1HWHB

1:1 complex of human growth hormone mutant g120r with its soluble binding protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
206
structure length
196
Chain Sequence
EPKFTKCRSPERETFSCHWTDPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an antagonist mutant of human growth hormone, G120R, in complex with its receptor at 2.9 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (hormone/receptor)
molecule keywords GROWTH HORMONE
total genus 32
structure length 196
sequence length 206
ec nomenclature
pdb deposition date 1996-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hwhB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hwhB01
3V7AE 3NTCH 1LGVA 3PWPD 2NLJB 4OTXH 2WK2A 3ARXA 5FO9A 4BSWA 3T4AB 3MRBA 4NYLB 1UJTA 4L4TD 2FL5A 3M8OH 4C59B 2R2EA 3ZTJG 4HD9A 2XQYK 4OQTH 2GAZA 3G5VA 3LB6C 4QRTA 3T2QA 4G8IB 2R2BB 5FAAA 2J8UE 4FG6D 3C9NA 2PR4H 3H42L 2PYEA 4Q58C 1U93A 3QFDA 3MV9E 2JCCE 3FQNA 4FN0A 1ZAGA 4O4YL 4WFEE 4AL8L 5E94A 3MV8B 3RWCA 1RK0A 1S9YA 3RIFK 1AQKL 1QVOB 2ZCKL 1FFPB 2WMPA 1CICC 1I3RB 1ZVSB 5EIQA 3MLTB 4BK4A 4LU5L 3Q1SH 3W2DL 2DWDB 2EH7L 4LLDA 1FSKC 3C08L 4CRPA 4GAFB 4KROC 5ICYB 5J11C 1FG9C 1R3IL 2EE3A 3P77B 4X6EA 3S5LA 4X80L 3MRJB 5LG1A 4KQ3L 2FATH 5JW4R 3SKNB 4X6DB 4HG4K 2QSVA 1X5JA 5HGDB 1BOGA 1I7UB 1DBAL 1QSFE 3WLWC 1CIUA 2OMNA 3CMOL 3F7QA 4XVUC 4YWGL 4PP2B 4C56E 1DBBH 3CSYB 4XNZC 5EZLA 5IOPA 2D7OA 4N0YH 1I3VA 4J8RB 1RJYA 3FOLA 3I2CL 2AJVL 3T0EE 4D8PA 5IUSA 4U49A 5D71L 4K3DH 3WKML 5T1LB 3DETC 1RJZB 4O2FB 3T3MF 2VE6A 4MDJB 1I1YA 2HVKA 3DIFB 2VZVA 4YHKH 3QFJE 5EU3B 1MWAB 3GZKA 2BVQA 4OM0L 2LV4A 1I85A 3RIAF 2J7LA 3UBXG 2UY6A 5IIEB 3UP1A 4HKBB 2HFTA 3NA9H 2YPLE 5D6DC 3H9SD 4M7LT 3B5TA 1U3YA 2MTPA 5I1LB 4PJAA 4R3SA 1WK0A 4ZUWA 4EOWH 1ZA3A 5KSUA 1CD1B 3FFCE 4P2QD 1A7BA 1RZJH 1BHGA 5B21A 3VXRE 3OR7A 3FQTB 5KSBF 4LSQH 2W0LA 5E7BA 4QOKE 3T1FB 1JF5A 1EXUB 2PYFB 1ZHKA 5FYKE 1I9JH 1KCVH 1BVKB 1I7ZB 3HNVL 4QF1B 3WJJA 3VG0L 2AXFA 2ZUQB 3MRPA 3BDBA 4WEBL 4Y4FB 5GGVY 5ESVA 1A8JH 2XOTA 2VDML 5TJWK 4EDWL 2W38A 3ULSA 3I6GB 5D2NE 1LDSA 3QXAB 2ZJSH 1XGYL 3C5JA 4EQ3A 1MY7A 2HKFH 1MFCL 2P47B 2Y72A 5CJQH 4AYFA 5C8JB 2ZCKH 1XIWD 1XGRB 1KACB 4XP4L 4L9DA 1AO7E 4MJ2A 5C0RL 3VFRA 2YPVH 3D18B 5HHOE 3QEGH 3D39A 1CT8A 1P4IL 4HQQL 4F7EB 3TT3H 5EUKA 1JRHL 1MAKA 1W0VB 4M7LL 3WNKA 4MVBD 1GPOL 4DUXA 1HHJA 4ZNEA 3NFPB 4JY6B 3OKKA 1BVLB 5FGBA 5C08B 5FDYA 1JHKL 5ACZB 5CBAA 1T20A 2CDGA 2JK5A 4X6CB 1TZIA 1DBAH 3CX5K 3L7FB 4HK0A 4M6MH 4MXWH 2P4AB 3QUZB 4J3OC 5IW3A 1T1XB 2ICWB 1M6OB 1AC6A 4W6YB 4PP1D 4M3JA 3TA3B 2APXA 2G60H 4DK6A 1MCPH 4UV7L 1EBAA 4H1LH 2VXTH 1G1CA 2AJVH 2BOCA 2H9GA 3EO1B 1GGBL 4LMQI 1VA9A 1KB9J 2NNAA 3SKMA 1K3ZA 1G6RL 2F15A 1R5VA 2R1YB 5KVDL 5C0AA 3LRSB 5F6HI 3U9UB 5TQ2L 4PGEB 4OLZL 3D3VD 1NC4D 1LO4L 3RNQA 4F37F 3QB7C 2YHGA 2VLME 1H0DA 2GUOB 1PZ5A 2Y6SD 3TPUA 5CJOL 4F2MB 5IFHL 3D0LB 4NUGL 4FZEH 1QSEB 2OK0H 3SPVA 4ONHA 5FGSA 2DTML 3WFDH 3VD9A 4AQ1B 2A6DB 5C0DA 32C2A 1UVQB 1VKXA 4X7DC 2BHZA 3WNOA 1Y0LA 5C3TA 4TPRH 4XCYB 3DROA 3O3DA 3NMEA 5ENWA 3WV0A 1F45A 4FTVE 3QDJD 2B7DT 4MNGB 1YUHA 1ZGLP 4YDJB 1L0QA 1WEJL 4JLRB 3FB6B 5I8OH 4HS6B 4XVUD 4F9LC 1IC7L 5CIPA 3ZE1E 3MGOA 4GG6A 3DX7B 3BHBA 1KIUA 2YD7A 1U8NB 3RWDA 3HHRB 1Y18A 4I2XE 4M8VA 4HPOL 1ZS8A 2E8ZA 4IMKC 4L4VE 5HI5D 4N0UB 4OSUL 2YPVL 3FO9B 4FOMA 2HG5A 1Q9OA 3D1MC 3S3SA 5L7XL 1J8KA 2QADD 1S5IL 5HDQH 3TBWB 5J4MA 1QEWA 5E9DD 5E70A 3TT3L 2VR4A 1FVEA 1KIRA 3SKNA 4H8WL 5CEXA 3IFOB 3S35H 4XPFH 4HLZG 2VNCA 3PWLA 1X5FA 5CHNA 1LE9B 4G8EB 4RAUB 3K7UA 2PXYB 2Z31A 1IAOA 2PO6A 4JM2B 1CFVH 5IJKA 1WAAE 1DN0B 4NNYA 2VUYA 4U6HA 1UENA 4WO4B 1NEZG 4PJFB 1KCUH 1MRFL 4NZRL 4Q2ZA 4HMDA 1HCFX 1OTTC 2ICEB 4OFVA 2HVKB 3VW3L 1F6AA 4P0DA 5ADOH 1SJVA 2I9TA 2E3VA 4WCYL 4GKNB 3BGFC 1JNHB 2EE6A 3P11H 4E5XA 2QLVB 3BPOB 1R3JA 3ULVC 3P4OA 3ISWA 1W72A 5K9JH 4QHUA 5DMKA 4JRYA 5F1KC 3B9AA 1ADQH 1FIGH 3VA2C 1DCLA 1A02N 1D5XA 2OCFD 4NC1E 3K2UH 4KDWA 2J8UF 4BZ2H 2X42A 2JB6A 3QIWC 5JHDE 4NRZA 3UMTA 1AXIB 4G6FB 1HOCB 2Z31C 3CUPA 3AM8A 2DQDL 4MJIE 3EJYD 5DO2C 1K4DB 4JZNA 5E08H 3W39A 3W5NA 3C8DA 3O9WD 3EYOA 1IGCL 3S36L 1I9RL 3O8XD 1WBZA 1VFAB 5IFJA 5F9JB 5CILH 2V9QA 3SJVA 3CU1A 2DD8L 5DK0B 2W65B 1U6AL 1C5CL 3BYTA 2BRRL 3JTSA 1FHGA 3LH2L 4BM7A 1HHIB 4UI2A 3P4NA 3X13B 5C0BD 1KFAH 4PJCB 1MJUH 4MAUL 1NSNH 3MJ9H 4ZPTA 5GGRY 3LEYL 2YPLA 1KULA 4NWUH 1I3UA 3SGEH 5EZIH 4QRQB 5KN5B 1W0VA 1SJHB 2MMXA 4PJDE 4H0IA 4NWTL 4P2CG 4XB7A 5K9OB 3ULUH 1XGUA 3I6LD 1XFPA 4FQXB 3A6BL 1PKQE 1KIQB 3OG4B 4IHOA 4WDIA 4RIRB 3EYFA 4Y16A 5FKPB 1CGYA 4ZAKD 1T4KB 2BK8A 3TH2T 3QUZA 4Y2DD 4POYA 4GW5B 1GHFH 4QEGA 3U2SA 3QWRA 1YJDC 1C5BH 1CDUA 2FB4L 4V1DB 4MNGE 5TPWL 3VFWA 1RMFH 2ADFH 4B7IA 3EZ8A 4DGIH 1YEFL 1ZT4B 5C2UB 3VI4F 3ARDD 4KQ4L 2ZUYA 4IRSC 1LEGA 4X4ZA 5GGSA 1ZANL 3PL6D 2IADA 3DMMC 1MI5E 3VJ6A 4M00A 2ADGA 5HHOA 2FZ3A 2CLVA 3SDDA 3QT2A 2VDNH 1TETL 5D1QD 4ORGA 2ZSVA 4YGVA 4K2UL 5JQHC 4E0RA 1FNLA 4N1EA 3MRRB 4A6YA 2XZQL 5EOQH 2OMBA 1LK2B 3IDXL 5ANMB 5I18H 2GTZA 2BSTB 4Z7VF 3UBXI 1ND0B 2A0LD 2VXUH 4JQVC 5TQ0L 2BNRB 5EBLB 4RAHA 1BIIB 5EU3A 3ARDB 4RWHA 3HG1D 