3KLQA

Crystal structure of the minor pilin fctb from streptococcus pyogenes 90/306s
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
137
structure length
137
Chain Sequence
b'STVQTSISVENVLERAGDSTPFSVALESIDAMKTIEEITIAGSGKASFSPLTFTTVGQYTYRVYQKPSQNKDYQADTTVFDVLVYVTYDEDGTLVAKVISRRAGDEEKSAITFKPKRLVKPIPPRQPDFPKTPLPLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative pilus anchoring protein
publication title Crystal structure of the minor pilin FctB reveals determinants of Group A streptococcal pilus anchoring
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
total genus 18
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12892 FctA Spy0128-like isopeptide containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3klqA01
3GLEA 3B2MA 3KLQA 3GLDA
chains in the Genus database with same CATH superfamily
4Z7VA 3L4ZA 3P0YH 4LCYB 3A24A 2NSXA 3TNNB 4DN3H 5LG6A 3O3AB 1WSST 1Y6NR 2AITA 2HKAA 3KPRE 1JYVA 2WCGA 2F9BT 2W92A 5DURB 3BZFB 2PMZA 5JOEA 3LRHA 3L3JA 1X6NA 2WLLA 3EBAA 4I0KA 3KPPB 3MGOA 2HH0H 4Q8BA 3EYVA 2AMGA 2B3RA 4IMKA 3RRQA 3QG6B 5CMAA 5CINH 4GRMA 3EFDH 1FFRA 3QORA 2WWMC 1BFSA 4JO2L 4S1SL 4P4RA 5DD3H 1J5OL 2GT9A 3CZEA 4PRAA 4L3ED 5C09E 5I1IL 5E08H 4U1MA 1SPDA 1AR1B 1WFOA 3NTCL 4QTHA 1KG0A 4WTZA 3BLBA 3E1F1 3PHQA 4C56E 1KDJA 1AS8A 4RFEB 3C5JA 1DBML 1JS4A 1BAGA 1G1CA 5I8EA 3P4OB 4OGAD 4K3EH 2A0LC 3NIDF 5CP7A 4YDKL 2YZ1A 5IHWA 1OQXA 4Y4FB 2HVKA 3QXTA 4QO1B 4D2NA 1CFQB 3OGCB 1HYSC 3CQQA 1D6EB 4F9LC 1BFTA 1ZT1B 1RK0A 3AREB 5K9KB 4WAFA 5L0QB 5E8DL 4FQHA 1XCQA 5GGRA 1F11A 2JJTA 3VRLF 5BOPA 3BP5A 3D06A 1DQQB 4TRPH 2YPLD 3IAQA 3QGVA 1Y18B 5LO7A 4G8GB 5GGSA 2J8UF 3JSSA 4PJCA 1U42A 1BMZA 4HWUA 4PTTA 1Z5HA 4PS4H 4DHLA 2XV2A 4NNPL 3UEZA 5CGTA 2TSAA 3V4VA 5DR5L 5D7KE 2Y6TE 3WD5L 3L4UA 5HYSG 3GSWA 4WSGA 4IYKA 3CZUB 1YYLH 1IGJB 2UZPA 2NY3C 5T5FH 1SOXA 1WC7A 1MHHB 2WMPA 4KK9C 3GBLA 4WWKB 2VW7A 1E4HA 1E5ZA 1MCIA 1VDGA 4JRYE 1GS6X 2X44D 1OP9A 1NCGA 1W2KT 1SOQA 3WJMB 1IB5A 3W11C 3CUPB 4Z8FL 3D34A 5KYXB 4KMTL 2CUMA 4NWUL 4U7SA 1KELH 5AW0B 2ATKA 2BMKA 2O5YH 5CS7A 4TNGA 2VLKD 2A9AA 3QDAA 3VFTB 1KZQA 5L4JA 1GYCA 3LPFA 1YNTF 4I9XA 2QADC 5JNYA 3QQ9D 1H3PH 2B0SH 4IMKC 5C08E 2OCFD 3DX4A 3MJ7A 3P3RA 1JZ2A 3QORC 2F54B 5T8IA 4W4OA 5GPRA 2ZAHA 5B8CA 2CDFA 3BISA 4MNQE 3FHEA 4YSQA 4YHKH 4RGOL 1SYSA 4GPVA 4AOFA 4YHNA 2OTWA 3VFWB 1RK7A 4OAWA 2XVLA 5HDOA 5IJVB 5KVGL 1A9BA 3BP4A 1JZHA 2HMID 1MH5A 4UQ2A 3DROB 2ZWNA 2CHXA 3NIDB 4DCQA 1MCHA 1FAKT 3QO1A 1F00I 2VGLM 1BVZA 1S9VA 3GSNB 4XGZB 3RPKA 1JRHL 2IWEA 3Q7JA 3KLAB 1JK9A 3MBED 1AXTL 1HWGB 1X5LA 1BIIB 1I8AA 1XSKA 3KYNA 5GGQH 2AABL 3T6ZA 4CU7A 5DMGD 2X1WL 5D1QA 4OCMC 2DEYX 5ICXA 4CUCA 1LP9A 4HJ0C 2JJTC 3H6AA 1NKOA 4K7FB 4E0RB 4EI5D 1SDDA 3TO4A 2ZAIA 1NDGB 2J8UB 3O6LL 4R7LA 2Y22A 3I02A 3DSFL 5EO9B 3ZQWA 1BP3B 1N0LB 5I73B 2WSDA 4NQED 4BD4A 4U1SA 5CU9A 1F1GA 1BJMA 4QHUA 2HB0A 1KGCD 2V5TA 5TQ2L 5BXFA 3WTSA 4PRIB 3S8FB 5KAQF 3FO2B 2J8HA 1IFGA 5GSRA 2GTWA 1E5BA 3BW9A 2EDQA 3BGFC 1GGCH 2XQYG 1OHQA 2D7TH 3ABZA 1OHZA 5CBEA 5BZDA 4AEIL 2AEPL 3CMOL 4OF8A 5I1EL 1IAMA 2RR3A 4FZEH 5HGAA 3V0DA 4A6YL 5JHLH 1QNZH 3L4TA 4MB3A 4G9FA 2J5WA 1E28A 4P07A 2HT2D 5HDWA 4HFWB 2APFA 3NJHA 4M1CC 1GKEA 4FFYL 1HILB 1YNTB 1KZYA 4PJIE 3AXIA 3ARXA 5B1JA 4I18A 5HJBA 2YC1B 4N1HB 4X80L 1XGPA 1SDAB 3GTTA 4W4OC 4Z7VF 5TPWL 4JDTL 3ZKQD 5B8CC 4RQQB 3AWEA 1NKRA 2ZAGA 4BZ2A 2BHUA 2V5SA 4S2SB 5KN5A 3C60D 1CDGA 3HKZA 4TSAH 1TVHA 1SQ2N 3HG1A 2J4WL 4C55A 2NXYD 3S88H 2WN3A 5DJ0A 3HI1A 3POHA 3S4SG 2EDFA 4XCFL 1SZNA 5IQLA 5ILTH 3SDXA 1OP3K 4O02H 2N59A 3TT1L 5I2IA 3ULUF 5A1AA 1GRWA 5AVTB 3RLSA 5IGXL 4XC1L 5C0AB 3TURA 1AJ7L 3Q2LA 2A5UA 5D1QC 4FJYA 5F96L 5C7XH 1TPXC 3TH2T 3FH7A 2IGFH 5I17B 3TO4C 1A6AB 1USZA 3ABMB 3CZFB 4ZFFA 4MCZA 1IBGL 3CLEH 2JXMA 4XTRD 5GS0L 4BYHA 1KFAH 1BWMA 5E9AA 4M48H 3DK2A 1XGUB 1E5AA 1FLRL 2YSSA 2B39A 1G1KA 3SE9L 3AB0B 3EH2A 2QVTA 4RDQF 3LKOB 5F0JB 3L6FB 2D9QB 5CKGA 2XPYA 1RZ7L 2ADGA 3FB8A 4Y5XB 2AAVA 2NNAA 1PG7H 1WF5A 5ABDE 1QLEL 1N64L 2BOLA 5C0DA 4NQDA 2RQ8A 4RGMB 2YUZA 3V4PA 4OQTH 4NZFA 1H19A 4Z7NB 1ZWIA 2DQIH 1ET5A 1WG3A 3WNMA 2BNQA 3M88A 3MNMA 3QZOA 2N1TE 1G7MA 3QUXD 4LGSB 2OMNA 1HHIB 5JYLA 2OYMA 2A9DA 4KHTH 4OV5A 3IE9A 1CE1H 2H0EA 1IBZA 2DDQH 5G4OA 2YRPA 4I18C 5MHSD 4UT9H 3F7YB 4Q74A 4PJ8A 1YNLH 4NRXB 4XNQA 2YGNA 5GZND 2EO9A 2VSCA 1KCUL 1SJVA 3N9GL 4UOW1 1HOCA 5CR8A 4AJYV 3IXAB 2R2CA 4PVMA 1GW0A 4XB3A 5D7IE 1UWFA 1UWGL 3BKYH 2XJKA 1OE3A 3I6LD 3ARBB 4ZPTA 3EJQA 4FI6A 1KBVA 1O0VA 1IIKA 2CLZB 2Y6SD 1XF5A 3B3IB 1N3NA 4HEPG 3VQLA 1KF9B 4P04A 2A99A 2XV0A 3AUVA 4XVOA 2XVGA 3C5ZD 4JBSA 9PCYA 2CIIA 1NMAH 4J3OD 2ORBL 1IGTB 1L5GB 1WEJH 4DKEL 2DYSB 1LE9B 2VQ1A 1R3LB 5GS1B 4BSJA 3Q2NA 5HHOA 1ZK5A 2OXGB 3MRBA 1JGDB 2E7HA 1U8PB 3C6SB 4GQQA 3Q9PA 4R4BB 4JM4L 2H2PD 2PO6D 5DVKA 4B50A 5FUZL 2KMWA 1GOFA 5E00B 3HZKB 1X5XA 3ZTJH 1FVCA 3DVNB 1GS7A 2JH2A 5JXAL 1TZGL 2FQFA 3L4CA 4NNXB 2OQJB 1KYUA 2RBLA 5EOCJ 5FOBA 1LWRA 4ZX4A 1ZA6A 1CFVL 3O6FA 3GTNA 4QHKJ 5KBMA 5E4OA 1EEUA 3LQZB 2RB8A 3B1UA 1GTNA 1HWHB 4LDOB 2C7UA 3T9WA 3M1BB 3NVQA 3WHE1 5BPPA 3KBHE 5D7EA 2X7LB 4Y1AB 3QCUH 