3KLQA

Crystal structure of the minor pilin fctb from streptococcus pyogenes 90/306s
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
137
structure length
137
Chain Sequence
STVQTSISVENVLERAGDSTPFSVALESIDAMKTIEEITIAGSGKASFSPLTFTTVGQYTYRVYQKPSQNKDYQADTTVFDVLVYVTYDEDGTLVAKVISRRAGDEEKSAITFKPKRLVKPIPPRQPDFPKTPLPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Putative pilus anchoring protein
publication title Crystal structure of the minor pilin FctB reveals determinants of Group A streptococcal pilus anchoring
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 18
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12892 FctA Spy0128-like isopeptide containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3klqA01
3KLQA 3GLEA 3B2MA 3GLDA
chains in the Genus database with same CATH superfamily
2E8YA 2UZYA 4FG4A 2KKQA 1OHQA 4S1SH 2MCG1 2EDRA 2QSQA 4IU2A 3BKCL 1HSBA 2FIRT 1I1YB 2Z7WA 3AS2A 3DX9A 4IGBA 1E4XH 2CO1A 4KMTH 4OFIA 1U91A 4OUUB 5FM4A 3SQBA 2P49B 1UT1A 3LXUX 2VJ8A 3R19A 1R5WB 2A6JB 3F2LA 4MQXD 5D5MA 3R8BB 3TBWB 1VENA 3PV6B 3FU8A 3C60D 4MCYB 1DQML 1XZ0B 4WNQA 5DQJB 5J1SC 3STZB 1ZWIA 3WNMA 2YAOA 5A2LH 1HEZA 2HFGL 2VSMB 2EAEA 4F5CA 5F7MC 4AIZB 1LK3H 4NFDA 4XCFL 1ID5I 5CBAB 5DZNA 4HLJA 4JFOA 1P84J 2DQHL 3VXSA 4UQ3B 1W16A 1VZHA 1ES0B 2X6VA 2N01B 4L4JA 5KUMA 2XVLA 3LKRB 2P5WE 3VXNB 3QIWA 2LV4A 4MXWH 2C7FA 2Z91A 3ZZSA 1ZVSB 2GJZA 5EU3B 1EHNA 1A02N 2AJXL 4HUWA 1AR1C 1ZLUH 1D9KD 3LRMA 2JK5B 1C8QA 3F83A 1ZS8B 4YSQA 5D7JA 1JYXA 3G9VA 4KNQA 2BFVL 4FG2A 4ZT1A 1RP8A 3TIDB 5IB4B 4X9GA 4CSTA 5I6XB 1JPSL 1VGKB 4EJ1C 5E8OB 4TVUA 5IK3B 3ILQD 3TLRA 1IRAY 2VLLB 3TO4B 3WTSA 2PPFA 5J8OA 4F3FA 3O3EB 3V2AR 3KR3H 3KYOB 2BCKB 3DETC 5F72S 3HKFA 2JIXB 3L3DA 4MQXC 3RE0A 1A9EB 4ZFGH 1JF1A 4NWUL 1J0IA 1GZHC 4R7NA 1KJ3H 4XWOD 1AGEA 4N2CA 4GSUA 2NYYC 3VFRB 4FP8L 3L9RB 2K6ZA 1CFSA 2GSMB 2LU3A 3HPLB 3S48A 4U2YA 5BQ7B 3VXQA 1QBBA 2R8SL 5ADPL 4YBLC 4GXFA 2O61A 2BS9A 2DIBA 3IKCA 4MYWB 1G9MH 3H6JA 4OFPA 2DW5A 3TEUA 2WLHA 2EZ0C 3EFOB 5SWQB 3ARDA 1NIBA 3RL1B 3GS7A 1AANA 3CFDA 1SDDB 4XBPB 2ZWLT 4KI5F 3K8LA 3S88L 1E9OB 3VFVB 4OW6A 1IQDB 3NMEA 5CR8A 3CZFB 1AGBB 1NDTA 4OM0H 1WD8A 4MJIE 3I84A 3C12A 1U3JA 3VWJA 4LXFA 5MENB 3FCBA 3SIKA 4CJ0A 1TETH 2G3XA 3GRWL 1QLFA 2VDRH 2X4UB 3GXUB 3QEQD 5ACLA 2O6DA 4OZFG 4N0UA 2FAUA 1PZBA 1BZOA 4WIQA 5IJVA 5TK4A 3RHWK 5D1XA 4IKIA 4QWWD 1LO0H 1JWSB 2NYKA 3CC1A 3UC2A 2GHWB 1RZ8A 2L3BA 1X5GA 3FB8B 5EU6B 2N7SA 3FQUB 1JHTA 4XPFH 5HD8D 3E7JA 3ZW3A 1ORSA 1U8NB 1N0XL 1ONQA 1OF2B 5F7EL 3MRFB 1R24A 3S37L 1CDBA 4P5SA 3G6DH 5I6PA 4YSEA 2YMTA 5C7XL 5EU6E 1QFWL 4GEJA 4C59B 5TTRA 1BXAA 1T20A 2AQSA 3FT9A 2L7QA 1AG6A 4KUCF 1UKTA 1MXGA 3UTQB 3F84A 4BXSV 1KEMH 3F12B 3I85A 3CC5B 4LVNB 1M56B 4ANWA 4F2FA 2DS4A 3RWIA 4HFWA 1ULVA 1HX0A 4O02H 1WIUA 3TBVB 5I1AB 4K3DH 1MUJA 4PJXA 4GMTL 4PRNA 2IV9A 4TQ8A 2DJMA 5HY9A 2QQQA 3QG6A 3KPRA 4AQOA 3GSVB 1KNOA 3EJUA 4CVUA 3QRGH 1FZOB 2NY5L 4JG5A 3P2TA 2AK1L 1BGXH 1JP5A 1U8KA 1GGUA 3FTGA 4JANA 4OCSL 5JHLA 1TTAA 4UTAL 4JPQA 3IFPB 2Z7YA 1CQKA 4MAYA 5BS0B 4XCYA 4QWWC 2ZCLH 3U1SH 1LLAA 3I6GA 1CFNA 4L3EE 4L3CA 3LSOA 5FX3A 1FGNH 5HDQL 3P77A 2P80A 4U1LB 4NZTL 3BVTA 3L1OL 3PXLA 5HD8C 5IMKA 1TEYA 5T1LA 3QJZA 3CXHK 1N3NA 1MPAL 5I5IA 1A7RL 4WFHE 3ARGD 4XH2B 3J27A 1QRKA 3U36B 4HLZH 1IGIL 3UZEA 1I9RL 4ETYA 3VB8A 4ZTPL 1S2EA 1MHEA 1SJMA 3IE9A 1DQJA 2HG0A 3JVGC 2CBTA 2JJSA 4YDVA 2Y69B 3FN9A 3BRGC 4WEBL 1KGXA 4RA0C 3CCHB 4XMZA 1J5HA 1QSED 3LRSA 5FHAH 5IB2B 3HA0A 4NDMB 5BQDA 3VQMA 1AJ7L 2WQVA 3KD4A 4C56B 4FCHA 1URLA 5IKCA 5E6IA 5AZEH 4IJTA 5L8LB 4ELKB 3TBYB 4TV3A 3O11B 1Z9PA 3RFRA 3RY6C 2VL4A 1N64H 3CSPA 5FYLH 1H9DA 5CZXD 5HBBA 1PD0A 3TYGL 5IR1B 1KLGB 4WWOA 3AITA 2OULB 4ENED 2OSLB 4K3JL 3MLTA 2X1PA 4U1NA 3KXFD 3PUUA 2OI9C 32C2B 2ZP8A 4OLVH 4ZK8A 1BMWA 3RWCB 1DVZA 3MBED 4R2GC 3AB0C 3PQYB 3ULSA 5F89B 2D73A 1TPXC 3V6FB 3RWJA 2GITB 4FL4B 3SE3C 1OB1A 3GHEH 5C0RH 3ARGC 3LX9A 1DBBH 5C6TH 1QKZH 3QIUA 2BIPA 2WBWB 3LMJH 2LGNA 3U79A 2P8LA 5E7FA 2Y2YA 1EFQA 2Y24A 1JGDB 3T65A 5A40E 3LKPB 4NZDA 4FKEA 4X5XA 3RVVC 1XFPA 1FG9C 4JFXA 3IU4L 1BEXA 4NSKA 2X4PB 5C0BB 4V2BA 1Z66A 1QUNB 1LEKA 1JL8A 3T3PB 1TFHA 4ABQA 4HV8A 2GEQA 4X0KA 2ITFA 3VB9A 4HK0B 3T1FB 4OBRA 1GW0A 4HDIB 2OMZA 2VLJD 4D94A 1EJ6A 2ARJQ 2EKSA 2WQUA 1AACA 3TZVB 2VLRB 4KROD 2MHAB 4LE8A 3VRLE 2BDNL 1Q90A 2A73A 2BSED 3D85B 3VRLF 1UQSB 2DV6A 5BVPL 4KK8C 1OALA 4NP9A 1XL6A 2F54B 3O45A 1TITA 3RQ3A 4RESB 4O2EB 4XNMA 1XGRA 3CX5J 2CHNA 3L95B 4GUPA 4IBZA 1FAIL 1VEPA 2KQNA 3AAZB 4UZGA 3WKNA 1BD2A 3ZSSA 1TVBA 5AYUH 1MHHA 2QR0B 4MNHB 4LQFH 5JXED 5FCUL 3DIVA 2VYRE 4KXZH 1NKOA 1DSFH 4JPSA 4BK4A 5F70A 4L37B 5TF1H 3MLSH 3LNHA 2YA0A 2PCPA 1RQ5A 1X44A 2FIKB 4U1SB 2H0JA 4WUKL 1D5XB 1TKWB 4FLHA 2VDOH 2X4QA 4PH8A 1L9RA 5EG6C 1E5AA 5JW5A 2DQIH 3EYQD 4CC4C 1U2YA 3S96A 1CFQA 3M8OH 1RI8A 2EDMA 2VTFA 3JZYA 4Q58C 5BJTA 1CG9B 3P2DA 4L2YA 4AVHA 3H1ZA 4P23A 1VGEL 2GAZB 4IMLA 1WIOA 3MFFA 1DJZA 2AZUA 3GSRB 1J8SA 1PYWA 3TA3A 5I16A 3GKWL 2X12A 2E6QA 2V8MA 2AGJH 5DJ6B 3LZRA 4ZXBC 1MCBA 1RZ7H 3S5YA 1G7JB 4W9GC 2OMYB 2ZPKL 1I3RB 1IV8A 3NDZE 5E2TL 