2EXWC

Crystal structure of a ecclc-fab complex in the absence of bound ions
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Ion-binding properties of the ClC chloride selectivity filter.
pubmed doi rcsb
source organism Escherichia coli
total genus 34
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2exwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2exwC01
1OAQH 4L9DA 4KFZC 1DUYB 1R5IB 2H6PB 5MERB 3DRTA 1HOCA 1JPFA 1ZGLA 3O6FA 2HT2D 2XI9A 4GS7B 4LLVA 1AR1C 4F8TA 4QWWC 1DFBH 5CJOH 1MELA 2Z35A 3BP7A 3HI6H 4APQA 2JTDA 4UNVA 3MRMB 4JRXD 4YGVA 3TP4A 3B9KB 1X4ZA 4HUKB 4GXVH 4X6EB 3C60B 2A6KB 1YNTB 5AAMA 3BRGC 5EPMA 3QUZB 1A2YA 2X89D 2AP2A 3O2WH 2BNQA 4EJ1C 2VUYA 3S98A 4HS6A 2P46B 2B5IC 1DE4A 3D5OF 4ZPVB 2AVGA 2ZNWA 3D2UB 4XWOD 4IOIA 4IJ3B 1ZOXA 5SWSE 2LABA 4IEFB 4YXHL 5I16B 4R0LA 4W6WB 1P7HL 5D8JL 3U4BH 4RFOH 1VKXA 4JM2D 2EDQA 1ZANL 3MRDB 4YLQT 5I74C 3RZCA 5DJXB 4NNPH 3VU2A 5I6XC 1MVUB 2CSPA 3RPIB 4U1NA 2NY2C 1GZQA 2Y36H 3DUHA 4GFTB 5GGSA 1U3ZA 5C2UB 3QUXB 4NQVB 3VD5A 2NY4B 4LSPH 2CQVA 3LEYH 3BW9B 3PWLA 4QXUH 3NVQA 3W5MA 2PYED 3MCG1 1FO0L 1S7VA 4WTXA 5LWYH 3P30L 1F00I 2X4QB 3QDGE 4H20H 4YXKL 3CSYA 2GW5A 4JPWL 1U8HB 1UJTA 1BQHG 3IDMA 4JQIH 5ICZB 2G5RA 3KPRE 4HIEA 1VB9A 3UJTH 1N0XH 1BEYL 4KV5E 3RDTB 1G7LB 5AWNL 4M6OL 2NXYD 3FQNB 1SVCP 4M7KH 2NXZB 4OT1L 5DDHA 4PJIE 2EE9A 1QA9B 4I2XB 4MJ5B 2YUVA 3MMEA 5EH1A 5HGGS 1NGZB 5A16A 3HC4H 4ZUWA 1KIQA 4PGBA 4OZIE 5DFTA 3IJHB 1A7QH 4Q6IA 1BIIB 3ETBF 2R0LH 4S1DC 1WWAX 2GHWB 3C5ZB 4PJ8D 1W0YT 3EW3B 1J05B 1FNLA 1KACB 1CGTA 5INDB 3WMSA 3AS0A 5EUOF 5BOZG 2G75A 3RU8H 4UV4L 4QYOB 2QHRH 5D2LF 4OM0H 5I2IA 3EJZC 2QTEA 3SKNB 4MQ7B 2C1PA 4OCWL 2X41A 2X1WL 3UBXA 1BFTA 3QXTA 5I66B 1AGDA 4NKDA 2Z93B 4NO5B 4XRCB 3MLYL 4P48A 5B4MD 1AGBA 1G7JB 4G8GA 1HEZB 3FB8A 4TSCH 3OJDA 4OBSA 3MBEB 1FIGL 2VDLL 4M6AA 4K8RD 1EHLH 3WFBH 2DJUA 1G9ML 4YDVA 3LQAL 1JHLL 2DIJA 2LFGA 5T5NG 4AIZA 1A1MB 2R4SL 1WC7B 2GAZA 4HWBA 2NW2B 4K7FB 3AUVA 5E6ZA 2P4AB 5JQHC 3TIDA 3WFHA 4PREA 1EEQA 3AVEA 1EGJH 2UWEF 3RJQB 5I0ZA 2OZ4A 3O6KH 1GHFL 1G7MA 4Y4KB 1BBDH 4JQVA 5D7KE 3S36H 5C70A 4OQTA 4ODWB 4P57A 2ARJB 2FLRT 4P23A 4JKPH 3SCMB 3GUTA 3KHQA 1X5FA 3ARFC 4P3DA 4M61B 2PETA 3S37L 4P46C 2QQKL 5DUBB 5CZVL 4JY4B 3KPLA 4OBRA 1KCRH 4LCUB 1C16A 5CWSB 4HMEA 3WNOA 3V4UL 3MNZA 1U3YA 1T0MA 3VCLA 2B4CL 2ZCLH 1NMBL 2XRAL 2WBJB 1WICA 3I50H 2VDNL 2VXUH 4MSWA 5L9DL 5DFVD 1IGYB 3H42L 4NCC2 1JZ8A 3MOAH 4H1LB 2DAVA 1HILB 1MI5B 2XOTA 5FOBB 1T7WA 4KI5F 4BSWB 1ZLUK 1MPAH 3WJLC 5MEQA 5T1LB 5IMMA 1CT8B 3QWRA 2Z8VC 2CLVB 4HF5L 5IW6B 4OGYH 4PFEA 5HHOE 2FHFA 5F9JB 3E8UL 5ITFA 1IM9A 3B5GA 4WY7H 1SJXA 1EO7A 5AG8A 1NSNH 2XV6B 4UT7L 4G8IA 3ZDZE 4N9OB 4X5XA 3ALPA 3KYKL 2ZOKA 2NY7L 1AKJD 3O4LE 2H45A 4H88L 1C5BH 3LHPL 3RIAF 5TGBA 5HGBB 3LKOA 2CDGB 1F58H 5C0CD 3P9MB 2NYYD 2BFVH 3SO5A 4XC1H 1E4XI 5GGRB 4XCEA 3IGAA 1OCWH 1PD6A 4Y19A 3RFZC 4GRLD 1T5WB 1T7ZA 4K94C 1U8QB 3GBML 4Z77B 3BYYA 4KRPC 4L3AA 1AXTH 4QGYA 2E8YA 1TZGH 4GQ9L 1SEQL 4W6YB 2Y6SD 3SO3C 4FQCH 4HC1A 5E70A 2YZ8A 1HHJB 1QLEH 2YRPA 5A43C 2VB5A 4RA0C 1LP9B 2P5ED 1IQDB 4KTYA 1KOAA 1JN6A 3BD5A 5E94B 5DJ6A 5E9DB 4JFQA 4LARH 4HAGA 2YC1B 2VR4A 1IL1B 3QHZL 5EU6D 4IRJA 1URLA 4GRWF 4AH2B 5FM5O 3KG5A 3L3DB 2I9LB 1BFOA 3TN0D 4I9WD 2AJYL 1WFOA 2OYPA 3AREB 1LO2H 1NCAH 1DP0A 4WWKB 1Y18A 2AGJH 3U6RB 5F8QC 5E6ID 3VFRB 2PO6A 4C56A 1HYSC 5KS9A 1HNGA 4R4BB 1SJHB 4N0FB 4U1GB 5I19L 3HE6D 1C08B 4HS8H 4XPGL 4KK8C 1JPTL 4EI5D 3A6OA 3GMLB 3TNNA 2ICWB 2BERA 2HT3C 3GBNH 4G6JL 3IKKA 4W4OC 5E8NA 5F9OH 4E0RB 5TQ0H 1WAAA 4NT6B 4EN3C 1AP2A 4JFXB 3SE9H 3G6AB 1T0NA 3WIIL 3FONB 2A6DB 3LIZL 2CKBH 4G3YL 1RVFL 3KLHD 3WXWL 4ZS7H 1DL7L 1XCTA 1HKFA 1MCKA 5D7LD 1B3JA 2HLFD 1KN4H 4K3DH 2WUCL 4V1DD 3VGGA 4FFZL 1D6VL 4F57H 5IHUH 5AZ2L 3MRLB 1CFTB 3M17A 1DQJB 3TYGH 4JRWA 1N7MH 4YHKH 1A6AB 1U2HA 3VXSB 5JOFA 5JQ6L 3UTTE 8FABB 3P0GB 1Q9KA 4TTGA 3TVMA 3CZFB 4HW6A 4P2RE 4U1SB 5BJTB 4HWEH 3O6LH 5T33H 3G5ZB 2OTWB 3X14A 4K23L 1PKQE 5GPRA 3S96A 1I3RB 5HDBE 1RK1B 1JPSL 4UI2A 4HS3B 1PBYA 4PRDB 5BMFH 3HR6A 7FABH 1MFAL 2V7NA 4L4TA 7CGTA 5GZND 3VD9A 2P8PB 4MAYC 3C87A 3KNBB 1D5MB 3JWOL 5D6CA 4TUKH 1RIUL 5HHPA 3L3IB 4O5LH 2B1HL 2B5IB 1F3DJ 1CDUA 2R1XB 1DQDH 4KDTA 5D72H 5ECJE 3CX5K 5C0DA 5IVXB 3RNQA 4KJWD 1NCNA 3SDDC 1H3PL 5ISZA 5K33A 4KJPC 3KR3H 1LK2B 3ULVH 5I74B 3OB0H 4HMCA 5EZJB 2Q86B 5I6XB 3G6JB 4JPVL 1FLRH 2DN7A 3GO1H 3T4YB 3OXRA 3V6OA 4BK5A 2UY6A 4XPAL 2Z8SA 4OLVL 4P5TA 4V2BA 3V0AC 2I9TA 1NCUA 5CBAB 4PRHB 1EMTL 3MC0A 1P6AB 1RIHL 2FEDD 1F4XL 4FP8L 1MCJA 2HKHH 2E9BA 4TPRL 4ZAKD 5D1QC 1FO0B 4ZD3L 4X7CC 4U6YB 1P69B 3DXAB 1LWRA 3TYFB 3NAAL 2L7UA 3W9DA 1A1NB 5HI4C 2PXYD 3BAEH 4LBEA 3BEWB 1EO8H 3U82B 3LKNA 4RWYL 4HIHB 3VFPA 4N5ED 5KZCB 1CZ8H 1WLHA 4LLYB 1YEJH 1CICC 2QKIB 4DGVH 1CR9L 1INDL 3ARTA 1I7RA 1UQSA 1Z0NA 2C9AA 1JZ2A 3SDCA 4X0KB 4MHHG 1NLBH 1P5UA 4UT9L 3R8BB 1EAPB 2FCBA 2F58H 2IAND 5B22A 3THMH 2BVQB 4GAGL 4KU1A 2XZQH 4R90H 4ZFOL 1JPGA 1RI8A 3NCMA 1LEKA 2CPCA 4EZMA 1QEWB 3F5WB 1BBJB 1IGTB 4RMVA 4X7EC 1HDMA 4HD9A 4D8PA 5IFHL 4PTUA 1BFVH 1AI1L 