1HWHB

1:1 complex of human growth hormone mutant g120r with its soluble binding protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
206
structure length
196
Chain Sequence
b'EPKFTKCRSPERETFSCHWTDPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH HORMONE
publication title Crystal structure of an antagonist mutant of human growth hormone, G120R, in complex with its receptor at 2.9 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (hormone/receptor)
total genus 32
structure length 196
sequence length 206
ec nomenclature
pdb deposition date 1996-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hwhB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hwhB01
4C57C 3QCVH 5I1HL 1A6AA 1CFNA 2I27N 3JWDH 2CK0H 3KXFA 4MJIB 4FP8H 5DJ6A 3NACL 15C8H 1Y6KR 1JGLH 2MQ3A 4ZDHA 4LDOB 1EMTH 1J1PH 4MA7L 3T04D 5I1JH 4U05A 3BPCA 4JG1H 1QFOA 3SOBL 4OD1H 3SDXE 4Q9RL 2EEDA 2IFFH 1IBGH 4NQCA 5DJDB 5DD1H 2GJ6E 4Y2OA 3OB0K 5LCVH 2VLRE 4KUCF 2JCCA 3TVMB 4AIZA 4XZUA 3VFWA 4K07A 4XX1E 4N9GA 1FIGL 3ALPA 4J8RA 3LY6A 4J1UA 3P73B 1BOYA 2H9GA 5KAQF 1OAXH 3D1MC 1UC6A 1TJIH 4CKVX 3I02B 2GCYB 5C0EA 1EUUA 4TTDC 1NAKL 4ZPTA 3VXSE 4K2UL 5ITBL 1XGTB 5E1AA 3FT2B 3VJ6A 1X4XA 1NPUA 3DI2B 2Z31B 1VGKB 4U6YB 4X99A 1XIWC 4LCIL 2H45A 1KXTB 4S11A 3L6FA 2HJKA 4C56E 3O2VL 1NGPL 5J13C 3GRWL 1QFUL 4NFBA 5GRUH 1ZOXA 4Y8AA 3RL1B 3VCLA 5DEFA 5ALBH 4AT6A 4MQ7A 4UIMA 2Y1VA 1I3UA 2R2HB 3FN9A 3H9YA 1G6RL 1OL0A 1QSEA 1TJHL 1AIFB 1U8JA 4JLRA 5FM8A 4WO4D 1RQ5A 3TPKA 2DB8A 1ZGLM 3QEQA 3ULUC 2FEDC 4PR5A 2CMRH 1X7QB 2EDLA 1MFBH 4N8VG 5IBTL 3ZKND 5JQHC 4F57L 4DAGL 5I17B 3SQBA 2VN7A 1DUYA 3D69B 4XCYB 3FFCD 4XP5L 5E08H 3UCRA 5HJ3B 4KK5D 4MHHG 4LCYB 2D03L 4E0RB 4X6BA 4MX7B 2C1OA 32C2B 2E5EA 5EUKA 3ROOB 1Q9KA 4O5LH 2EE2A 5HY9B 5H94A 1B6UA 4JAMA 2M2DA 3ARYA 1U3HD 1ETZB 1HKLH 4QO1A 1A1OB 1QRNE 3WNMA 4KPHL 4U1IA 1I1CA 2A73A 5ENWB 1FFPA 5INDA 3N50A 1WT5A 1WC7B 3W39B 5C07B 4NUGH 3DMMC 5IFAH 3QDMD 4KKCD 4WDIB 4Y89A 3PQYD 3EO9L 3G5VB 5DGRA 4HUVB 5AEAA 1KPVB 4IIQA 4PJEE 1H15A 3C2AL 4JN1H 4NKOB 4HBCL 2WINA 4F33B 4NZTL 4GG6E 3WE6A 4P2QA 3VGAB 2P5WB 5E5MA 4G7YH 1XZ0A 4DKAA 3ARBC 1JPTL 4HKBA 3G6DH 3LN4A 1MRDH 2X4OB 1YN6A 4HQQL 1FPTH 5ESAB 4PS4L 1RJLA 5JOFA 1AGDA 1R5VA 1RIHL 4NIKB 5E9DB 5IK3A 5HDLA 5FXCH 5DUMH 5C0ND 3N0PB 4MVBC 3T3PF 5SWZD 2DD8L 4IRSA 3D85A 1MFNA 5L0QB 2HFFA 2YPLE 3NACH 1WFOA 4QXTA 1VFBA 5E8PA 5C0AA 4MA7H 4KK6C 3QUYC 5AUMB 5CHNA 2GFBA 4GAYB 3FN0L 3E6HB 3QHFL 4Y2DA 3SOBH 5J12B 4Q9RH 1AGEB 2LFGA 2ZKHL 2NX5E 3WFBL 4CW1B 5ISZA 5A2LH 4XI5C 5F6HJ 1G9NC 2BRRL 4GBXC 4U3HA 2R56L 4G8IA 1FIGH 4HXAL 4UQ2B 2VR5A 1T7WA 3L5HA 3QJHA 5JTWA 1UWXK 2VKWA 3HPJB 4F3FB 2APTA 5IVNA 1HDMB 2CDEB 5IW6B 4ZPVB 5K9QI 2JCCF 3OR6A 4H0GA 4PJBA 1NAKH 1U2CA 3IXTA 5SWSB 3MJ6A 1ZGLA 4APQC 4K2UH 5ITBH 2FGWL 4MJ5B 1BLNA 3QQ4A 4XPHL 2PXYB 4YHMH 1UXSB 4LASL 2PTTB 4WHTB 1YEJL 4TNWK 1FNSL 3NGBC 3O2VH 1NGPH 4HXBL 3GRWH 1QFUH 2GYSA 1TZGL 1FDLL 4GO6B 1F3DH 2ADIA 5MEND 5GGTA 4C54A 1QKZH 5GHWL 4JB9L 4OFYD 3RKDD 1G6RH 1TJHH 1MHHB 2QQKL 1AGBA 5EU6D 2I60L 4EXPX 4I3SL 5C0FA 4KUZH 5IBTH 4D3CL 3R4DA 4F57H 3OB0H 1MCBA 1UG9A 1V3LA 3LSOA 4XP5H 3ZYIA 4HK3J 5A43C 1NGWB 1RJYB 4WW1A 4U7KA 3IKCA 2Y5TB 4PJIE 3E0GA 3GZKA 3KDMB 1H8SA 1INEL 5F93C 4N5EC 1WZLA 4ZOEA 1HH6A 2YPKA 1T1YB 4KGJA 1K85A 4U1NB 4QRTA 4IBLT 1PYWA 3JWNC 3PG2A 3V6BR 3VRIB 3Q6GH 4H0IA 4EI5B 4KPHH 4NQSA 3B9KA 4OZHA 3LQZB 4YFEA 3MNWB 4C58B 4U3CA 4X80L 5LG1A 4D0DB 4JFHD 3EO9H 4ZUVA 3UTTE 4OI8A 5M95B 3BYTA 4TUKL 5SX4I 5EIQA 3C2AH 3NMEA 1CDCA 4GG8B 5T33L 3H0TB 4EN3A 5C0IA 1RZ7L 5KSBB 4NZTH 1JRHI 4WI5A 5CP7A 4KZDL 3D18B 4ZNEE 4FXKB 1JPTH 4HQQH 1VESA 1MHCA 3W0WE 4OF3A 3CFCL 3B3IB 4PS4H 5EORL 2CLRA 2DKMA 3GSOB 4NQTA 1JMZA 3R06B 1RIHH 4LVEA 2BY3A 2A38A 2NXYB 4H1LG 5IBUG 5IFJB 2A6DB 1KOAA 2RFXA 2DD8H 4Y5XB 5FEBA 5HHOA 3HPLA 3MA9H 4UTAL 4S0SD 2YR3A 2YWYA 4WI8A 2V9RA 3ZKMD 1ZA6A 2W91A 4GMTH 4U1MA 3QHFH 2AJUL 4ZFZB 1YEIL 2R23B 2ZKHH 5DD6B 2FX9L 5DJ0A 3RWEA 4Z78B 1GGCL 3WFBH 4HJJH 1TCRB 2Z8RA 2NTFA 1JHTB 4E41A 2R56H 4I0PC 4IJ3B 5HHVH 4F15B 4HXAH 4WWKD 2YBRB 5DEGA 4O9HL 1M71B 1H5BA 2X44D 3NIFF 2IGFL 4POYA 4AH2A 4GLRH 2IAMD 3LKPA 3D2UB 4Z6AT 1U3YA 3HAEB 5KSUA 1A21A 3ULUL 4PTTB 4X5WB 3PGCA 1RUPL 3O8XC 4G8GB 3LRSB 5F1IA 4WHYG 4XPHH 1CF8L 2VN4A 5DXWA 4LASH 1NUFA 2VUYA 4HHAB 1KPRA 4HF5L 1YEJH 1RHFA 1N5AB 1FNSH 4PJBF 1MRCL 4OZFG 1TZGH 4F7CB 4XCEA 4JVPA 4N0UA 3HR6A 1UQSB 4JB9H 2XACC 1NUGA 5HYJD 4UU9A 4KWUA 4X7DC 2IPUG 4FQLH 2QQKH 3MO1A 1AHWC 3EJZC 1G0YR 3MLVL 3U46B 4I3SH 3BJLA 4L8DA 1HH9A 1KLFA 1T5WB 5HYIA 2ERJB 5GGQL 3ZKXC 4QRRE 1U8IA 2E3VA 3H2WA 1INEH 3TFKC 2W59A 5CSZB 2JTDA 4JEGB 5DMKA 2XTJB 4P4KC 3F58L 3V0VA 3CSPA 3LDBC 3OSKA 5B22A 3MRHA 1BIHA 2JK5A 3L7EB 1PJ9A 4HGKC 3TC9A 1LEIA 4PGEB 4HFWB 2PETA 2YRLA 1DL7L 2ARJA 3FO9B 1LEKA 3PWLB 4LSVL 2MPAH 3QIWB 1K4DA 3SKOA 3DHMA 4TUKH 1T83A 1YQ2A 4TN9A 2AK4A 3HN3A 2ADGA 1WCQA 5T33H 2V7NB 4UNUA 4BYHA 2Z91A 4OM0H 4OZHF 5E6IC 4EDXB 4LSPH 4CU7A 4KZDH 1U91B 2XWTB 5A16B 4GSDL 5DJ2B 5DJAB 4W68A 3PABA 3CFIC 2EDYA 4Z7VB 1RUAL 3O6FC 1KTDA 2P8MA 1G9NL 5I8OL 2EDNA 3CFCH 1X5IA 