPLC 1SYVA 3TJHD 2ID5A 2DQIH 1JGVL 4WV1C 4ZQKB 1IM3B 3P4OB 3IDXL 2NY5L 2ZNXA 2Q7YA 5CKAA 3VDBA 5L0QB 4HFUL 3MCKB 5CMAB 4TVPL 4U4BA 2EKSB 5DLMH 2IFFL 5B3JE 5F6HJ 4PBVC 1OCWH 4M1CD 3QXTA 1OF2A 4DN4H 4LRIC 4BUHA 4LCWB 3LH2H 4N0YL 4JHZA 2NLJA 5DA0B 4FQ1L 2BY1A 3L3OB 1HSAB 5HYSB 1NMAH 5EU7C 4ZAKA 5CJXC 4ONOA 4QRSA 4HH8A 4FRWA 2HT3D 1SMOA 2YUWA 4P59H 4GQPH 4P4KA 4ZNEA 2OK0H 1F6LL 4HLZH 1BWWA 1A7NH 1MWAB 1NGZB 4NUGL 1N59B 2OI9B 3CDGB 5DR5H 2AV1B 1G7QB 1HHJA 4N0FB 3C9NB 3DPBA 3OQ3B 4KJWD 2YD4A 1BD2A 1Q72L 4L8CA 4OF3A 5CINH 3RDTA 1QNZL 5IMLA 5TDOA 2YKLH 1JNJA 1MAKA 3D69A 3IAGC 4FXGA 4TSCL 5E24E 1U8QB 2CIKA 5FOBB 2ZSVB 3MLUH 2X05A 3N85L 3W9EA 2NY1D 1S7RB 3B6SA 3STLA 3D6GA 3FAWA 5DHVA 4PIRF 4ZFFA 3TT1H 3RI5F 5IHUH 4FQCH 4AL8H 5DUPH 5IQ7L 1KPVB 1P84K 3BGFC 1L7TH 2AJVL 5DS8A 1NCBL 2ARJQ 1BZ7B 3ZDYE 1T21A 4I1NB 5E8EB 3NCYS 1M05B 3MLWL 5TQ0L 2UV3A 4DUVA 5CBEB 5CD5D 4ZNEE 1BD2D 5BV7H 5CJBA 3RDTD 3DX6B 3W39B 3AM8A 5JW3L 2DRUA 5MERA 1U8OA 4S1RH 2DD8H 3OPZL 3LHPH 4GS7B 3K0WA 3BP4A 4IS6A 3WCYA 1EXUB 1DANT 3ZE0F 3RWGA 1BD2E 1QEWB 3G9VA 1N4XH 3VMNA 3MXWL 4PJEB 1KJ2A 4KJQC 1RJLB 2IGFL 1V7NL 3DRTB 1ZHKA 3QFJD 3VXQA 1S7TB 5CSZA 2OJZH 4NN7C 4UIMB 2YUXA 5FO8A 1U91A 5DK0B 2BFVL 4X6CB 5GGTA 1OB1A 3BQUA 4I0PB 5D1XC 4R6UA 3T77A 2GSIB 1G6VK 4PB0L 5IVZA 3H9ZA 2FJFB 4PY8J 3REVA 5F7MC 3VFVA 1RMFL 3KNBA 3OGCB 4WU7B 1A7RH 2EH8H 4KZDH 1SQ2N 3L95A 3EYUL 2CUMA 3CNKA 1YEDB 4M7JL 1F97A 2NYYC 5HHPB 5DURD 4OLEA 5JPMA 4KUZH 3CFDA 4NZTH 3EYVA 4UAOB 5D4QA 3U0WL 3VA6A 4F7MB 4NKOB 3GZKA 4XPBH 1TZIB 2PTVA 3GB7B 3RVVC 4LLYA 3S36X 1DN0B 3CFKB 1X6LA 3LN5B 1UVQA 3Q6FA 4JGUA 4RFOH 1XH3B 5TDPA 2AXHA 1ZLUH 3O45B 2XXCB 1FLTX 4YFEA 3MUZ1 2LTQB 3BQUD 3HR5A 4M6OH 5A16A 1ZSDA 4LSVL 4GLRI 4PGEB 5FCUL 3V95A 1Z9OA 3VH8B 1I1AC 2VAAB 3GIZH 1FO0A 2VXQH 4TQEH 1BM3H 1F58L 1QOKA 2NR6D 1RZJC 1T4KA 4ZPVA 3QH3A 1S7WA 4OI8A 3PWUA 1IAMA 1AGCA 1OAUH 3QHFH 4OZGF 1HOCB 1MHEB 1RUML 4L8BB 3ARED 4AH2A 1IBGH 1ZEAH 3VXRB 4ELMF 3O6LH 5ELIA 1CDYA 4HWZB 2O61A 4PJFB 1LO2H 3VWJD 3TIEB 2HJLB 3T0EA 1F4XH 1UB6B 1SMAA 5IB4A 1INDH 4LCIH 3VFMA 1MSPA 1FLRH 1NKRA 2B8OT 1IM3A 3P4OA 2GT9A 3U82B 1B6UA 2R0WL 4X7CC 5F7EH 4N9OB 4XP5L 1IGIL 3UAJD 4DGYH 4Y19B 5TH2B 3MCKA 5CMAA 1A6WH 1C5BL 1QFWH 5SWSB 4ZSOB 1F3JA 1PZUB 1YA5A 5HYIA 3IU4H 2BVUA 4M8VA 4KVNL 4LCWA 1AQKH 2P8MB 1HSAA 2YPLB 4KROC 5E8DH 1EEYB 5BOPA 4PJ5E 5F6IC 4ODWB 4XP6H 1ZLVK 4FFVD 3BKJH 4DVBB 3T0ED 4YXHL 1MWAA 2BCKB 1NGZA 2CDEB 1N59A 4XRCB 2AV1A 1G7QA 1EEQA 4N0FA 3C9NA 5DXWA 3G5YB 1WWCA 3C09C 5E4EC 2DKMA 1GPOH 4JO1H 2UVFA 4OIBA 2BVOB 2Z8RA 4KKCD 5CP3A 1T2JA 3IJYB 1HILB 1A7PL 2CXGA 5LQBH 4HS6B 2A83B 1CFTB 3RVXC 1AE6H 3TIDA 4LCWD 2NY4C 1U8QA 3UZQA 5C0EB 4RAHA 2ZSVA 2FSEB 1S7RA 5KVDH 3CGTA 4UIKL 4QYOA 1QLEL 4F7CB 3OTTA 4LPTA 5D8JL 4RGOH 1BZ7A 5E8EA 1FRGH 3E3QE 1DQJB 1M05A 1LO4H 2KPNA 3BGMB 1DQDH 1ZLSL 3QJFB 1U3JA 5CBEA 1DBBL 4GW5B 3KVQA 1EAPB 3AMKA 3TN0C 3DX6A 4XVUD 3W39A 3BXNB 1MEXH 2XT1B 4C56B 1T3FB 2JJSC 2YZ8A 1EXUA 4C4KT 4IDLA 1AR1C 1NJ9A 1QEWA 1TCRB 5KJRL 5AZEL 5EIVA 3DVGB 4PJEA 2F53E 1RJLA 1JPSL 1NFDB 3DRTA 2KQMA 2OTPA 1S7TA 1YC7A 2XZQL 2JK5A 4UIMA 1IAIL 5GHWH 1D7FA 7CGTA 5T5NG 5DK0A 1J87A 4H88H 4JGJA 3VFTB 3SE9L 3BN3B 4I0PA 3QCVH 3LKNB 1RZFL 1Y18B 4ACPA 1GGYA 4G8FB 5D7IE 1R3KA 4NKMB 5JOFB 1NGXB 5C8JB 2FJFA 4MCZA 2B0SH 4XTRC 1CXIA 2F5AH 3OGCA 4WU7A 4Y2DB 4N8VG 2W65B 4M7KH 1GH7A 2IG2L 4MQXC 4PJ9C 1YEDA 1EHLL 4YC2B 3OAZK 5E2JA 1G9NL 4QXGL 2R0ZL 3MXVH 5DQDL 2R1XB 4KRMB 1OTTD 2ZPKH 3HI6L 2Q8BH 3RWEB 2JJUA 5ACZA 4F7MA 4NKOA 4LFHG 4OGXL 3GB7A 4U6VL 1K8IB 1T66D 5DJ2B 5I17B 3CFKA 3CX5J 3LN5A 2CKBH 3FN0H 5H2BB 4L5FH 2ZG2A 4PJEE 2Z8VC 3O45A 4OFVA 4S1QH 1CVRA 1C5CH 4I0PD 2AK1L 4I48A 3VFOB 3ZYZA 2ADGB 3SE8L 2WZPD 1RZKC 1TNMA 2JJTC 5JW5B 1UC6A 4NNYB 4PGEA 3NCJH 4XNYH 2X1OA 3VH8A 1B2WL 1IL1B 1VA9A 2VAAA 1JHKH 3THML 3VFWB 3JUYA 1MFEH 4Y8AA 1OGAB 2G5RA 3RVTC 4OCYL 3BYYA 5FO9A 5FUZL 4TSBH 1IEAA 3MGOB 1MIML 2W9LA 1CF8H 1MRDL 1HOCA 1MHEA 4Y5YC 4L8BA 4I13B 4GQ9L 3HMXA 3VXRA 4YHMH 2R8SL 5I15H 3OAYK 5SX5K 1MCRA 1U9KA 1YEIH 4HWZA 5F3BB 3TIEA 2HJLA 1J1PH 2NXYC 4HS8H 1UB6A 3AB0C 1JGLH 4ISVB 4O2FA 5D1QB 2OZ4L 1IC7L 2ZCHH 1Q94B 3GMOB 2UY6A 5D7SL 3NN8B 2ARJB 1YY9D 4JVPA 4Y19A 5TH2A 1T2QL 4HMDA 5SWSA 4ZSOA 3IFOB 1I3UA 3VWKC 1AHWB 1YPZF 1YZZA 2GY5A 1E6JH 1U8NB 3CUPB 3VXRD 2YPLA 2MPAL 1WCQA 3S3PA 1EEYA 2AABL 5EULV 5D7LA 2E9IA 3SDXB 3KJ4B 5L6YH 4PJ8C 1G7IB 1EFXB 2F5BH 4DVBA 3FB8A 4P5KB 3P4MB 1ZT4B 2C4FT 2BCKA 2CDEA 5DRWB 2VDOH 5TGBA 3VXRE 5H35A 1C16B 3DARA 3FCTB 3R1GL 1YEFL 4H1LB 