1B0WA

Structural comparison of amyloidogenic light chain dimer in two crystal forms with nonamyloidogenic counterparts
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCQASQDISDYLIWYQQKLGKAPNLLIYDASTLETGVPSRFSGSGSGTEYTFTISSLQPEDIATYYCQQYDDLPYTFGQGTKVEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BENCE-JONES KAPPA I PROTEIN BRE
publication title Tertiary structures of amyloidogenic and non-amyloidogenic transthyretin variants: new model for amyloid fibril formation
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b0wA00
4PJ7A 4N8CH 1FZJA 4NQXB 3G5ZB 2VXQH 1PKQB 4OKVA 2X4PA 2VABB 4YDJA 3TN0D 2AXGA 4YFEA 3OKOB 3IFOB 4ZTOL 3EYSH 4Q2ZA 2APFA 2NY4C 3CFKB 3DVNA 3VFUB 3TJEL 5C8JA 4GW1A 4MXWH 3C9NB 4Z7OE 1AI1L 3GB7A 5HHPB 5HY9A 4V2BA 1EEZA 1MCCA 3LOWA 4JFFE 3EO1B 2R2CA 5BMFH 4PRIE 5HHVH 5I8KL 5TDNB 5GSRA 4OLUH 3MBEC 5AD0A 1P6AB 2MHAB 2XV6B 4YGAB 4XAKE 1RZIA 3ARUA 1INEH 5CD3B 4GLRH 4JFFB 1IAOB 3RPIA 5KSVA 1N5AA 1OGAA 2EZ0D 3P4LA 4GMSL 4OUOA 5FYKU 3SDAD 3IDXH 5DD5L 4PRIB 2MOVA 5IMKB 4PJCA 3R06A 4RFOL 1LVEA 4RX4A 3KYMB 3ARGD 3FO9B 3MLTB 4OM0L 1ZLSH 5JOPD 5ISZD 2XOTA 3L7EB 1TZHA 3WEXB 4ESKA 2OBGA 4HV8A 3O3AA 3MLYL 4FOMA 4LCWA 5ABDE 1P84K 3KPQA 1X5XA 1JTOA 5IMOB 5L0QB 1ACYH 4MHHG 5GJSL 2FX9H 4GBXC 4JFOB 1I8IB 2Y5EA 2NW3A 3BX7C 3W5MA 2ID5A 1PW3A 3PQYD 5I1KH 4BH7B 2VAJA 5D2NA 2VLMD 4QKXB 3BAEH 5C9JA 1WWBX 2LAAA 2DQCH 3BXNA 1MJUL 2W59A 5ESQA 1CFVL 1TDQA 4WU5A 4PRHE 4FFYL 3RVVD 3BEWB 2WBJD 1A3LH 5HYSB 3J8F7 1MI5D 3FQRB 5E8PB 3DRQB 3UC0L 4L3ED 4I3RL 5CEZH 5I18L 1ORQB 3VI3F 1CE1H 5B8CC 1BEYL 4PJ9C 5T5FH 4LOUD 5LQBH 2QV2A 4ODSL 4TVPD 4DGIL 2E9JA 1WEJL 2GJJA 1IC7H 4P5MA 1OL0A 5GGRY 2XKNB 2EEAA 4ONFH 1AD0A 4X8XA 2OZ4A 5ECJE 1GGUA 4O58H 3TCXA 2DQGL 3O45B 1S9KC 4F9PC 4MNGB 4BA8A 1AP2A 3LY6A 4DVBA 1S8DA 1EJ6A 3BKYH 1AGDA 3NH7L 3Q6FA 1RHFA 5KAQG 3GJEA 1R0AL 3NFPA 3OQ3B 5DRZB 5E99H 4CMMA 2Q6WB 1F8TH 4XX1G 5FGBC 3MQIA 4I0PA 2UY7A 2XZQH 3TCLB 3VRJA 1RSFA 4PJHA 1KN2H 5J12C 2CDFA 2XWBA 5IEKB 4U7KA 1NGPH 5INCA 3NCJL 1N0XH 1EZVX 2XN9E 3CJJA 1SEBB 1X5GA 5EO1B 4YDKL 5K9JH 4LSDA 3VXTB 2XWJB 5ITFA 4OI9A 4KMQA 4M3KB 4Q9RL 5IHZB 3MRKB 1UM5H 2VDLL 1G7IA 1HIML 4Z7UA 1O7SA 4BSJA 4RSVA 1DSFH 2XN9B 4X5LA 3VXRE 2Y23A 5I1DB 4OIIH 1H0DA 3VXMD 4F37F 4EOWH 3MRQB 2OSLB 1SJEA 4APQD 5E8DL 4NZRL 4RGMB 3K8LA 1MCOL 3BKMH 1KPVA 2CUMA 3B3IB 3F7VA 3F7QA 3MRGB 1D9KB 4WUKH 3LQZB 3GI9H 2AP2A 4W81A 3CX5K 4FZEL 4TSBL 4AMKL 1GH7A 4OGXH 4X4XB 2NW2A 3MJ8B 5BZWA 1ZMYA 1F4WL 5T3ZL 5J11C 5MEND 1KXVC 3GK8L 3JV0A 3TPKA 2F54D 4H8WH 3FRUA 2QADB 3HC0B 4YQXH 5GS0H 4ETYA 2DI9A 3DLQR 4DQOH 3C60C 5GS2H 3QIWB 1YNTB 2BJMH 1TETH 1U91A 2VAAA 4LFHD 1BPVA 2J6EH 3L6FA 4Y1AE 1HH9A 4ENEC 1YN7A 2VRAA 3DRTA 1QKZH 1ZGLM 2Q76B 3S37X 3TH4T 3LKRB 4OT1L 2DBLH 1ZA6B 4KVNH 2FZ3B 1D5MA 4JB9H 5JR1H 3JWNC 2CDGB 3DBXB 3MCKB 1DBAH 1I9JL 5C3TA 1T5XB 1LK3H 3VWJB 5L9DL 1RUQL 1QBML 4PJ5A 3FB8A 2GCYB 1EO7A 3A0OA 5FA3B 3VMNA 4F3FA 4M7LT 3QDGD 3ETBF 4FQCL 3BP6A 5BQ7A 3QXAB 5E2WH 2WIIB 5D1ZC 2HT3D 3RP1A 1ZS8A 1MNUH 3BZEB 1KCVL 1FNGB 3EGSA 3F12A 3FHAA 3MRMA 4M62H 4RFEB 4U3CA 5HGDA 2OR8A 1BJ1J 1KJ2A 3TH2T 5I66A 1U95B 4Y5VA 4V1DB 3WHE1 4RAUB 5JHDA 3CFCH 3EOAA 1NDGB 1DR9A 1I3UA 1RJLB 1MVFA 1BJ8A 1V7MH 1OTSC 2JTDA 2VKXA 4TNWF 4HX1A 2VZUA 5B4MD 2EYSA 1FE8H 4HWZA 3IFNH 3ULUD 1LO3H 2BP3A 2P8PB 4UU9B 2NXYC 1CTNA 1INQA 3RX7A 4FZ8L 3BGFC 4KY1H 3SKNB 4KZDL 1RJCA 4KRPB 3V5HB 3GHEH 1GVIA 4IOSD 4S1RL 4YHPB 3U7WL 1DVFA 3LN4B 1FIEA 3T2OA 2W0PA 3O11B 1FAKT 3GSNB 5LG1A 1KOAA 4X98B 2NMSA 1FFNB 2XY2A 4Q6YA 3HE7A 1RURL 3NOIA 4AENB 5I2IA 4DN3H 1Q9OB 1KYOJ 2DM3A 2FB4H 4HIIB 4PRBB 1IZKA 2EXWD 2P5WD 3U36A 4ELMA 2AJSL 4WWID 2JCCE 1XR8B 1M7XA 3RWCB 4OUUB 4H1LH 3KDMA 4LARH 4WTZG 5D70L 1NAKL 1FNSL 1VFAB 4HGWA 1EEUA 1FO0L 2GI7A 4OZHE 2IBZY 2BC4B 4ZNEA 1BZQK 1WTGT 4NO2B 4Y2DA 3UTZA 2IPUG 3CDCA 3DIFA 1UWXK 4P46C 4LCUA 2X9XA 5TE4H 2ZCLL 3MRNA 4AEEA 3FN0L 2JCCB 4PJIE 4BKLB 3JV6B 1I7UB 1OAQH 3LCYA 4ZOAA 4RMSA 5FA4B 3KYOA 3LV3B 3PWPB 4XPBH 3RIAK 1WAAA 5F7WC 4DCQA 2C9AA 1NANH 2AI0L 3QR2A 3ARZA 2IH1A 4TUKH 2I9LB 3KLAB 1OW0A 2H32A 1X5IA 1S7UA 4OFKA 5DJDA 5K9OB 1MWAA 2C3HA 2PXYC 3MV8D 5JOFA 4RMQA 3MO1A 3F58L 1KTKE 3MGAA 5IBTH 2X89A 4HKXA 2AV1A 1LHZA 3RKDD 3F8UB 3WNMA 2EH8H 3KG5A 3L1OL 4X83A 5E6IA 4PRNA 5IROC 3KWWB 3STLB 2OL3H 1F3JA 4M4RA 2OX5A 4KPHL 1UXSA 3GI8L 4G9FE 1W72A 2H1PL 4OCYH 2IAMC 4ODWA 3V52L 5E00B 4MLSA 4FABH 4ZS6C 3STZA 3TBYB 4OFDA 1U93B 4HUUA 5IP4A 2QQNL 4LLYA 4U1JA 1AY1H 1BP3B 3VXPB 2G2RB 1N6UA 3QH3B 1B2WH 2CIKB 2BFVL 3VRIB 3VE0B 3OJMB 4K94L 2BVQB 1A14L 3MNWA 3ROLA 4K94C 4PGEA 1HKLH 1PYWB 4YFLF 4WI3A 3CUPA 3O2DL 1IGML 4G5ZL 3RWGB 5IK3A 3L5HA 3ZT5A 1M05B 3FB6B 3VH8B 3I6LD 5DMGD 3HC3H 4M93B 2DTMH 3FAWA 4N8PA 2NY1D 1AHWB 1RK1A 1UWGH 3BI9X 4GW4A 2HTLD 4PP2B 2BXZA 2ZKHL 4YIQB 1DN2A 4P2OD 2GSIB 4NYLB 4XC3H 3U82B 3LQAL 3QRGH 4L3CA 3PGFL 4OKDA 4L8CB 5F70A 4OQ1A 2D0FA 2XIDA 5EORH 3CC5B 3LS4H 2Y5TB 3PL6B 4MD0B 1CLCA 4JDVA 3BE1L 3G5VA 3I3DA 2A77L 4NKIL 1OAUL 3C5JA 4YHIB 1N6QL 5C0AD 1MIML 4U6VH 3GSVB 3NN8A 4JGMA 4L4TA 3T0ED 1EJOH 5F7KC 3BESR 2DQEL 4XPAL 