4U4BA 3T0DA 3QPXL 6CGTA 4NRZB 1BQHA 3FCTA 3FU7B 5K1JA 1HXYB 2NY5H 5J56B 3HE6B 4A7TA 1NWOA 2A1WL 3KHQA 5C0CE 1QBAA 1OALA 4JO1H 4XXWC 4K5NA 3D4ZA 3D87B 3GSXB 3NGBC 2R2HB 2X4OB 1WAEA 3HZVB 4EZMA 1MFDL 4PJ8C 5F72S 5TE7H 1E4WH 4Y9CA 2WHVA 2CGYA 5IK3B 1ZGLA 4ERSL 2AMUA 2R2BB 2Z7UA 3A4EA 2H3KA 4J4PD 4J7RA 1FORH 2V9QA 3M8OH 2PCPA 4D0BA 4ELDA 4ICXA 1BVKB 2A9ML 4EUPB 2PP7A 4I1PA 2BXZA 3K2MC 3T77A 3SYAA 4LCCB 4UQBA 2H8PA 3LQAC 1T6BX 1IC5H 3MLZH 1JOIA 4KC3B 2WYZA 1QRNA 1T04B 5IV2A 3IBEA 4UQEA 2LLNA 4UV7L 3IDGB 3QIBA 2CO6A 1DBBL 1NLBH 3EYFA 4JDZA 1TNNA 1KLGA 4GJTB 4P9HC 2HWZL 2NY7L 2W9EH 3IMRA 4U3HA 5TF0A 4N24A 4AQAB 1ET8A 5JLZA 4P2QA 4JM2F 1NGXB 5INCB 4QCIB 3GUTB 4K23H 2IBZY 1UEMA 3MBWA 4ELMF 1S7RB 3P3YA 3WFZA 3CVBA 1L6PA 5AZ2L 1T0NB 3MA9L 4L9LA 4Y88A 1JDCA 1N70A 3O3BB 4S11A 3ZK0A 4BFIA 1QMUA 4DPAX 3VB9A 1K4DB 3O6FC 4Z7UF 3E6FA 1UA6L 5HHVH 1U8QA 4JFFB 4K9EL 3CFEB 3A6CH 3MRHB 4DF9A 5FLVA 1IM9D 4ZFZB 4AVJA 1WFMA 5JR1L 3CFJA 5KS9B 3RVUC 4WK2B 1VESA 4RMBA 1N5YH 2K1MA 4TUKL 5CEYB 4HUXA 4PV1C 4WFGE 4Z0XA 4GBXA 1XSJA 4R4FL 5DSCA 4DGIH 5SX4I 1D5IH 1WT5C 3SPIA 4HWZB 4W9CC 3KCPA 4G1MB 3FT4A 3IF1A 4L5FH 3HN3A 4A1RA 2X2JA 3H56A 1UYWL 3WKQA 2C3VA 4JDEA 3LIZA 2IH3B 1IE4A 4OFYA 4WY7L 2VLJD 1DVFB 4Y16A 5DO8A 1X7QB 5L2KD 2FIRT 1MAKA 5BV7L 4CVXA 5E6IA 5J12C 2HPOA 3O2WL 4IBQA 4KDTA 1QFHA 5L88L 3KPLB 3L2LA 1KJVA 2PXYA 2R83A 4NM4H 2AHIA 1UD3A 3C8KB 4U0QB 4OZGA 5J13B 4P3CL 4QKXB 5KBLA 3O3EA 4RGNC 4XPAH 5JUEL 2D73A 4TNWF 1M56B 3MFGB 2GCYB 1KJ2B 1MJJB 2XX0A 4OSUH 1XFPA 2KKQA 5DC4B 3V4UL 5AOIA 5EBWA 3WLWD 4HHWA 5EIIG 3QIBC 3UTSB 4ZTOH 4BBWA 3ETBJ 4X7SL 2VLLB 1S9XA 3VRIB 1K5WA 1K8IB 2CO7B 2FWSA 4KKLD 4LLAA 1MAML 1T89C 3AU1B 1DDTA 4Y4HC 1EBAA 4K7PH 5M7QA 1OAQH 3GS4A 1CR9H 3CN1A 4U49A 1NZRA 5GIRB 2Y36H 3RL2A 2C9SA 4JM2B 3L54A 2Q8BL 5L4FA 1ZT4B 5AW3B 1CG9B 3RG1C 2GK2A 2XHNA 4HIHB 3EKCA 4PM1A 2ZYHA 4ELMB 4F7CA 1B4JH 5A2JH 3PWVB 4QXVA 4M4RB 3VD5A 4L9LC 1ORQA 2VLRE 3PY9A 3MNVA 2BVEA 2VISB 3GMMB 5MEND 1XD0A 4Z7UB 3BEWA 2L04A 5KJRL 4Y2LA 2NY1B 2CM5A 2NTFA 2F8XC 4FYRA 1RPUA 4XPHL 1NPUA 3J8F7 2AGJH 4ENED 3B2DC 3U2IA 1E4XI 1K8DB 3QNXA 1I8LC 3DX3A 5C92A 4HD9A 5F7DB 2BSTB 4XCYA 5IF0A 4NKDA 1MRFH 5E5MA 4DTGH 1UT1A 1MNUL 5D55A 2BOBA 1VZIA 2DLTA 3T09A 2BP5M 1AKJB 3WN5C 5K9JL 5KSVA 4PG9A 5IKCA 2O5XL 2ITEA 3TBYA 1UB6B 4KK5D 2QQQA 3BCDA 2ZSVA 2BFGA 4YDVB 3RU8H 5E1QA 3S34H 4A2LA 3NSCA 1PLCA 3TCLA 3GLZA 4Y16C 3SDAB 5EU5A 3DDFA 4R90L 1WAAE 3ZVVA 1UUSA 1HJCA 3QPQD 3LQAH 3V8CA 4KDTC 2ZF8A 4JO3H 1NCAL 4NPYB 5AW9B 2Y7NA 4HKXA 1A7OH 5IZ7A 2Y7MA 3CVHA 4XNMA 1RIUH 3SCMD 3SBWA 1XQ4A 3L1EA 4P9HH 5FX3A 4AUYA 1MCCA 5DU7A 4BK5A 5I1JL 2W81C 2WQSA 4TYUA 2IO5A 1HZHH 1DVQA 1OK8A 1JGVH 1ZA3B 2CLRA 1N59A 3DWTA 3QHFH 4APXB 1V05A 4E9XA 5ESAB 3X12A 5C6WH 1RUML 3FO0H 2HFEA 2Q7YA 1S5HA 4ZTEA 4BQ9A 2QHRH 2XFXB 4JEGB 1HSBA 5DUMH 2XG4B 5I76B 4LCVA 5F88B 4G11A 3BEVB 1NCUA 4H8PA 1QFWI 4HPYH 3ZR5A 4MSWA 1X5IA 4JFEE 4ZMOA 1UKQA 1CD8A 4MJ5B 4BFRA 3PDOB 2YKLH 1YEGL 4LIQE 3MXWL 4UAHA 1T0OA 1P7QB 5D5MA 3D3VE 3GXIA 1ZHNB 1CIUA 4GRLA 3ZDYE 2D7PA 3JVFC 4FG6C 5D6CB 3K6IA 1LK3H 1KJ3H 3HI6H 5GRYA 3OXSA 5D7SL 4BCYA 4HX1B 1BLIA 2FAUA 4G6FB 2FCBA 4AMKH 5CBAA 2JCCB 3N04A 3ZO0A 1HYRC 2BW5A 2V0AA 2OLDA 2BRQA 3TEXA 1FNEB 3U4EB 3QIWC 3B3BA 5J4MA 2H6OA 4OFIA 3EJYC 1Q8MA 2NY6B 3LZRA 2X12A 4YFLI 4BZYA 1M1XA 2H1XA 1MFCL 3ECWA 2RH0A 2IAMA 5HHPA 4HIQA 1I75A 4KPHL 1JHKH 2VDKH 5MEPA 2AXFB 1J0JA 3Q3GA 4PI2A 2BS8A 1DEDA 3KPSE 5FM5O 1T6WA 2N56A 4C56B 2ZYSA 2J8OA 4IIQA 4I3SH 2H1PH 1U3HD 3EYUL 3LKQA 3MLWH 3VXRE 3L3KA 2KL6A 1S3RA 5EA0L 3SBWC 4Z23A 1MHEA 1OGTB 1PVHA 4J3VA 2F74A 5TD4A 5DD6B 4A2EA 4LU5H 4BK5C 2CH8A 3E3QC 2AV7B 5E4IA 2CO3A 2NX5A 3NFPA 2WLZA 3PHOB 2G0LA 3CIQA 3OHMB 5CIPH 3SY0A 5D7HA 1OPGH 4FA8A 2GITB 5I1AA 3S35L 2BDNL 4TQHA 5DRNB 3ZJAA 1T66D 2AK1H 2P45B 4JO5A 1QYGH 3IPBA 5I1GH 2XNAB 4RWYH 4AYDC 4OVVA 4LEOB 4GS7B 4F2ME 5I15H 1MCOL 5DQ9B 3U9PH 4HP5A 3QB7C 2AC0A 3FHAA 2EE0A 2B1OA 5HGHA 4D9LL 3BZ5A 1I1YA 3DPBA 4I77L 4GRLC 3GSUA 5IESH 3MCG1 3N55A 3RFZB 2WUCH 4L8BB 2YS4A 2X38A 3T4AA 4B9CA 4OJYA 2CGZA 1FL6A 4LCUA 4LP4A 2DWXA 1HCFX 5ICZA 2Z93B 1OE1A 3QSKB 2D8KA 1NCCH 1BD2B 1X7SA 2QQKH 1Z3RA 5ITFB 4NENA 3MJ8B 3UFIA 1LWHA 1Y1UA 3NAAL 2B5IC 4PJIF 5LNDA 4YGVA 4UTBH 4JO8A 3ZSSA 4XB7A 4YHPA 1UXWB 1SOKA 2DMHA 3FRPA 4KTEL 4BELD 1KSRA 2V17H 1C5BL 4FNLL 3QDJA 5SWZA 1ROCA 2IAMC 4E42B 2IOMA 2XVKA 5KYNA 4PJXA 2XQBL 3D2UA 1QWHA 1SY6H 1U8MB 3HB3B 4JHUA 1CDCA 1J8RA 4O51B 4U1GC 2P46B 4S0HA 4IIQC 1KPUB 1JZGA 1QTSA 4IEFA 5EU3B 2JJSA 2XN9E 4HEPA 1XCXA 4Q7DA 3BN3B 4WW2C 2HFFB 5EN2A 2CO4A 2EXWD 2I9LB 3CFKA 5DD5H 1S5IL 4GUOA 1H3TA 2BNUB 4KI5F 3GJFH 2XG5B 3DX8B 4D0DB 2V5MA 1MWAB 1Z9PA 2JIXD 1TTFA 2G60H 2NY0D 4TPRL 5F1SA 4LP5A 2FZ3A 4UWQB 1MDAA 2YRLA 4LF3B 2XACC 4ZS7H 4DZ8A 2WNKA 4GB9A 4I2XE 3IDJB 3INUH 3DDGA 2E7LA 1S78C 4HJJH 1YPZA 5ISZE 4G72B 4O58H 2VABA 3MCLL 4KVCH 4M9OA 5F9OL 1DQJB 3GI9L 1B0RB 4OM1H 4G80A 2HVJB 2X0WA 4WFFD 3SN6N 2VTFA 3C5SA 4U1HA 3MRDB 2FNWA 5EOQH 2Z7YA 4NC1E 3N1QC 2WLYA 3IJYB 1TTBA 4XVUD 5ESQB 5JMOC 1MHCB 1MIML 2WC7A 4F37F 5CZVL 5I0VA 4ZOAA 4K55A 3T4AC 1GSKA 3DMMB 2FQDA 2FEDD 