4EEEA 5C0GA 3WUZA 4C58B 1U95A 3DSFH 5A1AA 4N9GB 4JKWA 4QCIB 4XXCC 4MVBD 3SY0A 4F9PC 3ARDC 2VDQL 1KSRA 2OL3A 5DJDB 1R0AL 2K7QA 3BHBB 1PX4A 3UYRL 4CL7A 3FAWA 4OZHB 3W0WB 1IFHL 1OB1A 2GT9B 1FNSH 2UUDK 4NRXA 2IADB 2GJ6E 3PWVB 4S2SA 3W0WE 1KLFA 1DSFH 2YKLL 3JV5A 3WJJC 5ID0A 3WL9B 1GZPB 5T1KB 1X7QB 4NQXB 3QFJD 1JRHH 1Q9WB 2PF6A 5DD0H 1N0LA 1LHZA 3OR6B 5JUEH 5CIPH 2IAMA 1REIA 5GRYA 5F9DC 2F74A 2JJTC 3QISA 1CL7L 4DGYH 2PKDA 4OUOA 5CD5C 3VMPA 4JB9H 2P7TA 3NN8A 3Q5YA 4LNRB 5BQ7A 3QIUA 3GNML 2VZ1A 5E8OB 2XG5A 5HHNB 5E8PA 1OY3B 3JVGA 1ZWIB 5L2KA 4IHOA 3QJFB 3FFCD 3TBYA 3WNNA 1BD2B 4P46B 5JIPA 1KC5H 4LLDB 4WUUD 3RWEA 4W6XB 2KUTA 4TSBL 1CVSC 4KK6D 1M6OA 2OTPA 4NZRL 4JFEA 3MJ8B 3BYTA 2ENYA 3L3JA 4K9EC 2DQGH 3VGFA 3L3HA 4NUJA 3U0WH 2X40A 2YWZA 3NA9H 1HQ4A 3FQUB 3B6SB 1SY6H 1HSAA 4X5WA 3SKMB 4OFPA 1D5XB 1GGIH 1GC1C 4YFLF 3IDNA 1A6VH 2F9BT 4F2MA 5MENE 4Z95L 4HEPG 2D9QB 2LTQC 5GXBB 2DLGA 5E2WH 3MZTA 2A9ML 5GS0L 3D48R 2A83A 3OX8A 4F7PA 4OJFH 1Y0LA 1OGAD 4LKCB 3VFSA 1IC1A 1RURH 2X2YA 1ZMYA 3O8XD 5JIIA 1ED3B 1JF1A 1U8NA 1VFAB 5I1HH 1MQKH 1YECH 4M6NH 3PP3K 5ADPH 2XN9B 4XMPH 1TCRB 4JN1L 3NH7L 3Q6FA 1L6XA 1IC4H 1VPOH 3SO3B 3LQMA 5FO7B 5CCKL 1JNJA 3NCFB 2GUOA 3S35L 2FLBT 3JBG7 4J1UB 4ZMAT 3CZJA 5FO8B 1GGCL 3N1QC 3WKML 1LDPL 4WGVB 3SGKA 2CRZA 1JMXA 2PW2B 2VQ1B 5BZWB 3ESVF 5IBLC 4RBPK 5C7XH 4BZ1H 3D69A 1DQTA 2GFBA 2F54D 4K2UH 1I9RH 5KOMC 1FBIH 3UTZA 3NZHL 3OG6B 2FYYB 3NCJL 5FOJA 4Y5XC 5JHLL 1NEUA 4MQTB 2LU4A 3HC0A 1J87A 2EH7H 4N0CC 6FABH 1MCNA 1XGPA 1M71B 5CBEA 4ELKB 3JTSB 4UINH 3LKQB 1TQBB 1FYTD 5GJSH 3HLAA 5KS9F 4IS6A 1I1CA 2OLDA 1T2JA 4Q7DA 1KXQE 1I1YB 1L9MA 3B9DA 4XZUA 1AO7A 4PJHB 4F15B 2VDRH 4ZFZB 4OB5L 5CFHA 2LU3A 3G5VA 4EN3B 4F7TB 3MBXH 1F4HA 2J4WL 2P49B 5J11C 3ARBC 2V5MA 1FYHB 1WAAF 3HNSL 2XTJD 5J9PB 1AGFB 3HR5B 3V5DB 5C0IA 1WVZA 2J5LB 5HJ3B 2R0ZH 3UAJC 4LHUA 4EUPA 1L0YA 3GMRB 4CMHC 1QR1B 1FNFA 4HKZA 4KQ3H 2GTZA 2GSGB 1A6ZB 4HKJB 4MB4A 1W0VA 5CP7A 4OF6A 3RWCB 3WEXA 2H3NB 1CLOL 1F4YH 2HVKA 5CEZD 5BXFB 2EDHA 3R4DA 4NKQB 4JAMB 3ULUC 3EOYG 2R56L 3L3OA 1DN2A 5DJZA 3RVVD 3T0EA 4JRYB 1J8HE 4JPIA 3RTQA 1JYNA 3L7EA 5FO9B 4UNUA 3RUGE 3MV7B 5MI0C 2NQCA 4Y5VA 2A77H 3TJEH 4H8WH 1E6JL 3J8F7 3WV0A 4NRYA 5F71A 4H1LH 4MAYB 4I4WA 3U0PB 5GSVB 2IG2H 2XNAB 2IMNA 1I4FB 3V9FA 4Y1AA 3PABB 3C6LB 5AUMB 4Z7WE 5IMLA 2N7AA 3I75B 3SDDB 4MNQA 2AI0L 1KPUA 4JLRA 4PB0L 4MJ2A 4JO4L 2NX5E 2LVEA 3RY5A 3GJEB 2AJXH 5E95B 2BC4A 3FO9A 3B9KD 4JDZB 3C60D 3MRHA 2BNRA 3V5HA 3CLEH 5D7JA 1YPZE 4PRPB 2B2XH 3QUZD 5JXAL 1HCFX 4UOJA 3UPCA 3KDMA 4YEFA 2LVCA 4TNVF 3MRFA 2JB6A 4GXUM 4PLJC 4TVPH 5D1QB 5I8EA 2EECA 5C0FA 4PRPE 4P4RB 4YHNA 4KI1A 3D2UD 3EYUH 3VFMA 1CD1B 4ZNEA 3FB6A 5D2NC 4XXDA 4A6YH 5CLWA 3REVA 2W0LA 3WLBA 5IJVB 5D71H 5L8KB 3BMWA 2GITA 4YDLC 1T03L 4NQEE 3D6GA 5C71A 2ZPKH 5KJRL 1CICB 4LDLB 3TH4T 4DWHA 3VGAC 1Z5LA 1G7IB 3ZDXE 5CUSH 3QUXD 4F33A 3CH8A 5CJXA 2NY4D 1DR9A 4BFGA 1D3CA 3LDBC 2E9WA 2W1NA 2BHUA 1IQWH 3I02A 1MEXH 2EDEA 3W5NA 4ETQB 3OKMB 1DBJL 1QBLL 4LOUC 2ZSVA 4YX2H 4GAYA 3T0BA 1OP3K 1KB5L 5AYUL 2X9WA 4OKVA 1X5AA 4TYUA 2FJHB 4U2YA 3OKOB 1JYVA 4KTEL 4KRNA 3RDTD 2EXYD 2NXZD 4OZGB 5DRZB 5ADOL 1J0YA 1FVCB 5CSGA 2H26B 2VDPL 4JQXA 2DQUH 5HD8C 3IKCA 1RY7B 1PSKL 3MODL 4PY8I 3RI5F 4JDVA 1INEH 1A14H 3BIKB 4I18A 5E8EB 3X3GL 1MQ8A 1UKSA 1MREL 4OM1L 4NKIL 5FCUL 4KUZL 3KYNB 3C5ZD 4JM4L 1I8MB 1IGML 4BQCA 1FE8L 1UWGL 4R26L 5F9WC 3G9AB 4MCYA 2GKIA 2X4RB 4ZFGL 4OFKA 4H5SA 3VFOB 4MWFA 2MOVA 2ZJSL 3JTTA 1XR8B 1SJVA 4YE4L 4PD4J 5DS8B 2ZUVA 5IF0B 1N26A 3AU1B 4X4ZA 3SGDH 5B38B 2YBRB 1BF8A 1PEWA 1I9JL 1RHHB 4P5MA 2ZUXA 1IKNA 3T3PE 3FN3A 3MBED 2VL5B 4RZCB 4JRXA 4F7MB 1JRHI 1CFQA 4QRTA 2YPLE 4G6FB 1KG0B 3TA3C 1CFNA 3LS4L 2VUOA 4NM8L 2X89A 1PZ5B 2JB5L 1ZGLP 2VC2L 4ODTL 4YK4C 2OMBA 2EE2A 2Q3ZA 2MPAL 2BOBA 3DROA 2IQAB 3HUJB 5ALCL 4MNGE 4M02A 4U7MA 3MV9D 4Y4KD 1EZVY 1TENA 3ILQD 4O02L 4YXHH 3SCMD 4OV5B 2PW1B 1TZIB 4JM2A 5D8JH 2FBOJ 1KCKA 1ZANH 2W9DL 2LTQB 3HE7C 3ROOA 2R23A 3P73B 1MFBL 1G7QB 4QKXB 4WHYG 1EBAA 1NFDE 2PYEA 3QEQB 3GMOA 1FO0H 2DWDA 2WBJD 1L4IA 2KQMA 2XKSA 3C8KA 4KMTH 4YXKH 4HH9B 5GGQL 1G7HA 2BNUB 1MI5D 2EE6A 1R3KA 5FK9B 1KIUA 1T66C 3U79A 5DFWH 4B0MM 5T1LD 4AZ8A 2O5YL 2VR9A 4J4PD 1Q9LB 5EBWB 5IROA 3B3IB 4EOWL 4PY7B 1U93A 1NDGA 5DSCA 3BDYL 2XZZA 5AWNH 3VRLF 3VXMB 4X80L 4M6OH 2PNDA 3D1MC 1VACB 4HPOH 4P2QE 4OT1H 1ITCA 3OL2A 3SGJC 3X11A 1KT2B 4R0LC 3EDDA 3OKDA 3P9LA 4CVXB 1O0VA 3VXNB 4TUOB 3RZCC 5I0DA 1EVUA 1QFWI 2YXFA 4HT1L 5BS0B 1T3FA 2HT4C 1WZMA 3X3FL 3EO1B 25C8L 2JKXA 4NO2A 1KCVL 3DBXA 3DSNA 4PJ8A 1R3LA 4TVPD 3TBTB 2N56A 5EORL 4HHAA 4U1IA 4PJEE 5IW1B 4FXKB 4H26B 1EFQA 4UV4H 1ADQL 5JW4R 5C09E 5TDNA 4OCWH 5FB8B 3NBNA 3E6FA 3O0RL 4I48A 2J8UE 3EDKA 4LSTL 2DQJL 3NIFE 4PR5B 4FQQA 2CIIA 1X3DA 1QSVA 4Z7VE 3ELAT 3EYSL 3MLYH 2HMID 3ECBB 3LY6A 5E9DD 3SKOB 1A6TA 3VFNB 4Z0BL 3REWB 1FIGH 2VDLH 2VZVA 5ALBL 3ARBB 3MFFA 4HUWA 3ARED 2BVOB 4JZOB 1JHLH 4MQXD 5DGRA 4Q6IC 5FHAH 2R4SH 4WVRA 5EN2A 3ARRA 3QT2A 3SN6N 4XNMA 1WBYB 3BXNA 3WS6A 1NBYA 2EH8H 3O2DL 4PP1D 5IWLC 4RCAA 3GMNB 2VH5L 3LEXA 4CMHB 3SE8L 