5DJCB 5I8KH 2HJKA 2NY2B 1FVCA 4KWUA 1U2CA 2JJWA 5SX5K 2PW1B 2DIBA 2CRZA 4K7PH 4JPVL 2FEEL 3KPLA 5FHAL 5DK3A 1JFQL 4HKZB 4KROB 4ZFGL 3MMEB 3GHBL 4I18A 5ETUA 4WHCA 12E8L 5E2UH 3KXFB 3BP4B 1AGBA 1DSFH 2YA2A 1SBBA 2D7MA 3IKCA 4Y5YC 1CZ8H 3IJSA 1WIOA 1G6VK 4MAUH 3UYRL 1CQYA 5C92A 1HDMA 1R3HA 3VXSA 4KKCD 2R56L 3BVNB 3QQ9D 1PGRB 4O2CB 1F2XK 4H0HB 2GCYA 4HAGA 4ELMB 2AK1L 2C3VB 4QYOA 3G5ZB 3WL9A 1OVZA 3ZL4H 3GHEL 4L3EE 5FA4A 1QSED 2BNRE 4PBVC 2F5BH 5D2NB 1AGFB 1QBMH 2Q76B 2QBWA 2ESVE 3GI8L 3TIEB 1YYMH 1BJ1H 5DHVA 4HUMB 2NY5L 1P9MC 3JXAA 1S9WB 4TSBL 4X6DA 4U1MA 3NH7H 5GRVK 4ZQKB 5IROC 1T3FB 4MCZB 3T0XA 3TO2B 4QRRA 5DJYA 2P44B 2FO4A 2QKIA 1K4CB 1KC5L 3FT2A 5I16A 4WTXA 1KB5L 1T1WB 3V4PL 4ESKA 5TDPA 3BWUC 5IB4A 4POUB 1S7SB 3LQZB 1RJYB 4ODXA 3WHXB 2IAND 4U6VL 3VFVB 2DQFA 3RAJH 1CDCA 1A6UH 1GZQA 1K8IA 1RZ7L 2EXWC 4ODWA 1KTLA 3RBGA 3PWUA 1P7KA 2X89A 3V0VA 5E6YA 4ZSOB 3TN0B 1Q9WB 3ROOA 4PJGE 3LD8C 4YGAB 4YWGH 5HHPB 5C0FB 4X4ME 3SKUD 5JPNA 4H88H 3MFGB 2P5EE 3I85A 1IGIL 4ISVB 4R7DB 3VA6A 2NY6B 1SHMA 5EUOA 1F58H 1AE6H 4LVNC 4AH2B 5D71H 1RZGB 1YECH 2EH8H 3NN8B 3RWGB 2BNQD 1VFAA 5HVHB 3MV7B 3MACL 4ZODA 3P4LA 5ICZA 2NX5D 1HYSD 4KI1A 2I60H 5FYJL 1CS6A 3KYMA 3BDYH 4Z95H 4F7TA 3NCJL 2NXZC 4PJ5A 4WO4C 3KPNA 4YIQB 2FNBA 1A6AB 3MRCB 4Y1AE 4RGOL 3U0TB 4KHTH 3Q6FB 1GOHA 3TIDB 3UYRH 3HE6A 5KSBA 1CI5A 4KTDH 3AXLA 3HC4H 2AI0H 1ULVA 4QRTB 4NUJA 2X4PB 2KDGA 3VG0H 1HQRB 4YR6A 3BW9B 4PJ9D 3MJ9A 1QRNA 4UDUB 1K6QH 5C0CA 1MLBB 2AK1H 2IALA 5AG9A 3FHAA 3MBEB 3GRWA 2HT4C 1M71B 1AGDB 3LV3B 1MCCA 3KNBB 3EOBB 3R0MA 3QPQC 3V5KB 5EOCL 3VFWB 4XNQA 3U7YL 5BRZA 3RWHA 1U8MB 2ZWLT 4TSBH 3IF1B 3SDXE 5HYSA 4G5ZH 1HHKA 5L8LB 1HSBA 1P4IH 4QRSB 4HT1H 3LQAL 2AS5M 1K8DA 3WN5B 1BX2B 1ED3B 3WS3A 2VERN 2J3SA 4YZFE 3VJ6B 3OAYK 3WXVH 4OZHF 4GKSA 3BDXA 4DZBA 4PJHB 4MX7A 4BFBD 3W0WB 5GZOC 1A6UL 1MNUL 5DEFA 2BVEA 4JCLA 1FLTX 4YDLC 4LLVA 2D3VA 3HPJA 2BSTA 3LSOA 1DANU 4HDIA 3O4OC 3ZDXE 1G9EA 1R5WA 2F8OA 4GRMA 1IGIH 2CUIA 5B39G 2XQBH 2EE2A 3NCMA 4J6RH 2HT2D 5DJZA 3VGGA 3PP3H 1A6ZA 1F3DH 5C09A 4NSKB 3L3DA 3TZVB 4U1HB 3MBXH 1NGQL 1B9ZA 1G6RH 2CK2A 3MNVA 1QPPA 2KZWA 4NKOA 2JCCF 5E2TL 1EEQA 1I4FA 2K7QA 4NNXA 4F7CB 4U7SA 4NUGH 4U31A 5FKAA 2ZUTA 4WUUB 1BJMA 1G6RB 2Y36H 5EBWB 3TNMB 4TUJB 4GW4A 1WC7B 4TTGA 2EYSB 5JQ6H 5E4EC 5HYJB 4HWZB 1S7XB 4NJ9H 3V6ZB 2A9MH 3Q5YA 3BP5B 1LEKA 1CE6A 4MQTB 3IDJB 3KWWA 2R4SL 4BYHA 3PV6A 5IBTL 3DTXA 1A7RL 4R2GC 1MCHA 3IDYB 3SJVB 4M61A 5BV7L 1I7RA 3BKCH 3H6JA 3ZKSD 2JCCA 1FC2D 1CF8L 3LN9A 5JLZB 1FBIH 1OQXA 5CGYC 4P23D 1N6QL 5HY9A 3KS0H 1UXSB 5JHLH 1IQWH 1U8LB 4BSWB 3GM8A 1A47A 3BP7B 2A73B 2LQRA 1JTOA 5DRWB 5JW5B 3CFKB 3JUYA 5HDQL 2OZ4A 1T2QL 1UZ6E 5C70A 3G6JE 3MV7E 2AXGA 3PIQB 4NQCB 3ARVA 4JN2B 1NEZB 4Z8FH 3O3EB 3GJEB 5E8EB 1S7SA 3VGEA 2D31A 1QFWL 5FYLL 1GZQB 1QSFA 1RI8A 4B7LA 3HNTL 5CSGA 5KVGH 2FEDD 4OB5H 2HMID 4C56A 1V3JA 1KYOK 4FZ8H 5SWZA 3CFDB 4OV5B 4M7JL 2C7UA 2CLRA 2VL5B 1N5AA 3LEXA 2R1WB 3VFPA 1CDHA 5EUOB 3WFHB 4DOHB 4S1QL 1P7QA 1ADQA 3KS0J 4JRYB 1EVTC 2Q6WB 2BY2A 1KIPA 3X11B 5ADOL 4PREB 1JN6B 1MJ8H 2P24B 3RU8H 1FN4B 1RU9L 4XP9L 1CD9B 3HC0B 5ESAA 5F9OH 2FX9L 5CMAA 1W8NA 2ADIB 3D85A 4FQXD 4YBQD 3BZEB 1PQZB 1WCBB 2LAGB 2JJTA 4DOHE 3KPRE 4EI5C 5DRXA 1KJ2B 2DLFH 3OKNB 4WEMB 5ENWB 2OBGA 4OV6F 5HPOA 4Y16D 1EEYA 5C07E 1BAFH 4Y4KB 3S3JA 3BGAA 4P4RA 4O02H 4YHNB 4CVZB 1JPST 2WQRA 5C0NC 2ITCA 4DKAA 1F2QA 1AJ7L 2JJVA 2EDQA 2A6KB 1A64A 1YEEL 4J3TA 4LCCB 1ACYH 1VFBA 2YWZA 3JSSA 3DI2B 1KPRB 4JFOB 1IKNC 3TV3H 4URTB 3V0WH 2IPKA 2PW1A 1PZUB 1PBYA 1MY5A 1YQVH 5A2FA 3BIBX 4MWFB 4Q0XL 2OQJB 2XNAB 2DIAA 3QNZB 4G9FB 1C5CH 1FBIL 4GRWB 4P3DB 3VD3A 2GIYA 2XN9B 5IK3A 5A2IH 3IAQA 4OQTA 4MA8H 2PTTA 4HMCA 1EAJA 4RAVA 3QQ3A 1IQWL 1YYLH 2WQ8A 4KKAC 4JO3L 5DEGA 3MV9D 2WLYA 3E2HC 3MGOB 5AEAA 5CIPB 5JNYB 3O2VL 3BQUA 1EFXB 1S8DB 1IM9D 5JXEC 4E42A 3RNKB 3I9GH 1ZA3B 4MB3A 5KSUB 3ULUL 2IQAA 5ICYA 4PJIA 3MA7B 2P8LB 1MCEA 3EYUH 4U1LB 3W0WA 5HHQA 5I8CA 2IAMC 1U58A 1BF2A 3RY5A 5FDWA 4CAGA 3GMMB 5B39B 2DM7A 2WM0A 2YRPA 1JGEA 2FR4A 1C7TA 1DLHB 3GEWB 2QV2A 3MTRA 2X70B 4I0PC 4NNPH 3UTTD 3GNML 1YNLL 4XP6L 5HYQB 1HIMH 3B9EA 1AQKH 1EMTH 5TF1L 1U41A 1DVFC 2XT1B 5CHNB 4P5MA 4UQ2B 3OAYH 4KQ4H 5SWSB 1XR9B 1XGTB 5HYSG 4RDQG 4IM8A 3MRHA 3Q1SL 5CD5D 4DKFL 5B38G 4RZCA 3SDAD 4EDXA 2L7JA 2UYLA 4AIXA 4F15B 3QUMB 4PTTB 2W0FB 4P5KB 1I1RA 4LCWA 4YHIB 4XNXL 5HYJD 4QRPD 4YC2B 4PJ9A 1OP5H 4JJ5B 2QEJA 4HJGB 4NQSA 4JE4B 1FPTH 2HTKD 1T1YB 4MNQB 3RVXD 3O6KL 5I73B 2CUHA 3BT2L 2ZPKL 3X3FH 3IU3A 5IVXF 5EC1A 5E1AB 1AR1D 1ZWIA 2JJSC 1S9KC 4AJ0A 1AP2B 4JG1L 5DGRA 4HK0B 4JB9H 5A2JH 1JBJA 3REWA 4D0DA 4ZOEA 4R4FL 1NCBL 2EC8A 4Y19D 3QAZC 1YQVL 1NUFA 2BVQB 3PHSA 4OM0H 2GTWB 2I26N 1BZ9B 2O61A 4JO1L 1ORSA 5FO8A 4I3RH 1IZJA 4NCC2 1SJHA 4RFEA 5LQBL 2VWEE 1VEMA 2P8MA 2OL3H 3CFIC 4BK5A 4K7FB 3M17B 4LPTA 5BS0E 3HE7C 3DO7A 4GMTH 2YSSB 3RL2B 5IHZB 3AREC 2R56H 3FOMB 1BLNA 3GJEA 1MUJA 5E8EA 1I8LA 3MYJA 3QCUH 1GC1L 4PRBB 1AO7D 4WEBH 5H94A 1T21B 2NY3B 5JUEH 3CLEL 3ZDYE 5CGTA 5B8CA 4OGAC 3AB0C 4C55A 3OKMB 43C9B 4ODHH 4MD4A 1KTDB 3DRQB 3O6FB 3GMLA 3EYSL 2BFVL 4HIEA 2EO1A 