3KLQA

Crystal structure of the minor pilin fctb from streptococcus pyogenes 90/306s
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
137
structure length
137
Chain Sequence
STVQTSISVENVLERAGDSTPFSVALESIDAMKTIEEITIAGSGKASFSPLTFTTVGQYTYRVYQKPSQNKDYQADTTVFDVLVYVTYDEDGTLVAKVISRRAGDEEKSAITFKPKRLVKPIPPRQPDFPKTPLPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative pilus anchoring protein
publication title Crystal structure of the minor pilin FctB reveals determinants of Group A streptococcal pilus anchoring
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
total genus 18
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12892 FctA Spy0128-like isopeptide containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3klqA01
3GLDA 3GLEA 3B2MA 3KLQA
chains in the Genus database with same CATH superfamily
1M6UA 1P5UC 3QH3A 5I5MA 5HI4C 5DJ8A 4LCYA 4FXKB 2R9HD 5I1KL 1TJXA 3BW9A 4L5FL 4CDGC 4DGUA 1IC4H 2JVUA 3BH8A 4DEUA 3HW7A 1M56B 1M2VA 1CGUA 1P6FA 2SODB 3H9HB 3IF1B 4FD0A 5E4OA 1SLVA 3II2A 4K3HA 3RZCD 5FGBA 4CMHB 4Z5RA 3K2MC 1S7UA 4HWEH 4JFDE 2ZP8A 5IW6A 1OHQA 3BAYA 4AJYV 1CLVA 1GGCL 2R4SL 1FFTB 1AD9A 3GEFA 3FCSA 3FCTB 1CXKA 3QIBB 3E1ZA 3QQ3B 3L3KA 4FQHA 2EEXA 2QEJA 1JTPA 1KJ2A 4JFDD 3PWJA 2ENPA 3EXLA 4XNQA 3CN3A 4A7GF 3MOAL 4H1LA 2XX1A 2ZXBA 3TH2T 1ZS8A 1IZJA 2W0PA 3AGWA 4LOEA 3P73A 1U8OA 3H9SE 2JMRA 4MXQC 4QHLA 1J0IA 1R0AH 4O02B 1AP2A 3RBSA 3MJ9L 4UILL 5JUEL 5FDYA 3HNVL 3RVUD 1LLAA 3SDCB 3N91A 4PGDB 1ZXQA 3PGDB 3H9SD 1PU0A 1DANT 3C5ZB 5ANME 3A21A 4OJFH 3CV5A 5F7LB 4YSUA 3JSSA 4GW1B 3K4DA 5ITBH 3Q9PA 5EZIH 1Z0NA 3HE6B 4A38A 1CF8L 4QXUL 1NGWB 5GGUB 4C57C 4Y5VA 5CJXC 3QB7C 3LKOB 4PWHA 3UBXI 1P4IH 1BBDL 1R5WA 3ARED 4FKEA 1CD1B 2COVD 1UD2A 4A2FA 2Y07H 5FOBA 1JPST 4R26H 2B0SL 4NYLA 2EUZA 2Q3AA 2O5YH 3QORC 1I3UA 1WJ3A 