1GHFH 3IFPB 4NHCL 2HA1A 1A7NL 3N85L 4GBXB 4HK3N 5JLZA 2I60L 2ZUWA 2JIXB 3NPSC 5IK3A 3OR7B 1U3HC 3QHTC 4GW5A 4ZSOE 3CXDL 3S37H 1OAUL 4QHNA 4AMKL 2QQKH 5CZVH 2AEIT 5JORB 1PYWA 4XVSL 4I0PC 3V4UH 5IQ9B 1B0WA 2B4CH 3X13A 2XRAH 1RZ8B 1UVQB 2HTKD 4UIMA 2VDNH 4OCLC 3H42H 4I3RL 2NY1C 2K7PA 5DO2C 2XWBB 1G0XA 3DWTA 5GQBA 4P2YA 5HDQL 3RKDC 4RGNC 2BSTB 3VXSD 5DHXB 3S34L 3RX5A 4KQ4L 3L5IA 4HF5H 3BKJH 3E8UH 1MY7A 3ES6A 2D0GA 5K59E 2FIKA 4QWWD 2CLZB 3HTLX 4UT7H 5FDWA 5BZDB 1JGDB 3H3KA 4CADB 3MR9B 5F93C 2BY0A 1FNGB 1P4LB 3OGCA 4LCIH 2A0LD 4P23C 3OKNA 1AKJA 3QSKB 4NZUL 3VD3A 2NY7H 5DJ2B 4H88H 4Z5RA 4P9ML 3LHPH 4XAKD 4G8FB 2VMFA 1IAIL 5TFSL 2MCG1 5C0CA 3QDME 3GMQA 4WUKL 2F8OA 4U6HB 2G5BA 4PGJA 2V2WA 1SHMA 4GRLA 4ZQKB 1CDIA 3GBMH 3H7BB 4PGCB 1FZMB 1H15B 3LPWA 4H25B 5D2NB 4GQ9H 4HIXL 5I30H 4U0RC 4W81A 2IFGA 1JFQH 4ODXB 3SDXB 2W91A 5IOPA 4HJGA 4C55A 5F72S 2VSDA 1NEZB 2P5EA 4FQLL 1FAKT 3VGAB 2NY2D 1FCGA 2EDBA 4ZOEA 2WW8A 2NY3C 4HJJH 1QQDB 3SDXE 2X44D 1BX2A 1G7PA 4PRHD 4ZXBC 1LQSR 2Z8WC 1U8PA 1I8IB 5DJYA 3LDBB 1CS6A 3GB7B 4X8JA 3PF2A 3HI1A 2NPLX 3C08L 5DEZA 3TN0A 3DXAD 2AJYH 4CGTA 1NGPL 2Y25A 1BZ7B 1PEZA 3WCYA 4F8QA 1Q1JL 3MGTA 1KB5B 2BJML 5E6IA 4YHLL 3K3QA 3QA3B 4IMKA 5KZCD 5L2JA 1V5JA 3HE6A 5I19H 5LKNA 1H3XA 1RHFA 2W0FA 3IETA 1UADC 2FECL 4RNRA 4I5BB 4XPGH 1CFVL 5DJ0A 2XFXB 5GS1B 1JPTH 1V3JA 1P7QB 3U2SA 4G6JH 2AK4B 1V3MA 1BWWA 5J8OA 4RFEB 3IF1A 4U1MB 2R1WA 4GW1A 4ONFL 4S1DD 4JANB 3WIIH 3LIZH 1H3GA 4LMQE 2EIZB 4G3YH 1RVFH 4L3EB 5E1AA 1DUZB 3WXWH 1DL7H 5D7LA 3ZSSA 3SQOL 4R97C 2DI9A 4IRJC 1JGEA 1T04A 3U1SL 4V1DA 2WUCH 2EDOA 3UBXG 4FFZH 3TCLB 3EJZD 1K8IA 4OLZL 4L3EE 5AZ2H 4PLOB 1U8IA 1U91B 1JI1A 1PQZB 5SX4H 4GUPA 1T22B 3R06B 5F3HA 5DD6A 2V9RA 5FM8A 1XCQA 5DHVA 1LO4L 2D4DA 4OD1H 3I6KB 1FFOB 3VXOB 3MRQA 3KPSB 4PG2C 3FQXB 4K23H 2PTUA 3CVHL 4AENB 5H94B 1M05B 2R1YA 2DD8L 4Q9CA 2YPKA 1ITBB 1JPSH 5E2UL 3TA3B 1G0DA 1CE6A 1XGQB 4IRSA 4EDWL 4WJ5B 4WNQA 2DL9A 1MFAH 2RFXB 3PHQA 1XF5A 3WO4C 3JWOH 4YK4B 3QP3A 1MCPL 3QHFL 2B1HH 4UDTA 5DTFA 3NFSL 3SGDI 3CC5B 4LAQL 3VRIA 1EGJA 1RZKL 1NDMA 1RZKC 1TIUA 2EIEA 1ZK9A 4XC3L 5D7IA 2WBWB 2Z0BA 1LVEA 5IG7B 5C07B 1M7DA 3RWGA 1KPRA 3NA4A 2P8LB 2OP4L 4JFFE 1P2CB 2HN7A 3RVUC 4BA8A 4JPVH 1MVFA 5D5MB 1BD2D 4P46D 3HE7B 1IE5A 2YN5A 5IEKA 2X7LB 3TVMC 4XPAH 1QO3B 3NIDF 2I07A 3BH9B 4KMQA 1EMTH 3WIHA 1RIHH 2X4TA 4FP8H 4JVWA 4TPRH 4ZAKA 4LSDA 1A3QA 4TVSa 5IKCB 5DMJB 4ZD3H 2KKQA 2C26A 4LFHD 4NHUA 4XP1L 3NAAH 1INQB 2PXYA 4OCMC 5FUZL 2W92A 3HAEB 1CN4A 2IWGA 5C08E 3PUCA 3L3GB 1CR9H 1INDH 4Z76B 1WWWX 2B20A 3RHWK 2IANA 3BP4A 4UT9H 4TUJA 4GAGH 5JDSA 3H6JA 3RL1A 4HDIB 2F53B 2FR4A 3GHBL 5J1AB 3RWHA 5E2VH 2DWEA 4IMLA 1DEEA 1FQ9C 2XN9D 3TFKC 5IFHH 2W38A 1AI1H 4WI9A 5GRVK 3MA7A 3MGOB 1LO0L 4GAJL 1NGWB 2VDQH 1WCQA 5JW5A 3W9EA 4N5UA 4NQDA 1R0AH 3HA0A 3ILPB 3UTPD 3UYRH 3FQWA 3VE0A 1A1OA 3LS5L 3VXPB 4M3JA 5FV2A 3GKZA 3SJVB 4QRRB 3L6FB 2CDEB 4MD4B 2QQLL 3VGHA 1WF5A 2X1PA 3G08A 3OKLB 1JWMB 5A2JH 2YKLH 1WITA 2ED7A 4K7PL 4FFWD 1UZ6F 5B39G 4ZYKA 1U8LB 4C83A 2X5PA 3QZWA 4O51B 3WS3B 5F89A 4LVHC 4XWGL 3RX7A 3QO1A 1HYSD 4QRQA 1H5BA 1OOAA 1B90A 1S7RA 5GGUB 1CL7H 4NYLA 1VFUA 3QRFM 3CFBA 1UXWA 4HFWB 1HCVA 5IJKA 1YJDL 3E6HA 5IMKA 5I2IB 3HCVA 4KK8D 2FX9L 5IEHB 3FT3A 4WFGD 3GNMH 3U7WL 2HT3D 1H8NA 2M2DA 3KPMA 3FFCA 1U3HB 1WCBA 4EN3D 1RZIA 1D5IL 5EO9A 4WFEE 4ZTOL 5J6GA 4WUUA 3UO1L 4I0PB 2CKBA 3ZLQC 5EO1A 5KSVB 4XCNB 2IC2A 4NZRH 2VXQL 5GZOC 1N2RB 2HJLA 2NY1B 4Z6AT 5LAXB 4RGNB 3L95B 4O2FA 4XBGA 4CMMA 1RUPL 2GAZB 1XT5A 4Z7OE 2GCYA 2IAMC 1F3JA 2APBA 4NQCB 4XNZC 4LQFL 1TZHB 5IVZB 4ELMA 5ABDE 1YNKL 4L3CB 4Z95H 4JJ5B 4JRYD 1CGYA 2A9MH 2AEQL 5GS0H 3BIAX 1U92B 1XF4A 4ODVL 3QIUC 1MFEH 4X6CB 4P23B 1KEML 3IJYB 4N8VA 3HZVA 3MV7D 3JVGC 4G6ML 4PJBA 3O8XA 1BQLH 2D31A 3RBSA 4MAYD 1X6LA 4PJCA 1A4KB 3JWNC 5D6DA 2HLAB 1T1XB 1NKOA 4LSRL 5ACZA 4J3VA 2JCCA 3NH7H 3EYFA 4HGMA 2R2HB 5F1OB 2AXFA 4IDJL 4OGAC 3SDDD 3DX9A 1VDGA 4U0RB 4HULB 2JJVA 3BSZL 5CCKH 1CXLA 3S35H 1VA9A 5FYLL 4PV8A 3TBWA 5JXEA 5SWZB 2UYLB 2HJKB 1GGCH 1NANH 4KC3B 4DZBA 3WKMH 2DTML 2NY3B 1LDPH 4PJFA 5HGHB 4X9IA 5IM7B 2KDGA 5IB3B 4ZXBB 2MQCA 4U1JA 1H0DB 2F54A 4LGPB 1SBBA 1MCBA 2BOCB 5D1QD 1C7SA 3KYMA 3NZHH 3M1BA 4PTTA 1QVOA 4JHZA 4PRIB 2GK0B 2CDFA 2R2EB 5JHLH 3LKOB 3KPPB 4P9HL 4N0UE 5HYQB 1FYTA 1U41A 4LPYA 3T8XB 3S36X 1CICD 1SYVA 5A2IH 5DK3A 4MB3A 2VLJB 3C5JB 1FIEA 1FHGA 1JL8A 2OJZL 3KPNB 2XKNB 4MDJB 5EOCL 4OB5H 3BEVA 3EDJA 1FL3B 2J4WH 3V4VL 4HKXB 4UIKL 4F37F 2VLJE 1FCCA 3RWJA 2ADFL 3HNSH 4I8DA 5K9OB 2ARJQ 3E3QC 1BAFL 3SGKC 3GI9H 4MA1C 2VLKE 4R97B 3P11L 2XKUA 1QHPA 1OTSC 1MCEA 4JFZL 3ARDD 2V5YA 4PRNA 4PJAB 2G2RA 5DJ8A 1Y18B 3OF6D 5KVGL 1NMAL 1CLOH 2JK5B 3ULUH 3LKPA 4PJAE 1T20A 5HHMB 2R56H 5DEFB 3PQYB 3OJ2C 4HJ0C 4QRSB 4XNYL 2GJZA 4WENB 3IU3B 4GKNA 1SMOA 2NTFB 1AHWC 1S8DA 2EE3A 1UB6A 3ZT6A 3VXUE 5E8NB 2ZKHL 4DUXA 1E6JH 3MO1A 5SX4I 2FNBA 2R29L 2XIDA 4PLNC 5EBGA 1JPST 1QG3A 2YMXL 3HRZA 4UQ2A 3WNLA 4AYFA 4F3FB 3NTCL 4AM0A 4AIOA 1NMCC 5CIPA 2IALB 3ABZA 3QPQC 3T1WA 1DUYA 1R5IA 4PJXE 2H6PA 5MERA 3S3SA 1HXMB 5CD5D 