3SGKC 3QB7C 3LZFH 3MBEA 3EYUL 1P1ZB 1AGBB 2W38A 5L0QC 4KZEL 3ZTJH 1T20B 4MQ7A 2SEBB 3FQUA 3T2PA 5IVXB 2VXSH 4UIMB 4FXLA 4XH2A 3HS0A 5DC0A 4DKFL 4GAJH 4QOKE 1N2RB 2AGJH 5EC1B 5I1CL 4JLRA 4XZUB 4KQ3H 4UV7H 5EUKB 3FQNB 1TVHA 2YD7A 1BIHA 3EJZC 2Z92B 1C12A 4J6RH 4HC1A 4H25A 3MLUL 4NM8L 4ZUTB 1LE5B 1KLFA 2JJTC 4QOKB 4P2YA 2KZ1B 5D8JL 2V7NB 5IESH 4R8WL 1A6AA 2VSDA 2XT1B 1CYGA 4GBXA 1LWRA 3TVMB 1NCDL 3SJVA 3G5XA 1YNLH 4XPTL 3QPXH 4HPOL 4DZBB 4E42A 3MXVL 4LFHG 4KQ4H 1AR2A 1YMHB 5IFHH 2HLAA 1FYTD 3TLRA 3UTSA 5HD8C 4NO0B 1XH3B 2VQTA 3X12B 4PJAA 4HFUH 3KS0J 4OB5H 1H15A 3T1WA 1U9KA 5EU3B 4C55A 1CDIA 1I3RB 5FHBH 3RWHA 1E6JL 5B8CA 2ZPKH 5KVDH 3IJSA 3P40A 1AE6H 1UH2A 4PJ9A 1YNKH 4JRXD 5JW3H 1LDPL 1WZMA 4PS4H 4H88L 2W9DL 4HAFA 1G0XA 5EFIB 1Q0XH 3CDYA 1ETZA 1NMAL 4MQXC 2AK1H 4UILL 4RGNB 2J8UA 3FRPG 2HMID 3SO3B 4MAYD 1GAFL 5CUSL 3MV7A 1OCWH 1MCHA 3SDDD 5SV4A 4F9PA 4TOYL 3SDXB 2VZVA 4ODHL 5I71C 3UZVB 3CPLA 3L5XL 3MFFA 4UNVA 4K2UH 2AJUL 1PEWA 3QA3A 4LSPL 5C07D 1A3QA 4ZAKA 3HMXH 4ZQKB 1E6OH 5EIIB 5E2UH 3RVUC 4KROB 3FFDA 5FGBA 4G8IA 1G7JB 1MCQA 3QG6A 2YK1L 2Q8BH 5FO9A 3KPLB 2IC2A 2GAZB 1J5OH 3QHFH 2DD8L 2BNRD 3QG7L 2VDNH 4PG9B 4UNUA 5K59F 5TDPB 1WBZA 1KXQE 4RGMC 1Q9KB 1DDHA 4RMWA 4OGYL 1MLBA 1KTDA 2HKHH 1U8HA 1D9KC 3BUYB 3SGDH 5GGSB 3V4VL 5MEPA 2MMXA 2C1OA 3KPNA 2QADC 5DRXA 1XAUA 1CR9L 5JW4M 3QIWC 1S7VB 1QSZA 3IJYA 4CNIA 1IGIH 3NZHH 1JHKL 4BFBD 3JWOH 1RUPL 1FG9C 2WM0A 1V3LA 3TPUA 3I6GB 3H9YA 4I1NB 4D3CH 5F8QC 4YZFF 3OKDA 3RI5K 2B1AH 1C7TA 4Z8FL 1Q1JH 1ZHNA 2IANA 3RPKA 4LLMB 2UUDK 4QHUB 4YHOL 3ZKMD 4BZ2H 2JJVA 5I1EL 3C8DA 1G9EA 3OV6A 3VWJC 3WD5L 5L88H 1KLGA 4KMTH 4Z0BH 1G9NH 1H8NA 2C1PB 2NY7L 1TXKA 3C60A 2Z91A 4KJYA 1CIUA 1LO2L 4U1GB 1I3GL 4YDIH 5I16A 4XAWH 2YUXA 5FCUH 3QO1B 1DCLA 1QLEL 5D72L 4FQXD 1VKXA 1LQSR 3SKMB 5DEFA 5D1QB 3DGCR 3QISA 4XGZB 4O2CA 2C4FU 3DXAE 4XNUL 4L29A 1A2YA 2BX5A 4G8FA 1B4JL 4K3DH 1PEZA 5CSBA 4IRZL 3HC4H 5F21B 5FM5O 5JTWA 4R96B 1T0PB 3FO1B 4ZDHB 4N0UA 4P2QD 1GZQA 3MLZL 1NGXA 1RVFL 1D5BA 4LGRB 1P6FA 3QUZB 2DQJL 4XCCL 3GMRA 5KSUB 5EA0H 5D1ZA 4PJEB 3WNKA 1T7ZA 3QEQD 1MCSA 3WXWL 5T1LD 1MF2H 3WFDL 4HCRA 4NM4L 4QHNB 1OSPH 3O6LH 5DK0A 7CGTA 3GSNL 1I9IL 2KDGA 4UTAH 4EIZC 1QACA 2F8OA 3E2HB 5F6HJ 2XZCH 5EU6A 1VB9A 1AIFB 1YYLH 2WINA 1R5IA 4GMTH 5DC9B 5CEZD 1YDPA 25C8H 2A74A 1BFTA 3R0NA 2FEDD 1HDMA 2MQ3A 3V6FB 1BZ9B 4LSVL 2YMXL 5EZJB 3SE8L 4QWWC 5J6HB 1ZT7A 5M95B 4FP8H 5IJVA 2VXTL 5AYUH 1TVDA 4W6XB 5DGRA 3S98A 4ZSOA 1MFBH 2VDRH 3FQTA 4JGJA 1S9XB 5B39B 3I3BA 4HT1L 3D0VB 2XKSA 4JHZA 4KI5D 2IALB 2IFFH 4Y0GA 3DV4B 4C54A 2YD8A 5H94B 1ZWIB 3U2SB 4G3YH 5CBAA 4MNQB 1KC5L 3GM8A 3NGBB 1G7PA 5AAMA 3HNVL 1IEBA 3SKOB 1RZJC 5F93C 4JFEA 1YMMD 1G6RB 2EDEA 3MBXL 2EO1A 4LLVB 4JZOB 5GGRB 2JJWA 3PJSA 3RKPA 5C0BA 1FZMB 1RZGA 1AXTL 1FG2B 4NFBA 2MQ0A 1LNUB 2ITDB 1ND0B 4P46A 1ZKAA 4K7PH 1BREA 1IBGL 1WC7B 2QQKH 5SX4I 4MB4A 2X09A 3MV9E 4JVUA 4LLDB 3KPSD 5L7XL 3MXWL 1S9VA 5I30L 1I1FA 3VFOA 3ET9F 4MJIE 4WI4A 2JK5A 3VXOB 4Q9QH 5GRJL 4U6XB 5FYKL 4MVBC 1MRDL 2J88H 5HJ3A 1GOFA 1RUKL 1K4CB 4HIJA 3MV9B 5EZOH 2PXYA 2UZXB 2PW2A 5I1IL 1KCUL 3OKKB 5E2VL 3TBWB 4KK6C 4RMVA 1ZTXL 2PW1B 2C4FT 5A16A 4YLQT 3JUYA 1B88A 3LKNB 4NOFA 2VLLA 3HUJA 1CDGA 5IROA 1ZHLA 3HI5H 1U8NB 1T83C 5BRZB 1NCBL 1QHOA 1AHWC 1OTTC 3RDTB 2IAMA 3LN5B 1EUUA 3ESVF 3WIHA 1CLOL 1A7QH 3D1MC 4QRPB 2LVEA 4UNTA 5HGHB 1FBIH 3G5ZA 4NQXA 5FF6B 1PKQA 2Z31B 5HDOA 3PL6C 4X6DE 4OLZL 4UTBH 2VABA 3GBML 3OKOA 1NMBL 4UDTA 5CEXB 4U3XA 3BKJL 4FQIL 3N85H 3VFUA 5AZ2H 1IAIL 4NZUL 3QRFM 5AYQA 1N64H 3O3BB 4F8QA 5HHPA 2A83B 5FYLD 5EBLB 2CGRL 1EX0A 1M71A 1ADQL 2XTLA 4X6DB 4YX2H 3RZCD 5TDNA 4M7JL 3MGTA 3HPJB 4NQCE 4L1HA 3VGAC 2MHAA 4OCWL 2ADGB 2O61B 5J1TC 5CD3A 1XCQA 1S5HB 4JFFA 1IGCL 1IAOA 3FJTA 2CMRH 4XX1E 1QSFD 4Q97A 4YBLB 4PRIA 2NY6B 3MLRL 5IMKA 2KH2B 2R2BA 1DQDH 5ADOL 3KYMA 3OSKA 5EU5B 3FO9A 1RK0B 3MLTA 2B1HL 3MOBH 4X9FA 5ENWA 3TBSB 1W0WA 3CFDB 2B8OT 2IBGA 2N7AA 5GHWL 4PBXA 1A3RH 2VC2L 2E9BA 4YE4L 3JTTB 1N8ZB 3SGKA 1DP0A 1KT2B 3DSFH 4NQDE 2FNBA 5IMOA 2QBWA 4F57H 3BD5A 1G7HB 2DWDB 5HDBF 4JFOA 3MZTA 3TVMC 1I8IA 1DEEB 3V0VB 1A6TB 3WUZA 4BQ8A 1N3NB 3NCFB 2V2XA 3F7PC 3HR5B 4BH7A 4R0LB 1P7HL 1LGVA 1R5VB 5I1LB 4MA8H 1U8PB 1NGQL 2YS4A 3RA7L 2R1WA 1Z2KA 2GITA 3IYLW 1NEZB 4ZXBD 2BHUA 5FDWB 4LP5A 4RDQG 2ZOLA 3BEWA 2CLVB 3FQRA 5E8PA 3KYKH 3DRQA 2JJTA 3JTSA 4Y4FB 1ORQA 4H0HB 3CMGA 3UAJD 1F2XK 3UTPE 1Y6NR 4PRHA 2VN4A 5CEYB 1IQWL 2P45B 4IEFB 4HULB 3BKCH 1A9EB 1QFOA 4RGNC 1SJXA 2XKNA 3O41B 4PD4K 1BF8A 4UQ3B 3GDBA 5ERWB 3VWKB 3O45A 4HEPG 3O9WC 1RMFH 5JIPA 2XI9A 4I0PD 5ALBL 1ZT1B 2NR6D 3H0TB 1A64A 1R3IL 1SBBA 4LAQL 3VGFA 5EN2B 1QFHA 3BRFA 1V3MA 5DRZA 2FIKB 3MLWL 2X6MA 1MFAL 2Q6WA 4KROC 2ZUUA 2R15A 5F7EL 1HCVA 4G9DA 2OS7A 4LIQH 4QF1A 1FGNH 4MXQC 1BX2B 3TCLA 4K3GA 1KJ3L 3S3JA 1BQSA 1T1XB 3I50H 3NIFE 5DJAB 5C0ND 5IEKA 4XCYB 1EAPB 4MYWB 5K59E 1SEBA 3BDYH 4JREB 2J8HA 5EO1A 3WXVL 1H3XA 2YPLB 3VXTA 4H5SB 2EIZA 5EIVA 1N7MH 5EUOF 5IHZA 3TZVB 4AQOA 2AK4E 2DQTH 1JMXA 3MRKA 4WO4D 2XN9A 4XPGH 5D2LB 4NWTL 2XFXB 5CZVL 3T0BA 5I1DA 1R3KA 4Y8DC 1KB5B 2F19L 1E4XL 