5HJ3B 1F13A 4HKXB 4Y19D 2F8XC 2EICA 2AJSH 2BVOA 4WI3A 5SWSD 2YWYA 1HILA 1E4XH 3BESR 1WEJH 4HS6A 1FL6B 2A83A 1J1XL 1CFTA 3NZHH 2F19L 1JGEB 1ZAGA 4QEGA 4YK4C 4I3RL 1Z6JT 2VDKL 2YPLD 3HUJF 4MXVE 5SWSE 1IJ9A 2C7UB 2FSEA 4XNUL 4MS8D 1DBKH 2VDML 1NBZB 4NDMB 1PBYA 4F7CA 4PJ7F 1WISA 3QFDB 1JPGB 2YPLE 3OV6A 1DL7L 1G7HA 4XNXL 4D0DA 4KXZI 5GRWA 1DQJA 3LKRB 5D7LE 1I9JH 4NNPL 3V5HB 4XX1E 3ZLQC 1R3IH 4P3DB 1A22B 3BGMA 1NGPL 4LDLB 2E8ZA 4GW5A 5DEZA 1CCZA 4WIQA 1YECH 5D93C 1Q9LB 2DYPA 3BXNA 3V0AC 3MCG1 2J5LC 4D9LL 4XP9L 1ZT1A 2XZAL 1KCUL 3ARWA 3C8KA 3CVHL 3B5GA 1E4KC 3ALPA 3TC9A 4F7PB 2Q1EA 4X8JB 1TCRA 3VRLE 3SN6N 4FZEL 4JPVH 3BT2L 3DVGA 4Y4KC 2APBA 2HJFB 3L6FB 5K33A 1NFDA 4YJZL 1ADQL 2R9HC 4PUBH 3TFKC 2FJGA 3I6KB 4N0RA 4YHYC 3D9AL 1GZPB 1HH9A 4XPAH 2ZOKB 1H3TA 1LGVA 1JRHI 3O2WL 1U3HC 3LKNA 5E6IC 3TESA 1TZHB 4R97C 4G7YH 3VW3H 1BJ1J 4G8FA 1JZ4A 4NKMA 5IW3A 5JOFA 1NGXA 5C8JA 1BAFH 4Y2DA 1CGWA 1ONQB 4JQIL 3RRQA 3W9DB 4NCC1 4C56D 2W65A 3ARXA 2ZJSH 4P5TB 4BZ2L 3HNVH 4WUUB 1CLCA 3U30C 2D7TH 4LARL 1JTOA 4F58H 2H2SD 3SJVA 4MNQA 3LIZH 5K59E 1G84A 5ALCL 1SY6H 3SY0B 3RWEA 5LGJB 5KVMC 1N7MH 1K8IA 3CH8A 3FOMA 1F2QA 2EZ0C 2FATH 3Q6GH 4IOFC 5I17A 4CDGC 5H2BA 5HPOA 5HTSA 4L9DA 5ACMA 1NFDE 4B5EA 2B1AL 1IT9H 5E00B 3VFOA 4JFFB 4KU1A 1B0GB 2DKSA 2ADGA 2GJJA 4I18B 4KMTL 5FYKE 2XWJB 4XWOC 5JW5A 2EEBA 3EOAB 1MFCH 3N1QC 3GDBA 3LKQA 5EBMA 5DFVD 1IL1A 4Y2DD 1HXYB 3ARBB 3RIAK 5BMFH 3QDHA 2J1KA 3VFWA 4AT6A 3HFML 1RJYB 5E2UL 4GXUM 3KYMA 4TVPD 3FN3A 1KEGH 4CVXB 3MGOA 4GG6B 1IGYB 3S8WA 4PGBA 4PGDA 4LAJH 4JDTL 3FN9A 1KN4L 5T1MA 5AWNL 1PEWA 4YX2H 4TVPE 2O5YH 2LVCA 1ZA3B 2EDLA 2Q6WB 2ORBH 5F3BA 4R9HA 3SJVE 3JWOH 4MNQE 1ITBB 3GNML 4ISVA 4D9RD 4HEPG 5ICZB 1MI5E 3MRHB 4HZLB 1HNFA 3NA9H 4K8RH 2NPLX 5D2NB 1Q94A 3GMOA 3NN8A 1JPTH 3PP4H 2ARJA 5IFAL 5I73C 1KLUA 2W9EL 5F7LB 4D9RE 5A43C 2BNQB 1OGAD 4QXTB 3UDWA 5DD5L 4OLXH 3IFOA 2LE9A 5D7JB 3TJEL 5GJTL 4ZO6A 1I8LA 1U8NA 3U9PL 4X6BB 4J4PC 2KZWA 5T3XL 3CXDL 4YXLH 2BVPB 3S98A 3QQ9D 4OCMC 4R7DB 1LK3H 1G7IA 1EFXA 4KQ4L 4LIQL 1PG7L 5CLWA 3P4MA 4HLJA 1U2CA 1ZT4A 3SE4A 5DRWA 3DX8A 5D1QD 1CICB 4ZOCA 5DMIH 4MAYC 4PP1C 1UYWH 4GUPB 1C16A 3OJ2C 2YD8A 3AS0A 1JGDB 3C08H 3E2HB 3FCTA 5LBSL 3VI3E 2DMKA 3MNVA 1YDPB 4H1LA 5HJ3A 4ZNCD 4HKXA 4OIAA 5D70H 1FSKC 4Z0BL 3KHQA 2MJWA 3VE0A 3D39A 5GZOC 3CPLB 4MZ2A 1P6FA 4A6YH 2YA1A 5E6YA 4UTAL 3NTCL 3KJ6L 1UH3A 2C7UA 2Z9TA 5T1DH 1YUHB 4NDMA 1EFXD 1KENH 5C0IB 4HF5L 1DP0A 4HUKB 4Z7OE 3B9KA 1OAXH 3QFDA 2H9GB 5IVXF 4NM8L 1PAMA 3V5HA 3UO1H 4P3DA 4R96B 4ZG1A 3JUZA 5FDYA 4O02H 2EC8A 3JVGA 2DQIL 2OL3B 4Z8FH 3EDKA 3FO9B 4H25B 1MLBA 3L7FB 3T2NH 5J1SC 4F7PA 4X8JA 2I9TB 1KJMB 2OQJB 3GSWB 4RBPH 5DLML 4F57H 2HJFA 1HK6A 3IYLW 4U1IB 1OCWL 3EZ8A 4DN4L 1QKZH 4WFHD 3WE6B 3D39E 2WK2A 1IGCH 4M62L 4TTDD 3I6KA 1FDLH 2IANB 1NMAL 3MMEB 3HE7B 4WGVB 5DMKB 3HE6A 5FYJU 8CGTA 4RGMB 4P59L 1TZHA 4G6JH 4NZUL 1A7NL 4IRJC 5FKAB 1QBBA 1F4AA 2VLRE 1WIUA 4LVHC 5MEPB 5FB8B 1SEBB 5DR5L 3IKCA 1ONQA 3NMEA 1A9EB 3W9DA 5CS7A 2VISB 5DMGD 2HT4D 4P5TA 3FQXB 3NCYP 5CINL 2DMBA 1TJHH 4Q6IB 1RPQA 4WUUA 4F80A 5I1CH 4K7FA 5EA0L 5E0QA 2V9RA 2FBOJ 3QXAB 1B4RA 3TPKA 2Y07H 2Z31A 3SY0A 5B4MD 1AD0B 2YPVL 2WBKA 5LGJA 1RZ7H 4UV7H 2IEPA 3WXVH 1QHPA 3MLUL 4I0CC 4IBLT 4ZOAA 1WFNA 4JRXB 4Q9BA 2CXKA 3RHWK 3T2PA 5E00A 1SBSH 1NEZG 1FFPB 4WHYG 4LKXA 1B0GA 4I18A 3TT1L 4AL8L 5DUPL 2XWJA 1L7TL 3WS6C 3B9AA 5GS3A 3I6LE 1KN2H 2B5IB 4JKWA 3ARBA 5I66B 5KSBE 4OZGB 3W82A 1RJYA 4P5TD 5BV7L 1P7QB 1HQ4B 3L5XH 4BSWB 3U4EB 4CVXA 4S1RL 2DD8L 4GG6A 4S10A 3LHPL 3S4SG 1CFBA 3MO1B 2KUTA 2AQ2A 2BNUA 4PRHB 5F7FA 5TQ2L 1N4XL 4L3CB 1ZA3A 4WUUE 4Q9QH 5IB3A 3WJJC 5FHAL 4LF3B 3VRIB 4LPXA 1LNUB 1A21A 1Q1JH 4JFFD 2OJZL 2DIAA 2X7LB 5ICZA 3MRHA 3DTXB 3IVKB 1CFQA 3TO2A 4GAJH 1O0VA 1RZJH 1GGTA 3QUYC 5D2NA 5I1DB 1MFNA 3NA4A 2EH7H 3CMGA 3CXHK 3HB3D 2EDKA 3ARBD 4G6MH 1QFWI 1H0DB 3WO4B 2P24B 4H8WC 1EEZB 4QXTA 3GJEB 1IRAY 1QSVA 2A6KB 3BIAX 4MQ7B 1A7RL 5D7JA 2EH8L 3CVHB 4KZDL 1C08B 2QLVB 3RWDB 1QVOB 6CGTA 4EQ3A 4RNRB 4X6BA 4JO2H 4UU9B 3VDCA 4PJAA 4Z77B 1DSFH 4E0RB 5E5MB 2BVPA 2YD6A 1DR9A 4KUZL 4GG6E 3HZYB 4R7DA 2A6DB 1UJ3B 1MUJB 3KG5A 5DK2A 3DUUB 1IAOB 2CLVB 5JOPE 1NCDH 5JZ7C 2EDDA 3TBWA 4GUPA 4RMSA 1JGDA 4YNYB 3ARSA 4HS3B 3EYFB 4M6OL 1YDPA 4O51A 2BNQD 1T83C 3AAZB 4HIEB 2M26A 5SV4A 3NPSB 2QHLA 5D2NE 5CP7B 2H1PH 5D7JD 1KFAH 3V8OA 3CPLA 5DRZB 2VXQL 4TQEL 1GGUA 1BM3L 1LP9F 5FXCH 3I3DA 1LD9B 4PLKC 1CDJA 4O5LH 1S7XA 1OAUL 3QHFL 1YUHA 4OCLC 4S1DD 4URTB 5C0IA 3MBEC 1IBGL 1ZEAL 3IRPX 4TRPH 3DVNB 2H9GA 2CO6B 2DJUA 