1B0WA

Structural comparison of amyloidogenic light chain dimer in two crystal forms with nonamyloidogenic counterparts
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCQASQDISDYLIWYQQKLGKAPNLLIYDASTLETGVPSRFSGSGSGTEYTFTISSLQPEDIATYYCQQYDDLPYTFGQGTKVEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords BENCE-JONES KAPPA I PROTEIN BRE
publication title Tertiary structures of amyloidogenic and non-amyloidogenic transthyretin variants: new model for amyloid fibril formation
pubmed rcsb
source organism Homo sapiens
total genus 26
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b0wA00
2RB8A 3F62A 4HGWA 3LQZB 3FQNB 1CLOH 2JE8A 3HZKA 3ARSA 4HAFA 2NMSA 1J7VR 2E7LA 1KB9K 3IXTB 4IMKC 1DDHA 1P7QA 4KK8D 1XCQB 1NFDA 3I2CL 5GRZA 4JFQA 3CLEL 4IHOB 5F44A 5C08B 1HSBA 4J3WA 3TVMC 4HPYL 4X5LA 4NRYA 2C4FT 1A7OH 2B39A 4FQ2L 4ZFOB 3MRCA 3WJLA 4PJEA 3F7VB 4K71B 3U7WL 3MRRA 1OT1A 2VKXA 4X8XA 1G9NL 4LCCA 2R56H 3UP1A 5GRJH 5CMAA 1OCWH 4X6DA 5D5MA 2FATL 4LP5A 3IS0X 3V8OA 1BZ9A 3S9DB 4Z78B 5GZOC 4Y8AA 1RD6A 1XF5B 3DVNA 5L8KB 5EU4B 1BX2A 4Q58C 1II4E 4Z77B 3VXMD 4PTUA 2YRPA 5FYLH 3EOBB 2LE9A 1MPAH 1I7UA 1NEUA 1TXKA 3C8DA 5HTSA 2Z91A 4H1LH 5HHXL 3TNNA 5DHYA 3G08A 3IT8D 5DSCA 3QZWB 4KUZL 4R4FL 3WLWC 1JRHH 2WUBH 4OZHA 1U8OA 1RQ5A 3SCMB 4G6JH 3BWUC 3FJTA 1N6UA 2DI9A 4NKQB 1FH5L 4FFYH 2FHCA 4N8CH 1KELH 3FT2A 5GZND 1GPOH 3S3PA 4IRJD 1ROWA 3U7YH 5HYQB 5I1AA 3MSPA 3HRZA 3AROA 3BE1H 1LVEA 3O8XC 3WDIA 1DBAH 1KB5A 4FQQA 1GOFA 1OAXL 5EORH 5F3BB 3ULUH 4BK4A 2OYPA 1UACH 5C0FA 3KNBA 2VB5A 2ZUWA 3IDYB 2YKLH 5ALBH 1RHHB 3SDCC 1CIUA 4P2OD 1LK2B 1HYRC 1ZOXA 4ZFFA 5AWNH 2IBGA 1D9KC 4XVJL 3FMGH 3FB8A 1EZVY 5I8EA 4CU6A 1ZAGA 4JHWL 5IF0B 3U36B 1FZKB 3VDBA 1Q0YL 2E9BA 5EUOA 5DZNA 2OJEB 4O2CB 3LB6D 2N4IA 1ZS8B 2PCPB 5CIPB 2P49B 4JAMA 5GRXG 9CGTA 2ATKB 4ZFGL 1TPXB 5C08D 2XWBA 1MAKA 1LEGA 2FJGA 2FLRT 1CGSH 2R9HC 1UB6B 2X4PB 1F3JA 3P9LA 3QO0A 3FO9A 2V9QA 5FHAH 4OZGB 3GRWL 1KB9J 3C6SA 2AK1L 3DI3B 4BH8A 1FHGA 3DV4B 2R8SL 5E8NA 1DBJH 1KPRB 4X5XB 2QHRH 4LCWA 1ZT1A 4GG6F 5AYQA 4F80A 4Z0XB 4YDKH 3PDDA 5E95B 4XI5D 5HHVL 3ES6B 3SDXF 1A0QH 2CKBH 4G8EB 1Z3GH 4JY4B 2DMCA 3QYCA 5E94B 2BNQB 5DVNA 4Y88A 4LRIA 5TQ0H 5FGCE 3VFPB 3RWGB 2HJLA 4N0CD 1W72B 2O5ZH 2PXYC 2AERT 2WINB 3IDNB 2PR4L 4P9HC 4I0KA 4LSSH 5BS0D 3NGBB 2Y36H 2FGWH 5JMRA 4XNXH 4N68A 4S0SD 4G8GB 2ESVE 3HMXL 5C0RL 3SCMD 2VOTA 1TTFA 3L5XL 4I48B 5DRXA 4MQ7A 1N0LA 3HZMB 3OR7B 3T0EE 2R0ZL 1FNFA 5CD5C 5FYJE 1P5VA 1W0YT 2DYPD 2EEDA 3F58H 1MI5E 2VLLB 1ORQB 4LBEB 2YSSB 3FQTA 1TQBB 2DI7A 1KCLA 5K9KB 5E5UB 4PPTA 1Z5LB 1JNNL 4TSAH 5BVJA 2Y9RT 3IF1A 5ID1B 4N0RA 4JREC 4ELMF 1NC2A 5KANI 5IEKB 1N26A 4P4RB 4K3EH 2JB5H 2MWCA 1IGYB 4I0PB 4OCWH 4MD0B 4HIJB 1X5FA 1XMWA 4XP5L 4X6BA 5B8CB 1JYVA 7CGTA 2A0LC 1CE1L 5KVMC 3OR6B 4NP4H 4QHUA 4R7NA 3OB0H 4KJQD 3DROB 3ILPB 1RU9L 3ARXA 5ESQB 1NLDH 3W9DA 5EULV 1EGJH 4Q9QL 3RDTA 3V6OC 4I5BA 3STLB 5EBLA 4JFDA 4M93B 3LN4A 1N59A 4PB0L 5KS9E 5IVXA 2C3HA 1MCBA 5I17B 2HTKD 3VU2A 3INUH 3U0WL 32C2A 2XZAL 5D2NA 1OAKL 1XR8B 1MCRA 3GHEH 2YPVH 1ITBB 3RNKB 4NNPL 2FO4A 3C09C 1WWWX 4TNWK 1OGAE 1SYSA 1RUPL 5HHQA 4Y2OA 3TC9A 4KHXH 5EUKB 4JE4B 3MNVB 4UTAL 5HPOA 4N0UB 3TPUA 1CFSB 2BSTA 1YEFH 3NCJL 3SJVA 4GUPB 3H7LA 1URLA 3AS2A 4HJ0D 4GLRH 2X4TA 4ONOA 3QG6A 2VLRB 3HUJE 1IBGH 4QNPE 1ZT4B 1JYWA 5DJCA 3U46B 1C16A 4X99B 1A3QA 2IFGA 4K3JH 1XZ0A 4FABL 2J6EA 4G8GD 3A6BL 2AV1A 4U0RB 3VFSB 1FL6B 1U58A 4XCNA 2IMMA 4GW4B 2JKXA 1HE7A 1MFAH 3KJ6H 3MRMB 2SEBA 3H7BB 5DR5H 4MJ4A 4KQ4L 2IPTL 4I3SL 1EAJA 2CUIA 3HMWH 1P7HL 1KYOK 2M2DA 3UTQB 1OB1A 4ELKA 1V7MH 2VABB 4I77L 1YC8A 3ZSSA 4U6YA 4GS7C 5TQ2L 2BHYA 4C4KO 5I8OH 2NY7H 4DKFL 1TCMA 2J12B 4GSDL 4O02H 3HE6C 3U0TB 4UZGA 3JTSB 5GS0C 2QSVA 1WFUA 2XZCH 3O81A 2DLEA 3HE7A 4M6OH 3FN9A 4HIXL 1HXMB 1ZTXL 1UWEH 4N90D 5CUSL 5H94A 4QXUL 5LBSH 3GKWL 4BM7A 4PJAB 5JO5B 5INCB 2F54A 3L5WB 4PJCA 3ZKNC 2E8YA 5C0JB 5HHMB 4TRPL 4HFWA 1R3JA 4OLUL 1SMOA 3EZJB 5FECB 2FBJH 5GJTH 4ETYA 3E0GA 1RZJL 2IPUK 3QIWD 1NMBL 5TDNB 1X5HA 1N8ZB 2H32A 5DJ6A 1MWAA 3D3VE 2FX9L 3EYVB 3MLZH 5I76B 2NY5C 3NTCL 5C0DA 3I3DA 4PP2B 4BKLA 3CNKA 1FYTA 3WO4B 3MRBA 1HQ4B 5I75B 5FUOH 4OZIE 1LP9E 4ZD3H 4IIQA 2JIXD 1G9EA 1FORH 4GKOA 3WXVL 1T6VN 3FFCA 3QDMB 3KPLA 5DTFA 2YZ8A 1Q9LA 4JRYA 2NNAB 1FO0B 5EOQH 3CSBA 5MEOA 1U91B 4F33B 1MFDH 2NR6C 4JDTL 4M7KH 3AU1B 5HYSB 3AC0A 4P2YA 1UA6L 3ARFA 2OXGA 4PLNC 5FO8A 2BCKB 1PSKH 4PJDE 3D2UB 4OQTA 3SO5A 4JB9L 4QGTA 3SDDA 2VUOA 2YUWA 3DI2B 3NACL 1HXYB 2VLRD 3MBXH 3TV3L 4Q7DA 1DUZA 1XF3A 3SKJL 2FSEB 1RHFA 2W38A 4OZFB 4K23H 2VXQL 4JJ5A 4PGEB 1SBBA 3O2WH 4JO2H 4OF8A 4DK6A 3LEXA 3D0VB 2W9EH 3NBNA 4WJ5A 5D96C 2DAVA 3QUMA 2ZSVA 1OAUH 3GEWB 4XRCB 4OV5B 1JPFA 3KPRE 4RWHA 2VYRE 1H8OA 4FQXA 3PL6B 5C3LD 4XPHH 4YFLI 4UMGA 3MRJB 4KVCH 3LMJL 4XCEA 4HUUA 1FL3B 2VDML 3HNSH 1IC7H 3DYOA 4NKIL 3AMLA 4LCYB 2XACC 1EMTH 2VWEE 4OZGF 4U3HA 1FZJA 1NGPL 4RZCB 1EEZB 2W9LA 1U8JB 4KK8C 3UEZA 1T80A 1NJ9B 4MQXD 5IVNA 2B0SL 1U8KA 2AJ3A 4G6KL 2OL3L 2DIBA 4PV9A 1YDPA 3KYOB 3UBXA 4DZBB 3SKMA 5HYJE 1X7QA 4UOW0 1D5XB 2CGRL 3KYKL 5EBWA 5HHMD 1IC1A 1YNTB 