3PP3K 5EORH 3TESA 3CXHJ 5B3JF 1NAML 1HYSD 3L5JA 1MJ7H 4ZAKD 3V6OA 2H26A 5FO9A 3E2HB 1EVUA 1U8QA 4MGXA 5BVPL 1SEBB 4ZFOL 4RGOL 5HI4D 2VLJD 4JFEA 3DSFL 3JVGA 4DUXA 5E2VL 4UTAH 4NM8L 4WEUD 4UOJA 1EHAA 3W9DB 2AS5M 1G7IB 3SHSA 5A3IC 2O5YH 2AJUH 5TPWH 1YEIH 1CLCA 3ROLA 4GW1A 1GPOH 2FX9H 1T04B 1GGCH 5TGBA 3AREC 3KNBB 5HYSG 1FYTD 1J11A 2B20A 2O61B 1ITBB 4WNQB 4LRIC 4O9HH 1P2CA 2JB6B 3O4LA 3WIHL 3KPSB 3RBGA 2WBJC 3EYVA 3QO0A 1QLEL 5D93B 3L5WB 2IGFH 5GSRB 4M6AA 2CRZA 3S97C 1NBYA 4Y8DC 2GITB 4P3DA 3ULUH 3L9RA 3OZ9L 2QADD 1JNNH 1GYAA 3MYJA 5FM5M 3L3OB 1DBKL 1F90L 1FO0A 4JM4L 5EG6C 5IJKC 4NZRL 3QAZB 5KS9B 1E4JA 4KRPB 2XFXB 4HF5H 4K94H 4PJ5B 1V8HA 3G5YA 3MJ7A 4KTDL 4MDJB 3D0LB 1EAPA 5D1ZD 5DZNA 4L4VD 3ZDZE 2VUOA 2MNUA 4OF5A 2Z9TA 4HGMA 4O2EB 4WUUB 2CDGB 4MJ6A 1RULL 5J11C 1HQRB 5IVXE 5JR1L 3OR7A 3A6OA 2AW2A 2BNQA 4OZ4B 3EFFA 5DVOA 4BQCA 3MLVH 4P2OA 4W4NA 2I9LB 4OFDA 4BFIB 1HILA 1SJVA 1IGCL 4RAVA 3AS3A 4I18C 4MNGB 1IC5L 1GRWA 1DVFB 1U8OB 3S98A 3QUZB 4K3EH 4PJXA 5JOPE 2AJZA 4PJFE 1P1ZB 4XHJC 5FGBC 4O51A 4YHPA 3FT3B 2NY5C 5TH2B 5FA4A 4LSSH 2X4UB 2YKLL 1CXIA 3F58H 2ARWA 5HVGB 3RPIB 4P46B 1YYLL 4Y1AE 4J3VA 4BSVB 4P2CG 5E2JA 3T8XA 3D39E 3V4VL 5TDOA 3TO4D 4M62H 3NPSC 5ICZA 3LAFA 1RZGB 4F7MA 4ZMAT 1DL7H 4KROC 4LSVH 5B8CA 4YJZL 5F1SA 4ODUB 4Y16A 4HKXA 3CVIL 4O2FB 1ADQH 2KDGA 1GOGA 4UNVA 1RY7B 1YMHA 4GSDH 4M43L 3MRQB 4FQQB 1FZOA 4ZOCA 2J8UB 1RUAH 1J8HD 1G9NH 5F9WB 4POUB 5J6GB 4R4BA 4IMLA 1T0PB 1M6OB 4RFOL 1NAMH 3OXSA 2X1PA 1G7PA 4NCDA 5GIRB 3BQUD 2VDRL 1ZSDB 5IMKB 4N90E 4W4OC 4CN6A 3UO1H 3AM8C 3IAPA 2P48B 3MZTA 5D6DC 5BVPH 4RGOH 5ACZB 3QFJB 3MLYH 2N4IA 3DSFH 1WCBA 3C2SA 3HMWH 3QDJB 4NM8H 2V2XB 3L1OL 1A7NH 4KAQL 5EO1A 4PJ8A 1XCTB 3C09B 3MR9A 1ZXQA 5CMAA 4HWBL 4HUUA 3ZKSD 5DHYA 3TNMB 2HJFB 4Y4FD 1QR1A 2Z8WC 1IGML 1H3WM 3AGVA 4BUGA 1RIUL 2XN9E 3BP4B 3BMWA 3WIHH 3JV6A 4YDJA 1R24B 3VXUB 3TN0D 1IGYB 3BW9B 1UVQA 5D1QC 2DIJA 2YA0A 1ZHNA 1L0QA 1R3KA 2IADB 1D6EA 3OZ9H 4YK4B 4K23L 3MC0A 1JWSA 4IHOA 3TYGL 4YX2L 1DBKH 1F90H 4I3GA 3VFRA 4JRXE 1MIEL 4JM4H 2A6KA 2BMKA 4DGIH 3IU4L 1QPXA 3PP3H 4G6AC 4NZRH 4TNVF 3V7AE 1G7JB 1T21B 2XG4A 3WDJA 3EAKA 4U1SA 5DO2C 1UWGL 3MRDA 3BUTA 3GK8L 5T3ZE 4WUKL 3X3FL 5CINL 2BK8A 1D9KB 4MNHA 1PZ5B 1G84A 3GB7B 1K9TA 1RULH 4PRPD 4M5YH 4MYWB 1UCBL 5JR1H 3L3HB 5JDJA 3MLUL 3GUTA 4KMLB 4LLDA 5C8JB 4B50A 5J6HB 5FGSA 4UV4L 1IGCH 1CWVA 4JZNA 3BGMA 3SE3C 1IC5H 3RZCA 1WBXA 5IROA 4MQ7B 4LHUA 3C5ZD 4EKXA 4ELKA 2VZ1A 3PJSA 4GKSB 3MRGB 2XNAB 2EO9A 1SYSB 2F8XC 5CWSB 1YYLH 3EYOA 5HDBE 3CX5K 1CFTA 4PJXF 3O41B 3IDMB 4KDWA 4DCQA 5F7FA 3GSQB 1CG9A 1ACZA 2GTWA 2KL6A 3AAZA 4NN6B 4FRWA 4EUPG 1A4JA 4IM8A 1HXMA 5FK9A 2FHFA 3QEHB 2D7NA 3BZFA 3VGDA 3CVIH 3GBML 4OD3L 2E7LC 5E00B 1HNFA 1HSBB 4HKZB 3MPCA 3MRFA 2EO1A 5EU3A 1T0NA 5CEZL 1MHPL 4LBEA 1G7MB 1Z5LB 1JZ3A 4HDIB 4U2ZA 1WJ3A 2JB5L 5H2BA 1DE4A 2WM0A 1H15B 1TTGA 3GMPA 4X0KA 4R8WL 5ANMA 3MLTB 4RFOH 4OF0A 5IEKA 4XNQB 4EIGB 3THML 2VDRH 5CJ8A 4D0CA 1GXEA 1B2WL 4JFDB 4LDEB 5ICXB 3V5KA 4Y5YC 4PJGA 4NQEA 2AJ3A 2BY2A 3L1OH 3L3KA 4RAUA 4X5LA 1FCGA 4Y4HC 4KAQH 3UTQA 4L9LA 3MOBL 2FEEL 1R5VB 3P4MB 4HWBH 1MCHA 4JFYA 1UFUA 3EZJB 4EVNB 3FHAA 5DTFA 2ZJSH 1XGRA 4HGWA 3X14A 3FO1A 4IRSB 1YPZE 1BBDL 3MV7A 4QRQA 1VFBB 4RBPH 1IGMH 5C0AB 4JQXC 3T4YA 1RIUH 3DNKA 3OWEA 4YDVA 4WW2A 2C3XA 2KQNA 1TQBC 4KUCD 2FJFA 2YEZB 5DRZB 4LPWA 4K23H 3TYGH 3S35L 5ISZB 5HHMB 2Y6SD 4D9QE 1WZKA 3VFUB 1PY9A 3TA3C 3GMLA 1MIEH 3O2DH 5MEOA 3QR2A 5MHSD 4XPGH 4JZJC 1R3JB 1CDIA 3MNZA 1YNTA 4Z76B 4OCMC 5EOCL 3SKNA 5GSVB 2NY5L 3OGOE 1SYVB 2PYEA 3X3FH 5CINH 2VISA 3S36X 3OR6B 4BFGA 3T65B 1FN4A 1ZWIA 2RIKA 1UCBH 2BNRA 3B2UC 3MLUH 2A83A 4F9LA 2BVEA 5DJZB 4X9FA 4HPYL 3MJ8B 2AXFB 1W8OA 3AS2A 3TBWA 4Z7UE 3HE7D 5DS8B 1PY4A 3LKNA 3QQ3A 4M1CD 1P53A 2KH2B 3ARFD 2ADIB 3FZUC 2Z35A 2DDQL 4XNMA 3RIAF 4L3EA 3GHEL 5KTEH 3TYFA 3KYOA 4H1LH 4AQ1B 2H1PH 1QSVA 1BIIA 2A6IA 3PWJB 4XC1L 5FYJU 4C55A 2CKBB 4TUOB 4X6CE 3WUZA 2CO6B 3AC0A 3HZKA 1A6WH 3H9ZA 1ED3B 2R2EB 1OGTB 5E5RB 3GSUA 4QEGA 3V2AR 4XVSL 3TIEA 2W65B 2ZUSA 3AS0A 3J7HA 4XVUC 5JHDD 5JDSA 3MCKB 3VFTB 4ZODA 3GGWB 1CDGA 1YMME 4J4PC 1IGTA 5J9PA 3GBMH 2E7MA 2LU7A 4OD3H 5K9KA 5DC0A 1CGWA 3LKOA 1NBVL 3C60D 3QO1A 3U1SL 4Q97A 1MWAA 3PDOA 1I4FA 1MHPH 4HD9A 4NQDD 4R3SA 1LHZA 5EUOB 4OZIE 2MWCA 2JB5H 1OB1A 3Q3GB 2CRIA 4LKCA 5C71A 4R8WH 3T4AA 5C0IB 2NW2B 3THMH 3IDJB 4KDTA 3WL9A 1A9BB 1B2WH 4HWZB 2XXMB 3QDGD 5C0CD 2VR4A 2FJHB 4NCC2 3VW3L 3QA3A 1T7XA 4Z7WB 5ID0B 3MOBH 1OM3H 1XR8A 2ZG2A 1AD9B 3T77B 2CH8A 4PJGF 4K3GA 1AQDA 1A7RL 3PHOB 3ALWA 1BBDH 2LU4A 4IDJL 2CDFB 3BX7C 1J0YA 3KXFD 3PXJA 2X1QA 5MEPB 4YXLL 5I19L 2F8VA 3MREA 4FQXD 2BSRB 1J10A 3ZL4L 5KSAB 4IRZL 4LEOA 1GGYA 5DJ8B 5DK2B 2YXMA 1K8DA 3AY4A 3C6LC 3RWEB 2UZXB 5J1AB 1NH6A 3S35H 1XCQA 4EEEA 2XA3A 5GS3A 4WW2F 1DQDH 2BOCA 2QQLL 4NQCD 4X4ZA 3WKML 5DEGB 4FG6C 2W9DL 3TF7C 4XMKL 1SM3L 5JNYB 1PKQE 5EOCH 1S7XA 2VABB 2NY5H 4PJHE 2MTPA 2HKHL 1JGVL 1W0WA 4ZXBB 3O3EA 1JWMA 4U1JB 3IF1B 3P4OA 5DUBA 2AABH 1NFDA 1YEFL 4WI9A 4QF1A 3EZ8A 3O9WA 3ZKQD 5HPMA 1AKJA 1TVHA 2KKQA 5FO8B 2XWJB 4F9PC 1G0DA 1GVIA 4I13B 1TPXC 1XGUB 5T3ZL 