1CICD 4PJAE 4KK8D 5IW1A 1RI8A 1ZOXA 4YUEH 4UT9H 4R96A 3OJDB 3LMJH 4J8RB 1INDL 4LCIL 3AS2A 3FO9A 1FLRL 3NCCB 4H25A 1TETH 4DN3H 1UZ6F 2R29H 2VH5H 3L7FA 5MI0C 4DGYL 1WTGT 3LPGA 1A6WL 1SHMA 3BE1L 4EXKA 1KJMA 2L7JA 2OQJA 5JIKA 2I9TA 3GSWA 5FGRA 1XF2B 4QHLB 3IU4L 4U1IA 2J8UB 2P5ED 1AQKL 3RBSA 4P49A 5KW9H 3CCHB 4ZS6D 5ITFB 5HVHC 3QUMH 2W0PA 2VNCA 2IANA 3MMEA 3HE7A 4S0SD 5DMKA 5E8DL 3TA3B 4P46C 5DRXB 3U46B 1QO3A 4XP6L 1P5VA 3BKJL 2UYLB 4N90D 1MJ8H 1UM5H 5F88B 2OZ4A 5FKAA 5FB8A 1SEBA 3MV8B 2RB8A 2MWCA 1W0WB 2VISA 4N90E 3S6CA 4HCRH 1YEHH 4RGNB 4XPGH 4JPIB 4Q6IA 1RZGA 3ZE0E 1DEEB 3PL6C 4LVNB 1CK0H 3H42H 3QXAA 3MRNB 5DJXB 5LQBL 3S4SB 1MCPL 1AD0A 1DBMH 1FFNA 1AE6L 4QXUH 4D0BB 3QIWB 4ELKA 1YEGH 4JPKH 5BZWB 2IAND 3HE7D 2J6EH 3S36H 3SKJL 4JRXA 4LP5A 4P2RB 2CLZB 5CLTA 3VGBA 3RGVC 1NSNH 2WQRA 3Q0HA 3RA7L 4K94C 2IANE 3LDBC 3H0TB 4RGOL 3ZYJA 1KLFA 1FRGL 5GS0C 1LO4L 5DD0H 1A7OH 5I66A 1ACYH 4PPTA 1RIVH 2AQ1A 1P7QA 1OWWA 5J1AB 4DUXA 1HQ4A 4BSWA 3GKWH 3U4EA 4ELMA 2LU4A 4YZFF 3MO1A 3LD8B 2ICEA 2QJDA 3SGJC 1AD9A 5D2LF 2D7OA 2HVJB 2MMXA 4L3CA 4ETQA 1A6TB 4CVWA 1F3RB 4Z0XB 5FYLH 2FEDD 5HHVH 35C8H 2QQNH 4LF3A 4JRXD 3VRIA 1FQ9C 3MZTA 1LNUA 2W60B 2X7LA 5GHWL 3DTXA 3IVKA 5I1LA 2WIMA 4H88L 5DF0A 4NP4L 5I1DA 4NCC2 5HGAA 1PYWA 3ETBF 3QCVL 4YFLF 1RFDH 4JRXE 1HDMB 1YPZB 1H0DA 2P24A 4WW1B 1EEZA 1P7QD 3GJEA 2B0SL 3QBTB 2F5AL 4XVSH 2EDYA 3EBAA 5DWUH 5ITBH 3CVHA 1BF8A 4OF7A 4M7KL 3G5XA 4PRHD 3RWDA 1QVOA 4W6XB 5FM4A 4RNRA 4KI5C 4WFGE 4UU9A 4U1KA 4Z77A 5EH1A 5D96B 1U93B 1UKSA 5GGSY 2XPGA 4JVUA 5E5MA 1MIEH 3MXVL 4JFDE 4ELME 1JL8A 2ZPKL 3HZYA 2Q8BL 1ADQA 2PO6A 1UJ3A 1MUJA 2A6IB 1E27B 3ULSB 1PQZB 2CKBL 3FN0L 3DUUA 4L5FL 4EDXA 4UTBH 1IAOA 1YJDC 2CLVA 1NC2B 3PDGA 2O93L 4L8SC 2MKWA 5A1AA 4MD0B 4WTZG 4FS0A 3ZL4H 4S1QL 1C5CL 4YNYA 4HS3A 2HFFB 3EYFA 2Z91B 4NUJA 1E4XI 3NCJL 1ZMYA 4XNYL 3HUJB 3ABZA 4X99B 2EYRB 3STBA 3BJLA 3P11H 3WS3B 2GK2A 3N9GH 1VACB 1PW3A 4KHXH 1EDQA 1LD9A 5JIHA 4TSBL 3SHSA 2VZUA 1B90A 1X5ZA 3VFGH 3ULVE 3G04A 5DJ0B 5JORB 4EUPG 4OD1H 5JXEC 4YHML 3QYCA 3DVNA 3MRFB 5GSVB 1YEIL 43C9B 2UWEB 3DXAB 1FFOB 4TNVK 4HUVB 1J1PL 4HS8L 4JN2B 5FCSH 1JGLL 1BOYA 2OR9H 4J8RA 4MX7B 3FB6B 2ZCHL 2ZZUT 2VITB 3MFFA 4YQXH 5IJKC 2NMSA 3O9WB 4KH2A 1RUPH 2PW1B 3FT3B 1XF2A 4NJAH 4I3GA 4QHLA 2RCSH 3P77B 1UG9A 2XACC 2VDRH 4U6XB 1T7YA 1E6JL 1VFBB 4JFXA 3WFHB 2K9UA 2VDNH 5F1IA 3TA3A 1LE9B 3UROR 3FQNB 5DRXA 4QTHB 4Z95H 2UYLA 2F5BL 1KTKE 1ZA6B 3ILQC 2L0DA 2VXVH 3V0WH 4I3SH 3VXMB 2VDOL 2X70B 4HX1B 4RFNC 5GISH 2Y6SC 4IRSC 3UPAA 1N6VA 5FA4B 1UFUA 4XC3H 4J2XA 4G9FB 5J1TC 4JFEB 4FOMA 4P23B 4C58B 4JPIA 3G6JE 1DEEA 1VGKB 4I5BB 1HINH 5DJXA 1E4XL 4LMQE 1RUQH 1WEJL 3NZHL 1FFRA 4D0BA 1UM4H 4F9PA 1F6AB 4XNQB 5BZWA 4BZ1H 3PUCA 1CGYA 2QSVA 3OXSB 4UT6H 5T3ZD 1KB5B 4NQUA 3TA3D 4J3UA 2OX5A 4Z7VF 4P2RA 2X4UB 2CLZA 3S35H 3FZUC 3TCXA 2CK0H 3JWDH 1PLGH 4XB8A 4QRPE 2IBZX 3K4ZA 3MRPA 4D94A 3FT4A 1GGBH 2X6MA 2HLFD 4CN1A 5JW4N 3MV8D 4ZTOH 4XI5C 1I9JL 4G5ZH 4TUJB 5DGRA 1IKFL 3G5VB 2IMNA 5C0CB 2PYFB 4HG4J 5I76B 5IESH 3RQ3A 5J1AA 4RGND 3OHXB 4WW2F 1GOGA 3OKDB 1AC6A 3O4LB 1I75A 3EZJB 3EYQD 2BVQB 4KWUA 2FEEI 4EUPH 1F02I 3BP7A 4FN0A 5MENB 3QIWD 1HH6B 2BVEA 2HVJA 2XTJB 4RGNE 1A6TA 5T3XD 1ZXQA 5A2IH 3HLAB 4LLVA 2H26B 4LVEA 3QCUH 3DLQR 2VDQH 3MRQA 2BK8A 4JKPH 3WIIH 1U3HB 4P2RD 5CWSB 1RURH 2BNRA 4R97B 5F93C 2W60A 4QF1B 4OKDA 4WEBH 4XPAL 2DQHH 3PWPB 4BFEA 1NUFA 4P2RE 3U1SH 1HDMA 1YPZA 4WHTA 3VW3L 4WW1A 1YMHB 1FZJB 1AR1D 3RZCC 3ULUC 4ZUUB 3MLRH 2HLAB 4F15C 3OKEB 2BXYA 4HBQA 2ZJSL 4JFPB 1RY7B 3DO3A 1EGJA 1BBDH 3HNVL 3V6FB 4HIJA 1NC4B 5HPMB 1U93A 2D7TL 2X09A 5AD0B 4LLAA 3WNPA 4F58L 3LIZL 1SY6L 2A6IA 4IHOA 1E27A 2FATL 5E9DB 3ULSA 1PQZA 3MRBB 4YIQB 1IM9B 3C5JB 1NC2A 3L5JA 3UC0H 3QEUA 4MD0A 1IT9L 1N5AB 3UYPA 2ZOLB 2VLMD 2HFFA 2BNRE 2Z91A 3DO7A 4K7PX 2UUDK 3HI5H 2IALB 1MFCL 2EDBA 5FK9B 4YBQC 4OFYA 3HUJA 4QRRA 4MDIA 4X99A 4M5ZH 2V5SA 5BMFL 2XKUA 2E6PA 3WS3A 4P2OC 1VACA 1YPZE 4XVJL 2QQLH 4PJ7A 1KEGL 5IP4A 2XN9B 1ZLWK 5IVOA 1TIUA 2E7BA 5CGYC 4Y4FC 5DJ0A 4XBGB 2FEEL 2XA3A 4YX2L 1AH1A 2O5YL 3WNMA 3MRFA 5JDSA 2NXZB 3U7YH 2NY3B 3EW3B 1NC2D 4G6AC 4JM2F 43C9A 4IJ3B 5J11B 4EDWL 3JWOL 4HUVA 5A2JH 2GSGB 2NZ9C 1Q38A 4NYLB 4NQDA 4NRYB 1FZKB 1ZWIA 4MX7A 1DDHB 3RVTD 1KCVL 2EXWC 2LU7A 2Q3ZA 2AV7B 3FB6A 3MLZL 3NA9L 4K8RL 4MA8H 1XCTB 2VITA 4OFYD 3PP4L 4M3KB 4XPHH 4QOKB 3O9WA 4YXKH 2VR4A 4UBDC 3AY4A 3LN9A 3X17A 5I6XC 3BI9X 2PW1A 1OW0A 3FT3A 4X4ME 3HNSH 2A0LC 3HR6A 1G0YR 3BUYB 3HUJE 4QRRE 3BPNB 4XGZB 1K6QL 1VFBA 4U05A 3HPLB 5EB9A 1K85A 1PKOA 4RMQA 