1HWHB

1:1 complex of human growth hormone mutant g120r with its soluble binding protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
206
structure length
196
Chain Sequence
EPKFTKCRSPERETFSCHWTDPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an antagonist mutant of human growth hormone, G120R, in complex with its receptor at 2.9 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (hormone/receptor)
molecule keywords GROWTH HORMONE
total genus 32
structure length 196
sequence length 206
ec nomenclature
pdb deposition date 1996-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hwhB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hwhB01
1BJ8A 5T5FH 1MFEL 1WAAE 2VISA 1CT8A 4YXLL 4KROD 4YDVB 5I73B 4HKZA 1AI1H 4QXUL 2VITA 1B90A 4WFED 5EH1A 3HZYA 3SKMB 1UJ3C 1UWXK 2E3VA 3QEHB 5FV1L 4S1QH 3IJSA 1FGVH 3FFDB 3ROOB 5C0FA 1T66C 2X4NA 1RUKL 4MA8H 4CVUA 4MA7L 5LQBH 4G6JL 1J8HE 3ELAT 3SKOB 2HFEB 3RZCA 3QUMA 4R7DA 3P77B 4B5EA 1HOCB 5MERA 5IWLC 1YPZF 4BSJA 3HMXL 2IADA 25C8H 2DL2A 1BZ9B 5IFJA 4K7FB 5D70H 3QG6B 4X7EC 3ARXA 5E5RB 3PF2A 3S34L 2OZ4L 5DZOA 5HGBA 1FG2A 2ZZUT 2M1KA 4FFYH 5EU4A 4FXKA 4RX4D 2H2SD 1EV2E 4NCC2 4R26L 5IJKA 3NACH 4U2ZA 4O9HH 1A21A 4HGKC 4ESKA 5D1ZB 1ZKAA 3HRZA 4FQHB 5JZ7D 1CU4L 1EJ6A 5HYJB 2EZ0C 5K9QI 4H20H 1Y6MR 2VNCA 3T0EB 5C6TH 3IFLL 3TNNA 3FRPG 2WLYA 2AQ3A 3H9SD 3L5WB 4Z18A 5A2LH 4HIIB 4P46A 1XF2B 1AD0B 5L2KA 3OPZL 3NIGE 5FO9B 3MQIA 5DT1L 4N90E 1R3IH 3T0EC 4EN3C 1QR1B 4WW2B 1KB5B 4ZOBA 1I7TB 4JY4B 3W9EA 3EAKA 3ARZA 3VFPB 4OZIF 4WNQB 2XTJB 1YMME 5C8JA 2ESVA 4NQEA 4GAYB 4PJXB 1C7TA 1Y18B 3GSRB 4XTRC 5ICXA 4F2MB 4Z77B 2NY2D 1A8JH 3UDWC 3B3IA 5T5FL 5E6YA 4F33B 4Y2DA 3HI6L 4LRIC 4C54A 5C0DA 4TVPL 4H5SA 5T1LB 4FRWA 4MD4B 5JOPD 3D69B 1RUPL 1T5WA 1UZ8A 5I6XC 4MJIB 1SMAA 4E5XB 4WI8A 4LSRL 1KXTB 4L5FL 5C0BD 5I1KL 4LCWA 2OTWA 5DVLA 4OFIA 4HK3J 3TA3A 4PJHE 2W1NA 1Q9LA 4WW1A 3LEYL 3O4OC 1PYWB 3TIEB 2IAMB 1KPRA 2IAMA 2W9DL 1GZPA 4APQC 4QOKD 5T1MA 2IEPA 4OZIE 2D9CA 2Y07H 3BYTA 4BA8A 1T7XA 4RMWA 2X5PA 1WIUA 4GAJH 2VAAB 4DGVH 3RWCB 4GG8A 1MRFL 1QBLL 1VEOA 3RA7L 2XY1A 5FYLE 4C83A 1A7RH 3QQ4B 2Q8BH 3FO9B 5E6IB 5MENE 1RI8A 4B41A 1ZAGA 2OX5A 3OJMB 3LPGA 3QPXH 1NMAH 1HXMA 4U3XA 1CTNA 5DD6B 3BN3B 1KB5L 2E6QA 4M7ZB 3C2SA 1BD2D 2NY2C 2V17H 5GRWA 1QVOA 1TJIL 4LVOC 1O7SA 3W5MA 4N5ED 2X4NB 5CP7A 5E94B 3S96A 3QA3B 1RMFH 3OTTA 5C9JA 3IJSB 3RI5F 3O4LA 4HLJA 3BJLA 4HWBA 2YRZA 4ONHA 4N5UA 4FQ1L 3ARDA 3SGEH 5CLWA 2HVKA 4HC1A 3DUSA 1QR4A 1K6QH 1MLBA 1R3IL 1NBQA 4DW2L 1MCRA 1HSBB 2EO9A 5CILL 5C7XH 1OHQA 4YNYB 4QOKB 4C4KT 4PRPE 4KI1A 3QCTH 4P2QD 3DURB 4JQXA 2A6JB 3QDAA 4Q9QH 4XWGH 5AYUL 3O0RH 1IAKA 5F88A 3ARDC 5DD0H 4MJID 4NP4H 1MHPH 3AXLB 3QIWC 2EIEA 1EGJH 4LEOA 4FFZH 5IBUB 4JFOB 5T1LD 3MLWH 1FLRH 1XGQA 1JNLL 1T5XB 3CDFA 5BRZD 3U7WL 5E8NB 3U4BH 2VZOA 2XG4A 4L5FH 1G6RH 3UTSB 5HSFA 5JPMA 3B8SA 1CQYA 3MV8A 4Z0XA 5D1QB 1UM6H 1QR1A 4ZAKC 5MI0C 2GK0B 4KKLD 3IDIA 4TVSa 3VG0L 3V52L 2Z93A 3GNMH 3Q1SH 3S6CA 5KG9A 1KIQB 3QDHA 4D94A 3GBML 2JCCF 3D0LB 2VL5A 1FNGB 1HZHL 2R2HA 1CQKA 2OR9H 3DO3A 4HJ0D 4Z8FH 1QBMH 2YMXH 4PJ8A 2HRPL 2DQTH 4R9HA 3QT2A 3O3DA 3UXFA 3C8KA 2KDGA 4GBXA 4Z7WF 1JZ4A 3H9SB 3QEUB 4LP5A 4RMRA 3DSFL 3D0VA 3TBYA 4GRWF 3LQAC 4NZUH 4RAVB 4FQXC 1DDHB 1Q72H 4M1GL 4NNPH 1OWWA 2R56H 3RX5A 4CJ0A 2VLJB 1EEUA 3EO9L 4JGMA 2YRLA 5DMYA 4LU5L 4LASL 1L9MA 5K93A 1TJIH 4YHZL 1B4JL 4LSPL 4M6OL 1F4AA 2PO6B 2XNAA 1F11B 2VQUA 2G5RA 4UOW1 1YEKH 4ERSL 3SKNA 1CD0A 1QTYT 3V5KA 5DHYA 1YJDH 3CVIH 1TCRB 4KAQH 4TSAH 4U1IB 1K6QL 4O00A 1GGTA 3O45A 2ERJB 5E2WL 3K7UA 4KVNH 4F58H 4QHKJ 3IRPX 5H8DA 2OP4H 3UTOA 2P47B 2EDQA 4PBWD 1QOKA 5DI8A 5JW3L 5ISZB 4XWOC 1HIML 1BD2E 5JXAH 4M8VA 5DHVA 1P4IH 4JHAH 1BFOB 4YEEA 1WCBB 2EXWC 2V7HB 2B4CL 5I2IA 3MV7B 5ICZA 3U82B 4UAOB 4NP4L 1EXUB 3HI5L 1MCHA 4TVPE 2FHFA 2O26U 4M93C 3CC5B 5JW4N 1U6AH 4EN3D 2CDFB 5TE7L 1BIHA 1FVEA 1MUJA 1A7BA 4LK4A 5MEPB 3STLA 3VGGA 4KRPB 3QQNA 3I6LD 1RVFH 3H9HA 5KSUA 3KPQB 4OQTA 5ID0B 1T1WB 1MRCH 3IFNH 3JTSA 4OM0H 3RTQD 4H1LA 4CBPA 4PV8A 4X7TA 3UC0H 5C09B 5TE6H 1F00I 3ES6B 5CEZD 3KPPB 1NC4A 2A83A 1FZJB 1QBML 2MNUA 1F3RB 1MCSA 5AUMB 1U3HA 1QA9A 5C0BA 1IE5A 4M7KH 3MLUL 3DPBA 3QIWA 3QHFH 2OBGA 4IRJA 5DLMH 1EMTH 4XMPH 5HYJA 5BO1L 3OKDA 4MXVE 4R4FH 2R56L 2LAGB 4PY7B 1T83A 3LDBB 1J1PL 1NCWL 4NPYB 4YO0B 2ICWJ 1DE4B 4JLRB 2IQ9H 3UPCA 4S0SD 2FBJH 4OD3H 3SGJA 3LPWA 1YJDL 4ZAKA 3HFMH 4PJ7A 3NCJH 5CEXB 3OBAA 1RULH 2A38A 3TT1L 1AIFB 3IGAA 3INUL 3VFMA 1R5WA 5E2WH 1P53A 1J1XH 1KBGL 2VWEE 2F8XC 1RUMH 4L8SB 5E95B 3VXPA 3WBDA 3O6KL 5L88H 3BO8A 4UQ2B 2OQJA 3MREB 1G1YA 3CMOH 1ZXQA 4HD9A 4HDIA 1IEAB 1Q0XL 2R15A 3LS4H 1IAIL 4UZGA 5FEBA 3NA9H 1V05A 1EUUA 5J56B 3P4MB 1I7ZB 3BN9C 2B4CH 3B2UC 1KCKA 4UTAL 4JFEE 4BQ8A 5AZEL 1TQBB 4PD4K 5KS9F 3T2NL 1L4IA 2Z31D 4JJ5A 4RGNE 4U31A 4ZSOE 2WIIA 3MXWL 2I25N 5EFIB 4PGBA 4ISVA 1OCWH 1PYWA 1YEEH 3SE4A 5HHVH 1BJ1H 2H45A 5GGRB 5T1MB 1WWAX 1CFNB 5C09D 1F6AA 1GOGA 5D93B 2DD8H 3BKCL 1PY4A 4WTWA 1YNLH 1K3IA 1G0XA 4GRMA 2ED8A 4JFHD 4O2FB 2A6DA 4AH2B 4RWHA 4YE4H 1VGKA 1PY9A 4LHUA 5I18L 3H42L 3C60B 3PXJA 4PRIB 