1B0WA

Structural comparison of amyloidogenic light chain dimer in two crystal forms with nonamyloidogenic counterparts
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
b'DIQMTQSPSSLSASVGDRVTITCQASQDISDYLIWYQQKLGKAPNLLIYDASTLETGVPSRFSGSGSGTEYTFTISSLQPEDIATYYCQQYDDLPYTFGQGTKVEIKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BENCE-JONES KAPPA I PROTEIN BRE
publication title Tertiary structures of amyloidogenic and non-amyloidogenic transthyretin variants: new model for amyloid fibril formation
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b0wA00
1GZQB 2ZCHH 5BZWB 5DEZA 2YC1A 4J4PD 2DQTL 4FQXA 5C08A 5SV4A 4JG0L 3T3MF 2A9ML 4JFPB 1S7XB 5F72S 1QFPA 2EH7L 1LWRA 2XZQH 5DK2B 4ZUSA 1YMHA 1XR8A 1NGXB 3DGGB 1NKOA 1CG9A 4G42B 2FJGA 4YGAB 4HXBH 1NGZA 5E2WL 4CDGC 3OZ9H 3NA4A 4TSAL 1FO0A 1YMMA 4KHXL 1RVFL 1YEIH 2V5TA 3PGFL 1T2QH 3X3GH 3DX7B 1AY1L 4J3XA 1HCFX 1MHPH 3S37L 1R5IB 4XNQA 3FB5A 5JXEA 4P0DA 1A14H 3SHSA 1E27B 2IAMC 3MRJB 3O0RL 1ZLSL 1J10A 4HIIA 4D0DB 3I9GH 4UQ2B 5TDNB 5GSVA 2XRAL 4LKXA 2OSLA 1I75A 4KHTL 1F4YH 4MX7B 1ZHNB 3B83A 1JTPA 3IDJA 5INCA 3E6HA 1U3HA 3UBXG 5FFLA 4AH2B 4UUJA 3G5VB 3JTTB 4QXWA 1LEIA 5CCKL 2Z92A 1YMME 3TYFA 2HA1A 4GXUN 4KI5C 4JVUA 1O7SA 4KQ4L 1H3GA 4OZGE 1NMAH 4U6VH 3V8OA 1DJSA 4NKMB 4NOFA 4L4JA 2ADIA 2FX9L 3EFDL 4NQXB 4LRIC 1BAFH 1JRHI 5D7LA 5MEOB 2VDML 5C0CB 1TITA 4C83B 2B4CC 4PLNC 2G75A 4S1QL 2CLRA 5F3BB 1MAKA 1ZLWK 4WGWB 3CVIH 3STZB 4O4YH 4MXWL 1HQ4A 5F8RC 1DE4B 3LRSB 5DC0A 1ACYL 2IALB 3VG0H 1AIFB 4YDKH 1DN0B 2AJXH 4G6JL 3S96A 3RWHA 4ZUVB 3UAJC 1YPZB 1OPGH 1RUMH 2KZ1B 5KSUB 2CK2A 1UFUA 3QQ4B 8FABA 3G5ZA 5FOJA 1BQHG 1HSAA 5E4IA 2VZSA 1S7SB 5L0QB 2UVEA 4K07A 2P4AB 5D7LE 5GJSH 2ADGA 1RZ8A 4FABH 5IBLD 3CCHA 1S8DB 4LQFH 1VERA 2CJUH 4PJ7E 3SDAD 3WD5L 5GS2D 1VA9A 3BIBX 1G7MB 3VXOB 5BXFB 2R0ZL 4UMGA 4G6FB 4WW2C 1G6RL 5K9QI 5D1QC 1OP3H 1G7PA 4OI8A 1KCUL 3KYKH 4JFDB 1V8HA 4B50A 2IQ9H 1EO8L 5GZND 3DX9A 3NBNA 3TFKC 4NSKA 3W0WD 1NMBH 4QRPB 8CGTA 4OV5A 2XI9A 3O45A 1KOAA 5EULV 1F58H 3MRKB 5TGBA 3OAUH 1U6AH 4J6RH 1GGIL 1I9RL 2B5IC 3HLAA 1WT5C 4X6CF 4JAMA 3W2DH 2J6EH 1NGPL 1RY7B 3AREB 4LLAA 3AY4C 5D7JD 5DQJA 2NYYD 3D3VB 4HMCA 1UJTA 3P4NB 4JY4B 5MP6L 5CWSB 1MCNA 3NCYP 3MTRA 3WEXA 4B7IA 3HNVL 3D0VA 3ULSA 1UENA 1OTTD 3V5KA 4KK9D 3ARFA 3LN4B 4PRHA 4JFEA 4PJFF 3WFBL 1VGEL 1ZVYA 3LB6D 4OIIL 1J1OH 4U0RB 2X4NB 4ODTL 2XZAH 4UNUA 1VFAA 2NR6C 4HPYL 1CD1B 1DEEB 3G04A 4JFZL 3RZCD 4PG9B 4HUVA 4LSVH 1F97A 4UI2A 3VFSA 5J1TC 2HVKB 2DLHA 1SM3L 5C09D 1UQSB 3MRDA 4LCIH 5HJ3A 5J3HD 5DHYB 3C8KA 3UJTL 1N8ZA 1ADQA 3M8OH 5FCSH 5MENE 2X6MA 3KYMA 2B4CL 4JG1H 5DZLA 2KKQA 4X4XA 4NBXB 4PRHE 4JFEE 3K46A 3WJLA 2WSKA 3LOWA 5L2KB 4HIHA 4OT1L 3T0BA 4MA8L 1DVFB 3VMNA 3OHXB 3QEQA 4Y4HD 3BE1L 3ZE2F 3KJ4C 1OTUD 2CPCA 3WS6A 4TUKL 4JREB 3LEVH 5IW3A 5F6IB 1BBJB 3HN3A 5GHWL 1FYTD 5SWZD 1FNLA 3H3KA 3DLQR 3PGDB 4U1GC 3GO1L 5DJDB 1J0ZA 4P2QB 1AGFB 1BECA 1MVUA 1EPFA 5F89A 5FCUL 1UCBH 2NY0D 1JRHL 1JGUH 3D0LA 1I8LC 5FHBL 4QHMA 2KPNA 5ICZA 3MFFA 5SX4H 1BPVA 1LO3H 1OM3H 4LSDA 3PDGA 4NQTA 3MLYL 4H0IA 4GG6A 2APXA 2A6JA 2CMRH 1EZVX 3GSXB 3QEQE 3RAJL 3NTCL 1YN6B 1UEYA 2H32H 3OPZL 4JY5H 2FLRT 4OLUL 1OTSC 1NAMB 2XWBA 1CK0L 4U6XB 5I1CL 2HFEB 1JGEA 1CFTA 1A1NA 2V2XA 4UIMB 5ITBH 1CWVA 3FO0L 3MYJA 3SY0B 4P5TB 5HVHB 2XN9E 2P47B 3QQ9D 1CDGA 2IQAB 4APQC 4LLQB 4MXVE 4D0CA 2UZXB 1TETH 1K3IA 1EVTC 4AT6A 2HP4A 3QNXB 3GEWB 4OQ1A 4OZIB 5D96C 1T22B 4F9PA 4HKJA 3AGVA 5IVOA 3EYFB 2BY3A 5L6YL 1B3JA 3MUZ1 1NMCC 4YHNB 2VAAB 3U0WH 5EO0B 1F8TL 5BVPH 4GG6E 4FTVE 3HG1D 3OTTA 2YWZA 1A02N 4YK4B 1FAKT 5DJCA 1CD9B 2ZKHH 5D6CB 2MHAA 1FSKC 2WIIB 1T1WA 4MJ6A 3MLRH 3QNYA 3GZKA 2WBJC 3B5GA 4CADA 4F57L 1BVKA 1IQDB 2EZ0D 5JUEL 5JW3L 2F9BT 3EJYC 4GRLB 1YEEL 5ITFB 3RVXC 1KCLA 4HK3J 4XXCA 2OK0L 2HFGH 4V1DE 4J12A 2N1KA 1ZT4B 3B9KD 1B9ZA 2CLZB 2MKWA 2UWEF 2NCMA 2VO5A 4RFNB 1DZBA 4MD5A 3W9DB 4K7FA 5HXMA 2VB5A 1WWBX 3QZWB 3MA9H 4G80A 1UACH 5L88H 1ORQA 3QEHA 1UXSA 4LP5A 5C9JA 5JORB 2CIKB 3K2MC 4TNVF 3CXDH 3VFTB 2PUQT 2H9GA 2CLVB 4Y19E 2ITCB 3QUZB 1C08A 2EKSA 4ZO7A 3EZ8A 3MMEB 4WO4A 1RHHA 1A6TA 1WUNT 2XQYG 1B0WA 3F8UB 3MJ7B 4RMSA 4ALAL 1H3PH 1JGDB 1KACB 4CU7A 3PHQA 4HC1L 5LCVL 4JFXB 1TCRA 3P4MA 4DGVL 1T0NA 2Z31C 1J1XL 4PB0H 3ZDZF 2R39A 1FC1A 2BXZA 1EFXD 2KZWA 5E56A 4ZDHA 5KSAC 1Q94B 3IKCA 5C3TA 5B38B 3ZSTA 1QFUL 5D5MF 3ECBB 5IG7A 2X05A 1DLFL 4U1JB 2AXFA 2GK0A 2O5XL 1UKQA 3FB7B 2XTJB 2D7OA 4I8DA 1JNLH 5DF0A 3Q6FA 1HWHB 4JVWA 5C92A 4NFBA 1TZHA 1Q9LA 2HVJA 3B3IA 3T2PA 1HXMB 1RIVL 1R3KA 3BKML 3QIWD 4QRRD 2J12B 4XBEL 4F15C 1J1PL 4DCQB 4NN7B 2A0LC 2EXYC 5DMKB 3D25A 3M1BB 4QF1A 3OAYH 4NKOA 2DBJA 3DV6A 4IOFC 4KUCF 4EUPA 1U8KB 3HE7B 5FUOH 3EO0A 4DW2L 2VERN 2DYPB 1F45A 1D9KD 5L2JA 2Y1VA 3MV9D 5IWLA 2VRAA 1CDIA 3GIZL 1JZ7A 3GNMH 4Q9RH 2PYEA 1B0RA 2HTLD 4LNVA 1RIUL 4FMKA 1D5XB 2A1WH 4HUXA 1S7QA 2JJSA 1F02I 2DS4A 1YNLH 3RUGE 1MCKA 3QDJD 1TPXB 4DKFH 4FFWC 4YFLF 5C0DA 5E99L 4QHKI 4WHDA 3C2SA 3IDMA 2ZNWA 1Z6JT 2FJFB 5IMOB 4JRWA 2OL3H 4MJIB 2EH8H 3L7FA 2DI9A 4P46D 1JNNL 3LN5A 5IK3A 4M6NH 3VFRA 3V7AG 2EDOA 5GGRB 5EIIA 4ZUUA 