1Q72L 4MCZB 3MRMB 3EGSA 3SDYL 1FE8H 1D3CA 1RJZA 4DFHA 3GHEH 2YSSB 2AAVA 4X7TA 1S3KH 5J06A 1S78C 1WBYB 4XWGL 5F8RC 2GK0B 3MO1B 4I48A 3G5ZB 1A8JH 4L8DB 4XC1H 1QSED 2BSED 5B39A 4NBXB 1F97A 2HRLA 3MRKA 4WV1B 1XH3A 3EDEA 2YHGA 3CLFH 1JTPA 4QWWC 2NZ9D 4UBDC 2OSLB 5IR1A 4G42A 4ODWB 4J23A 4POZC 1T89A 2Q7NA 1PW3A 2O5ZL 2H2SD 1AP2A 5ACLA 2OZ4A 3MV9A 3CNKA 5LBSL 4HS3B 3RL2B 4X6DB 4Y19E 4YGVB 1P7KA 3IB4A 3BHBB 4WTZG 1I7RB 4WTXA 3CDGA 4ZTPL 5FUCE 4LDLB 4ORGA 1CD1A 2V5SA 3ARGB 1C08B 2UVFA 4KKAD 3DXAA 3FB7B 2Z91B 4PYGA 2VZVA 3HMXL 5I6XB 3KWWA 5IB2A 4X8JA 1CL7L 2AEQL 3H9SD 3MSPA 3F62A 3VW3H 3FFDB 4P2QD 3QDAA 4QRPD 1SHMA 5T1MA 4HCRL 3P0YL 4MDIA 4ZFFA 4P59L 4DW2L 2NY3B 1JYNA 5D6CB 5DD0L 1MI5D 4HMCA 3EW3B 2KZWA 3GBLA 5F6IB 1FFNB 1UZ8B 3L3JA 4PJ7E 4M48H 1A7RH 2H26B 3KPRD 2GY5A 2RHEA 3TZVA 4IDJH 4LSDA 4NSKA 3N85L 3SE8L 3D85D 4YXLH 3QUML 5I19H 3P9MA 3ZL4H 3HTLX 1EEYA 3VWKA 5BJTB 3ROLB 4L1HA 2FO4A 5DEZA 1G6RB 2JJTC 1JV5B 3QPXL 4GRLB 1PAMA 4HZAA 2YS4A 2QQLH 4HH8A 4CN1A 4GW5B 3C9NA 5FUCC 3W9EB 3WKMH 4QHKJ 4RIRA 4PV9B 4XMKH 3BXNA 3WUWB 3QO0B 4JM2A 3U4EA 4O02L 4WO4C 5GS0C 2HKHH 2W9EL 1F6LL 3S5LA 2GJZB 3HB3C 2EIZB 4K8RH 1KELH 3VD3A 5IV2B 5FDWA 1YEFH 1O7SA 2NY6B 1AXTL 1GGUA 1GCFA 2QL1A 1SJHA 3LKSA 2X9XA 3OX8B 3QIUC 3SBWC 3VXMD 5T3ZH 1JUFB 4Z0BL 1Q72H 1J0JA 1NFDF 4BZ1L 2WBKA 4HLZH 5GGSY 5DDHA 3B2VL 1K4CB 3WLWD 3GSWA 2L4OA 1WIUA 1CGSH 4Q6YA 4DN4L 1KGCE 3TBSA 4OF6A 3OR7B 1TQCB 4R2GC 4XWGH 1ZLWK 2EYSA 1OGAB 2BVQA 1AH1A 4MNQB 4MQTB 3S3SA 1R5WB 3HE6A 3QJFA 5DRXB 1FC1A 4RAVB 1N0XL 1FAKT 4JPVH 4NNXB 2Z92B 2C1PA 3DO3A 1MLCA 4CMHB 2X7LA 1BEYL 1KLUA 4PB0L 4ZQKA 4K9EL 3UTPD 2E9JA 4YHPB 5D7LD 5I76A 2EICA 5C0JA 4X4MA 2O5ZH 1CDYA 1NCDL 2ESVE 5ESVB 1II4E 3HC3L 5BW7A 4L29A 2XA8H 5F1NB 4LCWD 2DJUA 5CD3B 5TDOB 5LBSH 4EDWL 3B43A 1P4IL 1KCRL 2H2PD 3MODL 5D7JC 1N5YL 5FOJA 1U93A 1FBIL 3PIQB 3BKCL 3CH1A 3CH8A 1UKTA 3VMOA 3VXRB 3VWJB 5GGSA 2YD2A 4ZTPH 4G8EB 1EFXB 3ORJA 3B9KD 1ZLVH 1NEZB 4NO3B 3PL6B 1OP3H 5ILTH 4ZO8A 4GLRI 1IZJA 3CCHB 1JI2A 3GSXA 1YMHB 2W0KA 2W92A 2FD6L 3K46A 3QUXA 4P2RB 5DVLA 1CL7H 2JJSA 1NC4A 2AEQH 3S34L 4EN3D 3SKJL 1U8MA 5IG7A 1AO7A 4HCRH 4MA3A 2IPKA 4XC3L 4NUJA 1EPFA 4P59H 1S9WB 4DW2H 4PRHE 1BP3B 4S10A 5DD0H 3M17A 3MV8E 3C8DA 4MXQC 3NFNB 3KPMB 4ODBD 1LD9B 1JF1A 1OAYL 3T2PA 4XPAL 3IAGC 5AYQA 5C0RL 3SE8H 1UEMA 2XKSA 3QUMH 4N9OB 4UUJA 2NXZB 2BC4B 1I7ZA 3D0VA 4LVOC 5JIHA 4LAJH 2B2XL 4CNIA 3CIQA 3Q5YA 3IJHB 5DHYB 4A6YB 1KJ2A 1MREL 2BNUB 3A6BL 1CDJA 3QI9A 2N56A 2C3VB 4FMKA 4XNXL 4HUWA 2ZNXA 3QPXH 4DN3H 1FFOB 1WFTA 3L95B 5E99L 1BD2B 2ICEB 3PWVA 4GUPB 2EKSA 3T0EE 4O02H 3BDXA 1ORSA 5F44A 4E41D 5C0DB 1D5MA 3EIFA 5KANI 2DQCL 4OV5A 1CICA 4HWNA 2DMKA 4MAYA 2C26A 4NQXA 1Q38A 1N3NB 4J3SA 1AXTH 3QWQB 4JM2F 5TE7L 4BSJA 3PF2A 2PO6C 5SX5K 4FXLA 1FLTX 1QLFA 3DUUA 2VZOA 4R4FL 1P7HL 5D1XB 4Z0BH 1XF3A 4MJIE 2AV1B 3C5SA 4BZ1H 5F7HA 2HVJA 5HGHB 1NANH 3B2VH 3PXHA 4LPCA 3WS6C 2EH8L 5KVDL 2ZCKL 3BISA 5F71A 3DGGB 4DN4H 5JPMA 3EUUA 1PD6A 4PJDA 2DQTL 4LPUA 3UTZA 4CVWA 4LLDB 4WTWA 3WIIH 4WU7B 3O3BB 1NCAL 1N0XH 3T0XA 4PP1C 5JXEA 1GC1C 3D25A 4PGZA 5D5MA 4MCYA 1BEYH 1BFOB 4NRZB 4ELKB 3WNLA 3TWCL 4PB0H 2W0FB 3PJSB 4JZOB 3T0EC 2V17H 4IDLA 4O2CB 1XF2A 4CU6A 4XH2A 1NCDH 1XGPA 4OCWH 2R9HD 3MRRB 3GSVA 1FG9C 1P4LA 4NQVA 4HUMB 3RDTA 3PWPD 1P4IH 3O6LL 4Z7NE 4RMUA 2VDNH 1KCRH 1CG9B 5EOQL 4LLYA 4MB4A 1N5YH 1FBIH 3BKCH 5BRZB 2GTWB 1NC2A 2VWEE 5GQBA 3GMRB 2LE9A 3V4PL 1A4JB 5JPNB 4L8SA 3GI9L 4URTB 1XIWB 4NO0A 3ZKMC 5DZLA 5HHQA 4DKDC 1EXUB 3SDCA 1WVZA 1KB5L 4KY1H 5FOBA 3RPKA 1XF5B 1M05B 4PGEA 5CZKA 1HHHA 2FD6H 3MRFB 4NN5B 2AK4D 3S34H 3SDAA 3SKJH 2IG2L 5FHAL 2ITDB 2QQNH 1YQVL 4XC3H 5IEHA 3PGDA 3TVMC 2V5RA 3VXQB 4YPGB 4S1DD 5FKAA 1ZS8B 1HSAB 2X4TB 4YO0A 2G2RA 5BS0B 2Y06L 3KLHD 1BQHA 2AJ3B 4XPAH 5C0RH 3TJHC 2VDQL 2W0PA 2GAZB 3MROB 4G6FB 3HC4L 2VL4A 3JTTB 3I84A 3QNXA 4JFED 8FABB 2B2XH 1X6LA 4U49A 5IT2L 1SMAA 3I6LD 5AZ2L 3KPPB 5DTFB 3BPOC 4KVNL 1MREH 1XGRB 1MFCL 3A6BH 2VWEC 2Z31D 5C07E 2Y36H 4TVPE 4XNXH 4G43A 5CD5C 3GJFK 1RUQH 5B4MD 3C8HA 5E99H 1F8TL 5C0BA 2CIKA 1X9QA 1RD6A 3DMMB 4KJYA 5D7IB 3S6CA 3H8NA 4GKZB 3IS1X 4ELMB 5FKPB 1LDPH 2Q7YA 2AP2A 4M03A 1MFEL 2F8OA 4G9DB 5EBLA 3HNSL 2P5WE 5GXBB 3O4LD 4Y4KA 2DQCH 2EDKA 3HR5A 2DYPB 4PIRF 4QT5A 3ELAT 4I2XE 5TE7H 1A5FL 4JFOB 5MEOB 3ARBB 1QFWL 1INQA 4V2CB 3TIDA 4OD2A 3HG1E 1EV2E 5FUZL 5E9DE 1Y0LB 4JCLA 1ZHKB 3IYLW 4ZUWA 5GRJL 1U8PB 3S4SB 5CJXA 1QSFD 1KC5L 4OV6F 3NA9L 1OP5H 1F6AB 1GZQA 3BZ4A 3N1FC 3WJJA 2EH8H 3O11B 1BQLL 5KVDH 2ZCKH 4JHAL 5HGAB 4WIQA 1DLHB 5C1MB 5IHUL 2DQTH 4HUKB 3QUYB 4OKVA 4XRCA 3CJJA 1DZBA 1L7IL 2IH3A 3TBWB 3B9DA 2BNQD 3TCXA 3RUGA 4U6XB 5I9QB 1ZEAH 2Z35B 1K8IB 4PJDF 3RI5K 3TWCH 4PJ9C 1LVEA 2FSEB 1I8MA 5E94B 1QFHA 5CIPH 4LLWA 1MVFA 4XPFL 2CLZB 4DEPB 2YXFA 1NAMB 4X8XA 5D5MF 4GG6B 3VFVA 3O6LH 4F7TA 5EOQH 4HIIB 2IF7A 4ZFOB 1HYSC 3VXNB 1T22A 4OBRA 4APQB 3GSUB 3QB7C 4TSCH 1VEPA 3V4PH 3TLRA 1VACB 5HI4C 4PRBA 4DGYH 1ZVHA 3TIEB 4PTUA 2YZ8A 4NJ9L 2AKRB 5L0QC 1QHOA 3NGBB 1GAFH 3KPOB 3S7GA 3GRWA 1N59B 4FMFA 2BVOB 3ET9F 2IQAB 3MLWL 4WI7A 1A3RL 2BSSB 2Y7QA 4JRYB 5D7KE 5GRVK 