2GCYA 3CH1B 4PJ7E 4YXLL 1LE9A 2BJMH 3CX5K 1WVZA 2MHAB 3FQNA 4QTHA 3HNTL 1LK3L 1M4KA 3DXAD 3GM0A 4W81A 5GS1B 5JXAH 1ZA6A 3MLYH 1XGUA 1X5XA 4FXKA 3VXMA 2X70A 2B4CH 5DMIL 3VFUB 5LXGH 1NANH 5A2FA 2H3NB 1UYWL 4GXVL 3C08L 4P2YA 3O9WD 3K4DA 5FA4A 1S7UB 4UT7H 4G9FA 4JFEA 4P23A 4NQDE 1VGKA 4I5BA 5D70L 3G6DH 1KTRL 4YGVA 5EO9A 2HWZH 3UJJH 1WCBB 1WZ1H 4AK1A 1DANU 1F6AA 4XNQA 4ENED 4A6YL 4OV5B 4XZUA 3V4UH 2DN7A 2UZIH 1VFUA 3FQRB 5T1DL 5LJYH 1KENL 5J56B 2CKBB 1J0KA 1MFAH 4NZJA 5HGHB 1GIGH 3E1F1 2WINB 3VXMD 2VSDA 2YEZB 3LS4H 2ED9A 2VXSH 4TUJA 3UO1L 4Y0GA 3G5VA 1A02N 2PYFA 5I76A 4YHOH 4G9FD 4L3EB 4JFED 2NY2B 1BOGB 4KRPB 3O6MH 4Z8FL 3OHXA 1LEGB 3OKDA 1II4E 3O4LA 4KKLC 1KPRB 2ZCKH 2OYPA 2HTKC 1D5BB 2FX8L 5IWLA 2BVQA 5E2TH 1I85C 4FFWC 5EU6B 4MJ6B 3T2NL 5MENA 2LQRA 1HH6A 5ACLA 4JFEE 2AJUH 3C8HA 3HLAA 4F57L 2H26A 2BZDA 2AXFB 5IQ9B 4P4RB 1QKZL 2DLFH 1L6XA 5IJVB 3S88H 5CILH 2HYMA 5A3IC 1IGCL 1CQYA 4HJGA 5DMJB 1FDLL 5F9OH 4QF1A 3CSYB 4LASH 1HCFX 1NGWB 4O4YH 3HA0A 4XXDB 5DMYA 3MZGB 1L0XA 5F1OB 4G6JL 5C0CD 4JZJC 3NCEB 1FZJA 5F3HB 5LGHH 4IOIB 4ZUUA 4CBPA 2HLAA 2GTWA 4LCCC 3OKEA 4P3CL 4G80B 1J0HA 4M93B 4JFPA 3HI1B 4X7DC 5MEND 1TJHL 3V6FA 5I1CL 4JHWH 2XTJD 5HPMA 1NC4A 5AD0A 3O4LE 3RKDC 1U3HD 5J7CC 5J12C 2ZKHL 1FIEA 3FRUB 1NAKH 1RZ7L 1WWBX 4H8WH 4UV7L 3PWVB 5E9DA 3WXVL 2HJKB 2Q76B 3MRBA 4J3WA 2VN4A 5TE7H 4YIQA 1BIIB 3C5JA 4LPVA 5GRJH 3TO4B 3QWOA 3PWPD 3CLEL 1N5AA 2QQQA 2IAMC 3GI9H 4ZO8A 2YD1A 1GGIH 3BKMH 4KKNA 4HIXH 1LP9B 2IALA 1NKOA 5FK9A 4LPYA 1X5HA 3WN5A 1KN2L 2DTSA 3V6ZB 2DTMH 3QG6A 2MCG1 1RHHB 1RD6A 3WD5L 5HD8C 4ODTH 3L5XL 2AJYH 4IOFD 1A6AB 4YEEA 4PGJA 5J4MA 1NC4D 5IVXA 1MCKA 2GYSA 3I75B 2MQ3A 3CAFA 1X44A 4LEOB 3F7YB 5J3HD 1K4CA 5HDBE 1AR2A 4XBGA 2HFGH 4HKZB 1FGNH 3BDYL 5E9DD 2FECL 1IM9D 4XP1H 4CN6A 4MAUL 4HULB 3DMMB 2GSGA 2X1PA 1Q1JL 2AI0H 4NBYB 2DICA 4NYLA 2Z35A 4NRYA 4ZYKB 1FZKA 3QUZB 4LOUC 1DDHA 1IAIM 5E9DE 4GAJL 2AV7A 2OSLB 5DD3H 2EH7L 2DQUH 1CXFA 5AZ2H 4QOKA 4KMLB 5BJTB 5DD6B 25C8L 4G6ML 3CU7A 2XXMB 1CLZL 4KK5C 2PF6A 3TBTB 1B6DA 1TJGL 3QT2A 2XN9D 4L3AA 3WUWG 4XGZA 4DAGH 5F7DB 3RFZC 5JHLL 4JO2L 3WIHH 4PJXE 1DSFL 2NXZD 5EORL 3CH1A 2NY3D 2MHAA 4NZRH 5IVXE 1J0JA 5GS1A 3Q48A 2F9BT 1RIHL 3TJHC 5FO7B 2EYSB 2R2HB 4JHAH 3VFUA 2H3NA 1SEQH 3OB8A 4R0LB 3WLBB 1S7UA 3P3YA 43CAA 3CSBA 3O41A 5HHOB 5D9SB 1NMCC 5HGDA 4XXCA 1CE6B 4ODVL 4PJIE 4CU6A 3RUGF 2H1PL 1QRNB 4M1CC 1KFAL 4QOKE 1WCBA 3QEHB 5F9WB 3MBEB 4ONFH 4OV5A 2CRZA 1J18A 1J7VR 4O5LL 3N1PC 3FQRA 2HT3C 3HPJB 1NEUA 4N1EA 1WBYB 3LAFA 2CKBA 4TRPL 5HGHA 2I25N 4X5XB 1F4YH 2APVA 2PYEB 2YEZA 3ZZ1A 5L7XH 1S7QB 1PDKA 1GVIA 3NVQA 4UT9L 1S9VA 3CFBB 3B5HA 4KJWC 4YUEL 2P48B 1FFQA 3CK0H 1VFOA 3LMJL 4L3EA 5E8OB 4EI6B 1U2HA 1BOGA 2F54B 1MCEA 4I4WB 5D2LB 1LEGA 4U1GB 4XMPH 1KPRA 2G60H 1TETL 4YHLH 4DN3L 1DLFH 1U95B 2R29L 4HGMA 4MJ6A 2EDQA 1JWSB 3MUHL 5M7QA 1CXKA 3NABH 3C5ZB 4KC3B 2YOCA 3L3JB 2N7AA 2ARWA 4NC0B 4EOWH 1R0AH 4ZAKC 3PJSB 3MODH 1TQBB 2NY1C 1RIUH 4P46B 1SJHB 5IQ9A 4P2QB 1N5YH 3LPWA 5IJVA 1DFBH 5KW9L 4Y5XB 1EUTA 3OAZH 4U0RC 3TBVB 3QUML 5EUOE 1G1CA 3CSYA 1NGWA 3QB7C 1T20B 4OZFG 5KSAB 4XXDA 1AGFB 1NBVH 2IH1B 3RL2A 1KPUB 4GKZB 1MJ8L 1JZ7A 1J9CT 5CD5C 5EZJB 3HAEG 1G7LB 2NY0B 4L3ED 3RDTC 2NY2D 4IOIA 4KRPD 3PL6B 3RWHA 5B3JF 3M17A 1U8HB 1FH5H 2A2QT 4G80A 4AQ1B 4K9EC 3SDDB 4HCRL 5EU6D 3QCTH 2E6JA 4C83B 5I19H 1CIDA 4L3EE 1OVZA 4M02A 3FB7A 4GFTB 1JTPA 1X5LA 4Z9KB 1DBML 3MYJB 5GRUH 4QXUL 1T89A 1YEGL 4JPKL 3PWVA 4NO0D 2HJKA 2Q76A 4WO4B 2J6EL 3LDBB 1BIIA 5KSUB 4KRNA 3TO4A 4PP2B 4JY4B 1KG0A 4X0KB 4MMXC 1L4IA 3OAYH 5SX5H 1YYLH 1LP9A 5MP6H 3CD4A 3AM8C 1FV1B 3IDGB 3U6RB 4WU5B 3V6ZA 3ELAT 1A7OL 2DI7A 3F62A 1ACYL 1RHHA 1RIVL 2R1YB 1JE6A 4OI9A 2D4DA 3FQTA 1CTOA 2P8PB 3GKWL 2EDHA 3BZDA 4U1HB 4B53A 1MFDH 1Q0XH 1OSZB 3TCLB 3I75A 4XCCH 1FG9C 4LEOA 3F7YA 3ZTJG 4WWKB 2OBGA 5IUSA 1A4KB 3ME0A 4A6YB 4PB9H 2C3WA 5E5RB 4HKZA 3ZDYF 4JREB 5FYLL 5IVNA 1A4JB 5HHVL 35C8L 1YY8B 4KMQA 5FECB 3TO4D 2QQNL 1I3GH 3BQUC 1CT8B 3DMMA 3BIBX 1FNLA 4PJCF 1QLRB 4CU7A 1TLKA 3QUZA 3C60B 2C4FU 1W72H 3GHBH 2XI9A 2OSLA 4FQXB 2OJEB 3ARYA 1GRWA 1RFDL 3P9WB 5DD6A 1S3KH 1JPFB 1BEYH 3B3IB 4JO3H 2E7MA 2NR6C 1BQHG 1UQSB 5T5FL 2EE3A 1LP9E 4XVSL 4Y89A 5C2UB 1UEMA 5DWUL 2C1OB 2RBLA 2CUHA 5BXFB 2V17H 1D9KB 3HRZA 5DVOA 2R2BB 2VZOA 1MF2H 1RK1B 1KEMH 1MIEL 3KXFB 4YBHA 2N56A 3MJ9H 2FJHB 3VWJC 4KDVA 3V9FA 4PRAA 4HW6A 3LKSB 3DMMD 4PS4H 3WLWD 1HKLH 5FO7A 4HWBH 3QUZD 1TPXB 2EYSA 3NGBC 1XAUA 2R2HA 2EIZB 3EYOB 3TF7C 3ILPB 4J3VA 2OP4H 4KUCD 3ZL4L 3WLBA 4LEXH 1UZ6E 2AEIT 4Z5RB 