3GBNH 1MWAL 2ZUSA 3QQ4A 3RZCD 1WFTA 3WO3B 3OR6A 4OAWA 4MNGE 4O02H 1NKRA 2OJEB 1INDH 3O3UN 1CD1A 1DQDL 3EFDL 3QEQE 2EDLA 4W4OC 3PV6B 4OCYL 1N5YH 1ZLWH 2PXYA 1C5CH 1KPRB 4Y2DB 3RDTD 1EMTL 4GMTL 5IB4B 2BRRH 2WK2A 2XN9D 4Z7UF 3I6GA 3QWRA 4YHLH 1NC4D 3FTGA 3MR9A 3TV3L 4PB0L 3FMGH 2IQ9L 4U7KA 4L29B 4P3DB 1Z5LA 4MD5B 5H2BB 5AG8A 5SWSE 1AGDA 4LCWB 4L9DA 1BPVA 5CMAB 1UYWH 4LSSH 4AG4L 4V1DD 4FMKA 5DK0B 4JFFE 2D7OA 2W38A 5HHXH 5CBAB 1R3KA 5ESQB 4PLJD 2Z35B 3RFZC 1J1XL 3MLTB 1KCUH 2CLZA 4QXWA 3QRGL 1F58L 1P6FA 2R1WA 2P8PA 5GS2D 1U91B 3L3GB 1T1XA 3TCLA 5I9QC 1ACYL 5IHUL 1L7IL 1Q0XH 1CVSC 3ZKMC 1U3HB 1NMCC 2OS7A 3RY6A 3U46B 4S1RL 3U1SH 1EA9C 3T4AB 1OOAA 5DEGA 5DK2A 3SBWC 3VRLF 3WJLA 5BZWA 3TWCH 1YPZA 1I1YA 2EYTA 1LO3H 3K8LA 5EPMA 5IFHL 2P44B 1RUQL 3AU1A 3AMLA 5DD3L 4PY7A 4HIIA 4P46B 2NXYC 1A6AB 4G8EB 3PE9A 5ADOH 5FOJA 3MLRL 4HUXB 5ID1B 1YEEL 4I1NB 1JPTH 1FNLA 2ICWB 5IJVB 5CKAA 3QNZB 4E9LA 4HUWB 1KCRL 1J8HA 1XR9B 3U4EA 3WHXA 1AHWB 4U49A 4WV1A 3RY5A 1AIFA 3IGAB 3KPSD 1FC2D 2LV4A 4L4VB 4EI5A 1UH4A 1T6VN 1N2RA 4WENB 5DJ2A 1UWEH 1RK1B 3IXAB 2YN3A 1EVUA 4FQXA 2I24N 5I1LB 5KTEH 3S7GA 3NN8A 5E8OA 1JFQL 5C0JB 1FL6A 3SDCD 2N7AA 3ET9F 1V3LA 2AJSL 3QDMA 2IPKB 3GO1L 4KKAD 4AEHH 4GRLB 4NQDA 3DLQR 1A3RL 3ME0A 2BCKA 4JEGB 5BS0A 2WUBL 4B7IA 1AH1A 2W9EH 1C5CL 3X14B 1QO3A 1XIWD 2W0FA 3X12B 4EI5C 5F7MC 4JFHE 4OLUH 3RGVB 5JA9A 2CLRB 3N9GL 1D5ZB 5TPWH 2OR7A 3HN3A 5IOPB 1D5ZA 4K71C 2FWOB 3O11A 3CX5K 4NJ9L 3D25B 5I75B 1JGLH 5I8EB 1QEWA 2FEDC 4HJJH 3UTQB 4HS6B 4OFYA 4L4TD 4BZYA 2UYLB 5F7EL 4K8RC 1NGPH 3RWGA 3O4OB 4LSVH 3MRHA 2HN7A 1FFPB 1NANH 2WP3T 3ARBC 3T8XB 3S5LA 5L2JB 3K0WA 4PRPB 2G2RA 1A5FL 1ZSDB 1GGUA 4JFFA 1R0AL 5TFSL 4OZ4B 2Q86A 2FX9H 2DAVA 5HY9B 4RGNB 1VFAA 4KVCH 5DD1H 1FVDB 5SWSD 4GAGL 1NLBL 4JFZH 3ULVL 2X4RB 1LO3L 2F53A 4Z76A 3BH8B 4QTIL 1UXWB 4LKCA 4I9WD 3PP3K 2VLJA 3JWOL 4Z7QF 1TITA 4K3DH 4C58B 4YAQB 2VDRL 1YN6A 2J7LA 4PJBE 4X6CB 3P4NB 5HBBA 2RAMA 2V2TB 3WL9A 2BJMH 4KY1H 5DJ6B 1AO7A 4IRZL 4QHMA 4NN6C 4Z9KB 3CLFL 2O5XL 1VFBB 2ZUTA 1BJMA 3MTRA 3ARGB 5IWLA 3IDUA 4PY8I 2P42B 4RZCA 3HLAA 4N0YH 5C0BB 4QO1A 5FYKU 5F88B 1J86A 5GISH 2M8XA 1ADQL 3KVQA 2AXJA 4Z5RB 4ZYKB 1AD9A 5A3IC 4XAWL 2FIKB 4PUBH 2QBWA 4J3XA 1ZHLA 3MA9H 1UH3A 4K07A 3EYQD 4R4NC 5EPMB 3IU3A 3LMJH 2VC2H 4ZS6D 1MSPA 1KXQE 3WMSA 4NQXB 4B7LA 4PTTA 4RMSA 5BS0E 4NUGH 4BUGA 3P11L 1J0IA 1LO5A 3M07A 4KMQA 5KSUB 5I1JH 2KQMA 4GMSL 5JO5A 1T22A 3VRIB 4HJJL 4Q0XL 3AREB 4FP8L 2RR3A 3UCRA 2YC1A 2IJ0C 1NDGB 4YFLF 1AI1L 1I4FA 4OV6F 1NFDA 4YO0A 5DZNA 1MWAA 4XC1H 4LSTH 5EZIH 5SX5K 4KJQD 3MGAA 5T5NG 5FUZH 4JCMA 4N0CD 3GKZA 2OSLA 4MA7H 5E00B 3X17A 4M9OA 1J8KA 4WEBH 4XCNA 5DZLA 1Z9MA 3RBSA 3CLEL 2X9WA 1BQLH 3PGFH 4R96A 4FFWC 4FXLA 5DQ9A 4AYFA 1NLBH 2D4FA 5EOTA 4WHCA 1DJSA 4QHUB 2DMKA 5AAWA 1GZQA 1EPFA 5EFIA 3HMXH 1FZKA 3MODL 3HR5A 4IM8A 3B9AA 5D70L 2CRMA 1WICA 2KKQA 5ISZE 3WFHA 1RZJC 1MJUL 1N64L 3W82A 3VH8A 2GYSA 4MX7B 3WFBH 4OFYD 4HKBA 1UZ8B 1QSVA 4JKWA 4YDJB 4WU7B 1D6VH 4F57L 3EYUL 2V7NB 3MUGB 3VI4E 3STZB 2A0LC 3QDJB 5C6TL 2C3VB 2B1AL 1UH2A 2APVA 1E4WL 1RD6A 1RZGA 1ZSDA 1G84A 1LE5B 3O3DB 4EUPA 4EUPB 4OQTH 2VITB 3TIEA 1KJMB 3MLXL 3TEUA 4G8GE 1OAKL 3PWNB 3BP5B 2XICA 1TPXB 1NCCL 5BOZG 4MB3A 5JOEA 3QB7C 4PRIA 4OIBA 4OKVA 4X7FC 4GRWH 4CN1A 4CMHC 4Y2OA 4NN7B 2UZYB 1S9XB 2OZ4A 1V7ML 4HUVA 2FH6A 1CXIA 3U0TA 1F90H 1C08A 1JPSH 5HHMB 1KNOA 4AIXA 3E3QC 3CFJA 4G6FD 4IOIA 4QT5A 1BF8A 2FL5A 4P9HH 4UIMB 3HE6C 3KR3H 3ZO0A 3JVGC 4KXZH 2CDEA 4NYLA 5HDBE 4YPGB 4DVRL 3SDAD 1KCVL 4J3UA 4P99A 2JIXA 4MMXC 1RZKC 5DFTA 4NBXB 5EZLB 1LO0L 2EDWA 2FIKA 3OG4B 4AT6A 3BMWA 2ICES 3SDDA 2MTPA 2KH2B 1AXTH 1O7VA 4IDJL 4D9LH 4MXWH 5ALCH 4JN2B 5H94B 3ULUD 2KQNA 4NPYA 3TESA 2ZCLH 3SDCA 5B8CA 1IKNA 1I1AD 2DQGL 2UV3A 4CDGC 4M6ML 3MRIA 4PG2A 3EJYD 3DROB 4FQIH 3VCLA 4OD1H 3WFCL 4P5TA 3NPZB 4H8WH 1CF8L 5D1ZA 5J6HB 3MUZ1 4JO2L 4ETYA 3N85H 1GGCH 3VXUA 2FYYB 2QLVB 1KACB 5BZWB 3T0WA 4UIKL 4GG6E 4J1UB 2J8HA 1BBJA 1D6VL 1EBPA 1XF2A 4OI7A 4WWID 3C08L 4PJ9C 5J1TC 4J2XA 1KELL 3O8XD 4K94C 4XCFH 3OAZH 1IKFL 2EEAA 3D85B 5DDHA 2B39A 3M8OH 5IVXA 1OLLA 4DW2H 4JHBA 4E41B 1V7NH 1DFBL 5C2UB 4AL8L 3FONA 1TTFA 5A2KH 2AKRA 5MENB 2D03L 2YA1A 4U6XA 1OPGH 4QXUH 4U6XB 4RDQF 4HLZG 4XI5D 5FCSH 1CFVL 5EC1A 5M94B 3SDXB 4OLEA 1YY8B 2YHGA 4TSBH 4XPGL 1L7TH 5ISZA 2YPVH 4WWKD 4XGZB 1ES0B 1I9RH 2X40A 4BQ9A 2RBLA 3DX6A 1AY1L 5LQBL 1RZ8A 2D9QB 1MEXL 5F96L 1NCAH 4PJXF 2NY4B 3SKNB 1WVZA 3I6LE 1CDYA 3BPOC 4RFOH 1HHIA 3ZDYE 2ED7A 3SKMA 1WTLA 3ARBB 3OMZA 3VI4F 1NC2A 4BK5A 1HHGB 5DUPL 2IFFH 1I7RB 1R6VA 4IDJH 4D9LL 3RNKA 2UYLA 5HVWA 1NGZB 2OZ4H 4LCYB 3V52H 1VDGA 3L6FB 4YHPB 4FG6D 5ACMA 4TUJB 4M6MH 3BEWA 2EDOA 4G9FB 3QCUL 1MHHB 3DRQB 4O9HL 2E5EA 1DL7L 4W6XB 3ZDXF 1LK3H 1WF5A 3UPRA 1C16A 1NFDE 1I9EA 2P24A 4JG1L 5F9WC 4XBEH 4H8WL 3L3OB 4WW1B 1SYSA 2HAZA 1TCRA 3PJSB 1W72B 4TUOA 1WC7A 2HMID 3MNWB 2EDKA 4X6DB 1S7WB 3RUGF 5C0EB 2DIAA 1FL5A 2DWDA 2EE3A 2DQJH 3ULUE 4FQCH 1DEEB 1ZVSB 2N56A 1UM5H 3K2UL 1H5BC 5TF1L 1YEIH 5EU6B 1R24B 1GH7A 5EZLA 3C08H 1G7IB 5EB9A 2JJTC 3FAXA 1R3HA 4C4KO 3LIZL 5DK2B 4OJFL 4EXPX 1YPZB 4LLAA 