5T1LA 3PDOB 5LXGL 1AC0A 2IG2H 5FHAH 4AQOA 4RGMB 5E03A 1VPOH 3IGAB 2F53A 4PRAA 5JIIA 5IM7A 5GS0H 4K3DH 2FHBA 3BZEA 4M4PA 1IKNA 1J5OL 3WXVL 2QADC 5E8EA 5DRNA 3IFPB 2Y06H 3CFDB 4NOBA 3F7VA 1FV1B 2VDQH 2I26N 3HC4H 4LLVA 4MB3A 5AD0A 1XR8B 4YBQD 1ZHLB 2AEIT 5SWSD 2AEPL 2DM7A 4S2SB 4PLJD 5AZ2H 5A2JH 1BWWA 2W07A 5F3HB 1MFCH 2PXYD 2UY7A 2QBWA 1NFIA 1DEEA 3HAEG 4LHQB 3RY6C 4HJGA 5H37G 1YEKL 3PWUB 4MWFA 3STLA 3NIDF 4JY6A 5KSBE 3QIBA 3EO1B 4EXKA 1FAIL 2O5XL 1HYRC 3N9GL 5C08A 4OGZA 4BFBD 3IJYA 1OY3B 5J4MA 3ARDC 3OKMA 1GC1L 1A5FH 4U1HB 1LEGA 3EYFB 4O4YL 4OTXL 5F3BB 2XG5A 4R7NA 5FUZH 3QG6A 2GI7A 1HIMH 2F5BL 3UAJD 3LS4L 1OWRM 3WLBB 5GRJH 1D5BA 5TDNB 2D2OA 1KC5H 3CFKB 4HIHA 3NA9H 2HRPL 3Q6FB 4PRIA 1S9VB 3C8KA 1VFMA 2OJZL 2OS7A 1GZPB 1RK1B 2NY0D 1I3RB 4JHAH 5LAXA 3O9WB 5GJTH 5IHUH 4KJPC 2ED8A 3UBXB 2P42B 2OTUB 1EEQA 2H6PA 1P5UA 1L7IH 4HS6B 2KZ1B 1CN4A 4HV8A 3GM8A 5K33A 1FP5A 2GSGA 2V5MA 1EZVY 4FQIH 1QACA 3HZYB 3RZCD 4PJAA 2G75A 4XPFH 2EDXA 3RUGF 1A4KA 1CE6A 2JIXB 1S8DB 2D7PA 1A3LL 4G8GE 5EO0B 5J3HD 5ID1A 3O8XB 5BOZG 1OTUD 3UTSE 5IR1B 4H26B 2EDBA 4DVBA 1RZ8B 3OV6A 3BUYB 2NXYC 3ILQD 5I1AA 1KF9B 2VDLL 4HIJB 4ZSOB 4RNRA 4NJ9H 2HA1A 5F89B 3ZHKA 1JVKA 3E8UL 4LCCA 2JJUA 1S7SA 4PGCB 3OKDA 1I1YB 4OAWB 4TSBL 2NZIA 4XCNB 5I8CB 3MLWH 1BMGA 1A3RH 2HLFC 1AR1D 1SBSL 5AYUL 2M26A 4KH2A 3KYAA 5DRWA 1DQJA 4R7DA 5LXGH 3KPNB 1I7UB 2X4PA 1FG2A 1EHNA 2J1KA 4QXUL 2FNBA 1OF2B 4P5TA 5DGQA 1IMHC 1NCTA 4ORGB 5KVGL 4YR6A 1MEXL 3C6SA 5EU4B 2IANA 3LN5A 1BF2A 1DQLL 2FBOJ 3LD8C 4JFFB 1VA9A 4QY8B 3WXVH 3V9FA 3ZKXB 1J5OH 3NCYP 2HMIC 3T1FB 3SJVE 2XTJE 3OJDA 1A14H 3LZFH 2FH6A 1AGCA 3BESR 3IFNH 4NC2B 3FQNA 3D2UD 3T3ME 4P4KB 5FYKD 1QBMH 4NQED 4X7SL 3LDBB 4UMGA 4WVRA 4IS6B 3P77A 2B1HL 2VYRE 4KI5E 3VFMA 4NSKB 5FB8A 3K8MA 1IAKB 3DX6A 2NY4B 4HIXL 4Z77A 1YEKH 3I9GL 3OJVC 1WZMA 3MV7D 1MJUL 1A1NA 5F21B 1F3RB 4XP6L 1IM9B 1FAIH 2ITCA 3S35X 2HH0H 5CZXC 1WBZB 3QBTB 4LLQA 1JK8A 3EOBA 4TVPL 1GC1H 1P9MC 3WXWL 3L7FB 3QNYB 5ICYA 3O6FB 4U1GB 3CFEA 3CSYA 5KG9B 1HZHL 3RVUD 3OKKA 4L3CB 4KJWD 3EYSL 3S5LB 5IB4B 3CZFB 3ISWA 3I6GB 1ZAGA 4GRWF 2OJZH 3QWRD 4W6WB 4GS7C 3UPCA 2PYED 3DWTA 3IXAB 5JA8B 5D2NC 5F7WC 3HI6L 3LQAH 1IE5A 1WZ1L 3S96A 1WQVT 2BNRD 2HWZL 1F4WL 6FABL 4HWUA 5I74B 3NN8B 3QIWC 3AREB 2E8YA 3AB0C 3KPSE 2PTVA 5SWQB 3R0MA 2BSTB 2QQQA 1N0LA 4L3ED 2F74A 2WBJB 2FEEI 4NKQB 1A3LH 3L3DA 4HEME 3SE4A 2ZSVA 1IAMA 1XR9A 3SDXA 4N0RA 5ADPL 4J3TA 3QCUL 4PJAF 2IC2A 4ZS6D 2GJ6A 2D7QA 3VMNA 1MUJB 5KS9E 1GGTA 5IMLA 4GXUM 4G9FB 3NCYS 4HH9B 3FRPA 4PJ5E 4W81A 5HI5D 2VDLH 1FL3B 3E8UH 1IM3A 3RWCA 4WUUE 2YD5A 2X4RA 2Z93A 3V52L 5B39G 5IQ9B 4ODSL 1RSFA 1U3HA 1U93B 1FRGL 4LF3A 2WWMD 2DM3A 1SBSH 5J11B 3VXSA 1I3GL 3TO2A 3WD5L 5GGSB 4NBYB 1D5IL 4TTGA 1J7VR 3MXWH 4ERSL 4B7LA 4QXUH 4NQUA 4LIQE 5HXMA 1BFTA 3DIFA 5LKNA 3QDMA 4MNGE 4R26H 5KVGH 1MEXH 3TBYA 1K2DB 4HUNB 4QNPF 4C56A 2EE9A 1MCPL 4FFZL 2X4NA 4I18B 2CUIA 2P8PB 1DQLH 4AL8L 2OP4L 1MF2L 1N7ML 1YEDB 3KLDA 2PTUA 1RZIB 3KYKL 2W60A 2Y6SC 2HTLD 4PP2A 2HN7A 1BOGB 1NMAL 4J7RA 4ZTOH 1E4KA 5T1KB 1IAIL 4BSWB 4XAWL 2CLVA 4NUJB 1CXFA 5DFTA 5CBAA 3VI4F 4X7SH 1C5BL 3NOIA 5FYJE 1CQKA 5DQ9A 1JF1B 2V9QA 4F7PA 4KRPC 3SGKA 2B1HH 1KULA 1XEDA 4HIXH 3ZDYE 5I0DA 3ES6B 4R4ND 1U95A 4KROB 3T2QA 1J1OL 3SPVB 1FNLA 4WENB 5EU5B 5L8KB 4BQ9A 1MJUH 5GISH 1IL1A 4PLOB 4XP6H 2VJXA 2EDTA 2JELL 2EEAA 4DZBA 1ADQA 3BH8A 2J8UE 1QRNA 2GT9B 4TVPH 1VSCA 4QHNB 4RDQG 1ZLUH 2V5TA 3B6SA 3WXWH 2Z4QB 3QWOA 1HHIA 1HINL 1HZHH 5ESQB 4GBXA 3WMSA 2ZSWB 3BVNA 1DVFD 4QRUA 1NGXA 3EYSH 3VDCA 1NKOA 5F7LB 4PJEA 3DTXA 3V6FB 1XMWA 3EYUL 2NYYC 4PJFB 4MD4B 3QDJE 2DI9A 4MAYB 3RWHB 4U0RB 4F2MA 2VLLA 4P46C 5CLWA 1UXWA 1HXYB 3L3IB 3HI6H 5E6ZA 1NGYB 2R4RL 4PUBL 3DUUB 3ILPB 2X41A 5IB5A 1F4WH 1KG0B 6FABH 1MCLA 3C5SB 4LPXA 1EO8H 1HKFA 2D4DA 1DP0A 2XWBB 1RV6X 3P40A 1W0VB 2YPLA 3CDCA 4LK4A 3DV6A 4NKMA 4N8VA 4XBPB 3VXUE 5ADOH 4OFYA 3CUPB 4FXGB 1IILE 2HT4D 1U58A 5DI8B 1A9EA 4QHUA 4ODXB 4HK3N 1DN0B 1I9RL 1S5HB 2JCCE 4G8FB 3I50L 5ADPH 2AJXL 4RRPG 3V6ZA 2NX5A 1EEZA 1K3ZA 4YC2B 4XH2B 5DYOB 2Q8AH 3EDJA 3GSNA 3AMKA 4NHCL 3SDXF 1CCZA 3GMMA 3NFPA 2OR7A 1P4LB 5ITFA 4L8CA 3RDTB 3V52H 2ICWI 3QFJD 3QULA 4ODSH 3FHQA 2P5ED 4FQCL 1MCWM 1SJXA 3MV9D 3FTGB 3SDDA 1NC2B 2X4SA 1I3GH 4JO3L 4QOKB 3WD5H 5ERWB 1D5IH 2Y07L 4X98B 3B83A 4L8SB 4ERSH 5IB1A 3O6KH 3BRGC 1NCBL 3ABZA 4X6EB 5DHVA 4BK5A 1YECL 3F65A 4PY7A 1MCPH 5FOBB 3K81A 4B41A 4WRLA 4AL8H 1CQYA 2OP4H 1N7MH 1HHKA 4HJ0D 1NDMA 4R6UA 3T08A 3T09A 2YK1L 3DXAD 3QEQE 1NMAH 2SEBA 4YK4C 2AV7B 3BIKA 3MFFA 4XAWH 3LB6C 1KJMA 3OB8A 4MSWA 5IEHB 1M7DB 3PGDB 3RWIB 4WCYH 5EPMB 2FL5A 3RWDB 2FX8L 3GMNB 1C5BH 3AUVA 2DQFA 3RWJB 3DVNA 1X6NA 3H6JA 4JRXB 5E2TH 3VDAA 4PJIA 5C09B 5L2KB 3SCMD 2N1KA 4K7PY 1J1OH 1F4AA 3FOMA 2EYRB 3TZVD 3OMZA 2J7LA 5MERA 3RA7L 2PW2A 4H8WC 5JA9A 2JELH 1NGQL 1Z3GL 2R0KL 4XP4L 4OCLC 3T0DA 3MRNA 3VWKD 1UJ3B 4UDTB 3NIGE 2NNAA 2HT2C 3BE1L 2PW1A 3PHSA 1HINH 4U6VL 3LIZL 1A1MA 5GS1A 2D9CA 2DAVA 4WWKA 3UTTA 4ZUTA 1W0YT 2MJWA 2Q7YB 1YN7A 2H32A 3MNVA 2HFGL 3GSRB 1UCTA 3RY4A 4MS8D 1YY9C 3QZWB 4JM2D 1IC7L 3EYUH 2IAMA 3QNZA 1BVLA 3Q0HA 1BF8A 