3IT8D 2XZCH 2EDWA 4U7SA 5BRZB 1KFAL 3QG7L 3C6LC 1V7MH 4L4VA 2JKXA 4JM4H 4WRLA 1IAIH 5DQ9A 3RTQB 2PYEE 4EVNB 2A83B 1BREA 1L0YA 4PGEA 3IJYA 3EYQD 2RBLA 4K3HA 4L8BA 4YXKL 4HT1L 1JVKA 5I1HH 4XPTL 4PRBA 1RJZA 5I9QB 3IAQA 2EICA 4BKLA 3W39A 3BP6A 4S1SH 1YUHB 5EWIH 2IF7A 5IB1A 1CF8H 1OARL 4KC3B 4QRTB 5SWQB 1KN4H 3RWIB 2HAZA 3R1GL 1YEDA 4WUKL 4XNMB 1P9MC 5TF1L 4NQDA 5C0IB 2BNRB 2EE6A 2YKLL 4GG8B 1D6EB 4L4VE 1CFVH 5FM4A 3KG5A 4PUBL 3L7EA 2C4XA 2NY3D 3EYVA 1NC4A 4NO0B 4Y7MA 5INDA 4JM2B 4UQ3A 2FL5B 1OVZA 1KLFA 1UWGH 5B39G 3O8XA 5IF0B 1F6LL 4G3YL 2DQFA 3CD4A 2R56L 1I8KA 1ZV5A 3MBEC 1CLYL 4K7PL 3FQWB 4NQSA 2ADFH 3RGVC 4GLRI 5FIEA 1BLNA 1DN2A 3FO9A 3MJ9A 3WUZA 4PYHA 4M61B 4XNZB 4IRSB 4LL9A 4XC3H 1ZGLB 4X4YB 1FIGL 4XXDA 1SMOA 2ICCA 3TYGL 3QDME 4I9WE 5IR1A 1ZHBB 4NQDE 2A9NL 3VXRE 2DQJL 4H0GA 4JRYA 3SKJL 4ODXB 3V0WL 4FP8L 4K8RC 1CXKA 5CEYA 2YBRA 2VDOH 3E1F1 2R1WA 2YD2A 1ZLVK 5FYKE 4M1GL 4OCYL 1L0QA 1NFIB 3OKYA 3OAZH 5DFWH 4XVTL 2F8VA 2NLJA 1SBSH 2Q6WA 5J6GA 3C09B 5ESQA 1Z3GL 3OMZA 3VXMA 1NBZA 4GRMB 2OTUB 1KEGL 5TQ0H 3SGJC 1HH6B 4LNRB 4KXZH 1D5MB 1NJ9B 4M6AA 1JMZA 4HZLB 3FT3B 5FGCE 2PO6C 2PW2B 2E6QA 4JRYE 4MLIA 5HHPA 3I75A 1QLRB 2H1PL 4IIQB 1VFUA 1I1CA 5F1IB 3KLHC 3VJ6B 2IEPA 4Y4FA 5DMIH 5I6XC 4RX4A 1FHGA 1JHLL 3QSKB 1VACA 1DFBL 5KOVC 1QNZH 3O9WB 1SVCP 2FGWH 4YUEL 4ZNCD 5D1ZB 4OFVA 2NTSP 4PGZA 3FT2B 1FGVH 3VXME 4LAJH 2XWJB 3WHE1 1IGIL 1IZKA 1UZ6F 1S7WB 5CSZB 1YDPA 4URTB 1QKZL 5EPMA 3UTTD 5DSCA 1MIEH 4I0PC 4OUOA 4D9RE 4N8PA 3BPNB 3ARGB 4NCC1 5T1MB 3RX7A 3D6GA 4QXUL 5E2TL 3BP4A 1LNUA 3V5DB 5CBEB 1D3CA 2BSSA 4XPFL 4GUPA 4ZQKA 1CFNB 1D5ZA 3CFCH 3GHEH 4EOWL 5I71B 1KSRA 3MA7A 2VSDA 4G8GB 4P9HH 4P23D 3FRPG 4MAUL 5KN5B 5AWNL 3SDYH 4ODWA 1GOGA 2NY6D 3VD5A 3GMPA 5IHZB 2IAMA 5GISL 4JN1L 2MSPA 5GGTA 1BWMA 4TSCL 3ILPB 2CIIA 1PX3A 3U79A 3ARVA 3KXFA 4XNUH 4UOW0 2PW1B 1MCPH 1LDPL 1QBAA 5C0FB 1MHCB 3IDYC 3I2CL 4XP5L 5D9SB 4NUGH 4GBXD 5ADOL 3KWWA 3MRHB 2F5AL 3QQ3B 3CFIC 4LEXH 2H32B 4XMPH 4DN4H 2C1OB 1CFQA 1UADC 3STLA 3QDGB 1MI5A 2HKHH 3NFSL 4LLMB 4GW5A 4N0CC 4G9FB 1MQ8A 5IEHB 3GSQB 2IBZY 1ED3A 2EYSB 5GRYA 4Y1AD 4PJ9D 5T1LA 1ZT1A 4JPKL 1MHEA 4K8RL 1P7QA 1URLA 2HYMA 3WIIL 4Z76A 4H26A 5ISZA 3T3PE 4E0RB 5IKCB 2BSED 4MYWB 5BVJA 4HQQH 5FGBA 1EHLL 4EIZC 5C0GA 2VIRA 3H42L 5JO5B 1MJJB 2Q7YA 3KXFE 3U0TB 3SKMB 2E3VA 12E8L 1T1ZA 1WISA 2NX5A 4GS7B 4QRSB 3LS4L 5IGXL 4G6KH 2P43B 2V9TA 5I73B 1KF9B 2Y36L 4HJGA 3RVTD 3DSFH 2A77H 3MGOB 4FXLA 4KI5E 1QYGH 2V7HB 3VXTA 5HHQA 5JQHC 3UDWC 1FL6A 2ITDA 4JDVB 4RBPK 3V6BR 1QHOA 3TBVA 1IM3A 4M4RA 1I7UA 3FHQA 4ELKA 4JRXA 2P49B 1BZQK 2K7QA 3ZE0F 4O51A 4OZFG 2BX5A 2EE3A 2HLFD 4WW2A 2V5RA 4KTEH 5CLWA 3W9EB 2NX5E 1AGBB 2FO4A 3F12A 3JV0A 5I8EB 1VSCA 4OFYA 4YFDB 5D1QA 1U8NA 5D7IA 2J8HA 3AROA 4LU5H 4PJHF 4ZPTA 2NXYC 4F7CB 1DQJB 1MNUH 5I19L 4K7PY 3IFNH 5ID1B 1JF6A 3RNKA 2QJDA 5FYKU 1BBDH 3PQYE 1IAOA 3UJIH 5HVFB 1G6VK 5CEZH 3VWKC 1WT5A 4HK0B 3GSVB 1T3FB 4DVBB 4N0UB 2VISB 4WFHE 3HPJB 1G7IB 3HI6H 3AY4A 1PYWA 5JDJA 3PWPE 5ADPL 4AEIH 4L3EA 4WWID 3RY5A 1VGKB 1QSEB 4HX1A 3D85D 2QEJA 3D69A 3O6KL 5D7IE 1BD2A 3CLEH 1LO2H 1T03L 1FZOA 2DAVA 4KJQD 4WTZG 1UM6H 1WTGT 1W72A 5CZVH 3QIBD 2F15A 4LLWB 2G2RA 5KAQF 1FH5H 1NSNL 4FQLH 4Y2DD 4QRQB 5ERWA 4LVNC 1TVDA 1NC2D 1U8MA 5H2BB 5JOPD 2ZSVB 4EQ2A 3V2AR 5C2BH 4P9ML 4ORGA 3WJJC 5FHAH 1F5WA 5EZJB 3HPLB 5EU6A 3ZL4L 1F2QA 1IC5L 3C9NB 4L3EE 1LQSR 5KAQG 4ZYKB 1NH6A 3DBXA 1JF1A 2GTWA 5GRJH 5CD5D 4RIRB 4ZOAA 2DKSA 1R24B 2FYYB 3QUYB 3RWEA 3FFCA 3TWCH 3T65B 4D94A 1BD2E 3HHRB 3L3GB 1XZ0B 1MFBH 1WFTA 5EB9A 5FKAA 3T0EC 4PJ5D 2BSTB 1GJIA 2MFNA 1C5BH 2X09A 1BQSA 3P4OA 5IROC 5L9DH 3J7HA 3U46B 1U2HA 2ZOKA 4Q6YA 4X99A 1IGML 1X5JA 3JV4A 4ENED 2CDGB 3HC0A 2OCFD 2DIBA 2HT4D 2H26B 1FNAA 4YFEA 1RZFL 3TIDB 1ND0B 3BQUB 5ICXB 5EU6E 2A73B 1CL7L 3VCLA 3ZE1F 4PJIF 1QBMH 2OL3B 3WNPA 5JZ7C 3WS3A 3KPRB 2HJKA 4WJ5B 5T3ZL 3D39D 5D71H 5F7DB 2VQ1A 5DRNA 5TDOB 3VWJC 4CMMA 3MLXH 2M2DA 3HNTL 1I8LA 3LKNB 2NXZC 5J12B 1FPTH 1LK3L 5GGSB 4YBLC 4QXTB 1QQDA 1UWEL 4J4PC 2VLKE 2F53B 5LG1A 2JCCF 5D5MA 2J8UA 4JFOA 2FATH 1DLHB 4AJ0A 4W4OA 2VITA 3ZTJG 4UV7L 2Z35B 2VOTA 3Q48A 5EO1A 3NH7H 5AZEH 1YEGH 4XZUA 1KUMA 2ZUUA 3UO1L 3QFDA 4ELME 1F6AB 2P5WA 4L4TD 1FNFA 4Q0XL 1MRFL 2FB4L 3DMMC 4HHAB 3WFDH 5E6ZA 5DK3A 4JKMA 1FFOA 1E4XI 4BK5A 4NQEB 3HCVA 4KKAD 5DD3H 2VXTL 3ZDZE 3UCRA 2VXUH 2YR3A 1AFVH 2LAGB 3UTPD 4P4KB 2KBGA 3HRPA 2FHCA 5JXAL 3LMJL 3FAWA 1ADQH 5T1DL 3QUXA 2J8UE 5KVEL 5T3ZD 5H94A 4ODVL 1ITBB 2HWZL 2NY2C 5CJ8A 1SVZA 4NNYB 3V6OA 3WIHA 2GJJA 3SKOB 4DK6A 1WCBB 4F7EA 4AIZB 3TBTB 5EZOL 4RZCB 1NL0H 1XF4A 1LE9B 1G7LB 3Q6GH 2NY4D 2PTTA 4DTGH 5HHXL 4MJ5A 5F7NC 3UP1A 1N2RA 1U3ZA 2FIKB 4HBCL 2BVQB 2WWKO 1TZIA 1AD9A 3K0WA 5HYJB 5I8KH 5LWYH 5L7XL 5HGGS 1TQBB 4LHUB 4HPOH 3VG9C 1QVOA 1B0GA 3HZVA 1WBZA 5F3HA 5HYSA 3T04D 4OCMC 1LO4H 1CLOL 2CDEB 1MWAA 1V3MA 1OAYH 3BZ4A 4EN3B 4LSRL 4DGIL 3NCBB 4DKEL 4Q9QL 1MFNA 3NFNA 5KS9F 3B2UD 1N64H 1JNHB 5J1AA 2DN7A 4KVNL 2PTUA 1KG0B 5HI5D 5DTFA 3QIUD 1QRND 1R3LB 4RGND 2X4OB 2EDLA 3IVKB 1YC7A 3KPLA 4HIJB 5CJQH 1PLGH 2DQUH 2Z31A 1RQ5A 1WIPA 5FB8A 1N0XH 3LKSB 