3KLQA

Crystal structure of the minor pilin fctb from streptococcus pyogenes 90/306s
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
137
structure length
137
Chain Sequence
STVQTSISVENVLERAGDSTPFSVALESIDAMKTIEEITIAGSGKASFSPLTFTTVGQYTYRVYQKPSQNKDYQADTTVFDVLVYVTYDEDGTLVAKVISRRAGDEEKSAITFKPKRLVKPIPPRQPDFPKTPLPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the minor pilin FctB reveals determinants of Group A streptococcal pilus anchoring
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
molecule keywords Putative pilus anchoring protein
total genus 18
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12892 FctA Spy0128-like isopeptide containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3klqA01
3KLQA 3B2MA 3GLDA 3GLEA
chains in the Genus database with same CATH superfamily
5LGJA 3TLRA 4ELMA 2JKLA 4KVCL 1N5AA 5GZNC 5AVUB 2OMNA 4PJ8D 3D18B 1J87A 2HTKC 4H8VA 1RV6X 1NMCC 2F54A 5FYJU 1I1AC 3WAKA 3FT2B 4TN9A 3GI9H 3FZUC 5KSAA 2ZP8A 5AYTA 4GI8A 4J3OF 5F0PB 5AOIA 2LV4A 2CO1A 3FCSA 3KGSA 1IGFL 4ADGA 4PN6A 2R4SH 4EF3A 1B3JA 2FVNA 1Q8MA 1H0DB 3HHMA 1DR9A 5B1AB 3LS4L 4P2OB 4ZW7A 2WWNA 2BNUB 3T6XA 1FHGA 2R0KH 1OGAA 5HGHA 1LHZA 3OTTA 4TTDD 4E42B 2AI0L 1EMTL 2X41A 3N55A 4ODUA 1X4YA 2WLLA 5ENWB 3GMRA 3VJ6B 1O6VA 3IJSA 2VLKB 1T1ZB 1OAZH 4Q0XL 5DMYA 1NCBH 3EDKA 4PJ9C 2IADA 2UZIL 3CHXA 5TE6L 5FGBA 4YO0B 4JFFB 2JTYA 2P26A 4A6YB 2YD6A 4QXVA 3IXAA 1DVQA 1LE9A 1KB9J 5F7HA 3VQ1C 5KVDE 5EU5A 2PUQT 2QPSA 4LOVA 2ZXAA 5SWQA 4Q9QL 1ZLWH 2IG2L 4KQ4L 3QPKA 4MB3A 4HKXA 4C54A 4R0LB 1CI3M 1MIML 2YQBA 2W65B 3AXLA 1X7SA 3GMQB 4RSVA 4QPEA 5EBMA 3TBSB 2UZXA 1CFSA 3L2MA 4HJIA 3S8GB 2DWDA 1XGRB 2FJFA 4HIIB 4ENEC 1TJIL 4HG4J 4LSSH 5EF3A 4KKCC 2WVUA 1ZJAA 2DTMH 4YLCA 4NC0B 1XIWA 3BQUB 4CU8A 4FP8H 5BW7A 3ARDB 3MRFA 1E5YA 1E6OH 1HHKA 2X2IA 3BX7C 2KDGA 5H4YA 2IPKA 3EG9B 3QQNA 2ZSVA 2BOCB 4MAUH 3COOA 3CZKA 1PIFA 1ASQA 4R3SA 3QCVL 5D7IA 4GSXA 4X6CA 4RGMC 3QE5A 3MV9A 1FNHA 2UZIH 1JFHA 3QZBA 4F9PC 1TQSA 2OMTA 4YHKH 2A83A 4QY8A 4HIXL 1RPQA 2AAAA 4LGRB 2WY3B 3M1BA 1MQ8A 1FGVH 1O0VA 3AITA 3HA0A 3RQ3A 2GPZA 3OWRA 3QRGH 3HC0B 4ANWA 3AY2A 1EAPB 4QO1B 4XBGB 2AK4D 3H3BC 4FKHA 4QOKA 4WU5B 1SJEA 3T4AB 4FQ1H 2IMNA 3ZYZA 5IUSA 3C5JA 5KS9E 5C0BB 2DJ4A 1TZIA 2W88A 4JJOA 3BD3A 2NY1B 4OJAA 3F65A 3IBEA 1QRNE 4BDVA 1OGTB 2RD0A 4HLJA 5GZNA 3ZYIA 5DJ0A 2APVA 3AC0A 5DD3L 5B3JE 4ZTPL 3ZO0A 1KXHA 5LGKA 1GGBH 1AGCB 4R2GB 3KWTA 2ZCKL 3CZNA 4TUKH 5IW6A 2JKNA 4MMYA 2FJSA 3B9DA 2Y1AA 3WNOA 2X88A 4LSRH 4PV1C 2IBGA 2R51A 3Q7JA 3P0YL 4IKIA 2OQJA 4M56A 4V2BA 1FBIL 3Q8CA 2BSED 3U46B 4YWGL 5JHDA 3SYCA 2XI9A 43C9A 4MCZB 4MDIA 2NW3A 1ZT4B 2HX7A 1NUGA 4KRPC 4CKVX 4GBXC 4WSJA 4FDWA 2O5XH 3HNSL 1M56B 4NZTL 3LKNA 2YQ3A 4QRUB 2O61B 1ZWIB 1JK9A 5CLZA 4JK0D 1TFHA 3DX8B 1AR1B 1IGCL 1XO8A 2GTZB 4FJZA 4XBMA 5HGDA 1WBXA 4IU3A 5DUJA 5EPMA 4KXZH 1KCRL 1QKZL 4RMRA 2VIRB 4XMKL 4WEMB 4W9GC 5KYYB 1AO7D 1TJHH 4FG2A 4QT5B 4XMZA 5C2BL 3WMPA 4AH2A 4A7UA 3PPEA 4MJID 4G5ZH 1H9DA 1YPZE 3G9AB 5L4MA 4N24A 4MQ7B 4P8QA 3BO8B 4X8JA 2XN9D 3ZTNH 1CDGA 3BI9X 5IQ7L 2QGDA 1MCSA 2JI2A 5DD3H 2Y9RT 3HE6B 1NEZB 3IPBA 3T0DA 5K59F 4N2FA 3QUZC 2CPCA 2EH8H 1R3KB 2P80A 4L1HA 4GFXA 5IV2B 4YUEH 5HD8D 3DMMA 4WENB 2E6JA 4FXTA 2GY5A 3OAYH 3O6KL 3H2PA 3X1GA 1TZ8A 5HGAB 2CBMA 1BVLB 2C3HA 3AY4C 4R7NA 3T2PA 1USZA 3LXCA 3P4NA 3RY6C 1I8MB 5JIMA 2R2EB 3ULAB 2HWZL 3DVIA 2NUPB 3NOIA 5KZCB 2F58H 1IM9A 5ADPH 1EDHA 3LIUA 3VGBA 3Q44A 5I1IL 3HNVH 4RGOL 3GMPB 2R8SH 1E28B 2NR6D 2E9GA 2IQAA 3WS6A 3MLWL 1B4LA 1T04A 1OT2A 2X6MA 2P45B 3DUSB 3OV6A 1NGXA 1HQ4A 2PYED 4JJHA 3VNZA 3DARA 4L5FH 4CILA 2OK0H 5KANI 5DVMA 2YD4A 2XZAH 5C2BH 1XGQA 4RISL 5G5DB 2FWOB 1ILSA 5C0CB 1F2QA 1XF3A 5JXED 3ZTNL 1SLUA 4HPYL 1BPLB 2CDFB 1VDGA 1HYSD 2EDRA 4LVNB 4UU9B 3TNMB 1KGCE 4P48A 2JLPA 4Z95L 5E4AA 1DHKA 3QZWA 3QWOB 2DQIH 2Y69B 5E2VL 5HDQH 3GINA 2ZICA 1DZBA 2FBJH 4G1EB 4M5YL 3L4YA 5I1GH 1S7XA 4H20H 3MNWB 1MJJA 4I7ZC 1E4XH 4EN3C 4PLNC 2EKSB 3VG0L 1TQTA 1XH0A 3GXFA 2YZ1A 4RX4D 5KYUB 2Y1VA 2Y2WA 4K23H 1H0DA 1F6AB 3BVDB 5JIPA 3CZJA 2N56A 1JRHH 3NPSB 3WFBL 5I1HH 4MS6A 1K4DA 1FL3A 1FNSH 1XCWA 2DLFH 5KSUA 2X89A 4L3CA 5KBMA 2NX5D 2W1NA 1DUZB 5HXMA 2V5RA 4GSDH 2J55A 4WEBH 5SWZB 2Q86B 1YYLL 5AAPA 2YPVL 3QJHA 2GIXA 2B1OA 4AG4H 2QELA 3J8F7 4XWOC 1P6WA 2H5UA 5ICZB 4HGMA 1R6VA 4GRMA 4EUPA 5CU5A 1EFXA 3C5ZC 4PS7A 4XTRD 2GK0B 3IXAB 3SOTA 3QIWD 1UXSA 1J5OL 2BOLA 1E5CA 1Y0LA 3H0TA 1DVYA 4L8SA 4ZQTA 5I23A 3ETTA 1CFQA 5BS0E 2SEBA 3TYGL 3CN2A 2WLMA 4OZ4B 2IH9A 1RVFL 3Q6GH 4OB5L 2FEDD 4NQCB 4RFEA 2GJ6E 2FWUA 2Z31C 3RVWC 1C7SA 1S8DB 3ECBB 3K8KA 3HFML 3MLPA 4GAYA 5E2VH 4HWNA 1CFSB 1WPCA 4DGYL 1PJ9A 3JWDC 4CU7A 4BQ6A 1G94A 3WTVA 1R1CA 3LEXB 4DPRA 4Z7VF 2C3VA 4HAKA 4WRLA 1JVOA 4ETQA 3P4MB 1K8DB 2OR8A 1HZHL 4WUUE 3IU3A 5T3XH 2UY7B 4WHTB 3X3GL 3PPSA 3VW3H 2EUVA 3ARED 2UWEB 5BXFB 1KCVH 1K2DB 2Q2EB 5TH2B 1EO5A 3PV6B 3UH8A 1YEIL 5BZWA 4BRVA 3DV6A 3U6RB 1IM3D 1ET8A 3P4OA 1ASOA 1AGEA 1OAKH 1IZJA 1TIUA 2E9WA 2Q3ZA 3CXHJ 4KI5C 2NR6C 2CA4A 1OVZA 5I1LA 1A7RH 4X98B 3DOIA 2NDFA 5E99L 4S2SB 1ODUA 4CBPA 1KCSL 1RURL 1O6SA 3DJ9A 3QCUH 4AQ1B 5JW5B 