3WE1A 4R26H 3DO4A 3LCYA 1AHMA 2AEWA 3VDCA 3AM8A 2IANE 1CICA 3FQWB 3Q8AA 2VRQA 5HY9B 3MLVL 1V27A 5F93C 2EP6A 3I9GH 2XTJD 3O0LA 4NO3A 4FFWD 3O2DA 4MS8D 4XBEH 1X5ZA 2X05A 3SJVB 3WE6A 4ZUSB 3L3GB 4Z7AA 3F01A 1WD9A 5C3IA 3F7RA 5JPNA 3RZCD 1CGVA 2K6YA 4G7YH 3WCYA 1MREL 4FEMA 4X6CA 4X9HA 3K6SB 5I1HL 1WLHA 1SM3H 2ISDA 5D7IF 2EIEA 4YH6A 3VRJA 1N10A 3I3BA 1KBGL 1BEXA 3BE1L 3VXTA 2FBJH 3QZWB 2JJSC 3VXUD 3BHBA 5ACLA 1XF2B 1YEJH 1YJDC 1EBPA 3E1ZA 3O11A 1OCRB 4U6YA 1HQ4A 5B38B 4JB9L 4ODHL 5KANG 1I1AA 1GCYA 4JQIH 4JVUA 1MZZA 5MI0C 1Z9LA 3X2QB 4I9WE 4PRNA 3QUXA 4OD3L 5IB5B 4DQOH 2E6PA 2OR9L 4OJEH 3HN8A 4R96B 5ADPL 4LGRB 1T03L 3HVDA 4CKQA 3HE7A 4GINA 4WSJA 4S0TD 3II1A 2CBQA 3SKMA 1UZ8B 2VLMD 2E7LC 3FQ2A 5GZNA 3QNYB 5BRZB 1ETZB 4LAQH 1F4XL 2BSSB 1OCWL 2K6ZA 1ZGLM 4OCWL 4OH2A 3WHXB 1XTLA 3DUHA 1U8HA 4LL9A 1J5HA 4UZSA 2R69L 4UTAA 5DS1A 1MW0A 4HK0A 5BS0A 3QQXA 1YECL 3N41F 2BWDA 4ZXBD 2CUAA 4YWGL 2A77H 1I4FB 5IOPB 1HTYA 2VXSH 3EDKA 3Q6GL 4J3WA 5KSBE 2D2CC 3PP3K 2HLFC 1GGBH 1KUMA 2YD6A 2ZUWA 3OXRA 3UBFA 5IVXA 1FH2A 5AW7B 2GTQA 4P2RA 2A6KB 3FCUB 3AM8C 1T4WA 2Q20A 4MMZC 3S97C 3S5YA 3V9CA 3VFGL 1CICC 1BBJA 32C2B 4G3YL 1I9IH 1MFBL 1NCHA 3EFFB 5JZ7D 1M05B 4RISL 1WO2A 2BCMA 2X4QB 3LS4H 5JPNC 3KXFA 5AEAA 4LSUL 2OSLA 5I8CB 4R5XA 1EJOL 4PRDA 4O4YH 3OSVA 2K9UA 5H35A 1NC2B 5D7IB 3ATFA 4NCC1 1Q1PA 3TFKD 5JW5B 1T20A 3X1FA 3QJTB 3AABA 1WGVA 1EFQA 1JPST 3FCGA 3QFJE 4EN3B 2VXQH 2M1KA 2E5EA 2MNWA 4LVOC 1I1AC 5B3JE 4R8WH 5FYJH 1W0WB 2XWRA 4UF7C 5EIIA 4TV3A 1XGQA 4LLWB 1VKXA 1SUHA 3IPFA 2FHBA 1YEHL 3DTXA 3FFOA 2VMJA 3LKRA 1B88A 2ADFL 4UU9A 3QJVB 3V6FB 3QEQA 2MCPL 2NYZA 1F86A 4FKHA 4FULA 3REWB 3HE7C 4M9PA 4MJIE 2WQ8A 1INEL 4BH7A 4HOWA 3RL1A 1IJNA 1P9MA 5GJSH 4X4YA 2HKFH 1WPCA 3BI9X 4XNYL 4NUGH 4RRPA 3OLGA 5DEJA 1NINA 4FQJH 2JB6A 1P5VA 3AT8A 4NZTL 1QBML 2HLEB 4PJ9C 3NCCB 3S3JA 2ESVE 1KMGA 2E7BA 4HC1A 4UZUA 5CHNB 5L9DL 2DLFH 2PW1B 4G6ML 4FYTA 4X4KA 4IK7A 3VGHA 3HMWH 3RJDA 2IWKA 4C4KT 2Z7ZA 2YAFA 3N41B 2CWRA 3ZE2B 5C0JB 3MV8E 5HVHC 2B3IA 2FQEA 3GZQA 4OKDA 4FLOA 1NA8A 5J3HD 4PJBA 2WAHA 4WI0B 2Z31B 1HJBC 4AL8C 1DBKL 1OGAE 1UCBL 5H94B 5C07E 5DZVA 1JWMB 2G5RA 3VWKD 5FV1L 2LAAA 4JCWA 4BSWB 5I1KL 1XSIA 2GHWB 2EDDA 1EAPB 4PWIA 1EHLH 5J8OA 2X1OA 4AVKA 2R23A 1L9NA 4JREB 1BECA 3VH8B 1GPOH 4GT7A 3APCA 2CKBB 5CUSL 1LNUA 1EMTL 2WD0A 2G2PA 5EEVA 1TTRA 5EU6A 4AXWA 3VXMD 3GMLB 4YNYB 5ETUB 5I23A 2YOAA 3KBFA 3IGAB 3MGTB 3UPRB 3WUWG 1N19A 3SZKC 1IAIH 4UM9B 1XT5A 2H6UA 4WI6A 3SDCA 3T2PA 5IQ7L 2CLVB 3GRWA 4TQ8A 4R9HA 2WBJA 5GGTL 3KPQA 4IKJA 2M83A 2H32B 2V4LA 1CFTA 3FQTB 1NBYB 1RQ5A 2AEQL 3QJHA 1YY8B 3F65A 2XN0A 4MXQD 4D9QD 3CV5A 1P9MC 2VMEA 1U3JA 1VCAA 3QUMH 3GM8A 3GLEA 3O6KL 3BFQG 3OAYK 5DWPA 4EIGB 5JHDE 3O2VH 3O3DA 3KLLA 5CD5C 2F61A 3RWCB 2ZP0T 4K2UH 1J0YA 5EOCL 3BJLA 2A38A 3S37H 3WN6A 4NBYB 1KYAA 4P5MA 4MQXC 4F8LA 1R5IB 2OZ4L 1CXHA 3SKJL 4ABWA 2YD5A 3ULUH 1RIHH 4BWUA 4WUUB 1KPVA 1CXIA 2FJUB 4ZW8A 4WTWA 3NBNA 5EZLA 1FFNA 2APWA 4CW1A 1IAOB 2I7OA 1YMHA 1MEXL 4FL4B 1B2WH 1FL5B 1MCRA 5EWIL 3BQUA 2UWEE 3SO5A 1OEZW 3NRQA 4HS8H 5IFHL 3BIKB 3IFOA 1E6JL 3V0FA 2XKNB 2DQGL 2EACA 4ZO8A 2F58H 1BMWA 5IBLD 1I8UA 2FBOJ 2BZDA 3TZVB 4DJMA 4FXGA 1CI3M 3G5ZB 3FTWA 5L4MA 3GZKA 2DYPD 1WAAF 3TN0A 3L2MA 4UQIM 4DEPC 1S7XA 1A4KA 3Q44A 4H2AA 4RMVA 1NGPL 1TJMA 3CFUA 3HLAA 3K80A 1FI8C 2H7WA 1FC1A 3Q43A 2UYLB 2OI9B 1TLKA 4I0CC 5T5FA 5E8OA 4CGUB 3T0XA 3FO1B 1ZSDB 5KYUB 2Z9TA 3SDCC 3B1TA 2PCFB 4WVRA 4Z77A 5GSVA 1J1PL 1PGRB 3NEXA 5EU4B 1VCBC 4AYMC 1OB1B 2XFGB 4LSVL 2DMCA 4R7DB 1SJHA 1TTAA 1I9JL 1DJGA 3PNRB 4DEUA 3H9SB 1ID2A 3HNSL 4JNXA 4HV8A 4GW5A 4NKOB 3U6RA 2CXGA 5TDPA 1DSFL 4P23B 4Z76A 4XVSH 5IEHB 1JZIA 5JMRA 4DUVA 1G1OA 1RJZB 2KI6A 1NIDA 2G5UA 3AU0A 4F33B 4NQXA 1W0YT 3HI5L 2VLRB 4X5XA 5B4MC 2X4SA 1IT9H 4LKXA 3ZDYF 3BESR 2FATH 2VMCA 3BJ91 1B9ZA 4RZCB 4AL8H 3BRGC 4LLYA 4B96A 15C8L 3GXFA 1J05B 4JHWL 2O4EA 1RZKL 1HEJC 1ADQA 1CU4L 4OZ4A 2RCSL 4X8JB 4BZ1L 2W94A 1DYZA 4XMXA 3NFSH 3MUZ1 2IG2H 3IRPX 2FWUA 3BQUC 4H26B 4OLXL 1Q1JH 3L17A 4EIZC 1L7TH 1WS7A 2OTUB 2B4CC 3DV6B 3WSQL 4M8QB 4OCSH 3L5WA 1IUZA 1BM3L 2LU5A 3IN2A 4UM8A 2APSA 1CN4A 4N0FA 1JYWA 5AYUL 2ZG1A 4ABQA 4BGLA 1FN4B 1H6TA 2IFFH 2ZPKH 2H5UA 4JPKH 4UIKH 4DP1X 1PAZA 4PUBL 6FABH 3KAAA 2OJEB 3TN0C 2NLJB 3LMJH 2OXHA 3WELA 5AENA 2EZ0D 4N2OA 2KUTA 4ALAH 2P28B 4OLYL 1G9ML 2BZCA 1XD1A 3FQXA 3ETSA 4CSTA 4AQOA 4GAJH 3HFMH 4QRBA 3O4LA 2MTAA 4HK3N 2P44B 3SOTA 4B9YA 4ZTPH 1FNSH 2R4RL 1OTUD 3QDMB 2UXGA 5F3HB 1IC0A 2OYPA 3UG4A 4ZYKA 3S0PA 5E6UB 2VH5L 3E2HC 4H88L 4OZFB 2EXYD 5CZXC 3KWWA 4LSRL 4NGHH 1G7PB 1G7QB 3ILQC 4DN4H 3OWEA 4I5BB 1NCWL 3VX1A 5JXEA 2VRKA 3BZDA 3X17A 1G6RA 4JZNA 1E2ZA 3K81A 4PJGA 2F5AL 1AD0A 2X6AA 2V5YA 4JFEB 5FA3B 5A2LH 3HS0A 1BZDA 3MNZB 3MRKA 3BZ4A 1IFRA 1U3HA 3QEHB 1QG3A 5I74B 1U8IA 2EC8A 1OD9A 3L4VA 2WIIA 4JCLA 3ZDYB 4J6IA 3HJ0A 5T1KA 3UBXG 3DX7A 4WWPA 2F53D 4NHCL 3CDFA 5C0IA 5GRJL 2LTQC 2XBZA 3V5KA 1DLHB 1CLZH 1X5AA 2EYRB 1DVZA 4K3DL 4KH2A 3LQMA 1L9PA 3DO3A 3ZL4H 1XGYH 5LCVL 2OMUB 4WSKA 5KEZA 1P7KA 3QXAA 4Y2DB 4K8RC 4GSUA 1WAPA 1R5WA 5CN3A 1I7TA 4PJAA 3ZTDC 3SYQA 3EJYD 2HTLC 5HBBA 4F57L 