3DYOA 5DD1L 5F7DB 3DX7B 3VD7A 2AI0H 4MAUL 2Q3AA 5EU3B 4JO4H 5D7IF 1SQ2N 2DDQL 1FP5A 1S7TA 3MRMA 3B9KA 4X6EA 1AXSB 3C60A 4G6FD 2A6KA 1YNTA 4R2GC 1QR4A 1JCKA 3TVMB 2EDLA 3QUZA 3LN5B 1WK0A 1ORQB 5EOTB 1I9EA 5JXAH 4I3GA 2AK1L 2PN5A 5FGSA 4ZPVA 1LEIB 5E8DL 3D2UA 4Y5VC 3EDFA 4M1CC 2XICA 3IJSB 1TPXC 5DVNA 1SY6A 5I16A 4YO0B 2WMPA 2PR4H 5T1MB 4JGJA 5DJXA 4PD4K 1T03H 1MVUA 1Z9SA 5KJRH 3RPIA 5F1IB 3ZYIA 3QUXA 4DQOL 1A7RL 4NQVA 4UMGA 2BHYA 3DURB 2A6JB 3BW9A 3QEQD 2ZG2A 2X4QA 1OWWA 2D7MA 5T3XH 3PHSA 1DBJH 1QBLH 4G43B 1U8HA 3OXRB 2EEAA 2UZXB 4ZOAA 2CUIA 5ICZA 1U0QA 4NFCA 1KB5H 4GMSL 2FJGB 3AM8A 5AYUH 5IB1B 4F58L 2MHAB 5JPMB 3MGAA 1NCCH 3AB0B 3RDTA 1G7LA 4KTEH 3IDGB 3FQNA 1NCTA 5DD3L 3VXMD 1MHEB 5IMOB 1QA9A 1FZOA 2D7OA 4I2XA 2VDPH 4MJ5A 1CFBA 4HMDA 1MOEA 1NGZA 2X9YA 4XHQA 4DK6A 3DO7B 4F80A 1PSKH 3MODH 3IJHA 5BS0D 3X3GH 1MREH 5IBLD 4OM1H 3I85A 5ACMA 4NKIH 5FCUH 3C5ZA 4BZ2L 2EEBA 1CXEA 3MRBB 1HZHL 4KUZH 1J05A 5CJXC 3BPCB 5ANMB 4JM4H 1IGMH 5B21A 5INDA 4Z9KB 1UWGH 1EZVX 5GGVL 5C1MB 4R26H 3IAPA 3SKNA 4N0CD 2DQFB 4LVHB 4MQ7A 5CZXC 1NAKH 4TTDC 4ZFGH 3KPQB 5ANME 1HDMB 5I66A 4Y88A 1CFSB 4YHYC 3Q5TA 2Z93A 2DQHL 4NO5A 2ZJSH 4XRCA 4PJGE 4YE4H 5TE6H 3ZE1E 3BP6B 2Y1VA 3JWDL 1OLLA 5B3JE 1QPXA 2YD7A 1G7JA 3MACH 1J12A 1HEZA 1I9JH 1JUFA 5DMGD 3PGCB 3MBEA 4NBXB 3AMKA 3R8QA 5A3IC 2FEEL 4XP5L 1F2QA 5C3LD 1ORSB 3ARBD 1GOHA 1GGYA 4URTB 2W65B 5HGDB 4PBXA 2WP3T 3LS4H 1OB1B 1A1MA 4EXPX 4NM8H 1WC7A 5T3ZL 1CL7I 2NW2A 5ESAB 4K7FA 2JB5H 2VC2H 4ODTH 3AC0A 3GSNL 3UAJD 4L5FL 2MPAH 2ZOLB 1EH9A 1DN0B 2HYMA 5ALCH 2WV3A 4Y4KA 1OT2A 1QSFB 4ODWA 3RY6C 2ARJA 4O02H 4XVJL 3SCMA 1T2QL 3BDBA 3F6LA 2JIXD 1AGEB 3FHAA 4M61A 3ULUD 1D9KB 5DUBA 4ELMF 4OFYD 3HG1B 5I76B 3UJIL 3PXJA 4JY4A 1MFBH 4LCUA 5CWSA 2DYPB 2R0WL 1E6OH 2WBJA 5HGAB 4KVCL 3AS1A 4IHOB 1IGYA 1PW3A 4POUB 5KSAC 4H1LA 4PJBF 1OM3L 1GCFA 2HKFL 1HILA 3ME0A 1MI5A 3KLAB 5GGQH 1C5DB 5FOBA 4BSWA 4L8SB 5EDXA 1KJVB 2BK8A 3HAEH 5T1LA 1RULL 4KZDL 1ZA6B 1WWBX 1CT8A 1FORL 4Y8AA 2RAMA 2CLVA 2O5YH 5IW6A 4EOWH 1RUAL 5F9JA 3DX6B 4OI7A 1F8TL 3BDYH 4X80H 2BVTA 4GG6E 4E41E 4CN6A 5EO0B 2AV1B 4PBVC 4R4FL 4DW2L 1BM3L 1MLCB 5HSFA 4KKNA 4JM2C 1E4KC 1OL0A 2DLEA 5J89A 4BH7B 5HGBA 2FJFB 4HT1H 2CDGA 1QBAA 4XMKL 3P9MA 5GRUH 5CP3H 1KYOJ 1MNUL 4PLJD 5GGRA 5FYLE 1KCVH 1U2CA 4KDVA 3OB0K 5J3HD 1T5WA 2RHEA 1U8QA 2VDKL 3DYPA 5EORH 1EDQA 5FUCC 3ZL4L 4Z77A 1TTUA 4J2XA 1WUNT 4FABL 5IQ7H 1ADQH 4GO6B 5IVNA 4HQQL 1A3LH 3O0RH 1ZHBB 1HHJA 4LSTH 2DQJH 1LP9A 2VSCA 3Q6FB 5EIIB 4DAGL 5IROC 3QI9B 4YC2C 5E94A 3EYSH 5E9DA 3IDJB 3ZE0F 4X4ME 4F7CB 2YC1A 3O3BB 1IL1A 5EZLB 4O4YL 4Z0BH 4GQPH 4AH2A 2FHCA 1J0IA 3AROA 4LLQB 2EYSB 5ALBH 3L3DA 2KPNA 2DM2A 2I9LA 5I8KL 1JWSB 2J6EL 4LOUD 5T3XD 2AEPL 3AREA 4YBLC 1TETL 4WWKA 4Y16C 4X6DB 5F21B 1HE7A 5FYKL 3D3VB 3U6RA 3ARGA 2NY6B 3VFRA 5E08L 5DVOA 4NOBA 4PJ8C 4QTHB 4R4BA 1SJHA 4XGZB 3O2DH 2A38A 2MNUA 4JR9H 4X6DE 1C08A 4P2OC 4Z8FL 2VH5H 2X4OB 4D9RE 1I1AC 4E5XB 4CVWA 4NHCH 1A7NH 3DHMA 3GMLA 5HD8D 2ICWA 5F7FA 1P7QD 2I60H 4E0RA 2AK4D 2EO9A 4NT6A 1WTGT 3CXDH 1OAUH 4IS6B 3G6AA 4AMKH 1WZKA 2BXZA 1MHPL 1E28B 2A6DA 3FONA 5F44A 4NCC1 1ZLSH 4L3ED 1AHWB 4PLKC 1X5GA 2ZNXA 1G6RB 4K8RC 2XQBL 2ZWLT 4XVTL 4I3RH 4BQ8A 4BQ6A 4LSUL 5D96C 1N5AA 1CFTA 3MRLA 1DQJA 1VADB 5HDQH 3LQZB 3RJDA 1A6AA 1ES0B 1KJ2L 5TE7L 3VXSA 5IFJB 5T5FL 3S34H 3BP5B 4KQ4H 3UXFA 4U6VL 3CZFA 2AQ1A 3QDHA 4H0GA 4U1SA 5BJTA 2EYTB 5F70A 3G5ZA 2OTWA 1ZHKB 3KPSD 3ARSA 4W70A 1T89C 1CK0L 1I3RA 4YUEL 3VFWA 1RK1A 4HS3A 3O3DB 4ODHL 4PRDA 3TA3D 4R2GB 2YD4A 4NZUH 3BRFA 4P9MH 5LGKA 4YBQC 2Z31C 1JBJA 1IAIH 5TFSH 2P8PA 4L4VB 3KNBA 1D5MA 3LD8C 4WUKH 3L3IA 1B0RB 3TC9A 3BKCL 2R1XA 1D7FA 1HHKB 4PUBL 1S7XB 2A73B 5IVXA 1TTFA 1VFOA 4WI4A 4POYA 1TPXB 5DFVC 1L0QA 3BGMB 4HIXH 5C07D 1LK2A 5EZJA 4HZAA 2Q86A 3KPOB 3DGGB 3G6JA 4OZFG 4EIZC 4FQLH 2NNAB 3LPFA 3T4YA 3HE7D 1R5VB 2G60L 5IMLB 4CU6A 4JZNB 1J11A 1GH7A 4JLRB 1F4AA 4M7JL 5CBAA 1SJEB 4PRHA 3ZHDA 4HWZB 1PZUB 1MFDL 2EDNA 3WFEL 4UILL 1FO0A 4UT6L 1TCMA 2VAJA 2BNRB 4U6YA 3C08H 3DXAA 5E5MB 3TYFA 5C92A 1NGPH 4FNLL 1A1NA 5I75B 3CDGB 1T66D 1MHHB 3BEWA 5JW4Q 1Q1JH 1H8OA 2NYYC 4KK5C 2BJMH 3OG4B 4HIHA 4X7SL 1TNNA 3O4OB 4LLYA 3EHBC 2QKIA 3I2CL 5DXWA 4UZGA 4FN0A 3T0WA 2YD6A 3L9RB 5TPWL 3WSQL 1CFVH 4X0KA 3EUUA 1EAPA 2C1OB 2BVQA 1MJUL 3D0LB 3LSOB 2F53D 1JI2A 2VQUA 4ONFH 1QSEE 2HT4D 1Z5LB 3F5WA 1BBJA 1IGTA 2BVPB 4LPTA 3ZKQD 2X4SB 3SQOH 2FZ3B 4YR6B 4N9GA 4QCIA 3I6GB 2L4OA 4M93C 3BOVA 4ZS6C 4FA8A 2J2ZA 3S5LG 5DJDA 4OLZH 3BI9X 3BHBA 4YHYB 3OKEB 4HFUL 2ESVE 4OZHA 3W0WA 4MJ6B 5E6IC 1LO4H 1EEUA 4OIIL 5E24E 3GSWA 1MCFA 2GT9A 4U0QB 4Q2ZB 3SJVD 4QRRD 3TH3T 3HE6C 2IADA 5EU7E 3DMMC 3PWVA 4FZEL 3S4SG 5C3TA 2VN4A 3K80A 5HI3C 3WL9A 1GZPA 2DD8H 1X7QA 5T1KA 2BP3A 5DD5L 3LKRB 2PUQT 3FFDB 4EDWH 4NQXA 3TWCL 1MCIA 5KANI 1Q9WA 1QLRA 3P40A 4LP5A 3OR6A 1FJ1B 3HZMB 3BVNA 1JGVL 5J13C 2ILLA 1MCPH 1BGXL 3QHFH 1X4XA 3U9PH 3NFSH 4LAQH 1RZKH 2VAAB 3OZ9L 1GPOL 5A2FA 5HHQB 4QRPE 1G84A 3RIFK 4FFVC 5DMIL 1PLGL 4UQ3B 1ZS8B 4NZJA 4XC3H 5T3ZE 3VH8G 4LNRA 4LSQL 4JHWL 5E8OA 1Q0XL 5HHNA 3GMMB 5E00A 4DEPC 