2EXWC

Crystal structure of a ecclc-fab complex in the absence of bound ions
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ion-binding properties of the ClC chloride selectivity filter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
total genus 34
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2exwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2exwC01
4P5MA 1OT2A 3HB3C 3GM0A 1XCTB 4PTTB 5J1SC 4JM2D 3ZT6A 2G75A 3VXSD 1M1SA 1VGKA 3TH3T 1GGCL 4EI5B 2P8PA 2DQJH 1BIIB 2IH1A 3EYQC 4WV1A 2AW2A 4HUMB 2ZWLT 4P5MB 3X12B 1I9EA 3UBXA 3ARTA 5FYJE 1FIGH 1VDGA 4LLDB 3SDCC 4FQQB 3DURB 2YR3A 2BSTA 3I02B 1XGUB 4UTAL 1H8OA 2PUQT 2AXJA 5DMYA 4G8FB 1WBXB 2HLAB 3MRFB 1NGXB 2VQ1A 5I16A 1G1YA 5BV7L 2A9NH 2JF1A 5F70A 2WLYA 1IQWL 4XVTH 1LNUA 1BX2B 4LSRH 1N4XH 3ULUH 4HFWB 4P2YA 4N8VA 1JV5B 2I07B 5F7HA 4WW1B 5HYSA 2PNDA 3GBNL 2F15A 3TGXA 1PX4A 4KMQA 3BAEL 3D3VB 4PBVC 5DHYA 3WUZA 3OB8A 1MCPL 1S7TB 3BXNA 4O9HH 3BN9D 1MI5B 5CWSA 4F37F 4Y4FB 1QFPA 4QXGL 3ARDB 3RL2B 1CE1L 5KSAA 5ALCL 4F7EA 4PRPD 2XFXA 5C0EB 4ORGA 1UT9A 3MRHA 1T1YB 3NCCB 4M00A 4M7JL 2IANA 4JFFA 5TFSL 5IMMA 1G7HB 2X4OA 1IZKA 4XCCL 3WHXB 2Z92B 4NM8H 1IRAY 2ICES 4QRPB 4XC3L 3WE6B 4UILL 4RGND 2GIYA 1IZJA 1LVEA 1XGTB 1QO3A 5F21B 4MQSB 3QDAA 4O5LL 4MLIA 4FQXB 1ZA6A 5CEZH 4P2CG 3WFCL 4WHYG 3GHBH 4WDIA 4Z7WA 5BJTB 1KEML 4N1CA 4PRID 4RFNC 2CPCA 4AIOA 3TO4A 3VRJA 4DK3A 2C3WA 2YKLH 3TBWA 3QWRD 2GFBA 2OYPA 2O5YL 4LF3A 1I3VA 2CXKA 5E5UB 1ZT7A 3HS0A 1YEKH 4HIXH 4DFIA 1LWRA 4ZUWB 1S9VB 3DO7A 1ZKAA 1JGLL 1YEHH 4EN3A 5CSZA 1JNJA 1FYTB 4JFEA 4WTZG 5ISZE 3C5JB 2BVTA 5EU6A 3H9HB 1T4KA 3RP1A 4YJZL 3DHMA 3HE7C 3IGAA 3VFVA 1WIOA 2X4OB 4NZDA 5BRZA 4NQXB 3VE0A 1T0NB 2YPKB 4YHZH 1NMCC 4PJFA 1ZS8B 3KPQA 5DFWH 2WANA 4WU7B 4ONGH 4LNRB 2H1PH 3BP7A 4K8RH 4X6DB 4LLDA 2NY7H 3O6FD 1KYOJ 4I77H 3ZYOA 3TBYB 3GMMB 4DGVH 1DN0B 4YXKH 1A6TB 3MRIA 4EUPA 3MV8A 2A73B 5C0BB 3GI8L 5D1QA 3BJ91 3T09A 2JJTC 3U2SB 4KTDL 3MC0A 4P2RB 2C4FU 3DRQA 4Y5YB 5EZOH 1CICC 5EUOE 4NQCE 4M48H 4OGYH 3KPOA 4G9FE 3UBXG 2EYSA 2VZUA 3T0XA 1KLGB 4ZUSB 1AH1A 4NSKA 4PG2A 3OKLB 4YDVB 4U1SB 2VDQH 2HFGH 3MGTA 5IJKC 5MENE 4NZTL 3WS6C 2X1QA 4R2GD 1ETZA 3WFBH 4F7MB 3BEWA 3CFKB 1I7UA 2O5ZH 1IILE 5J13B 4JVWA 4J12A 5FHBL 2YPVL 4Z7UB 4OZIF 1M71A 2ZG2A 3I6LE 4PRDB 2GUOB 4Y4KD 5IUSA 4WW2C 2QKIB 2D31A 2AJUL 2G75B 3MRMA 3SGEH 4W6WB 5D1XB 4JKLA 1A7NH 2BOCB 3WNOA 5BQ7B 2IADB 5D7LA 4ENED 3RWJA 1CFSA 3JTTB 4LHQB 2CGRH 1R3HA 4JHWH 3FMGL 4XMLL 1I8LC 4KRPC 3LAFA 1RZGB 1FNFA 4N9GA 3TIEA 5IHZB 5D1XA 1GGIH 3MRLA 1CFQB 4PJGE 1INQA 3WEXB 3OV6A 4NQCA 1CFSB 1MHEB 3C6LD 1G6VK 1FFNB 3QBTB 1OVZA 1S5IH 1NC4A 3UTTE 1OTUD 4ODXB 4WUKL 3D0LA 4GBXC 1FV1B 1WUNT 2PCPA 4JCMA 1NFDE 3SDYH 3CFKA 2DWDB 4KAQH 3SDCA 1FLTX 3MLZH 3U0WH 4G9DA 1K3ZA 4JFPB 1HH9B 3VRLE 2AJVL 3UTPE 2XWBA 3I6KB 3WJLA 2J7LA 4MAYC 4PP1C 1OAZL 1QFWH 2CIKA 4WI6A 4XAWH 3D0VB 5EZLA 2YPVH 3TYGH 4JJ5B 1U95B 5HHOB 5D7JD 5FYJH 3CUPA 2BHZA 4MA1C 5GZNC 1Q1JH 2FATL 1AFVL 3S5LG 1BAFH 1KIQB 3V0WH 1Q9LA 2OTPA 3B5GA 3EYOB 4WTZA 3CNKA 3HN3A 4HKBB 4TNWF 3DUHA 3OXSA 3AMKA 3PHQA 3DVIA 1EUTA 4FNLH 4JDVB 2FJGB 3BP7B 4I48A 1U8QA 2BNQD 3SE8L 3O4OB 3BZ4B 2YBRA 4GUPA 3GSVA 1MI5E 1S5HB 1DLHA 4EKXA 3V0VA 1OPGL 3T0EB 1YEDA 4RRPA 2VXTH 5D70L 1CF8L 2GKIA 4HUWB 4RAUA 1UWXH 5CUSL 4XVSH 5EC1B 1OM3L 3H9ZA 2NY4D 2RB8A 1HHKB 1UZ8A 4KPHH 1QRNA 3ILQD 1HOCB 3EDJA 1HWHB 1IGTA 3IU4L 1BGXH 4L4TB 3BKYL 3KJ6L 4JE4B 5I8EA 3LDBC 1QA9B 1LEIA 5GS0H 1QZ1A 4YBLC 3MGAA 2WINB 3RUGB 2BX5A 1P9MA 5GGVL 3CDYA 4HK3J 5CJXA 2WW8A 2NY6D 2HT2C 3PIQA 4XNQB 4WY7L 2V9RA 1NDGA 3QIUA 2W38A 5F9JB 1QSFE 3HE7D 4YFLI 4Y1AA 2X41A 3DPBA 3L1OL 3PGCA 3VWKA 3F62A 1JI2A 3S36X 3L3DB 5F6HJ 4U6TA 1K8IA 2DJUA 4RGOH 5DMKB 3PWJB 5B38G 1QO3B 3MLUL 5AZ2L 5L88H 3O2WL 1CFNB 2F5AH 2P44B 4LQ1A 2HRPL 4NQDE 2G5BA 3SOBH 5AG9A 3LHPH 2XTJB 1MCPH 1N64H 1ZHBA 3OHXB 1WV7T 4GW5A 2CIIA 1MCCA 4QCIA 4MA1B 4J6RH 1VKXA 4LCIH 5IESL 4HJGB 3TBWB 1EMTH 2WP3O 5L0QB 3N1GC 1I7RB 1RK1B 1E4XL 2HA1A 3W0WA 1R6VA 2WV3A 4UV4H 3T2PA 2HLFD 2NXYB 3S88H 4N0UA 3FZUD 2WIIB 3W5NA 4PBWD 4PLOB 4MJID 5IB1A 5C2BH 2QQNH 1R3JB 4H1LG 2QJDA 2PTTB 4LCCA 5IJVA 4P4KB 1JWMB 1AO7E 4XNZB 4WFHE 4YXLL 1SHMA 3GIVB 5B39B 3SGDH 1O5DT 4J4PC 1U8KB 5INCA 1UFUA 1CU4L 5TDNB 2BOCA 1A3LH 4G8EB 4YIQB 2R8SL 1TPXB 4KY1H 1QR4A 2PTTA 3D39E 1QD0A 1IARB 1J1OL 1TJIH 3T8XB 3VRIA 3D48R 4YBLB 2ADJB 1A8JH 3G6AB 1WLHA 3MLZL 3SKOA 2AKRB 3BE1H 5AYQA 1KPUB 5FOBB 3IDXH 3H9SB 1PLGL 3H9SD 1HK6A 4J6RL 3RWIB 5MHSE 3BPNB 5JA8B 5KVEL 1S5HA 4WV1B 4DEPB 1J5OL 4DEPC 3RNQB 2FO4B 5HD8D 3ZKXC 3FO1A 3UAJC 3CZFA 2JKXA 4BK4A 1GGIL 1EPFA 1TQCB 2ADGB 2BCKB 4JM2C 2NZ9C 3OR6A 1JPSL 3VFWB 5I71C 3TESA 3NIDF 1JRHI 1DUZB 5EZOL 1WSST 2BVOA 4AEHL 1VFAB 4XWOC 5F7YC 1IGYB 1AKJB 2VUOA 1DL7H 2YMXL 3HAEH 1BD2E 2HAZA 4NZRL 2FD6L 4P4KD 5H94B 4AQOA 1YZZA 3FB6B 4KDWA 2FJFB 2AJUH 5F9OH 2F9BT 4S2SB 4GKZB 3VFMA 2PR4H 4KY1L 3GMLA 2DQDL 1I1AC 1J0ZA 4PJEB 1FPTL 3BP5B 1M6OA 2J1KA 1KUMA 2XQBL 2YUXA 1LO3H 2HKFH 5DJ2B 4CVXB 2NXZD 4XB7A 3K8MA 3GJFK 1D6VL 4FZEL 1MLBA 1CDUA 4RGNE 1J86A 2R0WH 3QR2A 