4GSDH 1U8MB 5D9SA 4MJ5B 1P1ZB 4EZMA 4U3CA 5GGRY 3RGHA 1XGQB 1QRNA 1IQWH 3OKNA 2YD2A 4Z7VB 3P11L 4LGPB 3KPSE 3N9GL 5IBTH 4LVOB 4LLQB 3IDUA 2X4TB 4KHXL 4PTTB 4J3XA 3IDNB 1P9MA 1SY6A 4FFVC 4HPOH 3HPJA 1FNHA 4H20H 1R3LB 5J13C 3T0EC 4OD1L 5IV2A 4F8QA 5J6GB 1NLDL 4F7EB 2WW8A 4X5XA 2PYEA 3VMOA 2QR0B 4O58H 4OZFB 4WW2B 4PRIB 2FB4H 3QXWA 5E08H 3CFBA 4TPRH 2KZ1B 3MJGX 4Y5VB 3HAEB 5L0QC 4EI6A 5E8OA 1AGBB 2OR9L 2F54A 4AIXA 4I4WA 1BVLB 5HHOD 5D2LA 4KKCC 2RR3A 4YQXL 1NBQA 5HYQA 2BHUA 1U95A 4I2XB 1JWSA 5HVWA 3NBNA 1RUPL 3C5ZA 3MBED 4XAKD 3L3JA 1B88A 1JF6A 5B8CB 3PJSA 4NJAL 3RI5K 1MCOH 2RCSL 3VD3A 4M4PA 4DGVH 1SJHA 2BDNH 2VDRL 1QRNE 4Y5XA 3CU1A 4TUKL 4U2ZA 2VDNL 4X80H 2PYED 5KSAA 3QDGA 2OI9C 1CI5A 2R15A 5CEXB 4Z95L 2IH1A 5DZNA 1WBZB 1KPUA 4GKZA 4DOHB 2R4RH 1A3LH 2VXVL 3V0WL 3DSNA 1NUDA 3G6AB 2GITB 1G7LA 4AIZB 4I3SL 2F54D 2VIRA 3FO2B 4XVUC 4LHUG 1U8HA 4BZYA 3S5LG 1EFQA 4YZFE 3DGGB 1P6AB 3HRPA 3SDDA 4PD4K 3C5ZD 3L1OH 4ORZC 4JRWA 1ACZA 5J8OA 1QSFE 5ILTH 1RUQL 4P46D 4P2QD 4X8XA 4JR9L 5KVGH 2IQ9H 1UM4L 3H9HB 4BZ1L 2DLIA 3ULUH 2IADB 2ZCLH 4WO4A 3K81A 4UT6L 1M6OA 5KSUA 5KSAD 4PP2A 1JUFB 2VWEE 3QRGH 4K55A 5C0FB 2Q20A 2ED7A 1PLGL 3JWDL 1EVUA 2NY0D 1GGBL 4K8RD 3IDGA 3PL6D 1TJIL 1BX2B 1K5NB 2WUCH 4ZTOL 5I1GH 3QDGE 4G5ZL 4GS7C 1KIUA 2WAHA 4LRIA 4WU5A 3UYRH 2C5DC 2R1YA 3X14B 2P49B 3SDDD 5IESL 3QDME 1CGTA 2XWBA 1X5AA 1BQHB 2LFGA 5B38G 1VKXB 1OTTC 3C87A 3TCLA 4JM2B 2E27H 3U48A 4WWKA 1NCWH 1AKJA 1A4KA 1FP5A 4ZUWB 3DECA 4A6YA 5I1EH 3DX9B 5BS0E 5IT2H 5GRYA 3S34H 1A4JA 5GSRB 4WO4D 1QR1B 1H5BB 3CX2A 4L4VB 1YY8A 3QCUL 4PY7B 3P4NA 5IFHH 3U36B 4U3HA 3WIIL 4JKPL 1P4IH 4I0PC 1RURL 1JVKA 1QLRA 1GOHA 1NCAH 4P57B 4HBCH 3EOTH 4NQVB 3C60A 4WEBL 3AUVA 4NOBA 1KB9J 2DQHL 4LSQH 3X3GH 3FFCE 4C55A 4FQXA 2OJEA 4M48L 3WHXB 2FWOB 4LNRB 3DIFA 2OM5A 3U1SL 3S97C 5T33H 3B3IA 4OLVH 1M7IB 1R6VA 3C2SA 4HWEH 1UQSA 3GMQB 1G6RH 3GJFH 2X4QB 3PP3H 3OX8A 3CFJB 4UAOC 4WWKD 1LHZA 2AJZB 5CZXD 1BBDL 3VJ6B 5HHMB 2R2BA 4PRNA 4W68A 4R26H 3D2UB 2BC4A 3KXFA 4CJ0A 12E8H 1INEH 3FJTA 4HXBH 2FJHA 3PDOB 4F7TB 3TV3H 3LKSA 2LTQC 5D5MB 4X5WB 5D7IF 3QUMB 3QO0A 4MJ4A 2FRGP 5J57B 5C92A 1NANI 2DQJH 2WLYA 3C60D 3N1GC 3QNZB 2EIZA 3EYOA 3ILPA 4FQXD 3U0PB 2V7NB 1DLHB 3MOAH 1YY9C 5EBWB 2XV6B 2BRRH 1D5MB 1I8KB 4HV8B 4KI5D 5TFSH 4MJ5A 1KT2B 3PWNA 1P1ZA 3GMLB 3OR7A 1ITCA 1UENA 4X6DF 3GRWH 1XGQA 3KYNB 4Z7VA 5KVEH 1D9KD 4LLQA 1FYHB 2X4TA 4POZD 5DQ9B 4PTTA 2QQLL 3PV6B 1FNSH 2DWEB 3SBWA 3KXFD 2EECA 5I18H 1R3LA 4IIQB 1B0RB 3O3DB 5CJ5A 1HHGA 4WFFE 4EBQH 4WENB 2DQFB 5J6GA 3U7YL 4MSWB 1XGPB 4OCWH 2QR0A 4WW2A 4PRIA 2W38A 3KXFE 4KPHL 2HVKB 3NZ8B 3LVEA 2VQ1A 1D6EB 4Y5VA 3HAEA 1CFSA 1BVLA 4RRPA 4MA8L 3GGWB 4NT6B 4QTIH 2H2PD 2RQ8A 2QEJA 2D3VA 3GBLA 4XPHL 4DW2H 1O7SA 2IBZY 3WKNA 4ZD3H 4I2XA 2D0GA 1J0YA 2O5XH 3FQUB 2W1NA 5HGBB 1U92B 1YYMH 1H3GA 1ZHLB 1MCCA 3HNSL 4ODHH 2HTLD 1Z2KA 4MS8C 4HZAA 5IROA 4O00A 4YHZH 5I9QB 3T0AA 2DJSA 1XR9B 1IC5H 2VLLA 1SJEB 3B9DA 2BJML 4PRID 4P2CG 4U33A 5CEXA 2ICCA 5JXAL 1WBZA 2VL5B 1C7TA 3MLYL 2YRLA 2GITA 4HDIB 5FGCE 3FO2A 2B4CL 3ZKND 5LXGL 3PWLA 4MNGE 4HIIA 4PRIE 5ALBH 5JA8B 4WUKL 3V52H 4CL7A 3DV6B 4UT7L 5GGSB 4P9HC 1ZE3C 2R69H 3BO8B 5DJ6A 3G6DL 2DM2A 4PREA 1T04B 3UJJL 1GJIA 3N1FC 5DHYB 4I2XE 3FQWB 2EIBA 5AG8A 4JZOB 3S96B 2IADA 3V4UL 2X4RA 4JFHE 4QNPF 2DI8A 3B5TA 2UZIL 1JUFA 3F7VA 2YRZA 2DBJA 3MLVH 5B39G 5DC9B 5C9KA 3WNKA 5C0FA 1PD6A 3H7LA 1EZVX 4NWUH 5F1SA 2YBRB 3MBXL 1MFAL 1GIGL 1KCLA 3KPPB 1BQLH 1S9XA 3WFEH 4W6WB 3LS4L 3R0MA 3HZKB 4K7PH 1BX2A 1K5NA 2VXSL 4NQEB 4NKDB 3O6FB 1T22B 5C07A 4DOHE 4YHOL 1NGQH 1KTDB 4MXVF 1UACH 3O6ML 3RVWD 8FABB 1MCJA 1KULA 1JV5B 4Y1AE 2ZCKL 5DFWH 2H2SC 2XKNB 3ARGB 4K7PY 4JM2A 2B1HH 3IXTB 4N5ED 1RV6X 5E2TL 1ZS8B 4ZUWA 1T7XA 4DJMA 5GS2D 3DX9A 4G6FB 3GUTB 2BVYA 2AJUL 5GSRA 5L2JB 1QR1A 1H5BA 4L4VA 4YLQT 4PY7A 4JANB 3U36A 3LKOB 4UQ2B 1BGXH 3A67H 1TXKA 4JG1H 4W6YB 5HDQH 5CILL 3S88L 3HS0B 1CD0A 4P57A 5F9OL 4NQVA 4LASL 4OFPA 4O4YL 4JPWH 3WFBL 5EFIB 4NNXA 5KZCB 1VEOA 1H3XA 5DFVC 1T7WA 5KAQG 4Y2DC 2FWOA 4LNRA 5T1LA 1TTUA 1AGEB 4YHNB 1M7IA 3TM6A 4YC2C 3GMQA 3QEQB 5AUMB 3T4YB 2WWMD 3UBXI 2X4QA 3P2TA 2I24N 4JCMA 3CFJA 4JM2D 1I9EA 5C07E 4GMTH 4OTXH 3VJ6A 3V4VH 3V7AE 4JHWL 1FIGH 4IM8A 3D2UA 4N9GB 2MFNA 5A40E 4L4VD 1NDGB 5D72H 3PDOA 1MVUB 4F7TA 4G42B 3VXTB 4LSPH 3QUMA 1NAKL 1NCUA 4H8WL 1YMME 3Q3GB 4OLYH 4F3FB 5TE7L 3X13B 4KHTH 5GRJL 3LQAC 3QP3A 5C1MB 3U0PA 2V7NA 1DLHA 3RUGB 3GI9L 5EBWA 4GW1B 15C8H 1GGIL 4M8QB 5T1KB 1F5WA 1D5MA 1I8KA 1MLCB 1KT2A 1R5VB 3EO1A 4HIXL 3GMLA 1HHHB 3BKCH 