4ZSOB 2GJ6A 3Q1SL 2WBJA 4OAWB 2P5WE 3NCCB 5KSVB 1U6AL 2B2XL 2P47B 1TZIB 1X4ZA 5FYKH 2X4SB 3L7FB 1T7WA 2IQAA 4RCAA 1BQSA 1QFPA 1RZ7H 3LZFH 3NN8B 4MLIA 3WS6A 1AD9A 2I26N 2GTZA 5C09A 1NL0L 5IGXL 4K7FA 1HINL 2OX5A 4H20L 5E0QA 3ROLB 3TBVA 4MYWB 5SWZA 2X1OA 4Y8DC 1U93B 3QDMD 2Z31B 1SBSL 4MA7L 12E8H 1E4XI 2AI0L 1KIQB 5EA0H 4RMWA 1R6VA 1NCBL 3OAYK 4QY8A 2PYEB 5ICZB 3CVHL 1W8OA 1UJ3C 3BP4B 3HR6A 3DNKA 4H25B 1B2WH 5GZNC 3D2UD 2Z35B 4IRJC 3VXPA 3QG7L 4PJGE 5BCAA 1IRAY 1NCDL 3MV8D 1A6ZB 1MJ8L 4X5WB 4C83A 3HI1A 2D7OA 1QTYT 2LAGB 4MA1C 5DMIL 3UZEA 5J7CC 3SE8L 3O4LE 1RZIB 3MV01 1EO5A 4PG2C 1FZOB 4WWKB 5T5NF 5IR1B 4BSWA 5GISH 4QRRE 4FZ8H 2OBGA 4P2OC 4F57H 3CMOL 3PL6D 35C8H 4J2XA 4JM2B 2AV7A 2WLZA 3EO0B 3M17B 4OCSL 3TYGL 4X6CA 1YEJL 1QVOB 1RUML 1FAIH 2X4QA 3TIDA 1FPTL 5EIIA 1A3LL 5AUMB 4ZYKA 3LB6C 5FOBA 2COQA 1I1YB 1MH5A 1UM6H 4QHKI 1A47A 2O5YH 4NO2B 1IGCL 1BEYH 1OTUD 1ES0B 3VA6A 1JE6A 2ZSWB 1R5IB 3OKNB 2BSRA 1CT8A 1DQLH 2DOCA 1T83C 4GRLD 1JPTH 4K71C 1MF2H 4PJ7E 4TRPH 5K59F 2X44D 5HGHA 4L4TA 1DBML 2ED9A 1J0YA 2QADB 4NKDA 4YFEA 3S37H 4NQVB 1KNOA 4NKMB 4YHNA 3BJ91 1CXEA 1KENH 4U1KB 3ZYZA 4HS6A 4D0DA 4XI5C 3B5HA 4R96A 4OGZA 3C2SA 3NAAH 5DEFA 5I1CH 2EIDA 3MRDA 5TF0A 1LDPH 2FX9H 2WANA 1H3GA 1G7QB 4BFEA 5FDWB 1HYSC 4OLVH 2H8PB 3V0VA 1NCAH 3MFFA 3O2DH 1FC1A 1KTRL 4N0CC 4YIQB 5DJ8A 1MJJA 1IFHL 1FGNL 3VRJB 3S3JA 5HHOB 5DJZB 2OR8A 3IKKA 3SO3B 1G7LB 2NY6B 5IMOB 1V5JA 4JDTH 5KVGL 3ZYOA 2BVPB 3FT4A 4RAUA 1NH6A 3CZJA 4NJ9L 1C5BH 1AHWC 1U8HA 1ZHKB 2PYED 3WO3B 3GMPA 4ZOAA 4HAGA 4U1IB 2XA8L 1CDIA 5GGVY 4M6AA 1BIIA 3VCLA 1J12A 2DLHA 4DZ8B 4ONGL 2DQCH 1ADQL 4KVNL 2BXYA 1U3HB 4F37F 3QWOA 3QI9B 3RBGA 4P5TD 4JFFD 4O2EB 5KSAA 3KPMB 5IQ9A 2ADJB 3QUYA 4PJAF 4P9ML 3KS0J 4WWKD 3IDYC 1BHGA 3GK8L 4P3DB 4NO5B 4X7DC 4LCUB 1KV3A 4PJFE 3MRFB 3N9GL 1CR9H 4V1DA 4OCYH 2ARJQ 3ZE1F 1JIBA 4H88L 5L2KB 5CGTA 4XPFH 3RWCA 2IPKB 4KJQC 3DETD 1KJ3L 4NHUA 1G7JB 3WIIH 3TFKD 1TPXC 3LIZH 1KJVB 1F11A 3EGSA 4NQCA 1NFIA 2NCMA 1LO5A 2HTKC 5BVPH 4ODTH 4Z7UE 1BAFH 4P23B 2A6KB 1EZVX 5C0AA 5F9OL 4LKCB 3SDCA 2QADD 2Z0BA 1D9KA 3SBWA 3OAUL 5A16B 1WT5C 4GBXA 4J3XA 3BMWA 1NBVH 4R90L 4NQDA 5LG1A 5IHBA 4LAJH 4P3CL 2AJUH 2K1MA 4ZNEA 3ULVE 1B0GA 2CK2A 4LSPL 3PG2A 2ZJSH 3TH4T 1A1OA 1NL0H 1NUNB 5HGGS 1X5ZA 2APTA 2YPKB 2WP3T 4NM4L 4HJ0C 4H20H 4HIIB 1C08A 5MEQB 1BQHG 1K4DA 5L6YL 4GRWB 4GAJL 1KCSH 2YD9A 1ZK9A 3PABA 3IS1X 4HIEB 2NY6D 3BSZL 1G9MC 2GY5A 1IQDB 2V7HA 3GI9L 1A6AA 4NQXA 3NGBC 5EPMA 5TH2A 3VE0B 3EJZD 4OLWH 5I1HL 1I75A 2H26B 4JKPH 1L4IA 1QLRB 3OQ3B 4LHJB 1K2DB 1UWXK 1CF8H 3QDAA 4U1SA 2APFA 2R0WL 4CL7A 1Y0LA 2BXZA 3JV4B 5D93B 1U3HD 1CGWA 2EC9U 3QI9D 5F7FA 1TQBC 3VI3E 3BP6A 4PYHA 1DLFH 2LVEA 5DHXB 5D2LA 4YDVA 1IT9H 3BD3A 5DEGB 1HIML 1IZJA 2AK4B 4PUBH 2CIKA 2FB4L 4BH7B 4C56E 5C0CB 2PXYA 1IEBB 1YEEH 3ARVA 2NY1C 4OUUB 2Y72A 1NCNA 5IFJA 2XPGA 5HBBA 4NGHL 2VL5B 4RISH 4Z7WA 1S3KH 3U30C 3T2QA 3DX8B 5B8CC 1OTTD 3DRQB 4NZTH 1ZMYA 2GQHA 3BZEB 5DVKA 3P30H 2P4AB 5L2KD 3QIWC 1D6VL 3BAEH 1QFWI 1Q38A 3ZYJA 2WUCL 2Y5TB 5GGTH 1IKFH 3WUZA 3UC0H 1JPGB 2XKNB 3MFGB 5JIKA 1GCFA 2IGFL 2DQUH 4P23D 4TQEH 4G7VH 3BQUC 5J11B 4P59L 1CU4L 1Y6MR 2JLLA 3BP5B 2AJVL 3QDGB 4NHCH 4Y16A 1NSNL 1MCQA 3KPNB 3QDJA 2GTWA 4ZOBA 1T22B 2IAND 1CICA 5J57B 1MLCA 1QRKA 1I7RB 4F3FA 4EIGB 1CI5A 1ND0A 5EU6A 5JXEA 1RY7B 3V6OA 3FFDB 2GFBB 3GMMB 1TQCC 1WIPA 3KDMA 4XMLH 5E8DH 3IXAB 3AVEA 1YUHB 1BLNB 1VFUA 2DQFB 3UJTL 4JM2F 4AMKH 5FFLA 3CZFB 2R15A 3ARQA 1BGXL 4KI5D 5J9PB 2LU7A 3QCVL 4WO4D 4PRHB 2P8LA 1A7QL 2MTPA 3PGDA 4U0RC 4PV8A 3PDOA 1BJMA 2XOTA 4D0BB 2UWEA 3BW9B 3CFCH 1OAQL 4J6RH 4OI9A 4PRIA 3T2NH 3MUGA 2B8OT 4MNGE 4S1RH 3TBTA 2EDOA 3V4VH 1P4BH 1Z9SA 1EO8L 1FAKT 4M43H 2AK4D 3EHBD 3VFUB 5T1MA 4MQXC 5C0CD 1ACYL 1JHKH 4PJHB 4OUOA 3FRUB 3SN6N 1UT9A 1YYLL 1S7SB 2BSSA 2X9XA 1JV5B 1Z2KA 5DHVB 1U36A 5K9JL 3MRPA 4TPRH 5JHDE 4NWTH 4H88H 3VGFA 3T09A 5B3NA 1TETL 4UNUA 5ALCL 2IWGA 5ELIA 1XCTA 2YOCA 2UZIL 1Q1JH 4OLYH 3MUY1 4L3EA 1U8QB 4NCC1 1DBBH 1U8NA 1XGTA 4F37K 1J05A 2X89A 5JDSB 1IAIL 4X98B 3VG9B 2Q3AA 4JG1L 4OB5H 3C08L 3KJ4B 1NC4A 3DURA 4NQEA 4PGDA 5C70A 4FQLH 5GS2D 1JNLL 3HE6A 3IU4L 3VXSA 1MHEB 2EKSB 5I75C 1KJ2L 4KKLD 2I9LA 1MCOH 1A9BA 4CMHB 3W0WA 1INDL 3JV6B 4X0KB 4HC1L 5C0EB 3H9SA 3V6FA 4NNYA 4LSPH 2F5AL 2W60A 3QR2A 2EC8A 3LSOB 4Z7VE 1ZEAH 3RWFA 2VO5A 1NANH 4XCYB 1G0XA 1F2QA 4GAJH 5BRZA 3U48A 5KW9L 3RFZC 3M1BB 1OF2A 4WU7A 1WICA 2E3VA 2ICWA 3KVQA 1G9NC 2JJWA 3DX6A 2DQEL 2HT3D 4PRHD 2FZ3A 3MRHA 2X40A 2DQHL 4XMPL 4TUOB 1NEZB 3TH2T 4ZODA 3PL6C 4C57C 4F15B 3MV7A 1SQ2N 4JPIA 2XG4A 1FBIH 1FCGA 4O58H 3MZGB 4QHKJ 5CZKA 2PNDA 4LLDB 3SPVA 4W81A 2ZUYA 1QSEB 4LF3B 1CL7I 4PR5B 5IB2B 3BZFA 2Y25A 5D7IE 1N0XH 2CDFB 2HKFL 3BKCL 3TBWA 4J1UB 5IHZB 5EOTA 2FB4H 1XH3B 1AXTH 1EEYA 4ZO7A 1UKTA 4YHKH 4CBPA 1VFMA 2VXSH 5KOMC 3D25B 5HGBB 3V2AR 1MCCA 3U9UA 1OTUC 1P9MC 2F8XC 1CFQB 3EOYG 3FQUB 3IJYA 1A4JA 4YXKH 4MXQC 4P4KB 4LLQA 5J6GA 2J7LA 4GRLC 2VIRB 3CFEA 3GSNA 5HDQL 2EE9A 1A6VL 3F6IA 3LD8B 1JUFB 4U6HA 2C1OA 2VLJE 1T89A 1HCVA 4JRXE 2WZPD 5E9DB 2W92A 3MXWH 3V52H 3X13A 2E7HA 2X4OB 5I2IA 4XCFH 3BPLB 