4BCZA 4FQQA 3EGXA 2Z92B 3OPZH 4B9KC 5IQ9A 4JO4L 3E6HB 3KPSB 2FJSA 4TUJB 4B9ZA 4YLCA 4KJWC 2BOCB 1WIPA 4OGXL 3D39A 4DWHA 3OHXB 2J57A 4XPFL 4Z3JA 4AENA 2R27A 3VXRB 4WKZA 4PP2A 5A16A 4PGBA 1W8OA 4XRCB 4TQEL 1BYPA 1ZVSA 1RURL 3O9WA 3L7FA 1IC1A 3DC0A 3RAJH 2VXUL 1NBZB 4FLSA 4IRSA 3SDDA 1D2OA 4FG2A 3EOBB 4HQQL 1DEEB 1ETJA 3LEVL 3PUCA 4HSQA 2IDFA 2WXNA 4G5ZL 4RSYA 5F89A 1AACA 1OAKH 2QKIA 1MQKL 5JXEC 1N4XL 1FWXA 1SVBA 1Z5LB 4PJ6A 5TTRA 4E5XB 1BREA 4F2MB 3K6DA 2DQHH 3WDJA 4AYBA 1CCZA 4DKFL 4IKKA 5HD8C 3LV3A 4CC1A 2F54D 2HG5A 2VDPB 3HS0C 2BO0A 4H44C 2P5WA 4DK3A 4F2EA 3B56A 2O1AA 3RVXC 4QT5B 1X7TA 4QI3A 2YAHA 4NKIL 1R0AL 5K59E 3LZQA 4AX3A 2BH0A 3OPUA 4YO0B 3ULSB 1FYTE 4ZI8A 1IQDA 5DK0B 1PG7X 3P11L 5BMFH 1JNLL 2B4CH 4QHNA 1GC1L 1HCYA 1D7FA 4M56A 4FFZA 3EJUA 4WK0B 5IMMA 1WZ1H 2K78A 1KXTA 1XX9C 5ADOH 1MSPA 3GD1C 4JY4B 4BFFA 3JWOL 3P4MA 4JRXB 3Q1EA 5IB4A 2WWKO 4W9KC 3BAIA 3ZKND 1GMEA 1I8KB 1A6PA 3UACA 4LASL 5T1DH 4B3VA 4HKJA 5SWQA 4NJ9H 1A6ZB 3DYMA 1MHPH 4H13C 4LCIH 1TETH 4YQXL 4N2EA 1QEXA 3ARTA 1WZAA 3BWSA 1JD9A 1SXCA 4OTXL 2VDML 3VQ2C 5FA4B 2NYYC 5E1AB 2R51A 1A1NA 3H4FA 2XN9B 4AM0B 5I1DA 4Q58C 4F7MB 1YG9A 4OCXL 3GWJA 4BRVA 2GHZA 3LKSA 5ITBL 4PJ7A 5EOTB 2YBGA 4OLWH 4IOIA 1U3NA 2GK0B 3U1SH 4KJPC 1G87A 5HYEA 4OZIB 3EXJA 2HFTA 2WXIA 3O9WC 1WCBA 2FUQA 4IRSC 3ZMEA 3SDDC 1Q9OB 2HKHH 3VXNB 4MBOA 4N9GB 4N9OB 4QRRB 2VWEE 3L9EA 4FQIH 4FRWA 4PRHB 1AHWA 1JPGB 3BAWA 3KLHD 3FUEA 5FYJD 4I2XB 1EQWA 4XR8C 5M95B 5E94B 5ISZB 5FGRA 3VXSA 5AYQA 1N5AB 2QDWA 3QZMA 1IKFL 5CJQL 1BZ8A 4P5TA 3QJFB 2E56A 4WGVB 1U8CA 2ZCLH 1LMKA 1S9YB 1NGZB 1QPXA 4AGMA 4AGNA 5LWYL 3GMOA 5T1LA 4HLJA 2FYVA 3D0VB 4Y1TA 3ECBB 2CPCA 2GTZB 3QUZD 2P47B 2QSTA 5KSBF 4XODA 3V5DB 2WNGA 2IDTA 2Y23A 1PFOA 3BH8A 2MSPA 1OE2A 2NY4B 1VGKA 3GNML 3T6VA 3VGFA 1M9WA 1RZ8A 2IANB 4MLSA 1BOYA 4L37A 2NZIA 2GY7B 4ZBJA 5A3ID 1MKFA 4GAGH 3DX9B 5C0AD 2MQGA 3FU0A 1OSYA 4HXAH 3UJTL 4K4KA 3MYZA 1RI8A 4R7NB 4K5MA 5HJ3B 5A7EA 4L0ZA 3LEYL 1AO7D 3GGWA 3VXPB 5J9PA 1M7DB 1FO0B 3LNFA 2HPTA 1R4XA 4FXKA 4NYLA 1JYNA 3V4VL 4M8UA 2LU3A 4Y2OB 3K1KC 4Y4KB 3TEWA 5KVDL 5DJ6A 5FC9A 3SHSA 5DMIL 2DQCL 4Z3FA 3LXUX 3LTVA 2VDRH 4QOKA 5TJWK 4FHJA 5CILH 4IKNA 4LHUA 4MA1B 1AGDA 2LFEA 4X7FC 5B3JF 1JZ4A 2H3NB 5F6IC 4HJ1A 4TM9A 2C3GA 3S5LG 1CFNB 2PYEB 3N50A 1NEUA 1PMYA 3ZKMD 3TA3D 3C6LD 1RP9A 4GYBA 3LOWA 1U2YA 2HT4C 1C9SA 4TNVK 1AHWC 5EG6C 5D7JB 1VGEL 1A5FH 4MTMA 2YAMA 4IRJB 4WJ5A 2XZCL 3B9KB 3VCLB 4PP1D 1J1OH 3FTXA 1GSMA 2W0KA 3MX0B 5KSAA 5EZJB 5I30H 5DLML 4OM0L 1TTCA 1MJ8H 5DFVC 2BNRE 2YGOA 4P5TC 4EDWH 4JJ5A 1PS3A 4UIMB 5E9DA 3THMH 4HT1H 3MOBL 4G83A 4WW1B 3KPTA 3O0RL 3B37A 5C0BD 1LDSA 5ALCH 3RWDA 1UXSA 3HZMA 1QBLH 1JPFA 1V7ML 2DMKA 3NDYE 4JY5L 1LQSR 2HJFB 5KSBB 1JV5A 5CJBA 5FPIA 2WVTA 5C0EB 2YMTA 4QXTA 3QQDA 2IGLA 4IGBA 4A2MA 1VSCA 4OF6A 3LSOB 4WO4D 2NXZD 1BAWA 3UL4A 3ZYIA 4UV4L 3BVNB 5AW1B 4AV5A 3ULUD 1I8MB 3WIHA 3T08A 1FRGH 1LO5A 4QY8B 1NEZG 4FGMA 1U41A 2VLKE 2GAZB 1JZEA 3ATEA 3EG9B 4JE0A 1EGJH 2GG1A 1RULL 4RCAA 4U3SB 5F1NA 4HOXA 2WJ7A 2B14A 3MO1A 3P9LA 1KCVL 3BC9A 3LIUA 1Q9LB 1BDYA 4H20H 3HCVB 4PCYA 1E4JA 3SE4C 3UROR 4D0CA 5HYJE 1FGNH 4N5EC 1UASA 2VAAA 4QRPD 4N3UA 1NJ9A 1M7IB 5FEBA 3I6KA 5FHBH 3WNJA 1RJLB 5DRZA 3BKJH 2YLHA 2RMNA 3BYYA 2HP4A 5IJKA 4MGXA 3OZLA 7FABH 3MOAL 4I0PB 3GK8L 2BHYA 4H5SB 4Y1AD 4NQCA 1XXFC 3QC5X 3WXWH 3SKNA 4A6YB 1A7NH 1E27B 4K7PX 4M62L 4MJIB 2YGQA 3MV9A 1UEYA 3HE6D 4F7KA 2OCJA 1G9NC 5ANMB 2QDVA 2BY2A 2E46A 5KSAC 5FECB 3DUUA 4WJKB 4KAQL 5JA9A 4H1LB 2QR0A 4N87A 4HF5L 4Q2ZB 3VJ6A 1OWRM 4PJ9D 1C08B 2QT6A 2ESVB 1TR7A 4ICWA 4NN7B 3U2JA 4FNSA 4E9QA 3K72B 4BZ2L 3JV4A 4HJIA 4JKLA 2GABA 5GS2H 5LXGH 3KPOB 4NQEE 1KLUB 3SPVA 2AK4D 4K94C 3X13B 4C59B 4IRZH 1MCWW 2LU7A 2ZD0A 2NY2B 2Y72A 3MV8B 3RURA 1U92B 3T1FB 3KHOA 3PGDA 2OAAA 1RZQA 3AG4B 2YAQA 4IGBC 1T0MA 4NZUL 3ASWA 1VJSA 1OGAB 4R97C 2WO3B 4KNSA 2UWEF 1UM6L 1ZIAA 5IWLA 3T04D 4L0PB 4A2FA 1MXGA 3WDIA 2FSDA 4I87A 5AVVB 5FDWA 1QWNA 5KUKA 3MRRA 3ZIMA 1FBIL 1F3JA 3CLFH 4NAMA 1QHPA 3VQ1C 3VWJA 2NZ9C 4WI9A 4F7EA 1XZWA 1IGFH 2EKSB 1X5HA 2AV1A 2VDOL 4X6EB 5JIDA 5HHNA 3C87A 3BUYA 4U1JB 3U6XA 4NNYB 1EZVX 1YY9D 2E9BA 4L3AA 2YK1L 5IMKB 2VL5A 1PZ5A 1HOEA 2VDNH 4GRWE 2VXTH 1ILSA 1MI5A 4QUOA 1EHNA 2DI9A 3KBEA 4JFOB 5FYKH 1KTBA 3DXAA 5HI3C 4F15B 4YHIA 4MAUL 1WHPA 3UX9B 4WU7A 2AKRB 1CXLA 1K4CB 2WQXA 2MKLC 1YSOA 5IJKC 4YXKH 3AS1A 1E0OB 5DJCA 4ORGA 2MQ0A 2ZSWB 3QNFA 3V4PL 1M7UA 2WXQA 2CHDA 4EJ1C 2AI0L 3NN8A 4NX0A 5E2TL 1ACZA 3OMIB 3TVMA 3KPMB 1I3GL 1OM3H 1D5XB 2WWOA 5L8KB 3CX5J 3V6ZB 4Z9KB 3KNBA 3WS3A 5AAMA 4OUUB 1LK2B 4Z3HA 5JHDB 1H6FA 3WNKA 3PGFH 1AZBA 3TV3L 3X3FL 1CDIA 2K45A 1I82A 5C0NC 3EJPA 1QTPA 3PWJA 3UBXA 2VB5A 3QCTL 3PFQA 5IVZA 5I19L 5DHYB 4GNKB 3TBVB 2HUHA 2GIMA 3V0JA 5DHMC 3HUJF 3PWPE 5D93C 3CXHJ 5GGVH 2F7PA 3BN9C 1XGTB 5C6TH 1EEYA 5IWLC 1ITBB 1NDMA 3OZ9H 4HK3J 4R2GC 3TPUB 1FAIH 3W1ZA 2GJ6D 2J56A 2F1BA 1Q9KA 3DIFA 5IM7A 2QSCH 3ZY7A 1T2QL 4L1HA 2NQDA 1RJYB 3U83A 3MLUL 2O6DA 3VWJC 1TZHA 3HC0A 4NQSB 3G7TA 3VD0A 3OL2A 3NK3A 4GQRA 4MWFB 5DO2C 4X6FB 4JAMA 2X4TA 2VQUA 3UABA 3AUWB 4ZX3A 2QVMA 2LV4A 3CHRA 4XT1C 1AIZA 3W38A 