4C57C 3VMPA 2DTML 3KYNA 4UB0H 3NIFF 2G2RB 1RJCA 3ZKMD 4F8TA 4PGCB 4ODTL 1JFQH 5HHMD 2AJYL 2EDFA 1W0VA 2DWEA 3LQZB 3D2UD 3QQ9C 5EC1B 1MJ7H 5IHBA 1BIHA 1FHGA 3SKOB 2A73A 4JDVB 1GGCH 3IU3B 1TTGA 2HFGL 4ZFGL 1B0RA 2J6EA 2DQFA 5D1QC 4QHMB 4MSWA 1KACB 4POYA 3MR9B 5I1AB 4YBQD 1R3JA 4XP1L 2HVKA 3ESUF 3NZ8A 4L4TB 3BEWA 2AI0L 1D6EA 1YEJH 3KDMB 5ISZB 3UDWC 3GGWA 4NT6A 3PHOB 5DD3L 5ID1B 2DQUL 1NPUA 3BW9B 5AZ2L 3O81A 2F15A 2ZUWA 3H9SB 1AHWC 5ESVB 2Y36H 3PHSA 1I8LC 2V2TB 3MNWA 3FQUA 1U92A 4J23A 4CNIB 4LSUH 1LK2B 3KJ4C 3WHE0 1NAMB 4DAGL 1FORH 4JJHA 5IMKB 3SE4C 1XR9A 3QULA 1SJEA 2RGSA 2EDNA 2EXWD 4RWYH 3MROB 1KGCD 5DJCA 3DX7B 1HEZB 5B39B 2VL5A 2QSCH 4NHUB 4HDIA 3FRPA 4B7IA 5K9JH 1GC1L 1DQTA 1EJOH 5CEZD 3BRFA 4JHAL 2ESVE 5C86A 1SEQL 3VXPA 3WKMH 1MELA 5FGBA 3BDXA 3DV6A 5GGSA 2F8OA 1X5FA 4DKEH 2OTWB 3OKOB 1ND0A 3TYFA 4CMHB 5I16A 3HZVB 1SYSB 2J8OA 1WIPA 3BN9D 4WWID 3BO8A 5CJQH 4R3SB 4PBXA 1T7VA 4NFBA 1QYGH 3WIFB 1P7KB 1T04A 4OLUH 5DHYA 2DBLH 3K46A 3QJHA 3FQWA 1EPFA 4JZOA 4ONFL 3S96A 3MCLH 4G3YL 3KPRB 4OZ4B 5HY9B 3TH4T 1JNLL 2ILLA 4MA7H 2HN7B 1EHAA 2GJ6E 4K9EH 4KTYA 5I1JH 4R4ND 5L8LB 1WLHA 4O9HH 3JVGC 5FYLE 1AXTH 1I1FA 1F4YL 2X42A 4M7LH 4NQEA 3O6FA 1T22A 5BVJB 3LEXB 2HT4C 3X3FH 3CK0L 5KS9E 1CR9H 1KTDA 4YDKH 3VFSA 4GH7B 8FABA 4ZAKB 2G60L 3Q5TA 4YHLL 5C08B 1DLFL 4OLWH 2H32H 2XKNA 3ARGA 3TLRA 5CCKH 5B4MC 1ZS8A 1KYOJ 3SGDH 4P4KB 3QWQB 3NABL 3ZKSD 1U58B 4K3DH 1R0AL 4EOWL 3GMPB 3GUTA 5L2JA 4D9QE 1RIUL 4JANA 3W11D 3LKOA 2DIBA 4UQ2A 1N5YL 3GSNH 1DFBL 3HS0A 5FYJH 5CBAB 4L8CB 3CZJA 2XY2A 1RU9H 5D6DC 5H94B 1KJ2H 5EFIA 5FA3B 4ETYA 4NQED 1NBVL 3JWNC 3O6FD 3EFFB 4J12A 2A9NH 2H8PB 1AGEA 1IARB 4FFWD 4P5TC 5F7UA 2NY7H 3MJ6A 3MV9B 5GQBA 4AG4H 3QEQA 3VFNB 1X5GA 5AUMA 3T4YA 1FH5L 2J88H 3IDYB 3B6SB 5I8KH 3ARGD 3M1BB 1G0DA 5IBLC 3CVIH 2OXGA 5I19L 5DS8B 4G6FD 4LLDB 4N9GA 3GSXB 1NDGA 1MVUA 4QHKI 1A0QH 5GRUL 1R24A 3VXTA 4I18C 1HI6B 3Q3GA 4MMZC 4F3FA 3QHTC 4QXWA 1T2XA 2C3VB 5KZCD 3GBML 3HB3C 5EPMB 3RUGA 3GMMB 3SQBA 3ARBC 4IS6B 5TPWH 4M8QA 5T1KA 3RWGB 1FAIL 1I7TB 1MLCA 1YYLL 1IKNA 1R5VA 4Y4KA 3GSOA 2CIIB 2VL4A 5MP6L 3OKYA 3QEQD 3RKDD 4WTXA 5CSZB 2IPUG 2CGRH 1CZ8L 2IJ0C 4P48A 2R0LH 3UZVB 1CDIA 3LQZA 1OAKH 3QIUB 3RAJH 3QEQE 3MRJB 1MFDL 1Q0XL 5EC1A 5FM5O 2WQ8A 4XCCL 1I9RH 5ETUB 3SKOA 2BY3A 3IU3A 3T77B 4PB9L 1DQQB 1MREH 3O8XB 4QHMA 5F89B 5C09D 5D2NC 5JMOC 3MR9A 1M71A 1HZHH 3VFVB 5I1AA 5MHSD 1IE5A 3KNBB 5KSBF 4OD3H 1I3GL 3BZFB 4L4TA 3KLHD 1KUMA 5T1KD 3P4LA 2BP3A 1S78C 4K23L 1W72L 4M4RA 5ISZA 3GHBL 4WFED 1NUNB 5E4IA 1UB5A 5ID1A 3BW9A 4G43B 5D7JC 5MHSE 1BFVH 1J8KA 3EYVB 3H9SA 4FQHB 1S3KL 2R56L 5ESVA 3RUGE 1BEYL 4JO3L 2V2TA 4KQ3H 1BREA 2Z93B 3Q6FB 4CNIA 1LK2A 4LCYB 4MLIA 4YHIB 1SVCP 4PRPD 1UWEH 4S1DC 3RY6A 2V2WA 2V17L 4FZ8H 3PGFH 1Z5LB 1WWWX 5IMKA 4XNMB 2VN7A 3EYSH 4WDIB 1MF2L 1JNHB 1CICC 1KEML 2DAVA 4KK8C 5EO1B 3MJ9L 2BY0A 3MROA 4BH7A 1MJUH 1HEZA 3DX7A 4RWHA 1IFHH 3E2HC 4L4TD 1MHHB 3X12B 2AW2A 1HKLL 2E5EA 4HWBL 3QEGH 3T1WA 4PJ5B 4ZPVB 4LSTH 3QH3B 3PWUB 5HI3D 3O3UN 4AJ0A 3UTPE 3H9SD 4L4TE 4LEXL 4XMLH 5JMRA 4GSDL 3OKOA 5ANMB 4AH2B 4OCSH 1G9NC 1SYSA 5ISZE 2XOTA 5EOQL 3WIFA 4K3GA 2O61B 1P7KA 1IQWL 5C9JB 4ZS6C 2PNDA 5IBTL 1CDGA 3QIBA 3U9UA 3VG9B 3VFMB 3KPRA 3NFPB 2Y7QB 2GQHA 5CP3H 1PY9A 2GT9B 4OZ4A 4ZUVA 5HY9A 4AEHH 2AXJA 3VH8G 2KBGA 2HN7A 4H20L 1YNKH 5CIPB 2DB8A 1W8NA 3GK8L 2V5RA 4MJIA 2CSPA 1F3JB 1FCCA 4FTVB 5E08L 3VD5A 5BVJA 3LEXA 5F1KC 5C08A 1XF5B 4X9IA 4D0CB 2DDQL 3F7RA 4ZTPH 2BVTA 5L8JB 1CYGA 4PJCA 1U58A 4PJAF 4Y16B 4LGSB 3GMPA 3IFPB 3IAQA 3HE7C 2ATKA 1MCOL 3KPRD 4RGMC 4DGVL 2BDNL 3LEVH 4JFZH 1ODAA 1PX4A 3FMGH 1H8SA 1KCRH 1IILE 5CBAA 4X80L 4FP8L 5H94A 2F53B 3OF6A 3KPRE 5FA3A 3IKKA 4BYHA 3EFFA 2R4RL 1A3LL 1F11B 1H3VA 2ATPB 1S5IL 2H8PA 3TIDB 5DJAA 1G7PB 4KK6C 1CN4A 3MV9A 4Q6IC 4JB9L 1PG7W 3VFNA 4NFDA 4ZAKD 1VGEH 3ISWA 3WFZA 3W5MA 4MJIE 1P84J 4XX1G 3M1BA 1BQSA 5GZND 1K8DB 3MNZB 4QYOB 4P4KD 4AEEA 5D7IB 2XA8H 1B9ZA 1C12B 3L1OL 1UH2A 3I3EA 4U6YB 2FEDC 4LLDA 3EDJA 3GSXA 4WVRA 5C08E 1YEEH 3T0BA 5KVGL 2IQ9L 1HI6A 4PJDF 5CGTA 4PJCE 1PKQB 4L8DA 2ZCLL 1ZLWH 2PTTB 1BFTA 2C3VA 4DCQB 4OF6A 1ZVYA 1IAKB 2Y4SA 3SO3B 4I0KA 5AYUH 2B5IC 3QRGL 4CJ1A 4NQCA 4X6DB 5EPMA 3GMMA 4WI8A 2CDGB 3O6KL 1A3RH 1I7TA 1NJ9B 3C5SA 5BRZA 1V05A 2CIIA 3MV9D 2MQ0A 3T08A 5I1GL 2NX5A 3OG4B 3VFRB 4LK4A 1FG2B 4ORGB 2W92A 4BUGA 1PVHA 1DBJH 2JK5B 4N1HB 1ZGLB 3V4PH 3MV9E 3QIUA 4UILH 3U2SB 3MRJA 1D6VH 1N8ZB 4XH2B 3VXOB 3EUUA 2E27L 5ETUA 4KV5F 1KC5L 1NCWL 2MCPH 1L0YA 5I1EL 1DQQA 2PETA 3RX8A 2MOVA 1BJ8A 3O8XA 1R3KB 