5F9WB 2V2WA 4CADA 3LEVH 2DQUH 4JLRA 1DQLH 1KIRB 1EMTL 2NY0B 3ARZA 3BWAB 3MOAH 5D1XB 4OZ4B 3L1OL 3HC3L 3MRDB 3NGBB 1GCFA 1TVHA 3VGAC 1U3HB 2F54A 4U3XA 2BOCB 3EO1A 3QEGL 4ZYKB 1WTGT 3FQUB 4P3WA 5F3BA 2LU4A 4CN1A 3QUYD 3HNSH 4JPIB 4MHHI 3S5LB 3S37L 1NGWB 1GPOH 2I07B 4JHBA 2Y25A 3RWEA 2DQIL 4XCFL 3HI5L 2ERJC 5DQJB 3V4UH 2Q87A 5JXED 1WFOA 2VLJB 4DGYH 5I8EB 1T20B 2JJSA 4X6CA 1I75A 3LSOB 1BIIA 5DD5H 3MV7A 2YN3A 1F6AB 1CGWA 4P2QB 1I8IB 3R1GL 4XAKE 5SWSE 4LPUA 3NBNA 1T0MB 3X14A 3SCMA 2E8YA 5F7NC 3QDJB 1GIGL 4CNIA 2X4UA 4YHPA 3C2SA 4RA0C 2QQLL 5FXCH 1EX0A 1NMAH 2Y07L 5T1MB 4OZIA 1UB5B 3GSWA 1RUPL 3I02B 2GEEA 3H3BC 4JG1H 5GISL 4LIQE 1LK2A 3KXFA 1OAYL 3F12B 3QDMA 4JB9L 3X12B 5C71A 4MWFA 4N0FA 1HXMA 1ZHBA 3O8XA 1KJ2H 2B0SH 4PTUB 5IHBA 2VSDA 3TO4A 3N1PC 4Z95L 2SEBB 4N0CD 1FC1A 4Q6IA 4J3WA 1J0JA 3QXDB 4OCXH 4LLMA 1T22A 3VFSA 5JHDA 4B41A 3QO0B 5GZNC 4NN7C 4FNLL 4M62H 1A6WL 2DQCL 5CGYD 5IVXA 3BJLA 2WBKA 5IEKA 1AIFB 3BX7C 5JNYA 1W8OA 1ZEAH 2WWKT 4I9WD 2VN4A 2CDEA 4JREC 3T77A 1BVKA 4QGTA 4I8DA 5CZVH 4MD5B 3OAZK 4F3FA 4ZS6C 5JUEL 2VTFA 4F9LA 2Q3ZA 3N0PB 5SV3A 5MEQA 3OKLA 1S5HA 1SEQL 4PJBE 2X70A 2XZZA 4L9LC 1CBVH 2FWOB 5T3XD 5TH2B 2F54D 4TULH 3QUZD 1AFVL 5L88H 5ISZA 2CO7B 2OR9H 4K3EL 4MD0B 1I8MB 4G9DB 4PJ8C 4QHKI 4D9RE 1YQ2A 3VFVA 1B6UA 4MAYB 2PKDA 3U48A 4OLUL 1NDGA 4OAWB 3QPXL 5EORH 3RZWA 1DL7H 1RK1B 5A43C 4MNQD 1XF1A 1TITA 3C5SB 2VDLL 1C7SA 1C1EL 4YE4H 5DEZA 3NIFF 2C4XA 4JO4H 1TCMA 4GG8B 5GRJL 1X9QA 2VQTA 4LRNH 5EC1B 3U9PL 4XCCL 4PJIE 1XAUA 2X41A 4WUKH 3VH8G 2J5LC 2D7TH 3DOSA 5FM5O 4UNVA 3VFRB 1V3LA 1UJ3A 5FYKH 1A3LL 2QQLH 1H5BC 4ZNCD 2KPNA 1N3NB 2JF1A 1MSPA 1KT2B 3BPNB 4XAWL 4ZS6D 5TDOB 4IDLA 2DBLH 4TVPH 3U36A 5BVPL 3LHPH 4GKNA 3A0OA 5HDOA 4LCIL 1AKJB 5A16A 1A9EB 1XF5B 5FUOL 3CFJA 1S78C 3VXQA 4UIMB 1ADQL 5E5MA 3DX8A 3VXSE 5JQ6L 3NZ8A 1A6WH 2DQCH 1NAKL 3JTTA 3QFJB 2W59A 4C4KO 2R4SH 5C0DB 1VFBB 43CAB 3GMRA 3SN6N 1RUAL 5JR1H 4TSAH 1DDHA 2OZ4H 1E4JA 5FB8B 3HS0B 5B8CB 1I9RH 2CRMA 2EDWA 2AEPL 4XBGB 4AG4L 4FQ2L 1HDMB 1BEYH 4QRPB 2MCPL 2PTTB 3BN9D 3VWKC 1CFQB 3QNYA 4N8VA 1F4WL 3EKCA 1U6AH 4L8CB 3I6LE 4IDJL 1U3HD 1KGCE 4WWKC 3LH2H 2C1PA 1P2CB 3Q0HA 4P2OA 1ZLWH 3ET9F 4QWWD 3MRBB 2GJ6D 3WNNA 1CTNA 2VMFA 1JV5B 4HWNA 1N8ZA 3GSNH 3LEYH 3T3PF 3FFDA 5ECJE 4FQIH 1KEGH 3RWFA 4FQJL 2BVUA 5LBSH 4KVCH 4XNQB 2EIZA 4XP5L 4TSCL 3S97C 5FYLH 2C1OB 4HZAA 3T0EB 3VRJA 5T3XE 1JZ7A 3A6BH 4PFEA 1N26A 2WW8A 5I75B 2FGZA 3RWIA 4EN3A 4IRJC 2J4WL 1TVBB 2ZG2A 5I1AA 3NCYS 5EWIH 4D9RD 1HN1A 3DRTB 1MI5D 3F7PC 4JDVA 4F7PA 5I9QC 1CU4L 1T1WA 3CZFB 1JUFA 1XF2B 4Z5RB 4QCIB 2VLJE 3EO9H 1CYGA 1OAQH 5C0JB 3V6OC 1U0QA 4YPGB 1QD0A 2X1QA 5F9OL 4WNQA 4XPHL 4NQXA 3OR6B 4I5BA 1UEYA 2Z8WC 3NIGE 1Z3GL 4X4MA 3VG9C 2CLVB 4M4RA 3P9LB 3UBXA 2F8VA 2EDTA 5FF6A 5F72S 2OTWB 1ZGLM 2WIMA 3HFML 5F97E 4MS8D 1FZKB 4RDQF 5GGRB 5EUOE 3HMXA 3B5GA 3HE7D 1A3RL 2IC2A 1V7MH 1L0XA 1J5OL 4G6MH 4AT6A 2VXUL 1U92B 4DVBA 3SOBL 4D0DB 5IKCA 2W9EL 1FJ1A 5HVWA 4OUUB 3TV3L 3V0WL 1JIBA 4LPCA 4WGWB 5F44A 4QT5B 4DEPC 4F7MB 2A6JA 2BY1A 1OTUC 2A73A 4PJ5E 1OARL 1EZVX 5MI0B 3A6CL 2YR3A 5KTEH 1ONQA 4K9EH 1BZ7A 4LCUB 1EFXA 3KPLB 1LP9F 4JFHE 1GAFL 4ZG1A 4LOUD 2FH6A 1HHIA 3QXTA 4NQCA 12E8H 3QULB 4KGJA 4M7ZC 4QKXB 3LKSA 4JO3H 1OGAE 3QEQD 5CP7A 4LLQA 3ULUC 3FQXA 4ZUUB 1VKXB 1V3KA 2XRAL 1B4RA 1TPXB 2ESVD 3ZZ1A 3BVNA 1OTTD 1Q1JH 2PNDA 2YRZA 1J1OL 3RHWF 3O11B 1HYRC 2WUBH 4WFHD 4PJBF 4PY7B 5IM7B 4N9GA 5F7LB 1H3VA 5I6XB 2BHYA 3ARFD 4HGWB 4ENEC 3VFOB 2IG2H 3LN4A 1IAIL 3BI9X 3MXWH 2DJUA 4WI6A 1QP1A 4DFIA 1S9VB 4FHBD 1XF4B 4HFWA 4JFFA 2J8OA 2CDFA 3N9GH 4HIXH 2I24N 3D0VB 4KI5D 4LMQE 3BSZH 5KAQG 4DKEL 4OZGE 4YHIA 2WANA 3QHZH 4NN5C 1G0YR 1Y18B 1LNUA 5CJXA 2NZIA 2X4NB 3RKDC 2GT9A 3FQUA 5KW9H 4PUBH 2BVOA 5HSFA 4ACPA 5DRZB 1EGJH 2P5ED 5FGCB 3MUGA 3NAAL 3ZYOA 3AFLA 2EDNA 1HK6A 1KB5H 3V4PH 2ATPB 5GZOD 3K8MA 4MA1B 2XWJB 5EIIB 4Y89A 4NQEB 3DYOA 3FO1A 1Z9LA 4Y4HA 1I85C 2FZ3B 1FNGA 3REWB 3RBSA 2HVJB 2AJSL 3MLZH 1PEWA 2ZOLB 1IAOB 2D0FA 2WBJD 2P48B 1ZMYA 4YXHL 5IW6A 1TQBC 1INDL 3X3FL 3FAWA 5C09E 1U3JA 4ELMF 2G9HB 4S1RH 3KPSB 3OTTA 4ZAKA 2P45B 3KPMA 1J5OH 2DKUA 2ZKHL 1WGOA 1RHHB 1E4XH 4UV4L 5HXMA 1EFXD 3AC0A 2W9EH 3WMSA 1AXSA 3DI3B 3LDBC 4P5TB 2FX8H 3RDTD 3ZHKA 1NCCL 3FB8B 4N5UA 2F5AH 2Y5EA 3L3OB 5J6GA 4FXLA 4HZLA 5IROA 2EDLA 3RZCD 3L3DB 3TZVA 4UIKH 2VAJA 4PJ5B 3DARA 1VADA 4PJXB 3UC0L 3MRRA 5CJ8A 4NFDA 1J88A 3H7BA 3FONA 1A7OH 4XB8A 2JELH 2XNAA 3SDDC 2CIIB 3AU1B 1RV6X 2GFBB 2NY4B 3B2UC 1EAPB 1HOCA 3LMJH 3QCVH 2DS4A 2VZUA 4PJAB 4R3SB 1G7HB 1WBYB 1YEDA 3FTGB 3M8OL 4JEGB 5HYJA 3OGCA 1PAMA 3RA7H 1AKJD 1ZS8B 5FYKU 3EYSH 4U1SA 2BVYA 1PDKA 2R69H 3SE3C 3EFFB 3KLDA 5I1IH 3BZFA 1XZ0B 1FH5H 2AXFB 3GSUA 5E2VH 5J3HC 4DKEH 1W0WA 4P5KA 1QSFB 2FYYA 1NDGB 3G04A 4G80A 1T3FA 4MCZA 5JPMB 4U1HA 4ZQKA 4PRPE 1WITA 1K85A 4FA8A 3RTQB 4FP8L 3K81A 2Y5TB 3GSOA 2H3NB 1EHNA 2VR5A 2Y1VA 1ZTXL 3CK0H 4ZTOL 1DQMH 4YHLL 2V5TA 1Q0YL 2Z35B 4EEEA 3IDNB 1G7MA 4ZUVA 5DRWA 5IV2B 3HI5H 3V4UL 3BE1L 2R9HC 4OZGB 1RVFL 3SDCB 4WW1B 4N0FB 4PGBB 4WVRA 5GGTL 1I1AA 4JY5L 1SMAA 3S8WA 2YUZA 7FABH 1ORQB 3EO0A 5FHBL 1MCLA 3SQOH 