1FNHA 1WLHA 4LLYA 5DQJA 1KFAL 2WWKT 5HD8D 1RZGB 5TF1L 2A6DA 3RI5F 1UFUA 4CMMA 4YO0B 1BVKA 3R0NA 4LOUD 3NIDF 4UDUA 4P2RA 2R4SL 4KI5F 3AB0C 5C86A 2FJFB 4K94H 2FWOA 2B5IC 3IJHA 4MXWL 1SYVB 4LQ1A 1ZVSB 1RIUH 3JUZA 4RGOL 4A2LA 4JKMA 4KQ3L 3GUTB 3T4YA 3ZE0E 1KPVA 5CIPH 1F8TL 1MHCA 1WC7B 2A6IA 2QKIB 4TOYL 3RL1A 2W0LA 1A6WL 1R3LB 3KLAA 2EH7H 2HTLD 5GJSL 5D7SL 1G7HB 4MJ5B 4OGAD 5A3IC 5EZOL 1KIUA 3GSRA 3HLAA 1XGUB 1VGKA 4EQ3A 5T3XH 5CGYC 1UZ8A 2R1WB 4LSRL 2NX5A 2RCSL 5CJXC 2A74B 1MIML 5KS9F 3UTTE 4HKZA 4P5TC 5ICYB 4HK3J 2YUVA 1KTLA 3FB7B 1MFBL 3O3DB 1NCUA 1ZSDB 3IGAB 2VDPL 4Z76A 5I1LB 1AI1L 5IB1A 1J11A 3P9MB 4I18B 1S7WB 1A6TA 2AEPH 2J2ZA 4R4BA 4WFFD 1J1PH 3CPLA 2MCPL 3FB6B 4X6FA 3PGCA 1UWXH 3ISWA 3QQ4A 1W72H 4IS6B 3MRQB 4X4MA 4J3OC 1PKQB 1UJ3A 3DETC 4M1CD 3IDJB 1MY7A 3AFLA 4IRJA 2A1WL 1AE6H 1CLZL 4M6NL 5KG9B 5F72S 2X9YA 1SJXA 4O2FA 4P5MA 2L7JA 2V2TA 2VLKE 3WHE0 3CX5K 4P4KD 5DFVD 3WSQL 4RRPA 3EYFA 5IQ7H 1QBLH 3L3HB 5H35A 1AD0B 4N0YL 1YEGL 1MCWW 3EOTL 4ORGB 4JFEE 3HA0A 4OT1L 3MRIA 2V17L 4ZFZB 5BOZG 1XGRA 5A2JH 1AGEB 1CGTA 1WWAX 5IW3A 4ODSL 2GSGB 3I85A 5FA4B 4NOBA 4HCRA 3WEXA 5JORA 1G1CA 1F00I 4LFHG 3BRGC 3NPSC 4NSKB 5CJQL 5KVFL 2NY6C 3FN0L 3QA3A 1T83A 4ZO6A 4EVNB 3F7VA 3PGFH 1FGVL 3QFJB 3DO7A 4JY6B 3EJZC 3LEVL 3VFOA 4M1DH 5F6HI 5I1JH 1EJOH 5KW9H 1MCDA 4JGUA 3WNNA 1IGMH 1F90H 2YK1H 5EIQA 4HLZG 4U1MA 3VWKD 1U3HC 4D0CB 2CXGA 3DO3A 1NGQH 2BVOA 1T2XA 1K8DB 1FRGH 3CJJA 3RWDA 4PJBA 4LKXB 5EBMA 4YXHH 3JBG7 4HDIA 1F4YH 3TLRA 2E6JA 1IQWL 2AXFB 1CGXA 4LVNC 1GGBL 5BS0A 4GH7B 2J3SA 5EZJA 2BDNL 4QT5B 5IWLA 4TSBH 1OTTC 4NZUL 1P84K 3D87B 4G9DA 1AHWA 5GSRB 3TA3C 1P7KB 2ZZUT 1S9XA 2B4CL 3GNMH 2UYLB 4ZO9A 1A5FL 4YR6B 2BMKB 3CCHA 2DYPA 3B6SA 3OTTA 5E8PA 3VGBA 2E9WA 2EDKA 3QCUL 5BV7B 3IFPA 4M1GL 3ZDZF 3S88L 1NAMH 3IRPX 4XNUL 4AEFA 4MNHA 3CLFL 2NXZD 2X4UA 1ZHBB 3MC0A 1MAJA 3SGJC 1EO7A 1RULH 3K8MA 5EDXA 3QEGH 3D18B 4MMXC 5CCKL 4P23C 4JFZL 3PWPA 3VG0L 4WUUE 1CLYL 4PD4K 4X7SL 1JGEB 4L4VA 3U0PA 1KEML 3V0AC 3BGMB 3GJFK 5F70A 3G5XB 3OKOA 4O51B 5DMJB 1M7DA 4ERSH 1CD0A 4F9PC 3D85A 5ID0A 2OTWB 3G5VB 1T0NA 3QDHA 2ZPKH 2PCPA 1N6VA 4U6VH 4M61B 1H8SA 4JQXC 1T20A 3L3IA 2ATKA 2I5YH 3ALXA 3MGTB 3F7YA 3FKUS 3LH2L 3ZZ1A 1E6JL 1H5BB 3FQXA 1XR9A 1FNEA 2A83B 3ILQD 1PJ9A 3UBXI 5GJSH 5K9QG 1RZKH 1H3XA 4JQVC 3QFJD 5HPMA 3F65A 2PUQT 5J12B 4WO4C 5DFTA 5KBNC 1A14H 3TCLB 4MB5A 2ED7A 3M8OH 3KPSD 2WIIB 5BJTB 5CEXA 1JNHB 1RZJC 3MOBH 1WT5A 1E27B 1Q72L 4D9QD 2OCFD 3NABH 5D93C 5IBUG 3TYFB 5HI5D 5JR1L 1AGCB 2G75B 5ACLA 3DX7B 1IAMA 4U1LB 4NRZA 3IRZA 4UQ3A 4ZO8A 5TE4L 2K7PA 2XTJB 5SWSB 5C7XL 1FO0H 3U9PL 1L6XA 4LARH 2M26A 5DZOA 4RNRA 3D39D 3O3EB 2M1KA 4FFWC 4JFPA 4MSWA 3OX8B 3WE6B 3MV11 4KKAD 2G2RB 3MLRL 1CK0H 1R5WB 1RPQA 1W0WB 1BFVL 1RSFA 3IDGB 1A22B 4N1HB 4OD2B 4OFYD 3VGAC 3OR7A 4HBCH 4R26L 1CD1A 4JDVA 2F15A 4ZUUB 1FN4A 4L5FL 4HGMA 3UYPA 2K3TA 1BJ1J 4M6ML 2PN5A 3SGDH 3LN5B 1CZ8L 3MODL 4LMQI 3REVB 4EI5D 5M95B 5I1IL 5DEZA 3O11A 3GSVB 4Q9RH 1YEGH 4UT6H 3TESA 1KBGH 3RUGE 1HHKB 3BD4A 5GGRY 5IEKA 2YEZA 4FP8L 4HJGB 3MA9L 5I1DA 1C1EL 4KKLC 1I1FB 4G80A 4M8QB 3OGOE 5EU7C 5JMOC 4PJXE 3I75B 4TULL 5CEZH 2I24N 3N1QC 4BQ6A 1NLBH 1BBJA 5F3HA 1OGTB 5AYUL 3SQOL 3KYMB 4G6AD 5DURB 4FZEL 4G3YH 2A9MH 3MBEB 1S7XA 3MXVH 3QIWA 1OW0C 3ZDXF 2NLJB 2R69L 1BOYA 2ZOKA 5FF6B 1M05A 4GW1A 4HWBH 2JCCE 1F4HA 3IDXH 3TPKA 1DSFL 1BZ7A 1FVDB 3AY4C 1GGYA 5E7BA 2XWTB 3T0BA 5BQ7B 2CR6A 1W2KT 4CNIA 5IW6B 2QR0B 2DBLL 1RFDL 3BQUA 5LCVL 1S7VA 3EDKA 4YX2L 2JIXA 2EEBA 5FOJA 1U8MA 3ULUE 5C07E 2CMRL 1C5DB 1UCBL 5D7KD 2UZYB 3QXAB 5IT2H 4KMTH 1YYML 1N4XH 1QO3B 3ROOB 1QSFB 4PRPA 4NCC2 3RWEB 5SWSD 3BGFB 4XWGL 5AZ2H 5CBEA 4ONFH 3BIBX 4DFIA 5KAQG 4Y5XB 4F7MB 4X4XB 2LFGA 3VW3H 1B4RA 4GXUM 1FLRH 5IW1A 3PQYD 4NZUH 3HR5A 4QRSA 3VDAA 4X99A 4EZMA 4Q0XL 4YUEL 3V7MA 3I9GL 4YQXL 1T5WB 4WCYL 3QCUH 4YPGA 2AABL 5IM7A 1IJ9A 4EI6A 4I4WA 4R6UA 4Z95L 1SJEB 3OAZK 4XBGA 5IVZA 3KPQB 4QOKE 2IF7A 1HHGA 2QQLH 5MI0C 5DYOB 1I8MB 1CQKA 2FGZA 4M3KB 4KPHL 4LOUC 5DRWA 4KC3B 3WUWB 2CKBA 5L0QB 2GJZB 5ESAB 4NUGH 3SKNB 1NGZB 5DGRA 4ETQA 2X70B 1IAKA 1N6QL 4Q2ZB 5T1LB 3HG1B 4CMHC 4KJYB 2QSTA 1P2CB 4U0QB 1TZHB 3TO4B 1N2RA 5CSZB 2ORBH 4QCIA 2ERJB 1PAMA 5FAAA 3MRLA 2GEEA 3QQ3B 4OGAC 1QPXA 1IGJA 1ZHLA 1CGVA 2HJKB 5IEHA 2EEAA 5FECA 4RIRB 4XXDB 5DURD 1E6JH 3WFBL 3MBED 3BPCB 5C6TH 4XCCL 1YJDH 5I30H 1FG2B 3LHPH 4MAYB 2NW3B 3ALWA 1QNZL 3L3KB 4CN1A 2Q86B 5JQHC 2EYTA 3VFWB 1DQTA 1DQDH 4RA3A 3VXRD 3TBYA 4AK1A 3L3JB 2OR9L 2W9DH 5GRVL 3FO0L 4JY5H 4RMQA 1B0RA 3CXDL 1DQMH 3GSQA 3QDMA 2F53A 2BY0A 5HDBE 4ZUSA 3S35H 1F6AB 4Z7QF 3STZA 5D7LE 3VJ6B 4ONHB 2J6EL 5F88A 3V6ZA 3C6LB 3BKMH 3V6BR 3L6FA 1QSFD 1ZE3C 5EO9B 1KLUA 4M1CC 4PB9L 2OLDA 1IC4L 4YAQB 4YE4H 1C7TA 1GGUA 2OZ4H 3U6RA 3K8KA 1YY8B 3T1FB 1G7IA 3MLRH 1I3GH 3MV8A 3VFGL 4P4KC 3F12B 4UB0L 4P57A 4H0HB 1RUKL 4MJIE 4B7LA 1HHJA 3T0VA 3LD8C 3PNWB 4JZOB 1F58H 4N1EA 3G9VA 1YEHH 3D9AH 1F4WL 4HFUL 5FCSH 4J7RA 2E27L 3MCLH 4IJ3B 4S0TD 1G7PA 5E00B 1E0OB 5EZIH 1CFTA 2HFEB 3HI5L 4M62H 3S4SG 4DOHB 2JJTC 4FP8H 2BOCA 1SVCP 4HXBH 3HC3L 1HDMA 4WEBL 3ZTJG 1Z0NA 1P9MA 4OD1L 5T5FH 