5L7XH 1UOVA 3OGCA 4TVPL 1FORL 1KFGA 2R1XB 3W56A 4UCFA 5JHMA 2B5IC 2EACA 4KKRA 2OAAA 1T6VN 5E4IA 4LOEA 3QEHB 2B16A 3P4OB 3FN3A 4M7KL 2J8UA 3VTTA 4F33B 1E3XA 2A5UA 1N12A 1JPTL 2R69A 5LJYH 3CVHH 2YAEA 5HTSA 4A37A 3O3BB 4G8IA 1BPVA 2APTA 4QHMB 3EZJB 1DQKA 3Q1EA 5B1JA 1FRGL 4PP2A 4KDWA 4G5AA 4QXTB 3VYOA 3SE4A 4G6KL 2EADA 3AG4B 4KY2A 4XPHL 1CCZA 1TCRA 3EYQC 4OFKA 4DK3A 5GRJL 5DMIL 5KAQG 5F7DA 2ZZUT 1OP5K 1XH2A 1OCCB 4A7SA 4CVWA 3HRZC 1FZJA 3L4WA 4NJAH 2ZXWB 4F20A 5G55A 3G6AA 2X0WA 4PJDB 5I6OA 4MD0B 3KH3A 1RMFH 4P5RA 3ELAT 4B95C 4DP2X 1H5BC 5EF2A 2CR0A 1SVBA 1Z5HA 4FQ1L 2ZXQA 5DD0L 5DCCA 5E9DD 2HPOA 3KYNA 1CBVH 5TPWH 1KJ2L 1U8LB 4G7VH 4DGVH 5E8DH 1VACA 4LLUA 2K3TA 3GNML 1CE6A 4RLDA 1JK9A 3LHPH 2XFGB 3VGGA 3P3UA 4PFEA 1MVFA 3MJ8B 4PJDE 5D7HA 5JIDA 3S8WA 1T03H 3ML8A 4PJDF 3WL9B 1AGCB 3DV6A 3VTAA 1NLBL 3ZRFC 1REIA 3FU3A 4L8DB 4JDZA 1HIML 3P69A 4JG1L 4JZJB 4PD4J 4Q8BA 2CLRB 4YK4B 2C1PB 3SGJA 3MROA 1OCWL 5ILTH 4L4TB 2AJVH 3ECBA 4NUJA 3O0LA 4O9HH 5HHNA 2OSYA 4MNQE 1BLNA 1OHZA 1NBVH 2JB5H 4TULH 5IB1A 4Z3GA 3WXWL 4ZUTB 1ADWA 2EH7H 1P7QB 3EJSA 4RFNC 2LVEA 2LFEA 2XN9A 2R29L 3FT2A 5GS1C 3VGFA 5JXAL 4CSPA 4NZRH 3BQVA 1MIEL 4L4TE 4PS8A 2QQLH 1TZ8A 4OM1L 1E7VA 4L1HA 5K9JH 4PJHB 4NN5B 4DKEL 3PFQA 1AZUA 1LEGB 4JGMA 4GG6A 1IGCH 2ZUWA 4LVHB 3C6LA 4AGPA 2O72A 3B7YA 2YA2A 4JG0H 2H0PA 2K6YA 2GTZA 2XWBA 5CCKL 2EIZB 3ILPB 4Q6YA 1UB6B 3L5IA 2JKXA 4DFHA 4NQEA 3ULVH 1X5IA 4PJHE 4WW1B 3TBSA 3F7VA 3JTBA 5ANME 4PJHF 2V3EA 2IH1B 1D2OA 3EJRA 1UH3A 2VQ1B 3KL3A 1LK2A 1IM3B 5BNXD 1QO3A 5EN3A 1NPJA 1ACXA 2P1YA 2WW8A 4MMXC 2HZHA 4R0LC 3B7RL 4JG9A 4W1TA 3TCLA 3D87B 5DS1A 2L0DA 5HJBA 1JRHI 1RFDL 4KMQA 1XIWD 3SBRA 2CQVA 1CFTB 5FYJE 2ETWA 2O5YL 1QFHA 1SXBA 2WXNA 1T1XA 3O3AA 4PREA 3GK8L 3FUNA 4R26H 5K33A 4EKJA 5KBPA 4X5WA 4H1LG 1V3KA 4IIQC 4NGHL 2H0EA 3MRIB 1YO4A 5EBWA 1XR9A 1EZUA 2NY6D 1WP6A 2H6PA 2DQDH 2WLLA 3OR7A 4N0YL 2MSPA 3IMSA 3QO0A 5HGHA 5HHVH 1XX9C 3ZKSD 1J5OH 1NGQL 5D1ZB 2VDKH 1HCFX 5D7LD 2VAAB 3PWVA 2Q3XA 1JGVH 1CL7L 3QQ3B 4FFZH 3L8QA 5SWZD 5I30L 3GQFA 3TU6A 3DBSA 2VMDA 2WVTA 3E2HB 4GKSA 2GSIB 1Z32X 3MRQA 2YQ2A 5KSUB 1PVHA 4IM8A 4JRWA 4LKXA 2Y2WA 4ILDA 1E6OH 3GLZA 3QA3B 3SPGA 4NZUL 5BV7C 4YH6A 2LU7A 1MNNA 3CU1A 3SOTA 5CSBA 5EU7C 4NT6B 5IFHH 1A9VA 3N1GC 4G3YH 1BAFL 2CO4A 4DH2A 1HNGA 3BAIA 3VRIB 5IGXH 1MRFL 5GQBA 3CH8A 3D18A 3HMXH 5LDSA 4H13C 3TC9A 2FT8A 3Q5OA 2FQEA 1H15A 3FOMB 4AUJA 1FNAA 1DCEA 3IFOA 3ESOA 1BZ9A 1N0LA 2JKNA 1PJWA 4EE2A 3VG0H 2KI6A 2PTTB 1F1GA 2A3TA 3AT0A 1GAFL 4MX7A 1DSYA 3DK0A 1OLLA 2JKTM 3D30A 4RAUA 3ABLB 1P9MC 2CJUL 1Q0XL 2MCPH 5D1QC 1DFBH 4Z7WE 1FNEB 3RA7H 3S0PA 3LRGA 4Y4FB 1W72B 1DJIA 4FKHA 4JY5L 5EC1B 3V0VA 4Z7WF 4RA3A 4HUVB 4P4KB 2A83A 3D2UB 1EJOL 3FU5A 3MYJB 4M3JA 4M6OH 3IBEA 1G7QB 3IXAA 4KJYA 4NAQA 1TNMA 1Z5LA 1ZLSL 3FAXA 5LNGA 5EO9B 4HJJH 5EU4A 3GINA 5JUEH 1YMHB 1F6LL 3QNZA 5JPMA 5I8EA 2Z3FA 1IO4C 2V6HA 3C09B 1L3NA 2WWOA 1KTDA 3KWTA 1NCGA 4XO3A 1JMZA 3HE7B 3EHBB 1R5IB 1XBRA 3DOSB 3WHE0 3HG4A 1C5CL 1G7MA 3DHJA 2Q8AL 3OAUL 4FMKA 1QTSA 2ITDB 3WHXA 4DTGL 3I9IA 3R0MA 3K1KC 1M05A 4H0IA 3L48A 1N59B 4GBXB 5ID0A 4KOBA 5I2IA 1XHHA 3DX6B 4GS7B 1KGUA 4XVUD 4IBYA 3IT8D 3BISA 1DLFH 1SY6H 1M2VB 3MV9D 5AOMA 4ZO7A 1VA9A 1VADB 2Q5BA 2LLNA 1SBBA 2G75B 5K1NA 3JV6A 4JK0D 1MJJB 2OMVA 2IIJA 3DARA 1F97A 3SSGA 5C0CB 1Z9LA 4DPBX 1I1YA 4OUUA 3BDYL 1KXVC 1Q1PA 2FEJA 4XGZA 2MCAA 2X2YA 2N1KA 4DUVA 2XWTB 1GPOL 2IDFA 2A6JA 3OPZH 3TBWA 2R0ZH 3RZCD 1QTYT 4QTIL 2BRRL 4MCYA 3SBQA 3QRBA 2P5WA 2AMUA 5DQJA 1R19A 4F8PA 5C0CE 4F57L 3SPHA 4P46B 3LOWA 3QZOA 1UOLA 4AIZA 3MLXH 3HFMH 2VJXA 1IGMH 4Y4KD 1JZ3A 1EDQA 1HH9B 3CVIL 3F7YB 3NRFA 4HXBH 4UQ3A 5IQOA 3DK2A 3Q13A 1XH1A 1TQTA 2ICEB 2XA8H 1H8LA 2YMXL 5ESQB 3LQZB 3FO9A 5L0QB 5C2BL 5C09D 1MDAA 4WSJA 1NC2A 1AZZC 1RJYA 4FQ2L 5I74B 4Z76B 3QRFM 4XVUC 4AJWA 5J6GB 3MHZA 1AS8A 2BNUA 3ULUE 2YQBA 1A2YB 1TLMA 2AQTA 2ZKHH 3TIDA 2NY2D 4KK5C 3RGVA 3X17A 1VGKA 3O2VH 2CCWA 5E8OA 1T21B 5L4MA 1OGTB 4YZFE 4PLOB 2AZAA 6FABL 2VLLA 1A4BA 3FRUB 3F00A 3TO4A 3QIBB 2J4WH 4YZFF 3O3EA 1IMHC 2BCKA 1S7UB 1YG9A 3ELQA 1SDAB 2JIXA 1UGKA 5J9PA 1OAKL 3UOAB 1A9EA 3Q3GB 1QYGL 3LD8C 5EIIG 1Z2KA 1ADQH 3V4PA 3DVNA 1BZDA 1SJVA 2ZWYA 2CM6A 1Q0YL 3L9RA 1WCBB 5DZJA 3BUDA 3NSCA 1MW1A 5GGRB 1H3PL 3HPLA 1R3LA 4UDTA 3QIWD 1BIHA 1GYUA 1Q9KB 5DI8B 3D25A 2OL3L 2YPLD 1GMEA 3BN9C 3CFIC 5D7JD 3RL1A 5I66A 4MJIA 1JG9A 4XOBA 4W9HC 3L1GA 4M8RA 1NAKH 4KWUA 1SM3L 2LU4A 3WFEL 5DXWA 3FHQA 1E9OA 3ZBMA 3BYYA 4TUKL 4NXSA 4IEFA 1G1CA 4AVJA 1AGBA 1KXQE 4MMZB 2FTAA 3FH7A 3MCG1 4HS8H 4EQ2A 3MV01 3QDGB 3US9A 1KN4L 2NW2B 1XB8A 1G9HA 5DHYB 4HKZA 2IQAA 2HRLA 2AF2A 1JWSA 2OV0A 1HJCA 4FHJA 1YYMH 5EU6A 2LHAA 1H6FA 3CFUA 3FQUA 4TRPH 4YR6B 3QDGE 1CTMA 4GIAA 3WLBA 1UT9A 1U8NA 3QS3A 1YVLA 4D0BB 2E9WA 2Q3ZA 5I15L 4XZUB 2J20A 1IT9H 4H88H 1JD9A 5B39G 9PCYA 2VO8A 1BFVH 2JTDA 4LCIL 3T4AB 3ARDD 4BSWB 5DT1H 1GGCL 1MFDL 5T5NF 1EGJA 2HRGA 2DQTH 5D4HA 3U2IA 3FQTB 4O2FA 3IS0X 1BBDH 3F12A 3CC5A 3GBDA 4I13B 1FCGA 1UADC 2AJZA 4XB8A 1ZEAL 4L18A 3ORJA 5I1AA 2J72A 2P4AB 3UTTB 7FABH 3ET9F 5KVGE 1AD9B 1LD9B 3Q9PA 3GSVA 5DVOA 4L3EA 1FZOA 1OOWA 4OD2B 1EUTA 