5I1DB 1JGDB 3P9WB 1T04A 3CFIC 4KPHL 2NYYD 3TZVA 3EOBB 1LK2A 2ZG2A 4Y16B 1BQHA 1FZMA 1IGMH 2GTZA 3AROA 4M9PA 4NGHL 5ESAA 5JW3H 3DWTA 3VCLB 4KQ3L 1X9QA 2GK0A 3CFEA 2V2WA 1R3JB 5ABDE 3EBAA 1LQSR 4IHOA 5CSGA 4F7CB 3WIHL 4U2YA 4MQ7B 4PRHE 3B9DA 3PWUA 2QQKH 1GOHA 2AQ1A 1BIIA 4NBZB 2J4WH 4F37K 5L9DL 5D1ZC 5CZXD 5JPNB 4MNHB 3MJ6A 4PJFA 3PWPD 1S7VB 2W9DH 4LAQH 1S5HB 4ZUTA 1T7VA 2DMCA 4PLOB 3VI3E 5IMMA 3ZL4L 3VXSD 1NBYB 4RFOL 1RVFL 3U46A 3T2OA 1HQRB 2ARJA 4ODVL 2RCSL 5JIKA 4Q2ZB 4XPBL 4Z7VA 1KIPB 2X4OA 5I1GL 5JORB 1RU9L 4X0KA 4HIJB 1S3KH 5JR1L 5DYOB 5JIIA 2Y1VA 1QZ1A 4XXCA 3VWJA 3QCUH 4M1CC 2OK0L 1HE7A 4NRZA 1M05A 3BQUB 3R8QA 2IQAB 4XT1C 3ULVE 4EXKA 1YYMH 4M43L 2XI9A 1SBSH 4PB9L 3O6ML 2A6DB 4AH2A 5JTWA 2VDQL 3MRQB 5FV2A 4QXGL 2XQBH 3DV4B 2IC2A 1KEMH 2GJ6D 5SX4I 4FQ1H 1JZ2A 2CRYA 5T33L 5C71A 1MQKH 5L7XH 5D5MA 5GGUB 1ETZB 4JDZB 5K33A 1P7KA 1AFVL 1BFOA 4PGBB 3CD4A 3FKUS 4N90D 2CKBB 2Y06L 3B6SB 2H26A 1WFOA 1SQ2N 2BVQA 4QYOA 1G0DA 2N1KA 4EZMA 5C6PB 3V6OA 5D2NC 5E99L 5CZXC 1G7PB 3BGMA 2PYFA 4V1DE 5E56A 5BS0B 2G9HB 4PGCB 2WQRA 4MD4A 4E5XA 3OF6A 3RNQA 3I3DA 3DX9B 3TYFA 4HIXH 3KJ4C 3RGVA 1IM9B 4P2RE 4OF6A 3F8UB 3GBLA 3EYSH 2GTWB 4KJYA 1CD8A 3FO1A 4FFZL 2YEZA 1I85A 5D2NE 1RHHB 3NFSH 3SPVB 1OQOA 2W65B 4BFBD 2W65A 3NZHH 1U3ZA 4UIMA 4K9EC 2HWZL 2WWMD 5KS9A 1DLHB 2ILLA 3NCCB 4ZUVB 2YPKB 4URTB 4WO4C 3JVGA 4PV9A 4LLWB 2CK0L 3SDXE 3C8HA 2WINA 1K2DB 3BUTA 4M03A 1IM3A 4D0BA 4L4VE 1IC4L 4P5KB 4Z5RA 5KSAC 4J3SA 5DQDL 1F3JA 3RKDC 2MKLC 5FUOH 2UZIH 3LRSB 4P5TC 4DEPC 4WWKB 4ELMF 5HDQH 1H3VA 4GXUN 4Z8FL 2DD8L 1N4XL 2NZIA 4KHXH 1RHFA 4M8QB 4QRSB 1FV1B 2XXCB 4Y16A 3HA0A 3CK0L 3WIFA 4ZG1A 4DQOL 5I18H 4DJMA 3QFJE 5FYJU 3TA3C 3TGXA 1A7PH 4O02L 5BW7A 1REIA 4P3WA 4LU5H 4ZFOL 2DQFB 3BPNC 4M6OH 1IQWL 4NZTL 5GS1A 5GS0D 4L1DA 4R0LB 1KFAL 3DO7A 1KEML 4CADA 8FABA 3BOVA 1MFBL 1ZHNA 2BRRL 4TSAL 1HHKA 1MQKL 1IMHC 4G5ZH 2ZUQC 5IF0B 2ZUUA 1DBKL 2X1QA 1FZJA 1T89A 3T2QA 1GXEA 3ULVC 1JF1B 3V0VB 3NPSC 3QJFB 5E99H 3RPKA 2VSDA 5F72S 1WEJH 3LAFA 3ARWA 2W9LA 3DRTB 5AAMA 3SJVB 1B2WH 2LU3A 5HI5C 4NUJB 4H0GA 1BVKA 4GJTB 1JRHL 4ORGB 4WUKL 3RL1A 1ZLVH 1WZLA 4KHTL 3O11B 3KPRE 3WFHB 2EXYD 5F1NB 5E2UL 5IVXF 1U6AL 5EIQA 5FF6A 3JV5A 2QADD 5B38A 1JPFB 1JPFA 4FZ8L 5GXBB 5F9OL 1OW0A 1U2CA 2IH3B 5TDOA 4R4BB 1NCDL 3EOTH 3FB7B 1H8OA 2OQJB 4I3GA 1GJIA 2Q3ZA 3WFDH 3MJ9H 1RUQH 3H3BC 3ZKND 4WJ5B 5IKCA 5EZOH 1W0WA 1UJ3A 3NCMA 4P23B 3CAFA 2HJKA 5I8EA 2K7PA 1IGIL 1DQQB 1HNFA 5F89A 1R5VA 4KH2A 4G8GB 3I9GH 3VD7A 5F3BB 2XWTB 3FZUD 5A2FA 1QNZH 1TZGL 1I3VA 2AGJH 3EOAB 3SQBA 4OT1H 3ARDD 5IVXB 3QRFM 4Z7UB 1TZHB 2CMRH 5D9SB 5FB8B 3O4LD 1CGWA 2DQIH 2FJHB 2WW8A 1N59A 1QSEB 4OIIL 1W72A 2XA8L 4L4VD 4JB9H 1AGEB 4JPKH 1F4WH 5CP3A 3DHMA 3DX8A 1SY6L 1NBVL 1VEPA 3CFDB 4K55A 3IJYA 2X44D 3ZKXB 3FO2B 4Q9BA 3U6RB 3PWJA 1MIEL 4W4NA 4Y16D 1XF4A 5F7KC 4GW1A 1NBZB 1IZJA 3LKSA 5FM5O 1R3HB 3MYZA 3TT1H 5GS2H 4LDLB 1OLZA 1KBGH 3VE0B 4UT9H 5FFLA 1DBKH 1CBVH 1KLGA 3QG7L 4WCYH 2CPCA 4K94H 5F8RC 1CXLA 1QRKA 5HTSA 4XP4H 1TJHL 4POUB 3S3PA 4UV4L 3OKEA 3NABL 4JRXE 4M7LH 3MCG1 3MNWA 5C0NC 1MFAL 1VFAB 3BIAX 3BT2L 1WZMA 3BXNA 3TCLB 4G8EA 5HHOB 1ZLSL 3CCHB 4QCIB 3MRRA 4JQIH 2FJFB 3DIFB 4ZS6C 4EDXB 3CXDH 3EYFA 4JO3H 1OSZB 1A6WL 4JPVH 1SY6A 1C16B 2P24B 2XZCL 3VFRA 4QRPE 5JMRA 5ENWA 1I7UB 1U3YA 3I50H 2NY5L 1OCWL 1O0VA 3G5YA 3P2TA 1J5OL 4XXDB 3BH9A 4YEFA 4YBQD 1P7QD 1AXSA 2X89A 3C8DA 3QIBB 3VFOA 3VXTB 3JBG7 3WO4C 3EYVA 2R2EB 4MSWA 3AB0C 3Q3GB 2HJLA 4XX1E 3U36B 3DHJA 2AJYL 3W11C 1H9VA 1IGIH 2EECA 3RUGE 1MH5A 3D39E 2O5XH 4JDTL 5IB2A 2ICCA 4YIQB 3UTTA 4YXHH 5DVMA 3VWJB 4BZ2H 5IW6B 4OB5L 5GJSL 3HR5B 4ORGA 2NY3B 3QUYC 3SDXA 3MBED 4EUPH 3C60D 1U8NB 4U1KB 4U1LB 1NFDF 3R1GH 4MAYD 4R7NA 3THML 3G6AB 3OWEA 5KSVA 1LMKA 2OMNA 4YZFE 5KSVB 3OQ3B 1EO5A 3LKOA 4M7ZC 4R96B 3BIBX 3HUJB 3MV01 1Y6KR 1CDJA 3GRWA 2YD5A 3MLYH 3PNWA 3O9WD 4XVTH 3LMJL 5IT2L 5HVFB 4HHAB 3B4NA 2MFNA 4FZEH 3RWHB 4ODSH 4TPRL 3WKML 5BV7L 3O4LE 5IFAL 5H37H 1TIUA 4OZFA 4PJEF 3CDCA 3D69A 4ODBD 5DC0A 4UV4H 2Q76A 3MRDB 3U79A 5IVXE 3HZVA 2A9NL 1KN2H 1XH3A 4LVHB 3KGRA 4ZS7H 4Z0BH 1KCSH 2PYED 5TF0A 1TXKA 3DMMC 4JQIL 5J6GA 5FXCH 2EKSA 1K4DA 1I75A 3FB8A 5FUZL 5JHDD 2I9TB 4NT6A 4Y5XB 3UJTL 3MJ8B 5KVGL 1LDPL 5ADOL 2NY1B 4HWZB 1OM3H 5IESH 4OKVB 1F3JB 4IEFB 4FQQA 4KDTC 4PRPD 3NTCL 4IIQB 1T1ZA 4WI7A 4OFPA 4P5KA 5AUMA 1ZOXA 1KYOJ 4P2YA 3TH3T 4UI2A 4QRQA 3DETD 3ARSA 1T0MA 1KLGB 1UWEL 1MCBA 4I5BB 5KTEL 1DBML 1YNTA 4Y19A 3UTSE 3CU7A 3OAUH 5HYSA 2PXYB 4ZD3H 2HG5A 35C8H 5EG6C 1I8KA 2ADFH 2CO7B 1A9BA 2R0ZL 1VFMA 3CDGB 3BEWB 2EYRB 4PJFE 4AMKL 1WBXB 3PIQA 5GJSH 2K9UA 4GKSB 4Q74A 4WFEE 3P77A 4YDLB 3FAWA 4HWUA 2XOTA 4U33A 1JE6A 4CUCA 2AEWA 1YY9D 5DTFB 3H9ZA 2VZVA 1UJTA 1B6DA 4KMTL 4K7PL 4U6HA 5JIHA 1VFBA 3SE9L 2GFBA 4NO2A 4LLMA 1X5JA 1FP5A 4I48A 3PXHA 4LVOB 3OAZK 3FQWA 4B50A 4OLWH 1NBYA 4H26B 1JRHI 2HT4C 5GGVL 1GGIL 1DQLL 5IFAH 1UADC 1MLBB 5K9OA 2V9RA 1U92A 2V9TA 3O2VL 2DI7A 5FA4B 3S88L 3GHEH 1YEJH 3KHOA 1F4HA 3B5TA 3REWB 1QFUL 5MENA 3VXOA 5CIPA 1JWSB 2FX9L 3D25A 4ZS7L 1QSFB 4NFCA 5LVEA 4JRYD 4ZQKB 1FE8L 5F6IB 2YUWA 5LBSH 3NMEA 2BNUB 