3FFCD 4KNTA 1Y7VA 3UXFA 4N5UA 2XA3A 1J0IA 3PAYA 1W72B 1YEDB 4QYAA 4LLVB 2ENYA 3NH7H 4M7LL 1H15B 1AI1L 5HHXL 4U31A 3I6LE 3KGRA 4DERA 3KEHA 5DVPA 3BP7B 4EQ2A 1CD1A 1JCKA 1FVDA 3PQYE 1IBFA 4QXGH 4M5YH 3MUGB 2IIJA 2FX9H 2OP4L 4FKKA 3V10A 3KJ4B 1S8DB 2XPGA 1TQCC 3CVDA 3TVMC 3MR9B 3F5WB 4HUVB 1AKJD 1CBJA 1UWEL 4V2CB 4X6BA 2HJKB 2CKBH 2Z0UA 4U6TA 2VW4A 5G5DB 4EZJA 3CHQA 2B7DT 2JI1A 2EEDA 3WS6A 1KN2L 3KDPB 5F6HJ 3WFDH 3FQRB 4FCHA 1RD6A 3GHEL 4LKCB 4ETQB 2AJVH 4MJJA 3IJSB 2IPTH 3HRZB 3TIDA 3AT0A 3OKLB 4NM8H 5KJ7E 4W9FC 4JPVL 1GGIL 1GKOA 1WTGT 3TT3H 4LCYA 1BF2A 1DJSA 3TNNA 2BSED 1F41A 5FKPB 1YHPA 5F7EH 3O3AA 4I4WB 1PFCA 3HUJB 2XZAL 3TCTA 4YSOA 1IM3B 3BZFA 1OP5H 3ORJA 2E9JA 1O5DT 2EEFA 3U0WH 2NPLX 3KPPA 3DURB 3QULB 4YSDA 4LXFA 4JN1H 3QG6A 2XUWA 2OYLA 2ADIB 1GXEA 2WZPA 3CTTA 5AVQB 1NCDL 4NXSA 2CG9X 3AGWA 1SLVA 4FYQA 5D71L 4KRPC 5I5MA 2ARWA 2ZOUA 4G5AA 1RZIB 3SOBL 3SPHA 1HIMH 4AH2B 4MHHG 4NKQB 2AVGA 1OCZB 3E38A 3M45A 4RFEA 4ZRGA 1TQWA 3P4OA 1OCOB 1DSYA 1PDKB 4EPSA 3PJLA 4RX4A 5FM5M 4OJDH 3A6BL 4N68A 4YHZL 3UGXA 1FFQA 3LDBC 4Y4FA 5F7NC 3U0PB 4QO1A 4XBGB 3VVWA 1CFQA 5J1AB 5D1XE 4AEHH 2MPAL 3NZHH 3OGCA 4S1DD 1XEDA 2DM7A 1D6EA 4GKNB 1TZIB 4M5ZH 4X98B 2DF3A 1J8KA 2YPVA 35C8H 3BSZH 1ZT1A 5LDUA 3AREA 2MEJB 5K9KA 1JTPA 3CSBA 3EO9L 4WGWB 3KPRD 4U7KA 4Z5RB 2R4SL 2OL3H 1DQQA 5EF1A 8CGTA 1Y18A 3JWDL 4G8GA 1XF4B 4WQOA 4HCGA 2J5LB 3UC2A 4DPRA 3S2AA 1A3RH 3SQBB 3ZUCA 3I6GA 4X5PA 1RH8A 2DIAA 4YUEL 2DLHA 3LH8A 3LIZL 3WS6C 3A23A 3AT9A 4LHQB 4LNVA 2YQ3A 5C09D 2X6BA 4HUCA 4DVRL 1IGJA 2D3VA 4DW2H 5K59F 3ZKSD 3FMGL 1MHHA 1U0QA 3EBGA 3S8GB 3MODH 3RYMA 4G7VL 4WWKA 4IHOB 4NO0D 3V7MA 4Q0XL 1VPOL 1AQKH 3WJMA 3Q0HA 5AQ0A 5I6XB 4KGJA 3CUPA 1OF2B 3TWCL 5L8LB 3H9ZA 4FNQA 1IX2A 5A6IA 4JGUA 3H42L 3ZZQA 5B1AB 3ZUNC 3VFTA 3FN0L 4R3SA 5FV2A 1BAFL 2BP0B 4JZJB 1FIGH 2VR7A 2ICEB 2PWGA 2WP3T 3RY5A 1QEWB 5LBSA 3H3PL 2F54A 5BUAA 3T2OA 1W8EA 1AR1C 2EDJA 4UQ3B 1CL7H 3VFWA 1NANH 4KJWD 4XP4H 5D7KD 1MLBA 1P1ZB 4Y5VC 3CD4A 5DK3A 5KW9H 5JIHA 3DROA 4N0YL 3V0HA 1C8PA 2J1ZA 3CIAA 25C8L 4Y4FC 1IQWH 3GSNA 1EFXD 4JRYD 1QUNB 3KYMB 3MI6A 1S3KL 1T3FB 5E2WL 4CN1A 4MQ7B 3V6OA 4A39A 2VRAA 3FT2B 3FB7B 4K5PA 1E3FA 4KO7A 1E90A 1BIIA 4ODSL 3AREC 4TSBH 3VI4A 5DA4A 3LX9A 3D07A 1SYVB 4K7FA 4E0RA 1CGXA 1URIA 4HDIB 5D7LD 3NRPA 1VZGA 1NDGA 2J8UA 2MIZA 5C08D 5LKNA 4UB0L 5EO9A 4KXZI 4ZMWA 2EKJA 1N0LA 4JN2B 1TEFA 1JZ7A 3TBBA 1KTJA 1JNJA 4BM7A 3MQIA 5EUKB 1SJEA 1T4KB 2VDLL 4PWEA 5FB8B 1MJ7H 2Z8VC 4AG4H 4PRIA 4MNQD 4B9FA 5BZZA 3FO2A 3FQ4A 3HB3D 4WKXA 3RVXD 1JG9A 1GCFA 3ALXA 4FQ2H 4ONGL 4MXWH 1QPPA 1AQDA 4M61B 4WWKC 4HS6B 3SQOL 1FYTB 4ZX6A 1JNHB 2VC2B 1A65A 1IFHL 3CVHL 3IMTA 4Z18A 2C9PA 5I0XA 4LBEB 2CBPA 2V9TA 1K6QL 3PIQB 2AEOA 1VLXA 4XC3H 1C12B 4HFWA 4LOUC 4Z95H 3NACH 1HILA 1AC6A 1Z3GL 4WEBH 1KNOB 2NR6A 3JV6B 3UAJA 1QVOB 3QR0A 4BEIA 1KULA 3CDZB 1I9RH 4Y9EA 4KK8D 4ZFOB 3ATAA 2AJXL 4MD0B 3TBSA 4LIQH 2F19L 3ESUF 5DJDB 2R0ZH 4FN0A 4RQQA 2CKNA 3T0WA 4JJHA 2WVVB 4XMWA 4AVHA 3C08L 2ICWB 4S2SA 3MLYH 1PSKL 1FNAA 2V8MA 2CHWA 2X3AA 1J5IA 1OTTD 1BMGA 3AY2A 2WCSA 3ARGB 1FP5A 1CF8L 4KKBD 4CRPA 3GPSA 3V6OC 3RDTD 4KHXH 3DMMD 3WI9A 4M29A 4AEEA 2XY1A 2DWYA 3GM0A 4ACTA 5C0AA 4WDIB 4LPXA 2NQ3A 3ECVA 1HH6B 1N0XH 2WO2B 3ULAB 1J11A 4IHBA 5I17A 2KPWA 4LVHB 5IW1B 3DJTA 3CZFA 1ES0B 4NN5B 2W0PA 4X83A 2X6VA 4YR6B 4YK4B 5I73C 1NAKH 2HLAB 4WU5B 3W5MA 4PGCB 3FOMB 3BVDB 3PP4H 1SEQL 3MKKA 3VFVB 1D9KC 1OY3B 3LKOA 3Q48A 2ZCHL 3L6FA 1P5UB 4Y5XA 5D4QA 1N6UA 3IKCB 3MBXL 3IVKB 2A74B 2DLIA 3SE8L 4XP5H 4TQIA 5JHAA 2X40A 1MCPH 4PYGA 4XMPH 1U3YA 2J3SA 3V0WH 5GS2D 2R9HD 4LOEA 5AVYB 5CCKH 4LRNL 2Y06H 3DPDA 3EOTH 1QX1A 3CC5B 3ZE1B 4GQPH 4R0LB 1HHIA 1L7IH 1V10A 3ARFD 2NR6C 3UAJC 1P2CB 5IB2B 1QZ1A 1Q9WB 3F7YA 1LMIA 3GHPA 5DJ2B 3HR6A 1F90L 1U2CA 1B3IA 1XZ0B 3IXAA 2NT0A 4MDIB 1OPOA 4K5OA 4CADB 4Y89A 1QI4A 2C3HA 3ARBA 3ETTA 2V2WB 3B3IA 1SJMA 3QR2A 5MEOB 4EDXB 1VZHA 3BDYL 5JW3L 2D9CA 3RIAF 2YQ2A 1UOKA 1KXVC 1UENA 2D03H 3FDWA 2YQBA 2WVSA 4DK6A 5TE6H 3GXPA 1A3LH 1IGTA 4OFKA 3QDGE 4G42B 2N7SA 1LO2L 1R3LA 5FYKD 5GS1A 2KLRA 1MUJB 1CLOL 5TGBB 3MVSA 2OXGA 2K6WA 2R1YB 3FQNB 1RCYA 1KB9J 1U8PA 2EDRA 4KJYA 4QTIH 3G08B 1RU9L 2GSMB 1NMBH 4R4BA 2JQZA 4KOCA 2I27N 4Y8DC 5ESVB 1JXFA 2EXSA 5F70A 3F7PC 4H8WH 3BUQA 3HZKA 3NIGE 2MTPA 2FHFA 4MMYA 4QHKI 4XMTA 1NLDL 3B2UC 4FQXD 1F45A 2BNRB 3DVNA 2COQA 4WEUD 5IW3A 4NNXA 5FIEA 2OQJA 3S37X 3KW7A 1NC2D 2KZKA 3TEZA 2BJMH 3EDJA 1JVLA 1JWUB 2WYHA 5EC1B 4Y5XC 3LQZA 1KC5H 1S7UB 4GQ9L 4L1BA 3J07A 3HW7A 4GFTB 4HLEA 1VB9A 1JP5A 1YJDL 3K8MA 3M1BA 4N2CA 5D2NA 1DO5A 3RKPA 3VX0A 3ZE0E 4F8NA 2BVPB 2X2HA 2X7LA 1JBJA 4K5LA 4Q4EA 1OB0A 4NRZA 4KO9A 3TBCA 4NIKB 3FU7A 3G5YB 1HXYA 4KKZA 4XWGL 3HE6A 4AC2A 1JN6B 5HGDB 2F15A 1AS6A 4W9IC 1IV8A 3ISRA 5DHEA 5GGUB 4JO2H 4S1SH 3GSXA 2VLKB 2R2HA 2HTKD 2X4OA 4DAGL 1J5OH 3HZVA 3OKKB 5I1IH 1RZJC 4IBVA 3N0PB 3NTCH 3RVVD 1HQRB 1DQVA 5IK3A 4PV9B 2EADA 1DBMH 2WTOA 2R2BA 3EF7A 4GRWF 4JFDA 4JFVA 3ARBC 4YDKH 2UZYB 3JWNG 5HYJB 2GJPA 1BVKA 4DP6X 4EUPA 5BUGA 5AVZB 3D0AA 3MRNB 1UGKA 4LCCA 1RLBA 3A3YB 3DHPA 4YDLB 1R47A 4GG6B 1AR2A 1T04A 2ID5A 4NUPA 4O9HL 2BW4A 