4LSVL 1P6FA 3HG1D 3HZVB 5T1LD 1EFXA 3ZTJH 4CN4A 4W4OC 4OLZH 4QRPA 2AEQH 4GRLA 3TO4D 3MACL 3FN3A 1KIPB 3HS0A 5E2TH 2XYCA 5D1ZD 2HFFA 2KUTA 3GJFH 1U95B 5B39G 1EIBA 3WIHH 4HGWB 1RURH 2MOVA 3HZKB 4O9HL 3WLBA 3VWKC 1WISA 3BESR 2AJZA 1DDHB 1P7QB 4MAYD 2C1PA 1GL4B 5J1AA 4E5XA 3MYJA 1NFDB 5F9JA 4JFQB 3NPZB 3BEWA 3RIFF 5E2VL 1HSBB 4I2XA 1G0YR 4WY7L 2GAZA 4NRYB 4I18C 3UTSA 3MRCB 5FYJH 4D8PA 5HVGB 4PJEB 3G04A 4GG8A 3MRRB 3WDJA 3DXAD 1KIQA 1VFAA 4LCCB 4KI1A 1NQBA 5ANME 1T1ZA 3X3FH 5JXAH 2J8UF 2PYEA 4DQOH 5KSBA 5CMAB 3C6LD 4X6DB 3QUML 3K80A 4ODHH 5D5MB 3G6JA 3OGCA 4LSTL 3DVNB 4X83A 4HG4K 1JL8A 1BX2B 4JHBA 2D0HA 2H41A 3GGWA 4AEHL 4EIZC 4P5TA 5DRZB 1E28A 1SJVA 4JFFA 4Q0XH 5T33L 5JUEL 3QO1A 2NXZC 3GRWA 1OPGL 2IALA 3M07A 3P11L 3QQ9D 4HJJH 3WIFA 2KKQA 1I7UB 4PG9A 4BUHA 3K4AA 1X6LA 4LU5L 2A2QT 2VLME 1T03H 2VDQL 2Z91B 4Y19E 3PHOA 4ZS7L 1JGLL 5DHYB 3G08B 2NPLX 5EZLA 4I3RH 5DSCB 1JGVH 3BHBA 2VXTH 4YXLH 4OZHB 4X4YA 3RZWA 1WAAF 3I6KA 1EV2E 1KJMA 1PY4A 4GAGH 4LEXL 2AJSL 3FT2B 4X8JA 5C9KA 5LWYL 5B4MD 2LVCA 3IVKA 1LGVA 1JMZA 3V4UL 1DTUA 5I1AB 4U1HA 3KXFD 3OKYA 3HRZB 1WJ3A 4L1DA 4WFHD 2OQJA 8FABA 3BX7C 1KB5B 4FQQB 3QXUA 1AFVL 1K5NA 4ODBD 3NFNA 1H8NA 2R1YA 5F8RC 3HMXA 1JZ8A 5C0FB 1DUYA 3KNBB 4PJ8D 3MROA 5ISZE 4M7LL 5FA3A 2J8OA 2EIBA 5GS2H 4ZFFB 2X4NA 5BZDA 1JZ6A 2PTVA 3SQBA 2VDKL 3FB8B 5I8EB 1B6UA 4XVTL 4MB4A 2HRPL 3OKKB 1N7MH 5EUOB 3D5OF 4X7CC 1MRFL 1AR1D 4WTWA 5GGQL 1G7QA 5MENE 5LKNA 3RJDA 3KPPA 4JAMB 4NJAL 4DVRH 1NGXA 3B3IA 1LEGB 2FJGB 5L7XL 1F3JB 3C60A 3P9LB 3QO0B 5DJZA 3UXFA 3FO9B 1UZ6F 4LSQH 4KKAC 4HS8H 4U05A 2IQ9L 2R0LH 4XVUD 4BH8B 1IEAA 2DM7A 5E8NB 1LO2H 4DKEH 1ZHKA 4LCWB 4JFHE 1ZT1B 2KZWA 1TTUA 1WCQA 2OTUA 1VFBA 4WUKL 3R8QA 3OKEA 2AGJH 1A8JH 3VRLE 4EI5C 3FAXA 2ADJA 4E41E 1BD2E 2Z8RA 2HJLB 3DECA 4KU1A 5IG7A 3IFNH 2FX7H 1TMCB 4TSCH 3MRFA 3ABZA 1PZUB 1PYWA 2C3GA 1F02I 2DQIH 4G5ZH 1QYGL 2D03H 4OLEA 2IH3A 2P45B 3OAZH 3TA3A 2EICA 3SY0A 2EDTA 5DRXB 1OM3L 4MQ7B 4R0LB 4D9RD 4AL8L 5DHVH 2OSLA 5F93C 4P2CG 5IVOA 4HIHA 4LSVH 5HSFA 2YD2A 2AKRA 3FQTB 2CJUH 1QFHA 4KY1L 3GMRA 4CKVX 3MACH 1IM9A 3NA9L 4WFEE 1H5BC 2D9QB 5D71L 3SDAD 3N06B 3IETA 3SGJA 5BVJB 3IF1B 4LSDA 1NC2B 1S9WA 4URTB 1A9EA 5DD3L 3LCYA 4GQ9L 5JW5A 3JXAA 3LAFA 2NY0B 2OM5A 5LQBH 1KCVL 2ICCA 1DLHA 1T2QL 1CDUA 5J06A 1JWUA 1YNKL 1JZ3A 2CSPA 2XG5A 4X6BB 2PO6A 4F9PA 4XNYH 4QHUB 4R7NB 2WP3O 1MLBA 3QCTL 4P49A 2IANA 4JVWA 3IYLW 1MFEH 4KGLA 3GSWA 3W9DB 3A67H 2X09A 4U6TA 4UAOB 2EC9T 2CLVA 3RDTB 4I5BB 2G60L 5EBLB 4JFDB 3LN4B 4U7SA 1N59B 1I1AD 4HIEA 4KV5E 4MX7A 4YK4B 1CDGA 2AP2A 4ZTPH 32C2B 5D2NB 4JQVA 3VH8B 3MLYL 2YD6A 4WO4A 4O4YL 4FTVE 2FO4B 5T1DH 1SYSB 5BO1L 5HHQB 2H26A 2JELL 3DSFH 3HC4L 1RK0A 4HWZA 4WU5B 5FM8A 2NTFA 4PTTA 4W6WB 5DC0A 4KKNA 4XP9L 4LHQB 3TPUB 2BSTB 3BDXA 3CXHJ 3SJVB 2BVTA 1EBPA 2W0FA 1MUJA 2NW2A 3CFKA 2Q7NA 5HHPA 2X4TB 4HZLA 1A6UH 3QG6B 5MP6L 3O2DA 1I3RA 4DN4H 5DJCB 1AO7E 3B9KB 4A6YH 2DQGH 1C16B 4X7FC 3H0TA 2JJUA 3DIFA 1XZ0B 1RIHH 3UTOA 5KJRL 1V7NH 1MCPL 2OMNA 1UH2A 2AV1B 3MOAL 4XNQA 1VGEH 1U58B 4XCNB 4AIXA 1AGBA 5LXGH 1X6NA 1NFDF 1PQZA 2IFFH 2SEBB 3ULVL 1ZLWK 1A7RL 3MBEC 1HHHB 2APWA 1JF1A 3AS0A 1SM3H 1OB1B 1GC1L 4ELKB 5IMLA 4U6YB 4PJEF 2KQNA 4LRNH 2EIZA 4M7LH 3KS0H 2JB6A 2NTSP 6FABL 1ZGLM 5D5MF 4X6DF 2NY0D 3W2DH 2VDOH 1I9JL 5JNYA 3GB7A 1XGYH 3HE7B 1MY5A 4KAQL 5H94B 3GHBH 2AQ3A 1ZANH 5CILH 4FA8A 1MRFH 3JVGC 2F54B 2N56A 1MREL 4HFWB 5EWIL 1R3JB 1T22A 1MCIA 4ZUVA 4PJ9C 1JZ5A 3A6CL 1ORSA 3BGFC 4QHLA 4NN6B 4EN3A 5F96L 3VFRA 2EXYD 2BFVL 3VMOA 4Y89A 4Y5XC 3RDTD 3ZT6A 2OL3A 5I1KL 4JFDD 2V2WA 2H32B 5DJ6B 1G6VK 4OZHF 1ZLSH 1GIGH 4JO1L 1MIEL 5J9PA 4BKLB 1J5OL 4CVZA 1FE8L 1FYTB 3MRBB 3AM8C 4IIQB 1I7ZA 3FFCB 3SE4C 3KPLB 4N9OB 4CADA 4KHTH 1Q9LB 4JRYB 3PIQB 2EH8L 4P9HL 3G6DL 4ZQKA 5L9DH 1QPPA 4J3UA 5TE7H 3DUUA 2GK2A 2B1HH 2HLAB 5JW3L 4E42A 4NWUL 4OCLC 2OP4L 5C2BH 5DUML 3ARFB 5FO8B 1XF1A 5ILTH 3NFPA 4PJ5E 3SDDB 1I4FA 5JQ6H 1L7IL 5D70H 1MRCH 4PJHA 1DUZB 1RK1A 3FRUA 3B9KD 2P5EB 1LEKA 4JJ5B 3CSGA 1S7TA 1BQHA 5C9JA 3TO4C 3LEXB 3QHTC 4JZJC 5EUOF 4WJ5B 5D1ZC 3QUMB 2ZSVB 2EDBA 3CVHA 4YZFF 1JPFB 3W82A 2C5DC 4MZ3A 1PKOA 1CN4A 4XCEB 3RVVD 4HUUB 3NA9H 3O6KH 5D71H 1FIGH 4YNYA 1NDGA 4UQ2A 4Q6IB 1QR1A 2FD6L 1CVRA 5L88L 4YHOH 4MAYC 2R29H 4K8RL 3L9RA 1FZJB 4K7PH 1DQJA 2VSDA 1F6FB 4P5KA 4PJIA 1AY1H 2YS4A 1NAKL 1ZA6A 5SWQA 2ENSA 2VAAA 1FFPA 4Q9CA 1RJLA 1U8KB 4H0GA 4PV9B 1YDPB 3U7AA 4JR9L 2A6JA 3HE7D 3UBXB 4D94A 1FLTX 1EHLL 1MQKH 3SKMB 3O3UN 1X7QB 1CFBA 2F54D 5EBWB 3C6LC 3L1OH 4XCYA 4GG6E 3DVGA 2GJ6B 4DVBA 1IC5H 4KK5D 4OBRA 2WBJB 4MZ2A 4FNLL 1HI6A 3LKOA 3MLUL 2IQAB 3SDXE 3HTLX 4FXKA 4OM1H 4WFGD 1AD9B 2Y06L 4UILH 3QQ9C 4HW6A 4KFZC 2GTZB 4UT9H 2AJYL 3BDYL 5C09B 4K7FB 1FYTD 3NOIA 1YNLH 2KZ1B 3K3QA 5DJ0A 3TBVB 5SWZB 1NEZA 3RU8L 3DVFA 4IJ3C 4AEIH 5J13B 3MO1A 4DAGL 1HH9A 4KDVA 4NZJA 4Z7OE 4DN3H 5C0BE 3ARFD 4QXTA 3DJ9A 3G5ZA 3MGAA 1S9VA 5B4MC 3VXPB 3BVNA 4WEMB 3HNVL 4WNQA 2EYRB 3T0XA 1T66D 4JHZA 4CVUA 1E4KC 5HY9A 4ELMA 1T1WA 3FQUA 4QRRB 2P5ED 4C83B 3HI1B 1K6QL 3KPRD 3WJJC 4UV4H 1AIFA 4OI8A 4XMKH 3RHWF 5BV7H 1BBDH 3LQAL 4YBLB 1FJ1A 1H3VA 