2IH1B 1X5GA 3OGOE 1ZTXH 5HHNA 3VWKD 4OLWH 4DWHA 4U3XA 5E6IA 1RAMA 1ZV5A 2YA2A 1EFXA 4OM1L 3RNKA 1RZFH 4ZODA 3WLWC 3JV4B 1YEFH 35C8L 3TIEB 5HGBB 1S9YA 2VLJD 3DX8A 3V52L 4OTXH 3FFCA 5EA0L 3QFJE 5T33L 3JWDL 2J88L 4EDWH 4R0LA 3D85A 5JA9A 1KTDB 1OGAE 4U4BA 2HVJA 5BJTA 1MAJA 2DJ4A 2GTZA 3E2HB 4HG4J 3TO4C 3QI9C 4UINH 4NNXA 5EOTA 3WUWA 1J8HA 1FAIH 1NL0H 2HTLC 3WFHA 5EO9A 1DTUA 4LCWB 4F3FB 3D9AH 3QEQA 5F93C 1TVBB 1QFWL 3K46A 3PE9A 3MNVA 3BQUB 3IF1A 5F9WB 2BNQA 4NJAH 1IAIM 3JWDC 4TQEH 3QDME 1E27A 1X5KA 3DV6B 4WEBH 3VD9A 4ZUUB 1CZ8H 3PQYE 1AKJD 1CLZH 2G5BB 2ESVB 1JWUA 3CX5J 3TBTA 4UIKL 3NIGE 2R0LL 1XIWD 1AY1L 3KYKH 4LRIA 1C5DA 3JWOC 2A77H 5B8CC 3L3DA 4UB0L 3MLXL 5D7KE 4X9FA 1DN0A 1K4DB 1G1CA 3LV3B 3CFIC 3CK0H 4X6FA 1KF9B 4RISH 5F7DA 2K7PA 4YFDB 1A6AB 3U0TB 1T20B 5C92A 5KOVC 5HYQB 5HHOD 1FGVL 4OM0H 4OUOA 2DM4A 1YJDH 4F8TA 3B9KD 5J6GA 1TCRA 4N90E 3MOBL 3V4PL 2OXGA 4CJ0A 5IK3A 3KLHC 3L7FB 3MRNA 1NGWB 4YPJA 3ULUC 1MCIA 1RZKC 1YNTB 3DMMD 3O6ML 4LAQH 5ESAA 3KPSE 4ZUTB 3PG2A 2E7MA 1JNLL 3P4NA 3C5SB 2HT4D 2GT9B 2IAMD 1DSFL 3P4OA 1RFDL 1VGKB 1ZS8A 2P24B 2G9HB 1P4LB 4X9BA 3VFOB 1ACYH 4LEXH 3ILQC 4MNGE 4L9LA 5IQ9B 3VJ6B 1A0QH 1JHKL 5JHDE 3KJ4C 3DRQB 1MCRA 2ESVE 4M1GL 1IQWH 3UPRA 5DGQA 3VFTA 5I1JH 4H25A 3GI8H 5DSCB 4ZAKD 4NQTA 3CLEL 4Z7QE 1EHLL 4DN3L 4W68A 1EZVY 4NC0B 5J6GB 3VMNA 5C3TA 1FFNA 2EIDA 3FHQA 1OOAA 1CN4A 4Z5RA 1EVTC 3QPQC 1DANT 1V3LA 3GNMH 1FVCB 4NQSA 2ERJC 1KJ2B 3EFDL 4PGDB 3KPSA 2R2BA 5BVJB 5DHVB 3X3FH 1A7QL 2H26B 2ZOKA 3T04D 4K71B 2IJ0C 4TUKH 4TUOB 1A7PH 1SVZA 3WIHL 3ROOA 3Q3GA 5BQ7A 2B1HH 1KJ2L 1NBVH 3PHOA 5AUMB 3QA3A 4HIIB 1F4HA 3QEGL 4LVOB 3I6GB 3U4EA 1KIQA 5B3JE 1Q9OA 3TA3B 4F80A 1EHNA 1MFAH 3OKOB 5DD5H 1H15A 3VXUD 4L4TD 4NUJA 3MRKA 3UBXI 4FXGA 2IAMB 3AREA 3TN0A 1KENL 2X4QA 1S7VA 4TSBL 3K4DA 1KTDA 3OMZA 3G5XA 5C09E 4K7FB 3IFLL 4CADB 2RFXB 1KJMB 4OKVB 3WFZA 4CAGA 2J6EH 3W9EB 4MMZC 2EECA 1OAQH 3PDOB 4PV8A 5K9KA 2R4RL 1XH3B 3WXWH 1AJ7H 2Z8RA 5E00A 2VLJA 1PY9A 4WW1A 3BOVA 5HYSB 1H3WM 1KPRB 4MHHG 3MOAL 4O58H 5D7IA 1B6UA 1AGFB 1AR1C 1JE6A 3BMWA 5MEPB 3L5JA 3KXFD 1YA5A 3P9LB 4Q6IA 5HD8C 5J13C 4OCSH 4KKCD 4KJQC 1T7YA 5HDBF 1JNNH 1RZIB 1KIRB 4V1DB 2SEBA 1PSKL 5GHWH 4OQTL 5D2NA 3MUJA 5E8EA 1QPXA 2ATKB 1G9EA 2VN4A 3TF7C 4IDLA 1T3FA 3GBNH 4ETQB 4G3YH 3GGWB 1L6XA 1TZHA 1KYOK 3QUMH 4OZGE 3DXAD 1W0VB 5JXAL 43CAB 3KLSA 4QT5A 3FHAA 2AP2A 1RQ5A 2ESVD 4PJIB 2H32B 4XVTL 4JO4L 5IFAH 1E4KC 1UJ3A 4JFZH 4DGIH 1NPUA 5T3XE 5IB2B 5FIEA 3NABL 2AXFB 3SE4A 1G7PA 2PXYB 3VFPB 5ID0B 3TLRA 5ERWB 5EU5B 4I0KA 1CDHA 2XIDA 2APWA 4O2FA 3BGFB 4Q97A 4LSSH 5FDYA 3G6JA 4JY6A 5EU6B 1B4JH 1OLZA 2IPTL 3ARDD 4NNPH 4RFEB 2MQ3A 3H0TB 1FH5L 4KQ3L 5FUZL 1Z3GH 4P48A 1T2XA 3D3VD 3TBVB 3EOBB 3NH7L 1UQSA 1P84K 5JQ6L 3M17B 3P40A 1ED3A 3MFFB 3T2NL 2PKDA 1T21B 3QXWA 5GGVY 4HK0B 4XH2B 2RBLA 4XBEL 2J88H 4XVUD 5JXAH 2VZSA 1YPZF 3ZTJH 1L6ZA 3WCYA 4R2GB 3WHE0 1CL7H 3RIFF 1LDPL 4PRAB 3OKMA 1W0WA 1XF4B 2ZUUA 2F74A 2C1PB 5I1HH 1H3GA 3O3EA 2YPLB 5JUEL 1PX3A 4MZ2A 1A6ZB 4HX1A 1FAIL 2BRQA 3QUYB 2C3VA 1YEKL 2GJ6B 4HIXL 3OG6B 5I1EL 3PXJA 2JELL 4KMLB 1QEWA 5KVFH 1UYWL 4FQ1L 1OP3H 3STLA 5CEXA 5K59F 1QSFB 3IKKA 3CVIH 5IWLC 3E3QC 4N1HB 3NOIA 3FQUB 5KANG 1JNLH 5T5NF 2G60H 4X6DE 1I3GH 3GIZH 3GB7A 4P9ML 3SY0B 3S37X 1CYGA 2HJLB 1YPZE 3Q3GB 5TDNA 3ULVL 1U93A 4JKPL 1JTOA 3SKNB 4I18C 4PJ7A 5HYEA 5EO1B 5BOZG 3IETA 3GIVA 1UM4H 5CZVH 3PWUA 4LVEA 3T1FB 4HK3N 3BWAA 3MRHB 1KIUA 3HG1B 3QXDB 1CXFA 4DVRL 3RGVC 5BMFL 4NJ9L 3D18B 1IEAB 2R29H 2Z92A 4Y4FA 1D5IH 3KLHD 4XNUH 2OI9C 3G04A 3AGVA 3ULSA 2NY3B 4XZUB 1TMCB 1MRDL 4G6FD 1B4RA 1GCFA 5ICYA 3LKOA 1HYSD 3BH8B 4J3OC 1SJXA 4GJTB 1JZ3A 1EO5A 1GAFH 1SBSL 2EDHA 3ARXA 1ORSB 5TPWH 2DDQH 3MNWA 1SY6L 1OP3K 1LK2A 1GPOH 1IAIL 3C8KB 4MD5A 3ECBB 3EO0B 4G42B 5EBGA 4M5YH 4PJHF 5F3HB 4EI5C 1RZ7L 3ZZ1A 4JFXB 3KPMB 5I1IH 2WWKT 4JJ5A 1TFHA 1I8LA 1R5WA 5CINL 1S7WA 1KB5H 5JIIA 1A0QL 2BJMH 1DQJB 3PWLB 3EGSB 5E9DB 2FWOA 1QP1A 2JTDA 2PTVA 3P9LA 4LSQL 4OZFG 4ZPTA 1QR1B 3UTZA 5LQBL 1JRHH 2ERJB 5KTEH 4XXDB 1IC4H 2FJGA 1VFOA 4M61B 2RJMA 1MFDH 1TETL 4Y4KB 3S6CA 2VLRA 2X4TA 2O61B 4WHCA 5L8KB 2CR3A 5E5MB 1PG7H 4LSUH 2AJZB 3HC0B 4NBYB 4P2OC 2GEEA 3RVWD 1MLBB 4JKMA 1UWEL 1IC7L 4KV5F 1EIBA 4NRYB 3F58H 2ICEA 5J6HA 1IGJA 4OM1H 3EO9L 3GSWA 4JN1L 1M7DB 1HI6B 5ACMA 3CSYB 4HUWA 4RAUB 5L2KA 4Q2ZB 2BOBA 1KCKA 2HKHL 4M5YL 1R5VA 4ONHA 1R5IB 1MIEH 3S88L 3WL9A 1ZLVH 4ZSOB 3KYMB 2YD1A 3L3OB 3CFDA 1N6QL 4RIRB 2WLZA 3S4SB 4H5SA 4NZRH 4CMMA 4PV9B 4BELD 4XVJH 1F02I 4HJGA 4L3AA 4MNQA 5C8JB 3KR3H 4L8SA 1QLFA 5JHLH 1DLFL 2UWEF 5C0BD 3MLRL 4XCNA 4LKCA 1U8KA 4OFPA 1T5XA 3VFUB 3ZE2E 5C0CA 4JFEE 3QZWG 1CBVH 1C7SA 1FGNH 4WI2A 4MJIE 4IEFB 43C9B 4I3SH 5FDWB 3O0RH 1WEJH 4V1DA 1AR2A 4JFHD 1BJ1J 4MXWH 4QHMB 5GGSA 5JR1H 3VI4F 1IC5H 1TQCC 4ODUB 4LLVA 5D2LA 5BS0B 1I1YB 4IDJH 1GZQB 2P7TB 3O4LD 3RWGA 1KFAH 1C12A 5AUMA 2OL3H 5I75B 1VKXB 4J8RB 1C16B 3U2SA 3SJVE 3AS0A 4EUPH 3RU8H 1R5IA 5DR5L 2JJWA 1FYTD 4KHTH 2VRAA 5IBTL 3AMLA 5JW4R 5DWUL 1GGBL 3VFOA 4KZEH 3TN0B 4YK4C 1DQQB 4D9RE 5IBUG 4LARH 3LRSA 2P5EA 4GG6A 4JJHA 