1N4XL 5T1DH 4ISVA 1G7QA 5C0GB 5GHWH 5FOBB 4ZO6A 1N2RB 5I73C 3O81A 2OJEB 3MBXL 1C16B 4ZXBD 4R90H 5DUPH 2P8PA 1CDYA 3C60A 1KJ2L 2B0SL 1WVZA 4KY1L 4NKDA 1YPZF 1D5BB 4OGXL 1YDPB 1MELA 1FV1A 2DQFB 3KHOA 3NA9L 1KCSH 4OFDA 4APQB 2NXYB 4ETQB 2VLKB 2Q8BH 1G1YA 4HS8L 1UXSA 4OLVL 4PREA 4PRBA 2UUDK 5H2BB 3SE8L 1TCRA 3BD4A 4XNMA 1PVHA 4P4KD 5JPNB 1A7OL 3T0DA 2E6JA 5F7EH 1IM3A 1N6VA 5J1TC 1LE5A 2XZAH 2W0KA 4IOSD 3FRUA 1JZ2A 2X1XR 3WHE1 3BQUD 4NHCH 2AXGB 4D9QE 4ORZC 4M48H 1GGYA 2DKMA 1AI1H 2PETA 3LN4B 5AZEH 3C5ZD 1ZT1B 3IFNL 3GBNL 1WIPA 3TH3T 3RA7L 1S7VB 5CINH 3MV7D 1XGYH 1YEKH 1FGNL 2K9UA 4B50A 2AK4B 4LLWA 3I84A 1S7UB 4TULL 3KPNB 2O5YH 3MLRL 3RDTC 2R69L 2ZUXA 1MFCH 3GM0A 5DJDA 5CKGA 1VB9A 4M8QA 1FH5L 1HKFA 3TIDA 4WFFE 3G08A 3FAXA 4G9FA 3E2HB 1ZXQA 4LAQL 4OD3L 3VU2A 4YFDB 4HQQH 3RL1B 1T2QH 1BX2A 4RGNC 3T8XB 5EN2A 1DL7L 5CEZH 4RNRA 1PLGH 2CKBL 4JKKA 3CFEA 4JKPH 4OD1L 1U8NA 3RWDB 3U2SB 2MPAH 2WBJB 4YHPB 4RGND 1I8LC 1CD8A 3GI9H 4Q9CA 2QHLA 3DRTA 1G7LB 5SWZB 1E6OH 5FOJA 4EDXB 4M03A 3WNMA 4E41A 1UYWH 3IS0X 1WZMA 3HRZB 1F8TL 3OB0K 3SE4C 3QPQD 2XXMB 3NPSB 3IXAB 1UH3A 4GRMB 3ES6A 5ALBH 3SQBA 4PJHE 4QHMA 4CJ1A 3NFSH 4HPYL 3DX9B 4JGUA 3HN3A 4HBCH 1K8DB 2YPKB 2BC4A 4JKMA 1H8OA 4UNTA 3JTTB 1MJ8L 3RU8L 1RUQL 2CRIA 5CP3A 5I16B 1HQ4B 2HN7B 4LCIH 3W11D 2FBOJ 3UAJD 3I02A 5D7KD 1PX4A 3FO2B 5T1MA 3T77B 3WFEL 4YBLB 1I8KA 4UBDC 2Q8BL 2BNRA 1WZKA 4GOSA 3STLA 4HH8A 1J0ZA 1SJEA 4N0UE 4ERSH 5IESH 4JCMA 4H1LB 4X7FC 4QXWA 2PO6C 4WENB 3V6ZA 2J6EL 2XZAL 1AGCB 4PRID 1TJHH 3VFSB 3MOQA 1FCCA 4HWZA 3HPLA 5EPMB 1A9BA 1HNFA 3VXME 4HUXB 1MCSA 5DA4A 5F3HB 2NY1D 4X9GA 4XC3L 5K9KA 4UAOC 1IL1B 1AI1L 4YH6A 4YNYB 4U2ZA 3MCKB 4L4TA 1JPTL 1JYVA 2UV3A 2BP3A 3QNZA 4NQED 1EFQA 1RURH 3OAUH 2VN7A 1GC1C 2CDEB 4XRCB 4ETYA 2NW2B 5B3NA 3ARBC 4Z7UA 4MA8L 1P1ZB 4PJ8B 3WIIL 2UWEE 5LGHH 3KPTA 5TE4L 3ULVF 5BV7C 2O5ZL 3BKML 3EYOB 4NO3A 4NKIL 3I3EA 1KEGL 2EXWD 4XH2A 3WLBB 4GS7C 4JHAH 3PIQA 1UXWB 4JN2A 4LEOB 1I9EA 4OZFB 5CEZL 3IDMB 5IB5B 3MRIB 3GMNA 5HTSA 3UAJC 2YD1A 5DHVB 5IJVB 5JIPA 1GZPB 1MLBA 3C6LD 3QHTC 3OXRB 5JZ7C 1NBQA 2PR4L 1BLNB 3H42H 4JREB 3GI9L 3WUWG 3JUZA 4F58H 4MLIA 1IKFH 2E9WA 2ZSWB 2CLRB 2VL5A 4EVNA 1T1YA 5I1HL 4L3CB 3CFDA 4P23B 4C54A 4XCEA 5HYJE 2W92A 4DFHA 2H2SC 4NQUA 4J1UA 4U7KA 3QDME 1MRFH 4NZRH 1YJDL 4J3UA 1KCLA 4CKVX 2CGRL 4F80A 3L3IB 3C60B 4Y4FD 5FCSH 2DQJH 3C08H 1V8HA 4JQVA 4LKCB 5IW1A 1GH7A 4DWHA 5I66A 1FE8H 1T0MA 3IDGA 3BWAA 4TTDD 2BJMH 3WIFA 5KAQF 3PDOA 1YN7B 5ERWB 1FFNA 2BY0A 4M02A 3OKEA 4MA3A 4P46A 3GSQB 1N3NA 2F54B 4NCDA 4LHQB 3HFMH 4PRPA 3B2UD 1KG0A 4Z18A 5JHDD 2ZNXA 1MCWM 4JVUA 4NN6C 2F58H 3M17A 2HRPH 1DBBL 4XBGA 5EZJA 5SWZD 1CL7H 2J6EH 3UPRA 5E8DH 5LGKA 2XIDA 3BOVA 2X9YA 2I5YL 4UINL 4LCCA 2X09A 5GJTL 3O4OB 1ETZB 4Q7DA 3CC5A 4U1NB 4XP1L 1HILB 2B1HL 3GRWL 5D7KE 4X9BA 4R4FH 4JFQA 3QIBD 4LLWB 3BN9C 2J8HA 4JQIH 4QHNA 5JO5B 1GAFH 1KJ2A 2X1OA 2UUDH 4MD4B 1IC4H 3HUJE 3LCYA 3BQUC 1P4BH 2OL3L 4QHKJ 1X3DA 4K71B 3BKMH 2GSIA 4GBXB 3IRPX 2EZ0D 5BZDB 1Q0XH 2NY6D 1T03L 2CDFB 4W6WB 1FG2A 1NCAL 4CW1B 2WUBL 4RNRB 4M1CD 3KJ4C 4PRDB 2BNQB 5A1AA 3DXAA 2R15A 2VABA 5I1KL 1G9ML 4TVSa 1I3GH 1L6ZA 1N8ZB 1L4IA 3WJJC 3RWHB 5BRZB 4U2YA 1YPZA 4HXAH 3OKMA 43C9A 6FABL 2JB5L 4JKWA 1EHAA 2BXYA 4UT6H 2NX5A 3TZVD 3WN5A 5HI3C 1RK1A 3X14B 3MREA 4EN3B 1DQLL 1HCVA 3ZKXB 2UVFA 5ID1A 4AIZB 3EOTH 3SBWA 4H5SB 4QXTA 5INCB 3OHXB 2YEZB 1DQDL 1Q94A 1MAJA 3D39E 5FF6B 1RD6A 1BMGA 4KDTC 4ZYKA 3QDGA 1A3QA 1FZKA 2DLTA 4ZFZA 2BVPB 3LB6D 4PTTA 4WUUD 1ZHBB 2UYLB 3O8XB 3FHQA 4J2XA 1U8PA 1UA6H 5AZ2L 2A77L 2YBRB 1H15A 3KYOA 4OLXH 4HS3B 3RGVC 1U92A 2FR4B 4JJ5A 5DMJB 4F8TA 1JI2A 3C5ZA 1INDH 4OV5A 3QUYA 5BZWA 2AABL 4Y2OA 3C5ZC 4CMMA 2LU3A 2X1PA 3WKNA 3STZB 1BD2E 3HI1B 1MCPL 4UV7H 3F6IA 2RFXB 3G6JA 4DUVA 5DC9B 4PJDF 2YMXL 4NM4H 4M5YL 5I2IB 2P24A 4WI7A 4XX1G 5L2KE 4K7PL 5IHUL 4Y7MA 5MERA 2IMNA 4BSJA 4Z7UB 5DO2D 5AYQA 4DCQA 1N0XH 4HJ0D 1SY6A 1TCRB 4XNMB 3UDWA 1RJLB 4LCWD 4R96A 3BKYL 3RUGF 1KOAA 4RRPA 3ETBF 3JWDH 35C8L 3REVB 3U46B 4E41D 2VDQL 3D48R 3W81A 1O7SA 4L3EB 4XVTH 1W0YT 3QIUC 5D7JB 5CCKH 3BUYB 1MRCH 1OP3K 5EA0H 1I7TA 2QR0B 3RGVD 5IMKA 4P3DA 4IRZL 5MP6L 4XWOD 4MNQE 5DMGD 4DW2H 4RX4D 4YR6B 5I74B 3DO7B 2ADJB 1H9VA 4L4VA 3L5WA 1T66D 1AHWB 2A74A 3O6MH 3H8NA 2ZOKA 4JANB 4JFDB 3U4BL 3NIDE 3VFTA 1UWXK 3RNKA 3VGHA 2VZTA 2OXGA 3O41A 4KZDH 3L3HB 2DLIA 3NIFE 4PY8I 3ME0A 1A1NA 4OFYD 3RAJL 4KJYB 1RZ7H 1K9TA 3OKOB 1QLRA 1AXTL 5HYSB 1JWUB 4O5LH 1KTDA 1IEBB 3U30C 3DRQA 4Z7WB 5TF0A 4HF5H 4P2QA 4OJFH 2CIKB 5ITBH 1QKZL 1PG7L 4TN9A 4H88L 3UPRB 3VFUA 2FDBP 1CXIA 2G2RA 3FO1B 5ILTL 3RWIB 5GGSY 3N1FC 2XI9A 3QIBB 5K9QI 2HLAB 2HTLD 4XPTL 4DK3A 4GKZB 4I3SL 1DEEB 4QRUB 4RMQA 1KB5B 3LKQB 3B4NA 4XAWH 1RZKL 4PTUA 4I48A 3DV6A 1LO2H 1U8KB 4S1DC 5L8JB 2ZUWA 3SCMC 1OT2A 5DMIL 1RHHA 4N8VG 1I1YB 4NPYB 3VWJA 5DUBB 3LKNA 4V2CB 2LTQB 1ERNA 2CLZA 2EDJA 1CXEA 4R7NA 3OZ9L 1LO3H 4IRSB 4U6YB 1LK3H 4OIIH 3C6LA 5FO7A 2KL6A 4C83A 3HC4L 3QEUB 4J7RA 5FO9B 3U6RA 2F19L 3TBVB 1QHPA 5LGJA 4M8QB 4EQ2A 2VAAB 3QULA 1T89A 5TGBA 5GS1B 3S36H 4NFCA 1K6QL 5DT1L 2CKNA 4MZ2A 3FO9A 2V7HB 3B9KD 3ILPA 