1ZWIA 4MWFB 3QUYC 2OP4H 3QJFA 1U3HD 5HVFB 1L7TL 4NC0B 3MUY1 1BD2A 1AQDB 2BY1A 5BRZB 5FV1L 4Y2DC 4LLDA 4OD3L 3DECA 1UCBL 2EDJA 1RJCA 2F19H 1YN7B 4I0PD 4DUWA 1V7NL 2BSRB 1BECA 4JG0H 3MJ8A 1V3KA 5BRZE 5KSAB 1DCLA 1SEBB 4IRSC 2NY1D 5DO2D 4WV1B 4ONGL 3FQUA 3B6SA 2EDXA 4RGND 3SKMA 1D5XA 4QHLB 5FUZH 3WJLA 5EUOB 3QXVA 4NQCD 3DIFB 2BOBB 3DROB 3SE4C 3LAFA 1QNZL 2E5EA 5DQ9B 5JHDE 2JJUA 3IFLL 4KJWC 2QADB 5EUOE 1ONQB 2CO6B 1A5FL 1PAMA 2DQTL 5D2LE 4P23D 3MTRA 1TTGA 2P47B 2ZCKL 1P4IL 1GL4B 5CEYB 1K9TA 3MV11 4EBQH 3IB4A 1KELL 3GHBH 5GJTH 1VFAA 2XN9A 3RGHA 3MQIA 2JJSA 5FM5M 5C0BE 4JHBA 1TCRA 1CGSL 4LEOB 3LCYA 4JFDB 4LIQL 4FZ8H 4RGMC 4ZAKC 1FGNL 1LO0H 2AERT 4GSDL 4GAJH 2DI8A 4LGRB 5FO7A 3PDGA 1RJLB 5KSBF 3OBAA 1YMMB 3MV01 5FIEA 4J1UA 5FO8A 3LS5H 5SWZD 3PWJB 4YC2B 1LP9F 4OQTL 3CCHB 2NY3D 2UWEE 2Z92B 3FAXA 3PP4L 2PW2A 2VQ1A 4K71C 5GS2H 4ZXBD 1JYXA 1OP3H 5JOPE 1QFOA 2QQLH 3C2AL 3HC3L 2VZ3A 4JFOB 2H32B 2X05A 4K7PH 1ZT1B 4YBLB 4DZ8B 2FYYA 3OKDB 5DZNA 2GJJA 4PRID 4Y16B 5DK2B 2FX8L 4R8WL 4JO2L 5I73C 1T3FB 4PIRF 3UX9B 3V52L 2XT1B 1JV5B 1M71A 4MB5A 4ELKA 3JTSA 5EC1A 4DVBB 3LKQA 2I5YL 3EGSB 1R3LB 5DRNB 2EYRB 3V6BR 4RDQG 4P2OB 1JE6A 3IDYC 1I1AB 4HK3J 5A2LH 1I1YA 2VLJD 2FX9H 2ADGB 3QQ4B 5FYKE 4CUCA 5TDNB 4U1LB 3S97C 1TVBB 1G9EA 4PJHA 4NRZB 4ZFZA 5CILL 3VW3H 4F7TA 4KI5E 1D5IH 4PJDB 1W2KT 3SDYH 4JFHD 4ZTOH 2N4IA 5J9PA 5HYJB 3UO1H 1AGFA 1MWAB 3HR5A 3V5DA 3VG0L 2NLJB 3A6BL 2AABL 1QRNB 3OWEA 3BWAA 5HJ3A 5KTEL 2VXQH 1NGYB 1A0QL 5DEGB 3DYMA 4FQHB 4ZUVB 3QQ3B 2AJSL 5D96B 1F5WA 2NY5L 3IU4L 1QR1A 1QRNE 2IBZY 2GSGA 1A6ZA 1RUPH 4HKJA 3RWCA 4FQJL 2H3NA 2W0KA 5BXFA 2Y07H 1NL0L 1I3UA 3P77B 4LQFH 1H5BC 4JAMA 1YNKH 5HHMD 4JRYA 3DLQR 3PQYD 5F7MC 5I1AB 3TPUB 4BSVB 4NKOB 2AEQH 5EA0L 3OQ3B 4JVUA 5IJKC 1CE1L 1ZA3B 5FO9A 4ODVH 5ACLA 4WHTB 1KEMH 3MV7A 3RA7L 2YRLA 1UKTA 2H2SD 4G6MH 2Z31B 2D9CA 4MAYA 3U0PA 1AR2A 3LD8B 5GSVA 4MJIE 2FGZA 2W0PA 5I71B 3SPVB 2F5BL 1I4FA 3FO0L 3PABA 3C6LA 4P5KB 5AUMA 4GW4B 4LSRH 2A9NL 5CGYC 3I75A 4CJ0A 3SDDA 1LDSA 4GRWE 5I1GL 1OF2B 5IVXF 2XZAL 4NUGL 3MLRL 5F7LB 3G6DL 5FA4A 1MRCL 3MOBL 3GJEA 3UTSB 4YHPB 3WKNA 2OS7A 2E3VA 3QDJE 1IAII 1EPFA 4JDZA 1U6AL 4ZUSB 5FYLH 3O2VL 5JR1H 2GTWB 3G6JF 3VXRE 3TVMD 2DKUA 4PRPA 1B88A 1C5CL 2DTMH 4Y4FB 1ZVYA 4LDEB 3ZZ1A 5HYEA 1ND0B 4OQ1A 1M7IB 2BRRL 1A7OL 5D1QA 1RZFL 2HFGH 1FSKB 4P4RA 3X17A 3TGXA 3GFUA 1CD1A 4P49A 4NSKB 1F13A 4HK0B 2C3WA 1BLNB 4WHDA 1ZSDB 3WUWG 1JZ3A 1GIGL 3LV3B 5IJVA 3GSQB 4YHOL 2AKRB 3BPOC 2IMMA 1CICA 3BISA 4LCWB 1G7IA 1JVKA 4JGUA 1AC0A 2DM3A 3SOBH 5ISZD 2D7QA 3S37X 2OJZH 2JLLA 3ULVC 2X9XA 5EOCH 4ETQA 3OKMA 3F12A 4UIKH 5JXEC 1YNLL 1Z2KA 2ADFH 4MS8C 2APFA 4RMWA 5EIQA 5BV7L 3MCLL 1OSPH 3G04B 1BAFH 5D4QA 5GRZA 3TFKD 4YXLL 3RVWD 1MIEL 1HWGB 3P11H 4NJAL 2FJHA 3OKOA 2FECI 3PWNB 2APVA 4XXCA 3QCVL 5D93B 4F9PA 4M93B 5ITBL 1R3HB 4JFZH 3FQRA 2AW2A 3OF6A 4OZGA 5DRZA 3BX7C 5KVGH 5FA3B 1FVCA 2H26A 3G5YB 1NMAH 1FFQA 4Z7UB 5IB5B 4OZHF 3BIKA 5E8EA 1XZ0B 4XNYH 2DIBA 3DMMB 5F7WC 2UVFA 3BJ91 2AJZB 4RNRB 5GS2D 3WJJA 3KYNA 4JKLA 1K85A 4LLMA 3QZWG 1I8MA 5C0AB 2ZKHH 2WWKT 5FCSH 43CAB 3F7YB 1DJSA 4UDUB 5F6HJ 4NC1E 2YMXH 5J13B 2EICA 3NTCH 3STLB 4CVZB 2VO5A 4POZD 5E1AB 1HXYB 1XR8A 4Y8DC 3HPLB 5DD1H 5DS8A 5IF0A 3AU1A 5TE4L 3H9HB 5B38A 2YBRA 1RHHA 4MAUH 5BVPL 1UA6L 2VZTA 1U8IB 4RZCA 2DDQH 2VL5A 1I3VA 4F7MA 2D4FA 3QUYB 1UM4L 3FQTB 1QBBA 1KG0A 2YOCA 2R39A 4DKFL 4Y2DB 3VFGL 2NZ9C 5MEOB 4KUCD 1F90L 1PZ5A 4O00A 5GSRB 2AK1H 5J7CC 2CRMA 1VEPA 3ET9F 3CJJA 4FQIL 1G1CA 3H9SB 3HUJA 4IRSB 5E8DH 2HH0L 1KTLB 2IPTL 3QXDB 4HLZG 2JELL 1BJ8A 1QSFD 2IAMD 4OV5A 2MFNA 2PW1A 3LKSB 3B4NA 4YWGL 3MLTB 4FOMA 3D9AL 3GKWH 3HG1D 3P73A 1G7QA 1MRFL 4DQOH 4QOKB 3ZKXC 1I8LC 2DYPD 3QEQA 5CJBA 4XAWL 3CK0L 3TT1L 5I1LA 3P0YL 4HH9A 2V9QA 4QOKE 1JP5A 2APTA 5FK9A 4X4XB 3ZTJG 4GMSH 3MLVL 3DARA 3N0PB 5EBWA 1Q9LA 4F58H 4WFHE 3B3IA 4RGMB 4PY7A 5EOQL 4G8GE 4OGAD 3VXMA 2P24B 4PV9B 1AGCB 5DD3H 1UEYA 4R9HA 1VACA 4MA8L 1SM3L 4NHUB 5EFIB 4NO3B 3BMVA 4PJ7B 3MRIB 2JE8A 4W68A 4UTBL 1KT2A 4LIQE 4R4ND 3QUML 4CVXA 3MLWL 3VXNA 4TUOA 1CXIA 2XQYG 3M8OL 3Q6GL 3MXVL 4CW1B 1OGTB 3EO1A 1NUGA 1S3KL 1F3DH 1HZHH 2NY4C 2DLHA 3TBTA 5IGXL 3QG7H 1A6UH 4HGWB 5JDSB 5IW1A 4FXKA 4H26A 4Z7VA 5I73B 5GGVH 1V7ML 4K55A 4X9GA 1IEBA 5FB8A 3ULSB 1A4JA 3AM8C 2DQHH 1CD9B 4PR5A 5E99L 4KKBC 3QI9D 3JWDH 3SKOA 2I25N 4KH2A 5JW5B 3VFNA 3U48A 3REWA 2EXYC 2OCFD 5E1HB 3DVNB 1AIFB 4PJHF 4XP5H 3ARBA 4ENEC 2H2PC 2CK0L 1VESA 3A67L 5EZIH 4FTVB 2BVOA 2K9UA 4JZOA 2FB4L 4YFDB 5T3ZH 1KYOK 3QO0B 3D3VD 2ICWJ 1OTSD 1WBYA 2NY6D 5FYJU 3MX0A 4FTVE 4L5FH 1AH1A 3VXTA 3GMNA 2J8OA 5E5RB 4M1GL 1YEGL 4QXTB 4UOW0 4GBXA 3ZTNL 4KAQL 5F1SA 1T2QH 1XF2B 2JIXA 1B4JL 3OR7A 1H5BB 5EB9A 1W72L 5AG9A 4HJ0D 2L0DA 2BY3A 3CFBB 5JORA 1UXWB 4Y19E 4R7DB 4MHHI 5IQ9A 3MBEC 1UVQA 2YXMA 5H8DA 4KVCH 3LEVL 4LDOB 2ZUQC 1OM3H 2XWBA 2HKFH 2CXGA 2BSTA 3QPQD 3QG6B 4HV8B 4KZDH 1FORH 5E2JA 5I15L 4JCMA 1WIOA 1RUAH 1GOGA 4FMKA 3CSPA 3VI4F 1F8TH 2VITB 5KVMC 2CLZA 4LCYB 1EFXB 5B39B 3QH3B 5BZDA 1JGDA 3D39B 3MR9A 4CADA 5IFAL 1FNGA 2VLRB 4QRUB 4Y4KC 1GVIA 1P4LA 