3SE3C 3BH8A 3EHBC 2ENSA 3ARXA 5DXWA 2Z91A 5ANMB 2IMNA 2W92A 1A9BA 3IDGA 4IHOA 4QHNB 5I8CB 3BZFA 4OD3H 2AV1B 2DTMH 4XBPA 2VXVL 3RVWC 4J3VA 5DJ6A 5DWUL 2AKRA 1P4BH 5IJKC 3EDKA 3HE6C 4XVJL 4X83A 1XGQA 4IMLB 3UPCA 3LSOB 4PJBB 5B4MD 1P4IH 1I8IB 3P11L 3OKLB 4LCYB 4MD4A 2C3WA 4K3JL 4MNHA 1LE5A 3KHOA 3O2WL 2R0WH 5D8JL 5KG9B 2H2SD 5GRUH 4QHKJ 3I6LE 5E2VH 3VW3H 1ZHLB 1WITA 1WC7B 2GCYB 3BXNA 2R8SH 2DD8L 3KHQA 3RRQA 2IFFL 3ZDYE 1PG7W 5IESL 1S3KL 3N1PC 1TCMA 4KRLB 1S7RA 4JB9H 1RUAH 4FFZH 2D2OA 2NYYC 2OLDA 5MI0C 4G6AD 2KUTA 5GZOC 2VSCA 1FE8L 3O41A 3AM8C 3MQIA 1CBVL 3QO1A 4H0HB 25C8H 4M7ZB 1K85A 5EUOF 4F7PA 1Q72L 1RZ7L 3L3KB 4NC0B 2B1AL 4JO1L 1C5CL 1AKJB 1M7XA 2EC9U 5J56B 5JHDA 1CE6B 2X4PB 1J18A 4IM8A 1CYGA 3MUJA 2AI0L 5EOQL 4NQVA 2FBJH 2XPGA 3S34L 1A7OL 4GKSB 4OD1H 4TOYL 4ZS6D 1HK6A 4PY7B 5CZXD 2WM0A 1QTYT 5BJTB 3C6LA 4CKVX 1ORSB 4M7JH 1JFQH 4JN2A 5J3HC 3OKNA 2IPTL 3F5WB 4LCWD 2HTKC 3SDDD 5FUCC 4HIXL 5J6HB 5DJYB 1HHHA 1MHHA 3DVFA 2YC1B 2ED7A 5J9PA 5TH2B 1WEJL 1DEDA 5C08B 1SYSA 2VLRD 4I3RL 2LQRA 5JHDE 3MUY1 4MVBD 4KJYA 5B22A 1QFWI 5D2LF 4Y4HC 4HWEL 4L29A 4Z7UE 1BEYL 4ZUSB 4ZNEA 1XR8B 1KNOA 1CG9B 4LOUC 5DR5L 1TIUA 4XTRC 4HCRH 4X9GA 1AXSA 3BMWA 5EC1A 1DBKH 4EUPH 3CFEA 1YMMB 1QP1A 2HRPL 4NNPL 1KIQA 2X1OA 5C0RH 2ZCKL 3QBTB 4XNQB 5I1DA 3O2VL 3C5ZD 3RGVA 4GQPH 2J4WH 4IDJL 3RZWA 3BIAX 5KVGL 1A9EA 3EOAA 3N1GC 4PGDB 4E41A 1UZ6E 1KJMA 1WTLA 3MV7D 4HIIB 4JFHE 5L0QC 5FO7B 1YEFH 2NY1B 5GSVB 4KKNA 4UBDC 2M8XA 4DVRL 4D9LH 3CFJA 3SE8L 2DQHH 2OSLB 3OG4B 3NCJL 4M3JA 5ACZA 1T04A 1GGCL 3M07A 2E6JA 3NIDE 4X8JA 5INCB 3E6HB 1U3HB 3HKFA 4UUJB 1IL1B 2VXQL 5DJ0A 1LEIB 2Z92B 1NCBH 2I25N 5I1KL 4YXLL 1KJ2A 2YPVL 2ARJA 3B9AA 3QPQC 5JA8B 2H41A 3TYFB 4NOBA 4XHJD 4NO3A 5B3JE 2FJHA 5K9JL 1I3UA 3ZLQC 2FWOA 1C1EH 1OQXA 2ADIB 1MCRA 2DI8A 4ZUWA 1T6VN 2XV6B 3IRZA 4MDIA 4E41E 2QQLL 2LU3A 2EDKA 3AREC 1IBGL 1DBJH 2G75B 1R3HA 1QACA 4MAYD 2CLRB 1ZGLP 4ZXBD 3BSZH 2W0PA 3LKPA 4FQCL 5KW9H 3D9AH 2PO6A 3DTXB 1I1AD 1HQ4B 4NZUH 3ARWA 4QLRA 4N90E 1N59A 2P48B 2E8ZA 3S96B 4A2LA 2ID5A 4CVXA 3BAEH 3T2NL 3U83A 1RZIB 5I8OH 4OCSL 5F7WC 1A7RH 8FABB 4PBWD 4LIQE 3G5ZB 4U0RC 5BCAA 3O2DH 3B9KC 4POZD 3RA7L 3FO2B 3QNZA 2CGRH 3C5JA 5FYKH 4MGXA 5J4MA 2ADGB 1RZ8B 1R3JA 3MODL 4X9BA 4P2YA 1JNJA 3HZKA 5HHME 3ROOA 1CU4L 1IT9H 1I9IH 2ZUQC 1H3WM 4QTIL 4I0PA 5HDQL 2UZIL 3CSYA 4GXVH 5J8OA 5HGBB 4P3CL 4ZSOA 2QSQA 1M4KA 3MACL 3MJ9H 4K23H 4C56A 3MV8A 4F2MA 4L8DA 4ZS7H 5AG9A 2AK1L 2OS7A 3BD3A 3DX9B 3H2WA 5IJVA 1E6JH 1VKXA 4NSKB 4L3CA 5CUSH 2IANA 4OV5B 1RAMA 3F58H 3O45B 5GGVL 2WNGA 3SDCD 5TGBB 3BT2H 4TQEH 1DVFC 4WEBL 3HLAB 2ZCLL 4JAMB 4ONHA 4ZO8A 5D70L 5JNYA 4NQUA 3VXSA 4WUUA 5E1AA 5F6IC 4M7KL 5BMFL 4ISVB 1MCHA 2FEEI 3BKYH 3QEGH 3GHBH 2AJZA 5IHBA 1FAIL 1MF2L 1RULL 3VXPA 1H3VA 4ZSOE 4L8CA 3KPSD 4X5WA 1OAQH 1NKRA 3D0VB 4OCXL 3ULSB 3ARDB 3RVVD 4OIAA 5C6TL 4QHLA 1PY9A 3ARFB 4OCRH 5E0QA 3IFPB 4DGYL 3TF7C 5I75C 1A6AB 2IANE 1CXHA 3MLTA 4PD4J 3ZDXF 3TBWA 1U42A 4CGTA 2EYTA 1RU9H 3G04B 4CMHB 4HUVB 5FEBA 5HI4D 1K6QL 3VFSB 3VXSE 4WUUE 1DQDH 5C0CD 5HJ3B 3MRDB 4HEME 1E4WL 1T21A 2QADC 4TSBL 3T4AA 3GRWA 4TUJA 2I07B 2X9WA 3RKPA 1BJ1H 5DLMH 3VD9A 3C8KB 3RDTD 3ARPA 1UH3A 4P5TC 5HVHC 4OFDA 1FGNH 2QHLA 1AXTH 4XP6H 3IRPX 1I4FA 3VFVA 4X9IA 1UXWA 3GJEA 1SYVA 4X4XB 2VDRL 1CGXA 1KC5L 1K2DA 3IF1A 3UDWA 1IGCL 3K8KA 4XNXH 5EBMB 4PRPD 3QEQB 4WIQA 3HMXL 3RNQA 2X4SA 1Q0YL 4NKIH 4YK4C 1IKFH 1A5FH 1CDYA 4ESKA 1NCDL 3V4VL 3KDMA 4PD4K 4PJIA 1BZ7B 4YEEA 3K7UA 4P2OD 3BZEA 4WI2A 5I30H 5GGTH 1IM9D 1MVUB 4FG6C 4MZ3A 2V17H 1MPAL 5F89B 4JJ5A 3D0LB 4UDUA 3B5HA 5IVXB 5T33L 2N4IA 4WI6A 1CT8A 1BZ9A 3MFFB 5ENWA 4XWOC 4RFNC 3AFLA 5JW5A 4TRPL 1XIWD 3WYRA 3VWKA 4GG6B 1E4KC 2EDFA 3WKML 4JO3L 2A6JB 3NIFF 5IT2H 3QH3A 1D7FA 1KTDB 3OJ2C 4RWHA 3B4NA 2XWBB 5DO2C 4YWGL 1MFEL 2AJSH 1CFTB 1JWMA 2V2XB 1RUQL 2NTFA 3MYJB 4JKPH 3IGAB 3SCMA 1A21A 4YHKH 1XR9A 3BGFB 2R4RH 1HN1A 4HWNA 2WUCH 4AT6B 5CGYD 4BQ9A 2EE9A 3EYSL 3QXWA 3HI1B 2AW2A 2VL5A 3PP3H 1NCWH 3O4OB 4O02H 4O58L 3K80A 2EDDA 3WJJA 3D87B 4NQCA 3QUMH 1WBYA 5DJCB 1FVEA 2NZ9D 4U1KA 2MHAB 4CVUA 4M5YL 1T1WB 4MJ6B 4P49A 4CADB 4PP2A 5EOCL 4RDQF 2XTJC 3BESR 2VLLA 3CU1A 2Q1EA 2X4UB 1JZ4A 3TCLA 2QSCH 4BUGA 1HCVA 4KJWC 4H1LA 1BFTA 3BPCA 3TCXA 5DDHA 3R4DA 3T0EA 1NAML 3FONA 6FABL 3QA3A 4YXHH 4MD5B 4K7FB 5IROA 4M5ZH 2FEEL 4RDQG 4LSTH 3HE7C 3SGDH 4G80B 5DJ8A 5E03A 1NFKA 1ORQB 1SEBA 4IRZH 4OLVL 1UXSB 3IDIB 1OLLA 4NQCE 3VFPA 5KS9A 3NA9H 4JFFE 1EGJL 1GRWA 1OAXH 5ILTL 4KZEH 2A2QT 3O11A 4WCYH 4B53A 1C08B 1JTOA 1OCWL 2EKSB 1BX2B 1DANT 4KK6C 1IGFL 2F54D 4OQTA 3PL6D 1RHHB 4WO4B 1A6TB 3VWJA 3EZJB 4BQBA 1TPXC 2JF1A 5KZCD 1WVZA 3PHQB 3P3YA 3SOBL 1JHKH 5FYJU 1FN4A 4HLZG 1T0NB 3BGMA 1IMHC 4D8PA 2O26U 5JDSA 3SE4A 1T7YA 1OGAA 4NHCL 1VEOA 1U58A 5GGVY 3T0EE 4R4BB 4Z9KB 1KJ3H 4I5BA 4J4PA 4XP1L 4ZDHB 3IKCB 4FQQA 2VQTA 2GITB 4X7SL 1P1ZA 5IG7B 3PABA 3SQOL 4TVPH 5I18H 3TJHC 2RAMA 5IQ7H 1W72H 4PLKC 2C3XA 4LAQH 1L7TH 2I5YH 4QNPF 2AXFB 2Q3ZA 2GK0B 4RNRB 3S3JA 5DC4B 1UVQB 2IJ0C 4WHYG 1WFUA 1EX0A 3Q6FB 4FXKA 2WWMC 4AEHL 2CR6A 3ALWA 4MMXC 2I60H 1Q9LB 2FX7L 5I9QC 4LPCA 