4N5ED 4TUJA 3JBG7 4LCWE 1UJ3C 1VFMA 2QQNH 4LL9A 3SE9L 1EAPA 3QSKB 3G5YA 5M7QA 3BPCA 3V5HB 1DBKH 2O5XH 4DW2L 1NLBH 3U82B 4KK9C 2YKLH 3MLTA 3W82A 5IMMA 4M61B 4XZUB 4OCYL 5CZXD 2OL3A 4AK1A 4L5FL 4YHOH 4FQIL 2EKSB 1CDJA 1RY7B 4P2OC 1KJMB 3NPZB 3NCEB 1B0WA 1MRDL 4C58B 2A83B 4XMLH 3UTSA 1X44A 2R8SH 2X4NA 3VWKA 1KN2L 4O5LL 4P9MH 4KU1A 5EOTA 3DHMA 4OZHA 1HZHL 1UH2A 1QNZL 3BZDA 1E4WH 2JIXD 2L4OA 3HKFA 1FORH 2AV1B 2XQBL 3FFCD 4U1JA 1TFHA 1YY8B 3MUZ1 5KVFH 5DA0B 3CH8A 4HFWB 4XMKH 5C0JA 1P84K 3SHSA 1JZ6A 3MOBL 3QI9C 5J6HA 2QJDA 3CUPB 3BO8B 5ABDE 5L9DH 3IU3B 3K1DA 1ZLWK 1JWSB 4WEUD 3KVQA 3GO1H 3MA9H 4M7KL 4FQCH 1CGTA 4P48A 3FT3A 4ERSL 4J4PA 1ZLUK 3IDXH 3GKWL 1LK3L 1OTUD 4OIIL 4HEPG 1FL5A 3SDXF 2A9ML 2F74B 1HKLH 6CGTA 1S7UA 2VLKA 2OS7A 3B6SA 1CR9L 1QBAA 3E6HB 1FFOA 1C08B 3QIWD 5F89A 2YUXA 1FRGH 5HD8C 2G9HA 3ZTNL 3UYPA 1JTPA 1H3PL 3WN5C 3JWDC 1U36A 2XACC 1CGVA 1OLZA 5D2LB 3MJGX 3WBDA 2F53E 4N8CH 1FP5A 5I19L 4LKXB 3P9WB 4ZD3L 2C1PB 2IBBA 5JHDB 2J8UA 4L4VB 1U91B 4WJ5A 1AHWA 1J0KA 2EDXA 3S96B 4EBQL 5D7LB 2DM3A 2B2XL 3D2UD 5I1GH 4ZXBB 4U1SB 2BVOB 4ONFL 1HEZB 3HTLX 3AY4A 2Y23A 3RZCA 3WE6A 4QRRD 2EEAA 5DFTA 3BKJH 3RWFB 2YXFA 4YO0A 1IAMA 5MEPA 4JAMA 4HX1A 1VSCA 3ZL4L 4CJ0A 4WY7L 5DEGB 3TWCH 5HYFA 1IGFL 4LSTH 4Y5XC 4P9ML 4Y4HB 4ODSL 1S9YB 4FZ8L 4DGVL 5E94B 1OY3B 3RVVD 1YYML 4K3HA 3BIKA 5ISZB 3FKUS 3ZKNC 4F7PB 4PRHE 1T5XA 4UMGA 1EDQA 3NIDF 3MA7A 4KTEL 1NGWA 5MENA 2CGRH 4RGMB 5KW9L 1I8KB 4HWEL 2VLLA 3HUJF 1DFBH 1AO7B 3PF2A 2EYRA 2CO6B 4KRNA 3SJVD 2OI9C 1AY1L 4JPKL 4PYGA 5EDXA 5EBLA 2XWJA 4M1CC 3EOAA 4UUJB 4G43A 5C07D 4LVNB 4ELME 2AJYL 1C16A 2NY6C 1WTLA 2R0LL 3U4EB 4LVHC 5CS7A 3H2WA 3ULVE 1YEJL 1YNTB 1MFDH 1S3KL 2Z92B 4DN4L 1RZFH 1PKOA 1EUUA 4GQPH 4LRIC 4Z78B 1FL6B 3QJFB 5HGBA 2ATKB 2NW2A 3D9AH 4PJ8A 3QUZC 5ALCH 4Y5XA 3ARYA 3CGTA 4NQXB 1GGCH 1RZJC 1DLFL 3FB8A 4J3SA 1S7TB 5E9DE 1LE5B 5IIEA 5FYJH 1GYAA 4O2CA 3KGRA 1A2YA 3HPLB 5D72L 5EPMA 2UWEB 4LCUA 1OHQA 3O0RH 4PRAB 5DVNA 5I19H 2IFFH 2C3VA 2J1KA 3VGDA 1K5NA 4YHMH 5ID0A 3FONB 1MQKH 4LHUG 5I71B 1Q9OB 1FV1B 4KTDL 3EYVB 4YDKL 5JW4N 4QF1A 1GZPA 4KJQD 3HA0A 3VFMA 2VDPL 1J8HB 5MEQB 1ES0A 2B20A 2XZCL 5IBLC 4Y4FA 4HH9A 3QEHB 1X6NA 4PLKD 3FTGA 5KN5A 2A0LC 4KJWC 4JDZB 4WY7H 6FABH 4UT9L 1KXTB 2IPUK 4IOIA 4GW1B 4MJ5A 5MEND 1CFQA 1NL0H 5FUZL 2Z4QA 4NNYB 3V95A 4MQ7A 1YNLH 2E7BA 4XP6H 2FJFA 2ZUQC 5GS1C 3EOTL 1NFDB 3OXRA 3HI6H 2ENYA 5JIIA 5T5FH 2FX7L 2H32H 3UJIH 3VWJD 3U0WH 3DMMD 1ZGLB 4WWID 2EIBA 5E8NB 1C5DA 3KPOB 3C87A 4PJ7A 1NC4B 4XBEH 2DLEA 2N4IA 4Y5VB 4P2RA 4X80H 3QQNA 3ZE2E 3WXVL 4HGWA 5FM8A 2WP3O 3LKOB 1IARB 1TZGL 4JO2H 2GUOA 2X7LB 3F7VA 4QXGL 4Q9QH 3BEVB 3STBA 1E4XI 3CC5B 4U1NA 2JB6B 3AS1A 3MPCA 3U1SH 4JY5H 1P4LA 4JR9H 5ICXB 3ZHDA 3I6KB 2ARJB 4N0YL 1U8JA 5FYLD 3TT1L 3ULVL 5EU6B 4Y19E 2VISA 1RJZA 1EGJA 4MDJA 1XGQB 5ALCL 2NY7H 4G6KL 3RI5K 2FH8A 5KSBB 3AXLB 3V5DA 1MLCB 4OGAD 4NRXB 4AMKH 2Q20A 4WNQB 4Z7UE 4OBRA 1QSEA 2X6MA 4ELKA 2J88H 3R8BB 4D9QD 5D72H 4PRHB 4PJCF 1F11B 4ONHB 5DJDB 4OLVH 1Q38A 5E2JA 3SE8H 4YNYA 4YHML 3LPWA 4HHAB 3PWPE 1BQHA 4NJ9L 2JJTC 1WF5A 3IXTB 3ECBA 4I2XA 1CICB 2ITDA 5IBTH 1J05A 2VE6B 3S9DB 4FABH 2V5SA 3WIHL 2IH3B 2VDMH 5CCKL 1OF2B 3QNXB 4JFXB 4AEEA 2AJUH 4KKBD 2NXZD 3OGCB 4WHTB 2IANB 3WUWA 2IPTL 3GBNH 5ACMA 1V05A 1MVUA 3TC9A 1ED3A 1N6QH 4UT9H 1J18A 3RDTA 4PRIA 3WD5L 3HR5A 4PRDA 3BEWB 1MFAH 1J0HA 3QIUB 4ODUB 4XP4H 3SY0B 3NACH 5I71C 5BW7C 3V9FA 3HI6L 5CBEA 1EXUA 2PYFA 4FMKA 3QZWG 1JPGB 3T0WA 3K8KA 2F53A 3OBAA 4J4PD 4EVNB 1LD9B 2BSRA 4LQFL 2A2QT 1INEL 4XPGL 1FVEB 2DQHL 4XC1H 1A7PH 3ARGA 4R26H 3BIAX 2H3NA 2Y5TA 4JKPL 4OD1H 4G9FD 2WSKA 5CLTA 3KAAA 2FGWL 3IDNA 4GKZA 3VRLE 4KC3B 2Z31B 5JXAL 1A5FL 3SKOB 3SDAC 2YD4A 4U6HB 4WO4A 4WW1A 5DVOA 5FM5M 1ND0A 4ZFFB 5F7UA 4FQPA 1XH3A 5CKAA 2G60L 1UZ8A 4S1QH 1U8QA 1AGCA 2NR6C 5CD3A 1FL3A 3IAPA 3GK8H 1KTKE 5DUBA 3ULVH 1D5IH 3IJHB 4GFTB 5HVFB 1JHLH 3C5ZB 1PG7X 4PR5B 5FCUL 2OJEA 1RZKH 5C0AB 4OLZH 2OI9B 1LO2L 3L3KB 4AMKL 3QEUA 3H9SE 3C6SB 4R2GD 4CMHC 5B22A 1JHTB 2ICCA 4QHUB 3ROLB 2OK0L 3QI9A 3VE0A 3RKPA 5D1ZB 3T1WA 5GJSH 2X40A 2ZUUA 4JFPB 2B4CL 2DI7A 4LLYA 3WFDL 5EU6E 4JRXD 1QYGH 4JGMA 4LSRH 1ZEAL 4LCYB 3LN5A 2XPGB 1QQDB 1Y6MR 3LKRA 5D7SH 3O3DB 2XA3A 5IMKB 1A9EA 1FNEA 1XF3A 1GJIA 1RJLA 1WEJH 1DE4B 4HV8A 5I8OL 1WBZB 1F4AA 2WUCH 4FQXA 5IFJB 5A2LH 4U1IB 5E7FA 1QBLL 4NC1C 1T5WA 4PJDA 1NMCB 3O3BA 5E8PB 4H1LG 1MHEB 1CBVL 4ETQA 2GYSA 4P9HC 1A7QH 1JGLL 4OBSA 3QJHA 1HILA 1YY9C 2A83A 4PJXA 5CJXC 1EH9A 4HPOH 5D7LA 4JFEA 3SKJH 4MJ6B 4OSUH 2BSSB 1YN6A 3QDGE 4U6XA 4GAGL 2HWZL 2LE9A 5T1LD 1WWBX 2B5IB 4P57A 2GK2A 3TVMA 1S9VA 3T2PA 3QPXH 4V1DE 2VH5L 1KIQA 3QDMD 4W4NA 4XMLL 4EI5D 2UZYB 1QVOA 3EYUL 1II4E 1Z9MA 3QUXB 1AD9B 2FGWH 2NX5E 1FZJB 1ZVSA 4GW5A 3CDCA 2ZCLL 1CFTB 3DURA 1E28A 3PL6C 2FBJL 1UCBH 2BNQA 3G6DH 1BOYA 5F7KC 3V79C 1QR1B 3U9PH 5J3HD 1BJ8A 2Q3AA 2R1YA 1JF1A 1FNSH 2CR6A 3U9UA 1IM9A 1R0AL 2C26A 1KV3A 3MRNA 1H3GA 4S11A 4XMKL 2MQCA 5CBAB 1T7WA 3QUYC 1DUYB 3JV6B 4N0RA 1W72H 1YJDH 3P4MB 3ARDA 4RFOL 4X5WB 5E8OB 2DQJL 2ICES 2DI9A 1T1XA 5AYUL 4QXUL 1CWVA 5T1KB 3VWJC 2BJML 2XWBB 5I30L 4XCNA 