4LLUB 1T1XB 1P84K 4QT5B 1U42A 1XGQA 4Y5YB 3WO4B 4M1DL 3QG7L 4L1DA 4Z7OF 1I85A 3TIDB 4OD2B 2NY2D 4LEXH 2VLKB 4JRWA 1ZV5A 4PJEF 3BP7B 4Y4HB 3W0WA 4ZUWB 2FJGB 1B0RB 4G7VL 2VAAA 3BH9A 1GZQB 1SY6A 1AFVL 3CFJA 2JLLA 5C0AE 4TVSa 1CL7I 2AXHA 1BFVL 1RZKC 5HVFB 3GBNH 4Q0XL 2YN3A 5HYJA 1JGUL 1ONQB 5KW9L 3KVQA 5K9OB 1U8LB 1X5YA 2IH3B 2R15A 1TQBB 3BKJL 1WT5C 5ISZE 5HHME 1NBZB 1I9RH 4Z95L 3P3YA 1KIRB 2FB4L 4Y5VB 5EIIA 2AJXH 3HE6D 1MHEB 4X4XB 1Q94A 5GZOD 2N7AA 3LS5L 1UB5B 5T3XD 2FO1A 4LLWB 3O2DA 3RNKA 4JZJB 1V7NL 1YJDC 1IZKA 5E2UL 5F7UA 2A6JB 4NHCH 3ZTJH 1FNEA 1GGBL 2C3GA 4DQOL 4JFDD 4P23A 3GEWB 4L8BA 5E4IA 3U79A 4R97B 4FQCH 3O6MH 2FR4B 3U30B 5TF1L 5I2IA 3BPNC 3MGOA 4JO3H 3U0PB 1AGFB 1KNOB 5CGTA 1PKOA 4F7EA 1YUHB 2Y07H 3MBEB 2Q6WA 2Y23A 4JDTL 4JDVB 4YIQB 1C7SA 4IRSC 3B5GA 1WFNA 1YECH 4IOFC 3G08A 3FONB 4MJ2A 1IAIM 2KQMA 2H8PA 3JBG7 2DJSA 3BRFA 4JFXA 1ZA3A 4Y2DC 2YK1H 3WFEL 5T1LB 4HAFA 5E6IA 2XY1A 1J88A 4H1LA 4LIQL 1NC4D 1KJVB 5I75B 3UPRA 2FWOA 3MUHL 1A6PA 1IEAB 3QFDA 1VCAA 1H3GA 2YA2A 1NANI 4EI6A 1JWUA 1T5XA 1ZT1A 4V1DB 5DRNB 5D9SA 3JUYA 5E2WL 1CIUA 3O3DA 2VLJA 4OM1H 1KPUB 2OM5A 4M6ML 1DFBL 3RA7H 1KT2A 4JY4A 4HIEB 4UT6L 3IDGA 5D2LB 3DVIA 3JV5A 5JUEL 3TT3L 1NGQH 1Z3GH 3FQUA 4PJIF 5FYJL 1IGJA 1JNHA 3VFOB 3RVVD 5EUOE 4M7LL 3CPLA 3I6KA 4QGYA 3BE1H 2BVTA 3QI9D 4U6VH 3DURA 3I75A 5DK0B 3STZA 2WANA 3D3VB 3VGEA 4NC1E 3C87A 3TBTB 2P49B 2CXGA 1ZVSA 2HFGH 5B3JE 4AM0B 3EOAA 1IC7H 4RSVA 3IJYB 4LVNB 3HA0A 3CK0H 4M1DH 1NGZA 3MBXL 3QG7H 5BOPA 1S7VA 5IKCB 3TH2T 4OZFA 3EHBC 2DMCA 4OLZH 3RQ3A 1LMKA 2MFNA 1OARH 2ID5A 4LU5L 4Q7DA 1LILA 4G7VH 3U4BL 4KTYA 5HHOE 3DROA 1DN2A 3MGTB 3VFPB 1AXSB 3CU1A 2AK1L 2CRMA 4HC1A 2OR8A 3QQ9C 4XPBL 4LLMB 4Q0XH 3VRJA 1JPGA 1JPST 1SJEB 5KW9H 1JYVA 3LKQB 1KCVL 4CMMB 4HV8B 4MXWL 3BKJH 5E8NA 4Z95H 1MCRA 2FB4H 3C6LB 2GSGB 3U7AA 2APXA 5E1HB 1I75A 3LS5H 3OQ3B 4P57B 5JXED 1ND0A 4LNVA 4EN3C 1TVBA 5I8EA 2J3SA 4NC1C 1V7NH 1TENA 1E28A 3QH3A 5FGBA 4F8TA 1GGBH 1Q9OA 2B8OT 4DQOH 2FIKB 1Z9OA 1K5NA 1BZ9A 2G9HB 2NTSP 1EA9C 2ADJA 5C3LD 1OSZB 3PV6B 3TO4A 4FTVB 5C9JA 3JZ7A 4QXWA 3CX5J 5TF1H 1LO5B 4M6OL 5EZLB 1OTTD 2B5IC 2GIYA 1BVKA 2EZ0D 1BGXL 2P24B 5F88B 1TPXB 2PN5A 2AI0L 4ENED 5K59E 3OKDB 1MJJB 4MXVF 2I9TA 3WS3B 2LAGB 3Q48A 4NO0D 1OW0A 3L3GA 1ZT7A 2UWEB 4H8WL 4DK6A 3SDCD 5KSAC 3WFEH 2XTLA 3BDYL 1EEUA 2WQRA 3FB6B 3KJ4B 4LGSB 4P5TB 4ZYKB 5KZCB 2UZYB 4LIQH 4GH7B 4NKIL 4NNPL 3MUGA 4UILH 4XBGB 4HT1H 5GJSL 3SDAD 1F2XK 1X5HA 3QRFM 3DGCR 2GJJA 1H5BC 1CXEA 4P49A 4G80A 5EU7E 2DF3A 3PDGA 1U8NB 1S7RA 5E2WH 1AGCB 2NR6D 4HK0A 4W4OA 5JXAL 4ZXBD 3EO0A 4M6MH 1DQQB 1DFBH 3AROA 5HYSA 3TT1L 4WU5A 4PGDA 4X6DE 5IHZB 1IQWH 3WUWG 4Y1AA 2F54D 5BQ7A 3NH7L 3D39A 5JUEH 5F7DB 3P77B 3TT3H 5FYJH 3UJTL 3AU1B 3B9VA 3FB5B 3VE0A 4XP9H 3QEUB 5FB8B 1R3LA 4M7LH 1J05A 5F6HI 4X5XA 4Z77B 3H3PL 1T4KB 4U1LA 1QHPA 4JGUA 2G5BB 5C0BD 2DLIA 5JW5A 2VXTL 3TN0A 5CCKL 3QUKB 1T1ZB 3RU8H 3ULVE 2GK2A 4FA8A 1JK8B 5D1QA 3FT4B 3EOBB 2DJ4A 3MBXH 5D96C 1I8IA 1I7TB 3NZ8B 1VGEL 2YA1A 3FCTA 4WV1C 5CJQH 1OTSD 2P1YA 4KKLC 1JIBA 4YEEA 4EOWL 3M1BA 4YWGL 4EZMA 1CK0L 4L4TA 3U4BH 2DICA 2NMSA 5EU7C 1AD0B 3MMEB 1QO3B 2R39A 5CEXB 3VXPA 1RUML 5DC4B 2A9ML 4E9LA 1VKXA 2AXGB 1VADB 4ALAL 4XPBH 3U7WL 3RTQA 3RVXC 4GW4B 2FATL 3SKMA 3MRCB 5L8JB 1KCVH 2EDDA 2PYFB 1KB5B 4MXWH 5E8OB 2NW3B 2FECL 3NCBB 3PP4L 3Q1SL 4Y19B 1VFAA 1DBAL 5HHPB 3I3DA 5BZWA 1CT8B 1T83C 3H7BB 3GIVB 4I4WB 3C5ZA 2ORBL 4FFYL 3ARGC 1NCNA 3BPLB 4XXCA 2XN9A 3MZGB 3MLXH 1AJ7L 2R69L 4CRPA 5GRXG 1TTUA 4WO4B 3WFCL 1T1WB 4M00A 1VFUA 3L3DB 3ULVC 5LGJB 3G6AA 4HZLA 2C9AA 3REVA 2B1AL 4FFVD 4KJQC 4H0HB 1J0ZA 5IWLC 1OWWA 1OPGH 1PEZA 1KCUL 3DECA 3WEXB 1TDQA 3FFCB 4M6OH 1NL0L 3MRLA 2NY3D 4OSUL 5F6IC 2X09A 1W8NA 3O0RL 1KN2L 1C1EH 1SQ2N 2IALB 4D9RE 1PSKL 3JVGC 1CZ8L 1G9MC 3QQNA 4PJ7B 3ZDXE 12E8L 1QUNA 1NMBH 4M61B 3R8BB 5I1KL 2UV3A 3DHJA 5IB3B 2P7TA 4LF3B 4MD0B 4H8WH 3OAYH 2VLMD 1OGAE 4MNQE 5DJYA 2ZOKA 3BDYH 2VZUA 4YDIL 4R2GB 3N1QC 4JFZH 3U7YL 3V5DB 4AK1A 1N6QH 3R1GL 3GIZL 4FQHB 3PQYB 4N0FA 2DQEH 3ZDZF 1YEHL 2R2BB 5GGTL 2P4AB 2X4NB 4PJXE 2QSQA 4JANB 4TQEL 1TZIB 1ZT4A 2F53D 3ARRA 3N06B 4P5MB 3EDFA 2BHYA 3CMOL 2X9YA 4B5EA 5JXAH 1RU9L 3GJEA 2CKBL 5C7XL 2LAAA 4NFCA 4TUJA 4ISVA 3TT1H 1BM3L 4H88L 1WFUA 3F12A 2OQJB 3OG4B 5B38A 4CVXA 5D7JB 3MRJB 5I16A 1ZHBA 5SWZB 4U31A 3EOTL 4HPOH 3H3PH 3PNWB 5BXFB 5I1EL 1Q9LB 2AJYL 4RGND 1RZKH 3BKYL 3KGRA 4JQXA 4NYLA 1BX2A 1MH5A 4ONHA 3SY0A 3IDYC 2VXTH 5KANG 3GJFB 5CCKH 4P2RE 3VFNB 2H3NA 1KIQB 1CLYL 4P2OC 1S7UA 3QIBD 4I0CC 2VQ1B 2DLGA 2VDPH 1A6ZB 5C08D 3K0WA 4QTHB 2UYLB 1KJ3L 4RFNC 2DWDB 5D71L 3UZQA 3TA3A 1OAKL 3OKNA 1NGXB 4HCRA 4EOWH 1YJDH 4YWGH 1KTLA 1CK0H 3W82A 2Q8BL 1C12A 2D7TH 1X5KA 1I9IL 1M7IB 4Z0XA 2IFGA 3X3GL 1UXWB 2ATPB 3MLSL 3HC0A 4ALAH 3C5JB 3U7WH 4LNRA 4M7ZB 1T3FA 3QUMA 1Q9WA 4XWOD 1FL6A 2XKNA 3MCLL 5EC1A 4LVOB 3RGVA 4K7FA 1U8KB 3VWJC 3VXRD 2BVPA 3UMTA 1DBAH 4I5BA 3HE7A 4MD5B 5MP6L 3VH8A 2EECA 5MENB 3VGHA 2GW5A 4Y16C 2ORBH 5ECJE 4FFYH 4N8VB 2XPGB 4JQVC 2HJLA 4G6ML 4D0BA 4GKNB 1QEWB 2EXWC 1AJ7H 2R69H 5I1GL 1U58B 5EU6B 3WFCH 1EDQA 5EN2A 4N0YL 5DA0B 1DUZA 