3DRQB 4OTXL 4LF3B 4DW2H 5DC9B 4R2GD 5DJ2A 4G8FA 3CMOL 4L4VD 4XMKH 5KS9E 3DV4B 4U6HA 1MNUH 4ZQKA 5DURB 1FRGL 2VDKH 3ZL4H 1V8HA 3MXWL 3NPZB 4PGCA 1KULA 4M1CD 1FZMA 4FXGB 1H15A 2W9LA 4H25A 4H8WC 4FABH 3A0OA 2ADIB 2E7HA 4U05A 5D2NA 5HPMB 3WE6B 4HQQH 4PJCB 1WAAE 1VCAA 2R4RL 3ARUA 3FRPG 3SDXA 5F7HA 3PDOB 3BPOB 1NEZA 4CN4A 2HRLA 3DVIA 4JKMA 4JZJB 1QQDA 3D0VB 3LVEA 1I8IA 4Y5YA 1ULVA 3GB7A 2H32H 5CINH 2DICA 4CDGC 1WZLA 2HFEB 5I8KH 1P1ZB 2BNRD 4BFIB 2ARWA 2J6EH 2AEPH 4WCYL 3N06B 1TETH 2D03L 1F2XK 3AXLB 1BZ7A 1QTYT 1EIBA 1M7XA 3T2OA 1KB5A 1MIML 5FYKH 4K7PY 3V8CA 3EO9L 2BCKB 5E08H 3QA3A 2XWTB 4XHJC 3KS0H 4WHYH 1KCLA 4G9FE 4JFYB 1FFNB 3C5SB 2RBLA 4I5BA 2XFXA 3U46B 3VI3F 5GS1A 4OZGF 5DC0A 1P7QA 4LSSL 1LO5B 3MLUL 2AK4A 4L4TE 3RGVB 1BJ1J 5KOVC 3B2VL 4RFEA 4U1MA 2YA2A 1YEIL 2OXGA 1MWAH 1MHPH 1CG9B 2EIZA 3FO2B 5HYIA 4L3EA 1DUZA 3ZDYF 5HY9B 3VD4A 2OJEB 2UY7A 5FYJL 1E0OB 1AQKL 4NPYB 1OP5H 3EYVB 4QY8B 2XQBH 3TCLA 2B0SL 5AAWA 3K7UA 5CZXD 1NCWL 3P4NB 2BX5A 4TTDD 4X99B 2P5WB 1U91A 3OPZL 1PQZA 4MQXC 4WWKC 1KJ2H 5TE7H 1T22A 2CUMA 5T5FH 2JF1A 3V6OE 3ARGC 4M00A 3O41B 3WFDH 4U6VH 3I6KA 3B8SA 3UMTA 1FFOA 3S35X 3KPSA 5I1JL 3FQXA 5BOPA 2J3SA 4AENA 5H94A 1M05A 4OLUL 4YDKL 1CK0H 2DKSA 5A3ID 4YUEH 4P99A 3TA3A 4ODHH 2DJ4A 1MY5A 4WJ5A 1OQOA 3EIFA 2RFXA 4GRWH 3RZWA 1DLHB 4HXAL 3CC5A 3CFKB 3BKCH 4RRPG 5MP6H 3UZQA 3HI5L 3UROR 4PUBH 1A02N 3HUJF 5HBBA 1KXTB 5SX5H 4FQXC 3C8HA 2IBBA 5IG7A 4AM0B 3L3KB 4AJ0A 2P8LA 3EYQD 4FQ2L 1P2CA 1EX0A 5D5MA 3HE7A 1QFUL 1ZV5A 2X7LA 2G60H 1QO3A 5C6WH 2Z4QB 3BH9A 4BFEA 3ZKXB 3TNMB 4M7JH 1ZLVH 3QNXB 2DQIL 2GSIB 1S7TB 1MFDH 5HHXL 3WFEH 4UILH 2A0LC 5IKCA 4UT6H 2DM4A 2XWJB 5KSAD 3NABL 2DMKA 2ADJB 4ORZC 3L5XL 1DEDA 1INQA 4FNLH 4LVEA 5BCAA 3TLRA 5SWSB 3HAEA 4MXWL 4X7SH 1Z9OA 1XF3B 3OJMB 3PNWB 3L3GA 3I2CH 4Z76A 2QADD 3SGJA 4GG8B 3PL6C 1RMFL 3CLFL 1MJUH 4HDIA 2F53A 3QUMB 5J1AA 4OF7A 5CKGA 1ZHLB 3QDGB 3CDYA 4OUUB 5DQDL 5CP3A 5LGJB 1ZEAL 2M1KA 1KIRB 1N6QL 3KPRB 2C4FT 4NQUA 1IZJA 3MGOA 4JFDD 5D1XB 1OSZB 1NGWA 3AY4C 3U9UB 4O2CB 3ARYA 2V5RA 5L2KE 3ILPA 1I3GL 2CJUL 2CH8A 1YMMD 4PJIB 4HFUH 4L1DA 3VXPA 5FGRA 3TEUA 1Y6NR 1IC5L 4OIIH 4OLWL 3MLSL 3SJVA 4QRRA 3L6FA 1YEFL 2CDEA 4MD4A 3IDXL 5GS3A 4OZIB 1J9CT 3QAZC 4MNHB 5JA8B 3OKLA 1JWMA 4FZEH 5DR5L 1FZOB 4Q0XL 5DD5H 4QGTA 1NUFA 1U8LA 3TWCH 1S7SB 1T83C 4Y16D 2XG4A 1F45A 3QQ9C 5IBTL 4O51A 3WS3A 2WIIB 1JGVH 2CIKA 1IAIM 5FYKD 1BGXH 3MYJB 1WFNA 2Y5TB 5GGUA 1BWMA 5DK0B 4RIRB 5FECB 5IWLA 1K8DB 3V4PL 3OZ9H 1GPOH 1MJ8L 3O2DA 4P2OD 5I18L 1EHAA 2LAGB 5DMIH 4HFWA 4X7TB 1I1AD 4LSQH 5C0EB 5IEHA 2XQYK 4JHWH 3GK8L 3LRHA 3MRPB 5HXMA 4UBDC 1J18A 1U3HA 3MNWB 1E4XL 4QF1B 4TNWK 2V2TB 1L7TH 3SDAC 5EBMB 3ULUF 3MV8B 2QL1A 5HYJD 4I0PA 2HFTA 1UCBH 4OD3H 1AD0B 1JUFB 4KROB 5KSVA 1HQRB 4NOFA 4XCNA 2FO1A 3VRLE 4PLKD 1V7NH 1N2RA 3VMNA 1BJMA 3MA9H 3MV8E 3WDHA 2ZUQB 2X42A 1G9MC 4WU7B 4ONGH 2VE6B 3L95A 5LAXA 5MHSD 4F9LC 3LQAC 2ITDB 4AQOA 4ZOBA 2ATKB 4KXZH 4NQCA 5H35B 1TZHA 5IVZA 5M95B 2CKNA 4L3CA 3U36B 3ZO0A 1RPQA 4JJ5A 1XF1A 3E2HB 2YD3A 3IFLH 3MREA 5C8JB 1U92A 3HZKB 4X6CA 1WT5C 1A5FH 2DQTH 3IJYA 2ZCKH 1P4IH 1KELH 4YBQD 2Z31D 3ZYJA 4M5ZL 1X5JA 1HKLL 2C3HA 4M6ML 1RIVL 2QJDA 2RCSH 1A4KA 5GRJL 2HLAA 1T1XA 1HYRC 1CGSH 2VNCA 2R2HA 2B4CC 4LIQH 4YPGA 5EOCJ 1FGNH 4WU5B 1S7UB 4L8DA 4GSDH 5HHOB 4N1HB 4OCYL 4FFYL 1J0JA 4N0YL 3QFDB 1PX3A 3RVXC 3UTSD 1YA5A 4HCRL 3SDXF 1BQUA 5SWZA 2UYLA 2HJKA 4X9BA 3MFGB 1CF8L 1KV3A 3O4LB 5HGHA 2X70B 4OQTH 4Y4FD 1G9NL 5IM7A 3PP4H 5IB3A 4ZXBA 4U4BA 1U3JA 3QRGL 1I1FB 3HC3H 3C2AH 4WFFD 1H0DA 4XTRD 3RBGA 2BOCA 3S7GA 1FL5B 3GGWB 4YDIL 2QV2A 1KPVB 2UVEA 3H3PL 4YDJB 4PRIA 2GK0A 2IBZX 2R2EA 2HFFB 2DQCL 2FX8H 3KPPA 4R8WH 1Q72L 4JO2H 1BVKB 3V52H 4KK5D 2CR3A 3T0EE 2I5YH 1VEOA 5HYQA 2JJSC 1F4WH 4LPXA 3FN9A 3T8XA 3L5HA 2QHLA 5GGVY 1HHGB 5K9JL 3EHBD 5FAAA 1FPTL 3QNZB 4LCWD 4AG4L 2BDNL 4HXBL 2VLJA 3C5JA 1RSFA 1Z6JT 3CSGA 2HP4A 1OD7A 2F15A 3TJHC 4A6YB 3KPNA 2XKNA 4MDJA 4FS0A 3QWOB 5CILH 1FL3A 4ZTPH 4ZOCA 4HKXA 2YRZA 3BKML 4GOSA 4HUVB 2VLMD 5K9OA 1TLKA 1UCTA 2YA1A 4Y1AE 5F88B 1JTTA 3VG0H 3VDAA 3A6BH 4NFBA 2AABH 5KTEH 1X9QA 1A0QH 4GAFB 3OGOE 4FFWC 4ZS6D 2AJSH 4PJAA 1R6VA 1B0GB 2NY5H 3IU4H 3G5XB 3DUUB 3IYLW 4FQJH 1ZLWH 3ARGB 5FYJE 2JK5A 1NL0H 1MCCA 3GI8L 1TQBC 2RJMA 3PQYA 5DEFA 4G5ZL 4QRSA 3B43A 4PG2A 3MLXL 5EA0H 4BM7A 3DMMD 3IU3A 3U4BL 1CE1H 4NM4L 1KF9B 4GRMB 5HI3D 2NTFA 4PP2B 1XR9B 3FO1B 4F15C 5K9KB 5C0AD 3RA7H 4ZNEE 4KZEL 3T65B 5FHBL 4HZLB 3DTXB 4Z0XB 5C0JB 5EC2B 4F3FA 3LEYL 2E27L 1NJ9A 1K5NB 2F5BH 2IALA 3HPJB 2YK1H 5ENWB 3FO0H 1R24B 4WI8A 1HXMA 2J5LC 1X44A 5F7DA 3PXHA 3UTTB 4FFVD 1T80A 3DX7A 4M8VA 5C9JB 4FQXB 4JQIL 5I1GH 1X5XA 2XZAH 5EU3A 4NUGH 3MLRH 3I6LE 1N5AB 4P2RB 3G6DH 4IOFC 4ISVB 1MRCH 1CBVL 3MOBH 2DBJA 3K4AA 3QUYD 1N0XL 1PKQB 1AXSA 1WV7T 3O2VH 4Y2DD 2F8XC 2D2OA 4XNQB 3OV6A 5D5MF 3LN5A 5EOTA 1ORQA 4Z7QF 5JOEA 4MA7L 3MYZA 4DGIL 3V6ZB 1UWXH 3DVFA 2X1QA 2BRRH 3C9NB 1A7OH 3VFWB 1LEIA 1RZFH 3UTOA 3H9SD 1ZHNB 1GAFL 3OKYA 4IRSD 3FTGB 3ZE2F 4N0RA 1MCQA 4G6KL 3IJSA 2Y7QB 3VWJC 5AD0B 1DLFL 3O11A 2EIBA 4YO0A 3JWOC 