3I2CL 1OK0A 1FPTH 4GRWH 4HZAA 2UXVA 5D1XD 5A2CA 5IIEB 4U0RC 4HFUH 2WWMC 1L6XA 1JE6A 1G5AA 2H9GA 2J2ZB 3UTTE 3MLRL 3T1WA 2WINA 1U8IA 2BP3A 5I18L 1O5DT 2ITCA 2NY1D 3V6OE 3MNVB 3T08A 2XJKA 1U8PB 3O2WL 1NEZB 5AVQB 5ANHA 2XPYA 3CFJB 4U1LA 4V11A 4FXKB 3ESNA 4JDTH 3RIKA 3ECVA 5AOIA 4G1EB 4MWFB 4XMLL 5I82A 3QPQD 1BVOA 3O0RH 5E5LA 1JHKH 3FQ2A 4XH2A 3SPVB 2W60B 3WMPA 4OR1A 5DD3H 5K9QI 5KANG 4TKWA 4JZNA 3F7RA 2Y07H 3UTPD 3TN0B 3CSBA 3ATAA 4S1DD 3OJDA 3HN5A 1QA9A 3NP4A 5GZND 4I85A 5TDPA 1KCLA 1MRCL 2Z8SA 1EERB 4OCMC 3KJ4C 3DRQB 5IB2A 5IVNA 4DN4H 2YAMA 4C83A 4WUUB 5KSAC 3DUSA 3EG9B 1NJ9A 2WLIA 5IJDC 4M8QB 3RNQA 1IM9D 2KYIA 2R4SH 4J7RA 4ELKA 2TAAA 2FBJH 3O11A 1UEMA 4F9PC 3H56A 3L4CA 5IQ7H 2EVHA 2WBJB 3P11L 2IWKA 1BCIA 3BWUF 4Y2DD 3PJNA 4WUUE 3KS0J 4L9LC 4V2CB 5KVFE 4FYTA 2BSRB 4KV5E 2OSLA 1S78D 2ADIA 2HRPL 3RURA 2H8PA 5C3IA 1HYSD 5TK2A 4KV5F 4BCXA 5HHPA 32C2A 5T1LD 3OLGA 3RWCA 4OLWH 1OKEA 2BOBB 1G6RL 2YEVB 5F89A 2W5PA 4UTCA 2GITA 2DKUA 3MLYH 1PKQB 1E9PA 3HB3D 2DAVA 5T3ZE 2ICES 5LBSA 3S5LB 3JWNG 3BRFA 3QFJE 4JREB 1KCUL 4PWGA 4TVPE 5AVUB 1NFIB 2OXHB 2UZIL 5CUSH 5TE7L 2YGVA 1NMBL 3FONA 1JGDA 1PZ3A 3LKPA 1IGYA 2RGSA 4XP1L 1DZBA 1PKQE 4Y4HA 4PJ5E 3JTSB 3INUH 4UM9B 5LBVA 2X4PA 2AEPH 5ITBL 1QUNA 2RH0A 4Y19E 2ZJSL 5E1AB 1WE5A 3PS6A 4KQ3L 2VE6A 4YC2B 3APNA 4P8QA 4P99A 4HK0A 4WFFE 3T1FA 2WZ6A 4L23A 3U6XA 2Q6WB 2NZ9D 1TENA 1TYRA 4E9RA 4L1BA 5FHBL 2F7QA 1G9NC 1A14H 2DI7A 2C3WA 3RY4A 3K71B 2DH3A 1IAMA 3X12B 2XTLA 2MHAA 1KJ2B 1SLUA 3DTXB 1OARL 1RCYA 1E4JA 2X05A 4N90E 2MKLC 1UQSA 2XJLA 2YK1H 4XP6L 1B0WA 2XWJA 4LZKA 4O2EA 4BQ8A 4P2AA 3IDYC 3LQMA 1UJTA 3L95A 3TO2B 3ZIMA 1SOSA 3K5SA 1XCTA 4LESA 4MNHA 4QAWA 3RVUC 3JWOC 3HR6A 3ARPA 4R7DB 3MCKB 3BVDB 4BFRA 3FCSA 4PBWD 5I23A 3TCXA 3BUIA 3RWDA 5EIQA 1JFQL 2NMSA 3T0EC 3LPGA 5TQ2H 2BNQE 4ZAKA 1U41A 1ZJBA 2WZ5A 3QK0A 4HCRH 4X80H 4HP5A 4U6VH 5JLZB 4MZ2A 2IQ9L 1J9RA 4U1SA 3VXRD 1D5XA 3VGAC 1TKWA 3DOHA 1OZTG 5BOPA 3MV8E 2E0PA 2HKFH 2EUXA 1SVCP 3CXFA 1FSKB 3COOA 4YSOA 1OQOA 1ZLWK 2FB4L 3QXDB 4XCCL 2YC1A 2EE2A 3ESPA 3FCGA 1J0ZA 3L54A 3GSRA 1JBJA 3GBNH 3VW3L 1JRHH 5I5JA 5DJ6A 2EE6A 3QEGH 1MW3A 1OCRB 1BJMA 4OFDA 1BD2D 1I3RA 4DESA 2R1XA 3X3GH 5IQ9B 3BZ4B 5BVJB 5FO8B 2HVJB 4X8GA 3UGEA 4BFJA 1G7PB 2GQHA 3LN4A 3ZVVA 3QEHA 4N8VB 3P4OA 1YUKB 3N41B 4X9BA 2EXWD 5HXMA 1Y6KR 4JPWL 4ODSH 1FG2A 5C7ZA 3GSUA 4Y9EA 4CKVX 3TJEH 5F3HA 4Q9QH 3HC3H 1KC5H 4QXTA 2WQRA 3ZYOA 5L4IA 1N6QL 2GCYB 2NY3B 1BJ1J 1KG0B 2V0AA 3HHRB 3SDYL 3V9CA 2PN5A 1G7IB 3N41F 4QY8B 3ZO9A 5IFAL 4P23D 5HI3C 4G42B 2A9MH 1EPFA 5JPNA 1DBMH 1PIGA 1Y7VA 2X4SB 1ETZB 2QEJA 2XY2A 2OP4L 4QHNA 3V0WH 1E4KA 4K3HA 4I3RH 4K15A 3ML9A 1CK0H 4ZPVB 2ZYHA 3P0YH 3FMGL 4PJDA 4MD0A 5DK2B 4WF7A 4TQEH 5I8KL 1FFPA 3D8MA 5IJKA 2BY0A 2XZQH 3MR9B 4M4RB 1EAJA 4WENB 5C0DA 1OWRM 1PS3A 3K4DA 4I1NB 4N2GA 1C5BL 3K2IA 4HJUA 1IL1B 1N18A 3CTTA 5HHXH 2VMFA 3B5TA 1HH6B 3MJ8A 4AW4A 4MNQA 5DK0B 4ALAH 2KL6A 3US0A 3LPPA 1UM5L 3KPPB 3RTQC 1F4XH 1OE3A 1AHWC 5IESL 3I50L 3IK2A 4J4PC 5F7LB 2VXQL 2AQ1A 2CUHA 4NERA 2C1PA 2HJLB 4MB5A 4EAEA 1AFVL 4L4TA 3D6GA 4BCZA 1UJ3B 2KDGA 2YFOA 4P2RE 2OMWA 3RWHB 3M45A 4ZO9A 2CM5A 4BFOA 1CC3A 4Y1SA 3T77B 4ZUTA 3SQRA 4OGYL 1QLEH 4TL5A 4HPOL 4ZMXA 1GCFA 1OTSD 2X1OA 3WAKA 4QD2E 2BXZA 3BWSA 1OAJA 4PJHA 3RPKA 5ANMA 5ID1A 2J25A 1T66C 4WNSA 2YA1A 1J5DA 1E28A 2GY5A 3FYEB 4IRJC 2H6UA 3ILPA 2AHIA 3QUXC 3QUMA 4DGYL 2R1WB 3BP4B 4F2MB 1XF5B 2IH1A 2E4TA 3EGXA 4PJGB 2VQ1A 4X9IA 4G6ML 4WW2C 3IMVA 3BP5B 1Y1UA 1IM3A 5I1CH 5KBKA 3VD9A 5DJYB 2ZUVA 3HMWL 4APQC 5EEVA 1PF3A 2PWHA 4LLQA 5C86A 1S9YA 1BG1A 1Q1JL 4U7MA 3QS2A 4F2ME 4XVJL 1CLYL 2D31B 4PJGE 4I18C 2OTPA 1CFTA 1F1AA 4BQ6A 4DW2H 4PJGF 1JXGA 1Z9OA 2J8HA 1FJ1B 3WOVA 3KPMB 3T2PA 4Z7IA 4GXUM 3MRIA 1SXNA 5JW3L 3DROB 2H1PL 1CB4A 5IMOA 4EI5B 5E6RB 3Q8EA 3SBWA 2A6KA 2W9EH 4UB0H 5DFWH 5GRWA 5LNDA 3JWDH 4HF5L 1G5GA 3C6LD 1B0GB 5D1ZA 2VAAA 3PGFH 4OVVA 3V4UL 3B9KD 2K9FB 3F3HA 5J13B 2X6UA 1ZE3C 2Q7YA 3KMDA 1HE8A 2Q9OA 4J3OC 4PGDA 4L8SC 5KSUA 5KVDE 5GGVY 2LQRA 4YXLL 3PNRB 4PR5B 1HCZA 1KXTA 1VIWA 2BOCB 1EZLA 4LEBA 1FF5A 2B20A 2KS0A 3BFQG 5I9QB 1IGJA 5K9OA 2WTOA 1H8SA 5AVRB 4AY0A 4BKTC 3B9VA 4K7PL 3LN9A 3H85A 4IRZA 4NT6A 4WTZA 3SJVE 2OMTB 3NZ8B 2D2OA 2AJ3B 1NKGA 4K94L 3UFIA 4EVNA 5F44A 2VLKB 1WTLA 4LP5A 3TIEA 1J1OL 1E3FA 2CH8A 4RQQB 4NOFA 3B83A 3DO7B 4LPYA 4UM8A 2ZG1A 4WO4D 3V4VA 3QHTC 2NLJB 4HC1A 3NDYE 4AKPA 3BW9A 4Z7WA 4H20H 4PI2A 1BBJB 5H8DA 3KNBA 4RSVA 2VLKE 3UCRA 2LVCA 4JO8A 4OJDH 1CUOA 4RZCB 5J6SA 3FOLA 5B1CA 4N87A 2PXYB 4N9GA 5J4MA 2CKBL 1G87A 4N0FB 4RMWA 1A3ZA 1YCSA 1QFUH 1FNEA 1CIDA 1VDGA 2R27A 4Y4FA 5EC1A 1W72A 4ORGB 4QRQB 5C8JA 4P4KA 1LK3L 3HPJB 5AKSA 4ETQB 2DQEH 1PDKB 1G7QA 4LRIC 1NOFA 3FTVA 4ELMB 5I1EH 4GT7A 1KCWA 2J5LC 3DURA 3FHAA 1ESOA 3JWOH 1P5UA 4HGWB 3L45A 3ZLQC 5L9DL 4I88A 3GXMA 2A9AA 3CLFH 5T33H 1KUMA 1NMAL 3R0NA 2WQXA 3IJ8A 4S0SD 3FSAA 5GSVA 1DJHA 4Z23A 2HJKB 4AGQA 2VN6A 3DX7B 3EIFA 2WXLA 5HVFB 4WO4C 3FFOA 4ELMF 3W37A 2NXYB 1N59A 2X41A 2Q20A 2VUOA 3GHBH 3UEQA 1AS7A 1SEBA 3GRWA 1HVXA 2YFNA 3HAEG 3KR3L 1VADA 3DVGA 3BIKB 1ZHKA 2YOAA 2G75A 3FSZA 2MPAH 1M71A 2MTPA 4XMXA 4JKKA 