4POYA 2K7QA 2XOTA 3IDGA 3AACA 5E8DH 5T5NG 1M2OA 1ROWA 5AKRA 1U4FA 5GS1C 1EXHA 4BKTC 3GMRB 3VA2C 4CU8A 1IZKA 3MBEB 1TJHL 3CZNA 4R7VA 4AQAA 4W9HC 5C0CD 2X70B 1NGXA 2JTDA 4NNPH 4QCIA 3O2DL 3QHZL 5INCA 3RB5A 3UBGA 3GUTA 5F8RC 5DR5H 3BWZA 3WD5H 4FHKA 4JFFE 3MNWA 1OIOA 5JDSA 3G3LA 5F0LB 4U6XB 5HI5C 4PJCE 3SDYL 3O3BA 1RFDL 3X3GL 2EDLA 1K4DA 3HAEG 4NQEB 4JFFA 3CFEA 3MRHA 3MYJB 4NO5A 1DQML 4ZNEE 3FZUD 3T0EA 4ZFZA 4PGZA 2GQHA 4N3TA 4Y7OC 5KVDE 3BRFA 5KS9A 3POCA 1J9QA 3QO0B 4PWKA 4Z8FH 4IDLA 5D2NC 1J5DA 4KMTH 5EPMB 2FEJA 1XIWB 3SKOB 3LHAA 4NWUH 5CEYA 2W1NA 5LJYH 1UWXK 3L7EB 5DT1L 4G1MA 3QPKA 4OCNC 1UH3A 3OKOB 3WV0A 4DQAA 5CP3H 4KNUA 5LGHL 1SNRA 2Z4QB 4LDEB 1A25A 3GEFA 1DVFA 3HZ3A 5DD1L 1X7QA 1UCTA 4KQ4L 4RGOH 5HGBB 3PPSA 4K3JL 5DZPA 1NIEA 2CIKB 5KVGH 2ZP9A 3FNKA 4OD1L 2IMMA 4OCRL 3KPLA 4MS6A 1E8YA 3C8KA 4GRWB 3EJZC 1WUNT 4UTAL 2GCYA 1KJ2A 1MJJA 3MJGX 4LCCC 3U9UB 3L1GA 1JRHH 5BQ7B 3C60B 4MQSB 1AXSB 2A83B 1AXTH 1JHLL 2EEBA 4QRQB 2NXYB 4DEWA 3UTSA 4QWWD 1G7JB 2AABH 2PR4L 4UT6A 3WEAA 2VLLA 2A9CA 3VRIA 3WL9B 4WFGD 1K8IA 2CO7A 3AVEA 3E0GA 2ATAA 1EPFA 1WBYB 3AU1A 4DP5X 4UDTB 1VF5C 5E2UL 2NSMA 3TV8A 3O6LH 2JE8A 5AOLA 4PJHB 5GIRA 3DSFH 4JM2A 1KGUA 3CPLA 5ABAA 1GZPB 5I16B 5D1QE 1ZT4A 1CG9A 1LP9E 4HIHA 4ELMA 5IG7B 2JKLA 3GMQB 1NCOA 3PWVA 5KOMC 4M4RA 3KVPA 5TQ2H 4O2CB 3QUKB 2FO4B 1NC4A 2EEXA 3DETD 1PX8A 5FW7A 4AYFB 2BVYA 2VISA 3GMMA 4XAWL 4Z7UA 2FT8A 2QBWA 3T0EC 1RPQA 3VTAA 1J8SA 4U6HB 4AEIH 2AEPH 1KT2A 3CMOH 1MF2L 4K3GA 3REVB 3HG0A 1N9PA 5C1MB 4A6YH 1AMXA 1K8DA 2QELA 1IEAB 1XDTT 3PWPB 4LEEA 4QF1B 5BOJA 4X4XB 5F7DA 2BSTA 2JLPA 3SIKA 1TKWB 1O9ZA 3GZPA 1UHVA 1SMOA 2YPKB 3L8QA 3ZKXB 5JQ6L 4FFYH 4R2GD 4JKPL 4V1DD 2YJLA 4G70B 4POZC 4IJTA 5D1ZD 2GUOB 5CFHA 1UB6A 3K4DA 4GSRA 3SEPA 3A4DA 1EEQA 3L3HB 2PNDA 5EF2A 1A6WL 4G9FE 4X80H 5TPWH 1X44A 2XYBA 2JB5L 5FFLA 1DVFC 4GMSL 3G6DL 4JDTH 5AYTA 1Z32X 2P8MA 3SDAA 1KOAA 2DPKA 4F8TA 3L1OL 2WXMA 4Y9FA 2I07B 3NESA 1YCSA 4NPYA 4DKDC 2FWOB 4UILL 2J4WH 5CWSB 1C7SA 3ARYA 4KROD 3RVTC 2WQAA 4L5FE 2R0LL 4HC1L 4XCFH 2YUWA 2ZXGA 3EJTA 1DDHB 3MRQB 4R83A 2CSPA 1OT4A 1QO3B 3TT1H 1W15A 5E8PB 3WFEL 1NOAA 4P3WA 5IGXH 2HN7B 2FWLB 1IO4C 3HG1E 1EAOA 4XC1H 5CJ8A 1D3CA 1ZA3A 4DGUA 5IIEB 1AJ7H 1U6AL 4APXA 1UZ6E 3UYRL 3ZT6A 1OTSC 3HBQA 5F96H 2DOCA 4XXDA 3C5ZB 5D4JA 3H7BB 2NNRA 2HJLB 2OW6A 4JKNA 2XG4A 5J11B 5I76A 2DI8A 5F88A 3IU3A 1IBGH 1U8NA 3BEVA 3CVIL 4N2HA 5BO1L 5GS0H 1GHFL 3CSFA 1KIQB 1D7CA 3R1GL 4LEXL 4HWEL 3I50L 1FLRH 1TJXA 1YDPB 3G6JF 3SE9H 4MJ5A 1SHWA 1SQMA 3BIBX 3PDOA 1M9SA 2PO6B 3OTTA 2ZTBA 1RV6X 1XCWA 1RZ7H 1P7QA 1WFIA 4NLHA 5CSBA 5T3ZL 1AZUA 1G7IA 1DFBL 1ZHNA 3V55A 1JZ5A 1WTLA 5IQOA 2NY1C 5E1IA 1QLEH 1EX0A 4XVTL 1N64H 4NQVB 3GIVA 1DJIA 1OOWA 3P9WB 4HX1A 2LQRA 1R75A 2JCCA 1UD2A 4GKZB 5B7FA 3BRDA 4OGYL 3VFPB 4D8PB 1FNEA 2R0KL 4P2YA 1OM9A 3U4EA 2W0FB 1BGXL 1JGLL 2CCLA 5LAXB 1C5CL 4DUWA 5HSFA 1WVZA 2MFNA 4IBLT 3QRLA 4Y2NA 5EORL 4L0YA 1T5KA 3GRWL 5M94B 3VG9B 4NQDE 2ITFA 2PP8A 3RB7A 3B83A 1WA1X 4MMXB 1I3UA 4YL4A 1EHAA 2BNQE 1JXJA 3N9GH 1KCUH 3VI3B 2VDQB 4ZDHB 3SDAC 1T1WB 4HZ1A 5G55A 2CQVA 3HHMA 3CBRA 3QS3A 4G9DB 4C56A 1UWGH 4LPUA 3QA3B 1H9DA 3QFDB 1QSED 2FUTA 1D6VL 2FH8A 4QRTB 4NXKA 1HNFA 4BV1A 2R0WL 3BD3A 5F21B 3H85A 4XNZB 1OGTA 1AP2B 3D3VD 1PLAA 3GSRB 3ML8A 5DD6A 5D1XB 2PN5A 3NT0A 4KK6D 4JFZL 1TDQA 3VXME 2ORBH 4CSPA 4ZO9A 3JT2A 3PHOA 4MZRA 3IPEA 4U1NB 5FK9B 3TFBA 4DKEH 5EO0B 3ZO9A 2QFRA 2GITA 1ZIBA 5CGYD 1ZS8B 4ES8A 1F1AA 1T7ZA 5DRNA 1PLGL 5A6MA 3RTLA 4Y2DD 1E2VA 3QWRA 1T7YA 4JM4H 2XNAA 3OC5A 5FGSA 5FUZH 2ROXA 3II2A 3NCEB 4LEOA 3ARDD 4YSCA 5KTEL 3MJ9A 5IY5B 5KBKA 1GVIA 3H3KA 5JXAH 1TZGH 5DQ9A 4F5CE 3G6JB 4S1RL 1F58L 1J18A 2YBRB 3KPSD 2WBKA 1CFVH 2ZUTA 2Z3FA 3OAWA 3T3ME 3FONB 4FD0A 4UNIA 3W37A 3RFZA 2MQ3A 4L8BA 2X53A 3VXRD 5FCUL 2Q8AL 1P6FA 4GIOA 5GS3A 2Z93A 1KV3A 5CFAA 3QPXH 2NUTB 5E8EA 1BD2A 2B2XL 3I84A 4ANWA 1IM9B 1LDPL 3BVWA 3U6XS 3MJ8A 5ITFA 2OX5B 1AQ8A 3ETBF 2A1WH 2KQNA 2NCEA 1UXWA 3JQOB 2NY6C 5AZEL 1M71A 4KDVA 5HYQB 5H4YA 1XR8B 3APMA 4E42A 3GKWL 1MFDH 1F4AA 4B0MM 3QXWA 2MCAA 2E75C 4D94A 3VE0B 3N43F 1U8MA 3FL7A 1HSAB 4GAYA 3MZGB 4ERSH 4V33A 3RX5A 4XCCL 2DICA 5I8KL 3QI9B 4IKLA 4XMVA 2NTSP 5L2KB 4F58L 2A9MH 2X89D 2HFFA 2I9LA 1RZGB 1CDYA 4UAOB 3D1MC 4EF3A 3FXIC 4TNVF 5I8OL 1JV2B 3DX8A 4UV7H 4D0DA 2OYKA 1MWAA 3D2TA 1ADQL 4G71B 1DBBH 4RGNE 1MCLA 2HWZH 4HD5A 1OAZL 5K39B 2NY7H 4ZAKC 3U4KA 3WJLA 2V2TB 1QOKA 1ICTA 4LF3A 3UADA 1FV1B 1AZCA 3KH3A 3L9YA 4C4BA 5E0FA 4K8RL 2YN3A 4Q9QL 5DEZA 4M7ZB 4J6RL 4XI5D 3SBQA 4GS7C 2P80A 1DQJA 5AZ2H 1B0RA 2IFGA 5I9QC 1B0WA 4FQLL 1S4IA 3MA9H 4FZ8L 4NZRL 3B5TA 1ET7A 3CNKA 4LRIA 4P2QE 5EFIB 3S3CB 3IJYA 1NFIA 5ESQA 3U30B 1MHCA 1UA6H 4K9EH 2NSQA 1BX2B 3RFZC 3BMVA 5JR1H 2ERJC 3I6SA 4TUKH 1W91A 3GHBL 1SLWA 5MENB 4R4FH 3VM5A 1W0VB 3IMVA 1BYOA 3IK2A 4B97A 1SOSA 1VACB 3FQWA 5HY9A 4APQD 1AFVL 3GI8L 3GMPB 1UYWH 2BX5A 3SJVA 4ZUSA 1DLFL 3L3GA 1QASA 4WY7H 4G1EB 4PW4A 3WAKA 3ROLB 5BV7H 3ISYA 3KYKL 3K6SA 1G6RL 5ISZD 1H6UA 2QV4A 3DI2B 5IT2L 1S7QB 3O2WH 1Q72L 5L88H 2ZYRA 1HX0A 1S2EA 5KVEL 3RGVB 4P3CH 4D3CL 1TVDA 5C8JB 3IKKA 1XF2A 5JUEH 1T7XA 5LXVA 