1OAXH 3Q5TA 2AEQL 1JFQH 1KJ3H 2HT4C 2ZSVA 4Y5VC 3DRTA 3UO1L 4HDIA 3G08A 4EI6B 3DWTA 5FGRA 1T1WA 3MA9L 1LO3L 4NKOB 2MQCA 4LCIL 5IESH 2ATPB 4E5XB 3OJ2C 1U3HC 4K9EL 4LLUB 3X14B 5C0JB 5FAAA 4O2EB 4G5ZH 3G08B 4WFEE 3VFMB 4X7SH 3TYFA 1G9NC 5HHQB 2H3NA 2Y36H 1P4LA 3LPGA 2EIBA 4NKOA 2R0LH 5EN2B 4KDVA 4PG2C 4UT6L 1TVHB 4D2NA 1IM3B 2OX5A 4YHLL 1MI5D 5DYOA 4M43L 4NGHH 4N8PA 4NHCH 4F15B 3MRQA 1INEL 3DX9B 2CKBA 3ARDC 1C5BL 1ITCA 2DQFA 4CN1A 1HYSC 3WBDA 3MLUH 5FECA 4Y1AD 4M1GH 2EH8L 3HC4H 4RMWA 3PHQB 3RQ3A 3FOMA 4TPRL 3O3DB 3RTQC 4EQ2A 4ZO8A 3CH1A 3QDHA 1B90A 1YUHA 1CDBA 1X4ZA 1LK3H 3B43A 4HWBA 5C6TL 3RWCB 1RURH 3LY6A 3UTTA 2BVEA 3GSXB 4LCWE 3QCUH 5AYUL 5ITFB 4JPKL 4LIQE 4OLUH 4YX2H 1IM9A 4F3FA 1RZ7H 1KB5B 2H6PB 4NC1E 4B41A 4AIZA 2HVKA 3VXUA 2HT3D 3MNVB 1J18A 4PGBB 5IVZA 3B8SA 5EO1A 2W07A 4TUJB 3FO2A 4CDHA 2ICWB 4BSWB 4QHMA 4ZS6D 1UM5H 1FCGA 4D8PA 1JWUB 4P46A 2XWTA 3L7EB 5DGRA 3V6ZB 1AE6H 2FD6H 2NY1B 3GFUA 3WD5L 4JR9L 4DUWA 1WISA 1NCBH 2VC2H 1KN4L 4Z8FL 2H1PL 3GMRB 4Q2ZA 3LKOB 1SMOA 5IMKA 1CDGA 4TNVK 2HKFL 4Z76B 3P77A 1U8PB 4JDZB 4MXWL 1NFDF 2ICEB 5J6HB 4P46D 2WUBH 1ADQL 5CZVL 3SDXB 1HI6A 2VQTA 3SDDA 1D5MA 1QLFB 2HYMA 1N6VA 4DJMA 5BOPA 5EBWA 5EO9B 3NN8B 4BFIA 1H3PL 1SY6H 4PJGF 5C0CB 3VFUA 1QSZA 2XZQH 3MLVH 1F4XL 1DE4B 2VZTA 2VDLH 5D1ZB 1QG3A 1RUAL 4TVSa 3DX6B 2AK1L 2PW1A 2J8HA 3MFGB 3G6JB 3PP3K 4JY6B 5CJ8A 3A0OA 4Y4HC 2UUDK 1WITA 1ZVSA 4H26A 3BW9B 5BW7C 4KJWD 4JFDA 2BRRH 4PY8J 5D7KD 5CP3A 1F8TH 1DUYB 1CLOL 3GMOA 5I18H 1X6NA 1T6VN 5CJOL 4Z8FH 1U8MA 1LO5A 2P5WD 1HQRA 5T1KB 5A3ID 4UDUB 1DBBL 4KKNA 2X4PA 4BSVA 3CX2A 5DRXA 2QKIA 1OTSD 1NBZB 3GKZA 4P2RA 3MRJA 5ILTL 3V8OA 4QRPD 1TJIL 3SDXE 4G8GD 2QQQA 2A73A 2W91A 5ID0A 1DBAH 5E8OB 3LIZL 3F7VB 5HTSA 4XPFH 2AAVA 1K4CA 1UH2A 3O41B 5JW3L 4O2FB 2EDYA 1RZFL 4M3KB 1MIMH 5HYJE 1G7PB 2PXYA 3VFPA 1MRFH 4ZS7L 3TJEH 1F6AA 4WFED 1Q72L 2FLBT 4U1HB 4O02H 4XWGL 4MSWB 5E1AB 5TE6H 2I60L 3EYVB 2Q76A 3OKEA 1FFOA 4YDKH 5INCB 4DAGL 3F58L 1OP9A 1W72H 1IEBA 2BRRL 4GRWB 4MWFA 2HFTA 4P57B 1XZ0A 5CGYD 3DI2B 5TE4L 2EH8H 1T7ZA 3HMXL 3HMXA 4X98B 4YHIB 2ADFH 4NN7C 5C08D 2NX5E 4WI5A 1Z9OA 3O9WD 4KV5E 4F9PA 5ALBL 1FAKT 4LLWA 1YYLL 1W8OA 1XF3B 2HJLA 4PIRF 4EJ1C 4JFYA 1WT5C 5GRYA 1V3MA 4XXCA 3D18A 3UYRL 1GXEA 1Z9LA 2Y6SC 2AJYH 5DWUH 3ULUE 3O2VH 4L8DA 1D5IL 1IE5A 1YC7A 5F1IB 3F7VA 3C6LC 4NBXB 3E3QE 1F6FB 4KZDL 2DMKA 1Q9OB 1OAXL 4FXLA 5DD6B 1OSPH 2VWEC 3LVEA 1JGUL 3UPCA 1ZA6B 1R24A 3S35H 2ZOLA 2O26U 2APTA 3FN0H 3PL6B 1GL4B 3WEXA 4ZG1A 3TPKA 2DQTH 1NAML 5ADPL 4LOUD 4JANA 1UXSA 5DS8B 1KELL 4PJXE 3D2UA 4GLRI 3CC5B 3IDMA 4OKVA 4YDKL 2B5IB 3ET9F 1BD2D 5DHVA 1MUJB 1ZLWK 4NC2B 5I1GL 4HBCH 3SDAC 1DQLH 4JY4B 5DEGB 4JZJC 1WIUA 4ZQKB 3IDYB 1P84J 4EN3D 2CUIA 4PS4H 5CMAB 3RVUC 1QLEL 2R2EA 1H9VA 3VA2C 4XNZC 2QBWA 2NY0D 3INUH 3T1FA 5DDHA 1DQTA 1A1MA 1BFSA 3EUUA 2C3GA 3U4EB 2IBGA 3UCRA 5DZNA 2FZ3B 4I18B 2XWTB 4PGZA 3RWDB 1U8NA 2C4XA 2WBJB 1AXSA 1FCCA 2Z35B 4BFGA 3BKJL 2ICWA 2V2TB 1EH9A 3VFGL 2KQMA 3H3PH 1IGIH 5IM7A 1YQVL 4ZNEA 3DBXB 1HKFA 2YRLA 1DEEB 3GHBL 4GXVH 2NY4C 1UA6L 1KB9J 1BEYH 4NO2A 2F8XC 4CMHC 2FRGP 2YUVA 3MRFA 5CBAA 3L3IB 3K2MC 2FYYB 1IKFL 4Y88A 1IKNC 2X89A 5F6IB 5TQ2H 1XR8B 3CVIL 4JPIA 1P7HL 5F1KC 2JCCA 3UYOD 3QRGH 3GMMA 4Y4FC 4FTVA 4L4VA 5GGRY 2F53E 3C2AH 1E4KA 4CW1A 1T2QH 2FX8H 3RPIA 3JZ7A 4OGAD 1YDPB 4U0RC 2OQJA 3SQOL 4WGWB 3RWHB 1Y0LA 3U0PB 2DQHH 1PY4A 5DQ9B 3S37L 3O2DL 4K23H 4D0BB 1ZLSH 4CRPA 3MCLL 4LHUB 2Z93B 2XTJE 4YQXH 1MVFA 3VW3L 2GTWA 4FQLL 1FO0L 1I1AD 2VJXA 3REVB 1UQSB 4Z7VB 3TZVA 4FQCL 4PJBA 5CD3B 3LQAH 3NIFF 1X7QB 3EYFB 1PQZB 4O2EA 4R6UA 4DKEL 3QDMA 5IBLD 2NY3C 1QUNA 3CLFL 4NWTH 4TTDD 5DK3A 3TNNA 4LSUL 4EXKA 1BEYL 4PLJD 4PRBB 3S3JA 4XPAL 2G2RB 4OJFL 4CGTA 1UKTA 4QRTA 4K07A 2I9TB 3LSOB 1A3QA 1F4YH 5K9QG 4I5BA 3U4BH 4OQTH 5FXCH 2VABA 2AXGA 5FGCB 1U8HB 5IVXB 4KHTL 1MF2H 3GNML 4GRLC 4KTDH 1KXTB 2W9DH 1ZMYA 4X7DC 1KLUB 3SDAB 1T2QL 1JZ4A 1RZGA 3TN0C 5D96B 2WUBL 2YD3A 3ZSSA 4R96B 1T5XB 4LU5H 4YXHH 1XR9A 2VSDA 4Z7VE 3LN4A 2EIZA 1I3UA 1W72B 2R2EB 2YWYA 2DJSA 3D0LB 4PYHA 5EZLB 1KT2B 1BLNA 3RZCC 5D93C 3MYZA 2DQJL 3W81A 1OP5K 1BQUA 3VGAC 2EIZB 3ULUF 4HIEA 4JO2L 4QY8B 3TPUB 4YHIA 4DGIL 5IB3A 1D5ZA 1HSAA 4ACPA 1X3DA 3GMPA 4ZOAA 2XRAL 3VG0H 2BY0A 4E0RB 1HILB 1PD6A 4HAFA 2NZ9D 4H25B 5DSCA 1HIMH 3UYRH 4B7IA 4NUGL 5LGHH 3VDCA 3CFJA 4XGZB 5CS7A 2Q7YA 4IS6B 4KQ3H 3GEWB 5FUZH 1D5BB 3TVMB 2ZCKL 3C8DA 1FFRA 3IDYC 3IS1X 4YK4B 1S9YB 4N9GB 4XNMB 5GGQL 1BFOA 5JIHA 1HQ4B 1QRND 3HZMA 4QTIH 1MHPL 4OCSL 4E41E 1XGQA 3DUSA 1C7TA 4ZUSA 5C9JB 4URTB 1WAAE 4Y16B 3SBWA 4R7DA 1T66D 1CQYA 1T0PB 3LKPB 5DQ9A 4OLZL 3MXWH 3F5WA 3BX7C 4HS8H 1S7RA 2IH3A 4QHKI 3QXDA 1I1FB 4ESKA 4NO3B 2ICCA 3TYFB 4OV5B 1SYVA 4Z7OF 5GRVK 2VLRB 2O61A 3LS4L 4S1QL 1YEIH 4QWWD 1F45A 4KVNH 5DC0A 1UGNA 2AJXH 4N9OB 3IDJB 3RTQD 2EZ0D 5I75C 2OZ4A 3RL1A 1KEGH 4KRLB 1WCBB 2Z9TA 2ZG1A 1HHHB 1Q9WA 3ULVH 4XZUA 5KN5B 1T1ZA 3EYUL 3RUGE 1G7JA 2X1WL 1IM3A 5ISZA 3C5ZC 5T1KD 1N4XL 2X4SA 4WI8A 2D3VA 5GS3A 2WMPA 4P5TA 3ETBF 5AZEH 5B38A 4H88H 3AREC 2GSGA 2PN5A 3SDCD 3O9WC 5IW6A 2WSKA 1JFQL 