4Q6IC 3MRQA 2YEZA 2MPAL 2OSLA 4YXHL 5KVFL 2F74B 4HXAL 5HHOE 2AK4B 3SDYH 1BWMA 3U48A 4PYHA 3B3IA 1PJ9A 1U6AL 3MRGA 1D9KA 3LKSB 4YZFE 4G6KL 3VXRA 4MJ6B 3LS5H 2KQNA 2VLKD 4Y4HD 3EZ8A 3MJ8A 4HIXH 3O0RL 1PG7L 3HC0A 4KK8C 5A40E 4S11A 5HHOB 1T03H 3QIWA 1CK0H 3LB6D 4MCYB 5D7LD 2VIRB 1RV6X 5T5NF 1EBAA 1QLRB 4ZFFA 1JF6A 3ORJA 3N9GL 3ME0A 3W2DH 3K0WA 3TN0B 5D1QC 1FZOB 1ZA6A 2FZ3A 5ILTH 4GAGH 1J9CT 3DBXA 4XCEA 5DJ8B 3MCKA 1GGCL 4OAWB 4Y1AA 3VWJA 1F90H 2ZSWB 3IDYB 5ADPL 4PJBB 3L3GB 4QGTA 5JPNA 1ITCA 4LMQI 2GCYA 5FA3A 4MCZB 3QUZC 3IDNA 2JB6B 2ZNXA 2WIIA 3GMPB 4I48B 4RGOH 5JQ6L 3BZEA 1FNGA 4RFEA 2YWYA 3X3FL 1J0JA 3MRCB 5F9OH 5D5MF 5IM7B 4N90D 3TT1H 3SDAB 2YD4A 1U95A 1HQRB 4RAUA 1NDGA 1RJLA 2EDNA 1KENH 3ARGB 1A6VL 4TSAL 3FMGL 1JBJA 4N9GA 4O9HH 4DUWA 3E2HC 5EO9A 5ISZB 1JWUA 1J1PL 1WITA 4RA0C 3PQYE 4KK5C 4MA7H 3DVFA 3RY4A 3UJTH 4UU9A 3VU2A 1WBYA 2KQMA 1JJUA 3QCTH 5EU4B 5E8EB 1TZIB 4M48H 4EXPX 3V5HA 5J4MA 4N0FB 1CVSC 5KS9B 3LH2H 3T08A 1MI5E 4J4PD 3PQYB 4DKDC 1A5FL 4YHPA 4NIKB 5C0IB 2YD2A 3LN4A 4WIQA 1SYVA 3B9KD 1T0NB 4XP9L 3O11A 1ZEAH 4X98A 4RNRB 1FFNA 1J0HA 4YJZL 2EXYD 1WISA 5DSCB 3IKKA 3D9AH 2WBJB 4QRSA 4AENA 1MI5B 1DQQB 5IHUL 4PRBA 2FL5B 3GMMB 3QT2A 4L3EB 3NGBC 2VLRD 4CN1A 1B4RA 5CLWA 4Z95H 2EO9A 1G6RL 1XR8A 4OUUA 2PO6D 5CIPH 4LNRB 4UIKH 1VFAA 2E27L 4QO1A 3D69B 2BC4A 3GRWH 2ENSA 1RAMA 3IAQA 1MCPH 4NO2A 3A6CH 2BERA 4YXKL 3QQ9D 4FG6C 5J3HD 3B2VH 2JCCA 2A6KB 3MACL 4YHYB 3JV6A 4I18B 1I7UA 4CW1B 4K8RC 5FA4A 3LEVL 4HWNA 3LV3A 4OZHA 1ZGLB 3PWPA 2BVEA 4DK6A 3CVHH 3SBWA 4MDJB 4FFVC 1IL1B 1K2DB 4DJMA 4JO3H 4OZFH 1DBJH 2I9LA 3RTQD 1GGBH 4PJIA 4KRMB 4TULH 4QXGL 4P5KB 3NPZB 4K7FB 5SX4H 5K9OA 3UPCA 4XNMB 4HQQL 4IDJL 4PJXF 2UVFA 5GPRA 1HZHH 2GT9B 3OJVC 4E0RB 5KN5B 3MYZA 1T80A 3RX5A 4X6EA 1CL7L 12E8L 2VMFA 3PGCB 4O5LL 4TSCL 1G7QA 1J7VR 3KWWA 3STLA 2V5RA 2ZSVB 4M3JA 4S1DD 2W0FB 1A22B 4Y88A 4PLNC 2EE3A 3CDGB 4QXTB 1H8OA 1J10A 1KTRL 4HJJL 3RDTC 3NAAH 2IG2L 3RVTD 5E00A 1OTUC 1VFBB 1U93A 3T65B 4H1LG 3VXMB 3V7AG 3VXPA 3ARBC 2XZZA 4ETQB 4UB0H 2Z31C 2G2RA 4APQB 5MENE 3QH3A 4OLYH 1YY8B 1S7XA 3VRIA 3VE0A 5JO5B 4FXKA 4XCFH 4HUXB 2BY2A 5I19H 4GUPB 2B5IB 3QUML 1BJMA 1PYWA 3RWGA 3EDJA 1M05A 3FB6A 3VH8A 3VXSD 3AGVA 1G7LA 1CDCA 1T83A 5MENB 1CT8B 3WNOA 2PTVA 1MREH 4K9EH 2F54B 1AHWA 1FLRL 2YA0A 3O3DB 4YIQA 5D93B 1F13A 2R1XB 4NYLA 3SN6N 4L8CA 1KUMA 2OTPA 2EDLA 2GSGB 2IPTL 4XXDB 2P47B 2DLGA 4L4TD 5SWSE 4J3UA 3PL6A 4MD0A 3UTTE 4AK1A 3KNBB 4JY5L 5F7NC 3ZKQD 5C0EB 2A9NH 4ZUWB 4MZ3A 4UT9L 5FGRA 4YHIA 1MQKH 1QLFB 3MBED 4FQHB 3R0MA 2IGFL 2YUZA 3TIDB 3GSVA 3KXFD 2X41A 4WCYL 4L9DA 4XRCA 4EJ1C 4PLOB 3NIGF 2VWEE 4KKLD 3F7YB 1YECH 3VW3L 1OAYL 3K4DA 1V7NL 1ADQA 2QSCL 5F3HB 3VFNA 1EPFA 4MSWB 2ADJB 4LSSH 4IS6B 4F7CB 1P1ZA 1AGBA 5IHLB 5BZDB 3QDGB 3O6FD 4ALAH 1GL4B 2P44B 3VFGH 2SEBA 3C87A 5IVXA 3PNWB 4UIMA 2QEJA 4CBPA 5HYIA 2QL1A 1DBBH 4NNYB 5TF0A 5HDBE 4IJ3B 3GSWB 4LSTH 2HH0H 4F33B 2XY1A 3CLFH 4R0LC 5EC1A 3QEGH 5ICXB 4X6FA 3EDFA 4GQPH 4XC1L 4RIRA 4GBXD 5EUKA 2XZAH 1EK3A 2Z92A 3ROOA 1FCGA 1ZSDB 5DUPH 3VA2C 4ZUTA 4DGVL 4KJQD 4I3SH 4IOFD 4QOKA 3OXSB 4Y4FC 5DMKB 3UTSD 4POYA 4W4NA 3TVMA 2DJ4A 1KLUB 1MRCL 1DLFL 1JF1B 2V5TA 3WFBL 2R29H 4YPJA 1IQDB 4U1KB 1YMHA 4E41D 1FDLH 5F88A 2D7TL 4U1HA 3W82A 4NO0A 1NUDA 3X12A 5FUOL 2WLZA 4FN0A 1RZ7L 5TQ2H 3D0LA 5EU3A 5ACLA 1I3RA 1X5JA 3WDJA 2E6QA 3ZKNC 5F1OB 1CGYA 4LRIC 2IMMA 2P5WB 4KI5F 1FV1A 4PY8I 1JGEA 2JIXD 2R8SH 2X5PA 2R69L 4PRPD 1N4XL 3ZTJG 3C09B 3IT8D 3OR6B 4R90L 4ZUVB 5TH2B 1SY6H 5HI3D 4ZAKD 2IQ9L 1N5YH 1JHTB 1EVTC 4LPVA 3Q2CA 1MHCB 1Z5LB 2A6JB 3O9WA 1S5IL 1QBLL 4X80L 3SDXA 2E6PA 2CRYA 5FO7B 3GFUA 5K33A 3B9AA 4M1GL 4M6NH 4XVJH 2OQJB 4OZIE 5DWUL 4JKWA 2AVGA 3TT3H 4ZQKA 3Q1SH 5EIIA 3GSUB 3TZVC 4PYGA 4WFGD 2PYFB 5EUOE 5KZCD 1G7JA 4RISL 2D03H 3VFSB 4JHAL 3W9EB 1F58L 1TCRB 4L5FH 1KB5L 4F7EB 3KPLA 5E2TH 2GAZA 2VE6B 3BQUD 3MV8B 4OZIB 3WSQH 3QDMD 4PG9A 4ONHB 2FBOJ 5TDPA 5LGHH 4PV8A 1ZV5A 1Q9KA 3UTQB 3FFCE 2OJZL 1PVHA 1AFVH 4AEIH 4LQFH 5ESVB 2CK0L 2R2HB 1WFTA 1MLCB 4ZYKA 4PP1C 5GGSA 4HKBB 4S10A 3C08L 2H9GA 1RULL 2QHRL 3CMOH 3KR3L 3ZHDA 4UBDC 3I9GL 1JMZA 1CZ8H 1S7VA 3CXDL 4Q6IA 1I3VA 2AV7A 3TP4A 1MSPA 4CL7A 1C8PA 1X6LA 2CRIA 3I6GA 3TN0C 4WHYH 1I9EA 3BH8B 3HTLX 3MRDB 4F8TA 4LLMA 4QHUA 2IJ0C 5CILL 1MFEH 5ITBL 5C0GB 1I7TB 1XGQB 3ESUF 3IDYC 2NY1B 3NIDE 3S3PA 1NPUA 1U2HA 4KU1A 3RVWD 4P2OB 4U4BA 3I2CH 4YXLL 4KTEL 1SVZA 3ARED 3K4AA 3N1FC 2Q8AH 3IFPB 5IB2B 2H2PC 2GYSA 3T0EE 3SKMA 2EECA 5EOQL 4EUPH 1AQKH 1K8DB 5D1QA 4O02H 4XGZA 3SDAC 2RFXB 3C5SB 3KPRD 5C0AB 1MFDH 4WU7A 5DHYB 1YEJL 3SE9H 3O8XC 3ARGC 4UV4L 4PRAB 2VYRE 2PCPB 3W39A 5CFHA 4R96A 3T0EB 2PN5A 1DANU 1I75A 1XGYH 4ZDHA 1OAXH 3EDKA 4NP4H 4S1QL 5D71L 5IVNA 3T0VA 1TQCB 5E1HB 3QUZA 4A6YB 3D3VD 5KSUA 1MHPL 1YPZF 3HZYB 1HCFX 1SMOA 3MMEB 4EDXB 2B39A 2M1KA 5GJTH 5BO1L 4X0KB 2HJLA 5EU6D 4YBHA 2F8VA 3WDIA 2M26A 1KBGL 4QHNA 1CI5A 1R3LB 5JPMB 1ODAA 2CH8A 1NBVH 3KJ6L 1EGJH 2E8ZA 1D7FA 1BAFL 5FOBB 4TNVK 4UOW1 2Y6SD 1AD9B 5CJ8A 4YNYA 1AIFA 3L5WA 3BZFA 2WBJC 3H9SD 5LWYL 1F3DH 5MEQB 1IT9L 1OP3H 2DICA 2HRPL 3QULB 4D9RD 3U4AA 4LOUC 