2R4SH 3OJDB 4HFWB 4NOBA 4OM1L 2VLME 1F11A 3B9KC 4MAYC 3CVHA 4LCWE 4KY1L 4L1HA 2PYEA 4NIKB 1S7VA 1HCVA 1JYVA 5E4EC 1MI5B 4FQIL 1M71B 2Q8AH 4DKEL 5IMLB 1I7ZA 4EIGB 1JUFB 3WCYA 5HHPB 3M45A 5HI3C 2ED9A 3P3YA 1CICD 1G7HB 2GCYA 4K3JL 4V1DB 4JN1L 3VD4A 5FUCC 2YPLA 3NIFF 4I0PA 1CK0L 5CJOL 1G1CA 3MV9B 4IJ3B 4IMLB 1NGXA 3HG1B 2DJ4A 3VFNB 1Y0LB 5E7FA 3K4DA 5C0CA 5D7JB 5ICYB 5BMFL 4OGAC 5HYEA 2R4RH 3ARED 1FO0A 3BGFC 1N3NB 3TYGL 3VD5A 3WKNA 3UZEA 4P59H 2H6PA 4I18A 4Y16C 5F97E 3P73A 5DC9B 4RAVA 1XF4B 2X1XR 3BVNA 5D7IB 4KFZC 4OCRL 4HG4J 4HF5H 4OF7A 5IUSA 1DEEA 1ZVSA 3UTSD 1P4LB 6CGTA 1GPOH 1CIUA 2HFEA 5HGGS 3RZCB 1BGXH 2QJDA 3RVVD 1X5KA 4D0CB 1GGIH 5HY9A 3MOAH 4OZFH 1D6EB 2IBZY 3QQ9D 5C0RL 5IEKB 3GSUB 1ITBB 2NXZB 3IFOB 5C07D 4M7JL 4TUOB 5FYLD 1YEJL 3RVWC 4YGAB 1HINH 2NMSA 4QWWC 3DETC 1QFUH 3GSVB 1UFUA 3QUZA 5I15H 1SEQL 4EVNA 1FN4A 2MOVA 2CKBL 4MAUH 2VDNH 1A9BB 2X89D 4PS4H 4E41D 1QLRB 3CH8A 1XIWC 4P2RA 4NQCE 3NFNA 5DRNA 5CP3H 4KJPD 1CE1H 1FNSH 4ELMA 1FZOA 3SDAC 3ZYZA 4MWFA 1HOCA 2CJUH 2XFXB 2NY6D 3QDGD 4YXKH 4XP1H 1MNUH 1NAML 4I9WE 4YR6A 2R4SL 4DKDC 5DD5H 3C6LB 3PDOB 2C1PA 2FZ3A 1QBLH 1PFCA 3QG6A 3G5VB 4YHKH 4JO1L 3DURA 4MLSA 1TMCB 2FD6L 4P4KC 3DBXA 2JE8A 1CWVA 1A2YB 2P7TB 1RZIB 2DI9A 2BVYA 3F58L 3WEXB 1S7UA 5E6IC 3RVTD 5L8LB 4FOMA 5DR5H 3F12A 3LKNA 4LLQB 2FX8H 2XPGA 4J6RH 1YPZE 1E4WH 2B0SH 4NUJA 2WSKA 1XGPA 5IHZA 3MZTA 2E9IA 2XWBA 2JK5B 4HWBL 1U0QA 4APQB 2BDNL 3NIDF 5ESVB 1YEIL 2R4RL 5CILH 1C5DB 4LSUH 4RBPK 5E8PB 1KIQA 4WU7A 4TUKH 4U1NB 4HAGA 2APTA 4RMUA 2JB6A 5E9DA 1JGEB 5C09E 1T2QL 2BZDA 2KZWA 2GKIA 4M5YH 1SMOA 4HKXB 3FQXB 3ZDYF 3FQXA 1JCKA 1YMMB 2C7UA 1P5VA 3RIFK 3T04D 1NFDB 2EDEA 3KYMA 1I1CA 5I17B 1XEDA 5A16B 1AXSB 3QIBA 4ZFOA 3X3FL 4CU6A 4K8RD 4KQ3H 4X7DC 5IMMB 4LGSB 3VXNB 3MLWL 3OGCA 4DVRH 1JNLH 4M7JH 3W2DH 3K80A 4UT6H 4Y5YB 4S10A 1DQMH 3QXAA 4WTZA 1UG9A 4PJAA 1QKZL 2H1PH 4AY0A 3W0WA 2VXQH 2QQKL 4PG9A 3LN4B 3O2DL 1MH5B 5DUBA 4JM2A 5HYJE 4RGMB 1P84J 1ZMYA 3A6OA 4EN3B 4F7EA 1MI5E 2ZCLL 4U1HB 3TO2A 1CG9A 1J8HD 4PJDB 4BSVB 1BZ7A 3ZL4H 2DIJA 5FYKL 5EU7C 1B3JA 3VXQA 3GB7A 1MNUL 5I0ZA 1JTPA 5GSVB 3MJGX 2QHLA 1DANU 1VESA 4RIRA 3VGBA 4J23A 3QDJD 2NW3A 1KTLA 4F3FA 3PGCB 3FL7A 2VXSL 1OAXH 2JJSA 1A6VL 1T80A 4E41E 4NNPL 5D1XA 1JHTB 1R5IB 4XPTL 3ZLQC 2KZ1B 4QRRA 3MRKB 1YYML 3UP1A 2JELH 2W0KA 4WGVB 3EO0B 2VDQH 3WDHA 4WI4A 1YEKL 4F8QA 1BFVH 1A64A 1K2DA 5F9AC 1IKFH 1U8KB 1WIOA 1X5ZA 4C83B 5T33H 1EIBA 3M8OL 4K23L 1GHFH 3NH7H 1N59B 1QSEA 4YDIH 1U8OB 4LCIH 4UT7L 3FN0L 4RNRB 1OTSC 4X99B 5IK3B 5GRZA 2GIYA 5IM7B 5I1IH 1RHHA 3SPVA 3ES6A 3QEHA 5IB4A 4F7PA 5JZ7C 4JM2F 3QEGL 1YC7A 3GMPB 4NNYB 3SQOH 1S7SA 1YMMD 2MQ3A 4M48L 5CZVH 5DRXB 4JHAL 3OG6B 4HS8L 3LKSB 5FHBL 2UVFA 5HDBF 4MCZA 4X98B 4PJGE 1CI5A 2AJZA 3D18B 4HT1L 4OTXH 3HNSL 5J1AB 1RZIA 1LVEA 3PHQB 5HVGB 5CEZE 4HS3A 2JJVA 3QZWA 1SJVA 4UTBH 4I0CC 2AW2A 3D2UD 1YNKH 4WTZG 1LEGA 3PDDA 4JRXA 4DN3H 2XKUA 1Y6NR 1TFHA 3V7MA 3QIUC 1X44A 4IS6B 4ELKB 1QSFA 2CK0H 5IHZB 4BM7A 1H3TA 5F1NA 3QUXB 5DSCB 5JHDB 4K8RL 4HC1H 4S0TD 4HULB 3GJFA 4G42A 4LQFH 2OTUB 3O3EA 4GH7B 43CAA 5T1DL 5DQ9B 2XYCA 5FUOL 5C1MB 1KLUB 1PW3A 1KSRA 1P69B 2XQYK 1AGFB 1J88A 1RUAL 4XMLL 5CGYD 1BIIB 5TE4H 1MJ7L 2EDFA 3G04B 2RIKA 3ARGD 3C6SB 4U1IA 1FNAA 3C8KB 5FHAH 3C6LD 2ZUQB 2UY7A 2O61A 3QIBC 3RI5K 5C0AD 2YBRB 1A6VH 3GHBL 2ZSWA 1I9IL 4XMPL 5IV2A 4NWTH 4QRPA 5B38B 1S78D 4G8IA 4AIZA 4XPTH 2BHZA 1PG7X 1WZ1L 2EDHA 2J8UA 1J10A 3MLSH 3VGFA 1ROWA 3MNZA 1I1FA 4PRHA 2AI0L 5FYJD 1N7MH 3MLVL 4TRPH 1FJ1A 1MFBH 1FPTL 4I18B 4FFVD 4GBXB 4K23H 3BKYL 3RPIA 1IGJA 1IT9L 2R23A 4PGDB 1MHEB 2EDBA 2NY3D 2HRLA 5IB3A 3UZVB 1R24A 3BN9D 2H32B 2OR8A 3SY0A 1ZE3C 4LLYA 1T7WA 5DMGC 4M3KB 5I30H 5MHSD 1B2WL 4JFPA 3DSNA 5C2BL 2Q86B 4KK9D 4HT1H 4O2EA 4Y1AA 5EWIH 3HC0B 1UB6B 1MFNA 4LPWA 1TQCB 4MJIE 1HHJB 5BW7C 1NFIA 2YPKA 5K9KA 5IQ9B 3HE6B 5FGBC 12E8L 2HJKB 3BEVA 2XY2A 3O8XC 4Y8AA 4ZTOL 3QEQD 4JREB 5E1AA 5LAXB 3SO5A 1CFTB 5E4IA 3MO1B 2O5YH 4KKNA 4YUEL 1U58B 3MACL 2RCSH 4NQEE 2XN9E 2UUDK 4JPIB 4K8RH 1X5IA 3PJSA 1VA9A 4IMKA 2IH1A 3H0TA 1R3KB 1U91A 1QVOB 3TO4A 3LVEA 3GBNL 5B8CB 5FGBA 4PR5A 1BWWA 2FNBA 4HWZA 1SHMA 4Y4HA 3QWRD 4G9DA 1RUAH 4P2OC 3FQTA 3MC0A 2WINB 5J1AA 1KENL 4NKQB 3RDTA 1D5IL 3H7BB 3TO4D 5I1EL 4XWOD 4KDWA 3SGKC 4ONHB 3GJEA 1ZANL 3C09C 1CT8B 2C26A 3DUSB 3TF7C 1CGXA 1QD0A 4JCLA 3WLBB 3DRTA 3JWNC 5GGTH 1D9KB 1SY6H 1NBVH 1FIGL 2CDGB 2OL3A 3T4YA 4M4RA 1P5UA 4JRXB 3HE7A 3QUMH 4IBLT 3IJHA 4ZOCA 3TH4T 4NZJA 5IW1B 1JPST 4EUPG 5KN5A 2HKHH 3B83A 1QLEL 3QG7H 2Y36L 4OSUH 4XRCA 1HILB 2DQFA 2JB6B 4MMZC 3PNWB 3RY4A 1TJHH 3SJVA 1T21A 2LU7A 3HUJA 3LEXB 5IHUH 5HGHB 4JRWA 3G5ZA 4XZUB 3KJ6H 1HH9B 4FQXB 3NVQA 1W0VB 3NZHL 4ZUTB 2DLHA 3AS3A 5I30L 2JK5A 1H15B 5KJRH 2J8UE 2VN7A 3LQAH 3CU1A 5E00A 3HMWH 4X5LA 5FYJE 3WJLC 4XC3L 1M6OA 4X6EB 3VXUE 1E4XI 1JGUL 1QQDB 2EEDA 1VHPA 5KANG 2DLTA 4F8TA 4BZ1H 4Z7UE 1MCDA 1G7QB 2F54D 5IBUG 5BZDA 5JQ6L 1E27A 3VXSE 5EOCH 2X4PB 5JNYB 4EN3A 4F7EB 3CVHH 3QI9C 4JAMA 2A9MH 3DMMD 5HDQL 4HPOL 5DUBB 3BPLB 5HYQA 4AZ8A 1DCLA 2QR0B 2FATL 4OCSH 1C5BL 2EDNA 4KHXL 3GGWA 2EDYA 1T66D 3WNLA 4LLWA 