3DSNB 1M6UA 4URKA 4JFHD 1BIHA 3RIKA 4K73A 1UGNA 3CX5K 1LL1A 4OIFA 4YAQB 1FUNA 2B9BA 2JJWA 2BLFA 3V4UH 5K9JH 1JZJA 3FT0A 4LK4A 4X7SH 3SCMB 3D05A 4F9PC 4TUOB 5LHDA 2C4FT 3WJLC 1MAMH 1S7VA 2E47A 4IOSD 1F0LA 3KS0J 4RMWA 1NGQL 1UZ8A 2AJZB 2XSKA 5C7ZA 1QSZA 2B16A 4M6OL 2Q8BH 3NIGF 5BRZA 1ETZA 2BSSA 4WFEE 3CXHK 4M7JL 3OZKA 4N22A 4LSPL 5E0QA 4JG0L 6TAAA 4PMFA 3WHXA 1D9KD 2MHAB 4LRIC 4PU2A 2Y24A 3UCRA 4AKOA 5KJRH 1NGYA 1FZMB 1QFPA 5IP4A 1I4FA 4XPHH 2AXWA 4HYTB 4PLKD 5I0YA 3ZE0F 1ZHLB 5KBPA 1PU0A 3LYRA 3QWQB 2A6KA 5A2IH 5C71A 4M02A 1MNUH 2F53E 1RPKA 1TU2B 3WAJA 2I5YL 2IBZX 3O8XC 2DH3A 3K2UL 2O5XH 3S8WA 1MVUB 3EFFA 4FI7A 4LLQA 1M05A 1GZHA 4L3CB 1G5GA 5D7JD 4AUUA 2VXVL 4ZMTA 4QXUL 5I8CA 3OR6B 1MJUL 4Z7WB 4JPIB 5JHBA 2JKSA 4R90H 1Q0EA 5J57B 1HNYA 1NC2A 3EHBD 5D7IA 3R8QA 1J8HD 3DHUA 1NCAH 4LT7A 5I6LA 5JW5A 4W6WB 3DI3B 3JWNC 1R3JB 2ZKHL 4WJG3 3Q9QA 3UG3A 1FPTL 4EN3A 1CFBA 3TS8A 4GI9A 5I1JH 2ZXEB 4KITB 4PTUB 1TZ8A 1W0WA 4KI5C 3ZHKA 3CSYB 5D70L 4LLWA 3U82B 3QDGB 4M7KL 2LR4A 3OC8A 2CD0A 1JF1A 4MKMA 3CBJB 1RUMH 4FFZL 3QXDA 4O2EB 3V6FA 1W80A 3IU4L 4YVUA 1V54B 3REWA 3BH4A 4MZ3A 3E3QE 1XF3B 4G6AC 1RK1B 1DN2A 1YA5A 3RJQB 4QRAA 2FR4B 1ECZA 2YD1A 1IGYB 4ZOCA 3BP6B 3W9EB 3NIGB 4P2OD 4ABVA 5BVPL 4UOW0 5E4AA 1EANA 1T7WA 4O02B 2P1YA 1CF1A 4PJCF 3FUKA 5F7MC 5E03A 1YEGH 3BQVA 3MXWH 3ZL2A 4TLUA 1TT6A 4Q6KA 5CHNA 3HLKA 2PW1A 3V0VB 3DX1A 3RVWC 3C75A 4XBPB 3ARQA 3LKNB 5D7SH 5C0JA 5CJ5A 2XV6B 3QFJD 3ZE0B 4DO6A 1H5BB 2X5PA 3P77B 4LPYA 4CMHC 2V33A 4L4TD 5D5ME 4WI0A 2Z31A 1RUQL 1OV8A 4YL9A 1E30A 5H94A 4LGPB 3V5HB 5LDSA 5PAZA 3QUYD 1MFMA 3P1VA 2DM2A 1KGXA 4BSWA 1GZHC 4U2YA 1MFCH 1N6QL 4KPHH 1EAPA 4AJ0A 1OAXL 4MDRA 4MJID 5E4EC 2CHNA 3L3JB 5CNHA 2DQMA 4RIRB 1UM5L 3QZPA 2QADB 5CJOL 3VH8A 2B15A 4EXKA 4J8RB 4LEBA 2X42A 2JKJA 2OMBA 1N12A 3D48R 1A6VL 1LVEA 3QORB 3GMLA 5ETUA 3EYUH 3IGAA 2G5BB 3UPRA 3LHPL 4ZMZA 5EA0H 1HHGB 2UY6B 3ZDZE 4L4JA 2UV3A 5AUMB 4UM9A 2V5RA 3APFA 1Z0NA 2DWSA 2NY2D 4LARL 3MV8D 3RWHB 5I8EB 2VJXA 3OG6B 2CLVA 3SD2A 5H37A 1UUNA 3S35H 2BDNH 4TVSa 2H32A 4NDMB 3CC1A 3FQTA 5C07D 1NBYA 4PD4J 1MIEL 1YY8A 4KX9A 1ANUA 2JIXB 1IKNA 3LRSB 1RK0B 3IN0A 2NX5E 2WQUA 4W93A 2NY0B 1XCQB 1LP9F 2K7PA 2W60B 4WLCA 1FFTB 3D4YA 1MCOH 1X5KA 2VN6A 5GGSB 3QR1A 4DKTA 4PJCB 2W59A 2WLMA 3RWCA 4J8QA 4PTTB 2P49B 2V3EA 4D9LH 4WTXA 5GS0D 1R5IA 3K5SA 2ODHA 1E5UI 4I77H 5C2BL 3SY6A 5HP5A 3JUYA 1PG7W 3CMGA 2BFVL 4WUUA 1ACXA 4FNTA 4XNXL 3WLBB 4YHML 4Y1SA 3EH3B 1XGZA 1IAOA 2XZZA 4HKBB 5JOPE 4H0HB 1FL5A 3MLSL 3BGFB 1NAMA 4JMXA 1F8TL 4KWUA 3NAAH 2XBTA 3WOVA 1BZQK 3BIKA 4B7IA 1YEWA 2ROYA 4KTEH 2PUQT 3GSQB 2XKNA 4HUUB 4HVBA 1C5BH 1WWAX 2CRIA 4FNLH 4ZMVA 1ZHKB 2W65A 2ZG2A 3EYQD 3JWNH 3TZVA 2XQBH 1H6EA 1HESA 3G5ZA 3ZQXA 1G9NL 2KQMA 1BF8A 3CSTA 5DK2B 2FTAA 3ASOB 2F8VA 1TQBC 4HIIA 3H0TB 2ZOKB 1FJ1B 3ZXAC 1YAZA 3RZCB 2KBGA 1H3UA 2UYLA 3EJZD 4YSPA 4KU1A 3T2LA 5ERWB 1JTTA 1S5IH 4KJQC 2OTWB 4KKAD 4OAWB 1FSKC 3FO1A 4K94L 3NJJA 5KYUA 2BIHA 3VXUB 3DA0A 3F85A 4TTDD 5HHQB 2PCFA 2ZNWA 1UZ6F 2CJUL 4TPRH 5EU4A 2WXFA 4CVZB 1OB1A 1R3IL 4L8CA 3KG5A 2JJVA 3UTTD 1S9VB 3V0GA 3NJMA 1KTRL 1JZ6A 3CCHB 4E41D 4R7DA 4BQ6A 4E36A 5MP6L 3NA9L 4N8CL 1IKNC 3WIHL 3EJRA 3H9SA 1MCSA 2XXCB 3HAEH 3KYNB 1UKSA 3MCLH 2YSTA 5F9OH 1LP9B 1KLFB 3GI9H 4HLZH 3I75A 4P23A 1AY1L 5IEHA 2HX7A 5FFOA 5F9AC 4F33A 5JW4N 1UM4L 4LOVA 3O6ML 2VLRA 1JGEB 1M6OB 2UVEA 3B9EA 2ARJB 4KXAA 3LNGA 5FF6B 1I85C 1YPZE 4A55A 1MIMH 4RZCA 1NDTA 3ABLB 2YOCA 3DIDA 3KW8A 1Q0YL 3LRLA 5CZVH 5FUOL 1J05A 5IMOB 3EZJB 3CHPA 4G59C 3FO9B 2ENJA 2PTTB 3CK0L 3PABB 4P05A 4U33A 3U36B 3WY3A 3OAYH 4X8JA 2Y2WA 5C0BE 4YIQB 4N8UA 4HHAB 3BKML 4FL4C 5GSRB 4ZXBB 2Z34A 3MLVH 3CQFA 4BWTA 2OTUA 3DV6A 1QW9A 1IARB 2Z6FA 5J6SA 2ZUQB 4M8QA 4TNFA 1DUZA 1FVEB 3VM7A 5HJGA 2ENPA 2JKXA 3TZVC 1FN4A 1EO8L 3FF8A 1MREH 5D96C 5I1HH 3S3DB 2OJEA 1SFDA 3ECUA 2X41A 3AGVA 1KBGH 2NLJA 3BE1H 1WYJA 3QH3B 2FECL 1O7VA 4FLQA 5FGCE 1TFPA 3HR5A 1PAMA 3DVGB 4X6CE 4NKMB 3KD4A 5BUPA 1F4HA 3OF6A 4JB9H 4ODHH 3LH2L 4QJ4B 2ZOLB 4TVPL 1GYWA 1FA4A 1GAFL 4R84A 4OD3H 1ZLUH 3QDMA 5F3HA 5CD3B 2OR9H 3GSVA 4QRPE 5GRWA 4IS6B 2W9DL 1OL0A 4OZFA 4LMQI 4BQBA 5ADPH 1T03H 1G7PA 1G7QA 5FUCC 3U0TA 4I5BA 2VMFA 4JG9A 2LABA 2MPVA 2AQ3A 4QHMB 4ZFGL 1F4XH 3QJZA 1CK0L 4W9EC 3IS1X 3FBQA 3BUTA 4P23C 1OCWH 4JFEA 3PNWA 3BPLC 4PJ5E 3D25B 4LE8A 4TULL 4OCWH 4U7MA 5FA3A 3QDHA 3MNZA 1VEPA 2VDOB 2R69H 1P4IL 3QEHA 3WNNA 3L3DB 3T3MF 5C0FB 1C16A 4TXVB 1YECH 1JVKA 1ZDQA 2NQCA 1CGTA 1JAEA 4YC2B 4YWGH 3MACL 3Q6GH 2L4OA 3NFNB 1REIA 3D6GA 1DLHA 2EYRA 4JLRB 2AK4E 3N3EA 4LSSL 2OMUA 3VFGH 2JKIS 2WZAA 2ZF9A 2ED6A 1A21A 4G3YH 5F7FA 1MFBH 1QWUA 5C0DB 4RISH 2OA9A 4LCWE 4LSQL 4ODBD 5IVXE 1R6VA 3IRCA 4P2RE 1M42A 1HU8A 2Z92A 2BNQB 1AG0A 2EYSB 3HIZA 4LSUH 5CLXA 2NNXA 1EJOH 5JO5B 4NUJB 2EVHA 3VWKB 3SPJA 4FX5A 1MCKA 4TUJA 1WCQA 4PJFB 2BOCA 5T1MB 2Z8WC 4MAYD 3MRLB 3P69A 1JK8B 1P6WA 1DUYB 3KYOA 3NGBB 3OHXA 4FCAA 4OT1L 4KMQA 1KB9K 1Q94B 3F3HA 4TN9A 3G5XB 5FO7B 4AW4A 4XNQB 2L8AA 4WI3A 2CUHA 3VXRA 4PYHA 2LU4A 4XE5B 1QFOA 2H2SC 1JE6A 4X7EC 2PLTA 4XRCA 3W9DA 5BCAA 4XHJD 3VXMB 4Q6YA 2EIBA 1UJ3C 4ZPTB 4DP8X 1NBZA 2DB8A 1F6FB 