4KK9C 3WBDA 2K6ZA 3DIDA 4X6EA 4FZEH 4ELKB 5SWZD 4ZSOE 3A67H 3LRSB 2X2YA 5C0BA 1FPTH 4JR9H 2R1XA 2HP4A 1OPGL 4BA8A 2WLNA 4NPKA 1KJ2H 2DQDL 4XCEA 4AK2A 2JE8A 4F9LA 2AQPA 1E6JL 4W9KC 3CH1A 4WGKA 4BFIA 1CVRA 2QQNL 1GW6A 4RFOH 1OW0A 3KWVA 2IH1B 2CGYA 3BPOC 3DTUB 3O11A 4FFTA 5IFJB 1NPUA 3CFEB 1AGCA 4DHLA 4AL8C 5L8KB 4OSUH 2YGNA 1E27A 1SGKA 3QG6A 5IW3A 2X44D 1MJ7L 1SQMA 5ANMA 1FFOA 4HT1L 3JT0A 1P4IL 4NN5C 5DK3A 3RDTB 3QZNA 3LVTA 1XL4A 4F3FB 3SYPA 1JVLA 1QD0A 2EXWC 3EFFA 5C0EA 3DO7A 3JV6B 5DZOA 4YX2L 1I8KA 4B27A 3ORJA 4AGLA 2HFEA 4U1SA 2E4TA 3DHPA 5LN8A 3FB5A 2YN5A 4JG0L 4UV7L 3OKLB 5K1VA 3SD2A 4JCMA 3IGAB 4M9OA 3T0EA 1DVFA 1W15A 1DP0A 1MWOA 5E99H 4DP8X 3H8NA 1T22A 3VRJA 4MA7H 3KGRA 4XMLL 4Z7UF 1RZGA 2C9RA 4PTTA 4UMGA 3EADA 4RNRB 4ECNA 4HHAA 5BV7H 3A67L 1BHGA 3FT4B 1EZVX 2X4OA 4NFDA 1NFKA 3TN0D 1CFNB 1SRDA 4AGMA 3WXVH 4DK6A 4HCIA 4QRSA 3NABH 1JF1A 2YD8A 2MEJB 2Z8VC 3D1MC 1JF5A 4LNRB 3X12A 1F4WH 2VDKL 1RUQH 1UGKA 3EJJX 3OZ9L 1BGXH 1IGIL 3A6BH 3FTSA 4HWZA 4J3OD 3FUDA 3L3IB 2FATH 1DLHB 1ZGLP 1RZPA 3Q8AA 4NP4L 3NIFE 2ZWKA 3VTMA 4UNVA 1S6NA 5C0GA 3KGTA 5E6IA 4M1DH 4TNGA 1TFPA 5DEZA 3UZVB 1I4FA 2P5ED 4AIOA 1T0MA 3PDOB 5H35B 1TNMA 3NJGA 3BH4A 4XNYH 5JPMC 1AR1C 3CWGA 1MRDH 4FFZH 4J28A 5HVHC 4OFYD 2X1WL 4NHCH 4AYEC 5CEZL 1YUHB 4APQD 2G5BB 1OT1A 2G3ZA 4XP9L 1T2XA 1BQSA 1N4XL 1PLGH 2VXVL 3SQOL 4F93B 5IBUB 4R4FL 3R7RA 5JORA 4D0CB 4F7PB 5IVXF 3QSKB 1HH9B 1WP6A 2VE6A 4HWBL 1G7LA 2YAQA 1WO2A 1TJIH 4KK8D 5F7KC 5JQ6L 5H37H 3HLAA 4LAJH 1BFOA 3SE6A 1BZEA 3P9MA 4QRPE 4JHUA 3HMXH 4KTDL 5BRPA 3HAEH 4UQCA 2H6PA 5KVDH 3ILEA 3LN4A 5D70H 1MJUL 1N10A 3OB0H 4L9LB 1ZPUA 4FFYL 1T7XA 3U4EB 3NQIA 2O5NA 5IW6B 2QLYA 3PRZA 4EIZC 3MRRA 3KWXA 4X42A 1GPOL 2PWHA 3EGXA 4G43A 4JFYB 4G70B 4N6QA 3M17A 2YD2A 2EABA 1FO0A 2FJUB 1D7CA 2PR4L 2OQJB 3OAZK 4P57A 4NB7A 4V2CB 3PWNA 3QUZA 5FLVA 3PGDB 2QSVA 4YDJB 4D3CL 4XNUH 2J12B 2ITCA 2B1HH 4G8GE 5DJYA 3KPRA 4A2EA 1GGIH 4L8SC 1BZQK 4A6YL 4X5XB 3T0EE 4YHML 4F8LA 1F42A 2PCYA 4Y5XA 3PGCB 1L0QA 2WKOA 4ETYA 4KFMA 4Q6IB 3E3QC 1CYWA 3DK0A 5E5LA 3DWTA 1YMHB 2OXHB 3O2VH 1R0AH 3UO1L 4XP4H 2ZUVA 3FQ4A 3SSGA 3BAKA 3KM1A 4YXKH 5KSUB 5T3ZH 5IQ9B 2PYFB 1FI8C 1KZYA 3MHZA 3QNYB 1USQA 3UACA 1FH5L 2NZIA 3VH8G 2C1OA 3BVVA 1KXTB 1WWCA 3BIAX 2R0LH 5HI5C 2V0AA 4N9GB 3OKYA 1T1WA 4HUXA 3FSOA 1G6RB 1IT9L 3ZL2A 1X7QA 3EYQC 4X6FB 3TWCH 4RQQA 3FFDA 3DTDA 4GAGH 3JWDL 5G4OA 1UA6H 4TNFA 2KL6A 4DO6A 1YNTB 3VGDA 4MJ5A 3M8OH 3LQMA 2OMXB 1T5KA 2LU3A 3LXBA 4G42A 4IIQC 1KNOA 3I3DA 5JR1H 5GRWA 3GMLA 3IDXL 3FAWA 3AWEA 3UGUA 3F5WA 3NT0A 3OB0K 1F4YH 4GAYB 3ZGIA 3DHJA 2CLZB 4XCFH 1H15B 1GYVA 2R0WL 5D2LA 1N8OE 3AUWB 4KRLB 2NNXA 4OCLC 3MBEB 1T04B 1SBBA 5DVNA 1TTRA 1CE6A 3P40A 4NDMB 1TJHL 2EXYC 5GZND 2O5YL 3QJQB 3SY6A 1AHWB 2FZ3A 3EJCA 4LXFA 5E2UL 4OZIE 1V7ML 3OR6A 3H9SB 2ID5A 4LAQL 4O2EB 2NNCA 2YPLB 5CIPH 4YXLL 1ROWA 2FSDA 2XYBA 2VTFA 2CBPA 3GI8H 1TITA 3UAFA 4CNIA 4AYMC 2Z31B 3GRGA 1A6AB 3C09C 2ICWA 4UILL 4Z78B 4N1EA 4WHYH 3HZKA 1RZJC 4P23B 4XPHL 3OF6D 2WNXA 5AW6B 5DJXA 3LPPA 4ZMOA 1E9QB 3CZFB 4IDLA 4P23C 4LEOB 3UBXG 1FL5A 4NQDB 3LRSA 4GRWH 3PJNA 3HRZC 2V2TB 1BD2B 2G4GA 4HIHA 3M7OA 5AG9A 2OMZB 1COBA 3P73B 1PCSA 1MCNA 1CDCA 4Y4HC 4AEFA 4PJHF 2IH3A 3GBNH 3RGVD 3JVGC 4BE6A 3IGFA 2CJUH 1D6EA 1SMDA 3VFRA 5ID0B 3S3BB 1V7NH 2D0HA 5IMMB 3T3PF 1HS6A 3DYMA 3T2OA 2DH2A 2VR9A 1JBJA 1N12A 1BZDA 4N5EC 3ESNA 2OW7A 4WY7L 1FFOB 2F5BL 2PW2A 4ONHA 1HHIB 4Q9QH 1N18A 1K72A 4WO4D 4XN5A 5DJ8A 1U92A 4S1SH 4U6YA 1EEZA 1EMTH 1AXTH 2GEQA 5IVXB 1R24B 1J9SA 1VZHA 2YD9A 3FT0A 1CYGA 3OKLA 4NQQA 2J1XA 1EO8H 4Z7NB 4JPVH 1NIFA 2FBJL 4LU5L 1CTNA 3TH2T 1GW0A 2R56H 1GGYA 3ZK0A 5DT1H 4WCYH 2F5AH 1LE5A 1WEJL 3OKKB 1N59B 5LO7A 4N1HB 3WIFA 3AS0A 1QATA 4X4YB 3L5WA 2DLIA 3KH4A 3L4WA 5IVOA 3LSOA 4PD4K 2J6EA 2EADA 4TUOB 3OF6A 5EF2A 1Z2KA 3RWDA 2NSMA 1E0OB 1E4JA 3T08A 4MLSA 5ICYA 3HE7D 4JRWA 2WJ5A 4U1JA 2HFGL 4ZS6C 4GUQA 3OXSA 3EO9H 3INUH 5TH2A 5HHNA 1T0NB 1IJ9A 4AV5A 1BM3H 5KYWB 1URLA 1T5XB 1X5GA 2W91A 2X9ZA 3L45A 4KY1L 5GGRA 2HVBA 1MXGA 2HMIC 1BP3B 4LPCA 3JXAA 1V3LA 1AY1L 3PWVA 1SMAA 4YGVA 1I9RL 5D6CA 1O6TA 1FVDB 1ZLVK 2F74A 1IAIM 3CSTA 3NSFA 4BKTC 5JW5A 3KEHA 5AB2A 4MS8C 1QR1A 5JW3L 1UXLA 5GIRA 4OB5H 1L7TH 3FU7A 4FQHB 3LHPL 4DJMA 1BZ9B 3ABZA 5IT2H 4MZIA 5KW9L 2EVGA 3FOMA 3ELQA 3KLLA 3MLRL 2QMJA 4H13C 4NERA 3AABA 1UXMA 3REVA 4JQVC 2C1PA 3O3DB 1JNLL 2BSEA 4C4KO 1QYGH 1KTRL 5CR1A 3ZYOA 1U3HB 3RB7A 1UWEL 2VLLA 1I9IL 3GNMH 1UZ8B 4P2RE 2ESVA 4EQ3A 4JB9H 3JUYA 4LHQB 1D2PA 3VFGH 6TAAA 2UZYB 3L95A 2K0RA 4Y9EA 4GUPA 1IMHC 4A7QA 4JZJB 2XTJC 3EGDB 5FS5A 4JUTA 3RJQB 1FZMA 3BZFA 3PWNB 1CFVL 3IDIB 3QUZB 2B08A 3OKOA 3G5WA 1QWHA 4KFZC 4DZ8B 5I18H 4JQXA 4GW5A 4FABL 4X9HA 4PJGB 4F1SA 1L4IA 1JJUA 3H6AA 3KPRB 1A6UH 4NN7C 5J5EA 3FN3A 2DMGA 2BIMA 1NWPA 5FHBH 3CG8A 1X7TA 3S88L 2HKAA 3A3YB 3GSWA 3PP3H 3SE9H 2FL5A 1WTGT 3C9NB 4BZYA 3FTYA 1S7RB 2J57A 1TJGH 3B56A 3NJJA 2QJDA 4NC2B 4X9BA 3C5SA 5FGBC 1PY9A 4F91B 2QHRH 4XNQA 4XPAL 3L9RA 1T83A 3LHPH 4FMFA 4OCRH 1ET7A 1TQVA 4NRYB 3AU0A 4TLTA 2ZOKB 3K4AA 1M6OA 2ODIA 3F58L 1P0SE 1JWUB 5GS0L 1FVEB 2OSYA 5JW4Q 1VGKA 4N86A 3RAJH 