1KJ3L 2ARJQ 2R2CA 3MR9B 3TWCH 1A6TA 1JTTA 2MPAH 3MRIB 4Y19B 1GHFH 1U91B 4M6OH 4FQXA 3AY4C 1Z5LA 3B2VL 3OAUL 4IRZH 2D9QB 3VDBA 4N0FA 1ONQA 3CVHL 4ZMAT 4ZFFB 4HIHB 4V2BA 3K74B 1F4YL 4GS7C 1L0XA 1J1XL 4OZGB 4F9LA 5GGUB 1V5JA 2VDRL 4KMTH 5CBEA 3L3JA 3NACL 1Z6JT 4X80L 4P46B 4DN3H 3ARUA 1U8NB 4UUJA 1EHAA 2AJXL 43C9A 2C3XA 2AV7B 4GMTH 4DW2H 1NEUA 3EOBA 1TVDA 4M4RA 4R90L 4IJ3B 2M1KA 5DRNA 3PGFL 3BDYL 1RD6A 3ES6B 4R7NA 1WCQA 1OAUL 2UWEB 4POUB 5MENA 2Z4QA 3RIAK 2YKLL 4FQ1H 4PTUB 4ODVL 1DQDL 1G84A 5E5RB 1GGTA 1W0WB 1M7IA 2OTWA 2R1YB 4Z7WF 3VXNA 5IQ7H 3ES6A 2GJ6A 3IFNH 5EC1A 1MFCL 2I25N 3O41A 3W2DH 2FL5B 3WN5A 3WNMA 5MEOB 4Y4HD 5FYJU 4OGXL 2FSEB 4EBQL 4PJIE 1RHHA 3DMMC 3O6MH 4JANB 4LAQL 2XA3A 5JPMB 4AT6B 5TQ0L 5LBSL 1I9IH 4D9RD 1HEZB 4CNIB 2J8UE 1EGJH 1MFEL 5B39A 5GGUA 4W4OA 1XCTA 2JIXA 3GSNB 5EOCL 1UKQA 1CD1B 3QHFH 2VSCA 3RDTD 5MEQA 4R4BB 1FL6B 1ZVSB 4X99B 3D0VA 3OKNB 3O4LE 4OGAC 4LIQH 2NY1C 2A1WH 3P2TA 5TGBB 5ESQA 4LASH 2D4FA 4S2SA 1JF1A 1R3LB 1CT8B 5E8DH 4IRSA 4OJFH 3IXAB 3IFOA 5CCKH 1QNZH 1WC7A 2P8PB 3H7BA 5EU6D 4RGMC 1LILA 4DVRH 5DRXB 3DV4A 3O8XB 5J4MA 1AC0A 1EEYA 1XF1A 2O5XL 1U8IA 1NH6A 4LU5L 1T1XA 4HMEA 4NQCB 3EOAA 1E6JL 1B6DA 4X7EC 5GGTL 5HJ3A 3BRGC 4Y2DD 4NP4H 1GYAA 4IS6A 3TVMA 5C0BE 1AQDA 1LGVA 4U2ZA 5IG7A 5SWQB 1FL5B 3FRUB 3B6SA 5GGQH 5KSBB 3HZVB 3MBXL 3MJGX 4L9DA 4OF7A 5C0JA 4WWID 4KUZL 4OKDA 4EIGB 2WBWB 5ETUB 1RJLB 4P57A 2I60H 2X1OA 3DTXA 1JPSH 3VG9C 4RISL 4APQD 4TYUA 4POZC 3MJ9L 1CGWA 3V4UL 3VFSA 3QH3A 1YEGH 2XNAA 3OZ9H 5F3HA 1FIEA 3LKPA 1HHJB 4ALAL 1Q9LB 3IAQA 1I8IA 3WS3A 4U6XB 5FGCE 1WWWX 1CT8A 1T22B 2P47B 4GKZA 1L7TL 3IVKA 3KHOA 1BFVH 2R1WA 1YNLL 3EFFB 4OD2B 4MZ3A 1OY3B 4FFWD 3LKSA 5EDXA 1JPTH 1C5CH 3V5KB 3KPPA 4GG8A 5CZXD 3EIFA 3MV7A 1K3IA 1BQHG 2H2PC 4YR6B 4XGZA 1KPRA 5BS0D 1Q1JL 3KNBA 1UCBL 1EHXA 4X4ME 2R0KL 4NYLB 5E94B 4PB0H 4O58L 1DFBH 1WFNA 3MBEB 5CKGA 2F54A 3C60A 3QRGL 4PGEB 1A9BB 3QO1B 4RGNC 3B9AA 3CSYA 1MRCH 1J12A 1PKQB 4LPXA 3BKMH 3D9AL 5DJ0B 1KLUA 4NNPL 4XAKD 1IM9B 5BCAA 1MHPH 3ILPA 1UG9A 1OPGH 3NZ8A 5CBEB 3O6KL 4QRPE 3L3GA 4LHUA 1H3XA 2EDNA 2ZG3A 4NDMA 1KEGL 4TUJA 4XP9L 4NQEA 4MB5A 1LP9A 2HH0L 4LNVA 3SGEI 3ARWA 4X5XA 1ED3B 1IT9L 4PRDA 1Y6NR 1OSZB 3P9WB 1MCEA 4UT7L 4QGYA 4JZJA 4MAUL 4RGOL 4AMKL 3KPRA 4HS3B 1MFBL 5GISH 4U3CA 2OR9H 4O2CB 3MCKB 4OT1L 4S1DD 1RK0B 3TT1H 5KN5A 5H37H 3FQTA 4MLSA 4Y1AB 4MQXD 2YC1B 3QUXB 4M1DL 2Y4SA 4WW2F 1DN2A 1A6AA 5HYFA 1MJ7L 3KLAB 2OJZH 1U8HA 5E2TL 5IVXA 2EC9T 4P5KB 2AEPH 5JO5A 1QHPA 5L2KE 5DRWA 4M5ZL 2F5BL 5GRJH 5IROC 4GAGL 4GRLB 2DTML 3FFDB 3U30B 2CLVB 2C7UA 1DVFA 4PUBH 4H0IA 3VFTB 4YHML 4BH8A 3MGOA 2XN9B 1RJZB 2QQNL 3ARBA 5E99H 2IFFH 1PYWB 5BS0E 4WO4B 3SCMA 4QRSB 5LBSH 5DJYB 3EO1B 4HXBL 1JNHA 5I73B 1ZLSL 1YYML 2CMRL 1LP9E 3OAYK 3ARFC 1MCHA 1U0QA 4LLUA 5ICXA 2MMXA 1KT2A 4N8VG 3SE9H 1VGEH 3UX9B 3OJMB 3WSQH 2PYEB 3RZCB 5T1MA 4QRSA 1BQLL 4WFGE 2CKNA 4M1CD 5J9PA 2XOTA 2IANE 4FFVC 5LGKA 4PJ9A 3RUGF 3NZHH 4X6EB 1KCSH 5FHBH 5JQHC 3HE6A 1IKFH 3LEVH 3L5IA 4M8VA 3PGFH 3QWQB 2UWEE 3BPCB 4HCRL 3ULSB 1F3JB 5GS1C 5F7DB 4KMTL 3QIBA 2P1YA 5C2BL 4JPKH 1WZ1H 4QYOB 2JB6A 1T04B 1CFTA 3RJQB 3DX8B 3EW3B 1EBAA 4KTEL 4BJLA 4PUBL 3MOQA 4K23L 4G43B 3VI3E 2P5EE 3WKMH 4X8XA 4M7LL 3L5XL 1MPAH 3HI6L 3QNZA 2GHWB 1XF5A 4AL8H 1SYSB 1A1MB 5DJ6B 1GOFA 4BH7A 4CMHB 5J1TC 3RBGA 5FGBC 3SKJL 4TSAH 5HHMB 4X6CE 1L9NA 2HG5A 5LKNA 5DQDH 4QRRD 1YNKH 4LRNH 1VFMA 1BWMA 1I4FA 1TNMA 3TPUA 4MJ4A 5CJQH 25C8H 3QNZB 2R9HC 1JL8A 5E03A 3WFHB 4CVUA 2GJ6D 3UJIL 1ZHLB 5F9WC 3T3MF 1OGAA 4P2QA 1NAKL 2B1HL 4RFNB 4DVBB 3WIHH 1NGZB 2UUDH 5B3JF 3V5HA 1KCSL 2MSPA 3ARQA 4KK5D 2HJFB 3IS0X 3T0VA 1A6UL 4FFWC 3DIFB 3E0GA 3WIFB 2XXMB 3G5VA 3NGBB 5EA0H 3STZB 5DJCB 1CFBA 1H3PH 5F72S 4J1UB 2EE3A 3QP3A 4HFWA 2OR7A 2FX8L 3TO2A 3LH2L 4HAGA 2D2OA 2FYYA 2Z8WC 2VLLB 5I6XC 1TIUA 4QXTA 4DOHB 4X9HA 3PQYA 1FL5A 2R15A 3RKPA 3CXDL 3FO0L 5BV7C 1K2DB 2FJHB 5CP7B 5CCKL 3RHWF 5I8OH 3MLWH 3L5WB 4Z7VF 5GS2H 2QSVA 1V7ML 2UV3A 3KPOB 4IOSD 1VHPA 5D7LD 2JJSA 3DECA 4OTXL 4HIJB 1J8HB 3VFSB 3QDGE 4IMLB 1Y6MR 4NSKB 5I15L 3U9UB 1JNHB 1F90L 4FZ8L 4LLMA 5IOPB 3CFBA 3WS3B 3G6DH 4NHUA 1JPTL 4JB9H 4IOIB 2ZCHL 2NW3A 4K3DH 4IIQC 1AHWB 1A6VH 4M61A 3QUKA 5I66A 4XNYL 4WFFD 4JPWL 4JFZL 1AFVH 5JORB 3VGGA 3QDGD 4Z78B 5CHNB 5EIQA 5ESQB 4POZD 3QQ4A 4ODHL 1PKOA 3VXMD 3QYCA 4UT7H 3EDDA 5HGGS 4QOKE 5FKPA 3RTQA 5SV3A 5DMIL 2D7OA 5HYQA 5EG6C 3KPQB 3I2CL 4R3SB 4YHOH 5HDOA 5ILTH 4QGTA 3GJFB 3ZE0F 4ODTL 5B22A 3RNQA 4ZFGH 3TCXA 2AJSL 1VGEL 1YQ2A 1CF8H 2VOTA 5GQBA 3WLWD 2X4NB 5MENB 2O93L 1C1EL 4YWGH 3LRHA 5K9KB 5C07A 1CVRA 2FL5A 3TBYA 3WN5B 3ZKMC 5MEOA 2LTQC 1ULVA 3IU3A 4JKWA 3MACH 4L8BA 5ESAB 4ZUTA 1LO4H 2DM2A 3ZKND 2FEDD 5CZXC 3IJHA 1KN2L 3EJYC 4UB0H 3QDGA 4I3SL 3MX0A 1KGCD 4N0UB 5GJTH 2FNBA 4HUNB 2FX9H 1OGTA 3TFKC 2CRZA 3TH4T 3VH8B 4X4YA 4JM2F 4JG1H 5E7BA 4MQ7A 3UYPA 1FZOB 3PF2A 2KUTA 1BIHA 4P59L 4U1NA 5CP3H 4R4ND 4EXPX 4MGXA 1IEHA 4JFDE 4C55A 3QB7C 5E1HB 1MCWM 3SDDC 4F58L 4DTGH 4ORZC 3B2VH 4LASL 5HI3C 3QG6A 4UILH 3IXTB 1CICA 2VH5H 2QR0A 1LDPH 4NQVA 2V7HA 1Z0NA 5CKAA 4AMKH 1LEKB 