1YEHH 1W9XA 2VR4A 4RAHA 1RUKL 3EOBA 2ADFH 3PPEA 4PIBA 1DEEA 5C6PB 3UJIL 2MCPH 5J1SC 4PB9L 3ULVC 1E3ZA 4FJZA 3MC0A 2OTPA 2QVFB 2FLRT 1INEH 3QS2A 4WV1B 4X5LA 2VCOA 5FKAB 1Y07A 1E9PB 1KGWA 1B4TA 1XR9A 4XNYH 1Z5LA 2VQ1B 2YFOA 4HETA 2DWTA 4E5XA 4F2MA 2Y5TB 1RLWA 3QEQE 5AL8A 5TH2B 4NZTH 1QBMH 3E8VA 5DS8B 5FYJU 3ABKB 5F1IB 2JELL 4QT5A 5I74C 1YZZA 5L9DH 4F27A 4G6MH 1T6VN 3T3MB 3MNDA 4YO0A 1ZHBB 3MCKB 1GTFA 5DK0A 2P8PB 1CMOA 4KRLB 3ZL1A 4RSVA 3P0VL 4DESA 1MRCL 3H9YA 4AUJA 2YMOA 4XZUB 1DBKH 5I28A 1ASPA 1UCBH 4JHAL 2PPEA 1ZSHA 4JY4A 1HL4A 1J86A 4WF7A 3DRTB 2ZWYA 4JRXA 2H3XC 1MLCB 3D85D 2Q0ZX 1J7VR 2BVQB 3L5JA 4CL7A 1I8KA 5I1KH 3CH8A 4M6NL 4PJBE 3MGAA 3LZFL 4GAAA 3B6SB 1A6ZA 4H2CA 1ESOA 1JIBA 4FC3E 2JCWA 2GJ6E 5DJ8B 5CUSH 4ECNA 1D5RA 1EMTH 4WK4B 5FA4A 2FSEB 4KTDL 5E1AA 2VYRE 3OHXC 2XN9A 4PLJC 4AM0A 4OCYL 4AQEB 1JF6A 1PZ3A 4Q56A 1MFVA 2DYPB 4JFXB 5EOTA 3FOLB 4X4ZA 5J12B 3OLIA 2GK0A 2VMDA 4XWOC 1K2DA 5T3ZE 5F7BA 1FYTD 1IGML 2LLLA 4XE0A 4GSDL 1A8ZA 4OZIA 2WXOA 3LD8B 5IQ7H 2VDKB 3QVAA 1OP5K 3D0LA 3FFCE 4HPOL 2ZG3A 1Q9OA 4RGNB 3TBTB 4X7TB 4N9GA 3VXNA 4QRRA 5GGTH 1JI1A 3CPUA 4MXVE 1DBJL 2J88L 4ZAKD 4AI7A 2P5ED 2AEQH 2EINB 5I71C 2IDUA 1JPGA 4GQZA 4PRHA 3K0WA 3TTSA 5FGBA 4I2XA 5B39B 5JQHC 4NQQA 3O6KH 5E94A 1DFXA 5ISZA 1BPVA 4WUKL 4N0UB 1N5AA 4Y4HB 1MNNA 2J20A 3W5NA 4XHQA 1BQHG 3RWGB 2DYRB 3DX2A 3K91A 5EOCH 4UI2A 1S9YA 1PCSA 1UXLA 5CIPB 2OZ4H 1Z1WA 3SKJH 3VFOB 1SXAA 1FNFA 1QFWM 3D0VA 1AOHA 3ECBA 4IBYA 1NGWB 3FH5A 3ZHFA 2GTZA 5IROD 3UTQB 2P7TB 3V5DA 2VUYA 2XICA 3L5XL 1FL3B 2L7JA 2OMXB 2YMXL 1MEXH 1MDTA 1FNLA 2IANA 4RMTA 5EWIH 1FNGB 3VU2A 1IAII 3GMNB 2YPVL 5IFHH 1E6JH 4DH2A 2DQGH 1XBRA 4L8DB 1V7NL 2UXVA 4R7NA 5HJ3A 4XN2A 3M7FB 5E7BA 5MERB 2OCCB 5LGJB 3FPYA 3OJDB 3VXPA 3WN5B 1M7DA 1FO0A 5EEZA 2F7RA 5DJAB 4MJ6A 1NGPH 3P0GB 4Y2OA 4Y4KA 4MVBC 1NUGA 3J2PA 4PB0L 5IBUG 2L7QA 4F8QA 3OR7B 2FT6A 5K1NA 3PAUA 4FLRA 4TS6A 4UQCA 1ZOXA 2B20A 2H3NA 2RQEA 2KH2B 4OCLC 5GHWL 3TYFB 4TQPA 2ZX7A 1J1PH 2J1XA 2BHFA 2PYEA 2Q10A 4LSVH 4FTDA 2MKWA 3IETB 1FCCA 1ED3A 4ZOBA 1E9QB 1I9JH 4IRJA 5ACZA 3B9KA 3HNSH 3VCLA 1EAJA 3MX0A 2VITB 2DTSA 5EF3A 1DSFH 5EZJA 3JTBA 4K15A 5LBSL 3GJFB 1S7WB 3WIIL 3BFWA 5DXWA 3NDZE 1NPJA 3W0WD 5A2AA 3FQYA 3HI5H 4L3FA 4UIMA 5HI4C 3IJEB 2BK8A 3FTSA 4WW1A 3VFMB 4PRPE 2BM3A 5HJDA 5HYSB 2WTPA 15C8H 1HHJB 4JHWH 5IUCA 4N6QA 4B9JA 4ZMQA 1U21A 1RZKH 1CU4H 3VFSB 3WEMA 5C0EA 1DJXA 2RCSH 1OAYL 4BZ1H 3K7UA 4L1LA 2NY4C 3CE1A 3GSNL 1KYOJ 1YMMD 3GRGA 3LN5B 3CFCL 5CO1A 4UMGA 3BVNA 4JK0D 4OLXH 3R0MA 1FIEA 3U4BL 2F53B 4FADA 3N1PC 3O45B 3QQNA 5HDQL 4JHBA 1I8MA 4JGNA 3WSQH 1YEEL 1HVXA 3IJ9A 1GC1C 2G75B 2OJ1A 2FEEI 3QNXB 4QY8A 1I8IA 1BM3H 2G3MA 4ESKA 1EIBA 3ARVA 5AYUH 2GSGB 3QIWB 3SYCA 5E5MB 3EG9A 3JWOC 2Q76A 2FH6A 4PUBH 2W0LA 3EFOB 1SXZA 3X1BA 2WXLA 2R15A 3OMNB 4RH4A 4UT7L 2AQRA 1HZLA 3HMXA 3VMPA 5HPOA 4HCRA 4Y4KC 2ZSVB 1SLXA 2BNRD 4OLYH 2RHEA 1G9MH 2E27L 1UJTA 1Q9LA 2WOBA 3F83A 3ZDZF 5IREA 3HCVA 3KBPA 2XJLA 1NCBL 3SD5A 4MA1C 1M7IA 1CGWA 3B5HA 1RJLA 7CGTA 2R4RH 4HJGB 3AROA 4YOKA 1ZTXL 4WW2F 4XH2B 4I0PA 2VO5A 2EDNA 4GXVL 3QZBA 4H5SA 4P2AA 2VH5H 4H88H 3ESVF 3O4LE 4PVLA 4LSRH 4PFEA 1E27A 1B0GB 4MJIA 1NCWH 1J5CA 1HKLL 3ML9A 2ALAA 4UCFA 5GZOA 4IRJC 3TNMB 3PL6D 2EVIA 5ANMA 3B9KC 5C2UB 5FCSH 1BZ7B 2BSBA 4DIXA 5FECA 3X12B 1HXKA 2F5AH 2Y7QB 3BO8B 3R0NA 4H1LA 2HFEB 1ILUA 2YRBA 2Q7YB 2ARJQ 5D7LE 1B6DA 4HH9B 4KKPA 4JFPB 4Q2ZA 1E3XA 3NJVA 1C08A 4GOSA 2ESVA 3IDMB 4F8PA 4NFDA 3K72A 4GUPB 4NOFA 3PYCA 1T21B 3KPOA 4J39A 4PJGE 1KLUA 2C3WA 4XMLL 3X13A 4NHCH 3T3PE 1KBPA 3MV8A 5GRJH 5EH1A 5HYJD 1U92A 3T1FA 2WBWB 4CVUA 3UTZB 4K3DH 2ADYA 2HCZX 1IC4L 4KH9A 2O93L 1OGAA 5LCVH 4GRLB 1UVQB 4KVPA 4XVJL 3DBSA 3T2NL 1F4YL 3HC3L 3FN3A 3FCSB 4IU3B 4F57H 1NFDF 1U4EA 1RHHB 2OMTB 4JO4H 4Y19A 2EKSA 5IEKB 1XEUA 4X6EA 2L7UA 2UZXB 5FO8B 2B5IB 4U1JA 4OGXH 3KM2A 4NNYA 1M1XB 1IEHA 3UJJL 4XPFH 5IMKA 5MEPB 3BAEL 2W38A 2ODIA 1WWBX 1BYNA 2EO1A 3ZDZB 4JFOA 5MEQB 4NLAA 4U1GB 3QAZB 3MU3A 1LO4L 2AKRA 4TQEH 1K4CA 1RURH 2JK5A 3BT2L 1DANT 2VXUH 1EDYA 3M07A 4I0PC 2ZSWA 4WW2B 3INOA 4HQQH 3S4SB 1XIWD 3AMLA 4JL1A 3ARUA 3LEVH 1RY7B 1SMAA 4TLTA 4KUCD 4G5ZH 1MQKH 1KB3A 3JXAA 5DZNA 1N4XH 4FHBD 1D5XA 2NX5B 2DV6A 1GIGL 2UUDK 3SY0B 1Z2KA 4DKFH 2QPFA 2VERA 5JHDA 4OUUA 1LK2A 2GI0A 3SODB 4CJ0A 1RZJL 3MA7B 1R9FA 4DUXA 4QR7A 4NN7C 5CGMA 4NKIH 3RTQD 1R0AH 3W39B 1YPZF 3QJRB 1L4IA 2N7BA 1JD7A 2WUBL 4J23A 4GO9A 4JKMA 1SF3A 1V3JA 1KIRB 2C4FU 2I60L 2Y7OA 3P11H 1JNLH 1NCTA 1RMFL 1BQRA 5AAWA 2P5WE 5DHVH 5DHYA 1GC1H 3TBVA 3KVDD 2X0VA 1I1YB 3FSWA 4M8RA 2XKUA 2FE0A 3RUGE 3AS2A 4ANKA 3LB6D 3GSUB 2R29A 1XGTA 3QUZB 4X0KB 2CRMA 4X99B 3JWOH 3L16A 3HHSA 3QCVL 1NSNL 3KH4A 3TPUA 4P8QA 1C7TA 4LCUB 3BUIA 3VXQB 4LASH 4X7CC 1NFDB 1TZAA 3EDFA 1RJYA 1E2WA 4NQSA 3QQ3B 2OJZL 4YQXH 3W3BA 4X6FA 1Y0LB 5BO0D 3OMZA 4OTXH 2VDMH 1ASOA 4JG1L 4YGVB 3NCJL 4PJEE 2LOEA 5DQDL 4CU6A 4AVIA 2DRUA 5IVOA 5KYYB 1TF4A 3GQFA 3R7QA 4OCXH 4BA0A 3S96A 1AO7B 4U3CA 3JVGA 4X6CF 3IFPB 5ITBH 2KDGA 3SQRA 4F15C 1XGRB 2Z65C 1W72A 1KB5A 1YEDA 4LLVA 5HDRA 2XRAL 1AGCB 1H15A 4ZSOB 1AS7A 2J6EA 1ZJAA 3BP7A 4C8XA 2VW6A 1EZSA 3AWGA