1DQDH 4AYFB 2ZJSH 2D3VA 3U1QA 4OZHF 1ZT1B 2YKLL 5DMKA 4YPGB 1UACL 3KBEA 3PP4H 1NINA 4PJ5D 1H5BA 2DLTA 1XHHA 1F1GA 1QRNA 5F9WC 4RRPG 4HLZH 3H3PL 2XKNA 4QHNB 2WZ0A 4RMUA 4Z76B 1U6AH 2PTTA 4BZ1L 4J6RL 5IF0B 1AKJD 1T1YB 3OXRA 2ERJC 2Y6SC 5TF1H 1BG1A 4JFTA 1HHHB 1ZSHA 4AIXA 4PWFA 3MA7B 1E9PB 2IGFH 4OGXH 3L3GA 1YN6A 2PW1B 4HMEA 3NIDE 2EH8L 1OP5K 3WGVB 4FFWC 1V05A 2CO3A 2WP3T 5D7KE 3CPUA 3GRWA 1AYOA 3OKMB 4ODTL 2XBZA 2ZCLL 4PGCA 3CLWA 4UQ3B 2ICEB 3UZQB 2VE6B 4MXQC 2BIQA 3W38A 2E7DA 4NJAH 5EMYA 5CWSA 1LM8V 1AVAA 3VI3E 3LEYL 3RDTC 4F7EA 2W0KA 1UT2A 4Y0GA 5F8QC 4OCRL 2ZUYA 1PPIA 1IAKB 3ZW3A 5TFSL 2CCVA 4NEHB 4Q89A 1JE6A 1F4WL 4HJUA 4HETA 2F8IA 4I3SH 3WLBA 5L9DL 1XTLA 3T9WA 4DESA 4J23A 4L1TA 1NMCB 3SPHA 2VR8A 2NNRA 3K6DA 1PZCA 3L5HA 5F7BA 5CEYB 4YDKL 4X4XB 1PBYA 2R15A 4Y16B 5EU6D 5F7FA 3GDCA 2Z0UA 1X5IA 2Q1EA 4YDJA 5BZZA 3MLSL 3WEXB 2X9YA 5A2FA 1OF2A 4FQLH 4A7SA 4FQ2L 3BAIA 5D7LA 3NPZB 3NIDF 5AOZA 1J11A 1N7MH 1HESA 3DNKA 3O2DH 3PWJB 2CIKA 4UTAA 5F9JB 1OTUD 4NQDA 5JZ7C 1ADQA 3A6CL 3MBEC 5FDYA 3G5XB 2DLFL 3MC0A 3QORD 3RKDD 1A8JH 2EC8A 5IMLB 2IDTA 2OXHA 3OKNB 5KTEH 1JGUL 1KLFB 1EFXD 1YYML 2XN0A 2BNRE 4OCWH 3RVTC 1KCWA 4LDLB 4N8CH 5JW4N 5ANHA 1KGUA 4GAAA 4S1DC 4ODHL 3VE0B 3UJJH 5FK9A 1MCPL 4B6ZA 4FJ6A 4JS7A 4M5YH 1ESOA 4BQ9A 1RJCA 4LLYB 4C83B 2VQ1B 2ZCHH 4KTGA 1JWSB 3ZT7A 3BFWA 3MRJA 1EUUA 4OCNC 5C0CD 2KLTA 4BQBA 8FABA 4DN3L 2VL5B 2W38A 3TIEA 2FQDA 4IS6B 5JA9A 3DSFH 4K55A 4LGPB 1YNTA 1NAMA 2BY0A 2F1AA 1KFGA 3DSNB 4B9FA 1TZIB 4J3SA 3JZ7A 2P8MB 3E6HA 5KSBB 2WLHA 4MNQA 2Y36H 5DJ0B 3V10A 3WS6C 1YYLH 5IHBA 1QRND 3LN9A 2UXFA 1JPEA 2L3BA 4ZQKB 1C12A 1HXYA 4XR8C 5JW4R 3VJ6A 4CVXA 1G7PB 3EO0B 1GKEA 3ELAT 1OXYA 4RDBA 4NUJB 4ZOCA 3QPXH 4E42A 4QTFA 5K9KA 3SDAB 3TS8A 5CD3B 2HH0H 5EO1A 1UOKA 5C8JA 4TQIA 4RMTA 1GRWA 4MXQD 4HK3N 3P30H 4GRWB 4NO3B 4UINL 3ZBMA 3L1OH 2GK2A 2ZKYA 3FQYA 1R5VB 2R1WA 3Q8BA 4KVCH 3QO0A 3MLVH 1HINL 4HK0A 4TNVF 1RVFH 5DHYA 5I1AB 4UQAA 5F93C 2Y25A 5EC1B 5FYJE 4C4KT 5HYSA 4MCZA 3U2JA 3TC9A 1DEDA 1S9KC 2DLEA 1UM5H 4XNDA 4ODHH 3R0NA 3Q2NA 1SBSH 1VZIA 1RXLA 2EIKB 2M83A 3MR9B 3RY5A 4FA8A 4MKMA 4GSUA 5KYWA 2CNZA 3GRBA 4XBPB 3KYAA 2JB5H 2DI7A 2A6KB 2X4TB 3JWDH 5C0BD 4IIQA 3ZZLA 3ABLB 3LQZA 2FO8A 5EEXA 1LK2A 1A9EA 3ZUNC 4FNRA 2K78A 3O3UN 5CGMA 3KW7A 1Y7VA 2DQUH 2R69L 4M5ZH 2HJKB 3TFKC 3VW3L 5CHNB 1ITBB 1BAWA 1BMZA 4LASH 2OJEB 4Q6YA 4JRXB 3BKCL 3TVMB 4KRMB 1F4YL 3RWJA 4XZUA 3MTXA 1TOXA 3D52A 3K8MA 3HE6A 3ULVD 4F20A 2I9TB 3PG2A 4ZSOB 3ZTDC 2QGBA 2LW3A 4R3SB 2H0EA 5FV1L 1IO4C 1EZLA 3B2DC 2C4XA 2VMDA 4L9DA 3EG9A 3GMOA 1WFIA 2BOCA 2G9HA 3L5JA 4GBXD 4EVNB 2CA3A 4MNQD 4YSQA 1P5UC 2G3MA 2ZYRA 1PDKA 1AG0A 1TEYA 1QFOA 1C5DB 1WC7B 2EIMB 2FT6A 4PD4J 3BFOA 5EIQA 4U7MA 3IJYA 1XBRA 3LMJL 4I8DA 4OIIH 5JXAL 3WNJA 4JR9L 4RMQA 3HC0A 2VSMB 1AFVL 4HUWB 3RWGA 3WMSA 3E2HB 1ZGLA 1OSZA 2GJ6A 3FQWA 3KR3L 3RVVD 3ZHLA 2QR0B 4IQHA 3UFIA 1G6RH 4WV1B 2VLJD 2JB5L 4Q7DA 1SJEB 3VNYA 3FH7A 4KJYB 5IIEA 3TO2A 5IHWA 4MA7L 4XPHH 3KPSD 1JWMA 4MASA 4JRYE 5FOBB 5JMOC 1FC2D 2GUYA 1JYXA 3TBYA 2X0UA 1NGYA 3VDBA 4UNTA 3RDTD 5A2CA 4F37F 3GSQB 2GSIA 4FFVD 1NAKH 2BDNH 2Y6TE 1Q9KB 2WSPA 5C0ND 4PJ9A 1NMBH 2NTFA 5CCHE 4Q9BA 1UOWA 2P5PA 1NANH 2JQZA 3DBXA 1DCLA 3TA3C 1FZOB 1MXDA 4OCMC 2Z34A 3DHUA 3NQKA 4OQTA 5I15L 1L9QA 1SXAA 3NGBB 3N1GC 1V5JA 2J44A 3QUXD 2ZOUA 4YZWA 4XH2B 1S7XB 4QRQB 4YHIA 2AHIA 3O6FD 2B7DT 2LR4A 3KL3A 1AZVA 2X0WA 4GKNB 1BXVA 2O5ZH 1A4JA 4F5CE 1NM9A 2AEIT 1XIWC 4BFBD 3CVIH 4OQTL 3D9AL 2PO6B 5E0FA 1N0LA 1E3FA 1ORQB 3IMTA 4LKXA 1FVDA 4N8VB 5IVXE 1E4KC 1V3JA 3DKHA 4R97C 3QDHA 4XN2A 1AXTL 1CLZH 3HZMA 3ULUL 5IHUL 3V5HB 2G5RA 2A74A 1T1XA 3I2CH 5C09B 3PHOA 3D39E 3WXWL 4HCGA 4X8JB 2PKDA 2VRAA 2QTEA 4LU5H 5J6GA 3B2VH 3NCCB 4AQOA 4AQEB 3P11L 3HS0C 1BQLL 5GRZA 5CWSB 1FNGB 2Q3AA 4MNQE 4NFBA 1SN0A 3D85A 3W2DH 4F8QA 4OUOA 1XV8A 1PCXA 3EHBB 3P0YH 4J2XA 5T1MA 5D6DA 1OAQL 2XZQL 1C16B 2WTOA 4B9KC 3G5VB 3DVNB 4AEHH 4QYOA 1I8MA 3MVSA 1WA1X 5TDPA 2EDJA 2Q8AL 4HD5A 3UTPE 3T65B 1BVLA 2K7QA 2GY7B 3MUY1 2ERJB 2FECI 5D4JA 1KIRB 2OMVB 5F3BB 3W11C 1V3MA 1NDTA 3VI3A 3ZN6A 3S5LB 4HVBA 2VDPB 5E4EB 5I74B 1MNUH 4KKNA 4WVRA 4XVOA 3T2LA 1BVOA 5HDWA 2JJVA 5I1DB 2MCPH 2RFXA 1R0AL 5D7HA 3SBPA 3OAZH 5EZPA 5DSCB 5B7FA 1T66C 4XMTA 1CBJA 3U9WA 2XPGB 3S37H 2LU5A 4ZD3L 5ADOH 1XAUA 4NRYA 4LOFA 2OXGB 4YDMA 4Y4HD 3MRBA 4BSWB 4KNSA 2IAMC 1F13A 3JBG7 4TNVK 5EUKA 4NZTH 1E9OB 1UA6L 2ZUUA 4YHMH 4NQDE 5AZ2L 2ZNWA 3BSHA 1F6FB 3U4AA 2C5DC 3FCTB 3HUJB 3VXOA 2XIBA 3QO1B 4WGVB 4WO4B 5KJ7E 1H5BB 2IAAC 1N6QH 4HDIB 4N0FB 4JB9L 2E4FA 4K5MA 3VFGL 4YHLH 4YN3A 4R7VA 4G1EA 3DX9A 1HHJB 4JE4B 4N8UA 2DBLH 3HZYB 3IFPA 3HNVL 1ZLSH 4RZCB 5I2IA 5EEWA 1NGQH 4JDVB 3WI9A 4BA0A 3QFDB 1U8LB 4LRNL 4JDZA 2J21A 1DUZA 2ED8A 3CFEA 5AVZB 4U1LB 3SCMB 3S88H 5T1LD 1GGUA 1P7QB 2PF6A 1ACYH 4MRCA 4PGCB 4YSPA 3VWJC 4JPWH 4TLUA 2AQ3A 2ROYA 1S9WA 1HX0A 5F1NA 4M62H 2OTUB 3FQTA 4NP9A 2GC4C 3WE1A 2D4FA 1GGTA 2XX0A 4IBWA 3K5SA 4HPYH 4QRAA 3QFJB 2MWCA 1RUPH 5AAWC 5FO7A 4OZ4A 2C4FT 2WBJA 3EOBB 1UWGL 3HHRB 2QL1A 1CFQB 5FKPA 4LLDB 4GG6A 4FN0A 1DJSA 2H9GB 2K1MA 5I75B 3WNPA 3CTTA 3OHXB 2VDNB 5CEYA 5C3LD 