3OXSA 5LB1A 1KJ3L 4CAGA 5C0CA 1LL1A 3T8XA 4G6AD 3UAJA 1YDPA 2HJFB 2NTFB 1B9KA 1J9TA 2XYBA 3FT1A 4U6XB 1E9QA 4YSDA 3ARFD 3NABH 4JFZL 1WBXB 2VR7A 4I0PB 3L4XA 1U36A 3HNVH 4F37K 2BSDA 1XGYH 1ZGLP 3BQUA 3MRKB 4ZUWB 1KCKA 5DS8B 2C9VA 2F08A 3ZMRA 2X1XR 1R34A 4M3KB 4PBVC 5B21A 4POYA 4LB8A 5JHDE 2UYLB 5ITFB 2BWDA 4S0HA 2WN2A 2JV6A 1ZJAA 1J1PH 4EMZA 2OJZH 2UVEA 4OCXL 1XGZA 4D3CH 3A47A 5J6GA 5DMKB 2XKNB 3MRLB 3V0IA 2J5WA 1A2YA 1CDUA 2CBMA 4YL9A 1NIAA 3VSTA 3ISYA 4NKDB 4LK4A 1ZLWH 3SKMB 3LQAC 4N1EA 1KBVA 1M6UA 4UIKH 4G6AC 1WWCA 1S7UA 4N2KA 2WGNB 1CGVA 4WFGD 4BRVA 4OCWH 4ZI8A 4I1PA 1JIBA 1KENL 1I1FB 3DSFH 4LPTA 1RSYA 2E4FA 4X98B 4GXVL 3H7LA 2NX5E 4YVUA 5GGRA 4FNRA 5EZJB 2MRYA 2XCMC 3ZT5A 1ILUA 2DQFA 1LO4L 5DFVD 6TAAA 1KEML 5D6CA 1MRDH 1Q9KA 4R4BB 2IG2H 3EBAA 3K4ZA 4QRRD 4G8AC 3VSVA 1FQ9C 4AYDC 3BE1L 4O02L 4P3WA 5IEKB 5F7HA 4K3DL 2R1YA 4JFVA 5GJSH 4FQXB 1KXQA 1GH7A 3LN5B 3RDTC 4Y5VB 2BHYA 4MSWA 4Z3IA 3RGVD 3X3FL 5I71C 1BGXL 1SEQL 1BDYA 4KRMB 3V0DA 2IPTH 4U1GC 3SCMC 5BMFH 2C5DC 2FGWH 5I1HH 3LIZA 1KCBA 4OCNC 1BQRA 3U1SL 3U1QA 3DOIA 4ZQKB 3ZTNH 1IQWH 2V9TA 3QDGA 4FTVB 1FGNL 1X7SA 3EYVB 3G5VB 1G6RB 4W6YB 2VWEE 5DHYA 3SPCA 3KWUA 2APFA 3MRNB 1UD3A 2XA3A 3ABKB 4BE6A 4QLWA 3WEOA 5HP5A 2VR8A 4NUQA 2V7HB 4YDZA 4PUBH 1M57B 2XACC 3ZKXB 3C08L 4XPBH 3SKOB 4NKOB 3HE6C 3VI4B 2DIJA 4BSWA 1J1XH 3VXUE 3U7WL 1TJGH 2D9CA 4NHUB 1SLXA 3FQTA 3EH1A 5F88B 1YEGH 1UA3A 3Q6GH 1NBYB 4AYEC 3P02A 4U3XA 5FYLL 5BZWB 3UTTA 2F8XC 2WXQA 1HSAB 1EAPB 1AD9A 4JDVA 5MEQB 2VNCA 3EBIA 4XE0A 1BHGA 3V6OA 1U8JB 2JH2A 2V4LA 4OD2A 4Q6IC 2J43A 2ZYIA 4KNTA 4AQ8C 1Q9LB 1QSFD 3FO2A 3AM8C 2ZF9A 1RURH 5BW7A 4JO3L 3T6WA 5EF0A 1YEDB 3Q06A 5AEAA 4LHUA 1FZMA 1ZE3H 3GHEL 1SXSA 4P5MA 5E2WH 1DBBL 5C0RL 1SHMA 5TQ0H 1B88A 1RZJL 4X7TB 2PO6D 1QMUA 3IPEA 4TTDC 5JDJA 4G1EA 3SDDD 4I9WE 2EDOA 4IMKA 3WO4C 4QF1B 1B2YA 1ZT1B 3R4DA 5C0EA 2W60A 3CN2A 4K9EH 3AQZA 4OF0A 2OR8A 4PGZA 4TNGA 2WK2A 2WYHA 4DQAA 2N7BA 3TN0A 1H6TA 3HHSA 1DN0B 1I9JL 3LCYA 4PGBA 3W2DH 3LZPA 5AAMC 3ZMNA 5E23A 1A0QH 2EDLA 3QJUB 5PCYA 3DRQA 4BSVB 2WIIB 3LPFA 3NJLA 1LEIB 1O75A 4WUUA 4L3ED 3EG9A 2XTJE 4DGUA 2X4TA 4LGRB 3AG3B 4M8QA 3IFLL 1OF0A 3QORC 1DHKA 1GY1A 3DYPA 1CWVA 4JS7A 5CKGA 3EUDA 3FSWA 4O4YL 5A2BA 1GC1C 4WFHD 3LNFA 4I2XB 2P28B 2G0LA 1YQVL 1F1DA 1PAMA 5EWIH 5H37A 2F5AL 4JRLA 3GZKA 3GSNL 1QI3A 3I9GL 3QFJA 4PJFB 2A6DB 4WWKB 1IJ9A 2GW5A 4MS8D 1T7WA 4AT6A 1N70A 4LIQL 4MA3B 3UXFA 1FVEB 1HHHA 2BOBA 3KPSE 4JHUA 4JHVA 5C07B 1UXMA 4WI9A 3GBMH 3HG1B 1OM3H 3S3JA 3VXTB 2HT3C 1PKQA 3GMQA 4B3VA 3MJ9A 1DSFL 3L9BA 1QVOB 4PJ5A 3S5LA 3H8NA 3NIFB 3MOAL 2NSMA 1SRDA 5LLIC 4XAKE 1NCAL 2EYTB 2OXHA 3JWNH 4HUXB 4PJFF 2OFQA 4Y19A 3H9SE 4KXDA 5EDXA 5IBUB 4M5TA 2A6IB 4UQCA 4V1DE 2F19L 1UUNA 3BCFA 1OAUH 2FATH 2YZ1A 5ICZB 4UT6L 1CN4A 2AFNA 1RZIA 4XBEH 5J11C 5CJXA 3JTSA 5DSCB 4WJG3 2DYPB 3M8OL 1QZ1A 4UM9A 3ZE2B 2DH2A 2IH8A 1IBHA 1SUHA 3NIFF 1TQBB 4BFNA 1HCYA 5E1AA 3RIFF 4E41D 5KVEL 3MRPB 1G4RA 3V52L 4KC3B 2P8MB 5AD0A 2Y1AA 1IZKA 4M6NH 4LGSB 2AGJL 1IARB 1U3ZA 3LPOA 4W9CC 2EILB 2EQDA 4XNQB 3EH2A 5EOTB 1EXUA 3T71A 4L5FE 2VIRB 5HYJB 1OLZA 2GTQA 3X12A 1RIVH 5L7XL 1JWMB 1KBGH 3DTXA 5DQDH 4JQXC 2E27H 3U7YL 3LNGA 3QQ9D 4LGPB 3EOTH 3GMLB 4G6JH 2BNQA 4BGDA 4H8VA 3CVHL 3LEYH 3QO1B 2JELH 1S9WB 1IKOP 4R7DA 4Y4HD 5E1IA 4LRNL 4ODUB 4N1CA 2D3NA 3MV8A 4L3AA 1HHJB 5D7SH 4F91B 4TN9A 3TT1L 3QUZB 3V9EA 5L4JA 3BDBA 2QSTA 4OY9A 4Y9FA 5SX5K 3RWEA 2ZT9C 5E1GA 5LNEA 1MCOH 2QLYA 1DVUA 5CS7A 4XR8C 1JS4A 3IMTA 1MCDA 4FNPA 3F6JA 4NKMB 1NCBH 1RMFL 3LQAH 2F8VA 2WTRA 5D7EA 2MJWA 3JTTB 4QRSB 3QXDA 4GAJH 4WKZB 3UTOA 1Z3RA 1IBGL 3O8XC 1I1AA 2VDQH 1VESA 5TPWL 1CBVL 4DGVL 3TVMB 2DM4A 4YSSA 1T6WA 1WCQA 4BIKA 3S35X 5GXBB 1HKFA 3QQ9C 1T03L 2KMWA 2PUQT 3UH8A 4MXVE 2KHAA 4GQPH 1OT1A 2F8OA 3LNDA 4MXVF 5IQ9A 3BZ4A 3WUWG 5FO8A 3LJ3A 1JK8B 3ESUF 2AJVL 2NPLX 3WFDH 1I8KB 2FJGB 4GFXA 4ZAKD 3NN8B 1IKFL 3UYPA 2XIIA 4HXAH 3KPLA 3QQ4A 4RDBA 2JB5L 1NBVL 5D93C 1AH1A 4PB0H 4N86A 1BZ7B 4NZRL 4QO1B 1KFAL 4Y2OA 3FB7B 5KYYB 1GC1L 3DPDA 2QQLL 3LYRA 3WKYA 1AMYA 4FYRA 3MO1A 1OT2A 4QY8A 1JGUH 5DEGB 5K9JL 4G42A 4OIAA 1DVFB 2I7OA 4B9CA 3SKJH 1QLRA 3DMMD 3RWGB 1XB6A 1MW2A 1IGCL 1QNIA 4QTHA 3T0XA 2FUQA 2KC0A 3ROOB 3I9PA 2ZKXA 5IP4A 1JPFB 4JG0L 1JZIA 1AAJA 3PL6A 4ATTA 2AXWA 2CDGA 4OKVB 3EFFB 3IDMA 4FJYA 5DK2A 3ULVL 1FGVH 2AXGA 4YWGL 1MLBB 1J18A 5CN3A 4GFTB 4HHAB 5T8IA 3LH8A 2X89A 3X1GA 3WJMB 3NFNB 3VJ6A 2BVYA 4IS6B 1IL1A 2XWZA 1RH8A 4MGXA 2VERA 3NSYA 4P5KB 2EUZA 2WB7A 1SHSA 4P2RA 2R9HC 1E6JH 3IAPA 1DUZA 2PP9A 3KPPA 4OZGB 3IDXL 4W93A 3FKUS 1WTGT 3WELA 4R26L 2BP8A 2HJLA 3NH7H 5MEOA 5BZXA 3HCVB 4G8FA 1JJUA 4LCWB 4QOKE 5FUCE 4B60A 1HE7A 3ECUA 1EV2E 2DQDL 3HZVB 2OYPA 1Y6NR 3A6CL 4OZGF 1INEH 3DMMC 4OLZH 4G8GB 2NW3B 4NQUA 3BAXA 5KYUB 3FT4B 4H5SB 2IH3B 2XV2A 2H4EA 3FUDA 3V4PH 3FFCB 4QCIA 3QDJB 4DZBB 1E6OL 5D7IB 1TJXA 4YHYC 4NLAA 3EF7A 4KZEH 4N28A 3O9WC 5B8CC 3F6IA 1D5ZB 4G8GE 2PP8A 4LOVA 2ZAHA 3A4AA 1ND0B 5IFHL 3MJ7B 4L29B 1U3HA 3RIAF 2QGDA 5I0ZA 2I27N 4HD9A 3DBXB 3QDJE 2BSSB 2IWGA 2R1WA 4F2MA 3HMXL 4PJGA 4JM2C 2KT6A 4Y2NA 1C8PA 1OSZB 2DQMA 1A4JA 5DJYA 3VD7A 4F15C 4BHUA 