4JGUA 1PD6A 4PV9B 4TVPL 3V6FA 1BZ9A 3LN9A 5J56B 5EZJA 5J6HA 4L3AA 3S36H 4LASH 4AZ8A 2R4SH 3OHXB 3QEUA 4JRXE 3O6ML 1FYTB 1S9XA 1MHEB 3GSXB 1F3RB 3LMJL 4QTIH 3D0VA 4G7YL 4LBEA 1BZ7B 3P4MB 4I18C 4RZCB 4YHYC 1T6VN 3DV4A 2OR9H 4LSUL 1ZWIA 3U2SA 5DMIL 4MAUL 4MNQA 3P3YA 3WKNA 3CFJB 5FYJU 1A6ZA 5DRWB 1FPTL 3SKOA 3EDDA 4NQTA 1J11A 2CJUH 4JRXB 5L8JB 1QQDB 3MR9B 1J1OH 4HD9A 4FFZL 5CP3H 3RWEB 4U6HB 3G6DH 4KTDL 4LLVA 2NY2C 1LO0H 5GGRA 4P4KD 1BLNB 1FZMA 5ETUB 2VZ1A 2EE6A 1LNUA 2ITDA 4YEFA 1ND0A 5C07E 3DYMA 5DQDH 4EDWL 1WC7A 2HFGL 3KPOB 1AC6A 2K3TA 4MAYB 4X7TB 4DZ8B 3SKJH 1BF2A 4PJXE 3SDDB 4PB9H 4P23D 3OX8A 4LLDA 4H26A 2W1NA 4NN5B 1ZK9A 2YD3A 35C8L 1RUAL 1VADB 2W60B 3VXOA 5C07B 4U6XA 4MB3A 5KANI 5EPMB 1K4CA 3JWDC 1FVEB 5GISH 4X5WB 2AQ2A 3MV9A 2GJ6D 3P9LA 4YBQD 4LLQB 5CZXD 2KKQA 3OKKA 5JXEA 4APQC 5C09E 2ZOKA 4CVXB 5EG6C 2PW1A 3EW3B 5DEZA 5EWIL 4JO4L 3VFVB 1BFOB 2IAMD 4OQTL 4ZS6D 2B5IC 2OJEB 3LKNA 4JE4B 3WJLC 3OAYH 1U8NA 1DANT 3T77B 5BRZA 1KG0B 3PDDA 1DLHB 4YEEA 3RDTA 1JTPA 5D93C 2UWEE 1KEMH 1FORH 3SY0B 3Q3GB 2CQVA 4QRPA 3WS3B 3ARBA 5HGHA 2VDML 3ZDYF 2Y1VA 2Z31A 3DUUB 5CEXA 1IRAY 3MUZ1 1E27B 1TZGL 2HFEB 2UWEB 4EBQH 2H26B 5FIEA 2A9MH 3O3BA 4PGBB 4Z77B 2A83A 3MYJB 2Q7YB 3SDCC 3D39E 5MP6H 4P49A 2HVJB 4X6DA 3MOQA 1MH5B 2X4OB 4BSWA 4I77L 4NN7B 5F44A 3HPJA 1K3IA 2ZUQB 3P9MB 4KXZH 1G0YR 1HSAB 2ADGA 4KFZC 2O61A 1BM3L 4AL8H 2HT3C 4LPUA 1S5HA 3RL1B 4WNQA 3DHMA 2VWEC 3EO0B 4FQXB 1YEIL 4IJ3C 3VGDA 4ZTOH 4P2QE 3S35L 1D6VL 3TJEH 4R97B 2CUIA 1MAKA 4PJDB 2CKBA 1AI1H 5H2BB 1RK0A 4UAOB 3DX7B 3QEQE 5CWSB 1BQLL 3ULUL 3IS1X 4M00A 5B4MC 5I8KH 1N8ZA 4OZGE 4LHQB 3ULUC 4P2QB 1GPOH 1KT2A 3K2UL 4Y5YB 4TPRH 5L2KE 2CLRA 3FT4B 5DUMH 5IR1A 1OPGH 1DBML 4QNPE 2DWDA 4JFDD 2GY7B 3U1SL 1DEEA 3V0VA 1XIWC 4KRNA 4M6AA 3QEQB 5T1LB 1N3NA 4XPFL 4YUEL 5DLML 3HR5A 3MLSL 5C2UB 4D94A 5IHBA 4R0LA 5CEZE 1R5VA 1T7VA 4P2RE 4OZGB 5DK2B 1JFQL 1NEZA 4OM0H 1EUTA 4GQ9L 4PRHD 2CLVA 1UACH 3BJ91 2WZPD 3MLYH 4JHWL 4HDIA 3ECBB 3IDMB 4Y4FA 1WVZA 1NCCL 5HD8D 3O4OB 3V4PL 2EXWC 3O3EB 3L3IB 2Z35B 5GJSH 1LE9B 3QUXD 4KI5E 3JV5A 3SE4C 5CEYA 3C09C 1A9EA 4AEHH 3OL2A 3O41A 3OGCB 1MCIA 4UQ3A 5FGCB 5ERWA 1YMME 2HYMA 4D9QE 3C8HA 4K7PY 4U7SA 3C6LD 1SM3H 4H0IA 3T0AA 1ZT1A 1I8KA 3VD9A 5I8CB 1PSKL 1YEGH 5I9QB 5EN2A 4LRIA 4U1LB 5I18H 4S0SD 2FIKA 3ZDZF 3HMWH 4JG0L 3UJIL 4ODTH 5DJYA 1YMMB 3DUSB 4DGIH 3KHOA 4Z7VB 1BX2A 3B8SA 2JB5H 4KK9D 1T1XA 2VLJE 43CAB 1E4WL 4RMUA 2B4CL 1TJIH 5DJAA 3RVUD 3GGWB 4OV5B 1YQVL 1NJ9A 2UV3A 1EAPA 4XCYA 2MCG1 5I1AA 4F80A 4LDLB 4WY7H 1PLGL 3AMLA 4LSRH 1J8HE 3HZKB 3KPSB 3VFPB 3WMSA 4OGZA 3EOTH 2V9QA 1W2KT 1R0AH 1RZ8A 1IILE 4OLVL 3TZVA 5BV7C 3U0WL 2NTSP 1S7QB 3LRSB 1DE4B 4WW2F 5D2LA 5GGVY 2XFXA 1G0DA 3VXRD 3J7HA 1J8HB 1KB5A 3TO4D 1UZ6F 2BY0A 4XPHL 2V2WB 5IQ7H 2F74A 5JXAH 2AK4A 1HXYB 1CQYA 2K1MA 4JVWA 3NCJH 1JF5A 4I5BB 2EC9T 4X7CC 5EZLA 4PGCB 3DVGB 3U9PH 1D5IL 1HHJA 2BSTB 2BOCB 4MJ6A 1NGWB 1JWMB 1FZJB 4FTVE 3D18B 4Q9RH 3BSZH 4JRYE 5DMGC 5TE6L 5IVOA 5AG9A 4HMCA 2VDLH 5HHOA 3U6RB 3MODL 1T2QL 3RGHA 2HTLC 3MA9L 4P2OC 4PPTA 5HTSA 2PTUA 4MCYA 2DS4A 5B38G 2B0SH 4Y1AD 2NY5C 1QLRA 5E8DH 5JLZA 3TN0A 3G04B 1MCOH 1FZOA 2YUWA 2DQUH 4Q9BA 3BH9B 1QFUL 5AD0B 3PWNA 5DJ8A 3CSYA 4FZEH 4AMKH 1RZIB 4CU8A 5C0RL 1MELA 3RPIB 1QSFE 4PJBA 5IWLC 3G6AB 3T0EC 3RZCB 2HTKD 4ZO7A 3H9HB 1TQCC 2YPVL 4MCZA 2D31B 3ELAT 1DFBL 1JVKA 4PJCB 3GMPA 4I48A 4XMLL 1HSBB 1YPZE 5IG7B 4DUVA 1JN6B 5EBMB 3AXLB 2O5XL 2QJDA 5IM7A 1QSFB 4Z0XB 3SDAA 2ATPB 1HQRA 4PY7B 3TNMB 3KPQB 4PJ8C 6CGTA 3CSGA 5SWZE 2DQHL 4S2SB 3O8XA 3ARGA 5ACZB 1I9JH 3MX0A 5ISZA 1T21B 5L9DH 2VR9A 4KGLA 1RUQH 4ODVL 5F3BB 3V4UH 1VEPA 3CDFA 2FDBP 4BQBA 5E8EA 4IMLB 1TZIA 3N50A 2MNUA 3PQYA 5CGYD 1JGLH 5C0IA 4BQ6A 2QSTA 2M8XA 4KVCL 2P1YA 4R2GB 1BVLA 2P8LB 1HEZB 4RNRA 4ZXBB 2FATL 1A7PH 5BOPA 3D25B 1UWEH 1ES0B 2COQA 5DSCA 1G9MH 4D8PA 2X4UB 4KUZL 2WBJA 2WUBL 1MI5A 5FHAL 1DQQA 8FABB 3DOSA 4NNXB 2FL5A 3GMMA 4U2ZA 5H37H 4L3EA 3UYPA 1R3JA 4JG1L 1KELL 4P59H 4H1LB 3BWAA 4FZ8H 1U0QA 5DGQA 3SQBA 4LNRA 2LVCA 4P0DA 1AP2B 2BVOA 3D69A 1QVOB 5TQ0L 5ESAA 4S1RH 4OF0A 2DM2A 1CLYL 3U7WH 3N06B 4LEXH 4PTUB 2E3VA 3NFPB 2A6KA 2G5RA 4I18A 3SDDC 3VGEA 2V9TA 3HFMH 4I0PB 3HI6H 2UYLB 4NN5C 1ZGLA 3KGRA 2F8XC 3WCYA 3CFBB 2BY3A 1BQUA 2X4TB 4MDJA 5AEAA 4OZ4B 1NFKA 2XWBB 1IL1A 1K2DA 1VFUA 3A6BL 5CJQL 1FNSH 2YD5A 2EE2A 1FO0H 5HDQL 4P5KA 2WV3A 3BP7A 4P9HH 1F4YL 4YHZH 2VR5A 1BIIB 3E6FB 4XNMA 5ITFB 4CAGA 2ATKA 2GT9A 4NC1E 5JIHA 2ZCLH 4LAJH 5KN5A 3S4SG 4M6MH 2C3VB 1A4JB 1MAML 1X3DA 4XP5L 4JQIL 2OL3B 4JO1H 3RAJL 2W0FA 2HLFD 2AI0H 2ENYA 3CDGA 1YA5A 3IU4L 4QXTA 4WO4B 3GKZA 5C7XL 3BGMB 1D5XB 4G9FD 1LP9F 4IMKC 4BZ1L 4N8CL 3F7VB 5JW5A 2V5YA 3T65A 3MLXL 2VLKE 1YC8A 1AH1A 1NAMH 4APQA 5A2KH 3CNKA 3F58H 2OMBA 4QRRE 1TIUA 5JO5A 3ZDYE 2FR4B 4MXWL 1OTTD 1GGTA 2YRPA 3MTRA 4GUPA 4M5YH 3S5LG 4OQTA 1CFNA 4KHXH 3WJLA 3L6FB 3BMWA 4FQPA 2VLKB 4Y4HB 3ZKMC 3RJQB 5HHVL 3DRTB 4C56D 5MENA 1CT8A 1WWWX 2F5AL 2F54A 1EFQA 4FQLH 3O3DA 2ITCB 3GI8H 4UUJB 1Z3GH 4NN7C 4G6FD 2H1PH 1X4ZA 2R1XA 2DLTA 1WSST 2ZUQC 1INEL 4Y4KD 3RRQA 4OZFG 2GSGA 4XXDA 5CCKH 5D7LB 