5IR1B 3UO8B 1GA2A 3FO0L 7FABL 2BSCA 2E56A 5C09D 1M7UA 4JFQB 4PREB 3SDCC 4WJG3 4GP5B 5KS9F 1NCOA 3VFMB 3VMPA 1RP8A 3X1EA 4K71B 5GJTH 4LCWE 4RISH 2X4OB 4QGYA 1JRHL 3FDWA 5CHNA 5BRZB 1V7MH 3M6DA 2C3VB 3SCMD 4H4NA 5BUGA 2XRAL 3CC5B 3K72B 4GO8A 5C0DA 5JHBA 3TX4A 1W72B 3IDYC 3JQOB 3MOQA 1L9NA 4JFFD 5I73C 3NFSH 4JPKH 3MCG1 2DLGA 4L3EA 3QJRB 1FSKC 3P02A 1KLFA 1OSEA 2P44B 2E27L 1XL6A 3GMNA 2OSXA 4XN9A 3P2DA 3TVMD 5TQ2L 1DQLH 3QC5X 4FQJH 4LKCA 1CLYL 4AX3A 4I1PA 5GZOA 1PDKB 3EFDL 4FZ8L 3U6RA 1CT8A 4KJQC 3W3BA 1J1XL 1UASA 3MACL 4K9EC 5ABDE 4MNGA 2MOGA 2VQUA 4ODSL 3FN0H 3MJ8A 3WFCH 3PWPA 2L4OA 2CO6A 4GLRI 4WI6A 3RZCB 3TL5A 2H8PB 3U79A 4BCXA 2ZSWA 2R1XB 1B6UA 2F2HA 2JI1A 5AW9B 4L29A 4UM8B 3OJDA 3X1FA 4MQXC 1UGNA 3BZ4A 3WO3B 3ZHDA 4UNIA 2AZAA 2UXTA 3AGVA 3MI6A 3IJ9A 2Y0SA 2VYRE 4XCEB 3RZWA 4GFTB 4AVHA 1BF5A 1KTBA 3HBQA 5DYOB 3OJ2C 3MRRB 1JHLH 3QRLA 4K7PL 2LGNA 4YR6B 3VUAA 2R2CA 1YEEL 1S4IA 3NCBB 1B0GB 3N6YA 4HIEB 3G7TA 4JFEA 5IB2B 2DI9A 2AJXH 3M88A 4GBXB 1YDPA 2BRRL 2JFCA 1Y18A 2N3JA 5K1JA 4Y2DD 4JG5A 4EDXA 3MRLB 3ARYA 1QFWM 1Z32X 1J8RA 3F64A 3SE4C 5J1AA 1GGBL 1I1AB 2B14A 3I6GB 3PUUA 5D9SA 1XF2B 1A1MA 1MHEA 2XIIA 4Z8FL 4UV4L 3GSXB 4RDQF 2F6AA 4ICXA 4MFHA 4PJIE 1H6TA 4DUVA 1W72H 3QXDA 4RNRA 4NUQA 3OAUL 3DYOA 1CZ8H 1SNRA 1HWHB 1WA2X 3T77B 1OPGH 1SOXA 3D39A 2WXMA 4W70A 1XB8A 1CGVA 3UBXI 1QAWA 2OJEA 2ZZUT 1EEUA 3APFA 4O2CB 4F2FA 3I75B 3CZGA 3SDYH 2E8YA 1LMKA 5IMOA 4FADA 3W39B 3QPXL 1T6BX 4EDWL 4JRYB 4Y2OB 5IHHA 2WXOA 3N43F 4XBEH 5HDBB 2VAAA 3WUWB 3BQVA 3HPJB 1JUFA 1UT9A 3GMOB 4L4VE 4TULH 1E42A 4Q58C 3QYCA 1CGWA 4W4OC 4LBEB 5F1IA 1AKPA 1QZNA 3C6SB 3FRUB 4FMKA 5DMJB 1OANA 2VO5A 3OQRA 4G6KH 1XH2A 1KIPB 1NLDL 1IBZA 4U4IA 1REIA 2DKUA 1XGTA 2DZEA 2O6PA 1TVHA 3FHQA 4NRXB 3UX9B 1NC2B 2ALAA 1U41A 2L7UA 4UTCA 4M8RA 2EJ1A 3VI3B 5DC0A 2BNQA 4I2XE 3ARDC 4PLJC 4PCSA 3CHRA 3TO2B 5HSFA 4PJGE 3TJHD 1NCHA 2XY1A 3U7WH 3VFTB 3R06A 1F58L 5JOFA 3SHSA 2QVTA 1NUDA 1V8HA 3BVUA 3NCFB 3WJJC 5J7CC 5GGTA 3NABL 4KX7A 5IJBC 2A1WH 3ECUA 3EJRA 3F58H 1QSED 3MLXL 2WXFA 3UBFA 5IB1B 1GL4B 4F24A 1B2WL 1K6QL 1KDJA 4LL4A 2VR5A 2QV2A 3I9GH 2PYEA 4I13B 1BPVA 1CFMA 5CBEB 4ENED 2GYSA 2ICEC 3KPLA 2BY1A 1B88A 2WCPA 4WUUD 1IC5H 2EVIA 1KJVA 4MXVE 4AI7A 4XOEA 2D7TH 2EQDA 4CN4A 1BCIA 4Z7UE 5HJ3B 1HHGA 5D8JH 2JKTM 3L8QA 2C9VA 2ZUQB 1FL5B 4UQBA 5LNGA 1OD7A 3UG5A 1WLHA 3O3AB 1OF0A 2D7PA 5FIEA 3RNKB 2AXFA 2UZPA 3SDAD 4EN2A 4NI3A 4J3VA 3SE8H 3QXAA 3STZA 4L8DA 3UTQA 3WOVA 3PAYA 1HI6B 5EUOF 4HWBH 3C8HA 3SGEI 3QJFA 1A6ZA 1TLMA 1X4ZA 4NSKA 5EOCJ 5LVEA 2DMCA 4F7TA 3HMXL 4P07A 4XHQA 5C3TA 4Z0BH 4GMSL 1S7WA 1DANT 3SIKA 4P5SA 3WFEH 1MCDA 3BWSA 4I0CC 1RHFA 5DJDA 3LNFA 4QCIB 1PNCA 2OR7A 3K6NA 1ZEAL 1YEDA 2ADJA 3RILA 1NMBL 2BNQD 4J6RH 3S36H 3O6LL 1WFJA 1EEZB 3OPUA 4DKDC 3ARZA 2PR4H 1C08A 1P7KB 1OGSA 2ZX9A 3BIKA 3EYSH 1ROCA 4NNYA 3GMLB 2FR4B 1QNZH 2H1PL 5JTWA 5CJQL 1X5XA 3APMA 1MLBA 5INCA 3QIUA 1TVBA 3RYMA 1MCLA 5I26A 3TV8A 3BRGC 4Z3JA 4XMPL 2F08A 1JN6B 4WKZB 5IR1A 2GABA 1C5CH 4A1RA 2EIDA 3F5WB 2NYYC 1PZAA 2OTPA 5JZ7D 2WLLB 5ENWA 2W80C 4XP6H 1THCA 3S5LA 2BY3A 4GAFB 2V7NB 3EJYD 2VM9A 4C58B 4Y9BA 3V4UH 1UC6A 5TK2A 3K2IA 2W5PA 2AKRB 3BYTA 2A9NH 4MX7A 1L9TA 3D69A 1IGJA 3JWOL 4KTYA 5IGXH 4YXKL 1OM9A 1NCWL 4RBPH 5C0IA 3AMLA 1AHWA 3ULUH 1M6UA 1PEWA 1R17A 3QIBC 3LZPA 1UA3A 5ECGA 2HG0A 3R1GL 3O6FB 5DR5L 1OHQA 1CDIA 4UANA 1I8IA 3V7AG 4NPYA 4KJPC 4XVTH 4U1GC 1HIML 1ODAA 2AQSA 1T4KB 2VGLM 4UUJA 3HAEG 1GGIL 2CJ3A 4DTGH 5K59E 2CALA 1KXQE 2VM4A 4HQQL 3EJTA 3QPQD 5MERB 4EOWH 2K9UA 1FN4B 2XZQH 1OAQH 2P5WB 2AK4A 3HUJA 4WFFE 5GGUB 3X1BA 1IM3A 5I73B 3FZUD 3FKUS 4IJ3C 3QUYA 1BVNP 1DJGA 1FH5H 3WHE1 3FTXA 1DO6A 1J05A 5LCVH 1FDLH 1S78C 4J1UB 5EBLB 4XMPH 5DK0A 1BMWA 4FMVA 5E56A 3ABMB 5DHXB 1DJYA 1P84K 4U1HA 1YY8A 2AGJH 3L4ZA 3O4LA 5KSBE 3ENEA 1XTMA 2VLKA 1LVEA 4CW1B 3D2UB 4KKQA 1RJLA 1VACA 3DIVA 3GZKA 4ZDHB 3WNNA 4A6YA 5CZKA 1I1FB 4FXGA 5F1NB 1HYSC 4MZRA 4LAQH 4JZJA 3V6OC 3T0BA 5E4IA 1IBFA 3Q05A 5EF1A 4LCIH 1AGBB 3C6LD 4R90H 4OM1H 3GLAA 3TA3D 1F3DH 4E41A 2YAPA 3HG1E 4DTGL 3ARFB 2NY5L 2WMPA 5D7IF 2R4RL 5F7EH 5LBVA 4PP2B 2FE0A 1RZFH 1AO7B 2JIXD 4K3EL 4OJEH 1N2RA 1GXEA 2K8MA 1I7RB 1MCBA 4HIIA 5CEZD 4XZ4A 4OV5A 5B1CA 3U0WL 3L9RB 1QI4A 4RIRB 3F7YB 4GIPD 3NPSC 4LMQE 3EJQA 4ZPTA 3P77A 3V4PL 4MGXA 4QHKJ 1J7VR 1F2XK 1DJIA 3O4LD 4G8GD 1OALA 4N20A 5E2TH 4P2QB 4TNEA 2NY5C 5EZLB 3N9GL 2JH2A 2DQFB 3PHQA 1E7VA 4Y16C 3BUIA 1LILA 1MIEH 2YOCA 4Y5YB 5DMKB 4F7MB 1OQOA 3NJLA 4LSSL 4EKXA 1AD0A 1H8OA 4X6CB 3SKNA 5KVGL 1Z3GH 2GSGB 3WY4A 3E8UH 3TT3H 5BS0D 5KZCD 3TONA 5AW1B 1AI1H 4E9XA 4X8XA 1U95A 4KNUA 4TVUA 4Y89A 3UCQA 4S1SL 2V8LA 3X13B 3H54A 3N1FC 3ZMNA 1HXMA 5I6XB 1OGPA 4Y1SA 4D2NA 5EPMB 3S4SB 5IUCA 3IK2A 3A6BL 4JQIL 1SEQL 3SE4A 3MZTA 3T4AA 4EIUA 2FSEA 4RH4A 5HVFB 2GEEA 5CINL 1D5RA 1NC2A 4MJ6B 1DQVA 4AH2B 5E08H 3Q8EA 1CGYA 2WTPA 1RZFL 1GYWA 3FSWA 3L16A 4WCYL 5AAMC 3FUKA 2X4QB 4RWYH 4LCWB 4HIXH 4HJSA 1BVNT 4NO2B 3ARBC 4OV6F 4PRBA 2V2WA 4OJYA 2GJ6D 4Q9RL 2F8OA 2J5LB 3TO4C 3U9UB 4ANVA 5E6SB 2VABA 4YQXL 1PLGL 2VXVH 3SQOH 1J0IA 4PGEA 4P5TB 2Y1ZA 2YJLA 3C8DA 3NFSL 4JPKL 4OT1H 4WFED 3DIFB 