2PNDA 3ILEA 3VG0L 5BOZG 1UENA 1P84K 4YHOH 5FGBC 3DGCR 5JA8B 4OFYD 2D31A 3IJSA 4IRSB 5BPPA 2JB6B 1FJ1A 4LLMA 3KPMA 4NBXB 5B3JF 3OKYA 4N2DA 2UWEB 5CHNA 2MCPL 1DFBL 3T2NH 4S2SA 3LEVH 3L08A 1IGFH 3PABB 2ALWA 3BAKA 2YAPA 4A6YH 3ZR5A 3EYUL 4BH8B 3T6ZA 5EB9A 5T1MA 4XP4H 2DJSA 3CXDL 3TNNA 5MEPB 3SJVA 4HVBA 2OZ4H 4HJJL 5JUEL 5DHXB 1IC7L 4EBQL 2UWEF 2GJ6D 3KCWA 2KZKA 5F7YC 2WNWA 2LR4A 4PR5A 5GRVK 4DNLA 3UBGA 2BOCA 5FYJD 1NUDA 4WI4A 1XCWA 4P05A 4YO0B 5DVPA 3ARED 5PAZA 3U4EB 1GHFL 4ONGL 4CC0A 1EGJH 4PI0A 3WY2A 1BOYA 5JO5B 1O9ZA 3QDAA 5IROD 2OMTA 1JXJA 1JUFB 2BHFA 1AKPA 1FL5A 1EVUA 1L0XA 2VLKA 4PS4L 4YHKH 3D52A 2FUTA 1KGCE 1DQLL 1SF5A 4RQQA 4XE5B 2VDRB 2QMKA 5AVVB 3U30C 3DO7A 4UT9L 2NLJA 3LXCA 1YY8B 3QWNA 4MMYA 4RMVA 2UXTA 4EOWH 2UXFA 3IU3A 3AT9A 4FHBD 2A74C 5F21B 2F7OA 1FN4B 1BBJA 5FS5A 4GJTB 2YIHA 2V7NA 3HHMA 1SN2A 1NC4B 3UJTH 3V7MA 3OPZL 1EH9A 2Y6SD 2R0ZL 1DBAL 4XN8A 5TJWK 2EDEA 3SDAA 4XAWL 4DHLA 5FV1L 1W8OA 4JFYB 4GINA 4JGJA 3S36X 4AQAA 4HIXL 4P5TB 1U8QB 3HPJA 3MLXL 1YEHH 2LTQC 4HEME 1RUKH 1D5BA 1WFJA 3MGTB 4U1KA 2Z4QB 4HXBL 4UF7C 1K3IA 4S1RH 2HA1A 3Q8FA 5F96L 4YHLH 1S3KL 3D0VB 3MV7D 4O02B 1JGLL 2WLKA 3U4KA 4Y9CA 4Y1AB 4YSUA 4PJ8D 4WDIB 3S34H 4F93B 2BIOA 4Q9RH 2WP3T 2V2WB 3PLYA 5ALCH 1JN6B 2IFFL 1HWGB 2PPEA 1BWWA 3FRPG 4UOW1 2YKLH 1JZFA 4PWIA 5DHDA 3PP4H 3VMPA 3DX7A 1KLUB 4WSGA 1CGYA 3CSTA 5LO7A 3O2VL 4JM4H 5E2VH 2GBUA 4FG0A 2PABA 4PB9H 5HDBB 4RX4D 3VH8G 3BIKA 3W9DB 2CIIB 4F7EB 3HAEH 3N0AA 2VR9A 4JFED 2Y6SC 2YJLA 3UTSD 1ADQL 5IB5A 2R7EB 2HMIC 5ALBH 1MZYA 3FH8A 1FHGA 5C6WH 4U6XA 5HDBE 3CU7A 4GEIA 4NJ9H 5HDBF 5LBSH 4KDTA 2V5SA 4MNGB 4W70A 1WBXA 3GLDA 3F58L 3QP3A 4I0PA 5DJ8B 3D3VE 5JHDA 4MHHG 1A1OB 1C7TA 3HTLX 2KDYA 4ZFFB 1ZANL 4GUOA 5HI5D 3WDIA 3MRKA 4ZUWA 4F7MA 1KSRA 2BS71 4PW9A 4NPKA 1PL3A 5DYFA 1WFUA 2OMXB 5CKAA 5JMOC 1NAKL 3UERA 3FQRA 5F1OB 4F7PA 4J1UA 3UYOD 2UYLA 3OGOE 5SX5H 1QI5A 3KJ6L 3FQYA 1DQDL 2QPUA 2DICA 2XTSA 5ITFA 1OP9A 1UWEH 2CO6A 5B1BB 3R7RA 4GAYB 5DMKA 5CP3A 1DEDA 3VWKB 4TF4A 1BEYL 1ID2A 2PKDA 1J05A 2VW6A 2EUWA 3NJGA 3Q2NA 2QGCA 1X5LA 3CSYA 1EHKB 1YYML 1L9OA 3UG5A 1EJFA 3TONA 3ZRCC 1UH4A 4F8QA 2NX5A 3GMRB 1BIIB 2CDEB 3ZE0B 4QJ5B 4GRLB 3UBXA 1ZDSA 4UQAA 1ORQA 4H88L 2ZWSA 3VE0A 1MCWM 4B9KC 3FU0A 4X98A 3BQUD 4AGLA 4NQVA 5DT1L 3MSPA 4X42A 3ULUD 4OD3H 2NXZD 1SFHA 5EZJA 3ZE0E 2DQTL 2EECA 4ZQTA 3GSWB 1ECYA 4LSUL 3ZE0F 2CA4A 2XZZA 5HGAB 3Q5TA 3FL7A 2I9LB 4W6XB 1JFHA 4WEUD 7FABL 1A6PA 1BXVA 4FQXA 3LN5A 1ZHNB 4Y5VA 2ZCKH 3GYRA 4HBCL 1FPTL 1W9XA 5IVZB 3RB5A 4CSZA 1Q8MA 1TQUA 1E27B 4LASL 3AUVA 4JL1A 1KPUA 2P48B 1OAZL 2OJEA 3FDWA 1DR9A 4ECNA 1FHNA 4JHWL 4D0CB 5EC2A 3BUPA 1JNHA 4I9XA 4WEEA 1R4XA 1NIFA 1XCQA 2FJHB 3EYVA 3PWLB 4JDTL 4FADA 4Q0XH 3M7OA 5DJCB 2BC4B 2FSEA 5ABAA 4NNYA 1IILE 1UCBL 3O0RL 4LSTH 3ZO0A 1JHKL 1AO7B 2ARJB 3VXUA 3KLDA 5DD3L 3L5JA 3P9LA 4LARL 5K1VA 2V7HA 1XH3A 2XZCL 4MXQC 1F00I 2WXFA 2VDOB 3EADA 4NZ8A 2QPSA 4P59L 5GISH 1P2CA 3KPTA 3O6KL 1AO7E 1AVAA 3RPBA 3CX5K 3WS3B 4DN4L 4JAMA 5C0FB 4DUWA 4I77H 4NHUA 1EX0A 2I7SA 5CMAB 4GW5B 5KS9B 3SYCA 1DL7L 3QH3A 2R4SL 4JCLA 4F9LA 3Q43A 1D6EB 1D7DA 4OGXL 1BVLB 1F8TL 1W8EA 2MMXA 3WS6A 1HSAA 4I3GA 1R75A 4QHLB 3Q5YA 3C60B 2FWOB 2DTML 1PG7X 2H26B 5TDNB 5KTEH 5ESAB 1U8JA 5KS9E 4IGBC 1U2HA 2ADFL 5KS9F 4MHHI 5E8PB 4D0DB 2WKGA 2FECI 4H26A 4JPIB 5ACZB 4JEGB 3EOAB 3OKMB 4RWYH 3MLPA 2VL5B 4OJFH 4YMPA 1YEDA 4OUOA 1T1YA 3EJZD 3MLYL 2QHLA 4NQTA 1E8YA 1L0QA 1DE4B 4FI6A 1R47A 3EYFB 2OW6A 4KY1L 4M43H 3VD0A 3CVHB 4X7TA 1HTYA 5IBTH 1EJ8A 2XNAB 5HYFA 5IBLD 1MCQA 4BFFA 4N8CH 1IFRA 2PPCA 3HN8A 4RH4A 1D9KB 1ZT1A 5D72H 5FKAB 1GZPA 1ERNA 2WUCH 1AIZA 4Z78A 1FE8H 2Q2LA 2WXJA 1DN0A 2AEPL 4KDVA 1WUNT 4TLSA 5HHMD 4LCCC 3A24A 3BKYL 3OVUB 4ZOCA 2Y7LA 1LDPH 3QJHB 3WLWD 4BSVA 3KBHE 4JVPA 5IVOA 1LEIA 5KYXA 1OW0C 4UUJB 4Z0XA 1WFMA 1F90L 4X0NA 3OX8B 1A14L 4QT5A 4OCRL 5D2NB 4AH2A 3QCUH 1CF1A 3KPSA 2Y06L 4K71C 4X6EA 5INCA 3IB4A 4DKAA 2BO0A 3C8HA 4R9HA 1HEJC 3A6OA 4IBWA 1AMXA 2NY7L 5C9JB 2A77L 3D0LA 4ZFOB 5F3FA 1IE4A 4WWKA 4FNLH 1CVSC 3QUMH 5D2NE 1B0IA 3RX5A 3H9SA 4OAWB 3LB6D 3N3EA 4V1DA 2ZX8A 4UTBH 2QVMA 1J5CA 3SE9L 5T3XD 5FYJH 3VXTA 2AXJA 1N8ZB 1T89C 3LPWA 4YDMA 1NKRA 3W1ZA 4DJMA 5IJCC 4ZFZB 1LVEA 1QVOA 2WQ8A 3DUUB 4G7YH 4LO9A 1I9EA 5ISZA 1ZLEA 1Y0LA 1ZHLB 2EYTA 1J12A 5TQ2L 5INDB 3O6FA 4H7VA 1JZ5A 4L9DA 4HCRL 1A6VH 4AV5A 5CNHA 4P2OD 1IAOB 4KZ0A 1BM7A 4WFED 5H4ZA 2ZUQB 2XSKA 1ODAA 5ICZA 3OQ3B 5I8OH 2DMKA 3GDBA 4RGND 3U9UB 2DWDB 3QEQB 5I6LA 5KZCD 3BKJH 1SJEA 4PP1D 2DYPA 3D08A 1SFDA 2HH0L 4QIRA 1Z5YD 3V8CA 5EUOE 4KAQL 4PGEB 4QRPD 4ZMQA 3MRPA 2FSDA 2ICWB 1VFOA 3NAAH 5AAPA 4G80B 4XVSH 4XN9A 3P3TA 2WXOA 2K7QA 2IOMA 3GBNL 5AW2B 3QEQE 2OTWB 2R0WL 1I1RA 3VD2A 3QFJD 3TX4A 4LBAA 1JDCA 1I7RB 4P2QE 5FW6A 3CZLA 5GRUH 3PY9A 4XNQA 1QASA 4ZUSA 5CBEB 5I73C 2VIRA 2WXKA 4PJ9D 3RHWF 2QFRA 3SE8L 4Z1PA 3VNYA 1JWMA 3SQOL 3X3GL 1WFOA 3RNKA 4F80A 4ISVA 3MCLH 1KIPA 4HHWA 4IRZH 3GMLA 3ULVF 3D06A 4Y19D 4ODSL 3GSXA 4WV1C 1ZSDB 4UZUA 4TUJB 3AFLA 1ETB1 5DMGD 3P30L 3QO1A 3H54A 1S9WA 2KZBA 4M8UA 4L1SA 3RGHA 3PV7A 1M9WA 4QYOB 4Q9QL 2I25N 5F9AC 3V4VH 1JZDC 2HN7B 3V95A 1HHJA 4B3EA 