4U1JA 4MDIB 4IBLT 5EH1A 2GITA 4OZ4A 5DYOB 3IXTA 4TRPH 4LLYB 2R1YA 5C07E 1FNLA 4IHOB 5IW1B 2YPLD 3BPCA 4LFHG 1P5UA 4J3UA 4KTYA 4LSTL 3V0VB 1F3DJ 4OLYL 1A22B 4RZCB 4YQXL 1QRNE 3RX5A 5EOQL 2GK2A 4M5ZH 3UC0L 1FNEB 1UACL 3HRPA 4MCYA 4TUOA 1MFBH 3FO9B 5H2BB 3PABB 3U48A 4PJEF 5HHOE 3VGBA 2CR6A 2E6JA 2R2BB 4P4KA 4NKMB 3QH3B 2VZOA 4MA3A 1NMAH 2VL5A 2IFFL 2CJUH 4YC2C 1S78C 3ZDYF 1G9MC 4Y5YC 4PJDB 4ZO6A 3QG7L 5DEGA 5IVOA 3RVUD 5KVMC 3QDJA 2Z8VC 5ITBH 2IALB 4GBXB 4ZYKB 25C8L 4JN2B 1OLLA 1IQDB 3QUZB 2VH5L 5D9SA 1WF5A 3HC4L 1OSZA 5T1DH 4YDLC 1D5BA 2VXQL 2IAMC 2ZOLB 4P3CH 3UPRB 4FXKB 5IF0A 3ORJA 1KACB 2Y5TB 1T1XB 4PRHE 3DX9A 43CAA 5HHNB 1YQVH 4NCC1 5E00B 1JUFB 1FNGB 1E4WH 4HH9A 1VADA 3OKKB 3BJLA 3DIFA 1S3KL 3QIBD 4M7ZC 4TOYH 3BDXA 1KXVC 3OXSB 4ZXBC 1A9EB 5JZ7D 1KC5H 1MH5B 4KRMB 1Z2KA 2LE9A 2VKWA 2PYFA 3SHSA 1NEZA 3OF6D 5ENWA 4RAHA 3S96B 4G6JL 3QXAA 5IV2B 2VIRB 4YX2L 1J0HA 1JMXA 5J12B 4EOWL 1UWGH 3MV9E 4KDTA 3VCLA 2IFGA 2EDFA 2OK0L 3ZO0A 3O4OC 2V6HA 5FCUH 1XGRB 2GCYA 5K9JL 1EEZA 2CLZA 3D87B 3N1QC 2ORBL 4S1RL 5D7JB 2SEBB 2V2WA 5JW5A 4NDMB 1U58B 2LQRA 1RUQL 2NY2D 1CD9B 2Z0BA 4U1GC 3CU1A 3A67L 3U0WL 3JVGA 3T2OA 1BVZA 4X7CC 1A02N 3SDXF 1FN4A 1QVOB 3HPJB 1FZMA 1OAQL 3LV3A 1IC7H 4QHLB 1RU9H 3I50L 4AYFA 3NCMA 1LHZA 1A6UH 5DD3H 3GJFH 4PTUA 1FNHA 2XN9D 3IFPA 4I3RH 4XC3H 3ROLB 4H5SB 2VAAA 1T83A 2EDOA 3BVNA 3FB8B 3TA3D 4G6MH 1D6EA 4UIMA 1SVCP 3QUZD 1BFVL 5DC9B 2BK8A 2JCCE 2F19L 3LEXB 5E70A 5KVGL 3GK8L 5KS9B 4GAJL 1QKZH 4FTVE 2NXYC 3Q1SL 3NBNA 1MIEL 4H26B 4PJBF 1MRCL 4KK8D 4C57C 1PKQA 5K93A 3HNSL 2FEEI 5C71A 5M95B 2W59A 2BDNH 5HDQL 1B0RA 3IJSB 5BVJA 2MPAL 4BH7B 5GXBB 1JF5A 5F97E 3MRBA 3TFKD 3D2UD 3HLAA 2WAHA 4HWZA 3HC3L 3TNNB 4HC1H 3TZVD 1TQBB 4OLVL 1DVFC 3R1GL 4RMRA 2HFEA 3BQUC 3OX8A 2HN7B 5JOPE 5DVKA 4MX7A 1KFAL 1I7UB 2OL3B 1AHWC 1JPST 2JCCF 3GZKA 4P3DB 4X6DA 3MRLB 2AXGB 3JWOL 4KRNA 2OR9L 4OT1H 1ZEAL 5L9DH 3O6KH 1K8IB 4XPHL 3I50H 2H9GB 2NY5L 1I8MB 4FXGB 3V7MA 4OQTA 4EUPB 2OSLA 3HCVA 1G6RA 4J7RA 4NRXB 2YC1A 3QUXA 5FYJD 2BOBB 4UINL 2F19H 3OKKA 5KVGH 1V8HA 4O00A 3U1SH 3FFCE 4O9HL 4U7MA 2A74A 3BP6A 4NN6B 3QFJA 4AM0B 2NY7L 1KJVB 1RJZA 1BBDL 3ARBB 3O6FB 4NRZB 5HHVL 2DYPD 3BPOC 3O3AB 1LE5A 5FECB 2QHRL 4ZOBA 2C7UB 1T1WB 2YXFA 4JFFE 1I3GL 1MY7A 3T0ED 4DCQB 4LLAA 1CIDA 1UM6H 1PG7X 2PF6A 5EZJB 3SPVB 3MV9D 3T77A 1BJ8A 2ZJSL 5JLZB 3QQ9C 1JN6B 4OZHE 4Q9BA 5MEQB 3GMQB 3UXFA 2MKLC 3MLYL 2W0LA 3C5JA 1TQBC 2AI0L 2H8PB 5EZJA 1K8DB 4G6JH 2QTEA 5I1AB 3BXNB 4KI1A 3UTSB 2CKBH 2FGWL 2Y5TA 3MACL 1ZT4A 5DVMA 4FOMA 4G8GA 5C09B 3V6FB 4N5EC 4R97B 1JZ6A 3H7BB 1G7MB 3KXFA 5DS8A 1C16A 4I0PC 4QTHB 2DQFB 3L9RA 1HNGA 3VJ6A 5ADPH 1JIBA 4LPWA 4LVNB 4PJ9C 4NOBA 1MREH 4PR5B 5CEZL 5EFIB 2CK0H 1U2HA 5J56B 3LRSB 2E9WA 2XZAH 4JGMA 3VRJB 2NY0C 1S3KH 3C6LB 3H7LA 3WIIH 2PO6D 5IVNA 3F7QA 4ERSL 3MRRA 4FQHB 5H2BA 2FZ3A 4I18A 1P53A 3UJTH 1MWAB 2N56A 1G7LA 1U93B 3QI9B 5AYUH 3VDAA 1W0YT 2V2WB 2XXCB 1NBYA 1OD7A 1TCMA 2P4AB 2R4RH 3B5TA 4OZHA 3O6LL 2Q3ZA 1WTGT 5SWZD 4LEOA 3WFEL 1LO0L 5GGTH 1MF2L 3CZJA 3UTZB 3FQRA 5IWLA 5EO0B 3BP5A 4UOW0 1NC2B 5C07D 3CSPA 1DQDH 3QHTC 4H1LA 2LVEA 5DD1H 5F9JA 5KAQG 3GSWB 4K2UL 4X7TB 4PJXF 4OZFB 5D1QD 5F7WC 5TQ2L 4OZGF 1R5VB 4ONHB 15C8H 1ZHBB 5LXGL 2UZIH 4KKCC 2VR5A 3VXQA 4R90H 3FFCB 2DIJA 2EXWC 1NFIB 4HEME 4WNQA 3MUZ1 5T1LB 1MREL 4R0LB 3R06A 4M6NH 3NTCH 4V1DE 4HHAA 2ILLA 4LSVH 4X4XA 1L7IL 5JHDA 2ESVA 5EB9A 3QO0A 4YDIH 3CXHJ 3L3OA 1UZ8B 3MCLH 3NCJH 1ZTXL 1SJHB 1Q0YH 2F8OA 4FP8L 1KGCE 3BH9B 1S7WB 1IM9D 5ERWA 4FG6D 4X6CB 4Y0GA 5FM4A 4YXHL 1S7UB 4LCUA 1FO0H 2DI7A 4EI5D 4LKXB 3C2SA 3IU4H 1EZVX 5GGRA 1T0NA 2AK1H 2FHBA 2YPKA 5JW5B 4Y2OA 4RSVA 5T5FH 2YUWA 3IETB 3FB5B 5CLTA 2ATKA 5F3BA 3W11C 4LCUB 1AHWA 4BM7A 3BW9A 4I0PB 5E2WL 3Q48A 3SE3C 3DMMA 2OL3L 4RA3A 4X5WA 4QOKD 4WNQB 3I6LD 1A4JA 1U6AH 4IJ3C 4HIEB 1DUYA 4ETYA 1BWWA 1M7DA 4ZFOB 4UOW1 1FZKA 5AD0B 1YN7A 4LDLB 4Q58C 2AS5M 3Q5YA 1ZGLB 3F65A 4FQQA 4XX1G 4X9GA 5IMLA 3OSKA 4IRSD 4HUXB 5C6WH 1OD9A 1MLCA 5C0FB 3DSFH 1PJ9A 4JFFD 2Q7NA 4HT1H 2ADJA 3JSSA 5TDOA 3QUYC 2PR4L 5FOBA 3P4LA 3RDTA 3WXWL 2V5SA 1WWBX 2PYED 3RZCD 5SWSB 1MY5A 3T65A 1NGYA 1J05A 3ZDYE 3T0WA 3GK8H 4DZBA 2J8UA 4G7VL 1CGSL 1V05A 4Q0XH 4Y2DB 3NCBB 3TEUA 5I8KH 1DJSA 2OP4L 4ZOCA 3TVMC 1A5FH 3SE8H 1P4BH 4WO4D 2DWDA 1IFHL 4MS8D 5TFSH 4O4YH 3U9PL 3BIAX 4JGUA 1I4FB 5DVNA 5LAXB 2FATH 3KDMA 4NOFA 3MTRA 5K9OB 3GHEL 4ZD3L 5T33H 4LEXL 2CO7B 3RWFA 3WLBB 3P30L 4BQCA 4BA8A 3DYMA 2I24N 4ZFGL 1DCLA 3VD7A 5EU4B 3GI9L 5T3XL 1FVEA 4OFYD 1F4WL 4P5TC 4NZUH 5C3LD 4PJ9D 1WZLA 2QQKH 1I7ZA 4P59H 3F8UB 2LTQB 3T4AA 3K80A 4XRCA 4WI3A 1RUKH 5BO1L 3VGHA 5I8CA 3INUL 4OLYH 4N0YL 1OCWH 1P2CA 1XT5A 4LLQA 2E7LA 4HS8L 1A4KA 3LPFA 3FRPG 1J0YA 5IMOA 1PGRB 1P4IL 2AQ1A 4RA0C 4X7SL 5MHSD 5J3HD 2OMNA 4GAYA 3IRPX 4S1SL 4OI9A 3ULVC 2WM0A 1IAIH 1TZGH 1TTFA 3QIWD 1KJ2A 3N0PB 4S1RH 4PRIE 4Y4HB 3IFNL 4HIJA 5MP6H 4K94L 1NDGB 4Z0BL 5HY9B 1T5WB 3RDTC 5IB5B 4NCC2 1IJ9A 3WKML 2H8PA 4IOFC 3LCYA 5IGXL 3WNNA 3HR5A 3QHZH 3MLXH 5F7EH 4QRRB 5DD5L 3MBED 3WHE1 1KCRH 5DA4A 1RK0A 3QUMA 3T0EA 4OAWA 5FEBA 2HN7A 4RAVA 