4PJ8C 2XWJA 5I18L 1EJ6A 2B4CC 1TVBA 4BSWB 1JUFA 2W1NA 1GZQA 5GGVL 4JHAH 4RMUA 5IFAL 1LHZA 3O6LH 2AV7B 2WWKO 1ADQA 3BT2H 2VC2L 1GC1H 4X6CB 2E7LC 1KN4H 5DF0A 2YC1A 5L2JB 1J0IA 4BQ9A 4UIMA 4K3DL 2X4QB 3TIDB 5GIRA 5IVXF 2YN5A 5EIIB 3S37X 1ZA3A 4ZYKB 2FX8H 1KG0A 4X7TA 3VXME 1AR1C 2JJTA 5FOBB 5KVEH 4UTBH 1KLGA 1MFCH 2D7TL 5CSGA 5KVDL 3RUGF 1MH5B 1SYVA 2E9JA 1YN6A 5TPWH 4W4OA 2BSRB 2YA1A 1CT8B 4R3SA 3WJLC 5ADOH 4JCMA 4EOWH 2VXUL 4XPGH 2QKIA 1RJZA 2BX5A 5HGHB 2P5WD 5D72H 4L4TB 4MJ5A 4NKDB 1KNOB 4YHNB 3FCTA 4Y1AE 2ICWJ 2GJ6D 1CFVL 1GGCL 4HS6B 4IDLA 4D0DB 4K2UH 4R96B 4K3HA 3VWKA 5C6PB 1QA9A 1FYHB 1C8PA 1ZVHA 4LNVA 4NPYA 1E4XH 3V0VB 2XRAL 3MFFB 2UY7A 2ATPA 3MV9A 5C09D 2OS7A 5DJ8B 1MJJB 5EO0A 2DLFH 3JWOH 3G6DH 1G6RH 3WKML 3LOWA 3MJGX 4KWUA 1M4KA 1EA9C 3FT4B 4RAUB 3FB5A 4BQCA 2QQNH 3BP7B 4XAWH 1U8HB 4XPAH 3GMPB 3KAAA 1DL7H 1SY6L 4NRXA 1RUAL 3CDCA 3TT1H 4F7PA 1BIIB 4R8WH 3VCLB 2Z92A 5A2KH 1O0VA 5C08E 3QWOB 4NNXA 4MD4A 3B83A 5KSAB 3GO1H 4LAQH 4QRRD 1E4WH 3SDAC 4LIQE 3T4AA 5IQ9B 3MLXL 4GKSA 3QUYB 5LGHL 1MRDH 3K2UH 4KUCD 3RA7H 2VZUA 4PJCF 4M7ZB 4LPYA 2E7MA 2VUYA 1EVUA 1RIVH 4XP4L 4GKZB 4DGIH 1MCSA 4RA0C 5EG6C 3T2OA 4X6EA 3ZL4H 2FNBA 3GDBA 5DWUL 5F7YC 5DQ9A 1AH1A 4V1DB 4XBPA 1YQVH 2AEIT 2EDDA 5BOPA 1S9KC 1XFPA 1BQLH 4JO4L 1NBQA 3BJLA 4UNVA 1AGEA 1GGIH 1H3UA 3UDWC 2X10A 2AS5M 3RWCB 4GXVL 1P1ZA 4UIKH 4NHUB 1NUGA 4JR9H 1F11B 3EGSB 1NFIB 4NSKA 1DVFC 1LO5B 2FEEL 1I1AC 2HN7A 2XZQL 4FQ1H 2IBZY 1TZGH 1XAUA 1KC5H 4YHLL 5C0AB 5DJXA 4L4TD 2HWZL 3HNTL 2E6QA 3MZTA 3KPSA 1D9KB 1FFOA 2AXJA 4GBXB 5ITFA 5F1SA 3HFMH 4NQDB 4DEPC 1S9YA 4HZAA 4LLWA 4ZTOL 2Y06H 5BW7C 2ZG1A 2YPLA 3H9ZA 1B0GB 3MLTA 4LVHB 1A1OB 3CFBA 3DMMB 1EXUB 5ITBH 4Q97A 2CDEA 4N8VG 3FAWA 4LRIC 1C08B 5E2WH 1K4DB 3D39A 1KGCD 5F6IC 3UJIH 5DVMA 3K2MC 3ARGA 3PABB 1MHPH 4JPKL 3P40A 5B3JF 1YPZA 3MJ9L 3BUYA 4HUKB 4NQXB 5CEYA 1A6AB 4XZUA 4MB3A 3CU7A 5EPMB 1NCCL 3Q6GH 3RVXD 2OK0H 5TH2B 1DR9A 1D7FA 4R0LC 4KRPD 5D8JH 1YMMA 2YXMA 4ALAH 2J88L 4U1SB 3L95A 3CDYA 1Y0LB 4NO0A 1BPVA 3OKLA 4F7CA 4RDQG 1K6QH 3BP6B 1S7UA 5KSAD 4EI5A 1U42A 2ZP0T 4KDTA 4GW5A 4YDVB 3VFNA 2DWDA 3QUYD 4OZGE 6CGTA 2D7MA 5DT1L 5FYKU 4FXLA 2DDQH 2F8VA 5C8JB 1I1CA 2CIKB 1LEIA 1RZFL 3RPIA 2NY0C 2PXYB 1IE5A 5DUPL 3ZT5A 1J8HA 4GMSH 4XP6L 2XPGB 3BH9B 4Z7WB 4W6YB 4NM8H 3S97C 2IJ0C 5MHSD 4DTGL 1UM4L 1CDJA 3C2AL 3RNQB 2BNQE 2AJXH 3TJEL 1L0QA 2MQCA 2EXYC 3MGTA 3RDTC 3HAEG 3BYTA 3THMH 1D5IL 3C9NA 4YK4C 2D4DA 4JREB 5HYIA 1HNFA 5D2NC 4G8GE 5C0AD 1OARH 5CP7A 4F58L 1AQKL 1UKQA 3D6GA 2V5YA 3ULVD 1D9KD 2VDNH 3AUVA 4Y16B 4GBXD 4GJTB 2XN9A 4NQDD 3QDJB 1FZMA 5DD1L 2GTWB 4G7YH 1KUMA 3WYRA 3SDYH 1V3MA 1CICB 2F9BT 3DMMD 4HUVA 2H2PD 1MLCB 4XP1H 4F3FB 5EU6B 1QRNA 1KJ2A 3GBLA 4F8TA 3UJJL 5E5MB 5SX4I 4TVSa 3B9KC 3PQYA 4JG0H 4HC1A 4P46D 3WS3A 1A4KA 3GFUA 4HX1A 1R5WA 5DQDL 3QP3A 5E08L 5IMKA 3PGDB 3C09B 4GKNA 4PGBA 1KCUL 1UC6A 1ITCA 3PDOB 2UWEB 1QLEH 4PRIB 4BSJA 3RVVC 1QBMH 3MUGB 4H0IA 1EHXA 3TBTB 4JLRA 1JPSL 2VXVL 3VXUA 4DKDC 3CVIH 5E24E 4FQHA 5B38G 2M8XA 1M71A 5DC4B 5E2UH 4P2QA 2HFGL 5I0ZA 5T1MB 2EDWA 3OKMA 3EFFB 4IOIA 4FQJL 2ZCLH 2YD8A 2BSSB 3QPXH 5EOCH 5J1SC 1OSPL 3MRPB 1WEJL 5I66A 2NYYC 1QFWH 5K59E 1JWMA 4YHZL 2W91A 1XCTB 4N0UE 3MCKB 3Q0HA 3GIZL 4L3EB 5DA0B 3EO9L 1U8NB 4KK5C 1XGTB 2EDXA 2HMID 1J05B 3R06A 2VLRE 1CLOL 1RUQH 1AXSA 1NAMA 1NC4B 3DURB 4NQEB 4PGDB 4MNQA 4GS7B 3TNMA 2LU4A 3VD5A 3HE6B 4RMTA 5KZCB 15C8H 3VXSB 3VXRA 2JJSC 3B2VH 2C3WA 1T7ZA 4M5ZH 5FKPA 2I9LB 1A9BB 3O3BA 2A9NH 3RRQA 4LASH 2DI8A 3W0WB 2VN7A 4Y16D 3H9SB 3V6FB 4NNYB 1A7OL 2W60B 1C5CH 4BYHA 2A0LD 3VGHA 3G9AB 3N85H 4AENA 5FUCC 1LO0H 4K8RD 4YHML 3BRFA 3X14A 3RWFB 2DLGA 1YEKL 4PJ9A 1CICD 2RHEA 2ZNXA 2R56L 4EDXA 5GRJL 1OCWL 5EU6D 1CXLA 1T5XA 3TBSA 5JXED 2HH0H 4Y5XA 1OF2B 1T66C 4WU7B 4Y5VA 5IV2A 4KXZI 1F4XH 1JHTA 2ICWB 3ZDYF 3HN3A 1UYWH 5AG8A 3L3OA 4OGYH 4PJAE 5I1GH 2AW2A 4MQTB 3DX6B 4I9WE 4YGVA 5FYLL 3AM8A 5HHME 2QQKL 2FZ3B 3MRHB 1MPAL 3I6GA 3MV7B 4JPIB 1T3FA 4PRID 3MR9A 1OAZH 1UKSA 1MCHA 2CLRA 3H3PH 3SPVB 1DJSA 3IKCA 1T0PB 5DVLA 4Q6IC 3BZFB 3VRLF 3TBWB 3GMNA 1X3DA 1JRHL 2BY2A 2WUBL 3H42H 3ZE1E 5EOTB 2KH2B 5HI4C 1EEYB 2ZWLT 4G6JL 5ESAA 1BFSA 4FFYL 2ITDA 3T1WA 4N8CL 2G5BA 3I6LD 4MS8D 1KELL 3U9UB 4X9GA 1GPOL 3U7YL 4EQ2A 3HG1A 2V2XA 3IJYB 1A4JB 3DGCR 4LLQB 5J6GB 1P2CA 3IAGC 4GT7A 3CFEB 3BE1L 4JZJA 4R97B 3GSNB 1DBAL 2NZIA 4AY0A 5D96B 5F97E 2D7QA 5EORL 3C2AH 5D1ZA 3ULUL 3VWJC 2C1OB 5JPMA 3TF7C 3PWVA 4HKJA 2B20A 1UACL 3EOAA 1KB5H 1Q9KA 4L3ED 4UU9A 2WIMA 2YKLL 5BMFH 5ALBL 1D5IH 1BJ1H 3X13B 1VEPA 2X89D 5I2IB 3OB0K 4PREA 4XT1C 4LLYB 2J5LC 3FMGL 1JWSA 5DQJB 5E99H 2WK2A 5K9OA 3U83A 2HT2C 3F7PC 2A6DB 5DXWA 1NC4D 4CMMB 4MAYA 2NW3A 4NQED 1BVKB 5HXMA 5GGSA 4UDUB 4P2RB 3WS6C 3IDMA 5T3ZH 3QUZB 2FWOB 3HE6D 2BRRH 3IJHB 1FSKC 5DRNA 2ADGA 3VFMA 4BZ1H 2CUMA 4G6MH 2VDLH 3T4YB 1KPVB 3PP4H 1YA5A 3W0WD 1MHCB 3HI6H 1CGSL 2VNCA 2A6IB 4G9FE 4LHUG 3CIQA 3K0WA 2CUHA 3H9SD 3RL1B 3DXAA 5FHAL 5D2LF 3LKSA 5D4QA 4R2GC 3RGVC 3GSRB 2R4RH 3HLAB 4EUPG 2QEJA 1DBJL 1VGKB 5F7HA 3DUSA 2QHRL 4DGVH 1P4IH 2VQTA 3CDGA 5TDPA 4PGZA 1UZ8B 5KSUA 2NX5B 3A6OA 3K81A 