3HAEG 3LQAH 1FVDB 1R3KB 4MLSA 5IFAL 3H7BA 5MHSD 2OZ4A 4GMSL 3VXQA 5ABDE 1OGAE 3D25B 4JHBA 1AE6L 4NKOB 3STBA 4EUPB 3JWOH 1MLBA 3EO0B 2DOCA 1WF5A 3AS1A 5L2JB 3R8BB 4WWKD 4BELD 4GAJL 5LBSH 3UBXI 3A6CL 3GBML 1MCWM 3ULUL 2E7HA 4XBGB 4G7VL 5IHUL 2MPAH 1S7QB 1PKQA 4JM2C 4MQ7A 1N5AA 3B2VL 4GRLD 4JLRA 5EUOA 3WO4B 5A43C 4OKVA 2GFBB 4KRPD 2ZCHL 3IDMB 4RISH 2HLAA 3INUH 1FLRH 4CJ1A 4XNZC 3WSQH 1X4ZA 5IK3B 3VFRB 1JJUA 2YUZA 5EIIB 2D9QB 4ZUUB 3RBGA 2MQCA 5I76A 3TH3T 1ONQA 3OX8A 3NACH 3LD8B 5DQ9B 4HXBL 1TFHA 3IJYB 1PKQE 4L8BB 5HHOD 1YEIL 2QKIA 4PRBB 5EUOE 1RJZB 1AR1D 1T2QL 2ZSWB 3WUWG 3X3GL 4RMTA 4BKLB 1MHPL 5HTSA 3BP6B 1BOGB 1A14L 1QSFE 5IB1B 3SE3A 3ULUD 3LDBB 1NCNA 3M17A 4NGHH 3IYLW 3PWUB 1YEDB 3FQUB 3I9GL 3WO3B 4MNQA 4NPYA 2X70A 2D7MA 2AXHA 2OQJA 3F6LA 5FUZH 5IJKA 2QQKL 5L8LB 3BPLB 1ZLUH 1ZHKA 3L7EB 3QJHB 5FO8A 2HLFC 3EYVB 1NC4B 4IIQC 4UQ3B 1BOYA 4M93C 3O8XB 1MY7A 2DQFB 5JOFB 3QXTA 5DVNA 1X5YA 4XVSH 4NQSB 5I17A 5EIQA 3I85A 5FV2A 1NMAL 3O9WC 2F58H 1BLNB 2YD1A 5D1ZC 3W0WA 1A2YB 2K9UA 2JB5H 3D5OF 4X7TA 4NJAH 3ISWA 1BAFL 4XXDB 3QFJA 2XY1A 4MNQE 3K2UH 4WGVB 5DK2A 5IR1B 3DJ9A 5FGCB 3MLSH 3BPNC 4PJXF 3ARGC 4O00A 3CVIL 4U1MA 1IAKA 3NABH 4O4YL 3UTOA 5A2JH 5CEYB 2R1WB 3VG0L 4YDKL 3AM8A 2AJXL 1B6DA 2ZWLT 5BOZG 1T20A 5B8CA 5DJZA 1IGJA 1OPGL 4HH9A 5I71C 4OD2A 4KZDL 2NLJB 2Q6WB 3GSUB 5J6GB 5ESQB 15C8H 5DRXA 1NBZB 4D0DA 2C5DC 3GK8H 4EEEA 3O4LA 1JYVA 5GJSL 2AK4D 4FABL 3QFJE 4LQFL 2CJUL 3QHZH 1PZ5A 1S78C 3PG2A 4DKAA 5IMLA 3RZCA 4YZFE 4Z7VA 2R2CA 4Z7NF 3JTTA 4LSUH 5HHPB 3I75B 1J8HA 4CVZA 2VR5A 3KYKL 4Y4FB 2IQ9L 5TQ2L 5D6DC 1CFBA 5EU3A 1VACB 2E9WA 3QPXH 1NMBL 2DQCL 1F58L 2VJXA 1U6AL 4J6RL 3U4EB 4H25A 3W2DL 2C3VA 4LLDA 5E5RB 4JY6B 4YHIA 1YDPB 2J6EL 3O4LE 4BM7A 2XACC 4Y4HA 5GGUB 2MCG1 5EPMB 5DSCB 3G6AA 3TV3H 1AJ7H 5DVOA 3CAFA 2DM2A 2VKXA 3OKKB 1HOCB 4Z7VE 1YA5A 2Y9RT 4GS7C 5SWZA 1RUPH 3BP4B 2OYPA 1DN0A 2R9HC 1J8HE 1IGTA 5I73C 4GUPB 1A3LL 3NIGF 1YPZA 5FUCE 4HF5H 2P8LA 4Z6AT 4ZQKB 1D5ZB 4R8WH 4AZ8A 3MA7B 2YA2A 4UINH 4PTTA 4ODWB 3LKQB 4X6CB 1J1OL 2MMXA 3GMPB 2XZAL 2JIXD 1RUKL 5C6PB 3T1FA 5DVLA 4ONFH 4R97B 2CIIB 2LABA 1T5XB 4XRCB 2ICES 3DO7B 4LCIL 3VXOA 3F7RA 1ZS8A 4YBQD 4CNIB 5HI3D 5IVZB 1WICA 3ZHKA 3KWWB 4BYHA 2BCKA 4JFDA 5CJXC 3M8OL 1NANH 4PJFB 4S1RL 3MRNA 1CFQB 1YPZE 5DYOA 1MI5B 3P9WB 4NRZA 4GW5B 1BJ8A 3LY6A 3PWVA 1ED3B 3F7PC 5T1LB 2FEDD 2BDNH 1JPSL 1ZT1B 4Z76B 4H26B 5ISZB 1IVLA 3AREA 1SEQH 3MLZH 5BVJB 4KJPC 4LMQI 5C0GB 1X6NA 1D5IH 3LEVL 4X9HA 1KPRA 2VIRB 3QDAA 1FL3A 1XCTB 2P42B 5CWSA 1UT9A 2NX5B 5CAYB 1QRKA 1X6LA 3UJJH 4OV6F 2C7UA 4HJGB 3QUMB 4JFDE 3T0VA 2VDPH 1PG7X 1UCBL 3CMOH 3LN4A 4ZUTA 1JGUL 1EAPB 1A1MB 1JUFA 4HUNB 3VXTB 5HHQB 2X4NA 4XPGH 5EOCJ 1FL6B 3B9KA 2VDLH 3BKJH 1LO3L 4HLJA 1OM3L 4LASH 2R4SH 2ITDB 3O81A 3RY6C 2R2BB 4PG9A 2CMRL 4OF7A 3TBVB 4UT7H 4JDTH 3S5LG 4JY5L 4ELKB 4JRXB 1UQSA 1CFSA 5E6YA 3D3VE 2GW5A 1A6WH 5DHYA 1A7PH 2AVGA 2FO4B 3B2UC 5ITBL 5C3LD 5D1QB 2P8MB 1OLZA 5D7IB 4ZPTB 3QUYC 2OBGA 4UT9H 5GGRY 4YHMH 5E8PA 1DP0A 3SGEH 1CIUA 1NGQH 3RNKB 1ZVSA 4HDIA 3DETC 4W68A 5GGQH 3NN8B 1DVFA 2B5IB 4OF5A 2R2HB 4MHHG 4ZAKD 1UYWH 3U0WL 3I84A 1EFXA 5BVPL 1Q8MA 1BBJA 2ZKHL 1PYWB 3MLRL 4LIQH 4AM0A 5C86A 4L3EB 1H8OA 5MERB 4P2QA 1XF3B 4HX1B 3PHOA 1M05A 1KT2A 3D69B 4Y16C 1BD2B 1QG3A 2HFGL 1FZOB 2BY0A 2A38A 1W72B 3MRMA 3L1OH 2G2RB 3DIFB 3UYRH 3QI9D 5D7SH 5ERWB 1U8MB 5GS3A 2N7AA 4QRRA 3CIQA 3MV01 4G9FD 2B7DT 4ORGB 1BQLH 1RK0A 4OJFH 1UACL 2D4DA 5L88L 1RV6X 4RFOH 4OZFH 3MLUH 4JPWH 5EU7C 5EU6B 3S9DB 2DF3A 3CXDL 2VUOA 1W0WA 4ZTPH 4U6XA 3MV9A 4LCCB 4QCIA 4UIMA 1OD9A 1JF1B 3RIAK 3SY0A 4P2QE 3EYUH 4P5TA 5TFSH 1H3PL 2IQAA 2VR9A 4K3DH 3UZQA 3FFCB 4CL7A 1MCSA 3PNWA 5B3NA 3U9PH 4Z7WA 5FKAB 2UWEB 2EDBA 4K9EC 3CSGA 4PB0L 4P4KC 5GS0H 3P4OB 4NC2B 4PRDA 5E9DB 1IC4H 5KSBF 4QRRE 4M7LH 4X99B 5I2IA 2EXWD 3JV4B 2R69H 3HC0B 4TUOB 1DQLH 4EDWH 3UYOD 2Q3AA 2I24N 4Z8FH 5MEPA 5DUPH 4WEMB 4P3WA 4R4ND 1IQDA 4ZS6C 4HS3B 4U1GB 4JQVA 5AZ2H 5FK9A 3WS3B 5CSGA 5ITFA 1UM5H 1F4WH 2FSEA 1JNLL 1JWUA 4CMMB 4M1DH 5DJXA 1F3DH 1LK2A 2CLZA 3RY4A 4Z7WE 4KTDH 1TQBC 4N68A 1QQDB 4DK3A 5D5MB 2AEIT 4GKNA 2VZVA 3ARUA 1AHWA 4LDEB 4WV1C 3NZ8A 2OX5A 3DNKA 4EN3C 3SJVD 2VITB 2CIKA 5FM5O 2CLVA 3IFLH 5EO1B 1TJIH 2ITCA 1MCWW 4PJGF 4R26H 1UJ3A 3GNML 3QP3A 3WDJA 1VADA 2DLIA 3RU8L 4Q9RL 3TN0B 3MMEA 4XZUB 5ELIA 2A1WL 1YJDH 4NRYA 2P5WB 2IADA 4MDJA 5CLTA 4MD0A 4FQ1H 1YNLL 2IGFH 4E5XA 2VZTA 1RJCA 5E4EB 4DKFL 3MROB 2BSRA 3OKDA 1FFOB 1U3YA 2H2PC 5FM8A 3FQNA 4P57A 3GRWH 5D96B 3VH8A 4DN3H 2OL3L 3EOBA 4X6EA 2EH8L 2P44B 4XPAH 3QUXB 4O2CA 1RZJC 4M6NL 1RHFA 4W6XB 5C0AA 1RJLA 2GY7B 2XZCL 1NDMA 1A3QA 3DVNB 1KBGL 1V7ML 5DS8A 4JM4L 3VRLE 1ITCA 1IAIL 2LFGA 1XF4B 2SEBB 4ZO6A 2GTZA 2PTTB 4MJ5B 2E7BA 1T2XA 1PJ9A 3H7LA 5I1HL 2OR8A 5FYLH 3JWDC 1HXMA 1AD9B 3MOAH 4RAVA 2ERJB 2AJ3A 5DT1H 1T80A 1JZ2A 4S1SL 3M1BA 5EWIL 3KYNA 1CF8L 1H5BA 4EDXA 1QVOB 3TO4D 2Y4SA 2DYPA 3HZVB 1WBZB 5F3HB 5HYSB 5K33A 3BZ4B 3KPOB 5C0AE 4P9HC 2D7QA 4Z95H 2PXYC 5T1KD 1A6PA 5HHVH 4BFEA 3GFUA 3BQUD 1CFVL 4D9QE 2XTJE 1UEMA 1MAMH 1MELA 4GO6B 1UWGL 2HT2D 3KPLB 3C08H 4M7ZC 4N8VA 2YUXA 