4PIRF 2VL4A 5BS0A 2VO8A 1MIEL 1ZVHA 5IBLC 1YDPB 4LCCB 1AZNA 5DZ9A 4YSSA 4RCAA 2ATKA 4OLXH 1IM9B 4HSAC 5F6HJ 1OTTD 2R23A 1AY1H 3CFQA 4KXDA 1VF5C 4URKA 1ZANL 2E3VA 3KLKA 2CQVA 3FQNB 1P69B 2QADC 4ZMYA 3DX8A 5JW3H 4Z7WE 5C9JB 1KWKA 2BXYA 5GHWL 3SOBL 2VUKA 4LSPH 4M5TA 4YBLB 2XVGA 2OAAA 2YSSB 3VGAC 4LESA 2AEPH 1QTYT 2X70B 1MEXL 3D33A 5FKAA 1Q9OA 4GMTH 3VE0A 5DRNB 3IDUA 1WGVA 1MUJA 2VSKB 4NCDA 4LIQL 2A9ML 2FEEI 4OUUB 4PJFF 1VGKB 2WN2A 2B20A 5DVPA 4UTBA 5E4OA 3MJWA 3HN3A 1SM3L 3B7YA 4HEME 2VH5H 3D4CA 3EO1A 4R5TA 1YECL 5I30H 5E70A 4YBHA 3BH9B 4KMQA 2EDMA 5L2KA 1VPOH 3GPSA 1MDAA 4XHJD 4ZMWA 3A4FA 1ZIBA 6FABH 3MNWA 2JKRM 5FLUA 2MOVA 4PCTA 5F6IB 3M1OA 1CLZL 2IF7A 4G1MA 2F7RA 4GYBA 4MNQB 4WW1A 1LEIA 3OMIB 1IQWL 1HT6A 2ENQA 2XQBH 5F6IC 1UFUA 2R2EA 2BSTA 4M7LH 4DGIH 4R7XA 4M29A 1A6VL 4UDTA 4L4TB 3QEQB 1T1YA 2QBWA 4OFPA 3B37A 5J12B 2AJZA 4I5BB 4JFOB 4ZNCD 1J9QA 4Y4FC 1L9OA 4NO3A 1MCQA 3MRNA 4WJKB 3BOVA 1EHXA 2X40A 2OLDA 2R59A 1KJMB 4PGJA 1HJCA 1U93A 2J3SA 2WNWA 2HJFA 3L7EB 2R2HA 4PRPD 4LPYA 3QJUB 1N68A 5ELIA 2D0GA 5HYSB 5K1NA 2HCZX 1EFXB 3QWNA 4KNTA 5ADPL 5ADOL 1MY7A 3JV5A 2WO4A 1ZTXH 2QEJA 3MN8A 4XPFH 1IEBB 4ZFFA 1CFVH 5I18L 2IV8A 3QJXA 5AEAA 3ZE0B 1I8IB 4F7EB 4NPYB 3BFQG 2AXGB 3QUHA 5I16A 2YWZA 3LZFL 4LP5A 3APDA 4EDWH 4ES8A 1SZNA 4GIOA 3FS9A 3NJXA 4JKNA 4NHUA 4TXVB 4TQPA 1A9EB 1P4LA 3QDJA 2O6DA 5GSVA 1RUKH 3WE6A 3D48R 4PSRA 4V1DE 3V6BR 4A68A 3O8XC 5B1JC 3MU3A 5DRZB 4PWEA 1WCQA 5HHME 3ZE2B 5ETUB 1Q9LA 2DBLL 3KHQA 1HU8A 4WI0A 3ZE1F 1UWXK 5KYUA 2EYRB 3IRZA 1NGZB 2J56A 3QUYB 3O3EA 1KN2H 4YIQA 3F7VB 3IU3B 4KI5D 3LZNA 2YGPA 4G9FE 4A63A 5SWSB 2KZWA 4WJ5A 2MCAA 2NSQA 2A6JA 1MF2L 1P5VB 1PYWB 3DO3A 3HOGA 3SDAC 3B7TA 5CCKL 4GO9A 1ZHKA 4NJAL 3M7FB 2Z0BA 4F7KA 4U0RC 2NQDA 1ZSDA 4XB8A 3CAFA 3AB0C 2QKIA 2Y5EA 2PXYA 3IJHB 3PL6C 3M07A 5LJYH 1E8XA 1QI3A 2GI0A 5C0CE 5TE4H 4U1NA 2A6IB 4B60A 3ME0A 5IW1B 4C57C 1I1AD 3IVKB 3RBSA 1S9VA 2EDFA 3HBPA 4LSDA 1WHOA 2Y2TA 4IRSA 5DJZA 4L8SB 2QQQA 4N2KA 5T1LA 2WZ5A 1YVLA 3AAZA 2LAGB 3WNKA 3HN8A 3L54A 4KKBC 4ZI8A 1ZT7A 3PQYA 3DVGB 3QIUB 1KCBA 3AG3B 1K8IA 2FEDC 5DFAA 1VKXA 3FRPB 5E24E 4Z3EA 3WTXA 5GRUL 2CBOA 5K33A 2WQRA 2X3BA 4OZHE 3JTTB 3TPUB 4Q2ZA 1IAOA 1R75A 5A6IA 2AITA 5EIVA 3QS2A 2BP8A 3KPQB 3RX5A 4ONGL 5D2LF 5B3JF 4ETQB 4LP8A 2O6CA 5AKSA 1KN2L 3QZWG 5E9DA 5LG1A 1DBAL 5C6WH 3NSDA 4UOZA 4B5EA 5C8JB 1E5AA 3HE6D 2WLJA 3DMMD 2NX5A 3NACH 2WVVB 4ZPVA 1CR9L 3QRFM 1YUKB 4X99B 5TQ2H 5D1XB 5J57B 4NO0A 2R56L 3EFFB 2A74C 1VRSA 3IDJB 5DT1L 2ADGB 2C26A 5I6NA 3DO7B 4IW4C 5CUSH 3GJFA 3BRDA 2YPLE 3DV6B 4RMVA 1PL3A 1JCKA 1G7MB 3A0OA 4P4KA 4IRSD 2XKSA 3S96A 3FB5B 2EUXA 3MR9A 3L3KA 4BYHA 4LSQH 4U3HA 2DW5A 5DEGA 3FN0L 1EHLH 1E43A 3WY3A 5D7IE 1ID5I 2F7IA 3Q6FA 4IIQB 2CHXA 3AREA 3LQZB 2NR6A 1L6PA 3WEBA 3CLFL 3POCA 3MRCB 3VXTB 2BHFA 4Z7QE 1XR9A 1C8QA 1JDCA 3TF7C 1S9XA 1M1XB 4LCWA 5F3FA 3S5LG 1ICTA 4XZUB 4NWUH 4YZFF 25C8L 1XF5B 1G7HA 2BVQB 1RURH 4PRNA 5DRXA 5LBSA 1NBCA 2Y06H 1ES0B 3MV7B 2GT9B 3KL5A 4UTAL 4YSRA 5MEPA 2WUCL 4CC4C 4ZTOL 2E47A 2DQTL 1N5YL 2AW2A 5KYXA 4ODSH 3EF7A 2CJTA 1HCZA 2K9FB 1FYTA 1NKRA 3SKMA 2DQHH 4Y16D 2WGNB 5CM1A 1TCRA 1WC7A 5C9KA 2H2SC 4WUKH 4F3FA 1PX3A 2JJSA 1KPUB 3HC2A 1LQSR 2Z65C 4HZ1A 4LCCA 4HUWA 3NA9L 3I6KA 4WFFD 3DGDA 3GT6A 4OZGB 4IJTA 4OTXL 3STLA 4Z8FH 4HUVA 4UT7L 4RA3A 5HHOE 2DQ6A 4JFUA 2QV4A 4PUBH 2JTDA 5GRVK 4QRPA 4U6XA 2CO2A 5K9JH 3ECWA 5FO9A 1YEGH 1WBYB 4P5TD 2CHDA 1KENL 2WYTA 4S0TD 4ALAC 3FW6A 2WAQA 4TTGA 3I6LE 4KO5A 4FG4A 4JHBA 3F7YA 4ZPTB 5E1IA 1OWWA 5FKAB 1I7UB 4OKDA 4RAVA 3S35L 2OCJA 4PV8B 2YPKB 3NN8B 1VCBC 3UAJA 5DFVC 1FRGL 1VFAB 1A1NA 2AQ2A 3HC4H 3QORB 3ES6B 4NRZA 3I3BA 5KYNA 2JKIS 1X9LA 1KT2A 1RCYA 2Z7YA 3FFCE 3AS2A 1CBVL 1NFDA 1DUYA 2E59A 3RY4A 2BX5A 4PJXF 3L5XH 2J8UF 4LE8A 5D7JA 4B96A 3AXHA 3VD4A 2XV6B 3P4LA 4B9ZA 4TM9A 3B2PA 4DFIA 4H7VA 5CNHA 4RZCA 1MFAH 5E8EB 1KELH 1JHTA 1Z5YD 3Q5OA 5F0MB 5ITBH 2J8UE 3BJ91 3MAWA 5JIHA 3QEQA 5LXVA 4W6WB 1KEGH 1FORH 2R39A 1M3IA 1UACH 3PP4L 1G6VK 4PUBL 4XI5D 5H2BA 3N42F 1FUNA 2FLBT 1PAMA 5GGVY 1I3VA 4DT2A 2ZUWA 4NO2A 2R29L 3DXAA 1T4WA 3MGOB 1INEH 5J6HA 3QFJA 1XF4B 1FAKT 4H25A 2P8LA 4FNLH 5IEHA 3VXME 3NIGB 4XP5H 2LLLA 4QHMB 5EEUA 4YL4A 1T03L 4K8RH 2G60H 1VFBB 5DD0H 3FU3A 3SKOA 2XU9A 2XWCA 2ORBL 1OCZB 1JG9A 2J1ZA 5DZAA 3IDNB 4DVRL 2D7TL 3WHXA 3ZKNC 3H55A 1KXVA 4LO9A 4L0PB 2Q7AA 5D2NA 3VYPA 2KLRA 2ITCB 4OIBA 1QQDA 4WO4C 3HG2A 1OAYL 1EHKB 1M7DA 5IVZB 4DGVL 3I9PA 1TTCA 2OMVA 1CK0H 5F3BA 3DTXA 2C7UB 4JZOB 1I8LC 1JS4A 5DDHA 4F57L 3MLXH 1SJHB 4M6AA 4LVHB 5BVJA 4OLEA 3B43A 3I2CL 2DQGH 1TR7A 2DWSA 1L9SA 3OSKA 5A3ID 2ZAGA 4RZKA 1A0QH 2CRMA 4Y4KC 4AT6A 3KLHD 1J8HE 4DP7X 1L7IL 1QW8A 1I7ZB 2DPKA 2QPFA 3B2VL 3DOHA 5B7EA 5M94B 5ILTH 4IBTA 4HC1L 5BQ7B 1KXTA 2V2XB 2E5EA 2WXHA 2OXGA 4U2ZA 1HCYA 3RWHB 3HTLX 3BVWA 3G3LA 1JF6A 4G8AC 5D4IA 4MZ2A 2UX7A 4NQSB 1SDYA 5GGVH 2VR7A 4O02A 3CZLA 4GKZA 2HT4D 3U48A 1KMGA 2BZDA 2DIJA 3M45A 3GYRA 4ZAKD 5T3ZL 4M5SA 3BEVA 3CFCH 4HJGA 5IKCA 2YFNA 4YS4A 2NQCA 1K5NA 2P8PB 4RETB 4PJ6A 4HDIA 5EULV 3UL4A 5B38G 2HPOA 1IT9H 4GW4B 1KIUA 2XG5A 5I2IB 5IY5B 3QFDA 4A7TA 5C7ZA 1A2YA 3P1VA 2XUWA 