3PWLA 2J1ZA 3I3BA 4LLQA 1D7FA 4MA8L 3BWAA 4HG4K 2OSLA 2VDOB 4FE9A 4NC2B 2CD0A 3L95A 4Y2OA 3EFOB 4NQDE 2OL3B 1FFQA 2DIBA 3RY6C 1JPFA 3AACA 4HKXA 3X3FL 1YNLL 1UUNA 3QXDB 1A6WH 1DDHB 4AEHH 4AQ1A 1T1ZA 3FQ2A 1DUZB 4NQDD 4CA4A 1QNZH 2EICA 3HNSH 3EO0B 1AR1C 3NZSA 2YN3A 1HL4A 2DQHL 2J5WA 5IREA 3Q2VA 1X9QA 2BIOA 1HWGB 3LZNA 4JMNA 4PMFA 5D8JH 3NPSB 2E7LC 4K3EL 5E03A 1D7BA 2F19L 2V7HB 5K1NA 3QUML 1A0QH 3D07A 1HOEA 1E50A 4Z0XB 4PV8B 1FFNB 1ZIAA 1G7JB 5J56B 4FXTA 4LEEA 1PQZB 2P5EA 4X0KA 1KY6A 3LH2L 1SMOA 4N2CA 3U9UA 4I3RL 1M42A 2V8MA 4PJDB 3PJLA 4YFDB 5H2BB 1QATA 4APQD 2AAAA 3UTQB 3QT2A 1IQDA 1G7MB 4EN3D 5L6YH 1A1OA 3ARGC 4LSTL 1U42A 1JNLH 2ZKMX 3QJOA 4LHUG 1BVLA 2NY0C 4WJG3 3F6JA 4LCCA 3OR6A 4TNWK 1HZHH 2EDXA 1A3RH 2LE9A 4JY5H 5F70A 1F0LA 2I9TB 5HVGB 5E4IA 3OKKA 2HCZX 1MFCL 5EOTA 5IBLC 4Q56A 3WNKA 4JFEB 5IVXA 2J71A 2IG2L 2ZD0A 3HRZA 4JM2C 5EBLB 2N01B 4F2MB 1BM3L 2ISDA 5EBWA 4ZS7L 2GEEA 5AAWC 4LRNL 4XWGL 3ZYIA 3BMWA 3K72A 4MSWB 1F42A 1PD6A 4PJXF 4S10A 1YEWA 4R4FH 3SJVB 5DWUH 1WITA 1WFJA 3VFWB 4IEFB 3B8SA 4AQ8A 5FA4B 3TZVA 4EXKA 4LL4A 3FN9A 2WNGA 4XRCA 1SN0A 4XH2A 4ZT1A 4XMKL 1YMHA 2AXGA 2FSDA 5EEWA 5IMOA 5AW9B 1LGVA 3FF8A 2WD0A 2AJUL 1RK1B 3LVEA 1BA9A 1YEFH 3KPQB 4ONFL 3T65B 2R1XA 3WLWC 1WT5A 4IMKC 4IRJB 4KHXH 4PJ6A 3GNML 4WTZA 4WRLA 3MRDB 1U8PB 5EO1A 3QRFM 4NFBA 2Q2LA 4H0GA 1N59B 4NQVA 4YHPA 2NW3A 1EBPA 3E3QE 4WW2B 3BIKA 2MKWA 5IJBC 3QWRD 5E8PA 4AITA 2HKAA 2V2XA 4ZMLA 3ECWA 1NLBL 1T5XA 1G87A 2F5BH 2EIZA 4TN9A 5BRPA 2XWCA 2ATKB 1J0JA 1PYWB 4YXHH 1A6TA 1D9KD 2P8PB 2VXVL 4TVSa 4YHZL 4E0RA 2FCBA 4P9HH 3RWDB 3KBHE 5D1XA 2VH5H 1RUAL 2IPKB 4P4KB 1PLCA 2AEQL 1ORQB 1NL0L 1T1WA 1BREA 3I02B 3K6DA 1YNKL 3VXUB 1KWGA 1T4KA 4QYOA 2FR4A 1B3JA 1BWWA 3C08L 5JIKA 1JWUA 1YEGL 1WH0A 5KSVB 5SWZA 4GRLC 5HDBE 5J6SA 1IAOA 2BINA 5AQ0A 3MRCA 3KYOA 4WU5B 