3OJDA 4L9LC 4MAUH 1FNAA 1MHCB 2X4NA 3V79C 2EXWD 3FOMB 4RFOH 4YHNA 3AFLA 1NCCL 4ZTPL 5FV2A 3BZ4A 1XIWA 3NCYP 2XA8H 4R97C 3VXTB 3WO4B 2R2HA 4KKBC 4JZOA 5I8CB 1QRKA 4PJIA 8CGTA 4NKDB 1CDJA 1NLDH 4OI7A 4N5UA 3KPNB 1PW3A 2NY2C 3LB6D 5CP7A 1E4XH 1A3LL 2B4CL 5GRXG 2R8SH 1CXLA 3KJ4B 4JFDB 4XNQA 5TE7L 2DLGA 1RZIA 3QCVL 1BECA 2PW2A 5GGTA 5C9KA 1MCKA 5FF6B 2FR4B 3CLFH 4FQIH 4KKLD 1WFUA 3X14A 3H0TA 4C83A 4TSAL 1L0YA 1SEQL 1YNTA 4H8WC 1XFPA 1NBVL 1A3RL 4XPGL 1JK8A 3VD4A 3O9WA 1E6OL 3LDBB 5E24E 1NGQH 5BZWA 4G9FB 4RGNB 4I4WB 4UV7L 3O8XC 1A6WH 2MCG1 4W6XB 1I1CA 4L29A 2V17L 4JDZA 3BMVA 4X5WB 4LRIC 1N5YH 1YEJH 4X4ZA 3ALPA 4FZEH 3U36B 3OR7B 1LO2H 4Z9KB 1FE8H 1F8TL 4GKSA 1QQDA 2DQIL 2VDPH 4YUEH 3P4MA 3EDFA 3BN3B 5DURB 4L3EB 5CAYB 1FPTH 4GRMB 3FB8A 1Q72H 4MDJA 4HUXA 4PJDE 2IBBA 5I16B 1CI5A 3I84A 1RIUL 3LH2H 3AU1B 3MV11 1Z3GL 4RBPK 4Y16D 1J10A 4MCZA 4HWEL 5CEZD 2JB5H 2AJ3B 1EXUA 5KSBA 4HLZG 4DAGH 4XPGH 2MWCA 2DN7A 5FO9B 1D9KD 4I3RL 4PGDA 3TJHC 4UMGA 4P23B 3TVMD 3QA3B 3HI5H 1JZ2A 3RIFK 4UZGA 1GOHA 3CPLB 3P0YL 1CK0L 2NLJA 4PJEA 2NTFA 1QHOA 4X83A 2H2SD 5F1IA 2CGRL 1FE8L 2FO4A 2DWEB 1RSFA 4OZFA 1ZLVK 5F7FA 4RBPH 4H20H 3I85A 3RNKB 3U4AA 2ITDA 2Y07L 4HULB 1L9MA 2R56L 4NUJB 2YEZA 3ZE1F 1JPGA 3ZDXE 1T6WA 2W0KA 2V2XA 3MLVL 5EUKB 1J0IA 4WDIB 4Z7WB 1JUFA 3I6GA 1CG9A 5IMOB 1VFAA 1UCTA 1XR8A 1FL3B 3EHBC 2RGSA 2D0GA 4XCEA 1HZHH 4HPOH 3TC9A 1RZJL 1JYVA 3MSPA 4LPCA 2BNQE 4FTVB 3VWKC 3PWVB 4H0HB 4ZPVB 1JGUH 4M9OA 3RY6C 3GMLB 2ZUQC 1MWAA 3MNWB 5SX5K 4XPTH 1ZLUK 2FLRT 4KPHL 4OCXH 5GS0C 3S36L 5DDHB 1UM6L 5H94A 3Q0HA 2CDFB 4WENB 4I8DA 5IK3B 3NZ8B 3TM6A 3BGFC 3KPMA 5A16B 2Z31A 1CQKA 3B4NA 2XT1B 3CDCA 4NO2B 4JM2A 5CGTA 3P0YH 5JTWA 5IFJB 4BSJA 2BFVL 2LABA 5KJRL 5F3BB 5L88L 4NYLA 2VLKA 2J12B 2DMBA 4PJCF 5GISL 4YAQA 2IBZX 1G0YR 2P8MA 5DK2A 1YYMH 2CMRH 4M8QA 1PAMA 3DLQR 5IVXE 4ZUUA 3TIDB 3PUCA 3DYOA 3T4YA 1DEEA 3C6LA 5LCVL 5IMKB 4X6DF 3H3PL 4XRCB 3NCEB 5F1SA 4NQCD 3NPZB 3WV0A 3GMNA 1UWXK 1SJHA 3P9MA 2HP4A 2DTMH 4XCCH 4L8BB 4UDTA 4NNYB 3R8QA 3S97C 3FQXB 4Z0BH 4M7LH 2OJEB 3QO0B 4AG4H 5JDSA 4QKXB 1T21A 4PJAE 4LCCC 5SWSA 3T65B 1T7WA 3L7FA 5F1OB 4MWFB 1CD8A 1IT9H 4M62L 4QRQB 3WUWB 1LP9B 4WIQA 3RL2A 1MCDA 4H0GA 5I1LA 3RA7L 1CGTA 3MNZB 1RIVL 3DXAE 4PRHB 5I1JL 3DUUB 3OB0H 3O3EB 3SO3C 3BKCL 5MP6L 1KCVH 2V9TA 4B7LA 3MMEB 1K85A 4I0PA 3PV7A 4CN4A 2M2DA 4GW5B 5A2JH 2H3NB 4HZLA 3AS1A 3TIDA 4XX1E 5L2KB 4G6AC 3HI1B 3QPXH 4XT1C 1XGUA 3PL6A 7FABH 5C7XH 4MNHA 5KS9E 1WBXA 5AWNL 1SJEA 2Q8BH 2BMKA 1ORQB 1UWEH 3MZGB 3EO1A 5C08A 4TN9A 4Y89A 4UNVA 2UYLB 5BV7B 3D69B 1U8JB 1RZKH 1YMMB 1MNUL 3RJDA 2DAVA 2HFGL 5F96L 3QIUC 3BEVA 3D1MC 4N0FB 3VXSB 3MLRH 1JN6A 1XZ0B 2XZQL 5F6IC 3L5XH 1DEDA 4LVOC 1M05B 4S0TD 5CJXC 1E6OH 5CEYB 5D5MF 1RJCA 2CIKB 2IMMA 4U1KB 1YMHA 5IT2L 4PJGB 1P6FA 3GSQB 2Q86A 2MKWA 1D9KC 5GGRB 1P1ZA 1CDIA 4BKLA 4G9DB 3ISWA 2OS7A 4ZAKA 4OIIH 3QULA 1S7QB 3LN9A 1WC7B 4HLZH 1ZGLM 4OD3L 1T03H 1N0LA 1FZKB 1YY8B 1YMHB 3G5ZA 4C56B 1GH7A 1JPFA 2VWEE 2W0FA 4HG4K 4KVCH 3BYTA 4JRXD 5TPWL 4X7FC 1G7QA 1WVZA 1WEJL 4G8FA 1A2YB 1DBMH 4OUUA 4HXAL 4JPVL 3V8CA 2IAMA 2MNUA 3AREB 1QSVA 5E6IB 5E95B 1K4CB 2X10A 3N1MC 4PJ8B 4HKBA 2EKSA 1CIUA 5C08B 4P23D 3G5VB 3IDIB 2BCKA 5D6CB 4G7YH 4D94A 2Y6SD 4FFZH 3SDCB 2IH3B 4GFTB 5BO1H 5FO7B 4K7FA 2B1AH 4NFDA 3ZL4L 4D9LL 4HBQA 4AZ8A 4LRNL 2ZOKB 5EUOF 2CUHA 4BQ8A 3PNWB 3NIDE 1A9BA 3HZMB 3Q6GL 2WK2A 4HMCA 3V7AE 5HHOA 3DVFA 4OLZH 2BC4A 4U31A 1AI1H 5DURD 2J8UF 3C09B 4F37K 4XCYA 1CL7I 2PW1B 4FABL 1DBAL 1OGAB 2VLRD 3X11B 1MJ8L 3HFML 1AC6A 3U4BL 4EN3C 4G8GB 3QZWA 4GG8B 4W70A 5IVZB 4G8IA 2Z31D 5IIEA 4Y7MA 4XCYB 1FN4B 4PRBA 3JVGC 1O7SA 2YZ1A 4C4KO 4M7JH 4ZPTB 5D7SL 1B3JA 3FT4A 4UI2A 4LSPH 4X9IA 1F2XK 4KC3B 4WEUD 1Q0YL 2A9NL 5L2JB 1S7VB 1Q9WB 2YD5A 4HGWA 2GYSA 3SGKC 4GKOA 2R56H 1ZE3C 4WW2A 4DTGL 5C86A 2R0ZH 3FT3B 2Q1EA 3O3DA 4KGJA 5HYJA 4NN7B 3P0GB 1KIPA 4LKCB 2GCYB 5ANMA 2D9CA 2A2QT 5HPMA 1X5FA 5KSVB 1JVKA 4FQPA 2PTUA 2OBGA 4AIXA 1F6LL 1M05A 2PW2B 2BXZA 2DTSA 3T2NH 3WS6A 3IYLW 4IRJC 3NH7H 5D7JC 4F57H 4MXVF 2VE6A 2Z93A 3B3IB 1LP9F 5E8PA 5IHBA 4RMSA 5AZEL 4K94C 5DR5H 3BT2L 3EBAA 3FAXA 3A6OA 3A6BL 4FQ2H 1URLA 1Q8MA 4D0CA 4B0MM 4N0RA 4AH2B 4OFIA 3SGDI 3LB6C 4YWGL 5J8OA 4YHOL 2AXFA 2NTFB 1MFDL 5K9QI 1AGDA 3BZFA 3MR9A 3DGGA 1CR9H 8FABA 5KVFL 2W9LA 4ONGL 4E41D 3ZKQD 2C9AA 4K8RC 4PG9B 2E6PA 2A74B 3BP6B 1QACA 2YSSA 5KSVA 4LFHD 4PJXA 4LLYA 4KH2A 5FHAL 3LQZA 5F44A 3TNMB 4OCWL 2P5EB 4YHMH 5TQ0H 3MOBH 5F8QC 3V4PH 5TF0A 1FG2B 1RV6X 4YHPB 3FT2B 4I13B 3PWPB 4BYHA 3C5SA 5JXEA 4M48L 2FDBP 1HCVA 1P69B 1EAPB 5I1CL 1S7TA 1T80A 3GJEB 3T0EC 1T89A 4OZHF 3NCJL 5FUOL 4I9WD 1SYVB 2A9ML 3BKCH 3H2WA 4Z7UA 3B8YA 5HHXH 2EE6A 3CXDH 3BD4A 3FO0H 1I1AB 2VDOL 2DKUA 2IBZY 2VDKH 2Y06L 3SY0A 3G9AB 5DJZB 2WQRA 4U1JB 3CDFA 4K8RL 2CK2A 3KLDA 3NAAH 4IMKA 5CWSB 1MFAL 4K3HA 1A2YA 4GS7B 5L8JB 4HV8B 3O2WH 4B5EA 1JCKA 1BVLB 5E9DD 4I4WA 1LEKA 1JHKH 4OD2A 4CVWA 3BO8B 4UQ3A 2P48B 2ZPKL 1JZ8A 5I1IL 3JV4A 3MRMB 1NLDL 5EPMA 1AI1L 5HBBA 4LIQL 3ME0A 3I02A 2ZKHL 4TSCH 4KJPC 2C3VB 1HSBB 3VXRE 3IAGC 2Z91A 4OLWL 3DTXB 