2Z31B 1Q0XH 5FB8B 5IMOA 2ADFL 4MQSB 3P40A 2DQIL 4MQXC 1AGDB 3BH8B 4MJIA 4OGXH 2Z91B 2AJVH 1FFQA 3ZYJA 1DR9A 5D4QA 4XC3L 4KMLB 1A9BB 1I1FA 3IDGB 5C0BA 2F53D 1F11A 3BZFB 4XBPB 1TJGH 2PCPA 1ES0A 3NCFB 4R0LC 3UTTA 4LPXA 3CDGB 1XGQB 4MD4B 1NEZA 3ES6A 4LBEA 1QA9A 2RR3A 3TGXA 3BGAA 4NJ9L 1DDHA 4MNHB 5JA9A 3P73B 3VFOB 4L1HA 1SBSL 1W8NA 4R7DA 1XMWA 4P23A 3BP5B 4MJIE 2ICWB 1TVBA 3ULVC 4KK8C 1PBYA 5TQ0L 5IQ9A 3FB8A 5C0BE 1VHPA 3RJQB 4PJXA 5BRZE 4H1LH 1A6VL 1S7RB 4NWUH 3DROA 4ZFOA 3FO1A 1D6EA 3UTTE 3B8SA 1FZMA 3DXAD 4G7YL 4GRWE 4HKXB 5KVFH 3O41B 1RJYA 2X4RA 4UILH 3JBG7 3QO1B 5DMIL 1U8QA 2AERT 3PP4H 2R23A 4I3GA 3MLPA 4F7PB 5JXEC 2HMIC 2IPKA 3GB7A 4L5FH 4X98A 3WL9A 3EGSA 1QNZL 3UYPA 2FGWL 4KRNA 1PG7H 1UKSA 4OQTH 4P3DA 5JHDB 4MA3A 2NY1C 2V5SA 4NQVB 2QL1A 4X6FA 4MZ2A 4P59H 4WW1A 5IBUB 4YAQA 5I0ZA 2VUYA 2BP3A 2GI7A 3VGAC 5HI4C 4PJXE 2BNRE 1MIEL 3C6LB 1OB1A 1W0VA 1U3HC 1Q1JH 3CX2A 43C9A 1R0AH 5T3XD 3B9EA 3P30H 4JN2B 3OKNB 3HUJF 4P4RA 5FAAA 1Q9KA 1AO7D 5I1AA 3CXHK 1MHHB 3CFCL 3GHEL 1S5IH 2M26A 4P9HL 3V5HA 4AQ1B 2VLJD 2OTUA 1MJ7H 2AJYL 3VXNA 3WV0A 3WLWC 4KJYB 1UZ8A 4KMQA 5E7FA 5FV1L 3T0XA 4L29B 4PV8A 4FXGA 4XNUL 4PV9A 3W11D 4HZLA 1MCPL 3VDBA 3FT3A 2OZ4H 2PW2A 2DQGH 4Z5RA 1AXSB 1QLRA 3L5XH 5EC1B 1JI1A 4XMLL 4NUGL 2LAAA 3CFEB 4RA3A 1DBMH 4GW4B 4LEXL 3NMEA 4XMPL 4DN4L 1KIQB 2HKHL 5I1DB 5HDBE 2BNUB 3RGVB 3O9WA 3VD7A 1A9EB 3EOAB 3JV5A 4E41B 1IQWL 3FT2A 1KJMB 4PJ8D 4OI7A 1S7WA 2VDNL 3C87A 2X4QA 3EW3B 1MJUH 3CFJB 4HQQL 7FABH 5ACZB 1T04B 4X8JB 2FR4A 3WXVL 5GGSY 4Z78A 1NUNB 5DJ0B 3V5DA 4KGLA 1J0IA 3NIGE 4G6KL 2ARJB 3D85A 1FLTX 3K3QA 5ESVA 5D7KD 3DSFL 4LSQH 4NO3B 5KN5A 4KV5F 2FJHB 1QYGL 2APFA 2L7UA 3KYAA 2Z93B 1RVFH 2E5EA 3LHPH 4ZUWB 1FL5A 3QIBA 2D03H 1AY1H 4Y2DA 4JHWH 1NC2A 5HHMB 1FO0L 4QTHA 2F8XC 1M1SA 3WNLA 4OF6A 2AXJA 3ARRA 2VZ3A 3LKPB 3LKRA 3EFFA 5K93A 5JPMA 4LGRB 3LIZH 4KTEL 1N59B 1A7NH 3ARDC 2H6PA 1EMTH 2H3NA 4LU5L 4CVXB 4OZFB 1MNUL 4KKBD 1U92A 5D6DA 3IFNL 4EI5C 1T7WA 2AP2A 1IEAA 2BHZA 4G8GE 4HWBA 1BBDL 2ICEB 1U8IA 5GS2H 1KTRL 3QNZB 2WBWB 4OKDA 3UJIL 3P0VH 3ZKND 5CEZL 4FQXD 3C5JB 4R2GD 5E08H 1R3JB 4R4FH 3HZKB 3ROOB 3I3DA 3HI6L 4RWYH 4BZYA 5F7EL 4EQ3A 3UEZA 1N26A 4EBQH 3CSYB 4AEIL 3O3UN 4KDTC 1NUFA 3MV8B 4C56B 4F2MB 1YQVL 5E00A 4L8DB 4R3SA 1K9TA 1KCSH 5IFHH 3CLEL 5BV7B 1LO2L 1YNKL 4S1DC 1VKXB 1YMMD 4WHTB 1KEMH 3QDGE 1TLKA 2QHRH 4L3CB 2IANB 4U1LA 4J3UA 2PN5A 3WJLC 5CZVL 4LDLB 1FH5L 4FQLL 1F6FB 1EBPA 4JQXA 2YMXH 4XMKH 1ZGLM 1PY4A 5C2BL 5GXBB 3VA6A 1KIUA 5FHAL 3VXSB 3NPZB 3WS6C 1ZLVH 4WUUB 4WY7L 5E1AB 3G5YA 4S10A 4RGOH 2Y7QA 3MNZB 1V05A 1WLHA 3S7GA 3U7YH 2FH6A 2AJZB 1TQCB 3C8DA 5HVWA 2D7NA 4P2RD 3G6JA 3VXPB 4L8CB 5GRJL 4X5WB 3OQ3B 1ZA6B 5CJXA 1H9VA 1DQJA 4QHLB 3TWCL 4L4TA 1G6RH 1VCAA 4YX2L 2EKJA 4TVSa 1MFBL 1N7MH 4YHZL 4KY1H 3ALXA 3FTGA 2WMPA 1C5BL 4RGMB 4PJDF 4N0FA 5L9DL 1ERNA 1P6AB 3H6JA 5DFVC 3TBWB 2EYTB 2VISA 3HPJA 4B5EA 1CLCA 3FB6A 5D7LD 1T21B 4HFWB 3T4AB 3VFWA 1NGYA 5C0NC 1EZVY 1QBML 1BIHA 1LO5B 4QWWC 3G6JE 5D71L 3RWJA 5EUKA 1I4FB 3BGFC 3VFVB 3HZMA 2JB6A 3MLXL 5IB5A 1SYVB 5EDXA 2UVFA 5KSBA 1FPTL 1K2DB 4FA8A 4YC2B 4K71B 4U7KA 1JMXA 3RY6A 5KOMC 2GJ6A 1KCVH 3RNQB 4YBHA 1FNHA 2X4SB 2Y5EA 3FMGH 2FATL 5CSBA 1PSKH 3S36X 3O3EA 4WU5A 3KDMB 4PJIB 4HS6A 2DMCA 1B4JH 4PGJA 2E27H 4ODUB 2R2EA 3C9NA 3R0NA 2WANA 3BZEB 4POYA 3NH7L 5AZEL 1ETZA 4ZYKA 1YEGL 4U0QB 4K55A 1QSEE 5CKAA 2RCSH 1EBAA 2FHFA 2J88H 3QIUA 5E1HB 4JJ5B 3WFDL 1EHXA 5CMAA 2XQYK 4UDUB 3L3GA 1XZ0A 5DD3L 2BSTA 3UJTH 4GAGH 1CT8B 1AR1C 1BZ9B 2VQUA 5DD0H 2VXUL 1AFVL 2BC4A 4I3SH 5KSBE 4OBSA 1ZAGA 3SDXF 2BHUA 1ADQL 2GJ6E 4YEFA 4J3OC 1I8MA 3VFGH 4RRPG 1J12A 1UG9A 5FYJD 4JQIH 2R0LH 2A6IA 2QBWA 3EKCA 2DLTA 4HSQA 2UV3A 1NL0L 3KPRA 4WO4C 4C55A 3RL2A 5F7DA 4KROB 2NTFB 3Q6GL 1NFDF 1K5NA 4WHCA 1FQ9C 4DTGL 3SCMB 4MNGB 1XR9B 3IAPA 4Y16A 4DQOH 1EEZA 4IRJC 5MEND 3LKNA 1L7IH 3BN9C 5I8KL 5LWYL 3L5JA 4PRHD 4JFED 4HPOL 2UUDH 1JRHH 1G9MH 4B0MM 1EEYA 2X44D 4NQCB 1LO4L 1WBYB 1FVEB 4U1KB 1OAYL 1RFDH 3LQZA 3MLYH 5D93B 4U1IA 4PP2B 1N64L 3VGDA 2V2TA 3KPRE 1I3GH 4PLJC 4LQ1A 4LVHB 3RJDA 1S7TA 4RBPH 3RIAF 3TCLB 3WIFB 1BHGA 5CJQL 5CJ5A 4RQQA 5F7HA 4H1LB 2DQUL 3DX6B 1L0XA 5DDHB 3T0EB 1N0XL 2ATKB 3GSWA 4JPVH 1J86A 3FONB 3QA3B 4K2UH 4N1EA 3FCTB 4N9OB 1UB5B 4HV8A 2B1HH 5DJ8B 5C9KA 1SEBB 1IGYA 3FKUS 5KS9B 4QGTA 2DTML 1RPQA 3SKOA 4NZDA 5EU7E 4WFGE 1A4JB 3TBTA 3CDCA 1P4BL 3MRGA 5FA3A 1BVLA 3OAZK 3ETBF 5A3ID 3O3AA 3VWJB 3ARBB 3H9YA 3WO4C 1P4IL 2FIKA 2XN9D 5GS1C 3VD3A 5JDSB 4NQEE 2JJTC 3BX7C 1BIIA 1OGAB 2NXZB 2R0WL 4OZHF 1U58B 4LPYA 5GRUL 3VW3L 5E2VL 1W8OA 4JZJC 3MGAA 1T2JA 3QZWG 4FQQB 1YEHL 4NCC2 5IBTH 2R8SL 2WWKT 1P1ZB 3V4UH 4WV1A 1MRDH 2VLRA 3O6LH 1KCRH 4XPBH 4EN3A 2MCPH 5C07A 4FTVD 3PABB 4HIEB 3ULUF 4MCYA 1L6XA 4TULL 1RUAL 3AMLA 4FFZL 5H37H 4G9DA 1KG0A 2VKWA 4AL8H 3GMLA 5JPNB 1JZ6A 3WMSA 1PAMA 1MY5A 25C8L 5HYJE 3H7BB 4V1DD 3VXQB 3T08A 2DLFH 4LGPB 1FC2D 1MLBB 5D1XD 5DMGD 4KK5C 4QHNA 5B38G 4X6BA 2Y25A 4WI5A 2J3SA 5EU5B 2AV1A 2VLRE 2E9JA 2NY2B 5C07E 4OD1L 3LS5H 1VFBB 2Z8VC 4JANA 4ONGH 3GM8A 4FOMA 3BPLC 4M7JL 3ILQD 4Y19D 3TPUA 1JFQL 3C2AL 1HWGB 