5DJ2A 3MRLB 3AB0B 4D0DA 4AM0B 3TYGH 3KNBA 2X4SB 3QNXB 3PE9A 4ELKA 3MUHL 5C0EA 4FQXC 2BFVH 4C4KT 4ZUWA 3TO2A 1XR9B 1QLFA 1A14H 4EVNB 4FQHA 4R97C 1KCKA 3TIDA 1ZLSL 3SKUD 3O2DH 1IGMH 3SDCA 1ZS8B 4UAOC 3MRMB 3F12B 5J1AB 3F7YA 5SWSA 1GHFL 4NHCL 2ICWB 3VD3A 3UTTA 4N90E 5F3HA 5E4IA 1X6NA 1WCBB 4MSWA 2ADJA 3S37H 2ZKHH 4IS6A 1ACYL 4FQ2H 4LQ1A 4F7CA 2FX9L 1UKTA 3LQAH 2GFBB 3PGFH 1JNJA 3SQOL 1CU4L 4G8GE 3AU1A 4NNYA 3VXNB 4R7DB 3L3OB 2A77H 3PHQA 3ARPA 4HWZB 3TWCL 1MCRA 3IDGB 1N6QH 3F5WA 2AS5M 1FP5A 2I24N 4U6YB 5FV2A 5IEHB 5J7CC 3ALPA 1TNNA 3M07A 5CEZL 5J13B 1CE1L 4GRWF 5T5FL 3OXSA 1L0QA 3SE3C 2APTA 3EYUH 5ICZB 5DMKA 1H5BB 2AAVA 3O4OC 4FXGB 4ERSH 5IW6A 1J05A 2WQ8A 1CD8A 2FEDC 3EYOA 1KLUA 1XIWA 5LXGL 2EDHA 5IW1B 5I15L 3LHPL 1JF1A 4XWGH 1ZVHA 1INDL 1ZOXA 1KIQA 4DKFH 4TN9A 1IQDA 5I2IB 4U1KA 4ONFL 5I1CH 2VLRE 3AY4C 5C0DB 4MX7B 5EOCJ 3B9KB 2XACC 4OLWH 3D48R 3B9DA 5HI4D 1BJ1H 3BKYL 1QRNE 4KI5C 4M43H 4NN6B 4NM8H 1PDKA 5I9QC 4X99A 1F8TL 4WFED 4YFDB 5D8JH 2VLRB 3UTZB 4R8WH 2P5WA 4LCUB 2OI9C 3MRNB 1NCDH 3O9WD 4KDVA 4JKLA 2PO6B 4X5XA 3ZDZE 3SE4A 4XPTH 3IKCA 1JPST 4F58L 3OR6A 4EEEA 4ZUVA 1N59A 2CD0A 4DVRH 5KSBF 4WTXA 2MCPL 5A2IH 3L3JB 3JSSA 4F7PB 3FKUS 4WI9A 3HRZB 1U8IA 1JHTA 2GY5A 2W9EL 4QCIA 2IH1B 1MHCA 1Z5LA 2A6JA 3MRFB 5DZLA 2PYED 1EHAA 2Y4SA 2FJFB 5K9JL 5FO7A 2I26N 4B41A 2A6IA 2OQJA 1MWAB 1ITBB 3OG6B 3GSUA 1LDPH 1HWHB 4H88H 2MFNA 2W9DH 4EKXA 1T1ZA 1DSFL 3RTQB 4OV6F 1S3KH 2GUOB 1DJSA 1PX3A 2EICA 3VFSA 5EBWB 1TCRA 1WFNA 4EOWL 4F7EA 1NMAH 2VE6A 1NL0H 1B0RB 3WKMH 4OZIA 1VFMA 4FS0A 4ONHA 3BKML 1ZVSB 5CUSH 2HJFB 3UTQA 4JR9H 1X4XA 3AS3A 4G6JL 4CKVX 4WUKL 1W72B 3GI9L 4ODHH 4WHDA 5EUOA 5ESVA 1V3JA 1MLCA 4OGXL 3L5XH 1NFDE 2WIMA 1CFQB 3DWTA 4HUUB 4IBLT 3CAFA 4H8WL 4YQXL 4Z9KB 2FCBA 4YHKH 3DX9B 4H8WC 5GS0C 1OAZL 5DHVH 2BJML 1FZKB 2J6EL 2HWZL 3IVKB 2XNAB 2YK1H 4F15B 4Q74A 1NFDB 1QKZL 4LSQH 1I1YA 2Y06L 2DD8H 4EQ3A 3QG7H 2FJHB 2WWMD 1KSRA 4M02A 3O2VL 4KVNL 4KKBD 2AXHA 3BH8A 4OCNC 5JR1L 2Y07L 4JAMB 4OGYH 3MRDA 5FYLL 3V4VH 5SX5H 5C0GA 4Y19E 2H3NB 2ZP0T 1XGQA 2JF1A 3VXSB 1J8KA 5T1MB 3RZCC 1CDJA 1CR9H 4P2OA 3BYTA 1RD6A 4M62L 4H20L 4M5ZH 3NN8B 3T09A 1JHKH 4L4TB 5IB2A 3O6KL 1RUPH 2BNQE 4R26H 4K3HA 2W65B 4JZNB 3C5SA 3MBEB 3QQ4B 5FYJL 3FZUD 1V7ML 3FQWB 3DXAD 4QGYA 2J2ZA 2BK8A 5DHYA 3KXFB 3FOMB 2VH5L 4YHOH 5D7IE 4PRAA 2A2QT 5ID1B 2XTJE 2BZDA 3FQUB 5I1EH 5F89B 4GW5A 4XH2B 1LO3L 2IEPA 5F1SA 5IWLA 3T0EA 3BHBB 2HRLA 1L0YA 1CD9B 4HH9B 3PP4L 1UCTA 3FO2A 2V7HB 4A6YA 3V5KB 4KY1L 3HZYA 4JLRB 4EN3D 5IT2H 3O6FB 3VFRA 3MMEA 4EDXA 1I3GH 1MCDA 2QLVB 3GHEL 5D7IB 4GJTB 1NUGA 4PJGF 5DFTA 2GEEA 1QLEH 1QSEE 5D72H 4H25B 1E4JA 3OAUL 1R3LA 5JPMA 4PJ8A 4KUCF 2VDPL 4XNUH 5DO2C 4M8QB 1D6EA 1P69B 4R2GC 3AMKA 4GBXB 4YDVB 4ZXBC 3HLAA 4IRZH 1AD9A 4DN3L 2FB4L 4XB8A 4E42B 2EYRA 4JM2F 3N1GC 1Z9OA 2CIIB 2EDOA 4E41E 3TFKD 1RVFH 2HLAB 2IADB 4M1DL 3C8KB 3UTSB 3QULA 4PJAB 3UAJC 3WXWH 5FM8A 3Q0HA 1NC2D 4NM4H 3RWHB 5TE4L 4E41B 3OHXA 4PUBH 3GSNH 3IJSB 4LEOB 5IB4B 4DN4L 1MHEA 1I9IH 2WNGA 5FECB 4HG4J 1MJJB 1BZ7A 3P4MA 3QUKB 4XBGA 4P3DB 1Q0YL 2NR6C 1T1YA 2CXKA 3CFJA 4Q0XH 5DRWA 1UGNA 4TUKL 4P4RB 3ZYZA 1KCRH 4JRXA 5I1JL 1GOHA 2PTTA 1QQDA 3B8YA 3LPGA 3T4AB 2JIXB 3V6BR 1JNLL 4U6HA 5C6WH 2YMXH 4K8RD 3SE8H 1DQMH 4JANA 4PRPB 3CH8A 2I9TB 1BLNA 2FX7H 1YY9C 5ETUA 2VDOH 2VXTH 2FX8L 4FFVD 5IBTL 3U4BH 3KPOA 4ZAKB 1S7SB 4X7TA 2MQCA 4DZ8A 4DOHB 4G8IB 3MRPA 3SDDA 3OKNB 2QQQA 3WV0A 1NLDH 3TESA 5GZNC 2OL3L 5FAAA 1VADA 1KC5H 2F58H 2F15A 4MJID 3SGEI 3HNVH 5JXED 5C07A 1K85A 3IU3A 3KS0H 2Y25A 1JWSA 4HLZH 4NC1C 4WO4C 1IMHC 4FABL 3RUGB 3HB3D 3QNZA 3MBXH 5KZCB 1MLBB 1ONQB 1FVEA 2L0DA 4X5WA 3ARXA 1AY1L 3MJ9A 5DR5H 1CXHA 4LLQA 1LP9E 3GSOB 3BQUB 5EBGA 3QDMB 1IBGH 2RB8A 4CVXA 5C0CD 2C1OB 3KPNB 1M1SA 1YC7A 2Q3AA 1CQKA 5DRXB 3VFVA 3GO1H 1XGTB 2OJEA 1GGIL 1T2JA 4NRXB 4NC0B 4X6CF 5L7XH 5E5UB 4TUOA 2V9RA 1KCSL 3ARBD 3HC3L 1JZ7A 1U92A 1LP9B 2DTML 4Y4HC 1X5HA 2FSEB 3T77A 4JDTH 3HCVB 5GRJH 2RGSA 4RMRA 5C09A 3PV6B 3TPUB 4XC3L 5FYKH 3QHZL 1MRDH 4KAQH 4J3XA 3QRGL 3OKDB 4IMKA 3SY0A 3Q3GA 4XNZB 3GIZL 3LS4L 5JDSB 3WS3A 3BPNB 5J11B 1JNNH 1KCUH 3DUUA 5I1IH 3B5GA 5E2VH 4PJ7F 3OXRB 5HPMA 4U6VL 4B50A 4Z7NF 1E27A 2HFEA 2UWEA 3WN5B 2H26A 4PGBA 4Z77A 1F02I 1KULA 2Q7YA 1WGOA 1DEDA 4NBXB 1IC1A 2HVJA 3WUWG 1KJ2L 1VKXB 1MH5A 1NCBH 2X4OA 4N1EA 4HK0B 4JPVL 4NQCD 3P9MA 2R0LH 1HSAA 5CMAB 4K71B 2VXSL 4G8FB 2RJMA 3AREB 1T04B 2P46B 3WFHA 3D39A 4OLZH 2AGJL 4FQXA 3OAZH 3GBMH 5IGXH 1NMBH 1U58B 3K3QA 3MV11 4FQIH 3NTCL 1IAIH 4NZUH 1JTTA 4UV7L 3KPRB 5TFSH 1DBKL 3H8NA 3GMRB 5H2BA 1YEEH 4M7LH 3DX7A 5CWSA 3TBTB 4CDHA 5I74B 5J13C 5IFJB 5IESL 4P2QA 2VDKL 1A7BA 4FQJH 3G08B 3FT4A 4PY8J 5HHNB 3D3VB 4NQDD 1H5BC 3SPVB 3UYOD 5KVEL 3QPXL 4B0MM 2YKLH 5KVGH 3FN3A 3QEQA 5C3LD 1IGCH 5T1LA 4KQ4L 2OMNA 5JA8B 5IFHL 3ZL4L 2E7BA 4J4PC 4OZGA 1QFWH 4LDOB 5DK2A 1U8QA 3MLRH 3W11D 3ZDXF 3T2NL 3B9KC 2BSED 4OB5L 1CD1B 5E6YA 4BSVB 5GHWH 3BN9C 5FHBL 4HUKB 5HYJE 2OCFD 2VC2H 4YE4H 4NN6C 4OD1L 2ZPKL 3ECBA 1DZBA 3H9SB 3SE3A 4PS4L 2NX5E 3DHJA 5JIKA 3L3IA 2Z35A 1LE9A 4MD5A 4MXVF 2PUQT 2PO6C 3HE6D 5KSAD 5D6CB 