4OGYL 2D0HA 4L3CB 4P2OA 1NANI 2CRYA 3N85L 2HLFC 3QUZC 2XNAB 3QAZB 5HDLA 5M7QA 2HMIC 4H8WH 5J89A 2MJWA 3T4AB 5C0NC 3AY4A 5T5FL 3LQAL 3KS0J 4LPTA 2HTKD 3D85B 5ACZB 3IVKB 5E8DL 4K3EH 5DD1L 4KI5D 2XFXB 5C0EA 1A7QH 3PQYB 1MSPA 5TH2B 2VDKL 1YNKL 3L95A 4D0BA 3BGMB 3TH2T 5HHXL 3HPLB 3DSNA 4PB9H 4Z7UF 4GQ9L 3ARFB 5HXMA 2P42B 5IIEB 2RR3A 2QSTA 2GK0B 4HJ0D 5LAXA 4PJBE 1YY8A 3IRZA 4HH9B 4JO2H 1G7JB 3CFBB 1HHJA 3QIBC 3OJDB 3DV4B 5MERB 2W0FB 4K3GA 2ADIB 4IIQB 3G5YB 4FXKA 3FJTA 4HT1L 3HNSH 1QBLL 4QHUB 4BZ1H 2DIAA 4DKFL 3ESUF 3M1BA 3EO9H 4OUUB 5HVWA 2ZPKH 2VLKD 1B88A 1F2QA 3DVNA 3EOAB 2B0SH 3ZDXF 1T7XA 15C8L 2X4RB 2J6EL 2AXHA 1JGVH 4QF1B 1RZJC 2A6KB 3O11B 2ADGA 2FBJH 2NW2B 3PXHA 2K7QA 4EZMA 3DNKA 1ORSA 4WTXA 1GGCH 5T3XD 1LEGB 4CUCA 1JF6A 1NBYB 1PKQE 2QLVB 3KPRE 4G42A 3RWEB 3TV3H 3FB7B 1FJ1B 1D5MB 2A0LC 4OD1L 1E28B 5IOPA 1TTGA 1FGVH 2JCCB 4OM0L 1TITA 1RIHH 1NL0L 5E8EB 2D7QA 1R5WB 1UEMA 3JWNC 3P9MB 4PGCB 1M6OB 4F7EB 3PWLA 5ALBH 1X4XA 4JQVA 5IEHA 2OP4H 1DQLL 4ELMB 1D9KB 1DE4A 2J8OA 1OTUC 3AVEA 1HZHL 5E9DE 4L5FL 1RZ8B 4M7LT 3ABZA 2YD2A 4BK5A 2J4WH 3KS0H 4GG6E 4PRHD 1W72L 3T3PF 3JTSB 2CIIB 4QCIB 1XGTA 4ONOA 5C2UB 5D1QB 1OW0A 1D5ZB 2APFA 1ROWA 4UDUA 1UXWA 4PJ9B 3AXLB 3MV7D 2K1MA 1CGUA 4M1DH 1FHGA 2AK4E 3RVTC 4HX1B 5GRWA 1JGVL 1XCQA 3RGVB 4PJ8C 2Z31C 3MRCB 3IJHB 3NFSH 1QYGH 3QFDB 2H41A 5BRZE 3UTOA 4OCYH 4WEBL 4YGAB 2PXYD 3QCTL 2FECL 4L4TE 1PYWA 1OAKL 4WCYH 3CLEH 1B0GB 3HNVH 1HYRC 3LEYL 2BZDA 4UDTB 1NGYB 1KN2H 4OCRL 4Q9QH 1JWMA 4OLVH 4K9EH 3T1WA 4WY7H 1NC4D 1C8PA 1SYSA 5DJ6A 1EEUA 4U6VL 2VZ1A 1REIA 2WIIA 3MRDA 2BNRE 4AIZB 5GGVH 5DD0L 3C60C 3GM8A 1YC8A 5J11B 3VFGH 1UZ6F 5F88A 4F33B 1FZOA 4J4PD 3CIQA 3DUUA 2MCPH 2V7HB 5EUOA 3K4AA 2F53B 5LG1A 1K8DA 5I1AA 1ZLWH 1CXHA 5AZ2H 1CU4H 2BSTB 3PP4H 4XPBH 5B21A 4JFDD 3E6FA 4PD4J 2EIEA 4RNRA 5C0AE 4X98A 4X0KA 1GIGH 5E8OA 5AAMA 2KBGA 4YFLF 3HG1D 3UPAA 1EUUA 1LE5B 2WWKO 2KDGA 1NMBH 5KSUA 4HKJB 4P5TB 1J1XH 4KJPD 1KJVA 4KXZI 3P73B 4LVHB 1WZ1L 5A2KH 3FQWB 3SCMB 4L4TA 5ID1A 1IGCL 4DCQA 2CH8A 3HG1E 5I1KH 4MCZB 3FCTB 3BUYB 3AC0A 3UMTA 3EJJX 1INDH 3SJVA 3MLYH 1KPVB 2DYPB 5BXFB 3ZDZE 3D25A 4PJHB 5HGHA 2EDRA 2BVQB 3X3GL 4M7KH 5DQDL 1UC6A 1YPZB 3OGCB 1II4E 1GRWA 2Q8BL 1AKJA 5AWNH 1NJ9B 1ZWIA 2VITB 3B9VA 4NCDA 4JRXE 2ADIA 3WJJC 1OWWA 2VISA 1QOKA 3W11D 2HJKA 1MHHB 3IDXL 1I9RH 3QDJD 4HPYL 2JB5L 4C56E 3RVXC 2GK0A 3HMWL 5HY9A 4HS3A 4OCWH 1BVLA 4Z0XB 2DD8H 1TVHA 2VQ1B 1FZMB 1X9QA 3GMPB 2BNUA 2X7LA 3BYYA 4MVBD 1G9ML 3RZWA 1ZANH 2VNCA 5EU6E 5T1LD 3LKQA 1B2WL 4QT5B 2EEDA 3O2VL 5BRZD 3PGDA 4ZPVA 1DLHB 4IRSC 4PYGA 3WIFA 1OQOA 4MA8L 3RY4A 1FV1A 3MRPA 5EBWB 5LGJA 1YMME 1JHLL 3QIWA 5HPMB 4RMVA 4HUVA 3JWDH 5GS1B 5JW3H 3HAEA 3K7UA 5I15H 3IF1B 5C6PB 2CRMA 5SWZB 3FT3A 3MPCA 3RFZC 1AXTH 1RIVH 2P5WA 2VDMH 5EOCH 4WWKC 1ETZB 3TO4D 3QI9D 5TE6L 1NGPL 4PRIA 3CFEA 2R0WL 2IF7A 5C0ND 1OARL 5IR1B 1MJ8H 1CLOH 3HFMH 2N4IA 4ZXBB 2DB8A 2I9TA 4RAVB 3AB0B 1X4YA 4JVPA 1X7QA 5L0QC 1A14H 4G8IB 3V52H 4G6ML 4F9PC 3L1OH 4JM4L 3BSZL 4LMQI 2I26N 3WYRA 4PJ5E 3DXAB 3RU8L 1YEFL 1BF2A 3REVA 1JK8B 3MV8B 1U9KA 4XP1L 4KK5C 2DQUH 1T89C 3GI9H 3CGTA 4UAOB 5JIKA 3VG9B 1X44A 4ZUVA 4IRJD 4LQFH 4MB3A 3KYMA 4NIKB 4JO3H 2B0SL 2EDWA 1LO4L 4WUKH 4EDXB 3VH8G 5FYJL 5B3NA 5D7LE 3VFWA 5DJYA 1YY9D 4BZ2L 3E6HA 3GO1L 4PJCA 3FFDA 1OTSC 4Q6IC 3SGJA 2DLHA 3CZFB 1RI8A 5IG7B 5SWQA 1N3NB 2YRZA 1CBVL 1QSEA 1HDMB 3PWPA 4LAJH 3S3PA 2UVEA 3VI4E 2VDRH 3H42L 2D03L 3QEQD 3VD3A 5D70H 1LMKA 1TCRB 2ITCB 4QXUH 3WO4C 3QEHA 3OAUH 1CWVA 2GT9A 5T3ZH 4YXLH 4D0CB 3K2UH 4HXBH 4JO1L 5ICXB 2Y07H 1OT1A 2WNGA 1ZSDA 1BGXL 2A77L 1I8MA 2KH2B 4PJ5D 4LGPB 5HHQA 3FQTB 5E2VH 1INDL 3FAWA 4ELME 5I1GH 2R1XA 4V2CB 5ELIA 4N0UE 3S5LA 3DBXA 1I7TB 1SM3L 3QUYD 4HKJA 5IBTH 5BMFH 3B2UC 3QWOB 3NCYS 5D71L 3MA7B 4ISVA 4M1CC 5ESVB 2ZKHH 4TSCL 5E2TH 5CBAB 5F7KC 4YEFA 1N7MH 4MNQD 3EDEA 4WCYL 1NLBL 5DVOA 1INEH 1WBZA 4PJCE 5DT1L 1LDSA 2XKUA 1A7OL 2YSSB 4JHAH 3P73A 2VZVA 4PJDA 3FO9A 1R3KA 3LS5H 5I71B 5DJ8B 3PWPE 3D2UB 5IEKA 3FQWA 1I75A 4JPWH 3JV6A 3B9KA 3PWUB 4Q6YA 6FABL 5KJRH 1DQML 2IQ9H 4JO1H 1FNEA 3CMOH 5HVHB 1G7HA 3WHXA 4PD4K 1KLFA 4Q9RL 5D72L 4XC1H 1TTUA 2FEEL 2ZUXA 1MJJA 1UACH 4P2QD 2OZ4L 2QSQA 4NFCA 4H1LB 1EMTL 1XF4A 5KSBF 3DI3B 4NQVB 5ADOL 1UA6H 1SM3H 4JR9H 3LMJL 3K8KA 3X11A 2D0FA 2IANB 5C0IB 2EEAA 5JOEA 5CJQL 3MO1B 2GITB 4G6KL 1CFQA 5J11C 3RL1B 3AAZB 2HLAA 3OKDA 4KJWC 5AG8A 4FFYH 1CXKA 2V7NA 4XB8A 5FHAH 1OM3H 1TLKA 3ZE1E 3EKCA 4OGXH 1KN4H 5DTFA 5CEXB 3VXPB 3CD4A 1C5DB 2FHFA 1QNZL 5DT1H 2G5RA 4NZTH 3OKDB 4KQ4H 5CFHA 4RX4A 4DQOH 1UH3A 3QCUL 4IMLA 5ITFA 1EJOH 5EU5A 1RUAH 1MWAH 1VERA 3LQMA 4ELMF 3MYJB 1JWSB 5JOFB 2B4CC 4RX4D 3QISA 5C0AB 3BE1L 1UB5B 5K9JH 3UTSD 5FYKH 4YGVA 3HRZB 3ARDA 1MJJB 5FDWA 1JYNA 4B53A 1V3KA 3C8HA 1A21A 2VB5A 5B4MD 4NHUB 1UJ3B 4FQJL 1BQLH 4YAQB 5EORL 4UUJB 3UZQA 4TOYL 3PWJA 1HHHA 4L8CA 1DANU 3GMOB 4R3SA 3DARA 5D2NB 5FUCC 3ZTNL 4R8WH 1N5AB 2IPUK 3D5OF 3EJZD 2A0LD 1D9KA 3LD8C 4RDQF 5AD0A 3ARSA 4QF1A 4QHUA 1MCLA 5FYKU 4G3YL 1U3HA 3F6LA 3ARBD 3X3GH 5CEZE 3OPZH 4J3SA 1V7NH 1AXIB 4YDJA 3THML 2W92A 5ESVA 