3CZSA 3BGMB 1VEOA 3VFWB 3HS0B 1A7NH 2A9ML 4BFEA 3N1MC 1DBML 2LU5A 1I3GH 1RVFH 1T0MA 3JV5A 2AITA 4A2EA 3IJYA 2OYLA 1LXMA 1TZGH 1E5ZA 1YEEL 2I5YH 3IM1A 5GGVH 4I3RL 4PIBA 3D39B 2YD7A 1CK0L 2G3ZA 5DZVA 4MAYC 2QELA 4XMKH 1NGWB 3U46A 4NI6A 4TQEL 1OAYH 2PF6A 3S2AA 2XZQL 3U0TB 4B9FA 5I75C 3LRLA 3W5NA 4UI2A 2X6BA 1TZIA 2C9XA 1OSEA 1XGUB 5J89A 4AYMC 1E30A 1JERA 4XMPH 4GO6B 1CD1B 5H94A 2FD6H 1VLXA 4ALAL 2FEEI 4FQQB 4DZ8A 4OF3A 4MDJB 2YSSA 1QSEB 1YNLH 4UBDD 1UWYA 4U1MB 5IHZB 3VI3B 2E47A 3MV8D 1KCRH 4E42B 4CGUB 2JJSC 3N44B 3RJDA 2Y3NA 1JDAA 1I8KA 2FJGA 4IJ3C 2ZIDA 2XX0A 4TLUA 2Y23A 1QSEE 5CR1A 5IHUH 4MA7H 1JV5B 4OZ4A 5E6IC 5JZ7D 1QLEL 4KGLA 2NY4D 4QO1A 3VI3F 3FB7A 1P1ZA 4WU7B 5M7QA 3QXAB 1AP2B 3N44F 4Q2ZB 4XCNA 3MBEB 2XWXA 2V9RA 3I6SA 5E00B 1TXKA 3OG4B 1J9QA 3IF1B 3RWGA 3EGSB 2HKAA 3VXME 3IDJA 4BHUI 2LOEA 3ROOA 1BQLL 1JPFA 1BQ5A 3KXFE 4C4BA 1I7ZB 3NA9H 3EFFA 4MRCA 4B5EA 1C9SA 4ABWA 1R5VB 1Z9MA 2BK8A 4IOSD 3V5HA 5DUML 3EYSH 2XI9A 4YUEH 5B38G 3L16A 4BZ2H 3BRDA 4FFWC 4OV5B 4H25A 3QIUC 3K72A 3NFNA 3QDMD 4HUMB 4IS6A 4KTDL 4EDWL 2E7MA 1UG9A 1WIPA 3ULUH 3L3OA 4QOKA 4NP4H 1KT2A 4WCYL 4KKPA 1TUPA 3VD3A 1CICD 1KGYE 3IVKB 4ADIA 3OLIA 4U6HA 2VLJB 1JHLH 4DW2L 1IEAA 5IJBC 3HCVA 1RPUA 2NY4C 1HC1A 1PZSA 2HLAA 2PR4H 5HGBB 4KROB 4I4WB 3GTNA 2XBZA 3JVFC 4UNIA 3RBSA 2CCLA 4ZMVA 1GIGH 1K4DB 3HZVA 1AYRA 1FVCB 3BPNB 4UB0L 2VLJE 3JWDL 4MD4B 3B8YA 3U0PB 5I0YA 1OPGH 4G8GA 1VFBB 3K80A 3FT4A 1JNLL 3V8OA 3QDJA 2X89D 3ARZA 5IVXE 3ASNB 5GIRB 1A1NA 2V5YA 2A9BA 4ZDHB 5IVXF 3WY3A 3OMZA 2NDGA 1JPEA 4G1MB 1M3IA 1X6LA 1T04B 5EF3A 2HKHH 2ARWA 4P2RD 2E9JA 2XV6B 1ND0A 4PEEA 5E4AA 3MGOB 5EU5A 4EN3A 3U0WH 1PQZA 4NC1C 3C8KB 4MA1C 3DBXA 2JQMA 2HVKA 3E38A 1S9VB 5I0XA 1MJ7H 1MQKH 4UOQA 4GKOA 2VISA 4S1QH 3I6KA 1W91A 5CZKA 1S7QA 1QAWA 1ZVYA 1BPLB 2RCSH 3X14B 2OYKA 2G2RA 4YPGA 3A21A 2AXFA 2QVKA 4HZLB 3MGAA 3RTLA 5I1JH 5JHLL 2VB5A 2VM4A 1RPKA 4IRSA 3U25A 2G30A 2OMUB 3LIZH 5CJ8A 1DO6A 4EZMA 1TEGA 2HLFC 5GGSB 3OXRA 4ZW7A 3HVNA 4NUGH 3DX2A 3K91A 2M83A 3LKSA 5AKVA 1I7UA 4PLJD 1OTTD 4OLEA 3P2BA 3EOBB 3EUUA 1DBKH 2I60H 3PABA 4DEPC 3OKLB 1JGEA 3CDGB 4NNPL 1G1OA 4XXDA 4UQDA 3AGVA 4BH8A 3NSXA 4JFTA 3QQDB 4Y5XC 2DQEL 1U3HD 1O7DE 1KYDA 1CDCA 1U8MB 2H47C 4Y16A 2G5RA 3SDCB 1RZKH 4WWPA 1TVDA 5T33L 5FFLA 4HKBB 4LCYB 2FX8H 1CXLA 1NTDA 3NJFA 3K3QA 5DQ9B 1ZLVK 5JO5A 1QR1B 2N7AA 3L3GB 4XT1C 2IAMC 5I1KH 4KK6D 5B1JC 3UAFA 4MDIB 1XR8B 4LU5H 3BAJA 4P3DB 2EO1A 5KVMC 3QJQB 3U6RA 3GHBL 2DMCA 4XNBA 5CJOH 4M4PA 3G5YB 2AEQH 3Q1SL 1YY8A 5T1KD 3DSNB 4BK5A 2ERJC 3ZU8A 1KTJA 2ED6A 4WHTA 1JMXA 4PLJC 4XXCC 2H3NB 1A6UH 4PJIB 1OTTC 1RZPA 5E9DB 2O26U 4KZDH 2CGRH 4KVNH 2QHRL 3ZUCA 4ODXB 4HEMA 3O3UN 5JR1L 1IC1A 3ZE1E 1F11A 5EFIB 2W0FB 3NABL 3E8UL 1MCLA 3APFA 3TS8A 3CFKB 2J88H 4JFYA 1PCSA 1YEFL 4L4VD 5E9DE 3NGBC 1A21A 4M03A 1U8QA 4PJIF 4UZSA 5LN4A 5T3XH 3FB6B 2FJFB 3MGTA 1UA6L 2Z4QA 1O7VA 2XXMB 3ARBC 4PS3A 3D0VA 5CILL 5EORL 3BJ91 3H3KA 5DC4B 5FM5O 3WTXA 5DWPA 2AQ3A 4NQDD 4WDIA 43CAB 2C9PA 5LN8A 2V2WA 2VZ1A 3QXTA 5KOMC 2NT0A 3UBXI 1NDMB 1NFDB 1J1PL 2B77A 4OZIE 1HKLL 3VNZA 4MDRA 4P49A 2LLGA 3BSHA 4GQ9H 2R0LL 4CDGC 2CIKB 2GSGA 4PCSA 4I5BB 4IKLA 4JM0A 3ATFA 5DVKA 2W0LA 2H45A 4ABVA 4YBQD 4FQJH 5H37H 3V6ZB 4HQQH 1HXMB 4KH9A 4GRWE 2VKXA 5DURD 2CIIA 2COVD 3SDAD 1OSYA 4JMNA 4N2NA 4A55A 1HINH 1Z3GH 4RBPK 1QX1A 1WAAE 2V5RA 3D5OF 4HT1H 3D3VA 3DSFL 3P0VH 2Q1EA 2PW1B 4HKJA 1JVKA 1ODUA 2CNYA 3FZUC 1DZ0A 3DDFA 1PY0A 2E59A 3HG3A 1BXXA 2WXHA 1VCBC 1MRDL 2IG2L 4TSAH 4M3HA 2KLSA 4H44C 1XIWB 2YWYA 2GBAA 2EH8H 1A1OA 2WWNA 3NK4A 3QI9D 3A4FA 3OL2A 3UDWA 5GJSL 1JCVA 1S7SA 1NEUA 4XP9H 5AWNL 4YS4A 1D6VL 1YY9D 2NY6B 4DEUA 1MDTA 2VSCA 5J7CC 3RVXC 4PG2A 3ZHNA 1BQHB 2QKSA 3EO0B 2JTYA 5CCGE 2IPTL 3I02B 5D7LB 4LF3B 1BFOA 4MTMA 5BMFL 1JYWA 3LH2H 2FGWL 4XI5C 5SWZB 5I1HL 4AITA 4GAYA 3QJFB 3DVFA 3ZTNL 3VWKA 1T5WA 4LSVH 1T0NB 4MJ5A 1NBZB 2D3LA 1W6LA 5HYSB 4RGMB 4UYPA 3PUCA 4R7LA 5FUZH 4FFTA 1N67A 3KDMA 5KJRH 2GC7C 5SWZE 1RZGA 4WJ5B 3DI2B 3GGWA 1M2OA 5DTFB 4AC2A 1MI5B 3ZQ9A 3GMRA 5E1QA 1IKNA 1HHKB 1KCVL 3VXPB 1I7TB 2Y5EA 4XPBL 5E2UH 1M7XA 5JHDD 3EFDL 3ZRSA 3WEXA 4XVTH 1T2XA 5AUMB 2DLIA 1M6OB 2AKRB 4ZODA 5DYOA 3QI9C 1T83A 2Z31D 3UC0L 4GMSL 1AYOA 3DGGB 4PRBB 4JO2H 5F7WC 4DK5A 2QADD 4L2LA 5IOKA 4IOFD 3N5AA 4W4OA 2DTSA 1XXDC 3L3HB 1H3GA 1EFXD 3G5XB 4PRHE 5GZOD 3IGAB 1C5DA 3QUYB 2DI9A 5T1JA 2FO4A 1ZHNA 4NN6B 4ZNCD 5DVNA 5GS0D 4KRPD 3QZMA 5IVZA 4ZW6A 1RL1A 1E27A 5JOPD 2CRYA 3MRHB 3RUGB 1ZTXE 1RURL 4UDUB 1F18A 4BFIB 5FB8B 2Y9RT 1Q94A 2VN5A 5JW4N 4OD1H 4R4FH 4Z7OE 5E2WL 5TQ0L 4GOSA 4Z7OF 2X2HA 4XNUH 3PWLA 5FYKL 5DJCA 8FABA 1UFUA 2Z92B 2YD6A 3K0WA 2ODIA 3RUGF 3M17A 3L4VA 4PGCA 1AO7A 2ARJA 4K9EL 5CWSB 3DX3A 3FPXA 4CVXB 1DANT 2E7DA 2B59B 2Z31C 1RJLA 2K8MA 2QKIB 3ZYZA 4U1JA 3IMWA 3TT3L 5DR5H 2JMRA 3DPBA 4ZMOA 3QWRD 1A0QL 2Q86A 4PRAB 5B4MD 4IOFC 3E1F1 4U2ZA 3UROR 3BGAA 1ASPA 5IMMA 4JFQA 4NQSA 1HXKA 5CMAA 4GW5A 5FKPB 5KS9A 5FXCH 5IUCA 2XIDA 2AVGA 4XNXL 5E8NB 1WZ1H 5J56B 4PBDA 4HIHA 3U48A 1PZAA 3GI9H 3BX7C 4KRPC 1U4EA 3MV9E 3UPRB 2WLNA 3LZNA 5EWIL 1AC0A 5KWYC 2I32A 2PCYA 2FWOA 3C60A 4XBMA 3RZCB 2H26A 1YNKH 