1ZLUH 4PLOB 3MCG1 5JOFA 1FIGL 4ZOBA 4XPAL 2DYPD 4X4YA 3RPIB 1X7QA 3QO1A 3TEUA 3QUKA 2DWEA 3B3IA 4L4JA 2R29L 3LRSA 3O2DA 4XPBL 5BZDA 4G7VH 4X98B 2YD9A 4WFFD 1J05B 2DLHA 2I5YH 1OLLA 2C3WA 4AEIH 5D70H 5IBLD 4PV9B 3P2TA 3DYPA 4IRSA 4U6YA 4PG2A 4DZ8A 1JCKA 5C0ND 4P23C 2H26A 4HUNB 2VO5A 2VC2H 4QO1A 2YUVA 2FJHB 1IBGH 1JJUA 3UTTB 5T3ZD 3WE6B 1A6PA 3JTSB 1IQDB 1A7QL 2YC1A 4HUWB 4YDVA 4ZD3H 3GSNB 2AVGA 5DI8A 5E00A 4L3EA 3ILPB 1KFAL 4AM0A 2RQ8A 3HZYA 1WSST 3QUXC 3IJSB 4K94H 1X5IA 1OM3L 2A6IB 2B2XH 1UM5H 2MQ3A 1EHXA 3DGCR 3C2AL 4D0BA 3KYKH 2PXYA 1JK8B 4XI5C 1K4CA 2HJFB 1LEIA 3DETD 3O3AA 3GMPB 5L2KB 4P5MB 3OR7B 1G9MH 3CLEH 4W70A 3D39D 4L8BA 5IJVA 1FFRA 1U8IB 1PY4A 5JW3H 1MHCA 4ODHL 3RVXC 1EO7A 4NHUB 5D5MB 2BX5A 3ILQD 4M5ZH 1C5BL 3CSGA 2DQUL 3FB5A 3AGVA 3GIZL 5CD3B 4LGPB 4P23A 3WXWH 5HDBF 3QFJD 1MHHB 2DM2A 2XA8L 4WWKA 1D3CA 5HHNA 1H8SA 2JK5B 3FT2B 5E5RB 3TFKC 3U4EA 3T0AA 3UTOA 3W2DH 2EH7H 8FABA 1MHPL 2G5BA 4EKXA 5D5ME 4D0CB 3UJJL 1VACA 1SYVA 2V2XA 3KR3H 1BPVA 3MRIA 4M1GL 4TNVF 1Z3GH 5HHOB 3FL7A 4I0KA 4WU7A 1FAIL 2N7AA 3D39B 2EDFA 3CZJA 1K4DA 1SY6L 1WC7A 3CNKA 5C0FA 5HHPA 2OXHA 4OFPA 5HHVH 2ADIA 2D2OA 4Y2DA 5JDSA 3LIZH 4I18C 1DTUA 1V7ML 1CFNA 2AABH 1JNHA 5TQ0H 3ZSSA 4YJZL 2APBA 5H8DA 1DQQA 4OZIE 3ARTA 2XKSA 5DMKB 2D9QB 4HV8B 3B9VA 3SGEI 5F96L 3DGGA 2YWYA 4LFHG 2CKBB 1NBVL 1QRKA 4G6AC 5DURD 2XY1A 2ADGB 3VXUB 3V6FB 1MCJA 4YK4C 1MUJB 1OTSD 4HIIA 4XHQA 3E6HA 5T3ZL 3VDBA 5IOPB 2H9GB 4DCQB 4OCXL 5HHOD 2IFFL 2PXYD 2FHBA 3SGJC 3BP4A 4YZFF 3TESA 4X9HA 5K33A 4XBPB 2APVA 1Z9OA 3KLAA 2FEEI 3FCTA 4QY8A 4NUJB 4WFHE 5HGGS 4JZOA 2P5WA 4GBXA 1QSZA 4WI2A 1SVZA 1QHOA 3HNVH 4LASL 4NKMB 3AS3A 1MQ8A 5T3ZE 32C2B 4QTHB 1IL1A 4L8DA 3PGFL 1NANH 5EU5A 3RDTB 3BXNB 3UTSD 3N1MC 1S8DA 1HWGB 5TDNB 1YPZB 5DVLA 5C6PB 4OZFH 4BQ8A 2I9LB 2R0ZL 5L88L 3V5KA 3BSZL 3TBWA 5I15L 2OR9L 3MV8A 1NANI 4PJAE 3VH8A 4MSWB 4O51B 4PJEE 3WIHA 1Y6NR 1BFOB 5E1HB 5CUSH 3BRGC 2V6HA 5KSAA 1N64L 2HLAA 3OHXA 5DD0H 3FB7A 2VLMD 4JM4L 4PJCE 3IGAA 4NZJA 4XNUH 4OI8A 2V5MA 3GSVB 3MNVB 3DBXA 3MR9B 5MEOA 4M7LH 4OZHE 3HMWL 4KZDL 4P3CL 4R4NC 2XY2A 3HMXL 3TLRA 4HW6A 2NXYC 5KS9B 4HS3A 4WW2F 1JHKH 1I1CA 2DTSA 3ES6B 1EK3A 3CDGA 4HF5L 4JY4B 4GW4B 4S2SA 2E9BA 4NKQB 3IJHA 4HUVB 1E4XL 3R0NA 1T83C 4NSKA 15C8H 3Q3GA 2APFA 3FOLB 4ZOCA 2OQJA 3TO4C 3QH3A 5A2KH 2UZXB 3ESUF 4JFYB 3O8XC 5DRNA 4KGLA 5DHYA 5HGBB 4Z78A 1T2JA 3IXTA 1U8PB 1F4YL 4BSVA 1M6OA 1LO4H 3MO1B 3ARUA 4UIKL 4Y8DC 5EZOL 5FUOH 3HB3D 4KK8D 4N90D 1CGSH 5DJXB 3F6LA 4WW2C 3FQWA 3ZKXC 5E95B 1ORSB 1A2YB 3UTTE 2JELL 2AI0L 1JF6A 1J9CT 4NQCD 1TTFA 3CXDL 4Z0XA 3IT8D 4UDTB 3SY0A 3VXMB 4P9HL 4R4BA 1G7IB 5KSVB 5FDWB 4D9LL 5DT1H 3ELAT 4ZPTB 2QQKL 2UWEF 4N68A 4HUUA 2RCSH 1F4WH 1IFHL 4JHZA 4GMSH 4NT6A 2PCPA 3GJFB 4M6NH 5IR1B 3S3PA 1SEBB 3MLVL 5KZCB 4P2RB 1UM4H 1JNNH 1LDPL 4LEXH 2DBJA 4LEOA 4ALAH 2AV1A 4OCWL 3ORJA 5DGQA 1MF2H 1RULH 1NGXB 4K94C 3REVA 4KJPD 4RIRA 1TDQA 2ORBH 3MRQB 5DD0L 1CLYH 4FP8H 1L7IL 1NFDA 3FZUD 4TQEH 4XNUL 4Q9BA 1A7PL 3CAFA 4DKDC 3HG1B 4YHLH 4DN3L 2DDQL 5HI3D 2FD6L 1MRDH 1KJVA 3ILQC 4FTVD 3QDJE 5CSBA 4ODBD 2W1NA 4ZO8A 1A1NB 3PQYE 2R8SL 2VB5A 2E7MA 1OD9A 3FT3B 2GK0B 1MIEL 1RFDH 3L3KA 1UGNA 1U9KA 3WFHA 2QSCH 4MB4A 1CFVL 1PKQB 4YXLL 5BQ7B 2ITCB 3LKOA 3IDIB 1D5IL 2IBGA 4NN6B 5T1DL 4F7TB 1OAQL 1NGQH 3DGGB 3NZ8B 4XVJH 4EN3D 2HKHH 2XWBA 3WSQL 4ZUTB 3DXAE 1D9KD 4KY1H 2XN9D 2BZDA 1WCBA 3QP3A 5E2TH 2AKRA 3CSBA 5LVEA 1R5VB 3D85B 1L9MA 4LIQL 4YDIL 1KCSL 4XNYL 3P11L 4WFGD 5L9DL 1KXVC 2BNUB 2Z8VC 3D69B 3QG7H 2IEPA 2R0WH 2H2PD 4ODVL 4EUPB 3VXOA 1KSRA 1VFUA 2VLLB 5DQ9B 4K7PY 1SM3L 1LO0L 2YSSA 2AK4E 3MRGB 2XXCB 1OPGL 3UTZA 3FMGL 3DWTA 4BQ6A 5ADPL 3UO1H 2G2RB 4C83B 2MHAB 2E27H 1TJIH 5KJRL 1HKLL 1WWAX 4NKMA 2CMRL 3TBYA 4POZC 5H37G 1LILA 2DM4A 3CVIL 5H94B 4RA3A 1CQKA 4NN5B 5IEKB 3RTQD 2WUCL 1KNOB 4L8DB 1YNTA 4AEHL 5E08L 3EHBD 2F9BT 4IIQB 5HHQB 4N90E 4XHJC 3WFBL 2QQKH 5FV2A 2I9LA 3KDMB 1A14L 2R2HA 5EO9A 2RCSL 1F90L 3O9WC 5D2LF 3W0WE 1DBJL 3W9EA 3BPCB 3V5HA 4ZDHA 4NQCE 4K9EC 3MJ6A 1U8OB 4Y5XB 4BZ1H 4PS4H 5I6XC 2EYSA 5L8KB 3DXAB 5DDHB 4PJ7E 3S96A 1BQLL 2HWZH 4CDHA 1CFTA 3DURB 1BD2A 3S37X 1BIHA 1IC1A 4HKZA 3DPBA 3O3AB 4K23L 2RJMA 4V2BA 4TNWK 2KQMA 2CXKA 4ONFH 2XTJB 3VXTB 1Z0MA 2FHCA 1KN4L 2VLRD 2H45A 4MYWB 5TE6L 1NEUA 4XMPL 1GOFA 4NWTH 3IKCB 4XXDA 1MCFA 2ZG3A 2CUMA 3OB0H 1JPGA 3VXUD 4WHYH 4UAOB 3L3JA 1MCBA 1PSKH 1S9XA 5D7JA 2F53B 4HWBL 4NIKB 2FBJH 3SJVE 4RMVA 3UZVB 1EV2E 3C6LC 5MI0C 4MXQC 4HH9B 1WZ1L 4LBEA 2Y7QB 4XCNB 4BH7B 3BPLC 4NZTH 1FDLH 4JRWA 1U2HA 4XT1C 2DRUA 4H8WC 4XZUA 3WS6C 5B38B 3SKOA 5ALBL 1A6TB 4P2RE 4WDIB 8FABB 4LF3B 1HE7A 4GG8A 4RFOH 4YBLC 2VZ3A 2NY5C 2EKSA 3ROOB 4RZCB 4XP9H 5IWLC 3WSQH 4QXUH 4CU6A 2OR8A 3K0WA 4RMUA 2FATL 3UTSB 4LDLB 3FJTA 4JPWL 1OOAA 1JWSA 2O26U 3WFEH 4BA8A 4PPTA 4F7MA 2R0WL 4MNQA 1SM3H 3Q48A 5LXGL 1FNHA 3V5DB 4BZYA 1YEJH 3RIAK 3WEXB 2FLBT 3SO5A 1BVZA 2E27L 4U1JB 3V7MA 3VXQB 3QI9B 3VE0B 3ZYIA 4P4KA 5F1IA 2HP4A 2ED8A 5GRUH 3CDFA 2H32B 4EI5A 1QSEE 1RJCA 2YA1A 1CG9A 5I8KL 4Z7QE 1K3IA 1CK0L 3BRDA 3SKMB 5CMAB 3W39B 1LP9E 1UACH 1S7XA 3L95A 4HKJB 3SDDD 3ZE0F 4Y4HD 1RURL 