3S34L 4CW1B 5IT2L 1WITA 3ZDZE 5F89A 4MCZB 4NQSB 5IFHL 3T0DA 1UXSB 5K9QG 4OF8A 3BZFA 1P4IL 5I1KH 3BMVA 2V6HA 2NW3B 1NCAL 3IS1X 3FO0H 3UJIH 4HBCL 3V5DB 3WO4C 2HH0L 4OGZA 5CAYB 3X3GL 4F9LA 5DD1H 4G43A 4HQQH 4FQHA 2GIYA 3R06B 3F6LA 5ACZB 4NQCE 3R4DA 4M7ZB 1M7DB 5T33L 5FM8A 1RHFA 5IBUB 4FFZH 4BSJA 4HWEL 2Z93A 1G6RL 5BRZE 4C59B 2Q8AH 3QIUD 4KI1A 4LCYA 4YHIA 2NX5E 1CS6A 3VXUB 2C9AA 5ESAA 1EVTC 4KGLA 2OR8A 32C2B 4I48B 3A6CH 1UJ3C 1Z5LA 3O3EA 4XNMA 4MHHI 3WS6A 4R26L 4WDIA 1Z3GH 1JNHA 3O8XD 3QZWB 4W4NA 5EU3B 12E8L 1INEL 1QPXA 5EO1A 2ZP0T 4XWGH 1J1OH 1VADB 2LV4A 3TV3L 1MHHA 4MWFB 3X12A 1EH9A 4N8PA 2DQJL 5FO9B 1GCFA 1IEAB 4PJ5A 3PWJB 3NPSC 4Q97A 1JI1A 3MOAL 4L1HA 1QFUH 5CD3A 4JJ5B 2BRRL 3VDAA 2F58H 5ANMA 4ODSH 5I30H 2E8YA 3GSUB 3VI4F 4FABL 3HN3A 3ARZA 3TVMB 1OT2A 3GRWL 3MA9H 5FIEA 5C9JA 5KVEL 5DT1L 1JPST 3CDYA 2X9YA 2XZCH 4O2FB 4HJ0C 3QUYA 1FNSL 1U0QA 3NFPA 2Y7QA 5I18L 2VTFA 5HGGS 1E4WH 4JLRB 4ODBD 3ARDB 5CIPA 4P9HH 3N0PB 4EBQL 4NN5B 2I60H 4OCWL 2W07A 4PJ5D 5DVNA 3TGXA 4FTVA 4J3OC 4JKKA 2FO1A 1URLA 1I3RB 1CDBA 4UOW0 5LG1A 4QTIL 7FABH 2I9LB 1XF5A 5GPRA 5D7LB 3ULVF 4LQ1A 4DW2L 4ZD3L 4M6NH 4D0CA 4Z78B 2JE8A 3FB8B 4ZS7H 4Y16A 4NKIL 1OAYH 2V5TA 1YYML 2VXUH 3IFPA 5ANME 5GRZA 3DHJA 5FM5M 3MC0A 5TGBB 3O11A 4ODHL 3TA3C 4NRZB 5CJOH 2YD5A 4JGMA 5H35B 3BKYH 4YHZL 3IDMA 3ALXA 2RHEA 1T83A 2ICWI 1IC5L 2A9MH 1BBJB 2HLFC 5DRNA 1LO0H 4HEME 4OD2B 2F53A 3LPFA 4XVTH 1N0XH 3P40A 4FQ2H 4FTVD 1F11A 2ATPA 4OT1H 1G7PA 3EO0B 4RGNC 5ADPL 1FZOA 1HE7A 1JZ6A 1DBAH 4LVNC 2CH8A 3EYQC 5TE6H 1KV3A 4FTVE 3V52L 5EZOH 3WSQH 1K8DA 3MNZA 3K2UH 3QIWC 4F9PC 3CFEB 2HAZA 5D7IA 2X4OA 4U7MA 1C12A 4Y16D 1JGVH 4YFDB 2R69L 4LDEB 4U6YA 2CLRB 5IMMB 1G7HB 3RJQB 3UBXA 4D0DB 1X3DA 2I07B 5GRVL 2VUOA 4HMCA 5GIRA 2VC2H 4H1LG 1PKQA 4UI2A 4BA8A 2DYPB 1DCLA 2PTTA 5HDOA 4DCQA 1QBMH 1IAKA 2F53D 3HC0B 5EBLA 1ORQB 3MLVL 3QG7H 4X6DA 5E70A 2NQCA 1ZT1B 3O2DL 2CDGA 3C8KB 4NWUL 4XC1H 1A6PA 4U0QB 3LQMA 3BH8B 1QFHA 3G6JF 3JV5A 5GGRB 1BQLL 4WY7H 3WFEL 3ARPA 1CGVA 4K7PL 3SDAB 4A2MA 5LWYH 1UWGH 3LD8C 1RUKH 1CDHA 3VFRA 1FG2A 2FJGB 4ORGA 1NGQL 1UACL 1ZGLA 2J4WH 3OL2A 1HH9B 3U2SA 1N8ZA 1ED3B 3K1KC 4XH2A 3VXOA 3KS0H 3LQAH 2B1HL 5I0ZA 2R23B 4FQJH 4NCDA 3UTTA 3G08B 4CW1A 4FQQA 1QZ1A 3IETB 4NQSA 3HG1A 1UXSA 3BPOC 1BGXL 4JG1L 2NW3A 2L7UA 3IS0X 5F21B 1KELH 2K7PA 3V5DA 3GO1H 3HMWH 2B7DT 1PKQE 2EE9A 3VXSA 4JPWL 4BK5A 3SJVB 1TQCB 2E3VA 3PV7A 2WSKA 4MNQB 3R06A 4X6DE 1M7DA 4K3JH 2YA2A 1X4YA 1MI5B 1T1XB 3FOMB 4E9LA 5D96C 3S35X 5JO5A 1OTUD 5F71A 3VXUA 2HRLA 5FEBA 32C2A 4GMTL 4OTXL 5D1ZB 2RIKA 3V4VL 3ROOB 4X9GA 2CKNA 3QZWA 4QCIB 4ZXBB 1GOFA 5EU3A 3O4OB 3LKQB 5D72L 2XKSA 5EBMB 3V2AR 1VADA 4CVZA 2H45A 3KGRA 4LSPL 4MWFA 4AT6B 2D03H 4OLYL 5GGUA 3RL1B 3KYMB 3MXWH 3UTTE 5K9KB 2ZWLT 4KHTL 1AXSB 3H6JA 3WDIA 1O5DT 1V7NH 3PWJA 2SEBB 3HG1E 4PGBB 4PGDB 1JP5A 3SGJA 4JJ5A 15C8L 5T1MB 3VFPB 3GSUA 5JIIA 3BKCL 3TVMA 3VXSE 4AY0A 3BX7C 4UB0L 2HKHH 3VXUD 1RZIB 4OF5A 1D3CA 3H8NA 3LKPB 3MV11 3UMTA 4H1LH 1EMTH 3EDEA 3KLAB 4LBEB 1J86A 3CIQA 4DWHA 5E2WH 3LRSA 1MJ7L 3WEXB 1AQDB 3VXUE 1KLUB 4JLRA 1GGCL 2ED8A 1U41A 3O3AA 4AMKL 3ARDA 2JF1A 4NRXA 2BSSA 4YWGH 5E7FA 3U0WH 1KB9K 3O9WC 2KKQA 3OKMB 3LEYH 3GIVB 3VGHA 1YEJL 3D1MC 1I3RA 1T6WA 4NWTH 1EZVY 2I9LA 4DK6A 2MSPA 3SGDI 3TVMD 5JHDB 4QRQA 3UEZA 4M9PA 5C7XL 4Z78A 1T0PB 4YPGB 4ENEC 4RX4A 1Q8MA 4LSVH 3MV7B 5DJZB 1PZ5B 3DX8B 4L8SA 3QQ4B 1IEBB 3O0RH 3PE9A 4NRZA 2D7QA 4OGAD 4QNPE 1SJVA 1FORL 3MA7B 2VLJE 1VSCA 3MNVB 4EKXA 3ARDD 2AEPH 1WQVT 3LS5H 1BBJA 3H3BC 4U6TA 1JI2A 3EJZD 4RWYL 4OD2A 3ZT7A 3OR6A 4LNVA 5I8OH 1RUMH 1GSMA 1TDQA 2QSCL 3P73A 4QHKJ 5IF0B 3IXAA 3VE0B 3D39B 1H15B 4MYWB 4XCYA 2KL6A 1W72A 3EO0A 1AO7B 4P23C 1LE5A 3RTQB 1EJOL 2CMRH 3PNWB 4OV6F 2VQTA 5F9DC 1DEDA 1DQMH 3QNYB 4KDWA 5D7LD 3UTSA 2E9JA 5BQ7A 4OZHF 3DV4B 2P8LA 2DQDH 2UZXB 4DKEL 3CFEA 3IB4A 3GJFB 2VLRB 3B9KB 5IFJB 2A74B 5CJQL 1HYRC 2CLRA 4U6HB 5IMMA 1S9KC 1QYGL 4KDTA 2I07A 4OLUL 2KQNA 4XP5H 3VXNB 1HYSD 4HK3N 3MLTB 2DBLL 1IGIH 4UZGA 3I84A 4X6CF 3MCLL 2XY1A 1IC1A 3MJ9A 1MHCA 2AEWA 3HC0A 4DZ8A 1ORQA 2J3SA 4MA7L 1MLBB 3ULVL 1A2YB 4K9EL 5I1JL 5ICYA 5E95B 3BH8A 4HWBA 4O9HL 5GGRA 1MFBH 1AXTL 3QPQD 4GKSB 1F8TL 3AVEA 2X4PB 3SDAA 3ZTNH 5IWLC 1V3JA 3BAEL 4R2GB 3X3FL 4CVUA 4AEFA 1CLOH 1CR9L 4PY8I 4YDKL 2VR9A 2XTJC 3QRFM 3DYMA 4JQVA 3HE6B 1ED3A 5I71B 1WZLA 5FKPB 1V5JA 2BOBB 2WIIB 3UTSE 1VESA 2FX9H 5KSBB 3F5WB 2R23A 1A6UH 4K3DL 3G08A 4J7RA 5DGQA 3IETA 1TNNA 2DYPD 1WFOA 3IKCB 3GSNL 5C0ND 2EDWA 3AROA 4LDOB 5FYJL 4MA1B 3UXFA 1RU9L 4K7FB 3M45A 5CEYB 