5TDNA 4AJYV 5HVGB 3IDGB 3CQFA 2P24B 2X9WA 3L9YA 4KJQC 1QRND 1UVQB 3BYTA 4JPIA 1OM3L 2DLFH 5EULV 4Y4KB 3EOAA 2V9UA 3GBML 1WS7A 3BD3A 3MLWL 2VL5A 4FG6C 3VXUD 3DX1A 3TWCL 2BIIA 4YXHH 4LFHG 4NC0B 5C09B 1CURA 1T2QH 2QLVB 3P4LA 4MJ6B 2HUEA 5EEUA 5DZAA 3VFMB 1FL6A 1R3HB 2E74C 3BVNA 2QDVA 2BVQA 2UZYB 2NY2B 4IU2B 5AW9B 1AQHA 5C09E 1HSBB 1UXWB 1U91B 4JRXE 2EXTA 2B1AH 5D7KE 2VSKB 2JKSA 3DTUB 1RUQH 3M6DA 1CYWA 2VR4A 2VR6A 4XP5H 4XN7A 5A6MA 5I6XC 4M5ZH 4UUJA 3BP6A 4WNQB 4M6NL 5AW5B 1ZWIB 5HDLA 1HEZB 1OAXL 3TO4C 1GXEA 4IDJH 3EH4B 5D2NA 2FZ3A 4FQCH 1RIVL 15C8L 4JFOB 1BVZA 2XVKA 4YDIH 5KAQF 1KBGL 4FFYH 2ZWZA 5DQDL 5C9JA 4I8DA 3QIWB 4Q56A 4ZFOA 3JUYA 4TOYH 3IRZA 3NZSA 4EPSA 4OJCA 3CHSA 4G7RB 2WSDA 4J39A 4OAWA 4HUWB 2YPLB 2A38A 4PG9A 3LEYL 4JQIA 5EMYA 1TTBA 5D7JB 2JELL 4KI5C 3BT2H 5MI0B 3BZDA 1TDQA 1AD0A 3DUUA 4Q9BA 4L0PB 5F7AA 3WFHB 4FXGB 1ZHLA 4X5LA 1E2VA 1VZGA 3MRRA 1GS7A 1OTUD 2EXYC 3M1CA 3QHZH 5EUOA 1QLEB 2YPLE 4B41A 4F3FB 1V3JA 3G3LA 1YHPA 1AQMA 3WNKA 5FIEA 1PX8A 2BSBA 4MLSA 1AHKA 1MCOL 4OIIH 4PIRF 3U9UA 2WLJA 3I74A 2VQTA 1JF1B 1OIOA 3QEQA 4OLYH 1EBAA 2QFPA 4P2QA 1AGEB 2IMMA 1OCZB 2OR9H 2YXFA 4GP8B 4MLIA 3ERXA 2Y7MA 3KPSD 4PGEA 4DP7X 4I48B 2ICWA 4G80A 1A7PH 4QHKJ 1HI6A 2F58H 5JDSB 4LHJB 4MVBD 3PHAA 3TBCA 4HWZA 2J7LA 3LZFH 1IBYA 1L5GB 1CYGA 4AQ1B 2O61B 3IKCB 5FECB 1UM4H 5CBEA 5BRPA 4LAQL 4P9ML 4UINL 2VOTA 1QBLL 1T2JA 3NCCB 3ARDB 3D7PA 1PSKH 1V7NH 3CFDB 4YLCA 4H4NA 3NCXA 1Q9WA 3NFPB 1FNHA 1MFMA 2DQGH 2TSBA 3IPBA 3VDAA 1JZJA 3WFDL 1Z9SA 1ZOXA 3BEVB 1ZSDA 4HXAL 4P9HC 1U8CA 1V10A 4PVLA 2IBGA 2L4OA 4U4IA 3VWJB 4DSYA 3O6LH 2WUBL 1LO2H 3ALWA 3CDZA 3G5ZA 1QLFB 1ZMYA 4J3TA 4LVNC 5DS2A 3QC6X 3RY6A 4OGQC 1U93A 1FDLL 3MUGB 1MY7A 3OLEA 5IJVB 5G4OA 5D1XB 1UWFA 3GDCA 4NAMA 4IBUA 3JT2A 2NUPB 4C56D 2PYEE 1JGUL 1HAWA 1KCSL 1QSVA 1RZ8B 2DI8A 3VFWA 4FFZA 4KH2A 1JHTB 2NY1B 4LNVA 2MQ3A 4ONFH 2BY2A 4AIEA 1PLGL 3VYNA 1BMGA 5CIPH 3ZPDA 1ONQB 3OBAA 4PWHA 4BQCA 4DQOL 5FFOA 2UV3A 2YSTA 2QBWA 1FGVL 5ENWA 2FT7A 4ICXA 1T20B 3ARGA 1QR4A 5GRXG 1XGUA 3ASWA 3LV3B 5EZLA 2D9QB 2Y7SA 4UT7H 2YPVH 1EEZA 3RWIB 4HFWB 5HI4C 1CD1A 1CU4L 1MUJB 1E6JL 3HMXA 2EDXA 4PJXB 4PRNB 4Z7NB 4MDJA 1QSEA 2RB8A 4KTEH 5HY9B 4OKDA 3OC5A 4Q74A 5EOCL 1U8KB 1RUPH 3FTGB 3FUMA 4JANB 5CLXA 4Z95H 1R3JA 1URIA 2FYYA 2ED8A 4Z7NE 1FFOB 4CADB 4Z7NF 2YUZA 4PJXF 1QFOA 4XCYB 3S35H 4Y2DB 3LHAA 2VZVA 1BF8A 2CUIA 2ZNWA 4PPTA 1CFNB 2PWGA 5AG8A 2DWEB 3B5GA 3VXMA 2E76C 5DK3A 1INEL 2Y5QA 3P77B 4WU7A 3QXAA 3KXFA 4PU2A 1AP2A 1UYWL 2OQJA 4Q2ZA 5T1LB 2BIMA 3BPOB 1RUAH 3MBEA 5E00A 5HYQA 2CU9A 2YLKA 3V4PL 4GSDH 4BK8A 4ADJA 1MF2H 3HB3B 2VLRD 3IGUA 5AOLA 1OSPH 1V27A 2NZIA 1MHEB 4HJSA 1DQJB 1I7ZA 1PEZA 3AWEA 4NEHB 4A38A 1HILA 2F54D 1X5AA 1Y07A 2ZD0A 1FFQA 4FL4C 2AJUL 1KTKE 3LRSB 4RISH 3WE6A 3KS0H 2ATAA 1FO0H 5EN2B 4EUPG 3LS4H 4KKLC 2OSWA 5EOQL 5IKCB 1B0RA 4M7ZB 3BPLB 4LLAA 4U05A 2GK2A 3LVTA 1OAQH 2BLFA 2O5XH 4HOZA 1KWGA 2JCCE 4WNJA 4YHOL 1SY6A 1NCDL 1UD4A 25C8L 2IGFH 4H8WC 4TNFA 2JKWA 2VLJA 5F7UA 5LGHH 3ZOAA 1UCTA 4N6RA 4AZ8A 2BJMH 3WGVB 3MACH 4BWWA 4GSQA 1YJDH 4JFDE 4GNKB 5HGBA 2ROYA 5I19H 4O00A 5GS0H 4UQIM 3TEZA 3LEVL 1IGFL 1HESA 4KUZL 3RWJB 1ZGLB 3MODH 1FVCA 1EHLH 3FTZA 5IVXA 4XX1G 1WQVT 4NO2A 4ZXBA 3HS9A 4A6YL 4K0OA 2WWKO 3TZVC 2B0SL 4XP4L 5AOJA 1SF3A 2IF7A 2P8LB 5L2JA 1RULL 4RGOH 3S6CA 2BM3A 3VD5A 4X5XB 1B2WH 3JV4A 2J21A 3B2VH 4NSKB 1EGJL 1T04A 5T1DH 3WFBH 1AC6A 1LEKB 2NZ1A 2MNWA 4R3SB 2NUTB 4HV8B 4X0KB 2JWYA 4LFHD 1JPST 3C8KA 3SGEI 5FUOL 3RBGA 3VXRB 2AK4D 1BVKA 2OMZB 3B5HA 1G0YR 4YHKL 1S9VA 1THAA 1Z1WA 1NGYB 1F3JB 4RSYA 1LILA 3HOGA 1YQ2A 4A2LA 1BP3B 2FJSA 4W9JC 4AI7A 5J3HD 4EOWL 4B9PA 3B56A 3IMRA 3HRZA 3VXRE 4RAVB 1IBFA 2G5BA 4YQXL 1VF5C 4YIQA 4ICWA 1SXCA 2VT0A 2OMUA 3GWJA 4XNMB 5ESVA 3UJTL 1XGRB 5LCVH 1AZBA 4GUPB 2VDPH 2ZAIA 1ADQA 1J86A 1P5VA 1BD2B 5EIIB 3MDJA 5K5YA 2DLEA 3RVTD 4RFOH 4FS0A 3EOBA 1HZHH 4W9ZA 5GGTA 2J6EH 3OKLA 3BWAB 1P1VA 1A7QH 1JOIA 5FC9A 4PYHA 2KUTA 4PW3A 3QQDA 4OQTA 2F53D 4JR9H 2YD3A 1BLIA 4YHLL 4JGNA 2MKWA 3BMWA 3FCUB 1DN2A 5G4NA 2X4QB 1U4FA 4MA8H 4Q9RL 1R3IL 4H0GA 3TJHD 5ALCL 3NFSL 4HKBA 4LCYA 4ERSH 3BVVA 5DQ9A 4WTQA 3KDPB 3CHPA 4J8QA 4P23B 4JFUA 4PN6A 4X5QA 2RBLA 2WLYA 5GS1A 3WGUB 12E8H 4MDIA 4JM4L 1MVUB 1VFUA 5E2VL 3TA3B 4PB9L 5ICXA 1PZCA 4IKKA 1MREL 4AENA 3NTCH 4E9LA 1ZV9A 2ZP9A 3G5YA 5BZZA 1I3UA 3FNKA 5JTWA 2PWEA 1TZOA 1W0YT 4OZFA 5FDWB 3H42H 3QUHA 1FH5H 5E9DA 1E4KC 2H3NA 5I8CB 5J12B 3MVSA 1BJ1H 3N9GL 2DQ6A 2J8UB 4ODXA 3AY2A 1FBIH 4W9DC 1OP4A 2ZOUA 1BVNP 2ZYSA 5LBSL 4M9OA 5IJKC 4OF6A 4AX3A 5I1IH 3GXDA 3CFKA 3K6OA 1C1EL 4MJ4A 4ES8A 3CLEH 1GKEA 4MCZA 1IVTA 4PP2B 4ODTL 3ZHLA 1F0LA 4MMXA 3VFUA 1RY7B 2Z7ZA 4R0LA 1FNFA 3CPLA 2H3XC 5I1LB 1KYOJ 4OZIA 4G82A 2J8UF 4KKBC 3CFTA 1EMTH 1GJWA 5F7DB 1ACCA 3PGDB 1NUGA 1NIEA 4JZJC 3MLZH 3HC0A 4M1GH 4YK4C 1NCTA 4E0RB 3KE0A 3SZKC 3S36H 4IU3A 2X4RA 4IIQA 3VO0A 1UWEL 3G6AB 5F0MB 5F7NC 3SOBH 5IREA 4NWTH 3NACH 3MUJA 3BUBA 5C3LD 1XO8A 3FUEA 4RWHA 1IFGA 3Q2CA 4B9YA 4B9IA 1I9IH 3ETBJ 2CIKA 2BVTA 4OLUH 1QFWI 3KYNB 4I5BA 2V5TA 2HUHA 1WAAA 3IAQA 4N8PA 1P7BA 5CGYD 4ZMYA 1VACB 2AERT 2OCJA 4LLUB 1CE6B 4QXGH 