2CSPA 4K07A 3IFPB 5GJSL 4P46C 1VKXB 2NW2A 4KHXH 5EIIG 2N0MA 3DBSA 5HYJA 2V17L 3S3SA 3ARBB 3MO1B 3MNZA 1IAIH 1BZ8A 1YJDL 4OLZL 4AUJA 3QXUA 1BYOA 1CL7H 2RCSH 2FH8A 5D1QC 2RMNA 2V6HA 1CGXA 2LQRA 3CFTA 3GHBL 3IBOA 4NWTH 3MSPA 4FQCL 4NQTA 5GHWH 3T71A 3CXHK 3QZMA 1OD9A 2PWEA 5DR5H 1CO1A 2FZ3B 4B9IA 3NH7H 3LB6C 1JV2B 4CJ1A 4GSRA 1AQKH 4BRJA 5HHPB 4H0HB 3GUTA 3O41B 1NBYA 1ND0A 5T3ZD 2Q5BA 3B6SB 4XOAA 3P54A 5EUOB 3GSXA 1J5CA 1R24A 5CIPB 2Z3FA 4WTXA 1CXLA 4EI5A 5IROD 3LZLA 2WXPA 1MHHB 3KPNA 2W94A 5EZOH 3VWKA 2ZCZA 4L3AA 1SEBB 1CU4H 2EH7H 1HINH 1NICA 3ILPB 3Q5TA 3KCPA 3SBQA 2F8VA 1XGUA 2EDQA 4UM9A 3HBZA 2QFRA 3S37L 4Y19E 4Y4FD 5FHAL 2VLKD 4AQ8A 3WHE0 3FQXA 2ADYA 3WS3A 3W11D 1K3ZA 2C34A 4X4YA 2VZTA 1HDMA 2WNKA 5IHLB 4AK1A 5FM5M 1OHZA 1YEJH 1JGEB 3IJEB 4AVIA 2PP9A 2Z9TA 4JRYA 4Y2OA 2FNBA 5JMRA 2APWA 5DVKA 1D6EB 3F12A 2N59A 2UUDK 4WWKC 5BO1L 5FX3A 1LK3H 4AW4A 3FMGH 4N2HA 3Q01A 2FTAA 3GTNA 5JOPD 3T6ZA 3P9LA 4I0PB 4U1MB 5DRWB 3ARBD 5F96L 3FULA 4KROD 2OYKA 4KTEL 1Q94A 3EJPA 1KACB 4UTBH 4LCIL 4R90L 4YGVB 1DBJL 3VFOA 5DEJA 1LP9F 2CDEB 3MJ8B 5CLYA 4KUZL 3C87A 4HFUH 1IC4H 3MJ6A 4JO4H 2XTSA 2IOOA 2CIIB 4WI5A 5B8CA 1JVKA 4WNJA 3C60A 3VI4E 5IBTL 4A2DA 3NEOA 5HDRA 2B2XL 1RKRA 2WWKT 2XJKA 4K4KA 1N8ZB 1F3JA 1ETA1 4JRXD 1UJ3A 4YNYA 1Z7JA 4QWWC 5CILH 5GJTL 2MCMA 1SYVB 3DPBB 1CLCA 2GTWA 1T21B 4NBXB 2W8CA 4O5LL 4PJ8A 3OC8A 1TTGA 2MQ3A 1N59A 1CQYA 3KYOB 3QNZA 4TS6A 4EKJA 2Y07H 1BJ1J 1RY7B 1B9ZA 2CK0L 3N2JA 4ORGB 3T4YA 2GJJA 2DN7A 3MMEA 4DP2X 2GBTA 2BZ7A 1A1NB 2IBZX 2E7MA 4EQ2A 2FHFA 2MTPA 1PQZA 2Q7YA 1U8MA 1UJTA 5J1AB 1G9MC 3W37A 1L5GA 2NW3B 3TFBA 1Y07A 1UM4H 1UENA 5E7BA 4WLCA 3VSUA 3O8XA 1FIEA 1W0WA 2VOTA 5F7DB 1KY6A 2ZQKA 4ODXA 3D5OF 1DANU 3QUXA 5EU4A 1NCJA 2AANA 3TEXA 4YK4B 3VD3A 4Y4HB 5FGRA 3K6FA 4WI4A 3RTQC 3UCRA 3GJFK 5KBLA 5IROA 4AV4A 4EI5D 4ZW5A 1R46A 2VIRA 3QJFB 4MRBA 1A25A 4ELDA 1I82A 4OKVA 4NYLA 4N68A 2VWEE 3DJZA 4DW2H 4E9WA 3I75A 1UXWA 4LCUB 2YEZA 1I3RA 2GCYA 4QXGH 4FA7B 1DQLL 1S7WB 4ODBD 3VVVA 5C0JA 4JO8A 1CXIA 3OPZH 2EDKA 3LKRA 3RPKA 4JE0A 1XF5A 2BVQA 1CLOL 3DXAB 3JTSA 3MGOA 5D7JD 1OP3H 4LEEA 3BCDA 5KSBF 3BQUC 3S8WA 4U4BA 1FE8H 4D0BB 4L4VD 1L7TL 3E80A 4JGMA 4MQSB 5DF0A 2FR4A 4LLQB 3GIVB 4K7FA 4HJTA 5D93C 2OMWB 1OCWH 1W8NA 1TCRB 4HK3J 1JTOA 4J27A 5HJGA 3IDNA 3D0AA 2XWRA 2YA2A 2X4RA 4YZFE 1E28A 3BAXA 2NY4C 4XAKD 5AB9A 2KPWA 4PJCF 2ZX8A 2ALWA 5C0RH 4P9HH 4WFEE 4NQDD 1P5UA 1ZV9A 2MPAH 3R8BB 4H44C 3W82A 3FQ1A 2OP4H 2A0LC 4C56B 1Q72H 3GM0A 4NCC1 3KNBB 3SBRA 1FZKA 1YQ2A 2GJZA 3RZCC 2LFEA 4RGNE 1UWYA 4O51A 4XC1H 1F8TL 1CF8L 2ZONA 4R2GC 5F88A 2LHAA 4WW2C 1A6UL 1KXQA 3SKJL 4LNVA 4V1DB 5LWYL 5HP5A 5C97A 4JY6B 1MNUL 4N0UE 4PG9B 1U8JA 3D08A 5HHMB 4CL7A 4JHVA 3CHQA 5F7MC 4YJZL 4XNAA 2Y06L 3T3ME 1RJZB 1OEZW 4P2RB 2CCWA 5L8LB 4DVBA 3FT3A 3IS1X 4HXBH 3SQBA 2ARJQ 3T8VA 2Y5QA 1OAJA 2VMFA 4GP8B 4I4WA 4NZUL 1T89C 1UTDA 3LQAL 1MJJB 4HJGB 3MV9D 1IM9D 1KYFA 2LVCA 4ZO7A 2ARJA 2IANB 5B39B 3B83A 1K4DB 3Q06A 4AQAA 5IF0A 4DN4H 2WAHA 1F6AA 4KGJA 1YY8B 2YLHA 2BW4A 2OMYA 4G8IA 1H3GA 1D9KB 3UEQA 4KJWD 1AR2A 1BOGB 1S3KL 4PWKA 2APTA 4V33A 4YHNA 4NJ9L 4OFQA 3ARTA 3GM8A 1D9KC 1HI6A 3U7YL 1IC0A 2FX9H 2P1YA 5HI5D 4YXHL 4AE0A 5DVLA 1F41A 1Z9OA 2LAAA 4GRMB 4I3RH 5CMAB 5D2NC 4RA0C 4G72B 3FB8B 4TL5A 4JVWA 1GOFA 5HHVL 3V4VA 5K93A 4ZAKA 1JWSA 3LJ3A 1K6QH 5TF1L 4LCWD 3WL9B 4MMZC 1ZLSL 4GUCA 3WN5B 4L18A 1HTYA 4P2RD 4F58H 5IOKA 1KTLB 3KAAA 3R4DA 1NAMH 3GZQA 4LRIA 2HFFA 4NNXB 5HHPA 2JXMB 3Q9PA 1BOYA 3FFCB 1YPZF 5F44A 4BSJA 1IC5L 2VMCA 3GTTA 2F53D 3A4DA 2B59A 1AO7A 2QVKA 3G6DH 4YHYC 5CFAA 1B9KA 5AG8A 1CUOA 5DZJA 4ZW8A 4S1QH 1G7PA 1WWWX 3EO0A 1JN6A 4WKZA 5A3IC 4M61A 1OF2B 2OMUA 5A43C 1HAUA 2AKRA 4X7DC 4X7TA 5LXGL 3CQPA 4I3SL 4XPFL 3VGEA 2GSMB 5F3HB 3VXSB 1NEZG 5A2LH 3QZPA 3QDJD 3DURA 4O9HH 3A21A 3H9HA 2VDPL 1KEGL 4Y5YA 5DHYB 1ACZA 5H4ZA 3TJPA 4FQIL 4U6HA 5HI3C 4UUJB 4UB0H 1MFBH 4M43H 4X80H 4XNZB 3B1TA 2HRLA 4YXHH 4KH2A 1AANA 3NESA 4C83A 3TP4A 1ONQA 1NCDL 1P6AB 2CGRL 2JELL 2YXVA 1U8HB 3EYSL 3WJLA 2WZAA 4IHOB 4F58L 2OR9H 1JXJA 4ELKA 1EGJA 2M8XA 4BSVB 4Q52A 3CDZA 5IZ7A 3MRIA 1QLFB 4FQXA 3ARFD 3ZZQA 2VISB 4YUEL 5GZOD 3NTCH 4PCKA 1WA0X 4AV0A 4BKLB 3HMWL 5A40E 1QOKA 2FEEL 3E6HB 1J05B 1RSYA 3GXIA 4GT0A 1A7NH 1WJ3A 2Y5TB 1M9SA 4FQJL 3VD9A 1CLYH 2YWYA 3EYUL 4H8WL 4A67A 5T33L 2G4EA 3LKSA 5G55A 5SV4A 5CD5C 4PHXA 1R3LA 4WI8A 3BQUD 2AS5M 1LO3L 5MI0B 1DE4A 5DHMC 5ISZD 3BVNB 2HZHA 3ZLQC 2D2OA 1DBAH 3MLTB 1A5FH 2KHAA 3ZRCC 1JERA 5E1HB 3J7HA 2MNWA 4QHKI 3O81A 4NN6B 1UH2A 3WSQH 4KK6C 3IAGC 1ZVNA 3ASNB 3QUKB 2FD6L 2IC2A 1I1FA 3FU9A 4IRJD 5F89A 5LAXA 2WKGA 4F8OA 1URIA 4OW6A 1IEAB 4JM2B 4K2UL 4AZ8B 3DJSA 5H37A 2WOYA 2QPEB 1H6UA 2ZUSA 1XCQB 3IKCB 5C0EB 5C0NC 4X5LA 3CSYA 2QR0A 3AGWA 1DEEA 2XWTB 2WZPA 4WV1A 4ABVA 4QHLA 4Z7VA 2C9SA 1KPVB 2VXSH 4MMXA 5H8DA 1UEYA 3RHWF 4HJJH 3CIQA 3K1DA 2X1QA 3KJ6H 2ENJA 4ZW3A 3DX6B 1OM3H 4BGLA 4WU7A 4ERSH 2AJXL 1RZQA 3ML8A 1JGLL 2D8KA 2VDOH 5KSVB 1RZGB 4KXZI 1WFOA 1Q9OB 1ZLDA 1MRFH 2YRLA 3CZSA 4P4KD 3VX0A 4XRCB 3TJHC 4MLIA 5EZLA 2WTRB 4PJDA 3MRKB 1TO4A 4LDCA 4YLBA 5I1EH 4A7GA 3DBXB 3FT9A 2EIJB 1P2CB 3UERA 2JKSA 