1FFNA 4ZFFA 2AJYH 3L1OH 1K85A 2ICEB 2LVEA 1A4JB 4Y1AE 3L3JB 4NM8H 3RWEA 4LCUA 3R06A 4ALAH 3ULVD 5ACZB 2QKIB 2BNQD 5HHNB 4G80B 1D5IH 3RKDD 4U0QB 3D3VB 5LXGL 2RGSA 4KDTA 1NEUA 2GJ6E 4O2EB 2PNDA 5I9QB 3MFGB 4LLDA 3GSXB 5I8OL 4G5ZL 1FVCA 4G7YH 1IKNC 4XP5L 3ZYJA 5DO2C 2DJUA 5HDOA 2P5WB 2MPAH 1MCCA 2IBZX 4M7LT 3QDME 4JHWH 1LE5A 1B0GA 4X9IA 5FA3A 1GGBH 4XP6H 1G0YR 1S9YA 5JXEC 2AJXH 2CUHA 4ODTH 1JRHH 4YHNB 4A6YA 5IMOA 1XGUB 4PGEB 4XPHL 2A6KB 5EUOB 4WHTB 3HI6H 5FECA 1L6ZA 4U1MA 2RB8A 3SGDI 2BHUA 3DUUB 1QPPA 3H3PL 2NY7H 5FYLL 3F5WA 1MCWW 3K46A 4Y4HC 1J05A 4JRYE 3LN9A 3EGSB 3MV8D 5IR1A 5DYOA 5E08H 2AS5M 3WLBA 1ITCA 4KDVA 5MEQA 1DBJH 1XGPB 1PKQA 3GI9H 4LF3A 5JDSA 2O93L 1JWSA 3EFFA 4MYWB 3OB8A 4RCAA 3C5ZA 3FB5B 1QP1A 1D5BA 2VH5H 3D2UA 2CLVA 1JI2A 4HH9A 4U1KA 3MRMA 1I85C 3QULB 1QFPA 1I7TA 3NTCH 4JY4A 2FATH 3QXTA 3W9EB 4PJFF 4HV8B 5GRJL 1LEKB 2ENSA 5IW1A 1MF2H 5JXED 3DXAB 1ZLVK 5SWQA 2CLRA 2VLKB 2Q8BL 3QFJD 3HB3C 4U1JA 3OKDB 2O5ZL 5J89A 3TCXA 4PGJA 5CGMA 1RV6X 5GRUH 2GT9A 1RJYA 3QXDB 5DRZB 3LKQA 4U6HB 3ZDXE 4NC2B 1F4WL 5IIEB 3REVB 1FFOB 3NGBC 2R0ZH 5HYIA 4X7CC 2QSCL 4MCYA 3EYVB 3QDMB 2WBJB 1MAMH 4XAWH 4LGPB 3V6FB 4XGZA 1DP0A 2P48B 2YD1A 1MCEA 1NAMB 5CBEA 4PFEA 3VU2A 4OUOA 1GAFL 3GJFK 4Y4FD 3KNBA 3RHWK 1MCKA 3W0WD 4M6NH 1TTUA 4G7YL 5A2JH 2EXYC 3NBNA 3HC4L 1JGVL 4IOFC 4LSQL 5DA0B 3X13A 5D7SH 3TO2B 1R3LB 4Y19E 4OCXH 4OBSA 5C07A 5KVFL 5AWNL 1YEDA 1MFAH 4UQ3B 5F8QC 3W9DA 3ARVA 1NL0H 1VACA 1A3QA 3D85A 5DDHB 3BQUD 3QNXA 2YZ1A 4MA1C 2EXWD 2AJXL 4ODTL 4AIZB 3V8OA 1ZLUH 1I9JL 2W0FB 1K4CA 2GUOA 1JZ5A 2ITCB 3L7FA 1J1OL 2H32A 4OCMC 1WBZB 3GHEL 3QZWG 1RUKH 4PJEE 5SX5H 5IMKA 5CCKH 4OZGA 2D0FA 1D3CA 4G6JH 4QOKA 4G80A 4HH8A 3MRJA 5A16A 4MS8D 4ONOA 3VA6A 2F5BL 1U8JA 1N3NA 4MLIA 3DGGB 4UUJB 1W0WB 1J5OH 3U4BL 1UXSA 3OZ9H 3BWUC 4TULL 3EYQC 3P73B 1MCNA 3BZFA 3WIHA 5HYSB 4JVPA 5TGBA 1EVTC 2HT2C 1NGZA 4PJCA 4Z76B 2NCMA 5LBSL 5AD0B 5DFWH 2Q6WB 3O4LB 4NKIL 3GI9L 4JFDE 5I76B 4XBPB 3FCTB 2XZAH 5J06A 5D71L 1KT2A 3MV9A 4LVHC 4G8GD 2NZ9D 2CUIA 5GGSB 3V5KB 4E42B 5CD3B 5F9JB 1CG9B 4L3CA 1BMGA 3TN0A 1TPXC 2I9TA 2CIIB 1S7RA 2NTFB 3QUYA 4JFXB 4YHPA 1FH5H 1QSEE 1T6WA 5FECB 4JQVA 4R2GD 5D6DC 1U9KA 5IBLC 2XZQL 3OPZH 4RDQG 1JV5A 5C9JB 1DBAL 5D72H 3WEXA 2F58L 5CEZL 3BAEH 2Q87A 4LIQE 4ZFGL 4DWHA 4L8CA 4QXTB 2DS4A 2AXFA 3OL2A 5HPOA 2AV7A 4X80H 2P8PB 3C60C 2BVPB 1G7MB 1JHKH 5EU6D 4LLMB 4HEPG 1A6TB 1U8PB 5D93C 4PJEB 5LGJB 4YHOH 1U8KA 1I8IB 2A6IB 1QO3B 1WBXA 5T1KA 2YSSB 5D7SL 1S7QA 3TH2T 2FJGB 2OTUA 43CAB 1NANI 4DGYL 2ZUVA 2E8ZA 3PL6A 1DUZA 3T0AA 4Q6YA 4PJDF 2Y25A 1RK1A 3IS1X 3BP7A 3QJHA 2FWOA 4JFOA 1QHOA 4X6DE 1UKTA 3L9RB 2PXYC 5I1KH 4K2UH 3V6OC 4W70A 3EO1B 1G6RA 1M7IA 5D96B 3BD5A 4FHBD 1HXYB 2X4SA 3PABB 3BIKB 2HLFD 5HHOE 5KVGH 5TE7H 2DYPB 2X1WL 3OGOE 4Q6IC 3KS0H 2VO5A 1OP3K 3RAJL 5GZNC 1YA5A 1NDGA 1JI1A 3PWLB 4PP1D 4CVZB 2D31A 2NY1C 5ACLA 3B3IB 3RVTC 5H35A 1K3ZA 5I19H 3GSNL 1K4DB 4XVUD 4BFGA 5JHLH 4GAYA 4PJXA 1A7RL 1QRNA 1G7LA 1KJ2A 4ZTPH 4PREB 4F33A 4JANB 5C0ND 3KLAA 5GGRY 2HTLD 1LGVA 1HYRC 3TNMA 2PR4H 1FYTE 1NMAL 1QFWL 1B0RB 3MOQA 2VAJA 5GGSY 4LPXA 1LO4L 1NGWB 2YPLB 3LH2H 3IKCA 3KPMA 3WXWH 2BRQA 3WS6A 4I2XE 4WI5A 2B0SL 4HHAA 1PKQE 5BO1H 5DEFA 1KEGH 1QHPA 3VFGH 1UKSA 4XX1G 3HR6A 5DFVC 4WO4B 1RURH 2BK8A 2QADC 3VD3A 2WUCH 5MP6L 5C0CD 1RIVL 4DK3A 2A83B 1W2KT 4R2GC 4WW2F 2IG2L 1CFSB 3F7VB 4UBDD 2HT3D 1Z9SA 2NW3B 2DQCL 1KTDB 1YN6B 4YPJA 5A40E 5AYUH 4HWEL 4K3EL 5DUML 1XH3B 3Q6FA 3O0RL 4X4ZA 2IALB 3IFPB 2HA1A 2ZJSL 2AXGA 3SHSA 3S88H 3V6BR 2EDTA 5SWZB 2VR4A 4OF0A 1OF2B 4J4PA 2DRUA 2H8PB 3KPSA 1AC6A 4HXBH 2IADB 1UZ6E 3BKJH 3CFDA 3HAEA 5D2NB 2NY2B 3EZ8A 5CJ8A 4G9DB 2J6EA 2CDFA 3H9HB 3DVIA 4HGWB 2DMBA 4K2UL 3DBXB 1D5MB 4GRWE 5JHDE 1JF5A 1EFXB 3T2NH 3AGVA 2DLFL 1F6FB 4DUVA 1C12B 3H9YA 5I16A 4L8CB 3HZYB 3U9UB 1AJ7H 2WMPA 4ETQB 3IU4H 4ETQA 1UC6A 3QYCA 5LAXA 2ARWA 2IGFL 3EJJX 1FAIL 5ECJE 5T1KB 4OLYL 3RWDA 5LGJA 4LFHG 5FOBB 3GMNB 5E8PA 4IHOB 4F7CA 3BDYH 3BP4A 1A1MA 1MREL 4U3CA 2J5LC 3MX0A 3ARFA 1LO4H 1T0PB 1YEHH 4RISH 1EEYB 2VXTH 1IEHA 4WVRA 5EUKB 1LE9A 1RK0A 4HZAA 3BH9B 1IAIM 4KRPD 3UTTD 1YEGH 2JELL 5E8OB 4P59L 3N1FC 3O2DA 4NQXA 4KKAC 1R5WB 3DVFA 1RURL 4Z7QE 3FMGL 1ZA3A 3VXUB 1WFUA 4UT7H 2DM2A 5AEAA 2CXGA 1CGUA 2X4PA 3NCEB 5JNYA 1E27B 4PD4J 3TBTB 1VENA 3Q0HA 4JM2B 3RIAK 5C0RH 3UYRL 3W9DB 5D1QC 3BZEB 5I0DA 5JQHC 3FRPA 4PJ7E 5DVNA 1BAFL 5T3ZE 4FNLL 4ZO8A 1VCAA 1INEH 4OTXL 1URLA 4OLXL 5B3JE 3W11D 1JBJA 1YEFH 2C4XA 4LBEA 1UCTA 2HTKD 5GIRB 7FABL 2B1HH 3BFOA 5TH2A 4UTBL 2ZUXA 3UJJH 1INQB 2R29L 1U3HD 1UEYA 1MCLA 5ACZA 3UO1H 1D5XA 2F8VA 1U3HC 3MV11 3IRZA 5M7QA 4MA3A 3K74B 5KVMC 5HI4C 5DD3H 3IJYB 1IC7L 2RHEA 3O3BB 1VEMA 3ILQD 3MGOA 3ZKMD 4JZJC 1S3KL 3EOYG 3GRWH 4P4KA 5TE6L 4AM0B 3BZ4B 2FD6H 4QRUA 4I0PB 4RGOL 3MLZH 1ZT1A 2OK0H 2VN4A 3VDBA 3BKMH 3KJ4B 1KJVB 1WGOA 4UNTA 5K9JL 1EXUA 5D6DA 4M43H 2D7TL 3QHFL 2BSRA 1VADB 3S37H 4AIOA 3I6GB 3UTQA 1DLHA 1CDBA 2HLAA 4LCYA 3BH8A 1IL1B 3P40A 1SJXA 4IMKC 3T08A 1Z0NA 2VKXA 4Y4HB 1TVHB 3SKJH 3HPLA 2LFGA 4J4PC 1ZVYA 3W5NA 4Z7NF 4UDTA 32C2A 4G9FE 1MCWM 2W9EL 3JTTB 4YFDB 3V4PH 2W0PA 