1JTTA 1PKQB 3TA3D 4HLZH 5LVEA 2NZIA 5DQDH 4MQ7B 3AS0A 4JLRB 5EUOB 1H15B 1KCKA 3MGTB 4XAWH 4OKVB 1FORH 4OAWB 3ARQA 2ATPA 3GJFA 2DQEH 2H45A 2CRMA 2YOCA 5KG9A 2HLAB 3V6FB 1T66C 1HYSC 1ZHLA 1YN7A 1WC7A 3KPMB 4M1CD 5ANME 2ESVA 3PV6B 3F7YB 4XVUC 5FOBA 5C0EB 4HKBB 5I76B 1AR2A 2BRQA 3S35X 4WHYH 3H0TA 1JE6A 1MUJA 2PXYA 3KPNA 4MAYA 5DMYA 3RHWK 2B20A 3HUJA 1W0YT 4OLWL 4XPHL 2GAZA 1T83A 1O0VA 4EIGB 1DBKL 2NW3B 5HHNB 1I1AA 2QKIB 3HS0B 4C4KT 5C0RL 4PJCA 1WQVT 1UB6A 1IAIM 2J4WL 3M17B 4M48H 2QQNH 4KKLD 1J0KA 5D2LB 1MREH 5T5NF 5K59E 2DKUA 2V9QA 2ESVE 4MNQB 3SBWA 4DOHB 1YEFL 4NPYB 4NN6B 1INDL 2X70B 4D9LL 3EJZD 2DQHL 3U4AA 5BJTA 3TVMD 1KIRA 2Q7NA 3OV6A 4LDOB 5F93C 3SDAB 2BNQA 1MAJA 4R0LA 5J1SC 5KTEH 1ZHKB 4H5SA 4LF3A 1GSMA 4Y4FC 1XGTB 1FBIH 5DJYA 2DKMA 5I17B 1OL0A 5TH2A 4YHPA 3BEVA 4PJCE 3W0WB 3FL7A 5JIIA 2ZZUT 4XPTH 3VXUA 4LLYA 4X7TB 4XX1E 3QFJB 4LRNH 1M7IA 3OB0K 4ZAKC 1DBJL 1Q9WA 3AAZB 4Z0XA 4FQHA 3R1GH 4NKQB 4U1MB 4Y4KC 5KW9L 4WUKH 1IAKB 2BNQE 3D9AL 5MI0B 4YDIH 2AS5M 2W0KA 2PYED 5AYUH 1T20B 1S7UA 5B8CB 5DJZB 3KPSA 1IGJB 4WU7A 3BAEL 4FFVC 3A0OA 4HH9B 5I8OL 3HFMH 3FT4A 4OD2B 2CK0H 1QEWA 1A7RL 1QR4A 3V79C 2VDKH 4PGDA 5GIRA 5C08E 3NCYS 4GAFB 5DRXB 5A2FA 2ZG1A 4WENB 2CGRL 2W9DH 5FO7A 3VXUE 5FYKL 3GDBA 3O4LB 3ULVE 4R97C 3DRQB 1EO5A 1HE7A 1G6RB 1C12B 1IT9L 1I9IL 1PZ5B 2G60H 2ILLA 4OGAD 1FZKA 3RZCB 4PIRF 4CW1B 5IMLB 3MCG1 3EIFA 4Z7VB 5IFJA 5AUMB 4GXVL 5C09B 3S36H 1IL1A 3MJ9L 1I7TA 1SJHB 1J8HB 4K23L 4L4VD 2VL4A 2WP3T 4CVZB 1SJEA 5AAWA 4XCCH 4ZS7L 5I74B 3X13A 3OJDB 4H88H 3RDTA 3HC4H 4BA8A 3MRQA 3KPSE 4DJMA 5EU3B 1E6JL 2HG5A 1KJVA 2Y72A 3GMMA 5CUSL 1UGNA 2EECA 3F58L 1WAAF 3WFZA 3BT2L 1J87A 4TQEL 2BOCA 4GRWH 1WWWX 4H25B 2C3VB 4LLDB 4YHIB 5FGBC 5E94A 3TZVC 4Y4HB 3CVHA 3LPFA 4NO2B 3QDMD 1FG2A 2Z8RA 3G6AB 4Z77A 4TTDC 4I9WD 1X4YA 3QEGL 3BKYL 1IJ9A 5DRZA 3GHBL 3DTXA 4NQDD 4Z0BL 1FYTB 5SWZB 4MXQD 3SE9H 3VXRD 3KNBA 4P2OA 5CEZE 3VDAA 1IGTB 3UTSA 1OAQL 2W59A 1OHQA 1RZIA 2P8LB 1IM9A 4OCRL 3EDDA 3L95A 3O8XD 4PTTB 1X44A 5TF0A 2IH1A 4MS8D 1WFNA 3FO2A 2ZUTA 3HZYA 1EH9A 3T1FB 1RU9L 4HJ0D 1DQDL 1LP9F 1ZS8B 5HGBA 3I50H 5GJTH 2I9LA 4K94H 3ZYIA 4DUXA 4NYLA 1JWSB 5DLML 3MREA 4AIXA 3MV11 4JRYD 2BCKB 1FGNL 4XP6L 3UTSE 3MRNB 4TN9A 1J5OH 5F9JA 3CH1B 1UM4H 5DYOB 2Q76A 4NRZB 3PWNB 4PJDA 3FZUC 2Y6SC 2DLGA 3PWVB 2N56A 4PRNB 4KKCD 3S8WA 1KV3A 3MZGB 4XNXL 1ODAA 4BH7B 4LCUA 4NKIL 3GMQA 3VXMD 2VMFA 1IKFL 4WEUD 4P5KA 1A5FL 3RIFK 1KPRB 3HG1B 3N9GH 4ISVA 4JFYA 1FL3B 4RFEA 4XCFH 4Q6IC 3U36B 4D9RD 5I30L 3O3DA 2F74A 5HGDA 1WGOA 5GGTL 3N85H 3ARDA 2C7UB 1VDGA 2AXGA 4QY8A 2V17L 3IFPA 4ZUTB 1NAKH 1JUFB 4OGZA 4EI5A 3TPKA 4CVWA 1A6AA 1F3JA 1G1YA 4RX4D 3B9KB 2DMBA 3RPKA 2D7PA 5IT2L 3I02A 3TO4C 2DMKA 5DI8B 2DTSA 1TJHH 2ZUQB 3LQAC 1CFSB 1JCKA 2I07A 4LCCC 4N9GB 2AJSL 4KDTA 3KJ6H 4KGJA 3JWOC 4FQIH 4JKPL 3E8UH 4YHKL 3PL6A 2R4RL 3FOLA 1GVIA 1T0PB 3QCUL 5E8PB 2WUCL 3DUUA 2XA3A 1A22B 1ZVSB 2MKLC 5F7KC 4HDIB 5IGXH 2VDQH 3SDXA 3WBDA 5EBMA 1FV1A 4BFGA 2D0GA 1NCWL 4O02L 1EFXB 3JTSB 2DJUA 2IAMD 1FFPB 4BQCA 3QUML 1BZ7A 5CINH 4JDZB 4AM0B 5T5FH 3DX8A 1S5HA 1DUYA 4I1NB 2A6DB 3KXFD 1NFDA 4DZBB 3S4SA 1A6ZB 2O61A 2ED8A 3NZHH 3OSKA 3IDXL 3PHOB 1M05B 1N6VA 1U8JB 1KT2B 2I9TA 1RZKH 2BVOA 5JOEA 5IVXA 5E8OA 5I75B 4M6OH 3B9VA 3MRMB 4KI5D 3SDXE 4QRRB 4YXHL 5I19H 3MOBH 3EDJA 1RURH 4M5ZL 4LSTL 3BW9A 1RK0B 5A2IH 1KTDA 4W4OC 4IRZL 1P7QD 4HKZB 2V5YA 1D9KB 3NA9L 4JCMA 4OFIA 1QD0A 1S9YA 1W0WB 1OAXL 2BY2A 2QADB 2XNAA 4HWBH 2WW8A 4KZEL 4WCYL 3MV9B 2NPLX 3TN0C 4QCIB 4KMTH 1QSVA 1NFDE 1T0MA 3A6OA 3LPGA 3S35H 5CJOH 2DJ4A 3IGAA 2NX5D 4DKDC 1OT2A 1HHJB 3BD5A 5E4EC 4S0SD 1P7HL 3PNWB 1JHKL 4Z7WB 1XH3A 3QDJB 4I0KA 1Z9OA 5IVXE 4YGVA 3UAJD 2CO6B 2YA0A 3HI1A 4M8QA 2GUOB 5DEFA 4PRDB 3PQYD 5I15H 5I2IB 4H8WC 3QUXC 3JZ7A 4YE4H 4E42A 4AY0A 4P46B 1TTUA 1X5GA 3GI8H 3V6OC 2ZJSH 4WFHD 4TVPL 5MEPB 2D4FA 5I18L 1NCAH 1S9KC 5IQ7L 1W72L 4LAQL 3PWPD 2I5YL 4X9FA 5FK9B 1S9VA 3OGOE 5JR1H 5LGKA 4CU6A 5F9WB 1UKTA 5HD8C 2FSEB 1JWUB 2X4UA 2I60L 5D1QD 2ERJC 1FCGA 2J5LC 5DJXB 5HHOA 1JPTL 1LK2B 3LQAL 2DLEA 3AXLA 4X6DF 4GKNB 4OI9A 3JWOL 1AHWB 3NZ8B 3IDIA 4XI5D 3Q1SH 4DFIA 4EI6A 2EDHA 1DANU 1BX2A 1UJ3B 1VPOH 3VI4F 1VADB 5CKGA 1YYMH 4EXKA 2MPAL 1RSFA 1YZZA 4NRYB 3H9ZA 3MO1A 2IADB 4MDJB 4PFEA 4MD0B 3BEWA 1B6UA 4E5XB 2RFXA 4IRJA 2BSRB 3WNNA 1JPFA 3OKDB 5IEKB 3EDEA 3FQNB 4P57B 4RISL 4R4BA 3INUL 4JZOA 1FLRL 1I85C 1KELH 4UZGA 3VH8B 4X6EB 3EOBB 1JHTB 2GITA 4AG4H 3WSQL 1IEHA 4O2CB 1KB5A 4PJAF 5F1NA 5C0AB 1RJLB 4BSJA 2NR6D 3OXSA 1NDMB 5SX5K 2YPKB 5DS8B 3NACL 4RNRA 4AQOA 2PTVA 1UVQA 3H3PH 2IBBA 1X3DA 2ZG3A 5I1GH 3ZTNH 1ZEAH 2GTZB 1T1XA 1GGTA 2NY7L 3TO2A 4RAVB 1FVDA 3CFDB 1XT5A 2EE2A 2AJ3B 2E7LA 2VABA 4O9HL 2EC8A 4HCRA 3KYNB 3WNMA 1ZA3A 1H5BB 1F00I 4EDXB 4NGHL 2VLKD 4NM4H 1HQRB 1F4AA 1DTUA 5KVMC 3ZKMC 5EORH 1J0JA 4F80A 4XBGA 5DJ2A 5KVEH 3VI3F 3L5WA 2CR3A 5CP7B 1I1YA 1HIMH 2GFBA 1FFNA 4N8VB 2DJSA 4XVSL 5GS1A 5F7MC 5C71A 3ORJA 1CICC 2JJTA 4YDVA 5DD1H 3WIHL 3ZT5A 3OF6A 3MLVH 4LHUG 5EBWB 2F58L 2JB5L 1FVCA 2DDQL 4JZJA 4NJAL 1DUZA 4Y2OA 1I1FB 3ARZA 5C0BB 4F58H 4P2CG 1F11B 4N1HB 1MCCA 