3OAUL 3BH9A 3B9KC 3DV6B 4DVRL 3EAKA 3P0VL 5DUML 5I1CL 4IRJB 1P5UA 3PV6B 5FHAH 3SDYL 4CL7A 3GHBH 2YD3A 3WIIH 4YAQB 4LKXA 3UC0H 5MHSD 2E9IA 5GIRA 3BZ4A 1DSFL 2MNUA 4WTZA 3TP4A 4LARH 1UM5L 4U1IA 1CZ8L 4NBZB 1WBXB 5J7CC 4KMTH 5J06A 2IF7A 3O2VH 2LFGA 3MBEA 2EIDA 2FECI 1NGZA 2IQAB 3KNBA 2WINB 1ZSDA 5TE7H 5FV1L 3DX6A 1IGMH 3U83A 2VXQH 4F9PC 4WWKB 2RR3A 4Q97A 1YEGH 2C9AA 4APQD 4P57B 3TVMB 5T5NG 3ZDZE 3RX7A 2EIZB 1E27A 2YD5A 4TOYL 4B5EA 5IMOA 1O0VA 2MSPA 4CW1A 2DMCA 4MQ7B 1EIBA 2V2TA 3GDBA 3DVNA 3GIZH 3HLAB 3BHBB 1P4LB 4HMEA 3L9RA 4WU7B 5T1KA 3PWNA 3RVUD 2L7UA 1TIUA 3BZEA 3VCLB 3L3HA 5T5FL 5IEHB 1T04A 2OR7A 1XGTA 3MV9A 5BOZG 2HYMA 3D3VB 4WI9A 5IB3B 2AKRB 2P5WD 1JRHH 3BP6B 5HI5C 1KC5H 4ZFFA 1MLCA 2ICWI 3RWEB 4DAGH 4W68A 1IM9B 1AKJA 5A16B 3KXFE 2AJ3B 3LQAC 1QLFB 1EJOH 5T33L 2X9WA 1L6XA 3EOAB 4KHXH 3DSFH 4G43B 4QXGH 3UTPD 1BBDH 1JRHI 5C09B 3FRPG 4P2RD 2F53D 5ICXA 2XICA 3BPNC 1T66C 1JL8A 3QDJA 5D1XD 3NCCB 1IEAA 4FQQB 3H9HB 5IGXH 5F6HJ 1MI5B 1XGPA 1H5BB 5KVMC 2GJ6E 1X4XA 4R90L 3P9MA 5DUPL 4KKNA 2YN5A 3NFNA 2NY7L 3QIBC 2W0FA 3LS5L 4X98A 2D9CA 4OGXH 2GTWA 3MZTA 4A6YL 5IKCB 5BZWB 1Q9LA 3IETB 3BO8A 3C6LB 5IBUG 5CJOH 4NO0D 3NCJH 5KOMC 3FQWB 5IVNA 1PJ9A 1HHHB 4XGZB 3UYOD 2HJFA 1LEIB 1KELH 1P9MA 4LOUC 4HUKB 2VKWA 5ID0B 2VAAA 2DN7A 5LJYH 5E9DB 2CJUH 5ISZE 1DR9A 1FO0A 3NTCL 1NBZB 1CICA 2P5EA 5I1JH 4HIJA 2DJ4A 1EEZA 1B0GB 3WIHH 1NFKA 5AZEL 1I3GL 4OI7A 3JVGA 2Z31D 3QEHA 3UDWC 3WS6A 2BNQE 5D8JL 4Q6YA 1FGNH 1J1XL 4JRXA 1QOKA 5LAXA 3GMPA 3MRLA 4TOYH 4NBYB 3WO4C 1XF3B 3HR5B 5A3ID 4OD2B 3QRFM 5I15H 4S0TD 3ZKMC 3C8KB 5KG9B 3EBAA 5BW7A 1YEHL 3NACL 5M94B 3GSXB 3U7YH 4L29A 5D7JC 4ONGL 2Q7NA 2YOCA 3MRQA 5EBMA 1R5IB 4NC0B 1ZGLA 1HXYB 1TQCB 1GL4B 5H35B 5E4IA 1AGDA 2EDRA 3HG1A 1HH9A 1N7MH 3ULUF 3GMOB 1OD7A 4YUEL 4UNUA 4W4OC 3GUTA 5C0CD 4H8WH 2MPAL 1HWHB 3HMXH 1J86A 3UCRA 1UA6L 3S35L 3ZKMD 3RFZC 2GJZA 3LAFA 3O4LD 4HKXA 2QHRH 3W9DB 3PHQB 1OWWA 2P8PB 4KROD 4GW1A 1MNUH 2NTFA 3DSFL 4PB0L 4P46D 5DRNB 4PJEB 4Q6IC 4OF5A 4H25B 1J1PL 2NZ9C 4X5LA 3P3YA 1NMAL 1IZKA 1U3HA 2HVJA 2Y07H 2C3HA 1ZA6A 4J6RL 4X7TB 5BO1L 2Q8AH 5C86A 5IW6B 3CX2A 4K3DL 4NRYA 1C5DB 3WKMH 4K7PX 3RPIA 1FNEB 2JLLA 4PJXF 3MLWL 5FCUH 3BUTA 3V4VL 3UTPE 2EYRB 4GRWF 5I76A 3ARGC 2P5WB 1MFEL 2MJWA 1D5ZA 4H20L 1JMXA 2Z8SA 5DD3L 1KPRA 4X5WA 3TYFB 1JN6A 3WYRA 4KKLC 2Y36L 3BKYH 2IFGA 4HIIB 4CNIB 3ARED 4MJ4A 5GGQH 1P6AB 4IBLT 1FL6A 2DQTL 5TFSL 2UY7A 3ALXA 4CADB 1IGCH 5D1XC 1HQRA 2C3GA 3CJJA 3QDGD 3L3GA 4JFXA 2X4SA 3F5WA 5CZKA 1ACZA 5CILL 5I17A 4N8VB 2L0DA 1NGXA 1G7JA 1NGYA 1T5WB 2ZJSL 4EN3C 1X4ZA 1F3RB 3W9EB 3GB7B 1IFHH 3AB0B 3S4SG 4V1DD 2BRRH 5EN2B 3T0BA 3IJYA 1WISA 5JHLL 4EIGB 3FN0H 1OSZB 4UU9A 3DBXB 4O58H 5K93A 5GS1A 3QQ4B 4CBPA 4QHLA 4IMLA 4WU5B 5C0RH 3MRNB 4X8XA 3RPKA 1QFWI 1WCQA 3PGDB 5I8EA 5FIEA 5AD0A 1CLYL 3K1KC 3GMMA 5B39A 4FQLL 1LD9A 2BSRB 3ZT5A 4J23A 1M05B 4MSWA 5BQ7A 1WAAA 4OZGF 4F3FB 4OKVB 4UTBH 2WV3A 2XWTA 1QFWH 3PQYB 5KSAB 2A6IA 2VDLH 4PGJA 1BFOA 4XAKD 1X5GA 4GRLD 2ZCLH 5J13C 3KLHD 3HZVB 1MJ7L 2QSCL 1PG7H 1NGPL 4WUKL 3TJEL 1UKTA 3AAZB 5GS2D 3TIEA 5TPWH 2CQVA 4OLYH 5KS9A 5ILTH 2P49B 1XH3B 1BGXH 3PWPB 2Q8AL 5BO1H 1JGDB 1GGBH 1DZBA 2HT4D 3BH8B 3EW3B 4AZ8A 1MREL 3UZEA 1ZANH 5IT2L 4IOFD 3OR6A 3VXNB 5DLML 3GBLA 2FX9H 1VGEH 5HPMB 3C6SA 3EJZC 3JV4B 2OX5A 3FO0L 5DMIH 2IAMD 4PJ7F 5IG7A 1RIHH 2ENSA 2VDNL 4MJIA 1TETH 5IFHH 2DLFL 2R1XA 3QJFA 3NABH 5E00B 5C08D 1UWGL 1AP2A 1YEIH 3UROR 4HXBL 1CN4A 2YK1L 3OZ9H 4F15C 5KSVA 1MFBL 3ARFA 1JWMB 2NY0D 3QWOB 4H26B 4LHUA 1CL7L 2HFGL 3V52H 3S4SA 4HG4J 1YEEH 3GMRB 5FO8B 4RMRA 1QBBA 4TSAL 3C60C 2P8MB 4PV9A 1DVFB 5F6IB 3QCTH 1U3ZA 5JOPD 4PV8A 3WFBH 3T09A 4I0PB 1LQSR 3FN9A 4CDGC 1K2DB 1U42A 1MHCB 4U1KB 5DSCB 1IC4L 4OZFA 4QTIL 4RISL 1X5ZA 4PS4L 1TQCC 3HZYB 4JFOA 5E0QA 2M1KA 3LPGA 5HGHB 1BBJB 1EO5A 5IVZA 1IC5L 4N0CC 1T03H 3O11A 4K23H 3LKRB 43CAA 3PHOB 2Z9TA 5L7XH 2W0PA 4Y19A 4M6AA 2K1MA 4GS7B 3V8OA 1IT9L 3BRFA 4RAVB 3NFPA 2LAAA 5GSRB 1FO0L 4YLQT 5SX4I 2OLDA 3TJHD 4TRPH 4WJ5B 1D6VH 4WHTA 3WUWB 3MRDA 4HFUL 1ROWA 3OF6A 1YPZE 1TVHB 4PJEA 3DVFA 3IFLH 1DQJA 4L1HA 3QJHB 4YEFA 1HEZA 2AAVA 1KLFA 5SX4H 1E28B 2I25N 3GNMH 5MEOB 3EO9L 1UFUA 2HT3D 4OT1H 4RFNC 4A2LA 3KPMB 5IQ9A 4JAMB 1NCWH 4X7CC 1KB9K 4EUPH 4MCYB 4JRXE 5J1SC 4KRPC 1XF5A 4LCCC 5DZNA 1FZMB 3LVEA 4E41B 4OGYH 4G3YH 3D5OF 4PGEA 1WAAF 4KK9D 1TNMA 4Y4KC 2CKBA 5DQDH 5E8OA 4NQEA 2EE9A 2QSQA 3DV4A 5DLMH 1NBYA 2Z93B 3AVEA 3VXPA 4WWKD 3QRGL 3CU7A 1HNGA 3NCYP 1RIHL 5LCVH 2H32A 4EI5B 5K9JL 1QR4A 5EU7C 5H2BA 2ED7A 4FQCL 3O2WL 5MENB 5IF0A 1FPTL 1J0IA 3E1F1 1YEIL 5EZLB 3QUKB 2DWEB 1HXMB 2J5LB 3MR9A 4Y2DB 4JFYA 5JDSB 1MI5A 1XGPB 5FEBA 4Z7OE 3RWJA 3CCHA 5GS0C 4EUPA 5GRUL 4OZFG 1QG3A 3CVHL 5I0DA 1OARH 1FRGL 4G6AD 1S7WB 4WFED 1BWWA 2IPKB 3UX9B 1GGIL 2HH0L 1WFUA 5C08E 4CUCA 4Z7NF 2AXJA 5I1CH 3T04D 4CVXB 2PN5A 5BMFL 1QZ1A 5JOFB 4Z0XB 1ZWIB 3QUMH 3HCVB 4RQQA 3SCMD 4Z77A 3PL6A 4RISH 4OCNC 1IGTA 4RGOH 1PD6A 3VRIA 3QO1B 4KMQA 3GSNA 5JDJA 4JFPA 4AIOA 2DYPB 4KMTL 5CP7B 3SE3A 1N0LA 3GJFH 3L3JB 5D1QA 1J87A 1S7TA 4K8RH 4NWUL 3BAEL 2IANA 1EJ6A 2VZOA 3B8SA 1UWEH 5TE7L 3SDXB 