4YDKL 4HKZB 1M6OB 2ARWA 3EBAA 1OOAA 1N3NA 4BSVA 1KTLB 4Z7WF 4HWBA 1CDBA 4Z76B 1A0QL 4L8BA 2CKBL 3K4DA 1Z3GL 1CL7H 4YBLC 3WD5H 4XBEH 1OP5K 5IB1B 3PWUA 3BPOC 3QNZA 4QGYA 4BFGA 2XV6B 2R2EA 3UO1H 3CUPA 5HYFA 5HGAA 1JN6A 1I1RA 1L7TH 1A6TB 2O5ZL 4R4BB 3MV7D 4UDTA 3CPLB 1L0XA 4ZSOE 2FHFA 4X6FB 3QXVA 5FO7A 1OSZA 5HHNB 4X80H 3PGCB 4LSSL 3QQ4B 2H9GA 4L3CA 2Y36L 2FGWL 4UV7H 4XNXL 3EDEA 2MQ0A 1JMXA 1GZPA 1NMCC 1WSST 4F7TA 3LEYH 4FQPA 3Q3GA 2IH1A 2IAMC 1OQOA 1X4XA 1XF2A 3FTGB 1E4KA 3KXFA 1U2CA 1FG9C 2H2SC 3F58L 4O2FB 3QEQA 4P5MB 3OG6B 3BFOA 3HPLA 2V2TB 2EO1A 4MA1B 2DM3A 1RV6X 3EYFB 3QPQD 4JRXD 1AGDA 5DMKB 1IGFH 1W0VA 2Q1EA 3CAFA 4PJ8A 2R0KH 3BD5A 4TSAL 5H35B 3BUTA 2HG5B 3MJ8A 3QIUA 1VFOA 4WRLA 1P5UA 3MRIB 4ZOEA 4K3EL 3VMNA 2JB5L 2C4FU 4OCWL 2VDRH 4TVPH 1XGRB 4IDJL 4ORZC 2FR4A 4YC2B 4W70A 3O2VH 1MCFA 1LO3H 4NP4L 4P2RD 3T77A 1UXWA 3WEXB 5JORB 3QUZD 3P4NA 2APVA 5J0BA 4N9GA 1NLDL 2VZTA 3IB4A 1EGJL 1JI2A 5GRUH 5IESH 2UWEF 4QRQB 3QA3B 4XPTH 4PY8J 4YHMH 4TYUA 5GGUA 3HKFA 3FONA 3VGDA 3RVXC 3DO7B 1YEKH 3OKDA 3VFOB 1EFQA 3INUL 4KDWA 1J1OL 4HV8A 3GHEL 4KRPC 5I71C 2YPVL 3PV6A 4TNVF 4U1MB 2HT4D 2NX5D 4L8SA 4ISVA 2BVOB 4KHXL 5DRZA 5JIIA 2H45A 2MHAA 5KSAC 4NBYB 3RWDB 3QUYC 4PJBB 4OKVA 3ARDA 2QQKH 5EBMB 3B4NA 1JYXA 4H1LG 1YEFL 4M7ZC 4HDIB 4H8WH 1WCBA 1NBZA 1UWGH 2QBWA 2J4WH 5BS0B 1IBGL 1QG3A 2FJHA 5EZJB 1ZGLA 1JF6A 4G9DB 1AHWB 4K3JL 1S9XB 5IB4A 4JKWA 4MGXA 1M7IA 3N1FC 1A7NH 3CCHB 2DYPB 3B6SB 5E8PB 3RIAK 5HVWA 3IFPB 1J10A 5I9QB 2X7LA 1MFAL 3KJ6L 3BXNA 5DR5L 4ODUA 4MNHB 5HHOE 1KPUA 1KXQE 3SDAA 2X4UB 3HMWL 1TLKA 4JFED 4JPVH 3SGEI 3T3PF 1V7ML 4XHJC 2R2HA 5E6YA 1D5MA 2VZSA 3O6MH 3WNPA 5I8OL 1MVUB 2NY7L 3PWPB 4O02L 2I60H 3ULVC 4L4VB 3U0PB 3SBWC 3DYPA 4GBXC 2XZCL 1U9KA 3OKOB 4M6OL 1M7DB 3OKKA 1GC1C 1UWEL 3D85B 5IOPA 5ID0B 5LBSL 2IG2H 3VDCA 1FNSH 1T0NB 1J8KA 1EPFA 4LVHC 4BJLA 3UDWA 3DMMC 1JTTA 2H2PC 2K7QA 1T20B 3L3IB 2VZ1A 3S4SA 2FBJL 5GJTL 3MJ7A 3U4BL 3F7YB 1QFOA 1DVFA 3FQXB 1I1AA 1XR9B 1FNEB 3SGKC 4XHQA 1UGNA 4P46C 5CHNB 5CS7A 5HPMB 5F1KC 2GSIA 3MLZL 4BA8A 2ZUUA 5L2KE 3MLWH 5CFHA 1MWAH 3GJFA 4MAUH 5CEXB 4BZYA 3WIHA 3SOBH 5FUOL 4ZD3L 5B39A 1FORL 1FC2D 2FECI 3P0VH 4Y7MA 5E8EB 5BW7A 5EOQL 1IARB 2APBA 4NRZB 4UQ3B 1MFDL 4J23A 1HYSD 4M7KL 3NIGE 4MD5A 4RNRB 5GRYA 2BC4A 4WVRA 1PSKL 4JFPB 2ESVA 4MSWB 3JV0A 1QFWM 4JZNA 4NQSA 4G8IA 3KHQA 4RMSA 1XGPA 3MBXL 4HHAA 4ZPTA 4IM8A 3T0EA 4OQTH 4L9LA 4K23L 1MI5A 1C12A 5JPNA 4Z7OF 3O2WL 3S5LG 4JO2L 2A77H 4FG6C 2W9EL 5I19H 4R0LA 4FFVD 1OAUL 1CD1B 4JDVB 1FN4B 5SX5K 2HMIC 2ZUXA 4Y2DA 5IIEA 4UUJB 4XPHL 4GRWE 4GOSA 4KVCL 1PFCA 5CGMA 2VSCA 4I8DA 3HNSL 3MLVH 1IC7L 3O11B 3NIDE 1EMTL 4KI5E 2YEZB 1IGIH 3ARWA 4D9LH 3BPNB 5I1DB 3PWPD 4I0CC 2NY1B 4G80B 3NCMA 2Z8WC 4FQCH 3RL2A 4L4VD 4IDJH 5EC1A 3U30B 2EDEA 4Y16C 4HUMB 5FGSA 4C55A 2ZOLA 2X9WA 3D85D 3H3KA 4K8RC 4OCRH 3C5ZD 1BBJB 4GRMA 3M45A 5F3HB 4HKBA 5DD0L 1CICC 5KS9A 1S7XB 2UUDH 3QIWB 2AK4E 5JXEC 4LLUA 1CBVH 3RVTD 2ZOKB 1GHFH 5C0CE 1M05B 4GW1B 4LEOA 2WQRA 1HH6A 5JOPE 1BZ7B 3MMEA 1OGAA 5FYKL 1RZ7L 1J1OH 2ICEA 3LZFL 4CNIB 3RAJH 3VH8A 3BQUB 4M9PA 4OF6A 1S7VB 3L5JA 5TDOA 2YMXL 2JIXB 1U8MB 1BFOA 2ZUQB 4WU5A 3EJYD 1BOGA 4C59B 12E8L 1VSCA 5CLWA 3HUJA 1WZMA 5EA0L 4PRPB 25C8H 3G5YA 5CBEB 1VPOH 2CRZA 4JGMA 2UVEA 3FHAA 5J89A 3VRIA 3EYSH 2EDJA 4MS8C 1B2WL 5EIVA 1JK8A 1TQCB 3MGOA 5GSVA 3LY6A 2NY3B 5FHBH 2XA3A 3B9KA 3UZQA 1OP5H 5IW1B 3HR5B 4QRSB 5EU7E 3QDGE 1TJIH 5GHWH 1V05A 1YEIH 3Q6FA 4QKXB 4N0FA 2C3XA 4F2MA 1G7MA 4K7PY 1A1MA 4YPGB 5IM7B 4EI6B 4I4WB 3SE9H 5GISL 5IVZB 4XBGB 4KZEH 4FZ8L 4F57L 1HHGB 1HHHA 3R1GH 35C8L 2HKHH 1B0WA 4XH2A 3BKYH 5DRWB 2CKBB 1FAIL 3CFIC 3LQAC 2LTQB 5FB8A 5FYLD 3OJMB 1F45A 4ETQB 4PRHE 1IAKB 2EE6A 1B6DA 1K3ZA 1UM6L 43C9A 4QLRA 2NY1D 4IRZH 5EH1A 2O5YL 1BEYL 1T4KA 2GT9A 5F1IA 3GBMH 1N2RB 4QCIB 4U1JA 1DQLL 1J0KA 1NGYA 3MRLB 8CGTA 1JPTL 1MF2L 1IGJB 1ZHLB 4LQFL 5IEHB 2C7UA 2P7TA 3U4BH 3S35X 2Z9TA 3U4AA 3D3VA 3QHZH 3S37L 5E03A 1KENL 3EDJA 1CXFA 1HCFX 3QUXD 2QV2A 1TIUA 4DUWA 3BYYA 1PZ5A 3NAAL 5I1CL 4OZIA 1LP9A 5E6ID 3G6AA 2EYTB 1O7VA 1LDPL 2B1AH 4QTHA 2D7PA 1FL5A 5DO2D 1BM3H 1Z0MA 5FGBC 2ED8A 3ULUD 4TUJA 5C07D 4G43A 2JJSA 1I7TA 2V5SA 3TBYB 3BQUD 4OLVL 1TTGA 1NCAL 2V5RA 3O2DL 1LK3H 1B0RB 3GSQB 3S34H 2F53B 2AQ1A 4KH2A 4RFNB 3PIQA 4ZUSB 3CGTA 1JCKA 4PJDA 3STZB 1N64H 5F88B 2HLAA 5AZEH 3V6ZB 3EW3B 3L6FB 2HVJA 4PRPD 1KLUB 3BZ4A 1C5BL 3NCYP 1X5GA 3WCYA 4WTZG 2YRLA 3S8WA 4ZG1A 3U6RB 1U92A 3ZDZE 1G7IB 2OI9B 2NY3D 2DQCL 3MV8B 5FXCH 3X11A 3X12A 2P5EA 3KPRA 3L3DA 3FO2B 1FQ9C 4P57B 3QPQC 4YHYB 4R97C 1HHJB 3VD7A 4HMDA 2AEWA 3WKNA 3C5JA 4XTRC 3AXLA 2DLTA 1T89C 3ZTNH 5J3HC 1B9ZA 4ZDHB 1NKOA 4OIIH 4HT1H 1UXSA 4RAVA 4CJ1A 1G7PB 3MNWA 2O26U 4HK0A 2UVFA 4Q6IA 1CFTB 1CR9L 4XX1E 5F71A 4OCYL 4UINH 1CCZA 4Z18A 4WHCA 4HPOH 4OD3H 4XWOD 1UENA 2BOCB 4JN1L 4M7JL 3QUZC 4HUWA 2BNRE 1HDMB 4XPFL 3X3GH 5MEPA 5DJ2A 1LNUA 5HYJA 4L8CA 3WIIL 1EFXB 1X5XA 4JFXA 3LIZL 4WFFE 4OFVA 4QRPB 2RQ8A 4GRLB 4A6YA 1KYOJ 1JP5A 3HS0B 1L0YA 4NC1C 1T0MA 1QSEE 4OFPA 2HFFB 5DD0H 3PWJA 2P5WA 4YHPA 3VWJA 5BVPL 1DFBH 4ODTL 1BAFL 1QEWA 2H3NA 1MQ8A 3WLBB 