3O6FC 3VFNB 3H9SA 2AQ2A 3DVGA 3K2UL 2PCPB 2LU7A 1ES0B 2XICA 4OCWH 4FZEH 1I9EA 3MLSL 3U82B 2X10A 1P5UA 2VE6B 3UTTB 4GRWB 3NABL 1KXTB 1OTSD 3SO3B 1XAUA 1NLBH 1NEZB 3BMVA 1N6UA 1J9CT 3ES6B 1QA9B 4LBEB 1MWAL 2HKFH 2ZSWA 5F6HI 1DDHB 4APQD 1TVHA 1BOGA 1YY8A 2OR7A 4R7DB 1TZGH 2HFTA 4P23B 15C8L 3L6FB 1TVBB 2NY6B 3PWUA 3FQUA 5IB3A 1PQZA 3GK8L 5J7CC 2JIXA 1T5WA 4XCEB 4NP4H 1C7SA 5IQ9B 3FB8B 3G6DH 4PJXB 3QHZL 3H9SE 3DROB 4ZFOB 4K9EH 1F4XH 3FO1B 3RWDA 3O2DA 5F8QC 4G43A 2WBJD 3QJHA 4YO0A 3RL1B 1FZMB 3ZKQD 4LSPH 1RJYB 5HPOA 3EJYD 2X4RB 5JOFA 3MJ8B 4GBXB 1U8QB 3UBXA 1KENH 2R23B 1GPOH 5KANG 3RVXD 1MCOH 3VGBA 3GB7B 2IPKB 3QPXL 4X98B 3T3ME 3WL9B 3UMTA 3EGSB 1A2YA 4P3DB 2P5ED 2PR4H 1LVEA 4LPUA 4MA3B 3ALPA 4Y1AB 4PJ9B 3O2WH 3WHE0 4X6FB 4YAQB 4WW1B 3RKDC 2LE9A 3U7AA 3MUHL 1C5DB 1KIPB 1PEZA 1WCQA 3TV3L 1AJ7L 1OB1B 1W0VB 2K1MA 43C9B 4LHQB 5HYQB 1RUPL 5IESH 1CGSH 1CGUA 4FZ8H 4P4RB 3RHWF 4GMTL 3X3FH 1Q9KB 4NNXA 5I1AB 4HF5L 4R8WL 4OF0A 4YHOH 3WKNA 1FE8H 1RMFH 1E6OH 3GSUA 4UINL 3V5HB 1ZTXH 1XGRA 1UCTA 4D3CH 1M7DA 1XGUB 1IEBA 1KGCD 3I6LD 3VXNB 1Q72H 4JHAH 1UZ8B 4U3XA 4ONFL 1BQHA 1PW3A 4PBXA 2E8YA 5KSAD 3BJ91 4PV8B 4OSUH 4FXGB 4PV9B 1EDQA 2P8PA 1AQDA 2UY7A 4Z5RB 3GMNB 3VRIA 5HYEA 4HUUA 2XOTA 4M93B 1RZJH 3PDDA 5F88A 4F33A 4ONOA 4BFBD 4JKWA 3CPLA 1BGXL 1E4XH 4KVCH 4EKXA 4DWHA 2LU4A 1IKNC 2I26N 4MHHI 2EDJA 4NHUB 3FRUB 3U4EA 2BDNL 3AUVA 5IMMA 4IOSD 1P2CA 4I48A 2A0LD 2EXYD 4JY6A 3L3JA 2X4QB 3MLZL 1E4JA 1SEQL 4IOFD 4PREA 4OZGF 4ZAKA 5GGUA 1LP9A 3B5TA 3JWDH 1D5IL 5HY9A 3GJFH 3W5MA 3OKKA 2FR4B 1HOCA 3DPBA 4Y4KA 2BZDA 5GS0C 4Z78B 5E8NA 3RX8A 3DO3A 4BH8A 3VFMA 1ZANL 3UJJL 3U30C 5L8KB 1XGYH 4OLZH 3U1SH 3D85B 2X89D 5BV7C 5ESVB 2VDPL 1JP5A 1IZJA 3CMOL 4XAKE 1WZ1H 4DUVA 3LKQA 4FFWD 4X6CA 4PRID 4XPGL 1FL5B 1SBBA 2VDLL 3KPTA 1F42A 1EUTA 4ZD3H 3QIBB 2GJZA 4LASL 2R4SL 4Y2DB 3QI9A 5DUMH 1NC2B 5JHDD 1VB9A 1PFCA 4QTHB 3CZFA 4UT7L 1T5XA 32C2B 4XRCA 2B0SH 2K3TA 3DO7A 1DL7L 4CNIA 3TT1H 3LKRB 1TQCC 5IVZA 1A6WL 3EFFB 4NBZB 5JPMB 1A7PL 3S5LB 4PJ7F 1GC1H 2H6PB 3C8HA 1CR9H 1CL7I 2BJMH 2H3NB 4PJFA 1U92B 2YD7A 4YHML 1JGLH 3DUSA 3PP3K 1NGQL 2AJUH 1IEAB 2VXQH 2C3HA 4RGMC 4Y5VA 1U8IB 4X6CE 5GGQL 3UC0H 3KYOA 4PJ5B 1YJDC 3GGWA 2J2ZA 5IV2A 1UYWL 1KJ2L 3M45A 3GMRA 3TZVA 2IG2H 1FNGA 2VN7A 3MLWH 4HUMB 3P0YH 4LIQL 1XCTA 4GSDH 3IFOA 2CUMA 3ZT6A 4PP1C 1ZOXA 1N4XL 3ULVH 5E00B 1Z2KA 2KQMA 1H3UA 3QUMA 3CDFA 3D39B 4R3SB 4S0TD 4PJFE 5SWSD 1EAPA 1A1MA 2QR0A 3FN3A 5TE4H 1MI5E 4U1LB 3GKZA 3MBED 3L1OL 3DRTB 3UYRL 4YC2C 5TE7H 4K71C 5D7SL 4OCSH 1K8DA 4M62H 5H8DA 2R2BA 1BQLL 4OJFL 5ISZE 4E41D 3QCTH 3G5YB 4RFOL 5M7QA 2Y7QB 1G7JA 4JPWL 1Z9SA 4JE4B 1D6VH 4FFYH 3SJVA 3E2HC 2P7TA 2V5MA 4ETYA 2YRPA 4ZTPL 5K9OA 3HNSH 3G6JB 4OGYH 4RCAA 1CU4H 2P8MA 3EYUL 1YY9C 4MCZB 4N90D 4IEFB 5TFSL 4K8RD 4K3DL 1QR1A 4L9LA 1I7ZA 1T7ZA 4L4TB 3JUZA 3U9PL 1KLGA 2YD5A 1CXLA 3FTGB 4KQ3L 3NN8A 1Z5LB 1YQ2A 4N0FB 5GS0L 2R2HA 4IOIB 3ZE2E 4PR5A 4M7LL 3L5HA 4RMUA 2R69L 2CSPA 1DQLL 4EDWL 3FB6B 2QSTA 4Z8FL 3H9HA 3BUTA 4JRXE 4JVPA 5DUPL 4LEOA 3WE6A 4WDIA 3VFWB 1NGYB 4OB5H 4G5ZH 1QBLH 2R1XB 5MERA 1N6QH 3RIFF 4Q6IA 1MRCH 5AZ2L 1XF3A 4KROC 1H3XA 5KSVA 3RWJB 3SCMC 3PGCA 2PO6D 1F4WL 5EUKB 3VU2A 3HZMB 3UPRA 1JZ3A 2NY4B 2JB6B 3QULA 3CVHH 5IB5B 4M1DL 3WLBA 4MMZC 3ZKXB 3DIFA 5FECA 5KSBB 3RI5K 4XWGH 5I1IH 5CILH 3WFHA 1QFHA 4ZFGL 2GJ6B 5ID0A 4V2CB 1QFWH 3TO4A 3CK0H 4N5EC 2QV2A 3O3EB 4I77H 4WU5B 3MBXH 1A7BA 4HS6B 2CO7B 5D93C 2R2EB 3IFLL 3PWLA 2FD6H 3IDNB 1V3KA 4LCCA 1AGCA 1ETZB 1NCCH 1HKFA 4I0PD 4OCLC 5F7LB 2HN7B 3HB3D 1YJDL 4LVHC 5F70A 1MIMH 4X80H 1EK3A 4FQ1L 2IGFL 3QIUB 4QGYA 1QRNB 3TEUA 2WLYA 5CMAB 4LMQE 2Q86A 2UWEA 4TVPE 5I1EH 4PJEF 1T89C 3N0PB 3GRWL 2BC4B 4X6DA 5DURD 4PS4H 5E9DA 4DN3L 4MXVF 4TUOA 4XPAL 3UTQA 5EZIH 4NO5B 1I8MB 1UA6H 1FJ1A 5DEGA 6CGTA 4PJGB 1WWCA 1XGPA 3HRZA 4AMKH 2A6IB 4HS3A 4GG6F 1KN2H 3RL2B 3GUTA 1HH9A 1K5NB 3ARBC 2OTPA 4Y16B 1EEZB 4HMDA 3FFCE 5FYLL 3MOAL 5DJAA 3SE4C 1ZKAA 4RSVA 2UWEE 4U3CA 2VH5H 5DT1L 4NDMB 2JELH 3BVNB 4WNQB 4N0CD 4PJAA 4OLEA 5E9DE 1EEYB 1S9XB 4Q2ZA 1ZLUK 3HMWH 1MCBA 4PGBA 3LQZB 4J3WA 1JF5A 4U1IB 4Z95L 3VI4E 3D18A 1NQBA 1CD0A 3TN0A 5HHVL 4YPGA 1WZKA 2V2TB 2DBLH 3LEYH 2D9CA 5BOPA 1MAML 1S7TB 4YHYC 2BVPB 3MROA 2O93L 4RQQB 3C08L 5E6ID 5I1JH 1Q0XL 1K4DA 3GSWB 5F96H 3V0VA 4OGXL 4XC1H 1MSPA 4HV8B 2AJVL 3IDUA 1OW0C 5D5ME 1IGYB 4ERSH 2E7MA 3MRLA 1TJGL 3DVNA 3BYTA 3MRGB 3V4PH 5FA3B 1BVLB 2SEBA 3O3AB 3BIKA 5CZKA 1IC7H 2P5WE 1AXIB 2X5PA 5EOCH 1BFVH 2NXYD 1BIIB 1Y18B 4YH6A 1M71A 4IS6B 1A3RH 1NBVH 1U8HA 4U1NA 3RP1A 4X4ZA 1P4LB 4HAGA 2C26A 1FRGH 4OFPA 4WV1B 2VLRB 2UYLA 3KPOA 3VWKD 4XB7A 5C07B 2RIKA 3OXRB 4IJ3B 1BFSA 4MCYB 3QAZB 3V6OE 4PY8I 1C8PA 1ZVHA 4NWUL 1GGBH 2VN4A 4G9DB 1X4XA 3JWNC 1FIEA 3C60D 4K3EH 5KVFL 3EOTH 1OQOA 3GMLB 2WINB 4UILL 4L9DA 2LTQB 1U91B 2ZUWA 3PP4L 2O5YH 4R9HA 3GI9H 4L5FL 5B39A 1AGDA 3UZVB 1I85A 3FHAA 1CQYA 3RUGF 4F7TA 5J06A 4C54A 1PG7L 4OQTL 4GH7B 2ENYA 4X6BB 1BQUA 4NN6C 3UTZB 4CRPA 3D2UA 4P59L 5IBLC 4YQXH 4BSVB 1SJXA 3EYOA 4JANB 4NQCD 3SDAC 3QWRD 4JFFD 1Q1JL 3TPUB 1R0AL 3CDGA 1FDLH 3P30L 4N0YH 2OJEA 3SQOH 1YNTA 