1IT9H 4KK8C 5SWQB 1IGML 3BKJL 4U1GB 4RFEB 2A9NL 4O9HH 3LOWA 4OQTL 1YEGL 3DUSB 1BD2B 1T04B 1BZ7B 5EA0L 4J3VA 3PGFH 4R0LA 4AENA 1ZLSH 2P7TA 4MNHB 2JCCB 5HGAA 5CBEB 3VXTA 1ZK9A 4RMSA 1XZ0A 4HIXL 3O3BB 5E8PA 3ARWA 4DGVH 4PRHD 4OAWA 5MP6H 3EFFA 4PGBA 3V6BR 2BFVH 3MGAA 3OSKA 4CU8A 1T0PB 4NO0A 3QHZL 2C1OA 3VRJB 3T0EA 4OT1L 1QLFA 3G04B 1WLHA 2HT2C 1NFDE 3CXHK 2WWMD 3VXRB 5EUKB 4HWEH 1P53A 4FFYH 2FLRT 1N59A 5C0IA 5C0BA 2YPLD 5E4EB 1KBGH 4FXGB 4EI6B 4XTRC 3THMH 1UADC 1SYVB 2V2XB 3B9KB 4GRWH 3ARFC 4KQ3H 5I0ZA 3PHQA 5D2LE 3G6AB 4HBQA 4P3CH 2NTFB 5EB9A 2RFXA 3U0PA 4XCFH 5LCVL 4P4KB 1AD9A 3QUXA 2AJYH 1IGYB 4XXCC 3CMOH 4OUUA 4QOKA 1AR2A 4YXKH 3ULUD 4PLJD 3R1GH 4K07A 5E8NA 3QIUD 4LVEA 4OF3A 4DUWA 1P6FA 2W07A 2YS4A 3H3KA 4PR5A 1G7QB 4JFEE 4X5XB 2XYCA 4UV4H 4X0KA 1KCRL 2E6QA 5C0GA 4LLUB 4KRMB 5DQJA 4G8GE 3BYYA 3JWOL 5GISH 5DHXB 4YHZH 1CLZH 1F6LL 2F54E 3RNQB 3MLUH 3SE4A 1WWCA 1HINL 4F57L 4JFDE 4GG6F 2MHAA 3C60D 1DANT 5GGTA 5BRZD 4YDLB 2W9LA 2AK4A 3DUUB 9CGTA 4APQA 4ZFGH 4M4PA 1BZ9A 1B0GA 1UKQA 4NT6B 1U3HC 1YMHB 4R8WH 3VGAB 3Q5OA 4Z76A 1MQKL 4FNLH 4M62L 4XCYA 2B4CC 4YDKH 3L95B 1FQ9C 3BPLB 4HSQA 5EC2B 1QRND 4S0SD 4XH2B 5F9WC 5SWSD 2PYEB 2B5IC 4YQXH 4N8PA 4MQXD 4OF6A 3RTQC 4YDJA 2EDYA 4PJGF 5BJTA 3T8XA 5E5MB 4F9PA 4POZD 4YHYC 1AQDA 1OTSC 4PD4K 4QTHA 2VOTA 4D9LH 5J6GB 3IFPA 2ZOKB 4JANA 1SEQH 2BSSA 5F93C 5DURB 2A1WL 4HC1A 1NL0L 1OAKH 1HYSC 5CJQL 1IVLA 4R97C 3OMZA 3GI8H 2P43B 3ZDYF 3GMQB 1AFVH 2O5XL 1VHPA 3KPRB 4M43L 2HJLB 3AMKA 4Z7WF 3KLAB 4NQVB 3HE7B 3WJLC 1NMBL 3RX8A 5D1XA 4K3GA 4OCWH 4G80B 5D6CB 1NC2A 3QI9D 3D3VE 5DJ8A 5HGDA 3NVQA 1N7ML 2B1AL 2VUOA 3D0VA 3O9WB 5I1AB 5ID1B 4JZJC 4I9WE 2NY4C 3DV4B 3Q6GH 1Q0YH 5EULV 3TYGL 1DBML 1UQSB 3SDDB 4JQXC 5DK2B 3QIUA 2FD6H 3CZFA 1LNUB 1G7LA 1NCDL 4KXZI 1YNKL 3FO2A 4LLDB 1DEEA 4QRUA 4X4XA 3QYCA 2XN9E 3BZFB 4NHUA 3OJVC 2EXYC 3U1SL 1U8KA 2FHFA 5FHBH 2NW3A 3T4YB 2K3TA 3S35X 1N4XH 4KXZH 1YY9D 4TUKL 1S9XB 5KANG 1JNLH 3PDGA 1BZQK 2VXTL 5JTWA 1AE6L 2AEIT 3ZHLA 3KPQB 5I1LA 4OCRH 1OP3H 1BOGB 1I7UA 3LDBB 2XFXA 3HZKA 3MLYH 2MKLC 3S6CA 5FGCE 3MLWH 4YHZL 3MROA 5C3LD 4ZS7L 2M8XA 1HINH 1DN2A 3QUMA 2I60L 4UOW0 5ITFA 3QH3B 3MXVL 4LIQH 4YDIH 1ZKAA 1WFNA 3G6JB 1TQBB 3B5HA 4CVUA 1BFVL 3QA3B 3RUGB 3CPLA 4FFWC 4HS8H 4Q6IB 1OP5K 1SJEB 2HLFC 4JM2D 3QWOA 4H26A 1OGAB 4UT7L 1RIUH 1QA9A 2V7NA 4BFGA 1JZ3A 2G75B 4G8GD 1OPGH 1NAKH 2M2DA 4X99B 4OCSL 1LP9A 4JFDD 1R3LA 2NMSA 4WIQA 4NOBA 1MPAH 2AJXL 3IFNH 3IYLW 5IB5A 3ZTNH 2OZ4L 1MFNA 4Q0XH 1ZHKB 4LLYB 5CINL 2IPTH 3S88H 1X5AA 4HJJH 3ARSA 3O4LA 3QG6A 3BGMB 4BUHA 3LN5B 1QLEH 3L5HA 4BUGA 1JNJA 2EC9T 1XCQA 4IDJH 1BBJA 3RTQA 5B4MC 3CXHJ 3SDAA 2Y7QA 4XCEB 3WO4B 2ID5A 3I3BA 4OQ1A 2YPLB 1BVLA 5C08A 4LAQH 4OD3H 4EBQH 4S1DD 5LAXB 3FQRA 4WI3A 3GSNL 3K3QA 4U05A 3TFKD 5L6YH 2BY3A 4YFLI 4LHUD 1U8IA 3I9GL 2B1AH 4U0QB 1I1AB 5TE6H 3LKSB 1TPXC 3IDMA 5D1QC 3TYGH 4XP5H 3GKZA 3PDDA 1F4HA 2X4RA 4LNRA 4Z0BL 2VRAA 3T65B 1HHGB 4NP4H 3B8YA 1YNKH 4M7ZB 4HWBH 1E6OL 4Y4KD 1GVIA 3QEQA 5JZ7D 3EDEA 1MJ7H 1BECA 2AJZA 2GK0A 5CJBA 4LSDA 1F8TH 1WZ1H 3QWQB 1S7QA 3OKOA 2GJ6A 5DD6B 3ARDC 5GGVH 3P73B 2WP3T 3ARPA 1BM3L 1VPOL 3ZSTA 4XI5D 5D5MF 2VDKH 2X4QB 5BS0B 4DEPB 4OIAA 4WW2B 4DKFH 1MREH 1RK0B 2AV7A 5JIKA 1MJJA 4ZS7H 4LRIA 2DIJA 4XPHH 3EDKA 3T3PE 1UT9A 1C8PA 3P0YL 1FNFA 5CJ5A 3UJTL 4JZNB 3NCBB 1OGTA 2XG4A 2E7CA 1RSFA 3U0TA 2JTDA 4XHJD 4P5TA 3CFJB 2B4CH 4YPGA 3OF6D 2EDEA 3BZ4B 1S3KH 2ZPKH 3VG9B 4HK3J 2R39A 5DFVC 1ITBB 2EO9A 5D2LA 4WTZG 2C5DC 3EGSB 5CLWA 4Y5VC 2H6PB 2EDDA 4G6ML 3GBMH 3TYFA 1A9BB 3DX9A 2E6PA 4B53A 3QCTL 4PJCA 1FLRH 5EO0A 4MMZC 1NCBH 4GLRI 1CIDA 3CFCH 4MQXC 5GRVL 2QR0A 1B3JA 4HJJL 4ZO7A 4GRLB 3BD5A 4N1CA 4NZDA 5DR5L 4LNVA 3TN0D 4MNGA 1MCOL 5BXFB 1MIMH 1QUNA 2V7HA 4GLRH 5TE4H 4FQXC 2QL1A 4YBQC 1R6VA 5DJXA 3TBTB 1PYWA 1ZLVK 4WO4D 3K8LA 1CLOH 1IC5H 5GRWA 3NA4A 3L5WB 4NKIH 1M7IA 4LARL 5D6CA 3WLWD 4TUOA 5EZIL 1X5KA 5EUOF 4L8SA 4HUXA 1JV5A 2C4FU 5HHXH 2IPUG 3DX7A 3AY4C 5FYKD 5C8JA 2MFNA 1S78D 4QYOB 1T5XB 3H7BB 4JN1L 2R4RL 2VXQL 2OL3B 2AXHA 1CLCA 1XCTA 4R2GB 4NP4L 1NFDF 2EDHA 5CGMA 4NQDE 4F58L 1REIA 5FUZH 5GGSB 5GS2H 2HTKC 3RWCB 2FWOA 2AGJL 3MJ8B 4NJAH 5TH2A 3CX5J 2V2TB 3KXFD 3B83A 3MOAL 3CFEB 4PJEF 2XKNB 1HQ4A 3HG1E 3JZ7A 5DDHA 3STZA 5B8CC 2FECL 1KF9B 1BM3H 1VPOH 4E0RB 1HSAB 5DS8A 1Z9SA 2VDKL 3U0WL 4LU5H 5F1SA 2BVPA 2D03H 3L7FA 3QDGB 1XT5A 3DNKA 5GS3A 3QIWB 4NKOB 2EKJA 4NNXB 5I30H 4P59H 5B4MD 1FFNB 2X4TB 4G8GB 1IGJB 2H8PA 3DJ9A 5JPMA 5FOBA 2N7BA 4PRPB 3BPOC 4XPAH 5DD5L 3QHFL 2XZQH 4MXVF 5EOQL 4ZPVA 4GT7A 4TNVK 2HRPL 4FTVB 2OTWA 4QLRA 3BP5A 5DFWH 4YXHH 3CSYA 1J7VR 4ODTH 2AERT 3VXMD 5E8DL 3T1FA 2ESVB 5BOPA 4I18B 2VQ1A 1LWRA 5IGXL 2ZUSA 1PZ5B 3TPUB 4F2MA 5GJTH 4L1DA 4AEIL 1I9IL 4YEEA 1OAYH 4LSUH 1FLRL 3TNNB 3PNWA 4RX4A 3KHQA 1GGIH 2VLRE 3KYNB 2FX8L 2VC2L 4JM2C 4MDIB 4RCAA 2DMBA 4DQOH 5BMFH 4HGKC 4FFWD 5L2JB 2M26A 2N56A 4P2YA 1MCOH 3RVTD 4KV5E 1MIML 1HI6B 1UWXH 4PRPD 1KELL 2G5RA 4X83A 4K94L 3WDHA 4LSQL 3FQRB 5DJAB 5I76B 3MV11 1ZT1A 2XKUA 3WFZA 1BREA 3SGKC 1KCVL 3FQXB 4ZUUA 5HHXL 1BQUA 1P1ZA 5I1JL 2IALB 3L5JA 2R2EB 3E8UL 1KNOA 3RVWC 2EEDA