3CDCA 2MFNA 2J71A 1GZPA 4K94L 4X6DF 4TVPD 1DLFH 2YMXH 3UJIH 4LSQL 2TSBA 1RJYB 1WQVT 5IB5A 4JANA 1QUNA 2DKSA 5EN2A 4NO0D 3PDOA 4MAYD 5H35A 4IRJA 2X4UB 2HMID 5FB8A 4WW1B 4ALAH 5AOKA 3E1ZA 3CLFH 4FKKA 3KZ8A 1AS7A 3BJLA 1VERA 4LCCC 4YSOA 2ILLA 4G83A 4L4TA 5GS1C 3QUGA 3T0ED 5DUML 1OSZB 1A4KA 3WFDH 1D5ZA 4HS6A 3V0IA 2H32B 2OFQA 2XJLA 3HI5H 4Y8AA 1G84A 4ACTA 4P9MH 2J1YA 3QZLA 1QMUA 4XX5A 4N5ED 1JZ5A 1JPSH 3RFZC 1U8OA 1HH9A 4OFDA 2GITA 5G2NA 1ZXQA 2DS4A 1MFEH 3LXUX 5T5FH 3QR2A 5E2TL 1BZOA 3U9UA 4XVJL 4JN2A 1S7TA 4A39A 5I8OL 4LQFL 1QI5A 4O51B 1GZHA 5D7SH 1G5AA 3FONA 4J12A 3N04A 1A21A 4I0KA 3CUPB 4OTXH 5IJKA 1U8JB 3QJOA 2R1YB 2XNAB 4K94H 1A3LL 2EE3A 1ZV2A 2Z7UA 3ULVE 3HEIB 1ZY9A 4OCXH 4B7IA 1Z9LA 1A14H 3SGKA 1EBPA 2A1WL 3UGEA 4QIRA 1JK8A 1KJ2B 4MA3B 1QFUH 2PWDA 4OD1H 1J8HB 5I19L 4OZIA 4L05A 5A2BA 4NENA 3FQNA 4DUWA 3I9GL 3MODL 3V52L 4XMUA 5EO0B 1IC4L 4JO4L 2CCLA 2I9LB 1WCBB 1ADQH 5EB9A 2V7HB 4KAQL 1A7RL 4MCYA 3ULVH 1EO7A 1C5BH 1I7TA 3KBFA 2A74B 3WFDL 3NRQA 3DUUB 1Z3GL 4XWOD 3L3OC 3ZKSD 4K3HA 5I5IA 3B9KB 2A9DA 4LDEB 4X6FA 2RTTA 4UBDC 4L8CA 3BUYA 1B4RA 2QDWA 3D9AH 4R4NC 4JHWL 3IVKA 3AT0A 1G6RA 3BUDA 4IRZL 2QVIA 2BNRA 1KGXA 3AS3A 3NCXA 2NXZB 2YBRA 1E90A 1JHKH 1TJMA 1RQ5A 4HHWA 5T1LB 4PJBA 2AXWA 5LN4A 5T3XE 3GEFA 4P4RB 2XKUA 5IMKA 2Z8RA 1FV1B 4AJ0A 2PCXA 5KANG 3ZE1E 4JZNA 1KYOK 1A3LH 5HYEA 2B59B 3NP3A 1AS8A 3VXMB 1TMQA 2Q6WA 3DUHA 2X4RB 2R2BB 1A14L 1LNUA 1ZHBA 4AC2A 4EXKA 1F02I 4O58L 4FQPA 2GJRA 4F8TA 3ZTEA 3CBRA 2JB6A 1NUFA 3L3JB 4U3XA 5E95B 4OF8A 3OLGA 1MJ8H 1RHHB 4YQXH 1JIBA 4GG8A 4LSPL 2E6QA 3MODH 2D31A 3AQYA 4U2YA 2BS71 1TT6A 3PL6D 3V52H 2VLJB 3D25A 4LPXA 2AJ3A 4AM0A 1T1ZA 4ZMNA 1T03H 1G43A 4P5KB 5DMGD 3VFPA 3QQDA 4PP1C 1AE6L 3DURB 1LE9B 1E7UA 3CK0L 2XQ0A 3JVGA 5LGJB 4ZO9A 3RPIA 3VXUD 1F3DJ 3E9TA 4JFDD 3OHXC 4BXSV 3MFFA 5I16B 4LCVA 4N22A 4XNMA 3OR6B 3RX9A 3FBQA 4K7PX 4KU1A 2WBJB 5INDA 5EUKB 4QXTB 1JZFA 1E9OA 3JYBA 3ML9A 4GXVL 5FW8A 2WQAA 4DFHA 2BJML 2IIJA 5CGYD 3B9KD 4R0LA 2HVJB 2W65A 4Z3IA 1Q0YL 4UWQB 3F7KA 5FF6A 4K3DL 3GSOA 1QLFA 2AP2A 2D7MA 1R4XA 2XTJE 3ZO9A 4O4YL 4XNXL 2XFXA 1QVOA 2E7LA 4GMTL 1DSWA 2WOBA 2M1KA 2BVUA 3HZYA 3CH8A 4DQAA 2PWGA 1XGPB 3EHBC 4MJHA 1NGZA 2G9KA 3ESMA 2V17H 3O9WC 4R83A 1GCYA 1EX0A 3UEZA 1XR8A 1MRDL 4L8BB 4HCFA 5I30L 1PU0A 1JGVL 5KVFE 5CKAA 1UH4A 1X5ZA 4R2GD 4P2OD 5SWZE 1QW9A 1GKOA 3T09A 4LQ1A 2RR3A 2Z35B 3D09A 1MLCA 3N5AA 5HPMA 5KVEH 2VR6A 4LSVH 1JNNH 1I75A 4WKXA 1FG2B 2CO4A 3RJDA 4AYSA 2OL3H 4S1RL 5D93B 3P0VL 4TL4A 1B4TA 3QJZA 2Z4TA 2WXGA 2A6DB 2A6IA 2Q76B 3O4LE 1BXAA 2A83B 3HHSA 4KTDH 1G9EA 2VMEA 3BKJL 4ZK8A 4OZIF 4MMZA 5B4MC 3C5JB 2E7LC 2BNRD 3BP7B 4DKEL 1M71B 1CFBA 1ZK9A 5F21B 2VDNL 3F7QA 4XBGA 1JV5A 5CN2A 1J1OH 4FTDA 2Y7LA 3WIAA 2M26A 4FCAA 4JFDA 1KTDB 4NWTL 3HS8A 3PQYB 4G7YL 3FAXA 4ELME 3QDGA 3SDDA 3TBCA 1AIZA 4H0LC 3PFQA 3WAJA 5T3ZE 2WWMC 3IU4H 3ROOA 2YAHA 1U8IA 3JTTA 3TPUA 4Q2ZB 1KLGA 1ZJBA 1INQA 3CV5A 4KMTL 3GBMH 4O02L 4TUOA 5J0BA 3O6ML 4LPUA 5FA4A 2X9XA 4Y5YC 3NJIA 2W0LA 1SJMA 4X9GA 2OX5A 5EC2B 5JXEC 3WY1A 3FMGL 3D0VA 1KLUB 1AOHA 1ZT4A 2J6EL 1W91A 1AGDB 4KROC 2WVVA 4ZPVB 1RJYA 4NO5A 3HCVA 4BIKA 1JMXA 32C2B 3K4DA 2PCFB 3LCYA 1DBJH 1U8KB 1WSST 4FERA 2OL3L 3M1BB 3P0VH 4H8HA 4I48A 5HYSG 2J5WA 1U8HA 2J2ZB 3ZOAA 3QUMH 4ZX4A 1CI5A 3N0AA 4D7PA 1RULH 1TNNA 1EQWA 2GC7C 2QADD 3FTZA 3RZCA 4KDWA 4WF7A 3DRQA 5LHDA 2H32A 2QSQA 3T6QC 1UH3A 3E8UL 4ZO8A 2YGOA 1MKFA 4HH9B 4Q4IA 4FZ8H 4X9IA 3U0TA 3VI4A 5ID1B 2XA8L 2ZX6A 4IBSA 3F01A 5DLLA 5CP3H 1TTUA 4WK2B 3FOMB 3GLZA 4OIAA 4LB8A 3PXJA 3K2KA 3VXSE 5LXGH 4IBVA 3QQ9D 1FF5A 1QX1A 1I9EA 4QHMA 1BWWA 3CDYA 3H7BA 2IDUA 1SEQH 1XXDC 1IUZA 3GBML 1ZV5A 3GJEB 3MV7A 1A7QL 4HF5L 1SDDA 4HFUL 4YR6A 5IV2A 1GJIA 4X6DE 4HPOL 1U2HA 1RP9A 4PRHA 5J6SA 3CDGB 1YNKH 1HE7A 3BSZA 4QRRE 4LHUA 4PRIA 3WN6A 5IB3B 1FYTB 1W8OA 3FRUA 3B7RL 1MFBL 4M43L 5F89B 1SY6L 2BFVL 2O5YH 3SE3A 2W0PA 3EGDA 1HQRB 2EE9A 1FWXA 5FV2A 5TE7L 3ZDYF 3V6OE 3NZHL 3BZDA 1QASA 2R0ZL 1HH6A 4JDTH 4K71C 4U6XB 3QI9B 1FLRH 3WGUB 1IKNC 3BDBA 4IGBC 5BVJB 5DHDA 3V8CA 1FP5A 5DURB 3V5DB 4U0QB 4WUUB 5GISH 3C5SB 2IQAB 1HYRC 2YR3A 3TT1H 2VDOB 1TZHA 3HMWH 3MYJB 3IWVA 3VQ2C 1UCBL 2ZOKA 3C2SA 1NGXB 4HUKB 2B5IB 4Y8DC 1RK0A 4WFGD 3CHPA 3H42L 1GYUA 5GGTL 4Z7WF 5CUSL 4OBSA 2Z8SA 5KVFL 1QWUA 3OPZL 2L7JA 2G0KA 3E0GA 4M3JA 4MS8D 1KT2B 3ATAA 3L3HA 4IOFC 4ZTOH 1N5YH 2YPKA 3NN8A 2W0FB 2K4AA 3SOBH 2DQHL 5IB5B 3JZYA 4YPGA 5AL8A 2YAOA 1SLXA 3FO2A 4M48L 1HOCB 4FEMA 1NCGA 5E8EA 3WLWD 1JHTB 4EEEA 5H37G 2LT9A 2FNWA 1EIBA 3LKPA 2VH5L 4WY7H 4NWUL 4WI3A 5AYQA 2R2BA 3SO5A 4L3CB 4MYWB 5DWPA 1DO5A 5GPRA 3DOSA 3N1QC 3QHZL 4FQ1L 2WXQA 4UIKH 3BP5B 5FW6A 4ATTA 4W9FC 3VA6A 4V11A 1YSOA 4OGYL 1HL5A 5CEXA 3B9KC 3L5IA 4ERSL 1V3KA 1QFWI 1W9XA 4KRPB 3ZPDA 2VXUH 4B9PA 3TT1L 5I6MA 5KBPA 1F8TH 3BZEA 5I0YA 4CVZA 1HWGB 3HC3H 1RH8A 3L7FB 4H26A 4JG1L 1F11B 2WSKA 4PIBA 2FJGA 3KBHE 1JZEA 4KVPA 4RAHA 1IAKA 5EUOA 2XY2A 2HB0A 2D03H 4MBRA 2NSXA 3H0TB 3IETA 4JFHE 4P9HL 3MQIA 3QH3A 2WV3A 1U42A 5D2NB 5HI3D 3KLAB 1JGIA 1SEBA 3TJEH 3WTWA 3D8MA 5JHDD 3GXTA 3UYPB 4XXWA 1WWAX 3N1PC 4OD2B 3QXWA 5AKVA 2NY7H 1NBZB 2YC1B 4LHJB 