3EYQD 2B1AH 2CXKA 4M7JL 2RJMA 2BY1A 1KCUH 1OLLA 4K3JH 2VTFA 2RCSL 1NL0H 1F11B 4YDLB 2C7UB 4NZDA 5EDXA 5GGVY 3OHXB 4QYOA 4PRHB 3O0RH 1KENL 2V2WB 1KN2H 3U36A 3W11C 4P4RB 1PSKH 3A67L 4L8CB 12E8H 5I1KH 3IDNA 3RHWF 4PLJC 1LE5A 4M5ZH 4J6RH 4PJ8C 4WFEE 2NXZC 2MKWA 5HYQA 1FORH 2DIAA 3C60A 4UT7L 2HFEB 5GZNC 5FA3B 3FRPG 4YDIH 3U7YH 2IH1B 3R1GH 3GIZH 4YHNA 3RVTC 4LFHG 3I3BA 3VFSA 1YEHH 1TCMA 1F3DJ 2LQRA 5GGTH 4Q9QL 4AENA 1QRKA 4TQEH 1MY7A 25C8L 1BD2D 1S9XB 4KGLA 1NDMB 5CGYC 3DO7B 5LVEA 2NY1C 3CMOH 2IAND 1HEZB 2B39A 2P8LB 4OQ1A 3MRPA 1D5XA 4YHKL 1RU9H 2VH5L 2CKBH 3MFFB 5C7XH 43C9B 2EDRA 5L8LB 1U92A 4WJ5A 3UAJC 5F9JA 5L2JA 1BM3H 1OSPH 4H88H 3WIFA 5AAWA 3A6CL 3BEVA 1PQZA 5BRZE 2DQFB 4X6CA 1T2JA 2I07B 4JVUA 1LE9B 3WJLA 5ABDE 4QRSB 4WFGD 4NO5B 3EOTH 2VDKL 1EO5A 3T2NL 4HMEA 5D1XC 3PUCA 4B7IA 2KBGA 5I1EH 2AJYH 2V5YA 5DJXB 1GHFL 3ARTA 4U1KA 3BKYH 3ZHDA 4FQXA 5LWYL 1Z0MA 2MHAA 1JZ4A 1CLYH 3BAEL 3IDXL 5IW1A 2YD4A 4DGVL 4OIIH 4FZEL 3OKLA 3LOWA 4I77L 3ULUE 3BEWB 1KJ3H 3LEXA 4KVCL 3RZCC 3UYRL 4BUHA 5D71H 5IROC 1OAKH 3KYNA 4TNVK 1I1FA 3G6JB 3STBA 4OZIA 1YN7B 3BP6B 1A02N 2K3TA 5BVJA 1O0VA 2AQ3A 1XGYL 5BS0E 4JO2H 2IAMB 5HGDA 1YDPB 3ULVL 1AC6A 1I9IH 5TE6H 1GH7A 1S7TA 4E42B 2WIIA 3X3GH 1XGQB 1B0WA 1H0DB 1JPSL 3GHBL 3MLSH 2O93L 1OTUC 3FL7A 2DLFL 1Q1JL 3UJIL 3ILQC 1F4XL 1IEHA 1HCFX 2X70B 2GY7B 3S36H 5DJCB 3MCLH 4TTDD 2XZAL 2FLBT 3RVWD 1JN6A 3QXVA 3BPOB 2FYYA 1G9ML 4BM7A 1IT9L 1QLRA 5MP6H 4RFEA 4UIKL 3CDYA 5D7IE 1R0AH 4ELME 2CIIB 3RY5A 4G6MH 2GQHA 1OCWL 2HVKB 3BSZL 4NPYB 5I1GH 4PJCA 4U0QB 5CKGA 1X5JA 4NN5C 1HHJB 3BGFC 4NRYA 3QXDB 4N0YH 3RWGA 1G7QB 1BHGA 1YPZF 1EAJA 1S7QB 5DQJA 3WSQH 4OQTA 4OFVA 5EOTA 3ULSA 5H35A 2A77H 2MMXA 1FVDA 3VGBA 2GJ6D 4CVUA 4G5ZL 1KENH 2BX5A 3TGXA 5GGUB 2VLRD 1PKQA 3RJDA 3P4NA 5DURD 3A67H 4PJHA 5D8JL 2WWKT 3QDHA 1FO0L 1BECA 5ETUA 4LFHD 4QLRA 5C2BL 5BZDA 4R0LB 4OCYL 4UT7H 1F3JB 5MEQB 3P4LA 4QHMB 3RKPA 4S1QH 2D31A 3VXSD 4JKPL 3T1WA 3OXRB 4Q9QH 5C3TA 5DFWH 1MOEA 25C8H 5HGBB 5HD8C 4WW2C 1UB6A 3DMMD 3KYMB 4XHQA 2HLAA 4C56D 2ZP0T 4CU8A 4PJ9B 4YHKH 1FNGA 2VH5H 3H9SA 1HOCB 3UXFA 3WDHA 1X4YA 5E6YA 5KSVB 2OR9L 3RVUC 4QRPA 3UPRB 4KJWC 2I24N 3A6CH 4FHBD 1INDL 1MI5A 4FABL 4I2XB 2Q3AA 5CBEA 5I1HH 2R1WB 4I9WE 4HX1B 4ZAKB 2VDKH 3T2NH 3HG1B 3UTOA 3KPRA 2VLJB 4JPIA 4X6CF 4OB5L 3OKEA 1KT2B 5HI3C 5LWYH 1UJTA 2DQHL 2AGJL 1JYXA 4JRYE 1LNUA 4JE4B 4F9LC 3I85A 2FH8A 3H9HB 1ZLSL 3BAEH 3QUYD 4OZGB 3IDXH 4RAHA 2OTPA 3B8SA 4DGVH 4NHUA 4XNUL 4FZEH 3FO0L 4I77H 1FYTB 4KVCH 2JJTA 3I75B 5I9QC 4BELD 1QRND 4YHLL 3STZB 3V5HA 1KFAL 2QR0A 1L7TL 2GSIB 3LVEA 2OTWA 4XI5D 2DWEA 5TE4L 1XGYH 3HRZA 4Q74A 3FQTB 4GBXD 3ULVH 4F37K 4DEPC 4UINL 1H3PL 1X5FA 2QADB 1JPSH 4ZS6C 1NGZB 1L4IA 3GHBH 4OZFB 1CFSA 4OZIF 4U6HB 4YAQA 3UJIH 5EC2A 2ZUUA 4YHZL 1B0GB 1G7HB 1P7QB 5I15L 1PG7L 4APQD 3VXMA 3BIBX 3V95A 2RGSA 1FCCA 5D1ZB 4L4VB 1G9MH 3TNNB 3P9LA 1IT9H 1JGEA 4LCIH 4CAGA 3A0OA 2WWMC 2OL3A 1UH4A 2GTZB 3RIAK 4RA3A 1IJ9A 2GEEA 5FGCB 4RISL 5C9KA 1I1AA 3VRJB 4FN0A 4ZUSB 3BSZH 4JHBA 2ATKA 1KEML 2YPLD 4A6YL 2LU3A 1IC1A 3VXOA 4W6XB 1LK2A 2BFVL 4RGMC 1JFQL 1FVCA 4C59B 3ARDB 3MTRA 1E4XL 4PJCF 1TVBB 4BH7A 3TBVA 2HTLC 2IPTL 2IWGA 4DAGH 1BJ1J 5D7LA 4BH8B 4KDTC 2NX5D 1E28B 4G5ZH 3DV4B 1U8HA 5DSCA 2I5YL 4LPVA 2D03H 2GUOA 4WTZA 4JG0L 4LCWA 1BZ7B 5HPOA 1LP9B 1WIOA 3O45B 5C9JB 4N5ED 5C2BH 2VIRB 2DM4A 4OCYH 3DUSA 4PGBB 4E5XA 4X6FB 4PJHF 3SDDD 4JKPH 4PBWD 5LJYH 1CS6A 5JLZA 4WFFE 3ZE2F 1CU4L 3NTCL 3L3GB 3RP1A 4KTEL 5FYLE 2R0LL 3JTSB 4JGMA 1R3HA 4NKDA 3K2UL 4HBCH 3AY4C 4YHIA 1KCLA 1J8HB 2FIRT 5EA0L 2OR9H 2XZZA 2WW8A 3VI3E 3MUGB 1KYOK 4NN7C 3X12A 2Y25A 3BD3A 1INDH 4XXDB 2WNGA 3AXLA 1CFBA 4GJTB 1FZKB 3BQUB 4JN2A 4F8QA 4ZSOE 1W72A 4J3XA 1CFQB 3F7YA 1YNKL 1JI1A 4Q2ZA 5I1CL 1FZJB 2ESVA 4OB5H 4WU5B 5I1LB 5AG8A 3O9WC 3OBAA 5KVMC 2DQHH 5FV2A 1XAUA 4JJ5B 1ZLSH 3MXVL 3FN0H 5FO7B 3W2DL 4XNUH 1YNLL 2C5DC 3FO0H 4Y4FB 2XZCL 1T6WA 4LCUA 4YHLH 1O7VA 3CFBA 4QXGL 5J1TC 4GRMA 1NLBL 4H25B 1L7TH 2WK2A 4JFFE 2P45B 5JW5B 2BRRH 2VDOL 5TE4H 2XZQL 4YNYA 4RQQB 3LD8B 3UTTD 3E6FA 4I0PD 4HKJA 4UINH 4KKBC 1H3PH 1YY8A 4Z5RB 3BGAA 2V7HB 4UDUB 3MLRL 3KLAA 4JPKL 3WHXB 4XMPL 4WY7L 2DN7A 5GGRY 1BBJB 1N26A 4UAOB 5T5FL 4YHZH 3LCYA 3DX9A 3NA4A 3OKYA 3O8XD 2FGWH 1KBGL 4R96A 5FM4A 5I15H 1PG7H 1T89C 3GMOA 4UI2A 1C7TA 3W0WD 3MV8A 1C5DB 3UTSB 5E24E 3P11L 2VL5B 3U6RA 2V2TB 1EVTC 4PRPB 3WS6A 4HXBH 4RISH 1B6DA 4Z18A 5IMOA 1FZMB 1FDLH 1X4ZA 3VMPA 1IAOB 1KEMH 4A6YH 5GHWH 1VHPA 3PV7A 5ELIA 3F5WA 4PRDA 4UQ3B 1OLZA 2JJVA 4ZUUA 2BOBA 2BFVH 4PD4J 1T20A 5IFHL 5IQ7L 1PFCA 2I60H 3M45A 3C5ZB 3EJZD 1E4XH 4D3CH 3BWAA 2IPTH 4HG4K 1MFAL 4Q6IA 2IQ9L 1J0IA 3IFOA 1WWWX 1S7WB 2XV6B 3DUHA 1A7QL 4IRJA 4RZCA 3U0TA 1N2RA 1Q8MA 1M7XA 5GGRA 3SJVB 3G04A 3TFKD 1UWXH 3PWPA 4XT1C 1UWEL 1G7LA 1RK0B 4GS7B 2VE6A 4JY5L 5HHNA 5C6WH 4P23D 4P4KD 1ITCA 3FO2B 1WAAE 3BP5B 4HLJA 5D2NB 1PX4A 3SGEH 1I8KB 3KPQB 1ORQB 1Y18B 3HUJA 3TZVC 2NY4C 2BCKB 1LO3L 2X40A 5CEZE 3IVKB 2FZ3A 4MJIA 2PCPB 1QQDB 4X80H 5JORB 3IETA 3RNQB 2R0LH 3AB0B 3HFML 3QXWA 5IF0B 4Z8FL 2MKLC 3K2UH 1RZ7H 1IM9D 1PZUB 4NDMB 3MACL 1W2KT 2EDHA 5E6ID 2EKJA 