1BZ8A 5DEFA 3CIAA 1JK9B 2CLVB 2ISDA 3AU1B 5ICYA 3C5ZD 1IC5L 1OY3B 5CN1A 3CUPA 4H40A 3H9ZA 4NN5C 3D9AH 4J3UA 3DV6B 1NEZG 4BKSC 1TJIH 4LSRL 4LVHC 2IAND 2ZG2A 1HAUA 1QPXA 5C70A 4CL7A 2JKRM 3POHA 1AQKH 3MROB 2GEEA 4NM8H 1KY7A 3TBBA 4DKFL 1UM6L 2P5PA 1XMWA 3LNEA 4KTGA 1BLNB 1DJYA 2WVVB 3H3PL 3NJKA 1JZ8A 2XN9B 1JZ4A 3GO1H 1XIWA 4ORZC 1D7BA 1LE5A 4ZS6C 2W9DL 5DD5L 1T80A 2PWFA 1BMZA 3VD4A 4K3EH 4AL8H 3V0AC 3LY6A 1BYPA 1YMMD 3O4LE 3PJSA 5JNYB 4LEOA 3GRGA 1L9QA 4GG6B 1CVRA 3UJIH 3EO0A 3ZQWA 1WWWX 3C6LB 3QC5X 4LF3A 2O5ZL 3NEOA 2JVUA 2XWBB 2GTZB 2WMPA 5SWZA 3SO5A 3B9KB 4APXA 2XQBH 1S7XA 2BVEA 3P54A 3SBWC 3NPSB 1TZHB 4K5PA 3TBSB 2PPDA 3GTTA 1NBZA 4PRDB 5D1ZC 3S9DB 5FA3B 2EO7A 4Q0XL 4GG6F 1QO3B 3E2HC 1CLZL 1WK0A 4LSTL 4PV9A 2VDLH 1NOAA 4M62L 2Z35A 3DIFB 3D2UD 3TCLB 3ABGA 1HHKA 1YECL 1OQXA 1PKOA 3VXPA 4LEXL 3WXVH 3O3AB 1T1XB 4BXVA 1H0DB 4IK6A 1UD6A 4LDLB 4PRHA 4XN4A 3MU3A 5HJGA 2AKRA 4I87A 4LLVA 1XR9B 3JWNE 3KCPA 1MCWW 3CSGA 3HE7D 2WLLB 2H6PB 3MBWA 2L7EA 4Z7VB 2P3YA 3QO0B 3RU8H 2MPVA 4YGVA 3P4NB 2ZSWA 5AAWC 5IB3B 3CMOH 4LP8A 3KGTA 1GS8A 4NXKA 2CBPA 5E99H 4GBXD 3L3HA 2E7LC 2R2CA 3MRQB 5DD1H 3WNJA 4Z7VE 2F0CA 2QTVA 2AQPA 4Z7VF 2EVIA 3SDXB 4ZYKA 3MRHA 1ZXQA 5FB8A 4RWYL 3C6SA 5CZRA 2VXUH 4Y4FC 4BA8A 4TQIA 4XHJC 1PIFA 1WT5A 4P4KC 5KYNA 3D18B 4JDEA 5KN5A 5IBTL 3SDXE 2VZSA 3QCVH 3TPUA 2Z92A 3SDXF 1H15B 5D72L 2NY0B 3IFOB 5JQ6H 5L8KB 2E56A 5CWSA 1BZ9B 1WC7A 4AM0B 1N0LB 5DJAA 3U2SA 3C09C 1N5YH 2B59A 2DDQL 5LGJA 3AWFA 3HE7C 3EHBC 2P46B 2NNFA 4LKCA 4MX7B 1A6AA 2IFGA 1AE6H 3TA4D 1LDPL 1TU2B 4ONHB 4AG4H 1A4AA 1BW8A 3MV9A 5K9KB 3FW6A 1C12A 4GBXC 4A63A 2VRAA 3QFDB 3FTUA 3BPCB 1LMKA 5FKPA 3TBTB 2FNWA 1NBCA 3V0VB 4GS7C 4ZW5A 5E8NA 3MYZA 3T0DA 2A83B 4CKQA 4OF7A 3RB7A 4OJAA 5CEXA 3QCUL 3BFOA 3IXAB 3Q01A 2ZOTA 4KJYB 4RZKA 3MX0A 3ARFB 2V3FA 5EU4B 1OL0A 2NQ3A 5IHHA 3RZCA 2HXAA 5JPMB 5EHFA 5I8EB 5MP6H 2P24A 7PCYA 1YUHA 1KTDB 4FNLL 5L4FA 2OK0H 1UWGL 3QUML 1UVQA 2OPCA 1MHPH 3MRGA 3WENA 1U3YA 3HZYA 5FYJL 4G5ZH 2B4CC 2DMGA 3RPIA 3WHXB 4B0MM 5JIMA 4YFLI 2BVPB 2O6FA 5HHOE 5ID0B 4P46C 3OMNB 4N8VG 1PG7H 5I2IB 1AR1D 5C09A 4MJ6A 4JRXA 1VZIA 3NSFA 2XOTA 4A67A 4F37F 3ABZA 3CFBB 1KMGA 4BZ1H 2ENQA 2ICEC 3RWFA 4QRTB 1MFBH 3HC4H 5L0QC 1GR7A 3JV6B 1MQ8A 2OMVB 1Q9OA 3AXIA 2V17H 4G72B 1OV8A 4GQRA 1CFVH 1KULA 4U0QB 5HYIA 1UXWA 2YAQA 4XGZB 5I74C 1OP3K 2BP0B 3DETD 4WWID 2NY5C 1A7OH 1IU1A 3UG4A 3V7AG 4YE4H 1GGIL 1NLDH 5D70H 2F9BT 1BFSA 1XGPA 4K7PX 1AQ8A 2EABA 2P5WB 1F5WA 1KLFA 1ILSA 2NYYD 4Y0GA 4XMWA 4Z8FH 5GRUL 3MNMA 3N85L 3RL2B 5CU9A 3QIBC 3GJFK 1DVQA 3N06B 5IWLC 2ZXGA 5CEZD 3M1BB 3T0AA 3HBZA 5HVWA 4WFGE 4N5UA 1TYJA 4IRZL 3FO9B 2X4NB 1M1SA 2EDHA 4ESKA 4QRRB 2EZ0D 1UUSA 3FQXB 4Z3TA 2BFGA 5I17A 4NCDA 4AUUA 1DCLA 1NC2B 1RJYB 2YPLA 4XB7A 4Z6AT 2Z1KA 1A25A 1QNZH 2BNUB 2ED7A 2FBRA 2UY7A 3FT3A 3QPXL 3NCEB 3QAZB 3WEBA 2YGPA 4CW1A 1TTCA 3NRPA 3V4VL 4JO1H 1R3KA 2FWUA 3ABMB 3K4AA 4HC1L 2WLZA 3RGVB 4QRRE 3U1PA 4FXGA 3WFHA 1CXKA 1HXYA 3CDCA 5I1GH 2F18A 1X5ZA 3ZTJH 4AEIH 3HNSH 1WV7T 5J9PB 2YEZA 2CO3A 4JN2A 5GGVL 4PCTA 2N4IA 4M6ML 3V4PB 4FA6A 3DVNB 5DF0A 4HALA 1DLHA 1W72L 1OAYL 4MMZC 4I48A 2VR3A 4X4YB 3DJ9A 1INQB 5DLML 1R3LB 5JDSA 5L88H 4UDTB 5H4YA 4XODA 4ZTOL 3D25B 4H8PA 4DN3H 1L5GA 3BGFB 4XMPL 4AQ1A 1GOHA 5FECA 2FD6L 1ZA3A 1HDMA 3PAVA 1OGAD 4MJIB 5I66B 5LAXB 1IX2A 1RU9H 1U92B 1KCRL 2XQYG 1KIQA 5TE4L 3NFPA 2DQCL 1DDHB 3GPSA 2DQUL 4JFPA 1RPQA 1G6VK 1MCKA 1ZIBA 3BEVA 3OZ9L 3T4AC 5FO9B 1JYNA 4LL4A 4G8EA 2WXRA 2PYEA 4U4BA 2D7TH 4IEFB 3OMIB 1KTBA 4P0DA 5IHUL 2HAZA 3UYRH 1DUYA 3HUJE 1PG7W 2EIEA 2TSAA 2ZSVA 1V3LA 4F9PA 4P2QD 5F6IB 4H1LA 4HKZB 3MUGA 2VN4A 2IQAB 1F86A 4FNUA 2NUPA 3APMA 3OC8A 2DYRB 1CQYA 4L9LA 4PMEA 1ZGLM 4A6YB 1ZA6A 4X4ZA 2WB1A 4BA0A 4ZPTB 4K23L 3FJTA 3SGEH 3WLBB 4M7JH 2WBJD 3MXWH 2Q0ZX 2EIDA 1QSFE 2PO6B 1NCCL 2B4CL 4LDCA 5BW7C 3SDDB 1DQMH 3CN3A 4RCAA 3T3MB 2IADB 3EYSL 2HFGH 4HBQA 1BOGA 3B9EA 3D48R 4YUEL 4K5MA 4LVOB 4BZ2L 4IQHA 4O2FB 2Z0BA 3LV3A 4XXWA 4FXKC 5A6IA 3OSVA 2AJZB 1MHCA 3ULUL 5LVEA 3J7HA 4IMKC 2XICA 2C8NA 2IOIA 5GZNA 4ODWA 3T3ME 1CL7I 3T6XA 3TN0C 4DP5X 4HCFA 1YPZE 4K8RL 1AG0A 1J9SA 1X7QA 4L3EB 4WLCA 3T3MF 4ES9A 2H2PD 1E2ZA 1YPZF 3PPSA 1IM9A 1DQVA 4HS6A 3PP3K 1MG2C 1QD0A 3BWUC 4Y89A 2BFVH 2PR4L 2H9GB 2QV4A 1FFOA 1IGTB 2ZOKA 1G7LB 4CADA 2WINB 1U8IB 1GJIA 2ITCB 3B2UC 4Y2DA 1JVOA 2C3HA 2DWEA 3S3BB 1OPGL 4R2GD 2VDNH 1TR7A 3BAEH 2CKNA 3V0FA 2WBJC 4JKPL 1L7IH 3QNFA 2ICCA 4PRID 4NWUH 2E6JA 3PRZA 4GKZB 5CINL 5DZOA 4JZNB 2E86A 3BN3B 4FP8H 2IDSA 3D4CA 3ASOB 4FQIH 5BO1H 2HKHL 3OJDB 1QA9B 4DCQA 5TDPB 1NCWL 3OHXB 2V37A 1J8HE 4O51A 4X2UA 3RVVD 2JCCA 4E9VA 1WHPA 2R8SH 5ADPH 3GSQB 5EN2A 3B9AA 4C83B 3DUSB 1NJ9B 3P3YA 4JREC 2WLIB 1MJ7L 4HJ0C 5FWQA 2BX5A 3CZJA 2GG1A 3RNQB 4EUPH 3MA9L 4S1QL 3WCYA 3S4SG 3PWNB 2H2PC 2DD8L 1T3FA 2FL5B 4JFDA 2EDYA 5I1JL 3LAFA 3FSOA 4K7PY 3TFKC 5BCAA 3S88H 3VXMD 1NA8A 2PCXA 1GYVA 4BQ9A 2ADIB 3LIZL 4N25A 2H8PB 3HAEB 4F8LA 1NGXA 5HHPB 4CMHB 4YC2C 3WTWA 4AYFA 4NUGL 4E41E 1DEEB 2YN5A 5SV3A 1TMQA 4KK8D 1DBKL 1MFUA 1Q72H 3LH9A 1ZGLA 1E9PB 2R23A 4JHAL 5HPOA 3ULAB 1MWAA 4Y7MA 2HT4C 4M1DL 3QPKA 1J8KA 3MFGB