3BUTA 1GIGH 5T1MA 3GSUB 4YHOH 3C6LC 4Z18A 2YSSB 5F1IA 3RPKA 1M1SA 4U7SA 5DJCB 4YBHA 4OCRH 3FKUS 3PL6B 4QHUB 3DURA 1VERA 2A6JA 2DMBA 1CGVA 2GYSA 4LLUB 3V5KB 1WEJL 3IDIA 1CIUA 4MXQC 4WFHD 4G43A 2FD6L 1YNLH 4BH8B 3MCLH 5IB1A 2FJGA 3STZB 4MJ4A 3GBLA 4YXLH 1IM3B 1MIEH 1TNMA 2MHAA 4OIAA 5JPMA 2VKWA 1CTOA 4NJAH 5TH2B 1WFTA 5ITBH 3QCVH 3F7RA 3IDGA 4YIQB 4JRXE 4HPYL 1MHEA 5IMOA 2MWCA 4YJZL 1S9YB 3UP1A 1T0PB 3VGEA 3U4AA 4WTZG 3DO7A 3O6KL 2IPUG 1MSPA 3PIQB 2HJFB 2BMKB 3QAZB 3CDFA 3MRBA 4KVNL 3QWQB 3CMGA 3BPCA 5ANMA 4HBQA 2FWOB 1A3RL 5CAYB 1HHHB 3WIHL 4OZFB 2DQFA 4O58L 4Q58C 4PGEB 5L8LB 3KPQA 5CD3B 1S5HB 5CGMA 4S11A 2QSQA 1OWRM 1CFSA 3NIDE 4J3XA 2B1AL 4PJ5B 3BP6A 2O61B 3BGAA 3BN9C 4J3OC 2PYEE 3PGCA 5BVPH 1UA6H 4HIIB 4M1DL 5DA0B 4NQDD 5JIKA 4P3CL 3GSXB 4PJ5E 2YD1A 4OGYL 1UM4H 2GJ6B 3SDAB 4YHZL 1ORSA 4G42B 2W65A 5HGDA 4FTVD 3VFGH 3GSWB 4OCSL 5ESAA 1II4E 1F90H 1UH4A 3KXFB 1S7QB 4M4RA 5GGTA 5TQ2L 4J23A 3U7AA 1TQCC 4RQQB 5KAQF 4FQIH 2ZOLA 1KENL 2BVUA 4FRWA 1DN0A 2HH0H 1FC1A 4OCNC 3KXFE 2IPTH 1QSFA 1QLRB 4PRBB 1ROWA 1ZT4B 3BVNB 4YWGH 1AXTL 3C6SB 3IFNL 1AGEA 3TIEB 3D9AH 1SVZA 4L1HA 1F02I 2EC9T 5FKPB 5EG6C 1D9KA 1KEGL 3HG1A 5I76A 1YQ2A 2ZUYA 1MRFH 1F6FB 2DYPA 5DRWB 3S5LB 5E00B 4X6CF 5HGAA 4NWTH 4XAWH 3CK0H 3KYOB 3MLZL 3P0YH 4KXZI 4W4NA 3SKUD 3KLAA 1C5DA 3HMXL 4L8SA 3MRRB 1KJVA 5LXGL 3CGTA 3IVKB 3MLVH 4E41A 1ZA6A 2DLIA 3EFDL 1LNUB 1LO2L 3DX6A 5CGYD 3V79C 3IXTB 3S4SB 2NCMA 2V5TA 5MENB 1EFXD 3D39D 4MA8H 1SM3H 1TJHH 2VLRD 5EO0A 2AV1A 2WIMA 1JMZA 4WEBL 4HLJA 4HG4K 1MLCA 1RUQH 2BVYA 5T5NF 1JHKL 1X6NA 3QUMH 5BW7C 3MLWH 1KIPB 4HS8L 3KS0J 4BH7A 5IT2L 2FJFA 3M8OH 4KGLA 1MJJB 5INCB 5FKAB 3Q6GH 3MXVH 2FGWH 5GS0C 1S3KH 2DIAA 3VH8B 1RZJL 5DURD 4GLRH 5IR1B 1RZJC 4JREC 3RWFB 4X4MA 3BZEB 4CU8A 1ZHBA 4MLSA 5EIIA 3B2UC 3HS0B 3QI9A 5E99H 1T2XA 3IDJA 4D3CL 1J8KA 4YHKL 2Q87A 4KPHL 4F7CA 3O3BA 5EZLA 2EIDA 4MMZC 2W9EL 3QEHA 2A6IB 4IM8A 4LLQA 3ULVD 2EYSA 1JWSA 5JXED 2CK0H 3A67H 3H2WA 3H0TB 4U1HB 4ONHB 4MS8D 1X5LA 4X6DA 2FB4H 1UWEL 3BD3A 3D3VA 2MJWA 1NFKA 3F7VB 4QTHA 2G9HB 3L5WB 3QEGL 5GGSY 4XGZA 3EZ8A 2X4OA 4NQTA 4O9HL 1NUDA 4M1GH 4NN6B 3WDIA 4E5XA 3SEPA 3ZTNH 4KAQH 1K4CB 5EC1B 4X98B 1B4JH 4YQXL 3RGVD 5C0CE 1W72H 3HFML 5TF1L 1HH9B 3BPLC 3TCXA 5HDLA 3KR3L 1E28A 4M43L 4ZPTB 2E7BA 1AHWA 5DMGC 1DVFC 3GHEL 3LPGA 4NNYB 3GSVB 4XH2A 1G6RA 2CXKA 3LEVH 4EVNB 5EU6B 3UPAA 4J8RB 1VADA 1KGCE 3LQZA 2P5WD 3PGDB 1ES0A 4AL8L 5KVDL 2P5EE 4GH7B 1EUUA 1Q9OB 2AQ3A 5IFJA 3W11C 1YEEL 3BWAB 1WWCA 3BP5A 1T6VN 4XCFL 5I15H 3A6CL 4YH6A 5EU6E 4H0IA 4LEXH 2EYTA 2HVJB 2VN7A 5IIEB 3NIGF 1ZHKA 3WIFB 4DKDC 1EO8L 1I9IL 4P0DA 1J8HB 1CDCA 4I9WE 3O3DA 4S1RL 4GBXC 4OTXH 1O7SA 1YEJL 2NZ9D 3QR2A 3RUGB 5JO5B 3CMOH 3JV6A 3MJ9A 1Z3GL 4L4VA 3QQNA 4UNTA 2VL4A 1NLBL 4G7YL 3CIQA 4K7PX 4RGOL 1UFUA 1B0RA 2XZQL 1KTDB 2Q7YB 1HHKA 1FRGH 1WJ3A 1S7XA 2A73A 3MXWH 5EWIL 1BOYA 2Q7NA 4ZUTB 4Z7WB 3VWJB 2R9HC 3BGMA 4DOHB 4KTDL 3T08A 1BFVL 3JV4B 5ILTL 2WWMC 3DSFL 2R4RH 2NX5B 1YUHB 5ETUB 1YEDB 3KPOA 3DGGA 2RR3A 2NNAA 1R5VA 4DOHE 5D7LE 4JZNA 2ATPB 2R69L 1IRAY 1D5ZB 1SJEA 2OSLB 1YPZB 4V1DE 5FA4B 5CEZL 4LCCC 2KH2B 1IARB 4HWZA 2M8XA 2DKMA 4OZ4B 2D7PA 4RFNB 3I9GL 2XXCB 3LZFL 4X4YB 1WIUA 3RKPA 5E5MA 5F97E 3VGDA 5ID1B 4XBEL 4RMRA 4WCYH 5A40E 2D03H 5DUML 3CDGA 4RWHA 1MHHA 3ZKMC 5SWSD 1MIMH 2VTFA 3MJ7B 1T6WA 1EAJA 3ARWA 3EO9H 1FDLL 3PWPB 1AJ7L 2DMCA 5J3HC 3LMJL 2FX7L 1MLBB 5DD0L 4NQEB 3B9AA 3L9RA 4WIQA 3PWPE 5J6HB 2C1OA 4LSSH 3D0LA 3MLUH 3LSOA 1BOGB 3ROLB 1CDJA 3B2VH 4JO1L 1YEIH 3AS2A 3QDGD 3V8OA 1OTUD 2BVPA 3C8DA 2X4SA 3IRPX 4R6UA 1YEKL 4C4KT 2FL5B 2FZ3A 4BQ9A 4YR6A 3KPRD 1VGEL 4Y5YC 5D7IE 1FZJB 5FYJH 3I6GA 4FQ1L 1AQKH 1YY9D 1G6VK 3F12B 1SBSL 4Y4HB 2B0SH 2YN3A 2VIRB 2Z9TA 4ZFOB 3WBDA 1NUNB 4WO4B 3OPZH 3OKEA 4BUGA 1S9VB 4MJ6A 4B50A 4CBPA 3NA9L 4KKBD 1JGLL 4LVOB 1SY6L 4Q2ZA 4RX4D 5TDPB 3FQRB 1I7ZB 4LK4A 1NC4B 5I1JH 1A6VL 4OLUH 1RUKL 3IRZA 4YDKH 2Y06L 3LKRA 5GS1C 4ENED 2H2PD 3FFDA 1BFSA 2O5XH 4LRIC 3WUWB 1OTTC 5EZOL 4MZ2A 2OM5A 4XCYA 2PYFB 3NMEA 1FJ1A 3HZMA 4KUCF 4V2CB 1TQCB 2O5ZH 4HXAH 4LLMB 3CAFA 5HHQA 2VAAA 3HI5H 2WUBL 3TF7C 2O26U 4UQ3A 3QXAB 1D6EB 1ZS8A 2C7UB 3EO0B 1PFCA 3RY6A 4M6NL 5ADPL 4FHBD 1QFWL 1EJOL 3GMMA 3GDBA 1YYLL 5I17B 4FQ2H 2NR6C 1AQDA 2CLRA 4G80B 5BRZA 1QFUH 1JWUB 2YPLB 3NGBC 3CFJB 3MV8D 5E7FA 1YN7A 3TZVC 4KROD 2BSRA 1A6WL 4X6BB 2DQIH 5KSAA 1SEBA 3OB8A 3WNPA 3NABH 5F7YC 3WLWD 4WV1A 3L5XH 4BZ1L 4MNGB 4QHLA 1IC7L 1ZXQA 1R5WB 1I9RL 2VWEE 5EUOA 5D7KD 5SWQB 4MXWH 3AFLA 3DIFA 4DN4L 2YUZA 3QFJB 1X5HA 1I7UA 3O3UN 4JJHA 3N1GC 5DQ9A 1NAML 2EH7L 4QHKJ 2V7HB 6FABL 2W07A 1ONQA 1DBAL 4EIGB 2VERN 3O81A 4NWUL 5CEYA 2K3TA 3QFJE 1HHIB 1FC2D 3CLFH 1E4KA 1NFDB 4TQEL 3O3EB 3AAZB 4JY6B 4DK3A 4G6AC 4ODUB 1HSBA 4XP6L 4P4KC 2VDRL 5DQDH 4LEOA 1N6QH 2NW3B 4JFDA 1TMCB 3K1DA 1S9XA 1I7TB 3P30H 2YUWA 5I1LB 5HHOD 4JREB 4JPWH 1RJLA 3FFCE 1FH5L 3CH1B 1JK8B 1I3GH 2ZSWB 2CJUH 1YMMA 3IS0X 1MRDL 4P2QB 4WUUE 3PWJA 2BHZA 2VLLB 1IC5H 1BEYH 2FRGP 3CCHA 3MLSH 2Z92A 3O4LD 1YEFH 2VDOL 1IAKB 2X4NB 4GLRI 1F4YL 3OAZK 4JFOA 2E6JA 3I3EA 3L1OL 5DR5H 4Q0XH 