4N5UA 5E5MB 1U3JA 2Z93B 1KV7A 2EYSB 5FDWB 3V0DA 5IEKB 4ZMPA 4P59L 3GSOB 3P69A 1BFVH 4TSCH 3F7RA 4XAWL 3RL2B 1A3RL 4AQZA 3LPWA 2W9EH 1E8WA 4YSTA 1KYOJ 3G08A 1I9JL 3MJ9H 3PWJA 1IGCH 3IJEA 4H8QA 4S1DD 3OSVA 3QPQC 4YSAA 3WNLA 3BSZL 1JD9A 3N42B 4M7KL 4NJ9H 3QIBA 3HI5L 1I7ZA 4FYTA 1A9BB 1MZYA 2NCEA 5SX4H 3ASWA 2BSRA 3NIFB 1GTFA 3ZKMD 3LVEA 4LLYA 2VQ1A 1FPTL 2X4PA 4NC1E 2OKMA 3VXUE 3B9KA 2Z35A 1R47A 5FK9B 1J0KA 1Q94B 2D4DA 2FT7A 4X5WB 5J1TC 4EUPB 1VFMA 3FUNA 4Z7NE 4L3EE 5EV7A 4OF7A 8FABB 4HWBA 3FO1B 4TV3A 3RA7L 5IQNA 4PLKD 3HZ3A 3GXMA 5IBUG 5GS1B 4NOFA 3UAAA 1P7KA 1K5NB 3BIKB 4OSUL 3AWFA 4P4RA 5IMKB 1CDHA 1FJ1B 2WP3O 4XNBA 1S3KH 4XMKH 3RVXC 4PJEB 4CVXB 3O4OC 1VGEH 1YEKL 1CK0L 3AS1A 3HR6A 4PCYA 3RKDC 4U49A 5DJ2B 3AM8A 2DH3A 3VGFA 4PAZA 4ODVH 3EZ8A 4H1LA 2G5UA 2EDNA 3WIIL 1MCJA 1CXKA 4UM9D 4FNLL 3SPCA 2KUTA 4MX7B 4OGZA 3W0WD 3WO4B 1QNIA 1IGJB 2AK1H 1O7SA 1TETL 2GFBB 3ESVF 3O11B 5JPNC 3W9DA 4KV5F 5DD0L 2X2UA 4BXVA 4JN1H 4R4ND 5AW2B 1K2DA 1C5CL 4XMLH 5TQ0L 5CN3A 5BMFL 4IKLA 4WFHD 5JNYA 1JTTA 2N1TE 3O41A 2EC9T 4H2AA 5EC1A 1E5BA 1KDIA 3MLZL 1T6VN 3NSXA 1VFUA 3QIWB 4QAMB 3T0EB 1T5WB 5JHLL 2DIEA 4EN3A 3A47A 4LK4A 2HUEA 2ZTBA 2YIHA 4S2SA 4KK8C 2DQGL 4ISVA 3MRMA 1WH0A 2IDSA 3ZR5A 4C4BA 1DBBH 1GSKA 4OV5B 3ARSA 5GRJL 3GIZL 1JOIA 1GSMA 1A7NL 3LKOA 3WS3B 3G5YB 4KHXL 2YEZB 4F33A 4WI7A 5C0JB 2FGWH 1PLBA 4FQIH 2BMKA 4L5FL 4X80L 1JSYA 4BFJA 3H85A 2XC8A 4HWZB 2VNCA 4GRLC 4J39A 1JGEA 1UQSB 4MMXC 1EV2E 5F7YC 5I0ZA 4M8UA 2PO6D 3WSQL 3LNEA 5K39B 3FJTA 4QNPE 4TLKA 1DSFL 5TPWL 4ORZC 1NBVL 4YFEA 3F85A 7PCYA 3K4ZA 3CDGA 4HEPG 5EZIH 2ZPKH 4HCRA 4LHUB 4PRIB 3ZR6A 5I1GL 4IOIB 5C08B 3LS5H 3PV7A 1D6VH 1RIVL 1ACCA 1ZRUA 3TOPA 3C09B 5D70L 4XMWA 4HHGA 1EAJA 1YEHH 2HFEB 4BEIA 1H3XA 4X6CE 1T89A 5ALBH 2AQTA 1JWMB 2X6BA 4ZRGA 4WEUD 4ONFL 4YNYB 1MFUA 5TD4A 4FFVC 4P0DA 5L0QC 2ETWA 5DD6B 4Z7NF 2C9QA 2CJSA 4F2ME 5IJVA 2X4QA 2G3XA 4HAFA 5EWIL 1RZIB 1CD8A 5I66A 1G9NL 4R26L 1DBBL 3VVWA 4GY4A 4D3CH 2H6PB 2GTWB 1FHNA 5DMIH 1AQKL 4R6UA 2NTFB 5DUPH 4HKJB 3V9CA 2NNAB 1F3RB 1Q9KA 2R4RH 5F7EL 4P5TA 4RRPM 3RIAK 4IU2A 3SJVE 1LLAA 4QNPF 5ICUA 9CGTA 3FB6A 4I9WD 2VDQB 4Y5VA 1F4AA 5AW0B 4KRNA 5KN5A 2N7SA 3IPEA 2TRYA 1FZOA 3VDAA 3L3HB 4Y2DC 5GS3A 4MBOA 3EF4A 5GZOC 3U25A 5I5RA 3SKNB 1XMWA 4RBPK 5EORL 1KBPA 5FUCC 4FNTA 2ICES 2X87A 4PVBA 1NJ9B 4N8CL 1WF5A 1PZUB 3GHPA 5GS2H 4GKLA 1MW0A 2VDKB 4X7CC 5SX5H 2G2RB 1LEGA 1MRFL 5I1JL 1A4JB 3PDDA 4BZ2H 3VXMD 1JYWA 3QEHA 3HC4L 1KCSH 1YEFH 1VADA 4JRYD 1F56A 3QS3A 2DV6A 1KF9B 3PHAA 3UAEA 2MOQA 2YD5A 2XG4B 5DURD 1GJWA 2BINA 1DBMH 2JIXA 4QDGA 4OFVA 2Z1KA 4FXGC 2KPNA 2CO7A 4X6BB 3H3KA 2YO3A 4PMFA 1B4JL 4XPGL 1KCLA 4B5ZA 1FAIH 4NQEE 3IU4L 3NYKA 1BVKB 3ZE1B 5C0AD 1CJYA 1EDQA 1XZ0B 3REWA 1KTLA 1F4HA 3WKQA 4MZ3A 4W81A 4TRPH 1MCHA 3FT2A 3JTSB 3VRLE 4LLVB 1RU9H 4LLQA 4KV5E 4NUMA 4KKBD 4PJ5A 4R5XA 1JZIA 4G42B 3KLQA 1U8QA 4G1MB 2EDWA 3S8FB 2IV9A 1BREA 1DN0A 1AS6A 1KFAH 3OJMB 1KN4H 1Y1UA 1EPFA 3UROR 4XN4A 1B3IA 5TDPB 2H41A 5FAAA 2DQEH 1A7PH 1EVUA 2VDMB 3K2UH 4UDTB 4Q9RH 3C2AL 4AITA 2Z6FA 4HALA 4EJ1C 3NSCA 3LRGA 1CGUA 4YL9A 3IFNH 3GI8L 3KBPA 3QUML 4JG0H 4UV7H 5E1AB 4OT1L 4M6NL 1EJ6A 4XVUC 5I8OH 3VSQA 5L2JA 3V5DA 4BZ2L 4PGBA 4XXDB 5E9AA 2DDQH 5D1ZA 5EU6B 5CGTA 2R2HB 3H4HA 3II3A 2ZOTA 4HUNB 1QBLL 3ALWA 1YMMB 1GC1C 3KYKL 4RGNC 1WT5A 4PM1A 4FXKC 4EZJA 1IEBA 2WLZA 2F15A 3S2AA 4AZUA 1MUJB 3HN5A 1OL0A 1CLOH 1UM4L 3GC3A 1D5BB 4G6JL 1RJZA 3TN0B 3UC0L 1BBJB 1WD8A 4CNIB 1LO5B 1RUML 1SUHA 3OR7A 5I8KH 1F97A 1QFUL 4OD1L 4PJHB 2GHZA 2HTLC 3QO1A 2W0FA 4IKNA 3F05A 2MH4A 4JRLA 4MJ5B 1M7XA 3TA3B 2Q0ZX 2EEAA 5I6OA 3WD5L 3UBHA 2YD1A 5DZNA 1T2QL 5B39A 5GGSB 5DWUL 2KT6A 3MYZA 3N41F 4PJFB 5AW8B 3TA4D 4I4WB 1OGAB 5HGHB 2FO4B 5DA0B 1XIWB 4JDZB 5IESL 2EXTA 2IH3B 2J7LA 1J5DA 3ZKQD 3QEUA 1T66D 2WXKA 2OP4L 4KQ3H 4BHUA 3II1A 3IMVA 1YN7B 4CKQA 2MRYA 4L0ZA 2EUWA 4U1LA 3CX2A 1WGOA 4JHAL 4FQXD 5J9PA 4HV8A 4DAGL 3RUGF 1R9FA 5B3SB 1U91A 1OCOB 3GHEL 4YO0A 3NFNA 5HHOD 1KGCD 2UVEA 2L04A 2ADIA 3VH8B 1ZA6A 1OZTG 1NFIB 2CUMA 4CSPA 2X42A 1IAIL 4OLZH 2BDNL 1G0YR 1INDL 2F61A 3L9BA 3VD0A 1KB9K 5JIIA 4PJXE 1X5KA 1QP1A 2LE9A 4BDVB 3IMUA 4Q9CA 5BOZG 1IKNA 1NC4A 2NQ3A 4JUSA 2FUQA 3UYPA 2DBJA 4O4YH 1PY4A 4G7SB 3WD5H 5FC9A 3VGAB 1RFDH 5E00A 3RL1A 3E8VA 1MVUA 2EVFA 5E9DB 1DQQA 1G7IB 3FSAA 2ZSVB 5SWSA 4FS0A 4WWKB 1HHKB 1D5XB 4ADIA 4NGHH 1BF8A 3PXHA 4H0GA 4G8FB 3BIBX 2VDMH 4OD3H 3FQ2A 1ZHKB 4MYPA 4LKCB 4PJ7F 2W9DL 2EZ0C 2W9LA 1P4BL 4FGMA 2WQVA 4WK4B 4YE0A 5FB8B 1JGDA 3D3VE 4NZUH 4KVNH 4U1JB 3QXTA 3S96B 4AYID 2H3NB 4DAGH 4X7FC 4LEXH 4IHOA 4AVJA 4UAHA 3GRWL 4CC1A 1PY0A 3SB3A 1G7JB 5ABZA 4J8RA 2VLME 5PAZA 4AMKH 4JRFA 4CC0A 4DOHE 1NA8A 5CCKH 4RDQG 5GS1A 3V79C 3NEXA 5D7LE 3CDZB 1OGTA 3UBGA 3L4UA 4K5NA 4Y4FB 3AMKA 1J0HA 2CKBH 2CZNA 2AV1A 4UM8A 4LF3A 2F58L 1J86A 1G4MA 4DPCX 2HPTA 5A7EA 3MV8B 2BIOA 3DGGA 4RGOH 1CDUA 5B22A 4AE1A 1VB9A 1RFDL 4Z7QF 1R3LB 3BAYA 3V0VA 3VFVA 1ZHLB 4R96B 1OT4A 4N4YB 4TKWA 4UYPA 5IBTH 5L6YH 3D50A 2HVKA 1UZ8A 2Z92A 2LLGA 1G1KA 1U3HA 4GRLD 4HEPA 1GC1L 2J6EH 2Y23A 2XWJB 3OJVC 2XXMB 3SE9L 2RHEA 4X5RA 5CILL 2XZAL 1IKOP 4GQZA 3US0A 1B0G