1HINH 3ZKND 4AIOA 3PDOB 1B0GB 4DKAA 3AY4A 1NGQH 4UOJA 3OGCA 1G7PB 1OCWL 3HAEH 4JQVC 3RA7H 5KSBE 5DD0L 3UTOA 3QQ9C 3U30C 4UT6H 3HZMA 4LIQE 3MUY1 1OW0C 1MWAL 3U0TB 3HMXL 4GFTB 4ZUSB 1S9YB 1B6DA 1ROWA 3LAFA 1OM3H 1BOGB 5EC2A 1II4E 3QSKB 5A1AA 3CSPA 1SYSA 4BZYA 4G80B 5KSBB 1EV2E 5AG8A 5B38B 3D85D 1C08B 4PREB 4Y8AA 4HPYL 3RTQC 1YMMA 2IQAA 3DUSA 5DK3A 4Z7VA 3NABL 1RPQA 4NFDA 3QHFL 4P4KB 3V6ZB 1AJ7L 4XB7A 43CAA 2AEIT 5GSVB 3GGWA 4YH6A 4OV5A 1V5JA 3WIFA 1W72L 4PJHF 2HKHL 4NUJB 1MEXL 1RZKH 3EFDL 3BP5B 2JJUA 3IDJB 2O93L 5ALBH 4P23B 3HZKA 3KPSA 4NKDB 1WBXB 4LAQH 3VFPA 3ARYA 1FQ9C 3KHQA 5F1NA 4S1DC 3UJJH 1YEFL 1S7QA 3LRSA 1DE4A 5F7EH 3TC9A 4O51A 5E08L 3K2MC 3MA7B 1OOAA 5SWQA 2EDFA 3RVTC 1IGIL 2ADFL 1J8HA 2GJ6B 4Z7UF 4F15C 4DTGL 1ZHLB 4NBZB 3JWOC 5IBUG 4KV5F 2V2WA 3RIFF 1PY4A 1FJ1B 1UADC 4I5BA 1Q1JL 4OF8A 4PGCA 1VPOL 1FAIH 2IAMB 4BZ2L 1CXKA 2BSTA 2HT2D 2BOCA 2J4WL 4YK4B 1F5WA 1NGWA 1K9TA 1JWMA 5L88L 3D18A 4Q7DA 1LEIB 1G9NC 4K07A 2OTWB 4UDTB 3V5DB 2NLJA 3L3HB 3U6RA 1WZLA 1MCLA 1QFPA 1XGUB 4LNVA 1XF2B 1A02N 2J6EA 4KHTH 1UJ3B 5FCUL 4N1CA 2F19H 1E4XH 4JDZB 4XTRC 2MPAH 3AFLA 5DJXB 1SVCP 4YXHH 1M71B 4K3EH 2F5BL 4JRYA 4PLKD 4HXAH 1UENA 3G04A 3MGTB 4WUUE 3QPQD 5C0FB 1IEAB 3BH9A 2MKLC 3KYAA 1B3JA 3HC4L 1NKRA 2H2PD 3QHTC 1XCQB 3O0RH 4FFWD 1RY7B 4KKLC 3HR6A 4NFCA 2BMKB 3G6AA 3RZCA 5E0QA 2APWA 3H9HA 2D31A 3UBXG 2R2BB 1P5VA 3S6CA 4KMLB 3FT2B 1TFHA 3O8XD 2LAGB 2R1YA 3O6FC 5BJTB 1FFPB 1HSBA 5ENWB 1MF2L 1W0WB 5IG7A 3ZT6A 43C9B 1JN6A 5EBMA 3AXLA 4HC1L 1ZE3C 4NRYB 1QSFA 3O6LL 4PJGE 1JPTH 4WI8A 4Z0XA 2ATPA 4PY7A 3TNMA 3VA6A 4UTAL 5IBLD 2E7LC 1GC1H 4S2SA 5E56A 1UXWB 4JFDE 3MNVA 1GGCH 5ACZA 2VL5A 3W0WE 1QA9A 2XPGB 1YPZA 4PGDB 4GMTL 1T21A 1HQ4B 2V2XB 2A6DB 2J3SA 3OZ9H 4PJGB 4KJQC 4PJFF 4IOFC 5F3BA 2AKRB 2R1WB 2GITB 2N1KA 4JO2L 4TTDD 1BMGA 4JFDB 3X3FH 4IMLA 3ISWA 3WFEH 4FP8L 1IGFH 5AYUL 5BOZG 2ZOLB 3MCG1 5C2BH 3WLWD 2E6JA 3O4LE 3S4SB 2ZWLT 3QIBD 3JTSB 1CGUA 4JKMA 5HHQB 2P8LA 4UINH 1HEZA 5DVNA 3ZSSA 4ZXBA 4TSAH 2IFFL 3D25A 3FMGH 4D0CB 1ES0A 2P43B 2X4UA 4PRHB 1U3HD 1SEQL 1JPSL 1UYWH 8FABA 4NNXA 1ACZA 3GHBL 1FHGA 3K8MA 4OD2B 5GRUH 5E95B 4H1LA 2YD6A 2UZYB 1NCUA 1T7XA 2DQIH 3QUXB 3MRJA 1YEHL 3WDHA 1QVOA 1MPAL 1A5FH 4K7PL 4QRTB 1IVLA 1B9ZA 4NBYB 3T4YB 3S5LB 4PTUA 5HI3C 4ZAKC 4HEME 3MRIB 5HBBA 1CGTA 5IV2A 1T7WA 1RUMH 1IC4L 2NY2D 3REVA 4G9DB 3C6LB 4UDUB 2UYLA 4QF1B 4OFPA 1XT5A 4Q9QL 3CFBA 5IHUH 3GMNB 4Y5XC 2X4TA 4OZ4A 4ZFZA 4HWBH 1G1CA 2J88L 4OZFB 1G6RH 3QUYD 2OK0L 3P4OB 5EZOL 5I71B 2E27H 5EB9A 1FH5H 1MHHB 1WIPA 1NEZG 1BIIA 3E6FA 2EIZB 7FABL 1Q8MA 3BQUC 5DYOB 3MGOB 4YXKH 1OSZB 1CS6A 2C3VA 3B9EA 4NWUL 1A4JA 3SGEH 3V8OA 4PB0L 3HI5L 2DMBA 1R3KB 3T0WA 2OL3A 2YEZB 4ZFGH 2AJ3B 5GGVL 5FOJA 5E9DE 4WO4A 1KTLA 3I02B 1B6UA 3BGMA 1D5XA 4YPGB 1JRHI 1VCAA 1A7QL 4XNZC 4JRWA 3ULVF 3VXRB 1QPPA 4EI6B 3BPNC 1OWWA 1H3WM 3TJHD 3TO4B 3BGAA 4LCCB 3N85L 4JFQB 1D5ZB 2FR4A 1EH9A 1ZXQA 1N64L 4Y2OA 3QCVH 1CL7H 1M7DB 3WN5C 4OLXH 4O5LH 4Z7NE 3RHWK 2VLKA 4Y4HA 4YX2L 3VGGA 4I9WE 4ZFFB 2OXHA 5T3XL 3O2WH 1IGYB 3CCHB 4QRRA 4UUJA 2ITCA 1KV3A 3RVWC 2IG2H 1ZANH 1LILA 1UA6L 4QY8A 5DT1H 4K71C 4XCEB 3SDCD 5D7LA 3PP3H 5CINL 3MRLA 2CMRL 3AREC 4AM0A 4Y1AB 3FCTB 5SWSD 4HF5H 2X4SA 3QNXA 3UTTD 2EDBA 2O5YL 1XR9A 1REIA 5JPNB 3UZEA 3WFCL 4S1SL 3ARTA 3P0YH 6FABL 4EVNA 4WVRA 1GOGA 1HNFA 3QUMH 3IDNB 4XHQA 4WFHD 4MDIB 5F96L 4HKJA 3BRGC 1M7IA 1HHHB 1OGAE 4OD3L 1RHHB 4HGKC 5J1AA 2QR0B 1A3RL 2ICWA 3WBDA 4HCRL 1I9RH 5E2JA 5I74C 3DSFL 5K9KA 1WCBA 1FLRH 1CFTB 2V17L 4F57L 4OFIA 1LDSA 5JMOC 3SOBL 4XBPB 2I60L 2LV4A 2GFBA 3VXQB 2Y36L 5DVOA 1KF9B 5CJ5A 4N9GB 5EO9B 3VXNA 4R7DA 4DW2L 1JWUB 4KJPD 3L3OA 4JY5H 4MNHB 1H3UA 3IDGA 1G1YA 5E5MB 1WBYB 2IGFH 5C6TH 2FEEL 4U6YA 3FOLB 3WFZA 3SCMD 1XIWD 4G8GA 5FKPA 3ZDXE 5DD6B 3KYKL 1KFAH 1BD2E 5D2NE 1ZLUH 2Y6SC 5IEHA 1OAYH 3EOBA 1V7NH 2FH8A 3RNQB 1QG3A 4AH2A 5ICZA 1H5BA 2ZUSA 1SYVB 1U8KB 4FXGA 5F1IA 4TTGA 1CVRA 2RR3A 5IW1A 2DLEA 2GTZB 2OLDA 4J7RA 2PNDA 2WP3T 4HLJA 4MXVE 1S78D 4J4PA 5L8LB 4QRSB 1AQDB 5C0DA 4MX7A 1OD9A 4XC1H 3B9KA 3I84A 3K8KA 3K1DA 1RMFL 3P0GB 4CUCA 4G7VH 5T33H 5J8OA 2VLRA 5I1GH 2G5BB 5C9KA 4LIQL 2PO6A 2P24B 1CG9A 1DLFH 1AR1D 5C71A 1QRNA 4P4KC 3TA3D 1P84J 4OZHB 3L3JA 5CBEB 4JQVA 4F7PA 1RJYB 3R1GL 2D7TH 2Q7NA 3HRZA 4NUGH 1P4LA 2J8UF 3QI9D 3MRFA 1YQ2A 1RZ7H 1I8LC 2FJFA 4PJIB 5F9AC 2YUVA 3LEYL 4P23C 2GK0B 1JPGA 4PJHE 1N7ML 3INUL 1OQOA 2DQTL 3HMXA 4LVHB 3V7MA 1KXTB 1U3ZA 3FO0L 4HK3J 5GQBA 3RTQA 5TPWH 4XPGL 2GUOA 5FUCE 1FL6B 4X6EB 2R69H 5EBWA 1E4KC 4R90H 1G7QB 4AT6B 4YBQC 1EZVY 1B0RA 5CZXC 1P5UA 3GIVB 3SDYL 4Z7UE 3GJFH 1ZVSA 3PXHA 3V2AR 4LPXA 2HJFA 1MJ8H 1S5IH 3FFCD 4GKNB 3LS5L 4I3GA 3ARQA 3WIHL 3EFFB 1ZLWH 3VG9B 4YK4C 4HIXL 1CFQA 1NLBL 4M1GH 4R4BB 3DX9A 3RU8L 1Q9WB 2R0WH 1PG7W 1S7XB 4FXKB 2ESVE 2FO1A 4QRQB 1FZKA 5MI0C 5HSFA 4G9FB 3IVKA 2XNAA 3Q5OA 4FNLH 1F58H 1UJ3C 1NFDA 1CLZL 2Z0BA 4JM4L 2FJHA 4C56E 1J18A 1G7LB 2LU3A 3OR7B 4GAGL 4GG8B 4GKSB 4JAMA 3FHQA 2OJZH 4MQSB 1SBSL 2AQ3A 2CK0H 3WIIL 3S88H 3L95B 1IM9D 2Z8VC 2BNUB 3C08H 3VXSA 2H3NA 5JDJA 1LO5B 2BSSB 4C56B 1RULH 2QHRH 5T1MA 2CXGA 3KR3H 