5DJDA 4P5KB 4X9HA 2Q86B 4U1GC 3HI5L 2QV2A 4G9FE 4JM2C 5IP4A 3O6FD 3JV4B 3VDBA 3DVGA 3RIFF 1AE6L 1H9VA 2XQYK 1YNKH 3IU3B 3P73A 3REWB 3V8CA 5I1CH 4QRRD 1JP5A 2J5LC 4HFUL 4TUJB 3I02A 3HZMB 4YDKL 1XGTA 3QXUA 1ZHBB 4QTIL 3FT2A 5DR5L 3W2DH 1MFDL 2Z31A 1YNLH 1VGKA 4U6YA 4ZO6A 2F15A 2XZCH 4KK9D 5I74C 5A3ID 4MA8L 4QXGH 3O2WL 3HCVB 1BX2B 4ONHB 5C6PB 1NLBH 1WV7T 3WN5A 3RL1A 2VDOH 2XZQH 2H3NB 5L88L 3FOLB 5GRYA 1MWAL 5CS7A 2HG5B 3IJSB 4XAKE 2R2HA 2XXCB 4CVZB 1JZ5A 3HE6C 1AIFA 2WBJD 3M8OL 1AO7E 1FJ1B 2FHCA 3MLRH 1T03L 3QISA 4WY7H 3MA7B 1WGOA 1WIPA 4GAGL 2RBLA 1RUPH 5T5FH 1X7QA 1X5AA 5EZOL 1KBGH 1AR2A 1CF8H 5I17A 3D69A 1UEYA 4XCYA 5DQDL 1IGIL 1QSFA 3W5NA 5F9DC 4LCYA 5BW7C 4E0RA 5CJOL 1MQKL 4MX7A 3O3AB 3P11H 1YC8A 1KACB 32C2A 5C86A 1MRCH 3ROOA 5DMJB 5HY9A 4M1GL 1AXIB 5IVOA 4LOUC 5FCUL 5EC1B 2Y4SA 4DZ8B 4S1SL 1ETZA 3DYMA 5EBWB 1LDSA 5ENWA 1C5CL 5IQ7H 3NBNA 3ARFB 1WC7A 2DI7A 2DL9A 5C07A 3W39A 1WUNT 3CC5A 3S8WA 1CR9L 2Q76A 4WDIA 3WDIA 3VXTB 3F7PC 5TDPB 3QPQC 4HUVA 4XMLL 1MFAH 4D0BB 2PR4L 1KPVA 1MCCA 2IQ9H 2NY7L 5GGQH 4QCIB 4NKOA 3QUXC 5C0GB 3ESVF 4ODTL 5DFVC 4PG9B 5EN2B 3GMQB 3X13B 5DMGC 4IMKA 2E6JA 4EUPB 2P5WA 1XF4B 4YLQT 1UA6L 2XT1B 4JY5H 4NNYB 5I66A 5T1KD 2X4OA 1G0XA 1CE1L 3HZVB 5ESAA 2VC2L 4N0CC 3L5XL 1M4KA 1QTYT 1NLDL 1MCFA 3U36B 4ONGL 2R1YB 4PBVC 5E9DA 5JHDB 1LO3H 3WFHB 4KROD 1UADC 1MVUB 3RVVC 1E27B 5EBMB 4Z8FH 3HUJF 1NSNL 4GAYA 1HQ4B 4NQDB 3E6HA 1Q0XL 3QI9C 3MACH 1IVLA 3V7AG 4J3OC 1AGEA 3UX9B 3UZEA 4CW1A 3HI5H 5I8OH 4HLZG 2OJEB 5FYLL 1AE6H 4UQ2A 3QDGB 5C0CB 3OPZL 3MRPB 4JJHA 3HPJA 4F3FA 1CICC 4MAYC 4HFUH 3V0WL 3X11B 4U0RC 5JOPD 1HDMA 3EFDL 2CDEA 5IW6A 4ZPVA 4M8QA 5E2VH 5SWSA 4QOKE 4UZGA 1WWBX 2HTKC 4MJ5A 2BHUA 4QTIH 2PXYA 5DR5H 1A6AB 4Y1AD 1MFDH 4AZ8A 1CFNB 1UXSA 3D39D 4OIBA 1VEMA 2PTTA 4WHTA 2OZ4L 4MA8H 3KXFB 1T66C 3O2WH 2EIBA 2N7BA 5DJ6B 1RPQA 1DQML 1KTRL 4ZDHB 5L88H 5B38G 3Q2CA 3RBSA 1MWAH 3BPCB 7FABL 1QLEH 1MHHA 2D0GA 3M8OH 1EK3A 3OKLB 3U48A 1G1YA 1T03H 5D1QD 4NQCB 1M1SA 3ARZA 4PBXA 5EZOH 2JCCB 5IBLC 4AIZB 4XZUB 3VFWB 1U9KA 4YC2C 3Q5OA 4N9GB 1H3XA 5DQDH 1IGIH 1NGWA 1RJYA 4J8RB 2Y5TA 5C09E 3KDMA 5L2KE 4G6AD 4J1UB 5CJOH 1MQKH 4L4TD 2H9GB 4AYFA 4KTDH 3RDTC 2ZCHL 1T1YA 4M1GH 1CDBA 4U1NA 5C0EB 4U3XA 3BWUC 4N90D 4ZPTB 5FCUH 1JCKA 2EZ0C 4S1SH 3BN9C 3RTQD 2WSKA 5E1AB 3DLQR 4EI5A 3VJ6B 4ETYA 4L8SC 4X99B 5L9DL 4NM4L 4TYUA 3ZYJA 1JE6A 3QHZL 3L6FB 3LQZA 2HJKB 1BWMA 3MNWA 1CR9H 3SDCC 4D0DA 1U6AL 1QPPA 4XMLH 2VNCA 2PR4H 3RGHA 3VCLB 2NY7H 5DEFB 4AT6B 2PNDA 4UIMB 4GG8A 3MUJA 3H0TA 5KSBA 1QSEB 3SDAC 2XN9D 1U8JB 4V2BA 3D18A 4JLRB 2ZWLT 1UA6H 2YKLH 3KR3L 4FXKA 3VH8G 3QEQB 3ZE1F 1GGIL 2VLKE 4S0TD 4NT6A 4PR5B 3CVHA 5HYEA 2VC2H 3B3IA 2OI9B 4K8RD 3V4VH 5HSFA 1N4XL 2NR6C 2X1XR 3L5XH 5F7EL 3GSOA 2EDQA 1CFVL 1DUYB 1NLDH 1IQDA 4ONGH 5IFJA 4OFIA 4JRXD 2A6DA 4X6BB 3OAZK 2C1OB 4Y5XA 5AAMA 5EUKB 1Q9KB 5H94B 4X7FC 4JAMB 5T3ZD 4DKFL 3OGCA 4DTGL 4UOW0 4FFWC 4U1IB 4ZFZA 2A73B 2IMNA 4M43H 5EFIA 1FFPB 4IOIA 5INDB 5DD6A 4Z78A 2VXQL 1UJ3C 5JZ7D 1TCRA 3O4OB 4S1RL 4YBLB 3ETBF 1JHTA 4NP4L 5FYLH 4IIQB 2YBRA 3OPZH 1M71A 3RWFA 4Z7QE 4Y4KC 2WINB 3BJ91 3WE6B 4P2QB 4QRPB 3V0WH 5E5MB 1OTSC 3D2UA 1XZ0B 5T3XL 3HAEA 1HK6A 3WO4C 4PTTA 5I8KL 1F00I 4HKBB 1F4HA 2FECI 3LN4B 1BQUA 1YN6B 1MI5B 4HUXA 3LPWA 4NWTL 4J3UA 4G8GA 2HKFL 3LRSA 4N1CA 1RJLB 3PDDA 2L0DA 5F70A 2VOTA 3KPRB 3BPNB 2FDBP 1AGDB 5JOFB 2RQ8A 5IK3B 4HHAA 4OFKA 2OZ4H 1N5AA 3WJJC 3D85B 4ODVL 1CBVL 2HFFB 4QXTB 1DQMH 4F7CA 2CKNA 5E8PB 1MLBA 1UQSA 1Z6JT 5CHNB 2GFBB 5DLML 3CAFA 1DLFL 4Y2DB 2P44B 2X9WA 1JHKL 3U46A 4Y5VC 3V5HB 3K74B 1T5WA 4YX2H 2OTWB 5AWNL 3HRZB 1WISA 3DJ9A 4G8IB 4V1DE 3IU4H 3TA3D 2A0LD 2E9BA 3QJHB 3K1DA 3SEPA 4FFVC 5J57B 3QWRA 1UWGH 5CSZA 3GK8H 4WUKH 2DQDL 3NPZB 2ZCHH 4F37F 3WO3B 4R97C 4PJBB 1FSKB 1B88A 3SQOL 3IXTB 1ZGLB 5D2LE 1CI5A 3U30C 1BLNB 2ZPKL 3QQ4B 3L7EA 3MBEC 1WLHA 4JKKA 5F72S 4HFWA 5A40E 2HT3C 3FQWA 3QHZH 2QLVB 5EULV 3RGVD 4OI7A 1FFQA 3FO9A 3PWLA 4UV4H 3D3VE 1U6AH 5DT1L 3S88L 1KIUA 1LO0L 5CEYA 3LV3A 2V7NA 3B9AA 4EDXA 1GSMA 4GRWE 3D87B 1U91A 2XWTA 5A16A 5DJ2A 5IVZA 1KN4L 1AGBB 5DJAA 3KR3H 4WGVB 3BDBA 4Z7VA 5C0FB 3WFDL 5I75C 4BH7B 1WK0A 2ICES 1N4XH 5D7LB 5F7EH 5KSBF 1IKNC 3LSOB 4PRIE 4WW1B 4D9QD 1EBAA 1OT1A 3IKCB 4XCCL 4WFHE 4LCWB 1U3ZA 1SEBA 1CD0A 1FNAA 1HH6B 2YPKB 4QRTB 1T2QL 3U83A 4DKFH 1PYWB 4XVUD 3H7LA 2QHRL 3W9DA 2VQTA 4DTGH 1G7IA 4J4PD 4NQSB 5E7FA 3B9KB 4OZHB 1T04A 5CEZH 4FP8L 1YC7A 2X89A 3KNBA 4S1RH 4ZUVB 2O61A 1J1PL 4WNQA 3QIBC 4OLXL 2JB6A 4NKDB 4YFDB 3KPSA 4EN3B 3HI1A 3L5WA 1BJ8A 5GSRA 4LVNC 4K9EC 5CP7B 2EYTA 5T3XH 1KCKA 5KVFL 2GITA 1QBLL 2ILLA 4FTVE 1MHCB 4NWTH 2HKFH 3L3OA 2CLRB 2JKXA 3H3KA 5KS9A 4PYHA 2B5IB 2QSVA 4Q2ZB 4PJ5A 2RFXB 5TQ0L 4MDJA 4ODVH 2WWKO 3D0LA 5HHOB 1CBVH 3HPLB 3OAZH 4XWOC 1JGDA 5D72L 2APWA 2UWEE 4O2EA 2CDGA 3WYRA 1ZA6B 1HQRA 5DLMH 4U1MB 8CGTA 1T80A 4OZ4A 4BQBA 1YMMD 1ZVYA 1JHKH 2CSPA 4LCUB 5FUOL 2I9LA 5DJ0B 4BFIA 1U41A 4GRMB 3LHPL 3C6LD 4MNGA 2A9NL 2NTFB 1DQTA 5AWNH 1DVFA 1U8OA 4E41B 1FHGA 3VI4E 3QUZA 1H5BB 3EYQC 5HHXL 1P1ZA 5D70L 3FT3A 3I2CL 4AH2B 2AERT 2DQDH 2X4UA 3KLAB 3LKPB 3J8F7 5KSUB 