1U8LA 4K9EL 2HT4C 2MCG1 1FVCA 5BXFA 1X4YA 1INEH 2AJZB 1QQDA 1N5AA 1HKLH 1NBVL 2C1PB 3IFLH 3UYRH 3TEUA 4BFBD 5J1AB 4E5XB 2AJUL 3MYJB 3AB0B 2H1PH 3VA2C 3U2SA 5F9JB 2B5IB 5EB9A 2YMXH 2ZJSL 3BEWB 4I2XB 2A73A 2GAZB 4ZAKD 4AT6A 3UTSB 4D8PB 2F53D 1KCSL 3G04B 4GG8B 5E9DE 1KACB 1FNGB 4RAHA 1IAII 1CYGA 1F97A 4RSVA 1VFAB 4YDJA 1CDCA 3KWWA 1T1ZB 5F9DC 4PJGA 5KSBB 3I3BA 1U0QA 3RGVA 1YY9D 3G6JB 5IFHH 4OLWL 3OGCB 3EYOA 3MJ6A 4HGKC 4JKPL 5C3TA 3O4LA 2EYRA 1NBYA 3GGWB 1CF8L 4P5TB 1E28B 4JFFB 2X41A 4F7EA 4XVSL 3QO1B 4QRRA 1A2YA 2IALB 3IAQA 3WIFB 1BECA 3RVWD 1DLFL 4P2OB 2GK0B 4PG9B 4IRSB 4LCIH 1IT9L 1ERNA 3PHOB 4OM0H 1ZLUK 4PUBL 5EU3A 5EZLB 2DB8A 1YN7B 1PG7H 3BHBB 3FQRA 4OSUH 1YEEL 4QRUA 3R8BB 2GIYA 1I9RH 4X4YB 3LS5H 5L2JA 4AEEA 1LE9A 5SX5H 4RISL 1YECH 3I6KB 1SHMA 4OZ4A 1S3KL 3S96B 4YC2C 4ACPA 1KJMB 4QHMA 5HYEA 1ONQA 2QJDA 2PW2A 4NZTL 1R3KA 4JQIH 4X8JB 5CJ5A 2YHGA 3P30L 3IVKB 2IAMA 4HSQA 4PJ7A 4U1HB 3BDBA 3ZDXE 4I1NB 5CAYB 3OXRA 2OQJB 1EFXD 8FABB 1JZ7A 4MXQD 1XIWD 4ZXBC 1K5NB 3BAEL 3NFNB 4QRPD 5D1XB 2R1YB 4U33A 4CVXA 4LQFH 1DUYB 5GGTL 1IKFL 1S8DA 3UC0L 3MROB 4JPWH 5FA3B 2DQUL 4TQEL 1PKQE 4G7VL 2X4NB 2MMXA 5BZDB 3JTTA 5F9WC 4NHCL 3DHMA 5I73C 3ECBA 4QF1A 1DE4A 3BH8A 1CGYA 2E5EA 1BVLA 3KPPB 3NPSB 1T1YA 5JHLH 1NGXB 3B3IB 3QIBA 3T8XA 1KXVC 3C60B 2WBKA 1BIHA 3RVUD 1NDMA 3UTSD 4XMLL 5E8DL 1IEAB 5IWLC 3BP7A 4AMKL 3QRFM 3KYNA 5DD5H 5ADPH 3P4MA 3WDHA 2ZKHH 5LAXB 5A3ID 1Q9WA 1S78D 1MAMH 1MCLA 1TNMA 4FFVC 2AXGA 2P8MA 3WN5A 4XPBH 5IROC 2Q8AH 4PS4H 2OTUB 1VFBB 4OQ1A 5CGYD 1PG7W 5I9QC 1CE6A 1QP1A 3CFCL 3OKEB 4J6RL 3T2NL 1OHQA 1X5IA 2VLMD 4JFYA 3TGXA 3JSSA 4S1RL 4PJFA 4LDLB 3V4VL 1P4BL 3QFJE 4IRSD 4M43L 3HC0A 2F58H 5IG7B 4MVBC 3JWDL 4GKZA 4LVNB 1PYWB 5K9QI 4U6XA 3DSNA 3BN9C 1JHKL 1JHLH 4D9QE 2IH3B 3IFOA 3TA3B 3SY0B 4M7JH 4JN1H 4O5LL 3C5ZC 4TPRL 4NWTL 3WFDL 3QHFH 5EU5A 3F5WB 4RFOH 2OSLB 2RIKA 4HIHB 3OG4B 3QEUA 1Q1JL 4OLYL 4JANA 1KEGH 4Q9BA 2AKRB 3RVTC 4Z7UA 1DBBL 2FYYA 3GMRB 1IM9B 3MA7A 5ISZD 3SE3C 4GQPH 3IETB 4OB5L 5D1XD 1S9WB 3QULA 1OQXA 1A9EB 4MHHG 4NZRH 4FQLL 3QFDA 5JW5B 1DLHB 3KLHC 4K9EH 3DX9A 1JWUB 2IC2A 5DLMH 1I3UA 2VMFA 3F6LA 1MCOL 2PO6B 4U2ZA 3B9DA 3EJYC 5MEND 4Z7QE 5GS0H 4WI8A 3UZVB 1MLBB 5E2JA 2IANB 3UPRA 3DMMA 4Z0BH 1EXUA 1MFNA 1ZEAL 2BY3A 2YZ1A 3GSWB 4QXGH 5DFWH 1F5WA 4M4RA 2CLVB 5D1QC 4ZFOL 3EYQD 4DCQA 4NQUA 4HULB 3C60D 4MX7B 3MUHL 1CLCA 3SGKA 4P46A 2V7NA 4OJFH 4PBWD 3V5HA 3V5DA 4WO4B 3LKPA 3LS4H 2P8PA 3IDUA 2ZCHH 3W81A 5FCUH 1RK0B 4HWZB 3LRSA 1KIRA 2NTFB 2NY5H 4XVSH 4E41D 4PTTB 1NGWA 2DMBA 3EFDH 1FBIL 4O58L 1IKNC 4C56A 5FYKD 3ESUF 4XC1H 5JLZA 2W0FB 1MUJB 1N0XL 2NW2B 3VI4F 3CFKB 5HHPB 4RWYH 5C8JA 1EUTA 3ARUA 4HZLB 1AXTL 2W65A 5CJOH 3EDFA 2DD8H 3BPNC 4YHKL 1I3RB 2VXSL 5C0GA 3H0TB 4KROC 1G6RA 5HI3D 3BH9A 1WFTA 3GMLA 1CXKA 2NY4B 3DIFB 5D7KE 4YXKL 3O4OB 3S36H 5FYJU 4XNQB 2Y7QB 3TA3D 2X4RA 3VGAB 1AGBB 2XTJE 5SWSE 1PQZB 3RNQA 1WZLA 3K46A 2RJMA 3B9VA 5A2FA 3MNZB 1RMFH 1JF1B 1IGTA 2Q6WA 5IMLB 1IM9D 3MXWL 3V52L 3QUXC 3ZHDA 4XCFL 4HQQH 1WFNA 5E6IC 2I25N 1TVHA 2EIZB 4NZDA 5E4EB 2FL5A 1VACA 1TJGH 3C5SA 5DO2C 2JB6B 2CK0H 3ULUC 4ODVH 5KSBF 3TZVA 4HH8A 4FQIH 2BVQA 4K94L 5JNYB 3GB7B 2DLIA 1IAOA 1R3IH 1RIUL 3OZ9H 3Q5TA 5CP3A 2ZUQC 2H6PB 4KZDH 3ET9F 2PO6D 5C2UB 3LKRA 4ZUVB 1R3HA 2CDGA 2J8UE 3R0MA 2EH7L 4Y4KD 1ORSB 4QHLB 3BKJH 4EN3B 1UVQA 3VFRB 2C4XA 1X44A 5F7WC 2OL3B 4MCYB 1NMAH 2V2WB 3PDGA 5T3XL 4WV1C 5E5MA 2NY3C 2W0PA 4LVOB 1CFNA 1F3DJ 1A3RH 1JGDA 2MKWA 1GAFH 2YUZA 2GI7A 5DS8A 4LNRA 4YPJA 1D5ZA 4BFIA 2R23A 5DJAB 4CVZB 3H8NA 3FT3A 4JDZA 5F7MC 4MNGA 5I15H 1GOGA 1I7ZB 2XKUA 4CADB 3WXWH 1WZ1H 4ZQKB 3UTPE 2YUXA 3DUUB 2AEPL 1J1PL 1PLGH 1R5VA 3RWJA 5IB5A 4XXCA 3BIAX 4E42B 4Y4HA 4OF7A 1WAAE 5IBLD 1U3JA 1W72L 4XWOC 3H9YA 5TFSH 2LTQC 3RKDD 3NFPB 3JWDH 1I4FB 1ULVA 3QXWA 2ARJA 2BHUA 5JHDA 3EFFA 4D2NA 4FFWD 1RK1B 1AE6L 4N8VA 5DD6B 3N1MC 3RBSA 1LEKB 1S7TB 1BQHB 4QYOA 1ZLUH 5C9JB 1TDQA 3UAJD 2NY4D 4O5LH 2AAVA 3WFDH 5A2IH 3EKCA 3L5IA 3CVHB 3VFTA 5IQ7L 1QBLL 3MCKA 5E70A 4DGYH 2GUOA 1QSFE 5F7DA 3TN0C 1J1XH 2Q76A 3UX9B 2ZG2A 1LD9A 3BISA 1I8IB 2F19H 1PY9A 4YNYB 1NDGB 4UQ2B 5MI0B 1QR1B 4HXAH 4NOFA 3V4PH 1TJHH 3T3MF 1IM3A 3L9RB 2QSCH 3QNYA 2X05A 5F1OB 4QHNA 1DQJB 4P5KB 4PJIB 4KJWD 1ZA6B 5SWQB 1OY3B 2VAAB 4EBQH 1FFPB 4EDWH 1RJLB 4ZAKC 5FO9A 4G42A 4Z7VA 2A6JB 1HHIA 1T1XA 2ITCA 3BIKA 4RFNC 1UZ6E 4HCRH 3MOQA 3PJSA 3E6FA 1JTOA 3DHJA 1WIOA 3PGFL 4QTIH 1YY9C 3ZE2E 4LIQH 3VFVA 3DVGB 4DVBB 4M1DL 5I1JL 4HWEH 4EN3D 4M9OA 3U79A 1EJOL 4OBSA 1HI6B 4L8DA 1IGML 1F90L 2YK1L 3LKOB 3NZHH 3E2HC 2YBRA 3BO8A 2OI9C 4FXKB 4LLVA 4NC2B 1NGQL 3HAEA 3O0RH 3RVWC 4YHYC 1WV7T 1FRGL 5FGBA 3QWQB 4Q74A 3TT3H 5DJ0B 4YXHL 3AREC 2IADA 1F4YL 5D7IA 1HQRA 1PX4A 4AG4H 1JTPA 1AR2A 4HWUA 3ULSA 4K3GA 3QXDA 3MO1B 3QZWG 1HH9B 3Q5YA 2B7DT 4R7DA 4TSBL 4ZPVA 4QRTA 3NIGF 4QXTB 5F1NA 3GJEA 3G5ZB 4C58B 1S9VB 1Q0XH 4M8VA 3GNML 3BVNB 2C3VA 4WNQB 2ADFH 4OCNC 2DKSA 4MDJA 1RJYB 5HY9B 4ELMB 4AYFA 2C9AA 4YEFA 5C0ND 1T1WB 1NAML 1XIWC 2VLJA 1AIFB 2ICES 4JRXA 1FJ1B 2XWJB 2APXA 1TVBB 1RULL 1VCAA 1S7QA 1SY6A 3QEGL 5F7EH 5IBTH 1MELA 1GZQB 2EKJA 1J0HA 