3RNKB 2DBJA 3I9GH 1TITA 4G6FB 5HHXL 4HUVA 4Y4KB 2QSQA 1TJGL 2DYPD 4JFZL 5F9OL 2NNAB 4JN1L 4XRCB 5DQJB 3BW9B 5IF0B 3TT1L 1CN4A 4Y19A 4PJ5E 4EUPB 5GGTL 2IPKB 2W65A 3VFNB 1BVKB 4GRLD 4JZNA 3QQ4A 4XHJD 3VGAB 3FQWA 1XF4A 3KXFA 3FOMA 3VD5A 4IRJC 5ID1A 1WJ3A 1VGEH 4RBPH 5ACMA 3TIEA 4HFWB 1CDHA 5F89A 4I0KA 5F8RC 5ITBH 4AJ0A 1FL3B 3BHBA 5C70A 4HH9A 1GGYA 1KACB 4PJ8D 2V7HA 3V5KA 4X6FB 4QHLB 4YXLH 3CX5J 2R2EB 3O6FA 4RIRB 5T1DL 4M48L 4N1HB 4PJFE 1IAMA 1ULVA 4UQ2B 5D7IA 1JZ5A 3LH2L 3R8QA 1Q94A 3ROOB 1N0LA 3PUCA 4F37K 4KI1A 5EOQH 2BDNL 2XA8L 2DM4A 3V95A 3WHXB 2DRUA 1ZEAL 3BP4B 3IXAB 3OAYK 4HS8L 4XBEL 2E7LA 4HWUA 4M8QA 2W92A 1YEJH 4JM2C 4NQSB 4JKPH 4YDVA 5T1KD 3VI3E 2WQRA 4PJFB 3D9AL 1NUFA 4HMEA 1JHLL 2CIIA 4N0YL 5AWNL 4G42B 1EMTL 5DZOA 4Z95L 2IADA 3C8KA 1MHPH 1UM4H 4U1HB 5F88B 4UIKL 4ACPA 3RQ3A 2J8OA 4HWEL 5DUBA 1TVBB 3GRWL 4XP6H 3D0LB 5BO1H 3EYVB 3QUXC 3V79C 1MCPL 3CXHK 3PWUB 3A6CL 3EZJB 4E41A 4WFEE 3KJ6H 4LEOA 2AERT 5IB4A 5FECA 1FV1B 1JGEB 4TRPL 1BAFH 1MJJA 5DRNB 2DQFA 3QUKA 4XVUD 1HE7A 3C6LC 4P3DA 2K7PA 5F97E 5F9JA 1U8OB 5BVJA 4JO3L 4P4RA 1GGBL 1I8MB 2H45A 3T4AA 2JIXA 4LU5H 4XNYH 2OP4L 2PYEE 3O9WB 4NHUB 4CJ0A 4PRPA 2I9TA 4U0RB 1K6QL 4KK9C 3UPRB 3O6MH 1S7SA 2YOCA 4CGTA 3BN3B 4G43B 3UYRH 5BXFA 2OYPA 2PYEB 3OKNA 5DD3L 3WUWB 4F2MA 4TNWK 1UFUA 1Y6KR 4MAUH 1LO4L 4Y5XA 4Z7WF 2DJUA 3GNML 1FPTH 3TV3H 2X10A 3NAAL 1HKFA 3QXTA 1AO7E 4PV8B 1RU9L 4FFZH 5HDLA 3RUGA 1ONQA 2K7QA 4ZYKB 4UB0L 3GSOA 3BQUA 2X7LA 4XCFL 3TO4C 3QDMA 4LCCC 2H9GB 2HFGH 1KB9K 3BT2H 5C09D 4IOIB 3QBTB 4P2CG 4QXWA 1CICD 1XGTA 1HN1A 4NRXA 3WS6C 4HSQA 4X7FC 5B21A 4Q6IB 35C8H 5GZOC 1RUAH 1LP9A 4JFXA 2AV7B 4YDLB 2FSEA 5KOMC 3HCVA 4Z78B 3HUJF 5DVKA 3PV6A 2X4QB 4WDIB 3E6HB 5IW3A 4POZD 1NC4D 5JDSA 3RZWA 5JZ7D 2ZUWA 3W5NA 3S34L 4OF5A 1I1CA 3OXRA 2YRZA 1UB5B 4W4OC 5EWIH 3M8OL 1PZUB 3WN5A 3OJ2C 2P7TA 4J2XA 1YECL 1U8LA 3FN9A 3D87B 2R56H 2YXMA 1FLTX 4D0BB 3D39D 4LPYA 4LSSL 4XMPL 3DJ9A 1A9BB 3RWJA 2HTKC 3CU7A 1T89C 4ALAL 4HK0A 4DGYL 1BECA 3GSRB 2BSRA 4XWOD 1WLHA 4I2XE 4WU7B 4HKZB 5CMAA 3TBVB 1P7KB 4KKCD 1DBBL 3AREA 1T04A 2VDMH 1FIGL 4LSTL 2HH0L 3W39B 2WSKA 3RWIB 1U58A 2D7NA 5IVZB 3CLEH 1HI6A 1YJDH 3KPRA 1TZGH 4KGJA 5JUEL 3X3GL 2W91A 3PDGA 5TF1L 3DXAB 4I2XB 4EZMA 2ORBH 3MROB 3TBTA 4GKOA 4HZLB 4I3SL 1IM3B 2HJLB 1RFDL 1AKJD 3KVQA 2CLZB 2O5ZL 5IFJA 4IRSD 5H8DA 3G08A 5L2KD 2BRRH 5HHNA 3D3VA 3H6JA 1WT5C 2XQBL 3SPVA 3MJGX 4EN3B 3U46B 2R29L 1U8MA 1YEIH 4YNYB 3L5WB 3BZFB 5CGYC 1D6VH 4P2RD 3WLBA 3D2UD 5TQ2L 3FT3B 4LVNB 1QR1B 5T5NG 1PX4A 3N1PC 1HHGB 1CD1A 5SV3A 3LPFA 4BSVA 2AJYL 2WBWB 3DO3A 4XCNB 1BQLH 5KOVC 3IETB 1UG9A 3H9SA 3K2UH 4LKCB 4M9OA 3H3PH 3QEUB 1OWRM 3U1SH 3D6GA 4LBEB 4JEGB 5IBUB 4JPIB 4NQEE 4XPFH 4YUEH 5D6CA 1SY6L 3MLSH 1NC2B 2X70B 3PDOA 1N5YL 1B0GA 2JJSC 4MMXC 3SBWC 1RZJL 1A6ZB 1J1XH 1XGRB 3ZT7A 2NX5A 4LRNH 3KJ4B 2R0ZL 2ADIB 4D9QD 2AEPL 4GQ9H 2J8UE 3ALXA 1EEYA 1T3FB 4JHWH 5DD1L 3U0TA 3Q1SL 4ZUSA 1S9YA 3NCBB 3MV7E 4XVSH 1NCCH 4LVHC 1BOGA 1QBAA 4G80A 3UXFA 5I1HL 1AXIB 5B38A 5KSBA 1C08A 4PREA 4P3CH 3ZE1F 4L5FL 2NTFA 2NYYC 3DYPA 1T5WA 4P4KA 3OX8B 1KJVB 4H26B 4NJAL 3V6ZA 3BIBX 2BOBB 2X4RA 4GAFB 1XZ0B 5LGHL 2I5YL 2VLJD 5GSVA 1FCCA 1I7ZB 1AFVL 4AEIL 4LQFL 4NUJA 1I8LA 1KNOB 1ZVYA 3BP5A 3T8XB 3IDJA 4P23A 1A6UH 1WWAX 4NKDA 1J8HD 1WBXA 3VG9C 4XMKL 3P9LB 5K9QG 2HG5B 2AEQL 4N68A 2P5ED 1T0MA 4MJIB 3UBXB 2HLFC 5C0CE 2ZOKB 4JG0H 2YC1A 1KIPB 3UJIH 1CZ8L 1BBJB 3MA7A 3CXHJ 1E4KA 2GJ6A 5AAWA 3A67H 4NCC2 1BFSA 1BFVH 1E4WH 1U42A 2B4CH 2ILLA 5GS0D 1A7OH 2AJXH 1YQVH 5C0CB 1FJ1A 5GS2D 4M61B 5BS0D 4JY4A 3HAEG 1A1MB 2N56A 5CSGA 2K9UA 1S7WB 3R4DA 3NCCB 4U1NB 2H6PB 3BPLB 4OCXH 3UCRA 3ARBB 4FTVD 4NKQB 1PG7X 1LEIA 3QCUH 4X4ZA 3IGAB 1KPRA 4JRYD 3V5DA 2OTWA 3LKPA 3U0WH 4JPKH 3I2CL 3L3HA 5LAXA 1XGUA 1QP1A 1XF2A 1ZLVH 2Q8AL 1G84A 1A0QL 1UJ3A 4DKEH 4Y4KC 2AXFB 4JDZA 3ES6B 5DJXA 5HYQB 1FNFA 4ZTPL 1MFDL 4BSWB 5C0FA 5KTEL 5E7FA 1IEAA 3SE9L 2J12B 5AUMA 1D5IH 5MEOA 4W6WB 3DX6B 3JBG7 2A38A 3X11B 1XGYL 4TUJB 4WNQB 1RIVL 2BMKA 3QZWA 5TE6H 2G75B 5HYEA 2VZSA 2HP4A 3MODH 3BMVA 1HYSD 3MA9H 3UO1L 4NQCB 3BUTA 4G8EB 3FT2A 2WLYA 2CKBB 5GJTL 5BJTA 1FFPA 3Q6GH 3E3QE 5BVPH 43C9A 4N0UE 4KDWA 4NRYA 1HNGA 1PZ5B 1JYWA 1EO8H 1NBVL 1EGJL 4R3SB 5GGTA 1QYGL 2ARJQ 2NXZC 4JJ5B 1WZ1H 2CLRB 3T3PF 5ALCH 5IR1B 3ILQD 5SWZD 1UXWA 4IRJA 4WGVB 2XPGA 3MOAL 4LCIL 2X9YA 4JFPB 4PGDA 3OKYA 1HQ4A 2A6DA 4X9BA 3ZYIA 4ORGB 2NCMA 4PJGA 2ZCKL 2OTUA 2BY1A 4J23A 3VD4A 2AKRA 2YPVH 4I13B 5DO2D 2XA3A 4NQDB 3QIUD 4R2GD 4PFEA 3P30H 5LCVL 4JFDA 4GRWH 3OPZH 3NCYS 3S36L 3NACH 3W0WA 4LASL 2ZUYA 2R4SL 3S4SA 4HDIB 1P7QD 1QO3A 4JM2A 5HHQA 1CFSB 3PWJB 1W8OA 4P57B 4D0CA 2D7PA 1NDMB 2OR9L 5HI4C 3NCEB 1LEGA 1YEKH 3QFJE 3FTGB 3O4LA 5I0ZA 4OD2A 2FECL 5CIPA 4OJFL 5IQ9B 4O4YL 4FQ1L 1H3PL 3QUXA 3HE6B 5KSAB 4OBSA 4OCSL 2ZCHL 3GRWA 4U3HA 4U0RC 1I8KB 3C6SB 2FGWH 4QRTA 5DQDL 4OCMC 2X1OA 3T4YA 3S5LA 4AG4L 3DMMD 4JFEE 2I25N 3DETD 3MRIA 5DQ9B 4C83B 3L9RB 2ZUVA 2E7HA 5DJYB 4L8SB 3C6LA 4UDUA 5JW4R 1CGVA 4KUZH 1YY9D 2JCCF 3CVHA 3CD4A 3ZLQC 1WZKA 3FB7B 3GMNA 1VEOA 5IIEB 1KELH 4OZFA 4Z7WE 1NJ9B 3D85B 5I1AB 