4X8JA 4WUUD 4LCWD 2KZ1B 1UB6A 3LN5A 3O6FC 4TULH 2Q7YB 3CVHA 3NFSL 1IAOA 2UYLA 5IBLC 3VXOB 5GZND 3U83A 3WFBL 5J06A 4GRMA 3VRLF 3DRTB 5D1ZA 1P5VA 3QI9A 1ZA3B 4XMPH 3DHJA 2A6JA 1FRGL 1FGNL 4PP2A 5HPOA 1VACA 5E4EC 4M9PA 5SWSE 4X6CA 1I3RA 2AJVH 1NCAL 5A1AA 2HFFA 1R3LA 2UZXB 5M94B 3IT8D 2CDGB 5IB1B 2ZUTA 1KSRA 3DX7B 3M07A 4MVBC 4PJHE 4HV8A 4L4VE 1NLBH 3EDKA 4PJEE 1CDCA 1N26A 3LPWA 4X7TA 5IHLB 2LAAA 5I19H 4HUKB 2NR6C 3MJ9H 5EPMB 1G0XA 1U41A 3CJJA 4YIQA 5C0DA 5T1LA 4FHBD 3V6FA 1NFKA 2E8ZA 3CCHA 4HZAA 5FYKD 4JO3L 2NXZB 2DLTA 4CU8A 4N1EA 5CIPA 3THMH 5EBLB 3HHRB 2BSSA 1PG7W 2FSEA 3V2AR 2VN7A 1GC1L 4LGRB 4I1NB 1I9JL 3SQBA 5FO8A 3JTTA 2PO6B 4XMKH 4XTRD 5ACZA 5JPNB 5A2LH 1F3JA 2NY4B 1BVKA 4AEHH 2IPUG 3KPSB 2I5YH 4FRWA 3KXFE 1F42A 1KB9K 4X6BA 4PFEA 1T04A 4OLEA 3ULUL 5F7NC 3BWAB 4DUVA 3LN4B 3CX5K 5DHVH 4GLRH 4HH8A 3HZYA 2YWZA 2E3VA 3Q2CA 4PJ7B 5HI5D 4JFOB 4MNGA 5D5MB 3OBAA 5KG9A 5J9PB 3ARPA 4YPGA 3B9KB 5GRZA 3OXRB 4RDQG 3GBMH 1IBGL 4WFFE 2D7TH 4X6EA 4BFEA 2E8YA 3BO8A 1EO8L 5DK0A 5C09D 2D03H 3OJVC 1ES0A 1RUPL 2FB4H 1C1EH 4PGBA 3IDJA 1PVHA 2H9GA 2VLKE 2X6MA 2FGWH 3KXFB 4NO5B 4LDOB 2LV4A 4LK4A 5MEND 1UM4L 1VADB 4MXQC 2FX7H 4IRZL 1YEDB 5GS2D 1R0AL 4APQA 5CHNA 2GAZB 5HHVH 4N0YH 1YY9C 1ND0A 3QQ3B 2FBOJ 1CGXA 1XIWB 4BUHA 4XNUL 2VR4A 1IGTB 2AK4B 2XZAL 3VWJA 4DKDC 4U0QB 4FFYL 2VDNL 4Y19A 1D5XB 2MCPL 1PZ5A 2LU3A 1P7KA 2NX5D 4UT9H 1KNOA 2IGFL 5H37G 5CILH 1GVIA 1YYLH 2NCMA 3ZT7A 5FUCE 4EI6A 3P11L 5ID1B 3TO4B 3RPIB 4R7DB 2Q87A 5I2IB 1R3IL 3EO0A 4G80A 2EKJA 4JCLA 4GRLD 3QRFM 5EWIL 4L1DA 3MFFA 5DK0B 1VEPA 4S1SH 4U6HA 1BHGA 3A6CL 2D7TL 4WWKB 1MFEH 5L9DL 5C09A 2IQAB 4GRWF 4D3CH 5IFJA 4GBXA 2DF3A 2AABL 3QUMB 1UYWH 1NKRA 5B4MC 3TZVB 1EERB 5GJSH 2VE6B 4A6YH 3FL7A 1FFPB 2BHYA 4GOSA 4QRRA 2HJFA 3W39A 1S7XA 1GSMA 1TXKA 3UEZA 5DJDB 2D4DA 2NNAA 5FOJA 4OZIE 3QQNA 3IKCA 2PETA 4X5XB 1O7VA 1RVFH 3HE7B 2DMCA 3DROA 3VWJC 2I27N 4ODSH 3W9DB 3LEXA 5DZOA 1FNSH 4D0DA 1AGEB 4JZJB 1L7IH 4Y5XC 4HS6A 2MFNA 5GSRB 4BH8B 4WWKD 4L3EA 1NCCH 1KCLA 4ZTPH 5BVPL 2WBKA 1BM3H 1FORH 1CS6A 1SJVA 5DEFA 5SX4I 4LGSB 3O6FA 4EDXA 5K33A 5D2NE 2EDLA 1MAML 4NNXB 3FTGA 1OB1B 2AEIT 3SDAA 3BESR 3OWEA 3E6HB 3MREA 4M7KL 4HS6B 1P9MC 1XF2A 3WXVL 1L0QA 2XYCA 5IEHB 1XGPA 3HZVA 5D6DC 1BPVA 1ZHKB 1EXUB 4GXVL 1HH6B 5JNYB 5DD0H 1KIRA 5E4IA 4JLRA 2XG5A 1VESA 4KHXH 4NBZB 5KW9H 5F7MC 4FP8H 1DL7L 5TF1H 3ZDZF 1GAFL 2APVA 3QDJE 5EIVA 3E2HC 4A6YL 3QJFB 3AXLA 1KB5L 5FGSA 4KK8C 3DMMB 1OQXA 4I5BB 3RIAF 4XPTL 2J2ZA 4F8QA 3S36H 3PHOB 3MLSL 2NY2B 3MOAH 4IMKC 3MJ7B 1YN6B 1EV2E 5D9SB 3QJFA 1XF3A 1GZQA 1YEEL 4U33A 5HSFA 4ELKA 3IFOB 4H8WL 4D9QD 5IMLB 5DO2D 1A4JB 1U92B 4OD1H 4UU9A 3FONB 5HHPB 1UB6B 1C5CL 4YHKL 3ULVE 1U6AL 4Y5YA 2EC8A 1NAMH 4U1IB 1NDMB 1XF2B 2R69H 1U8IB 3KR3L 1GC1H 4OSUH 3NPSB 1NEZB 2ICWJ 1UXSB 3MZTA 1U3HD 1AY1H 5FO7A 2I07A 1S7QA 5CEYA 1DUZA 2C26A 4ALAH 4OI8A 1N2RB 4XP4L 3BUYA 2YZ8A 1NGWA 3GSQA 5I1DB 3OG4B 4FS0A 2BVUA 2FWOB 1QLEH 1JF1B 2DIBA 3D6GA 1BJMA 4KI5C 5T1MB 4Z7UE 3F12A 1FL6A 3QEGH 4JVUA 2YK1H 2YD8A 2VLJE 2GSIB 4OIBA 5D1XC 4ZFOA 4LSSL 2UZYB 4I2XA 2EDQA 1NBZA 1EO8H 3KYAA 5A2IH 3STZA 3CH8A 3PWNB 3RWDA 3BP4B 3ARVA 5SWZE 4MXQD 5CIPH 3R8BB 4M6ML 2V2TA 3BKJH 1FC2D 1P2CB 2N7AA 3EYSL 4LLQB 4XBGA 4KVNL 2OXHA 5BW7A 2VLMD 3TWCL 6CGTA 3OAZH 4KJYB 1NGZA 3L6FB 4MJ6A 4YHLH 2IG2L 3QSKB 3B6SB 5DTFB 1JGEB 4NQEE 2NR6D 5HGAA 3VXRA 4MCYB 4P5KA 4K3JH 2XZCL 5JPNA 4Q7DA 1BOYA 5E08L 2CSPA 5DUPL 4LEOB 2RHEA 5DXWA 3FQNB 1P7KB 1WJ3A 5L8LB 1YJDL 3K0WA 1JWSA 4AJ0A 3SKUD 3EYQD 3FZUC 3HUJE 1AIFB 3KYOB 3U46A 5D71H 5D5MA 3FQXA 1A4KB 3H6JA 4CVZA 3SQOH 2R39A 1TZIB 2E7HA 4FFVD 4CU7A 4BQ6A 2BERA 4Q9RH 5E2VL 5FM5M 5CSZB 1ZT4B 4I2XE 1OAUH 2L4OA 4RMQA 5HHMD 5GPRA 4JM2B 1FC1A 5DQJB 4A6YB 1JP5A 1JHTB 4KK6D 4P46C 4XVSL 4R8WL 4GMTL 3QEQB 5K59E 3RI5K 4XTRC 4XPHH 5C0GA 3PGCB 2H32H 1EJ6A 2Z4QB 4OF6A 2XZZA 3NMEA 1QBML 3P11H 1OAKH 1NCDL 4JKPH 3BZFB 5E56A 3VFRB 4XPAH 5CILL 1LE9A 5F7UA 3HE7A 3FB7A 3NPSC 4W6YB 2Q3AA 1FSKB 3I3BA 5C0GB 5HI5C 4KFZC 3OHXA 4KI5F 5AEAA 3L3JB 1ONQB 3B9DA 4X8JB 4MQXC 2F53D 2HTKC 2LFGA 5EZIL 2LU7A 4OBSA 1DLFH 1A7RL 4JQXC 1RUQH 4MB4A 3C6SB 4X4MA 2RQ8A 3RPKA 2IPKA 2UWEA 5JLZA 1I8KA 3LMJH 3A6BH 4FQ2L 3VXMB 4PB9L 3SE9L 2NZIA 4F2MB 3N85H 4L8CB 3ULUD 4CKVX 1ACYL 1EBPA 3LRGA 4NQDD 4AH2A 3QQ4B 4I2XB 4XP5H 4R4FL 1FG9C 4MJIB 4HWZB 2RCSL 1ZSDB 2ZZUT 2CJUL 3RTQB 3LHPL 4MA7L 4JREC 2XQYK 4YDJB 2LU4A 3LQZB 4GMSL 3WNLA 4ZAKC 3UJJL 4WVRA 2DLEA 1RMFH 3FMGH 4U1IA 4XMLH 5DO2C 5IB2A 3ULVF 4PG9A 1U3ZA 4GXUM 5HGBA 4KJYA 4Y4FD 2VC2L 3VXSA 1TETH 1NAMB 1U92A 4KKBD 4ODSL 2VXUL 4XBPB 1BP3B 1XGQB 2W9EL 1CG9B 3EYVA 3GKWL 4P2OB 1EFXD 3O2DH 2VDLL 2QSCL 1N2RA 5FGBA 4RFEA 2CXGA 2DS4A 1NDMA 1HDMA 2WWMC 3MRRB 4FMKA 3F5WB 2C3HA 4G43A 4NWUH 4LCCB 5IJVB 1BF8A 1H3UA 4WI9A 2X4UB 4Y16A 4HKXB 4QY8A 5B8CA 1FZJA 2A38A 3QEHB 1CFVH 3OKNA 2EYRB 1VENA 2DBJA 3VI3F 5CGYC 3OKOA 4G7VH 1HH9A 5CSGA 3MMEA 3NFPA 4LPVA 3S35X 4QNPF 4P49A 2BHUA 4CBPA 3F6IA 2ORBH 4P2RD 2G2RA 4FMFA 2HFEB 3OX8B 3U36A 2AERT 3C08H 5I76B 4UQ3B 1AP2B 1AGBB 4MJ5A 3IDUA 1INQB 3X17A 1P7QA 3RX7A 3TJEL