1FDLH 2YC1B 2DQJH 4GRWF 3DUHA 4UIMB 5GIRB 3WFCH 1ZA3B 1A1NA 1KG0B 4X7TB 4ERSL 4AIZA 1T7XA 1KLGB 4Z8FH 3FOLA 3QUZA 2WMPA 2X1XR 2CRMA 1T21A 1S5IH 2ZPKL 1YN6B 4U6VL 1EVTC 5B38A 3RX7A 3RVUC 3DGGA 1MJUH 2I5YL 5IHUH 4R3SB 1R24A 2XFXA 3RQ3A 4FMKA 43CAA 4HEME 4GMTH 3ARTA 4GAFB 1RJZB 3KG5A 4M48H 4M00A 4DOHE 1RZKL 3QWRA 3UTTA 1S78C 3FCTB 1A14L 2X1QA 1YMHB 3M8OL 5ECJE 3VWKB 1QA9B 1J87A 2HJFB 3MOBL 2VZVA 1M6OA 1INQA 2DQDH 1KN2L 1MOEA 5F7KC 3NABL 2Y07H 5H8DA 1KF9B 3P73A 4NPYB 1IEHA 4TNWF 3P4OA 3IJSA 4XGZA 2ATPB 2IMNA 3MV9B 4IRSC 5EO0B 2GY7B 2IBBA 1FO0L 1A02N 4LARL 1WBYA 3P2TA 3LKQA 3MLSH 5C0BD 2UY6A 3FB5B 1JFQH 1MJ7H 5HHNA 5D7JA 2CO7B 2XY2A 1U2HA 1CK0L 1KT2A 2AQ2A 2P43B 3N50A 4NKOB 1R0AH 3H6JA 4NRXB 1G9MH 4F7PB 3MUZ1 2VLKA 2Z92B 4ZUTB 2NXYC 1NFDE 3V5KA 1S5HB 4HBCL 2GITA 3FTGA 4NNXB 1JZ4A 4MD4B 3MJ9A 4WW2A 4HK3N 2NXZB 7FABH 4NO3A 4JFEA 3T4AB 1Y18A 2VITA 4GKSB 3PXJA 4PJEE 5D1XC 4OTXH 5DMKA 5L8LB 2EDYA 4Q9RL 4UT6L 2HG5A 1KBGL 1EAPA 5D5ME 4X6DE 1LO4H 3QRGH 4WGVB 4X6EB 1OWWA 4S1SH 5DQ9B 2BK8A 4XBPB 3KPOA 3CK0H 4DW2H 5D6CA 2FIKA 3V0WH 4IEFB 5CEZL 1QZ1A 5C0IA 5T1KA 3W39A 1P1ZB 4NUJA 1MNUH 1VADA 1NLBL 4KK9D 5I8KH 1QBAA 5T5NG 4NN7C 1B3JA 5DDHA 3EYQC 5HVHB 4G3YL 2A9ML 4APQA 3WV0A 3C60C 3MXVL 2HN7B 3GBNH 4ZXBA 3VD3A 2DMKA 4QRQA 3NZ8A 3RTQC 2R1XA 4HWBL 4OZHE 4Y1AD 3IDXL 4YDIH 2YWYA 2W59A 5DJXB 4PY7A 1Q94A 3EZ8A 3KPSB 2VE6A 2YN3A 4D9RE 2DTMH 3RY6C 1FFOB 5ITFB 4YHIA 4FMFA 3ZHKA 1S9YB 3NFSH 4LLWB 4PJHF 5CWSA 3GSOA 3WFEL 5FUZH 1QOKA 2YPLB 3MLTB 4WI7A 3ZKSD 3CFBB 1ETZA 1Z9LA 5IT2L 4KMTL 2CDEB 1N4XL 1Z6JT 2F5BH 3MV9D 1U8IA 3D39B 1N5YH 1I85A 5AZ2L 4ONFL 3ARGB 3GMOA 4ZOCA 5LGKA 1YPZB 3BUYB 5CEYB 5HI3C 5CSBA 4XZUB 3VMPA 2W07A 3CSYA 5T3ZE 3VW3L 1D6EB 4OLXH 4HUXA 1FLRL 3QJHA 2PF6A 5EUOE 3OXSA 4FXGA 4HMEA 4LHUA 4YZFE 3O6FC 4BZ2H 4TUKH 1YMMB 4PJIF 5IROA 3L95B 4NO0B 3OKLB 2PETA 4F7CB 1K9TA 5GQBA 5J8OA 4EUPA 3B9EA 1S7UB 4JEGB 4WEUD 4EI5B 4HF5H 1ACZA 2QQLL 4GW5B 4WUUA 3VFNB 4POYA 2DWDB 4JO3H 2N1KA 4Y4FC 5IJVA 1KCKA 4S1QH 3GMQA 5TE6H 1LEIB 3RPIB 2WM0A 5SV4A 1MVUA 3TWCH 4PGJA 4U7MA 4LCWE 4NUGL 1J8HB 2D2OA 4WHTA 1UQSA 4MCZA 2PO6C 3MRKB 3CX5J 3C5ZA 2ORBL 1X9QA 1ZWIA 4Y4KC 5DJDA 5DJYA 3SKOA 2BNUA 1TFHA 3MYZA 3BWAA 4G8FA 5CZVH 3H3BC 3C9NB 5C6TL 5CINL 3SE3A 1YJDL 5I30L 3DVIA 3LHPL 5CHNA 3MCG1 1DEDA 4PGCA 5CP7B 3I3EA 1DQDL 1NFKA 5H2BA 4PRAA 4Y5YC 4YDLC 1GSMA 4UT7H 5ETUA 2W9DL 2Y6SD 4LLMA 4JY5L 2XN9B 1DQML 1KN2H 1FZMB 2O5XH 5E8EA 3RI5K 3S35L 2YPLD 5IBLC 1AKJA 3IDIA 3TIEA 4WI6A 4HUVB 1U41A 3BKML 3RKDC 1QRNB 4HH9A 5D1QA 4TVPE 3ESVF 1KJ2B 5HYSG 3GSUA 2HAZA 3ARGD 4EJ1C 4YE4L 5TGBA 2OZ4L 3L5HA 3PQYB 3I2CH 1A4KB 3WS3B 4HX1B 2Q7YA 1I3GL 2GCYA 2NY4C 2DJUA 3CLEH 4LL9A 3UAJC 4W68A 4HPYH 3O4OC 1P4LA 3NCYS 5IMKB 1CVSC 4OZFG 4GKNB 4FQ2H 4PRBA 4PGBB 4OZFH 3P77A 3U7WH 1YMMD 4F9LC 4MJ6A 1F58L 1G9NH 4NO0D 1YEHL 4KRMB 3LV3A 3D9AL 1J9CT 5T3XD 1RJCA 4JLRB 4UUJA 2FATH 4JFDE 3RUGA 3T0DA 1IKNA 3VXUB 3MCLL 1NUFA 5IVXE 5EZIL 1U95A 4FQHB 4M62L 1M71B 2P42B 1P84J 5E4EC 1YEDA 4J3SA 4KJWC 4P2QB 5D2NE 1J0JA 2DM4A 1JF5A 4PJXA 3OKMB 4IOIB 4HXBL 1J8HD 3I02A 3FO1A 3VD4A 3AAZA 1K8IA 4H1LA 3T65A 1LDSA 2D3VA 4LPUA 4IOFD 3WHXA 5T5FL 3ME0A 2BNQD 5I66B 4OLZL 5HHXH 1JWMB 2X5PA 5F7UA 2AEQL 5E2TL 4KUZH 4R4FH 3SJVE 2JCCA 3WIHL 3GKZA 4EN3C 4XNZC 3R06B 1RURL 2R39A 4PD4J 5DI8B 3D0LA 5ICXA 1FH5H 1AXSB 1NAMB 4N1CA 3QUXA 1U3ZA 4MNQB 3L3GA 4LVOC 1MCNA 3TNMB 5E6IA 2CR3A 3VXRB 5C07A 5FKPB 1OAXH 3O3BB 2BHZA 4JFOA 5HJ3A 4K9EC 4H26A 5MERA 3WFEH 2XN9D 4HKXA 2Y4SA 3O41A 5FYJL 4AENB 5SX4H 3X14B 5F89A 5C92A 2P24A 4XVJH 1EX0A 4PJ9B 4EDXB 5JXAL 3X3FL 4I0PD 4DQOL 4JHWH 5FKAA 4ODHL 1Q0YH 1T5XB 3TBSB 1QRND 3FRPG 4Y5VB 5ACZA 5IV2B 3U82B 2D31A 4WV1A 2V5TA 5C0NC 1JHTB 2KBGA 4LFHD 4WGWB 3E3QE 4ZFGH 2CIIA 2X42A 3L3OB 4AH2B 3V7AE 2F54E 4PJCE 4QOKA 4YGVB 4HJJL 4NBZB 1HWHB 3I6GB 3GRWH 2GJJA 4RGNB 2FEDC 2AK1H 4J4PA 1T03L 1RAMA 1T3FB 3T0WA 4OIAA 3MR9B 4W6XB 2R8SH 2CLRB 4H5SA 5CJBA 1AQDA 2QHLA 3IKCB 4I3RL 1JGVL 2VXTL 2FBOJ 3GMNB 4YXLL 3VXUD 4PRNA 4S10A 4WFGE 5IBUB 3TJHC 5HHVH 4U49A 5FV1L 3S98A 2ITDB 5L8JB 4P2QD 5FK9A 2RFXA 4GAGL 4E0RA 2G5BB 3NMEA 1FYTE 3CMGA 1T2JA 2V2XB 3FFCE 4KKBC 4JRYE 5I1EL 5I8CA 4JZJB 5DK3A 1A6PA 5D1ZB 5FUCE 3F8UB 2PR4H 5JPMB 3PWVB 4HKJB 4M03A 5F7NC 1QSVA 3EOAB 1Q9KB 4UU9B 3TN0A 3D69A 3S5LA 3HMXH 5C0RH 3L5XH 5CINH 4PREB 1JWSB 2DRUA 5K9OB 1OTSC 1YPZF 4WI2A 2R0ZH 1CTOA 4MNQD 2P5EE 5GGSB 2X6MA 2HLFD 1N7ML 4F8QA 3IDMB 3O9WA 3VXOA 3PF2A 2HVKB 5DRNB 4E9LA 2ADGB 4G9FB 3VFMB 4UI2A 1SEBA 1JNNH 4ZAKA 3I84A 5D7LA 4DVRL 1CG9A 5B3JE 5HGDA 3DXAB 3BN3B 4LSQL 4MWFA 4HS8L 1KOAA 4KXZH 3Q48A 2R0LL 3LKSB 5IUSA 1AP2A 4PJ9D 4ZS6D 1LO2L 4XP5H 3DUSB 4DKEL 1UADC 3FQWA 4LPXA 3CDGB 5EBGA 5TDPB 3AGVA 5KSUB 1CE1H 4JGJA 2OTPA 2ZUTA 4MJIA 1EGJA 3FOMA 3QB7C 3QJFA 5K93A 3LDBC 4I9WD 3KYAA 1N3NB 2VL4A 2BOBA 3O3AA 4BSVB 1RU9H 4CU7A 4Q9QH 3FO2A 2AGJL 4L8BB 4L4JA 4PYGA 5DC9B 1KLFA 4DKAA 1WTLA 3PWUB 1GGTA 4PB0H 3QNZB 2R2EB 1EBAA 3CUPB 5HGAB 1JN6B 2VQUA 3QNXA 4KJPD 3AREA 4AQOA 2CLZA 3U0WH 1GJIA 4RGND 4UDTB 5JIPA 2XZAH 4ZDHA 3IFNL 2GJ6E 1OAKH 2FX7L 5FO7B 2DN7A 4TSCL 1OSZB 1DP0A