3WD5H 3L5IA 1MQ8A 3EGSA 4TRPL 4OLUL 3TBWB 4PJ5D 3KYAA 5DD6A 1BFTA 2NLJB 2Z4QA 3UYOD 1U8PA 4AQOA 3QQ9C 2MHAA 1Q9OB 2BC4A 5EO0B 1AQDA 5C0JA 3IJHB 3U9UA 4KROC 4F7MB 3LS4L 4FTVD 4GLRH 3QQ3B 1QLRA 1WT5A 2P8MA 3QUXA 3J7HA 5DSCA 5EDXA 1QBAA 3OKMB 4LSVL 3EYFB 4ZUSB 2BFVL 1CDCA 1DQML 1BAFH 1GVIA 1TENA 2ZPKL 1BX2A 3FONB 5AZEH 4RNRA 5J13C 3NIGF 2Q1EA 4HJGA 1QKZH 4D3CL 1AGBA 4DN4L 1FNEA 1MCOH 4RFNB 1I8MB 3FFCD 4K9EL 2B1HL 3DROA 4YBHA 5HVHC 3BXNB 1TETH 2VDOH 4DAGH 1WTGT 1JZ7A 4HUXA 3BQUA 4HKJA 3S4SA 1AO7E 2B2XH 3MRCB 4PJ8D 2LQRA 5IJVA 4ZDHB 4M1DH 1H8SA 5ID1A 4X98A 3AY4A 4PJBB 1XF3B 4X6CE 4YUEH 5T3XE 1A1NB 4N9GB 3GMMA 4A6YL 3VXPB 4P9ML 4J1UA 3IXAA 3AM8C 1OTUD 2VDKH 1CDHA 1DVFD 4FFYL 3JWDC 1I1AB 1QRNB 4YHMH 3NACL 1YMHB 1N5AA 5TDNA 2WM0A 4OCYH 2OSLB 5GS1C 5F6HJ 5GSVA 5HYFA 4MNQB 4H20L 3WIIH 5HD8D 1CGSH 2OJZH 4WTXA 2E7BA 2FH8A 2PTTB 4QEGA 1Q1JL 4Z7WB 3NA4A 2A2QT 2CO6B 3EIFA 2DWEB 4JFPB 5I1CH 2HVJA 1A14H 5FYKD 1H5BB 4HCRL 1MJJA 2VIRB 4Q9RH 3V4PL 1BWMA 1WC7B 3JWDL 3GMLB 3QP3A 1UYWL 4GKNA 3VGAB 4P5MA 2BSTA 4Y5XC 5JW4R 1NSNH 4ZUVA 3GDBA 3QUML 3W39A 2VC2L 3SO3B 3NAAL 5I74B 1SYVB 4X6FA 2J5LB 3BUYA 5FHBH 5GRYA 4G6AC 1J18A 1MHHA 2XTLA 3DRQA 4KI5C 3TJEL 2IPTH 1AP2A 4GMSH 4MJ5A 4YAQA 4MDIB 1AR1C 1RZ8B 2GAZA 5E2UH 4I3RH 3U0TB 4S1RH 3U1SL 4NQDE 1JNJA 4X5XB 1NAKL 4X5XA 2BNRE 3QUKB 3MUY1 3IS0X 3VXMB 3WYRA 4CVXA 1KGCD 1KLFA 4X9GA 5L0QC 2PYFB 4XC1L 5D96C 3HMWL 1HKLH 1MRDL 3STLB 2COQA 4DN4H 5MEPA 1JGUH 1BQHG 3LB6D 2V5MA 4M61A 4PLKC 4FABL 5I73C 3JTTA 1N6VA 4KJQC 2WNGA 2EE2A 5DJYA 2MCPH 4PTUB 3AAZA 3LKPA 3U7YH 5DHVB 3STZA 2QSQA 1BQLL 3PGFL 3WL9B 3GMRA 4G7VH 4FTVE 5IR1B 3S8WA 3FQUB 1IRAY 2FB4L 4PV8B 5D2LF 1H3XA 2GSGB 3NCYS 5IFJB 1JZ3A 3FO0L 2EYSB 4A6YH 4ODXB 3KDMB 2XRAL 1ORQA 3CPLB 5FGSA 1PKQB 5EO0A 4JPWH 4PJEA 1AKJA 1LDSA 1I9IH 2H3NA 1IEBA 1S7TA 3G9AB 4Q2ZA 3KPOB 4N0FB 4JB9L 3VRIA 4FQJH 4ALAL 4QHUA 3O3AB 3KHQA 3MLSL 2DDQH 4X4YA 3B9EA 4FQPA 2P1YA 2V9QA 3QXUA 4ELME 1WT5C 3VXOB 1YNTB 3I2CH 3VXSA 5DJ8A 2B1AH 2OJZL 1GRWA 4HBCH 4YQXH 1S7XA 4EEEA 3D39A 2DQHL 3TZVB 4OQTL 3W0WE 1CFBA 4WW2A 3MLXH 4NNYA 4HCRH 3SDXF 1NJ9A 4NJ9H 4XP5H 3RDTB 4QHLA 4Y7MA 1MFEH 2DLEA 1MIML 1NSNL 4JDVB 1V3KA 3F6LA 3CX5J 4JFEA 3WSQH 3SDDB 2DQDH 3QCTL 2R2HB 1GGBL 2NNAB 4GFTB 5ITFB 1BEYL 5ICXB 4F2MA 1GCFA 4XWGL 1Y18A 3GSRA 1EDQA 3BZEA 3K81A 1R3LA 4TNVF 1PKOA 4R6UA 4KI5D 2H2SC 3KYKH 4MA8L 1HYSC 1A4KA 3PG2A 3SGJC 5EU4B 5FO7B 3VDCA 4LVEA 5TH2B 2NY5H 2IPUK 3MRGA 5DO2D 4GBXC 1H0DA 2BMKB 4UINL 4HUVB 3L7FB 4OZGB 4WHYG 4I13B 3CVHB 3BE1L 4XCEA 3LEVH 4S2SA 4MA1B 1ZGLP 3NFPB 3TZVC 2FO4A 3KLSA 4LPCA 4P2QB 3OXSB 4MD0B 1KPUB 4K3HA 1HXYA 3GNML 4PLNC 2APFA 2R2CA 4I3SL 3R0NA 2NY4C 3CZFB 4OD1L 3E2HC 3QFDB 1ES0A 5F3BA 1F4YH 2BNRD 3T65A 1CE6B 4FXGB 4OB5H 2DQTL 1T1YB 4NHCL 3SEPA 4OGYH 2H2PC 3DOSA 2V7NA 2ESVD 3CZJA 4M00A 2F19L 2OLDA 4N8PA 5D7LB 2Y23A 3DSFH 5D7LA 4CU8A 1S5IL 3QUZD 3R1GL 2W07A 3EJYC 5CP7B 4ZXBD 4J4PD 3SOBL 4LKCB 4TSCL 3B8YA 2XKSA 3JV6A 2F53B 5JLZB 2HJFA 3QWQB 4ORZC 4NRXB 1FFRA 1IM9A 4QRUB 3ZKQD 4D0DB 4Z7UA 4H1LG 2W60B 2W60A 4FZEL 2Y9RT 4M6NL 3ECBB 3B9KA 3GUTA 2GW5A 1JYNA 1KPVB 3V7AE 5DK0A 3HC4H 3QDGB 3ZDZF 4CADB 3QWOA 1OAQL 4C55A 4TVPH 2ZCKL 1U8JB 5LGKA 5INDA 3WUZA 1HIMH 1WBYB 2HLAB 3GSQB 3EFFB 1OPGL 2P45B 3VFSB 2EYRA 5IQ9A 5DRXA 3FB5A 2R39A 3LQAL 2ZG1A 4LSTL 5EZIL 2EICA 3LPFA 2ADGB 2PCPA 4FFVC 3IXTB 3A6CH 1I9RL 1YUHB 4PJ5B 3RTQB 4EI5B 3PP3H 1DQTA 1ZV5A 3FB6A 2QQNH 2N7BA 2PTVA 1JMXA 1HXMB 3SDCB 3OB0K 1KG0A 1XCQB 2P5ED 5H94A 3RL1B 2Y07L 2ZSVB 2I60L 4H88H 2D2OA 2OI9B 4UINH 5D2NA 3VFTB 3FQRA 1DN2A 4IRSD 3BE1H 2XACC 4GS7B 4NQED 3AMKA 4HW6A 5EIVA 3HG1E 1KC5L 5CBEB 1SEBB 3M17B 4GW4A 3T2PA 4KK6D 1F45A 1J0HA 3MRFA 4Z7VB 1OAYL 2P46B 5C70A 3IVKB 5C08A 4UQ2A 4Z78B 1YN7A 3QPXL 4XMKH 4PBXA 5JOPE 1FNGA 3G5YB 2ADFL 5KVEL 2V17L 4HUUB 1HHKB 4UILL 4JANA 5CJQH 3TZVD 2GSIA 3GGWB 1U8MA 4JVWA 1B4RA 2DM4A 1FDLH 3MV7E 3T0ED 3TJHD 3EDFA 2Q20A 2V6HA 4R4FL 5EU3B 2OTPA 5CEZH 1UM5L 5D1ZD 1P2CA 1XR8B 3R06B 2FSEB 2ICWI 5EZJA 5C7XL 4LLYB 1CR9L 5HHNA 4PG9B 3LIZH 3SDAA 1GL4B 4Z77A 3G08B 1I8MA 2EKSB 3HNVH 1G7LB 4Y5YC 3GSOB 3MBXH 1DQLH 3L3DB 4BSWB 4LHJB 3BI9X 3RPIB 1FFOA 2EH7L 1A9EB 3GB7B 4JRYB 3DX9A 3TYFB 5DD0L 4PJBA 1IGML 3MRQA 1OAQH 2AEIT 4MX7A 1EGJL 4BYHA 4JRXD 4UU9B 3TM6A 4CAGA 4HKXA 4RWYL 5EU5A 1MPAL 3ILPB 4L3AA 4CNIB 2VLJE 1KCVH 5I1AB 3HG1A 2VRAA 2W0LA 4DKAA 3DYOA 4UOW0 5I66B 4XNYH 3VXUD 1NC2D 3E6FA 5BXFA 3IDNB 1ZHBB 3DX7B 1UM6L 4WFFD 1OGAB 5L9DH 3OKOB 5C6WH 1QSZA 3L3KA 1FRGH 2HT2D 4BH8B 3BUYB 4KROB 4LAQL 5DJ0B 3ARUA 2Z0BA 3OKLB 1FGNL 4XCCH 3GM0A 4ZOEA 1CICC 2VISB 5GRJH 3S37X 1LNUB 3CIQA 4WFGD 3QXVA 1FYHB 4NDMB 5F6IC 1HWHB 4U1GB 3MCKA 4LAJH 1F4XH 5GJTL 4ACPA 5HI5D 5J9PB 4GOSA 4PPTA 5T1KD 3BQUC 4PR5B 4NZUL 3HAEB 3SJVE 1ZA6B 4AEIH 1BJ1J 2R0LL 2BNQE 2FEDD 4UILH 3CNKA 4MB5A 1S8DB 5D6CB 1B4JH 1HQRA 2EDRA 4LSPH 2G5BA 1C8PA 1BQUA 4XNUL 4OZHA 1RJLB 4XBPA 5B22A 4F37F 3WXWL 1E4KA 3QZWB 3NZ8B 1H3UA 1CGTA 5E2JA 1AE6L 4X6DF 2K1MA 5DRWB 3QO0A 1F97A 3VFGL 4GQPH 4YHLL 5L7XL 4NKOA 4HKZB 1XGYL 1JGDA 5IROC 3I02B 5JPNA 3I84A 2W91A 4OCXL 2V5TA 3R0MA 3QAZB 1KJ2L 2FJFA 