3J7HA 2H32A 5M94B 4K07A 1ZT1A 4DZ8A 4ZUUA 4NQSB 4Y16A 5DK2A 2ED9A 4OZFH 4PJEB 1OGAB 5IBTH 1JV5A 4ELME 4DVBA 2V2XB 5C09B 1EHXA 3OXSB 4XHJD 4XCCL 3EGSA 3WHXB 5DRNA 1F6LL 2EYRA 2J8UB 4P2OA 2V17L 3V4PH 1MJ8H 1OGAE 1I1AA 4IDLA 4Z7VB 2ADGA 2QSTA 3QQ4A 4U1LA 1IEBB 1TVBA 4PJBE 3O6ML 4NRZA 4S1SL 3GK8H 3V6FB 5KSUB 4B7LA 1A4JB 3BPLB 4PJDA 1E4XH 2MMXA 1UH3A 4J6RL 3V0WL 5HYJA 1MWAA 4LLAA 2NLJA 1DVFB 2GIYA 1QRNA 1VGKB 3FMGL 4M4PA 1CDBA 1NGYA 5DEGA 4ZO6A 4FQHA 4ZUVA 5KANG 3QQ3A 1YDPB 1G9MH 1UKQA 2HWZL 1XAUA 3LQAH 3VFTB 4WWKD 3OKKB 1OW0C 2HAZA 2OQJB 5B8CB 5J57B 2X1OA 3PJSA 1C7TA 1XH3B 3ARGD 4KKCC 1J0ZA 3P77A 1EXUB 3VFVB 2V6HA 1QKZL 4GJTB 3STBA 3VXTB 4ZSOB 5I1AA 2F54E 3TPUA 4BSVA 4NKOA 1T89A 5TJWK 5E6YA 1ZA3A 3VWKC 3MOQA 4WHTA 5EU4B 4J3TA 1ZE3C 2Z31A 1TVHB 4KWUA 1WQVT 4M5ZH 5EBLB 1HKLH 4M6MH 1RIVH 1TJIL 3VDBA 1FYTE 3SPVA 3GMPB 3VRJB 5GRJH 3ZE0E 5IB2B 1XGUB 4P5KA 3W2DL 4GW4A 5CJ5A 4YNYB 1NMBH 3UTTD 3TO2B 4NC2B 3T77B 5L9DH 3MSPA 3U83A 1OF2A 1BP3B 4FQXD 1NBVL 4OCYH 4FFYH 4P2RD 4N0YH 3UTSA 1AXIB 4YHPA 3K0WA 4U3CA 4D0BB 4XPHL 3PV7A 4HCRH 4ZUSA 2XTJE 2YR3A 2GTWA 3C09C 3QB7C 4Y4FA 3HNVL 1G9NH 2EDFA 4LCCB 1ND0A 5HI5C 4YEEA 4ZO8A 1M7IA 3QDMB 1RJYB 3KYKH 4KJQC 1ACYL 4YDIH 1IAOB 1MHCB 3H3PH 4NSKA 1EJ6A 5CEZE 2DQCH 4HK0A 5DMYA 4G7VL 1Q72H 1BLNA 3ARXA 1E4JA 1ZSDA 2WZPD 1PDKA 3LV3A 3GSQA 2AKRA 4KK9D 3MZGB 5C2BL 1YC8A 1WBZB 4LCWA 4MQSB 5DHYB 1OARL 1Q8MA 2BDNH 4HXBH 5E03A 1SEQH 2NZIA 4CNIB 2PCPB 3PL6D 4YPJA 1W8NA 3IS1X 4L29B 4TOYL 4WW2B 2Z91B 5TDOB 2YHGA 1T5XB 1P9MA 5FDYA 5ICYB 3BKMH 4G9DB 3PWUB 4UU9B 5D1ZC 3G04A 3LH2L 3S3JA 1YMHB 1DQML 3QHZH 1LE9A 4Y5YB 3VG9C 3PWNA 4X9HA 1R3HA 1L6ZA 2X4PB 3SQBA 1LE5B 4M8QB 1DBBL 3U0TB 1CDHA 1C12A 5FA3A 3G5YA 4LRNL 1UB5B 1I8KB 5TF0A 3M45A 4Z7UA 2OXHA 3GI8H 5IB5A 2J12B 4EKXA 2I26N 1QUNA 1XZ0A 4G5ZH 5IHZB 2YA0A 3MLXH 3DMMA 2AJZA 3Q5OA 4NM4H 1KLUB 3P4MB 2Q6WB 5C0AA 3CFIC 4KZEH 1IGCL 1WBXB 5DRXB 5FHBH 5F1KC 43CAA 3F7YA 1R3IL 1LO3L 3QQ9D 4UDUA 4KRLB 3STLA 2E27H 4CVZA 2E7LA 1HXYA 1YZZA 5L6YL 4JG1L 1H9VA 2B39A 3ALXA 2D0HA 3TV3L 4KMTL 1MUJB 4PJ5D 3HPLA 3GRWL 4OAWB 3H9HA 4LHQB 1D6VH 5DVKA 3CSBA 1CBVH 4UBDD 3QUYA 1UT9A 1KUMA 5JQ6H 2GJ6D 3FQTA 2IF7A 3SDAD 3S6CA 3W0WD 4Y2DA 5KAQG 3NGBB 5HYSB 4WGWB 5MEOA 2EDDA 4HPOL 5FUOL 3TZVB 3RWDB 3GIZL 5GSRA 1V3LA 4MA7H 5L7XL 4DGIH 1TFHA 3KXFD 5I1KL 5H2BB 1QBML 3ZKSD 5M7QA 4NFDA 5T1KD 3H9SA 1CXFA 1B6DA 1GAFH 2H2SC 5A2KH 1KTLA 3QXDA 4G6KH 1MCLA 2HRPL 4I2XE 1CIDA 4PJ9B 1DLFH 3LKSA 1RIUH 3MLTA 3SE4A 3D25B 3PHOB 4BELD 2FATL 4JFFB 3NFNB 2IFFL 1NAMB 3T2NL 2Q8BL 1LEGB 5F7KC 1H3PH 4QOKA 2DS4A 3GM8A 4E9LA 5DHVH 3Q2CA 4JM2F 1WEJH 2VQTA 1CD8A 4MD5B 2FD6H 5KG9B 4P4KB 4OLVH 1A21A 4X4XA 4QXGL 1ERNA 4CKVX 1I85C 4L8BB 1F4XH 2D0FA 1EEYB 3WFCL 5LQBL 4KGJA 1IGJB 4OSUL 3INUL 3P0VL 5FHAL 2P24A 4KKAC 4PV9A 5FGBC 4BKLB 1AGCA 5C08B 5MEND 2J7LA 3ARVA 4OFVA 3NZ8B 4HPYH 3RVXD 5EFIA 4B53A 1C8PA 4BSJA 4NO3A 5I1IL 1XIWA 4PJ7A 1A7PL 3MRIA 4MDIB 2EH8L 1T1YB 4RWYH 1EVTC 3RHWF 2H8PA 5SV4A 4K3HA 4PRAB 3MV9B 1UG9A 1OT1A 4CW1A 1OGTA 3P4OB 2A1WL 4KRMB 4KVNH 4XI5D 4MCZB 1TVDA 4HGWA 2WQRA 3MV9E 1A3RH 4OF8A 4M5YL 1NBZB 1JIBA 3JZ7A 3WIHH 5JW3L 4O58H 1JHTB 3M07A 3ULSA 1OPGL 4PB9L 3BO8B 5GIRB 1HWHB 2VZSA 3RVWC 2B1AH 5ESQB 4GKSB 2XPGB 3AB0C 1E27B 4RAUB 1CGUA 3T1FA 4M1DH 3TJHD 4P3CH 3DVNA 4RAHA 1NC2B 4ZG1A 1AIFA 3BKJL 2HG5B 1MI5E 1N4XL 1IFHH 2RGSA 1QHOA 4N68A 4FTVA 4OFDA 4YHZH 2IH1B 3DOSA 4PJDF 5CEXB 4R7NB 4OCSH 3QO0A 4LCIL 5TQ2H 3QIBC 2XXMB 1KENH 3EOBB 3NCYS 1OQXA 3FN0L 1ETZB 1RD6A 4QXTA 1U8OB 6CGTA 3WN5A 2CO7B 4K94L 3N1PC 2H9GA 1JYWA 2CD0A 3RIAK 1XF2A 2CIKB 4POZC 3T4AB 1CGWA 3IFNH 2BRQA 1N8ZB 3N1FC 1OP5K 5KSBB 1KEGH 5I30L 3K46A 3CD4A 4UB0L 4TVPE 4L8CB 1JFQL 3VWKB 1AFVL 4R7DA 5HTSA 1YJDC 1KGCD 1E4WL 5KSBE 1BQHB 4Z78B 4Q97A 5D70L 4HJJL 4JY5L 3MLZH 2XA8L 3MNVB 3QEUB 4TSBH 3HMXH 1LP9E 5LXGH 1NKRA 3QG6A 4HV8A 3EFDH 5E9DE 4XP9L 5H37G 4C54A 3ALWA 1OAYL 4Z7NF 2VITA 1NGQL 4LCYA 1EFXA 4IOFD 5B39A 3QH3A 3D39A 5DYOA 4U7KA 2VLRA 4QRUA 2ZCHL 3DRQA 1J8HD 4WEBH 4LF3A 1CDYA 5E5UB 3C09B 1JHKH 5JNYB 5IT2H 1D9KC 5SX5K 5LGHL 4HIJB 2QLVB 3DV4A 1HI6B 3MREB 3LRGA 1RZJH 5J1SC 1B9ZA 3CXHJ 4XPTL 4FXGA 1MCWM 2ADIA 1AC6A 5HPMA 3IFOB 3VWJD 3WE6A 4X9FA 1ZLVK 3T0XA 1LK3L 4L8SC 3ZHKA 2NX5D 3PDOA 1EA9C 3C6LD 4JN1H 3EFFB 1P84J 5KVFL 4F7EB 4DTGL 4YPGB 4JZJA 4D3CH 4L8DB 4KPHH 3D0VA 4L4JA 5D9SB 2W9EH 4HLZH 2WINB 4OD1L 2HFEA 4MXQD 1P1ZA 4R4NC 4BFIA 4FG6D 3VXSE 5D1ZB 3CX2A 3MRNB 4G9FA 4YZFF 4PRPD 3AXLA 1T4KB 1KBGL 3UDWC 1W0WB 1UWEH 2AJ3B 3O9WC 1FL6B 3MPCA 3VG9B 1A9EB 2BCKA 3GJFB 2XWTA 4X5LA 3PWPD 3K1KC 3QEGH 3U30C 4N0UB 2EDWA 1CXKA 4N8PA 4JFYA 3BT2L 2AXGB 3NCJH 4NQED 1FFNA 3C5SA 2BVEA 4O9HH 4ZO7A 1IBGL 5F3BB 3U46A 1CLYL 4XAKE 4P9HC 1LO5A 3QULB 1U8MB 3RGVA 1HINL 4YQXH 3ZYOA 3ZTJH 4Z7UF 3HFMH 5TF1H 3QI9C 1CG9A 4M43H 1FG2B 1H3WM 3FO2A 5MEPB 5IVXE 3S8WA 3GHEH 5HY9A 2DQEL 2OJEA 2VLKB 1MCWW 4NPYA 4QHMB 2NY2B 3EYVA 4QY8A 4Y4HD 4OCXL 1KB9J 3P4NA 4X99A 2P5WA 4WO4D 3Q0HA 3G6JE 2AQ2A 4AL8H 3L5JA 4CU7A 5KVDH 3ZKND 1BVLB 1YEEH 4XCFH 2NY6C 3CFEB 3O41A 3A6CH 2EDTA 3Q3GB 4PRHE