2L0DA 2ATPB 3GJFB 3P73A 3VFOA 2VC2H 4Y8AA 4W6WB 5GZNC 1S5IL 3BDBA 4J2XA 1MEXH 1YN7B 3BP5A 3QRFM 3U0PA 2ICWA 1K3ZA 3T0ED 3TM6A 4EUPG 2ESVB 1MJ7L 4R90H 5FOBB 1AE6H 3T8XA 1F4HA 2YS4A 3H0TB 3K4DA 5F44A 1MUJB 2PXYB 5D7JC 3VA2C 3KPNB 4MAYB 3HUJB 2OZ4L 4ZFZA 3TIEB 2DQGL 3ET9F 4HKXA 2GAZB 3L5XL 3TC9A 1T1YA 1I1AB 3A6CH 5JZ7D 5B8CC 2FIRT 2GT9B 1DBML 2ADJA 1NPUA 5HGHB 1OTTC 2D7TH 1DBBH 1CICA 4KK9C 5BW7C 4PJCB 1UB6B 5F6HJ 3MCLH 3B2VH 3LB6C 2WK2A 2NXZD 3KR3H 4HUWA 1MJUL 3O6FA 3LCYA 3RZCC 7FABL 1KIRB 3V6ZA 2BNQB 4I4WB 4R0LB 1JZ5A 1GAFH 1KXQE 3LRGA 3FQRA 4H5SB 4G8EA 1X5FA 2WIMA 4LF3B 2D31B 4OM1H 5I74C 1KB5H 4FHBD 4C59B 5IB2B 5IW6A 3CLFH 4BSWA 1EERB 3GKWH 3S98A 5LXGH 4OUUA 4HGWB 4LSQL 4LKCA 4N8CH 3N50A 3DMMD 4M00A 2YEZA 5FGSA 4YHPB 3GMOA 3BEVB 2XY2A 4FN0A 3LHPL 4R96A 4WI7A 3VXUB 4LLYB 4OBRA 2YD8A 4ODHH 2D03L 3SDCB 4OZGA 1DCLA 4JHWL 3FRPA 3TLRA 1Y6NR 2P1YA 1M7IB 5E2UL 5E95B 1Q9WB 4Z0XB 1OTUC 3PUCA 3FFDA 3MJGX 3NGBB 4FQHB 4HFUH 2NY2D 1U8LA 1P7KA 1EXUB 3LIZL 4W4NA 1A7NL 3NCEB 3VGFA 1A0QL 1P84J 1R3IH 4P2RA 2YPLA 5BS0A 1S7UB 4NN5C 1EMTL 4GW4A 1U8OA 3KPSB 2QQKH 4WU7B 1TTGA 3K81A 3FT4B 1QEWB 5C7XH 2NY0C 2BNUA 4MWFA 1N3NA 5GIRB 1ZSDA 1TNNA 1QSFD 3P0VL 1EJOH 3MRCB 3TH2T 5E08L 1BM3H 4R4FL 4RWYL 3CC5A 1FZKB 3VGAB 4ZNEE 1PGRB 4M43H 4EBQL 5IFJB 3FQTA 4KPHL 4JCLA 1AQKH 3RWGA 4PJ7A 1I7TB 3T77B 2FNBA 1SJEB 1RK1A 4OTXH 3X13B 3RDTB 4P2RE 2YPLE 5BS0E 3MRQB 1KCSL 5IFHL 4PBVC 3QQ9C 3V52L 2HG5B 1KJVB 1KEML 1P84K 2QHRL 3GMMB 4QHUA 1MFCL 2XKSA 2Z93A 4L1DA 1AD0A 2YZ1A 2BOCB 2YMXL 2ZG2A 4XMKL 4KZDH 3EHBD 3KS0J 5EFIB 5E94B 5C0JA 4PRPB 2F19H 3CVHB 5LGHH 1FG2B 1XF1A 4RGOL 4Z77B 4BFIA 4MNQD 1F3DJ 1VENA 3U7YL 3WFEH 5DRZB 5HBBA 3RVWD 3J8F7 2KDGA 3S88H 3KNBB 1YEJH 4P2OB 1G9MC 1DSFH 1JK8A 2EZ0C 4QOKD 4Z7OF 3HE6D 3I6GB 4YIQA 3UTSB 4OZFA 4QXGH 1IM9B 3L95B 3PE9A 4HH8A 2ZUXA 3P4LA 5F9OH 3EO9H 3QO0A 1N7ML 2DL9A 1IKNA 4KY1L 3VGHA 2ICEA 2IH1B 3HZYB 2D0FA 5TQ2H 1D5BA 1FYHB 1UH4A 2CH8A 1XIWB 4XH2A 2DQCH 3L9RA 3VMOA 1E0OB 3BHBA 4XI5C 3QFJD 2O5ZH 1CCZA 1SJVA 4IMKC 3LV3A 5I1LB 2I9LB 4CN1A 4NYLB 4PJHA 3T3PF 3MREB 4P99A 3U4BH 2W60A 5CS7A 1WBXA 5CFHA 4XHQA 5GZOD 3GBNH 5F9JB 4WHTA 2Q76B 2YSSA 4WFEE 4PJDB 4GQ9H 2FCBA 4UTAH 3OKEA 5MENA 1A3LH 2YRLA 1AP2A 4WTZA 2XFXA 4A6YA 3BFOA 1KCVL 4LCUB 3GMQB 3FMGL 4KI5F 1C16A 2AQ3A 1PSKL 4P5KB 2W9EH 3PIQA 3ZE0E 2J7LA 3MNZA 3O4LD 5CHNA 1RUKH 5F1KC 1B4JL 4JFYB 2E27L 4RFEB 1YECH 2XG5A 3PJSA 3B6SB 4XNYH 5FYJE 2EIDA 3O3DB 4PJHE 2F74B 1OAUL 1ZA6A 3MV8E 5HGDB 4C56E 1FZJA 3F7VA 5LJYH 2AXGB 2RCSL 1MFAL 4QY8B 2J88L 1J8HD 3AMKA 3GIVA 2HTKD 4EI5B 5JIPA 4R6UA 1F3JB 4GAGL 3SPVA 5DD0L 3QIWC 4S1RH 4I3SL 1LD9A 3L3HA 2YXFA 4NT6A 4OLYH 3I02B 4BQ6A 1D9KC 4MSWA 3VFGL 1QHPA 3RVUD 1JPSH 4HFWA 3PWJB 4I0CC 4JQIL 2R0LL 4NZTH 3R8QA 3EO1A 4L3AA 1HI6A 1LO5A 2X9YA 3AB0C 2YD9A 4D2NA 4LOUD 2HTLC 2BXYA 3GSNA 4XTRD 2F54B 3PL6B 4PJEA 5F71A 4DQOL 3FOLB 3RX5A 3DUUB 5KZCB 1L7IL 2XN9A 4WW2F 3SDXB 4CDHA 1FV1B 5D7IF 1ZXQA 1G9ML 2AEWA 3BKCH 4P46C 2J8OA 4F3FA 4WFFE 1WK0A 4UDTA 1MH5A 5TPWL 3LPWA 1RFDL 4G6MH 3TP4A 4ODUA 4D0BA 3DX8B 4UBDD 5I16A 1S5HB 1DUYB 1HZHH 4FQ2H 4FTVA 3MRFA 4JQVC 2APTA 1NFDB 2O61B 3S4SB 1G84A 4KUZH 3PHSA 5F9WC 4G6FD 3DSNA 1I3GL 1IAMA 1P5VA 2I9TB 2BVOB 3MXVH 2MNUA 3OKOA 2W38A 3EYQC 4PJEE 5E8OB 4JFDD 1P69B 2VLME 2W9LA 3QPQD 2JCCA 1B88A 4JPVL 4V1DA 4QRPD 1AC6A 5BO1L 4K2UL 1AHWC 3BW9B 2B1HL 1WIUA 2X40A 1T6WA 2AABH 5D1XA 4X7CC 2RGSA 5DMJB 2F5BH 5FYLE 1PDKA 3ZE1E 3I6KA 1X5KA 4PJIE 3ARED 4WI9A 4WWKB 1S9YB 2FLBT 2XNAB 1UJ3C 4Y5YC 2HH0H 1U8PA 3D3VD 3OJVC 1T0MB 3KGRA 4Y19A 3Q5OA 2GSGA 1OGTA 4MNGA 2NY3C 3ELAT 5C70A 4ZPVB 3TA3A 1YEKH 4AENA 2Q8AL 1XH3B 1KXVC 4Q97A 3OWEA 4YGVB 1E28A 4KRPB 5EC2B 3Q0HA 3F62A 2XQBH 2JCCE 3THMH 4M8QB 3MUGA 5DEFB 1MQKH 5FM5M 3LZFH 3VRJA 5IBTL 5HSFA 3RI5F 3V4UL 5EOTA 5KVDH 4E42B 1S9WA 1MRDL 3O6LL 1NLDH 1KCRL 1UWXK 4XPBL 2MCPL 5LKNA 4OF3A 3U48A 2W91A 5CGMA 1SY6A 1CGWA 1KPVA 1S9VB 2CKBA 2R15A 3CSBA 2X9XA 4GT7A 4YNYA 1CTNA 5C6WH 4AL8L 4MNGE 4CJ0A 3WIFA 4OZHB 1INQB 5HHOB 2MWCA 2WAHA 3DX6A 1OWWA 2ATKA 1T89A 1LEKA 5IUSA 2DWEA 4WI8A 4ELMF 1H5BC 2XA8H 2YD6A 3AXLB 4PLOB 2DLFL 3FCTA 1UB5A 1OSZA 5DHVA 5L2KD 4MA1B 3BH9A 3IB4A 4PYGA 1DVFD 4KAQH 4EI6B 4I2XB 1A4JA 4NRXA 3LS5L 1O7VA 1TXKA 3RPIA 1PEWA 2GIYA 5IB4B 1G9EA 4ONGL 3TVMA 2J8UF 4S11A 4J8RB 3MO1B 3ARBA 3BEWB 4PRAA 4P2QD 5DQDL 3IXAA 3KAAA 43CAA 2RFXB 4IRJB 4XAWL 1JPFB 1FORL 1QLEH 3WN5C 1K4CA 1K8IA 2DQEL 3RUGA 4JZOB 4JGMA 1A8JH 2DWDA 1WFOA 1KB5B 3ZKSD 4JZNA 5F1NB 4HIEA 2APBA 3OXSB 1CTOA 3ZO0A 2XKUA 1U93A 5KS9E 3IXTB 1F3RB 3DOSA 3NCCB 2QADD 1HKLH 3SO3C 3G5XB 2MQ3A 1T1XB 2BVUA 1XCQA 5JPNA 3QEUA 3TO2B 1QO3A 2ARJQ 5FDWA 4P5TD 5TDPA 2Q87A 3RU8H 1X5AA 2GEEA 1F90H 1X5HA 2VABB 3KVQA 2AEPH 4P23C 3QUKB 1ZA3B 3QWOB 5CIPH 2NY6C 2W0LA 2QQNL 3L3OA 4M48L 1OW0A 3HI5H 4I18B 1MREL 3LRHA 5EU5A 2AEQL 4UNTA 1VFBA 4FQPA 2AK4B 5F9DC 1OP5K 4FNLH 3A67H 5DJ2B 2OXHA 3L5WB 3BDYL 4PY8J 5KTEL 1H15A 1KBGH 3MGTA 2IC2A 1I1YB 4GBXC 4OAWA 1FFNB 1FBIL 4PG2A 5GS1B 3C5SB 4FG6D 3JVGC 3P9MB 4YDVB 3V6FA 4K94C 5DK0A 4YR6A 4LARH 1FVCB 3KPMA 4JZJB 3PV6A 1DUZB 2AGJH 4PJ9C