3T3MF 2LU7A 3P4OA 5GGQL 5GZND 5TQ0H 3CX2A 1MHHA 1C5CH 3KLDA 3BVNB 1CLYH 2Z8RA 4BK5A 5DYOA 1T2XA 3QNYB 3MGOA 1CIDA 1RZ8B 1OSZA 15C8H 4NJ9H 3LRGA 4PGZA 2XQYG 3K80A 1J0IA 4YDLC 2AJ3A 4GOSA 5BCAA 2V5SA 1KEML 1FORL 4QXUH 3I02A 3BIAX 5CJQH 2RQ8A 4YPGA 2VERN 5EZLB 5KJRL 1HHJB 2A1WL 1NAMB 4EI6A 3TO4A 3NFSL 4LCCA 2WWMC 4JFQA 1D5ZA 3BISA 4QRRD 1UH4A 5E9DA 4BELD 2A9ML 2CDEB 4KKBC 1K5NB 3KPPB 5I8OL 2VJXA 3QEHB 5MHSD 4U2YA 1M7DA 1MFCL 3WS6A 1ZA3B 1PKQE 4XP5H 5MP6L 4RWYL 4K3JH 4JQIH 3QWOA 3EHBD 3S7GA 5JLZB 1EXUA 3IU4H 1IGYA 3CCHA 2EC8A 3AS1A 2X42A 4HS3A 5L6YL 1F6LL 4LPWA 2FLBT 2O26U 5F71A 4AL8L 4HIHA 3PWNB 1F97A 3MLXH 1BGXL 3CSYB 5LBSH 1Z9MA 2Q1EA 3FCTA 3AS0A 5JQHC 1XMWA 5HVGB 4MS8D 4GSDH 4NCDA 4W4OA 3V8CA 5M94B 2D2OA 1U3JA 3FZUC 4MDIA 1HHHA 3UPAA 1RHHA 2R9HD 2QR0A 1FVDB 2ICCA 2QSVA 1GPOL 2N4IA 2F5AH 4TPRL 5JORA 2LTQC 5KW9H 1KYOK 5DUML 2ICWI 1CFTA 3QYCA 1T89A 1OPGL 3G5YB 4XBPA 2BVYA 1U3YA 2D3VA 5D7KD 3VXQA 1ERNA 4EN3C 1A6WL 3O8XB 2YZ1A 4G8GD 3RIAF 1F00I 3BDBA 1QTYT 5DC4B 2YPKA 5F7HA 4FQQA 4MNHA 5IVXF 5E5MA 5EOTB 1Y18B 1FNEB 5EIQA 4YHNB 2WMPA 5FEBA 3FOLA 4LVNC 2DQDH 2ZJSL 5DD6A 5FDYA 1UACL 2N7BA 1GHFH 4NHCH 4WHTA 4X4YB 3EBAA 2FJGB 2Z8SA 3FONA 4Z5RA 3RNQA 2WAHA 3TFKC 1Z0NA 1WT5A 1U8KA 4D9LL 2Q86B 4RRPG 1EHNA 3SQOH 1BVLB 1CU4H 3B2UC 3QDAA 2GTZA 1JGVL 3BN9D 4R4FH 4AEHL 4D8PB 1BD2A 1CXLA 4ODUA 3TWCH 1AQDA 5I73B 3QIBB 4JKKA 4RWHA 3FQXB 1DQLL 1R3JB 5SX5K 1SM3L 3KJ4C 4OCRL 3BWAB 4HXBH 3ZO0A 3E8UH 1YEGL 2VXUL 1QRND 1U3HB 2BVOB 4LKXB 5ESAB 3RY6C 5GRVK 3HMWL 2IBZX 1IKNC 4ODTL 2G5BA 4MNGE 4K8RL 2P24A 5LXGH 5FK9B 1OP5H 5I15H 3LHPH 2AXJA 2JB5L 1INDH 4WEMB 4Y16D 3ZE1E 5HPOA 1SY6A 2JJSA 3CK0H 1TJIL 5CBEA 2R39A 3RWFB 2P49B 4KRLB 1RJYA 5I17A 4K23H 4QHMB 4M1CD 5C0JA 4U1SB 4WY7L 5J9PB 2RIKA 4LSRL 3T1FB 2NY2B 3WJJC 2GK0A 3EOTL 3BP7B 3SDXF 1MIEL 1LEKB 2LE9A 1DL7H 2ATKB 5JXEC 3KAAA 5EDXA 1FL6A 1RIUH 1KN4L 3QUYB 2YSSB 3HB3C 2FBJL 4F58H 3VJ6A 1GXEA 4AT6A 2MCPH 4C58B 5IQ7L 3GIVA 5JXAL 1CCZA 1YUHB 2DL9A 2W9EH 3U9PL 5JW4Q 1C5BL 4AEFA 1JNHB 4GKNA 4GG6F 3EFFA 2ZG1A 1FNAA 4D2NA 5JW5B 1A8JH 5E7BA 3BPLC 3BSZL 4PD4J 1FN4B 3MJ6A 4R4BA 3QWRD 2Y9RT 3SGDI 3B6SB 1Q9WA 4M4PA 4XP4H 2XRAH 5DHVB 1I85C 4QRQA 4G9FA 2B0SL 3GUTB 2E9WA 4NZDA 3BPCB 1CFNB 2X1WL 4JY6B 4HMDA 4YO0A 3OR7A 2DQUL 3BEVB 3HG1D 4GG8A 4GKSA 4G6JH 2ESVA 1SJHB 4M6OH 1C5DB 1CF8H 2VL4A 3L95A 4XTRD 5DJ2B 5FM4A 4D0DB 2BNUA 1Y6MR 1BBDH 1LO5A 1XF3B 5GS1B 2BSSA 4Y19D 4C56A 4ELKB 3RNKA 1OAZH 3OB8A 3TO2B 3NFNA 4GXUM 1UQSB 3MNZB 2HWZH 2CKBL 2ICES 4WFHE 2VSCA 4Y4KA 5DTFA 5MERB 3SDCB 2Y06H 5IF0A 2NNAA 3MREA 5DQJA 3BW9A 1MRFH 2EE9A 5SWSB 3UTTB 4EUPA 3O2VH 4H0GA 4TQEL 3W9DA 2BNQD 2IPKA 1BVKA 1WCQA 2Y07H 5IKCA 5GS3A 5FYLH 5FUZH 4ZD3L 3AU1B 3T3PE 5GXBB 4HFWA 5F7MC 3E3QC 2XTJD 1L9MA 4OM1L 1FL3A 4CADB 1B0WA 3C2AL 4V1DE 4ZFOA 3PHQB 3T2QA 3V4UL 4BUHA 1LK2B 3F5WB 5D7JC 4QHLA 2R2EA 3DI3B 3I6KB 4H20H 4O2EB 2VZTA 3EKCA 4P9MH 4UQ2A 1S9WB 2C3XA 3O6KH 4ONOA 3MUGA 1JGLL 4PJEF 3MLVL 3B43A 1QSED 1T22B 3HNSL 4J3SA 3WHXA 2EYTB 3BP4A 3IXAA 1EGJA 4OF6A 5FYJH 4BM7A 4N5UA 1A7PL 4DEPB 3W11C 1UWEL 5IW6B 4NQSA 1EBPA 2VH5H 1J05B 1G9ML 4PJFA 3EYOB 4WWKD 1QNZH 1XIWB 3SCMB 1X5AA 4R6UA 1G9MC 4Z76B 4JZJB 1KIQB 3WL9A 4X7SH 3LPWA 4G42A 3PP4H 2FRGP 4P59L 2Z4QB 3WNLA 3IF1B 4LLUB 5GRYA 5DI8A 3BIKA 3IRPX 1IC5H 3ILPB 3MC0A 1TVBA 3EYVA 3HE6C 4LLWB 3ZYJA 5CGMA 5KSAC 2D4DA 3PWUA 4QT5B 5GRWA 4LEXL 3OAUH 5EH1A 4X99B 2VDPH 2DLFH 1YYMH 2AJVH 3HFML 3MRHB 3HI6L 5DRNA 5F6IB 1GIGH 4CDGC 4X5XB 3DV6B 4L8SC 3IKCB 2D7OA 1FFOB 4J3WA 1U8OA 1VDGA 1N59B 3DGGB 2DLHA 5FFLA 4M1DH 1OB1B 2OZ4H 2P4AB 1U8IB 1X5FA 3RI5F 1I8MA 4WW1B 5CP3A 4QCIB 5DJCA 3OAZK 4MJ5B 4NHUA 2R0KL 2FO4B 3THMH 4P9HL 3PWPE 4FHBD 4YHZL 4JCLA 4P9HC 1NBZB 4F9LC 1L7TL 1ZT4B 2HN7A 3T3ME 1CGXA 3V0AC 1EO5A 3TA3B 4FMFA 2A6IB 1LD9B 1P4IL 3UPRA 4DN4H 4M6ML 5A3IC 1T1ZB 4G43A 3QI9B 2XG4A 3BOVA 2PYEA 2XG5A 3WUWA 5F7FA 2HT4D 1YN6B 1Q0YH 4JO1L 4LF3A 4EI5D 5EOCH 4X7DC 1JL8A 4ZODA 5JA9A 1BQHG 3P9WB 3I75B 2PF6A 1TJHH 3EYFB 4K55A 2X1XR 1UB6B 1F42A 5I1JH 3T04D 1JNLH 2C26A 5AZEH 2GJZA 5EUOB 5F72S 2BVPA 1NAML 5CJOH 4QTHB 2FX8H 3QDJD 1NUNB 4PIRF 5FYKE 1K4DB 5D7SL 4M5YL 3U7YH 5BV7B 4IOIA 1A1OA 4OTXL 4C59B 1QRKA 1AO7A 4GRMB 2BXYA 4KHXL 5GIRA 3FFCB 3T0DA 4XI5D 1T4KA 2HT2C 4B5EA 1I1YB 1G7MB 4FQLL 4NO3B 3VMOA 4Z78A 1Z3GL 1JIBA 5DURD 4X8JB 1MCFA 1F4XL 2X1PA 2X4QA 4WDIA 5DFVD 5JIIA 3E6HA 4GXVL 4DFHA 4OSUH 5CCKL 3X14B 1OGTB 4OGAD 4ZOCA 4ZUUA 1IGTB 3TYGL 3TNNB 2A73B 1TQBB 4YWGH 3B83A 1UB5A 2BVTA 4PLKC 4KJWD 1VERA 3QPQC 1RIHH 1GGIH 2F53D 3RGVB 2FGZA 1KCSH 4NDMB 2E7CA 5IMLB 1IM9B 4D0BA 4JVPA 4NRZA 2DJSA 3B4NA 3S37L 2WWKO 4FFWC 4U6TA 4FQ2L 1A9BA 5KVMC 3QHZH 4X6DF 3GSRA 5D5ME 3LQAC 4HKZA 3TBVA 1P7KA 3GIZH 2YBRB 3VXUE 3OF6D 2DYPB 2X4NB 4GW5B 2AW2A 2NZ9D 3RWIA 1XEDA 2GK2A 3S35X 5IVZA 4GRLB 3FO2B 5IVXE 5D5MB 3DXAA 4I2XA 5IBLC 3VFRB 3ZTNL 1RZFH 2VO5A 3MROA 3VXUB 4KTYA 4HZLA 1IM3A 1KJ2H 2R4RL 2FWOA 1JK8B 1FRGH 2CLZA 2IF7A 5KAQF 2WK2A 1KEGH 4ERSL 4E5XA 4PJ8B 4JPVH 2I07B 4EN3A 1D6EB 3U46A 4TTDC 1XGPB 4XWGL 3PABA 3HLAB 1OF2A 4WEBL 5C08D 5JHLH 5TGBB 4C4KO 4ZNCD