3DIFA 1AHWA 3TBSA 5EBLA 1KN4H 1KCUL 3OHXA 4OV5A 4LVNC 1L7TL 4TYUA 2ESVB 2YPVL 4LRNL 3CFCL 3EYSL 5I15L 1AY1H 2BXZA 3VXRD 4L9LC 1I1AA 1FSKB 2NXYD 1FL6B 1KJ2B 1UM4H 5C0GA 5ANMA 2AQ2A 5ANMB 3WNPA 2IMNA 2SEBA 3L95A 3HUJE 1FNSL 3PL6D 4JR9L 2YSSA 2VKWA 3RNQB 3W81A 3IFNL 1OVZA 2UVEA 4LBEB 4Y88A 3UPAA 5F7FA 4IRJB 2F15A 5FYJL 1GGYA 4KWUA 2W59A 4WJ5A 2X9XA 3NCFB 4NBYB 5HXMA 2BY2A 2UZIL 4QRRE 4OZIB 3G6DL 3QUYD 3U2SB 5E9DE 2GK2A 4OZHE 4HX1A 5CEYA 4YFEA 3X11A 1HSAA 2L0DA 3BRFA 4E0RA 3UZQA 1KCRH 1NQBA 2IGFH 2AJUH 1E0OB 1DQQA 1G9NH 2MMXA 1NLDH 4X4XA 5DR5L 4G8GA 1NUNB 2Q3AA 4Z7VE 4UOJA 4TN9A 4HQQH 3J8F7 4OCWL 4PRDA 3EDKA 1EEQA 2DQJL 4XTRD 1NCUA 3BDBA 5I71C 4JKPL 2R0LH 1NCWH 3GIVB 3VFNA 4Q97A 1B9ZA 1AGEA 3MRPA 4YDVA 2AJ3A 1T20B 3RTQC 4JZOB 3CFBA 4I4WA 1QLFB 1YQ2A 3CFJB 1YEGL 3ARBA 3O45B 3IYLW 4GRWB 3E1F1 2DYPD 5EN2B 2VABB 4QRPB 4H1LH 1FVDA 4NKMB 3U0WL 3INUH 4X6CF 4UAOC 1NEZA 2G9HA 4PJ7F 4NRXA 2BY3A 3MUJA 5JA8B 1CICA 4M1CD 5F7HA 2V7HA 2M26A 4HJ0C 4CN4A 1SJEA 4KJWC 1L9NA 3RHWF 1G9MH 1CFNA 2BSRB 2AK1H 3IDJB 3GI8H 1ZT7A 3H6JA 1FBIL 4QGYA 4UTAH 4LRNH 3WN5A 3HTLX 5E94A 2J4WL 3VWJC 1YEFL 3R4DA 5D7KD 5JDJA 2NTSP 1WUNT 1R0AH 2APXA 4JKMA 1FC1A 2OL3H 3KPOA 4UV7L 1N8ZB 3DUUA 1M1SA 2A77H 1AO7D 4L8DB 2R69L 1BZQK 1UCBL 3WHE1 1EJOH 1KF9B 5CIPB 4LDEB 4WHDA 5T3XD 1RU9H 1OT2A 4RMTA 3VXRA 4YHIA 3E0GA 2YPLE 4Q58C 2DOCA 3IU3B 4CW1B 2R2EA 3LV3A 3H42H 1NMBL 4R2GB 2XWJB 3JUYA 5FGRA 2DJSA 3VXTA 3BISA 2PR4L 4ZSOA 4M5ZH 3WLWD 3MLZL 2F54A 4L8SA 2NQCA 3VXMD 1J8HB 1XR9A 3WHXB 4IRZH 5I1HL 2AJUL 4WNQA 3ULUL 1NMCB 5KG9B 2VL5B 3WNMA 3UTPD 3MLTA 5KANI 1BFVL 4PY8J 2QQLL 1QACA 2N4IA 1HH6A 4LCCA 1HH6B 3BGAA 5BRZB 2Y06H 3QFJA 5DMIL 4OZGE 5D4QA 4H0HB 5C0IA 3FN0H 1NGWA 5E8DH 4HWNA 4EI5D 5FGCE 2RFXA 4N0UB 4LEOB 3O2WL 3F7YA 3RWIB 3L9RA 4WU5A 2GITA 4OFVA 4N0UE 4D8PA 4C56A 4XH2B 3B2VL 3KYMB 3LKQB 2VIRA 1WFNA 2ZSWB 5J4MA 3NABH 4BSVA 4TQEH 4ZFOB 3REVA 2O61B 1F2XK 3NFSL 2HKFL 1FLTX 3N1GC 4W68A 3VXQB 3MRCA 4RAUB 4X5WB 4NQDD 3K1KC 5E2VH 1ZLSH 1YNKL 4KK5D 3B9KD 4PRPA 1EHNA 2VWEC 1Q9KA 3OR6B 3KPNB 3JXAA 3S5LB 1DVFB 3TWCL 3QXAB 3WNNA 4YHYC 2CKBA 1MCOL 3W0WB 2BVQB 2XZCH 1F3DJ 4XP9L 3MROA 1JIBA 1DEDA 1TZIB 2H26B 4KRPC 3WXVL 1JYWA 3SN6N 1BD2B 1MELA 1F6AB 3UBXG 4XHJC 1OP5H 3OKOA 1L0QA 3QDMD 1A7QL 4JFFD 5D7LD 5EOCJ 3P30L 3RVUD 3OKNB 4MJ6A 1MCPL 1DTUA 2OTWB 1O5DT 4CNIA 1HKFA 3BMVA 1YJDC 5EBWA 4DZ8A 4X9FA 2AEPH 2GAZB 2OMBA 1LNUA 3GHBH 5IBTH 3ZMRA 2YA2A 2XN9A 4OD2B 4LOUD 4YHML 4QTHA 1RY7B 1IBGH 5DMKA 1IQWH 4NQSA 1R5IA 2BVPA 4NZTH 5BJTB 1U8LA 1I8KB 4XNZC 3VFOB 2FHBA 3QHZH 4GW5A 4NHUB 4FTVB 3S35L 4KV5F 3ULSA 3L5JA 1TVHA 3P9LB 3H9SE 2Q6WA 1N7ML 2Z31C 2QQLH 1KTDA 3NFNB 5DRNB 4PJIF 1JN6A 5TPWL 2PO6C 1RJZA 3T3MF 3L3HA 1HHHB 5I1AA 1IT9H 1V5JA 3OX8A 5E8DL 3A6BH 5I6XB 4PJDE 1J0KA 1X6LA 5LGHH 4D9RE 4NJAL 3WE6A 5E8EB 5IT2H 3FN3A 3UYRH 4ODSL 4TPRH 3WKMH 5I74C 4D0DA 5JO5B 2KL6A 3GSNB 1ODAA 5HHOA 4EI6A 2HJLB 1EH9A 1KV3A 1LO5B 4FNLH 4R0LC 3U36A 4Y4KD 5KVDH 1T22B 7FABH 2Z93B 4NQTA 2XTJC 2XFXA 5CD5C 4NO0A 3HHRB 2R29H 3ZE1F 4BKLB 3S3SA 3VH8G 5F9OH 2ENYA 3ZKXC 5B38G 1T04B 1P7QA 1NCDH 2XA3A 4GAGH 3MUHL 3L3GA 1I1AC 2ATPA 1IM9D 4KZEL 3ULVH 1MRDH 1UACL 2NY6C 5FO7A 5C0IB 4OLVH 4W6YB 1U8IB 4ZDHA 1UVQA 1Q8MA 4PJIE 3BHBB 4RRPA 4K3DL 5GSRA 1A3LH 2XTJE 5HYJD 2IANA 2V2XA 3V5HB 2AAVA 5DJCA 2MCPL 1MI5D 5E9DB 3FB6B 1K8IB 4QOKE 2Y5TA 4OV5B 2HFGH 3QIWB 5J0BA 2FB4H 2WBJC 3BKML 4L3EA 2BOCB 1OAUL 3KXFB 4XPAL 1PBYA 4OF3A 1A6AA 1H15A 4RRPG 2XWBB 3BSZL 3DXAE 4C59B 5E70A 1MLCB 2UWEA 3UAJD 3ARGC 4PYGA 4GUPA 1SEBA 5HHME 3L95B 1HCFX 1FFPA 3MFFA 4NRYA 4TNVK 2YD8A 3QHZL 1L0XA 3VJ6A 4OBRA 3LRGA 5J3HC 2IMMA 2NX5B 3D1MC 2YD3A 5ITFA 2X4TA 2X4TB 2A0LD 2IBBA 4XCFL 3EDDA 2DQHH 3CUPA 1U36A 4PJHF 2YBRA 4KQ4L 4NUGL 3RWHA 4EQ3A 2DQUL 5HHPA 2F54E 3VFUA 1X4YA 5FCUH 5LGHL 1DN0B 4Q0XH 4P3DA 1JWUA 4OLWL 2BY0A 3V4UL 1LWRA 1T7YA 4F7TA 2DQDL 3MGTA 2Y72A 4PTUA 5KJRL 4UB0L 3UYPA 4IDLA 1KPVA 5KVDL 4BK4A 2NLJA 3ILQC 5L2KE 3LD8B 2C5DC 4Y1AD 4NHUA 5HYSG 4LNVA 1N26A 2ARJQ 3RKPA 4C56E 1CYGA 4P4KB 3IB4A 2J1KA 2B5IC 1YECH 4YZFF 2B2XL 2EDJA 5F96H 2X1OA 4HGWA 3CVHL 2Y7QA 5EU6E 3FCTA 3RWDB 3DI2B 4OCSL 4IRJC 3HZMA 3MODH 3IFPA 3RJQB 4N0CC 2I5YL 2GSGA 3MRJB 4WEMB 2B20A 4NC0B 4A6YB 5F44A 1HHJA 3S9DB 2X4UA 1OP3H 4QRTA 1JHTA 4ODHL 3GMPA 3WLWC 3WIFB 4I3SH 3MJ7A 3D9AH 3WFBL 3SBWA 3TLRA 4XPAH 5GRVL 4P5TB 3CCHA 4LNRB 1IAKB 2X41A 2FX7L 4NHCH 3G6JF 5F70A 3UX9B 3QNZA 5JIPA 4PP2A 5C0AE 3PUCA 5DTFA 3H8NA 4BH7B 4O2CA 3A67L 1Q1JH 4RMVA 4WWKA 3T0EE 1KNOB 2VXVL 1TCMA 3DO7B 3T0DA 4YNYA 4XHJD 4Q6IA 2VLLA 3TBTA 1U8MB 3JWDH 4PBVC 1IGTB 5K9QG 3T09A 2GSIB 3QULA 3AFLA 3SCMA 3OR7A 3QH3A 2G60H 3T0XA 2VLKD 3LKRA 1VERA 3HE6D 4Y5VA 3MV8E 4NNXA 4WO4D 1QQDA 3GJFB 4TNWF 3C9NA 3DXAD 3JV4B 3NZ8A 2J8UB 4HUWA 2BNUA 3OJDA 4HFWA 3HI1A 2IFGA 4JJHA 5E2TH 2CKNA 1NGXB 4X8XA 2NNAA 2NY4D 2GT9B 1H5BA 5CSZB 1IJ9A 2YXMA 4RFEB 5HPMA 4H0IA 1KCSL 4JO4H 1XGTA 2JJTA 5DGQA 5HYQB 3KR3L 3T1WA 1A6ZA 3DUHA 3GEWB 4LRIA 1RJYB 3QXDA 5DRZA 4PJIA 3VFTA 5C9KA 4Z95L 4CL7A 2NY7L 2YA0A 5IMLA 2VE6B 3PABA 3SE3C 3Q5YA 4MAYB 3T77B 2Z92B 4PJ8C 1N6QH 3I3BA 4GBXD 