3SDAD 5ADOL 1OM3H 5FDWA 3D85A 2RFXB 1KIPA 3VU2A 2Z31B 2A9NL 5LKNA 5FYKD 1MI5A 1T1XA 2NY7L 3NIFE 4AG4L 1N2RB 4Z6AT 2J88L 1IZJA 5I8KL 4HKJB 2VZTA 5J3HC 4YHPA 1BVKA 3ZMRA 4LKXB 3CVIL 5D1ZA 3ROOA 2F74A 2WANA 4PJFF 5HHQA 4QCIA 4ZXBA 1YN7B 1XFPA 3MREB 1A0QL 2I5YH 1A1OB 3NFSH 5IB2B 2YXFA 2YK1H 3AC0A 3GSVB 2CR6A 1PFCA 5FUOH 4OFDA 3TT3L 3RL1A 3UTOA 3WFDH 4BQ6A 5K9KA 4UNVA 2R2EB 1AXSA 1HHIB 2SEBA 3SJVD 3QUKB 4MNQD 2XZQH 2BNUB 5TPWL 4XP4H 1IAIH 1KIQB 3VFPA 2EKJA 1MI5D 5E8NB 1BZ9B 2F8VA 5IB3B 4K3EH 4HXAH 4ZOEA 5EC2A 1RZIA 4OM1L 5IB5B 3D3VE 1SBBA 3LKPA 1UCTA 4CAGA 3L7EB 3KLAA 5D1ZD 3KWWA 2R0LL 2NXZC 3WV0A 1OAKL 1NDMB 1CFQB 4LBEA 3RAJL 3TO2B 2NY3C 4ZXBD 4IJ3C 3WEXA 1F4WH 1I9RL 4N0CC 5J11C 1AQDA 2OLDA 1JRHL 4YDIH 1I7ZB 5DQJA 3RZCA 4PJBE 2HFEB 4ZDHB 4YDLB 5EWIL 2X4SA 4LL9A 3ARVA 3K7UA 4APQB 1CE1H 3OKMA 3GIVA 1RUAH 2FH8A 4QGTA 5I75B 2DM7A 4PJAB 1SM3H 2AK4B 1CGSH 5TE4H 1BFVL 5HDBF 5JHDA 4HUXA 3O3BA 2R4SH 3W81A 4X9BA 3BPNC 3QI9B 4MQSB 4YPGA 5FFLA 3QQ3A 1CVSC 3ZHDA 3T0VA 3MV7A 5DK2B 4KQ3L 5DJZA 3W0WA 2OL3H 4AENB 1PZ5A 4KVCL 3QQ4A 4MDJA 1IEBA 5DTFB 1J8HB 3TBWB 1INQB 5GS1C 1A1MA 4E5XA 3MA7A 4L29A 2FIRT 1HXMB 3PGFL 2DLHA 3EYSL 1Q0YL 4EI5A 4OB5H 4O51B 2YUVA 1TVHB 1MIMH 2VABB 5ID0B 3ZT6A 1MJUL 1VENA 2IPTH 5DJ8B 5IF0A 2DM3A 4Q9CA 4Z7WF 1H15A 3VGFA 1AO7A 3ULUE 1I1YA 3RTQA 4XXCC 2M1KA 3PNWA 3PIQB 3QEGL 4XPFH 4LSTL 3QNYA 1S7XB 1MPAH 3DV4A 4XMLL 4PJXF 4KAQH 5CJ8A 4OCSL 4XCEB 1G6RA 2VLRA 3GJFA 5IFJA 4U2YA 4PJDB 1AGDA 2A74A 4U6HA 3BEVB 3EIFA 5IW1B 5JHDE 1ES0B 3VXNA 3MLTA 4GRLB 2OS7A 4MZ3A 2D9QB 3MV7E 5LAXA 3W0WE 1G1YA 1DVFB 2ZG3A 4AEHL 4MLSA 5F96H 2ZUSA 5ABDE 2FYYB 4Z7NE 4RFEA 1YNKL 1CXHA 1A2YA 3D39D 1XZ0A 3PDDA 2Y9RT 3V6OC 3RKPA 4AIOA 2YC1B 2MPAH 2DQEH 2NY2C 4MJ2A 1AO7D 4KRPC 4PJIF 4PGZA 5F7HA 4GKSA 3RTQD 1EJ6A 2X4PA 3LH2L 3KPNB 4U1MA 5JIPA 5F1NB 1AO7E 2VLRD 3B9KD 3QUXB 3GRWA 5FKPA 1P4LB 1QO3B 2BOBA 3FTGB 2WIIA 5KSBA 5HBBA 4ZTPL 3F5WA 2OK0L 3MJ8B 2VKWA 4OF0A 4KKBD 3T04D 2EO1A 3ZSTA 3T1FB 1JZ3A 3LEVL 4JFZL 3KYAA 3TWCH 1KCRL 4GBXB 5C0JA 1JIBA 3OB0K 3SCMB 5JNYB 1RZGB 5J06A 3BWAB 2WBJA 4XNUH 2YKLL 3GEWB 5CEYA 2RFXA 1IVLA 3I85A 4E41A 4R2GD 1FFNB 4M93C 3V79C 3U7AA 3ZO0A 4ELKB 4MNHB 1WV7T 2CUIA 1DL7H 3QDJE 2YD7A 1N2RA 1VGEL 2FX7H 4HSQA 3HE6D 1RVFH 3I6LD 2YZ1A 4HKJA 5EUOF 5IHUL 1T89C 4FQCL 1MRCH 4RMVA 5HDLA 1J5OH 4D9LH 1YN7A 2CK2A 3TO4C 4I8DA 3MREA 4DEPB 1A1OA 4UDTB 5IB2A 3GSVA 2R2EA 4Q74A 4WUUD 1LMKA 4JFDB 3F58H 4ELMB 1HHIA 4IEFB 4FHBD 5AYUL 1WC7A 3QUKA 1ADQH 4OM0H 2ICEB 4P5MB 2Z31D 1M7XA 3MJ7B 1KIQA 4TUOB 1A3RL 5IBLD 1AD9B 5E8NA 1BZ9A 4ETQB 1FNGB 4FG6C 2BOCB 1VERA 4HUUA 2XYCA 5IB5A 4E41E 4D2NA 1DBJL 1IGMH 3L7EA 1KYOK 2EC9T 3SDXF 5I1LB 1NDMA 3CFIC 5ICXB 4UILL 1FL3A 1D6VL 2ZUTA 3D25A 5HGAB 4NBZB 1PYWB 4KJYB 3DMMC 3REWA 2MCPL 1I7ZA 4HGWB 4EIZC 3WLWC 2HFEA 5D71H 3QUZC 4ZDHA 1QSZA 3B83A 3QXVA 1EO8H 4U1NB 4APQA 3O2DA 2N7BA 1I1RA 1N26A 1F90H 3FO0L 3G5XB 3UJIL 1A14H 3U4AA 3KPOB 4U1KB 2AK4A 5JOPD 2XPGB 5DD1L 3VRJB 4HQQL 4NZTL 5HVFB 3QI9A 4XPBL 2PO6B 3SGKA 5EG6C 4FFZL 2HMID 1L7IH 1G7MA 4AENA 4RFOL 4EDXB 2Q8AL 5DTFA 1J8HA 5JQHC 4GXUN 1INQA 3AMLA 2WM0A 3A6CL 1HXMA 4HKBA 5T5NF 1TVHA 3V5KA 4NUJB 1S78D 1R5IB 2VABA 4FFYH 1MCIA 5ID0A 4APQD 4LSSH 4XWGL 1J10A 4R0LC 1NQBA 5DJ8A 1KN4H 2WWKO 1ORSA 2P7TB 3MUY1 3GIZL 3IJHB 3PIQA 5T3ZH 1ZK9A 4YO0B 3MUJA 1QFUL 4H0HB 5KG9B 3V7MA 3G04B 3WO3B 3E0GA 4WHYH 3QI9D 5F9WC 1DUYB 2F58L 2IPKB 4XCEA 4ODSL 5I30L 4PJDA 3STZA 3O6LL 4CKVX 3DNKA 2FH6A 1FVEB 2AK4E 3BEVA 3GKZA 1P9MC 1LO2L 3MA9L 3P0YH 1J8HD 1ES0A 2PXYB 4CADB 1F4XL 1T0MA 3B8SA 2IMMA 4GRLA 2XZCL 4YDJB 3G6JB 1DVFA 1L0QA 3MFFB 2ZUVA 1E4WL 2FYYA 1J8HE 1OSPH 5F7EL 1T5XB 4X6EB 2YC1A 4P9HL 5CSGA 5T3XH 2I60L 1QFWL 3CXDH 4CUCA 1S7SB 5K9OA 4U1GC 1OTSC 3IDIB 3AREB 4LIQH 5DUMH 3KPNA 3ECBB 5EZIH 4QRPB 2LVEA 3C5ZC 4JFXB 5F1NA 7FABL 5F1IB 3QAZB 3QUXA 1TQBC 2VWEC 1P4LA 1UWXH 1P2CB 3FTGA 5A2KH 4Y5XC 1DJSA 4KTEH 4R8WH 4ZS7L 5JW4R 3MJ8A 1FVDB 1OAYL 4GRLD 4U1SA 2VXUL 5I74B 2E7LA 3NACH 4PJDE 3M8OH 5KSAC 1DVFD 3JWOC 3T1FA 3OMZA 3BKYL 5DZOA 4B50A 2MKLC 5JDJA 4JQXA 4OIIH 4GBXA 1GPOL 2NY0C 4JO1L 4BJLA 2A9ML 4K8RC 3SCMA 5JNYA 3SE3A 1KTLB 4X4YA 4XVTL 1N0XL 3BWAA 1LEKA 4FQ2L 4PFEA 2DWDB 2W59A 3SDDC 4RQQA 4KY1H 4MNHA 2GTZB 4DZBB 3T3PE 1DBAL 2JCCE 3QUXD 3S9DB 5TE6L 5KVDL 3QPXH 1WT5C 1V3KA 5EZOL 3WSQL 3K2UL 3QHZH 4KV5E 1LILA 1JNNH 3MRPB 2W0FB 3FT4B 2CJUH 4WO4C 3BISA 1ZGLM 1P53A 4I9WE 4A2LA 1DQDL 3JZ7A 2XWTB 4UDTA 2VC2L 3RIFF 1EGJH 4GBXD 4KK6D 1E6OH 3SCMD 5IKCA 4JFDA 4QGYA 1QBML 3B9VA 1MEXL 5KTEH 3QG7L 4KKAD