4NFDA 3RPIA 5I71C 1P84J 3PGCB 4BSVA 4OGAC 5F1IB 5F97E 5JW4R 1RZGA 4PLKD 3EOYG 1KPRB 3PWNA 4LCCC 4HPYH 1NUNB 3T3MF 5IMOB 5DT1H 4XCEB 1LO0H 4N0UB 2DDQH 1L9MA 4O2FA 4UU9B 3KJ4C 3MRQA 1KN4H 4FQQA 4KI5F 1S78D 1D7FA 4P5TC 1KSRA 3UROR 2J8UA 3HKFA 1OD7A 3WFDH 1HH9B 5D96B 3B5TA 1UACL 1MJ8L 5F7MC 3IFOB 1M6OA 1U8IB 4XCCH 4RZCB 5GGRB 3GKZA 5GIRA 4Z7VF 1ZSDA 5IMKA 4XVSH 5DMKB 4QWWD 3QFJA 4POZD 3SN6N 3V0VB 2P5EA 3G6DL 3QDJA 5HYFA 1T2QH 2V2XA 4M9OA 1FPTL 4D8PA 2QHRH 3LMJL 1V3KA 1NUDA 2EDFA 1PVHA 1XCTA 3MRHB 2JK5B 5E56A 3VRLE 3HUJB 1JZ7A 4Q9CA 1NBVH 1LEIB 3MRBA 3TNMA 3U1SH 2DLHA 1UENA 1OAQL 2ARJB 4NJAL 5DUML 2HJFA 1TIUA 2FZ3B 1LEKB 2D7OA 3IETB 1K4DB 3SKOB 4OLXH 3BP4A 2AK4B 2ADGB 1EX0A 2VMFA 1X5XA 3FMGL 3SO5A 1R24A 4O58L 4TULL 3VXUA 1IGYA 3BW9A 4M3JA 1JPFA 4YH6A 5KVFH 2IADA 1QBLH 1F58L 3MCG1 3PABB 4XBEL 3HLAA 4Y88A 5EO9A 1KTDB 2P8MB 3FFCE 3SO3B 4KV5E 2DL2A 1H8OA 3LEYL 2J6EA 3DVGB 4LGRB 4KI1A 1G7JA 1T21A 3FKUS 5TQ0H 3SCMA 1TETL 5FO9B 1U8QB 4LSUL 4M02A 3FQRA 5D72H 4JFEB 1D9KA 4YEFA 1PZ5A 3GB7A 3RVWC 1EJOL 2VZSA 5KS9F 3L3HA 2ZUTA 4IRZH 4YHML 2W9LA 3QDME 1UYWL 3PQYE 4GW1B 5FUOH 2QSTA 5C8JA 2MQ0A 5J6HA 5TGBB 4Y19D 2FX7L 3LHPH 3WN5B 2A9NH 2RAMA 2LABA 3D48R 1I8LA 3BPLC 1J87A 1QKZL 2W9DH 1P2CB 3O4LB 5HHXH 1SM3H 3EYVB 5B21A 3EJYD 5D70H 5HGGS 1JHLL 3I2CH 3LEVL 4M9PA 4GKSA 1JGVH 3SE4C 5GS0D 1NBYB 2XNAA 3MRGA 4P3DB 1SYSA 3ZKNC 3L9RB 5CWSA 3HB3D 4KUZL 1PG7X 3MYJB 3O41A 3IDMA 5HTSA 1FO0B 2OYPA 3GSQA 4L4JA 4KK5C 3SGJA 5SWZE 1QSFB 3ZE0E 3K8LA 2BP3A 4K94C 3G5YB 3MJ7B 2W0LA 2NLJA 1EAPB 3QIUD 1NDGA 3SDYH 3QEHA 1U3HC 3BKML 4MJ6B 4RRPA 2RB8A 2XICA 1FLRL 1I1AD 2UVEA 5E00A 3Q6GL 3IDYB 1HSBA 4HKZA 2BNQB 3EFFB 2R29L 2X5PA 4KKCC 3B9EA 3KLSA 4P2OB 4R2GD 3ZDYF 1BPVA 1HILB 3CC5B 2Q76B 4Z7OE 1G7MA 1UACH 1Z5LA 3R8QA 3ZT5A 1MJ8H 4HDIA 4RFNB 2E6PA 2H41A 3MLTA 4KKNA 1R3IL 4PJXB 2AJZB 4XNQA 2IBBA 4O51B 2Y9RT 1S5IL 2J8UF 4JFDA 5ICXA 1E4KC 5FA4B 5TF0A 1VENA 5I66B 4J12A 4AEFA 3RX5A 3T8XB 3LMJH 3F7QA 3P2TA 5ICZB 3P4MA 3SGKC 5C0NC 4LMQE 4EVNA 5D7JD 4F7MB 1OAQH 3LPFA 4NJAH 3BRDA 3RAJL 5MENE 4LSRL 1U0QA 3MA9L 3OKOA 5B8CB 3OG6B 3EKCA 4Y16B 4HKXB 1OQOA 3FMGH 4M8VA 4GMTL 3QXAA 5EU6E 3MV11 1P69B 3JUZA 2CPCA 4TULH 1ERNA 4O58H 3HMXH 2COQA 3C08L 2DM2A 1FZOB 1KGCD 1F02I 1F58H 4YZFF 4XBEH 2YEZA 5DRZA 4C4KT 4HJJL 2D4FA 3LEYH 3VFUA 4I0KA 4AY0A 3P0YH 5HHVL 4R4BB 5GS2H 4IMLB 4A2MA 1R3JA 1EGJL 3OXSB 4Z76A 5IHLB 2M1KA 1G7PB 5GSVA 4OKDA 4MXQD 1SYVA 1TETH 4LSUH 2BERA 4M8QB 3UC0L 1WCBB 3N85H 1GJIA 3T65A 4M7ZC 1EJOH 2ESVD 5EO1B 3WBDA 4PJ8B 3MR9B 4JPWL 5CMAB 4JDZA 4HUUB 1UYWH 1E4XI 4U4BA 5E0QA 4JFHE 2QSCL 5DJZA 3HHRB 2EE3A 4RDQF 3MJ8A 1CLZL 2AXFA 2FX7H 1HWGB 3AS1A 5DS8A 1QR1B 2FBJL 4U7SA 3RKDC 4OCNC 3JV6B 4D94A 2VAJA 4YDJB 1JHLH 3LEVH 4FQLL 1UVQB 2W9EH 2NY1B 1ZHNB 3PWJA 4BKLA 1QD0A 1R3KB 1RFDL 1D6EB 3SGEI 4QGTA 1JWSB 2CKBA 4IHOB 4TUOA 1CD8A 3T0WA 3VFRB 2A6KB 4YDLC 2BMKB 1MCSA 1ED3A 2R2EA 1OGTA 3FAXA 2ED7A 2PO6D 4U1SB 4PRHD 3MRDB 2NY0B 2W65A 4JFQA 3K4AA 3MV8D 2VKXA 3MCKA 3BKMH 4MNHB 3VFTA 2EXYD 3GGWA 3SDDC 1NJ9A 1FLRH 3UYOD 4NWUL 3CZJA 2R29H 3GUTB 2MPAL 2OMNA 2ZUVA 5EUOA 3G6JE 1HCVA 4JZNB 3BGMB 3RZCB 3BYYA 3Q3GA 1WBXB 4LHUB 4PP1D 1R3IH 3MUZ1 2NW2A 4K9EH 4OM0L 3IDJA 4LSPL 1S5IH 5IIEA 1A9BA 4GRWH 5CZVL 4HWZA 3T0ED 4JREC 2VZTA 3HC3H 5JMOC 2FJHA 4IRJD 4NT6B 3NIGF 3EYOB 3CVHB 1CXLA 1CFTB 4Z7WA 5ID0A 2FCBA 4EDWH 2MOVA 4DCQB 4N8CL 1CVRA 1IQDB 1OP9A 3MODH 3SGDH 3ZT6A 1U3JA 1AD9A 3CD4A 3T77A 1MJ7L 3AAZB 3RAJH 3PHOA 1HXMB 4LSRH 4GQPH 1G9EA 5FK9B 1U2HA 2CDFA 4OBSA 5HYJE 3BZFB 3OGCB 4AEHL 4MJID 5MEPA 5FFLA 2BSRA 3CDFA 2R4SL 5KSAA 5DJ8A 2O5YL 1NKRA 1TZHA 2AXJA 5TPWL 3C08H 5DK2A 5EFIB 5CUSL 4IOIB 1GPOL 5EU3B 3BGFB 5DMIL 1T0NB 5J1AA 1ZLWH 3LRGA 4JO4L 4LBEB 5GS1C 4WWKC 1J1XL 5H2BB 1DE4B 4JFPA 3VFGL 3BT2L 3GMPB 4X0KB 3RWFB 5ANMB 5IEKB 1EGJH 1UH2A 3U9PL 5JNYA 2VABA 3EBAA 3TVMD 2IAMC 4D0CB 3V5KB 4ZXBA 1OAYH 4ZG1A 2HYMA 2EIDA 4PJGB 4U1JA 3UC0H 1I85C 4MXVE 4NQEB 3KJ6L 1JNNL 3IF1A 4HUXB 3L3KB 4RAUB 1H3TA 2F54A 2APBA 2APFA 3TJHD 3UTQB 3PHQA 4L9LB 5I18L 4JPWH 5FO8A 2XWJA 4JFYB 2QSCH 4X83A 1YA5A 2R0WL 1XGUA 4K94L 4HGWB 5KOVC 1CLZH 3X14B 3FO1B 4WI3A 4MCZA 4M6NL 3MRMA 3MV7B 2WP3T 1KUMA 4QRQB 2FBJH 1MLBB 3T4YB 5CD5D 2EC9U 4YDVB 3RJQB 4WW2B 2YSSA 3AMLA 1WBYA 2GK0A 3MV01 4JHZA 3GM0A 3G5ZA 5BO1L 1RFDH 2FJFB 1SMOA 3BO8A 3DSNA 1HHGA 4YXHL 3ECBA 3GMLB 4WV1A 1XFPA 2F5AL 4K3EL 4XB8A 1V05A 3MNZB 1YNTB 2HP4A 3MUY1 3QXTA 3SKNB 2OSLA 2VLJE 4OCRL 4ODWA 4RMQA 1T7ZA 4LSSL 4P23C 4R4FH 4ZOBA 2PYEB 5DZOA 2VISB 4R90L 1FN4B 4HS3A 4PG2A 1ZWIB 4R0LC 3RL2A 4M62L 2BNRB 4NWUH 4X6DA 4OZGE 2ARJQ 2A83B 4YGVA 2LV4A 1GIGL 3FQWB 1FYTE 5FAAA 2YUWA 3ARPA 3BHBA 3IDIA 3KS0J 3ZSSA 1I7RA 2YPVL 4N8PA 1EIBA 4PD4K 4PPTA 1NCAH 5F8QC 2WLZA 3LKNB 2XKUA 3ARUA 3QQ3B 1KXVC 4WGWB 1CDHA 4CDHA 5C07D 4XNMB 2P46B 3LV3B 4TVPD 5CEYB 3X17A 3ARGA 4L3EB 1C08A 2YD7A 3FB7A 1ADQL 3D9AL 5TJWK 3TYFB 3OL2A 1A47A 3KYOB 5CZVH 4PJ9D 4MA1C 5IVZB 5EUOF 1BIIB 1VB9A 2A6IB 5IOPA 3FFDA 3S9DB 2ZG1A 4RX4A 1ODAA 5IWLA 2P5WD 3ZMRA 4N8CH 3HZKB 4OF7A 5D6CA 2ZUQC 1FFNA 1UZ8A 4ZAKC 4L4VE 3OTTA 5SX5H 2D0FA 3HG1D 4LKXA 3UO1