4FABH 3LKOB 4TVPD 4GO6B 3V0AC 1AXTL 2EDDA 4NSKB 4U6YA 5C0CE 3HCVB 5D5MB 2DQGH 5GGUA 4NN5B 1NAMH 4OZFB 3WFCH 3MXVL 1BD2A 4XNXL 3DJ9A 4BH8A 5HD8C 3ZE2F 3SCMD 4LLVB 2PW2B 1JL8A 2I5YH 3TPUB 3BGMB 3BPOB 3S97C 1KIUA 3QIBD 4PGCA 1PAMA 4EQ2A 3OKNA 5EBWB 2E7HA 2BXYA 2BSED 4C56D 4FG6C 2CGRL 3ILPA 3FZUC 2YUXA 2JIXD 4DCQB 3C5SA 5BVJB 4P4KD 3U4AA 4AENB 1LILA 3O6FD 4KGLA 4J6RL 1KELH 2C1PB 2FZ3B 1T03H 4HBCL 1ZT7B 2XQBL 3QUXD 1YY8A 5CSBA 1F5WA 3S3JA 3SE9H 2YZ8A 1CFSA 1KUMA 3X3GL 1F8TH 3PP4H 3GIZH 5FIEA 1OARL 2BP3A 4IIQA 2J8UF 2IBGA 1IVLA 3TP4A 5BVPL 2MCG1 1KJVA 3QXWA 1KIRB 1LD9B 1TQBC 4M5YL 3H0TB 3D3VA 3ZE1E 3RVWD 1CFQB 5B4MC 3O2VH 3PDOA 1AD0A 1I9JH 1BF2A 2VABA 1BQHB 1FZMB 4XB7A 4JM2D 4PJ9B 4PRNA 2HG5B 3GMOA 2AERT 2PUQT 4LPYA 3RGHA 2GTZB 3QHTC 3VFMB 1ERNA 2F54B 4Y89A 1SM3H 3OV6A 5ALBL 4RWYH 1TQCC 1GOFA 4IIQC 1KTLB 1JV5B 4PJGF 4EBQL 1NCAL 1FQ9C 4WV1C 2E6PA 3PWUB 4UT6L 2DTML 5FM8A 3OZ9L 5I8CA 1QSED 4XNYL 5EU7E 1MFDH 3D87B 1A7NH 1ZHLB 4OM1H 5KSAD 4JLRA 2IFFL 2Y6SD 3FFCA 3ISWA 1FRGL 2CRZA 4PG2C 4WI9A 5BRZA 4X6DA 2CXKA 1JPGB 4M62H 4I2XB 4QCIA 5DQDH 1IC1A 4QRRD 5FYKH 1DL7H 1JK8B 5E9DD 2P8LB 3HRZB 4NZRH 3V6OE 1A0QL 1NGQH 2QHRH 3IXTA 1NCTA 2IANB 2V2XB 4P2QE 4Y5YA 5F1SA 1QA9B 3C9NB 3UJIH 1MRFH 4Z78A 5B4MD 1CXFA 3JUZA 3QJHB 5ILTH 1AR1D 2VXSH 3TA3D 1SJHA 2PW1B 1FH5L 3DTXB 4XZUA 1F4XL 1AGFA 5DEZA 4X9HA 1DE4A 4H8WC 1KOAA 5FKAB 3VRJB 2F5AL 4FQCL 4AEIL 3D39B 3K2UH 5TF1H 1CGVA 4BELD 4ZFGH 3C2AL 4TSCH 3TYGH 2DYPA 4R4BA 5DI8B 1FIEA 1K4CB 1QUNA 2FDBP 5LWYH 4PJGA 5FDWB 3DVNB 3EDJA 1JGEA 1HQ4B 5I8KH 1HQ4A 4ZXBC 3FT3A 3GIZL 4Y4FB 1E4XL 5GGRA 3HS0A 1MI5A 2GJZB 1N0XH 4JHZA 1JUFA 1KCLA 1ONQB 1QLFA 1WK0A 2C3HA 3IDYB 1R5VB 4JFQB 9CGTA 4PJAE 5TQ0L 4Y8DC 5EO9A 4Q9QL 3ZHDA 1DSFH 5EO9B 1E6OL 4S1QL 4ZUWA 1ZLWK 5F93C 4PRIE 3MRBA 2YUZA 4KI5E 4FQ2L 3V4VL 5D5ME 2VDNL 5GGSA 1Q38A 5J1SC 5F9JA 5CD3A 1NDMA 2JJWA 2R0KH 3NIFE 2FO4B 3M1BB 3F65A 4DN3L 3HKFA 3AS2A 3TJHC 2CJUL 3KWWB 1BOGB 5EULV 4NFBA 2FEEL 5IB3B 2F74A 3LZFH 3MO1A 2HN7B 5T5NF 3P9MB 3MRHB 4GLRI 4MCZB 3WFDL 5EIIB 3JWOC 3VE0A 1J0ZA 2PETA 1HI6A 3Q6FB 2YPLD 4GG8B 4M62L 1OAYH 5EZOL 5BQ7B 4LQFL 1JHLH 1AP2B 3QBTB 3Q1SL 4NKDA 1T1YA 4R90L 3N06B 3GBMH 1TVBA 1QPXA 4ZPVB 3UROR 1YYLL 1DUYA 1NGQL 1A0QH 2QHRL 5E8NA 1HZHH 4EJ1C 4X6BA 1A6UH 5DS8A 3VGAC 1BHGA 3IFOA 2ADIA 2YMXL 5JW4M 5CIPH 3QUZB 2DN7A 4F80A 3TT3L 3WS6C 1NLDL 5ESAB 2DQIL 1MFCL 1FVCB 3EO0A 4HWBH 1Q72L 5HGDB 3SY0B 4X8JB 2J3SA 4MVBD 4P48A 3SDDC 5DVOA 5DMJB 5GS1B 2FYYA 5T3ZL 1X4XA 1MIEH 2AI0H 4CMMB 5KOMC 5EO1A 1FSKC 2IG2H 4ZMAT 2H9GB 4N1CA 1NUGA 3BD3A 2WANA 3VGEA 1A4KB 1UKQA 4K94L 1TNNA 4HIXL 1NUFA 2FLRT 3VD9A 4N0FA 2B8OT 5IB1B 1MPAH 1EEYA 1WJ3A 4QHNA 4EKXA 3BT2H 2K7QA 1AQKH 2HWZH 5BCAA 2R1XA 5E8EA 3UTSA 3KYOA 3MRLA 3MBEA 3I02A 1WAAF 4P23C 3L5WA 4KK6C 2LVCA 3IDXH 5DVKA 5EWIL 3Q6GH 4ONFL 3MRMB 3T1FB 2M2DA 3LEYH 4MVBC 3SDDD 1D5BB 1IC4H 3D2UB 5FYKE 4HIHA 1C5DA 4ZTOH 1FORL 4RMQA 4D2NA 2A77L 1MHCB 4OI9A 5IG7A 4G42B 3IVKA 3MUGA 4P3CH 3MACH 2D0GA 3HG1D 2C3VA 2JTDA 3G5ZB 1IGCH 3PV6A 4JFDD 1Q94B 1Z9OA 3P4LA 3RP1A 1YQVH 2E27H 4R90H 1X5XA 4ONGH 5DHXB 3AS1A 4BJLA 4M5ZL 3T77A 4LLVA 1A6UL 4JZNA 4RISL 4MJ6B 1DDHA 4JDTH 4PRDB 5GGQL 4XNUH 1WWWX 3O9WA 3PGDB 3BPCA 1GZQB 2AXGB 1KYOK 5T3ZD 4NO5A 3MROB 5D8JL 5GHWH 5LJYH 1Q9LB 3G08A 1IGYA 1I3GH 1X6NA 4WUUD 4GKNB 3NH7L 4YDIL 3CSYA 3UTZB 2OCFD 2CIIA 4NQCB 3WN5C 5I1IL 4GSDL 4MAYA 4HIEB 5JW5B 3GSXA 4HKBB 4WFHD 4FQQB 3C60A 3HFML 2C3GA 2EZ0D 4ZPTA 5HJ3B 2BSSA 1CE6A 4FXGA 2YWYA 2VQ1B 5CZVL 4MDIA 2X70A 3VWKA 5BV7C 5EU5B 2AK4B 4HUKB 5MI0B 2CH8A 2D3VA 4WUKH 1D6EA 3KS0J 1SVCP 3CFCH 1MHPL 5FA3B 3MRKA 2I07A 1EHLH 5KS9B 2NY5C 4PJCF 1FLRL 5B39G 4UUJA 4JKKA 2ITDA 3GK8H 2ZWLT 4GAFB 5D7IE 1CIDA 1G6RL 2C3WA 4U6VL 1JNNL 2VB5A 4JR9H 4P2RB 3H7BA 1G7IA 5IQ7H 3QSKB 3MJ9L 1KB9K 1ZGLM 3KAAA 4BZ1L 4LVNB 1OSZA 2E7MA 5SV3A 4HXAL 4XP9H 4DEPB 1KIRA 1LD9A 1MCQA 1MWAB 1U3JA 2L4OA 1IEAA 5L8JB 5CD5D 1HYSD 4LLUB 5IESL 2A9ML 4LOUC 3T3PF 3K2MC 4G9FD 3PQYB 4P3CL 3QEQB 4PRAA 3I6KB 4PTTB 4YPGA 4I2XA 1ZHKA 4WFGE 1NC4B 4NNXB 2IWGA 1L0YA 1UVQB 5JXEA 2JB5H 1NFKA 4OLZL 4OZHB 4AT6B 3PL6B 2R2BB 4M1GH 3CDYA 3BW9B 5I8CB 5H35B 1RIHL 1E4JA 1INDL 4MQXD 1CLCA 4APQD 1XGQB 3ZKSD 1IBGL 4YIQA 5GGQH 5IB2B 4LPVA 3VXRB 3WJJC 2BVOA 3ALPA 1PSKH 3FQRB 3TFKD 1RJCA 5KBNC 5JOFB 2FEEI 3WD5L 4LHUB 4GS7C 3DECA 4X4ME 2Z91A 4KVNL 2HFFB 1U95B 2PN5A 3L3IA 3MBEC 4UT9L 2IH3A 2YK1L 4QLRA 1FNHA 1TTGA 5GGVY 4JFEB 1ETZA 4JDZA 3O6FA 3ZTJH 5L2JA 2MPAL 1RZGB 3HCVA 4HGMA 1UB5B 1UA6H 4AG4H 4I4WB 1OP9A 3B2UD 5TDPB 1TZIA 4NJAH 1G9ML 3CH1B 2Z31B 4JFQA 1D9KC 3QCVL 5GGVH 1ZHBA 3DX7A 1LO2H 1QEWB 2JF1A 3D85D 2VMFA 4KC3B 1FBIH 4QGTA 1IARB 4MB4A 2ZPKH 3TBYB 1JWUB 4M6AA 3T65B 4HFUL 3CXDL 4JO3L 4XNZB 5EUOF 3C09B 3SE8L 1UXWA 2EIZB 1I8LC 4FN0A 1G9MC 4UU9A 4UV7H 1TETL 2VDOL 3FB7A 1RIUL 4X0KB 1KTKE 3C5SB 1UWXH 5BVJA 5K59F 1A02N 1NDMB 4WFHE 1JNNH 1UCBH 2EEBA 4D8PB 2J2ZA 5CWSA 3FQNB 4HZLA 5TGBB 2NPLX 4S1DD 1XGUA 3D3VD 2YN5A 4LP4A 4P2OB 4JVUA 1IL1A 2R9HC 4LGRB 4P9MH 1NMBH 3IDYC 1A3LL 4O2FA 3MLRH 4XVSH 2BNQA 2VAAA 3S36X 2VH5L 5CZKA 1HWGB 4YDLC 2ZCHH 2DKUA 4DVBB