1I85C 5I1DA 4IBVA 3F7VA 2VMFA 1H5BC 3KM2A 3FUIA 1RK7A 4I0PA 1AYRA 2JIXB 4NRYB 1FAIL 4XPGL 3VH8G 2Z8VC 5DHDA 3RZWA 1OAQL 1GYCA 3LHPL 1CI5A 4L8BB 3UYRL 2J72A 4J1UB 4AIZB 2VW4A 4G8AC 3T3MB 4OIFA 5GRWA 4ZW3A 5C6WH 3HAEB 4HFWB 2G9HB 1D2PA 1EWHA 1X6LA 2VL5A 4JCLA 1IMHC 3T77B 1L0QA 4P23D 4Z7UF 3SKMA 3FRPG 4UT9A 3GMRB 1OP5K 1INDH 4PRHB 1ACYL 4HWUA 1QSZA 5HHPA 3LEXB 1IL1A 1DVFC 2AEPL 5C8JB 1Z5LA 1MCBA 4JPQA 3ARQA 3U6RA 4KMQA 2CDEB 5C0CB 2DLTA 4HZAA 4KV5F 4ZPVB 4JO8A 2VDKB 4K94L 1QUNB 4MX7A 1G1OA 1KYDA 3P9LB 4G2AA 4CSZA 4XT1C 8FABB 2BSSA 4YDJB 4XB8A 5C09A 2FJGB 5JXEC 4FXLA 1ETA1 1NCDL 4TUJA 1PSKL 1HT6A 4RMQA 5B1JA 1CCZA 2OSXA 2WVSA 1IV8A 4PRAA 4R9HA 5CIPB 4HIIB 1YC7A 3DDGA 3QFJA 4WKZB 5FGSA 3WNLA 3NSXA 3QQ4A 4U3SA 1UXWB 1TEYA 1M7XA 3EDKA 1OSZB 5TDPA 1YPZA 2X9XA 1U41A 3WFZA 4YGVB 4UM9A 4Z7QB 1K2DB 1UOLA 1CGVA 1TKWB 2UVEA 1N64L 4NWTH 3H6JA 5AW8B 3V5KB 4RWYH 2X9ZA 3GSWA 3LZQA 2UXTA 4GW4B 3RNKA 3EYQD 1KBVA 2VERN 3CHSA 3VSQA 3TN0D 4OKVA 3L3OB 3BUYA 5FLUA 3L4UA 4QMEA 1J5HA 4HIXL 4AY0A 4PCSA 1B0GA 5HPOA 5C0EA 5LNGA 4K73A 4BWWA 3VFGL 4C4BA 5DO2D 3KWVA 4ERSH 1PDKB 1IAIH 3ULVE 5DJYB 3PU7A 3ERXA 2FYYA 2NY5L 3OKOB 5JW3L 5FGCB 4WK2B 5H35A 2AVGA 2WAQA 3S8WA 3Q8CA 1JN6B 2J8HA 4FFWD 3HB3C 3IDGB 5D7LE 2YUZA 3C2AH 1F00I 3ULVD 2XBDA 5HYSA 3QEGL 2HLAA 1AZNA 5B3SB 4UANA 5GRZA 1YN6B 2Y25A 4NRXA 3U48A 4F20A 4JFZL 2WOBA 4ZMVA 4YVUA 5LG1A 3MXVL 5D7LD 3KPPA 1E5AA 3QXUA 3BPOC 1U8IB 4KH2A 4NQSA 4R8WL 1LO0L 1WIUA 4R0LC 2HSIA 4GAYA 3WJJA 4C8XA 1S7QB 2Y1ZA 4ZSOA 1BVNT 3QEQB 5CUSL 3CN1A 4PJIF 3A3YB 4QHUA 1TZ8A 1M7DB 2C1PA 3QDMB 5I6PA 2VLJA 3JBG7 3VI4A 2JLLA 1ZLSH 2NNCA 3OKNA 5C0BE 3PIQA 4B7LA 2EC8A 2ZX6A 3WGUB 2CAKA 2A4CA 1HNYA 3LQAL 4Y4HC 3VD4A 3LRGA 1MFAL 2HRHA 3IE9A 3U7YH 1IB5A 4BKLA 5IHUL 3V6FB 4W68A 1CK0L 1N8ZB 1YEDB 1EEYA 3KYNB 5C0BD 2W80C 1P84K 3TF4A 1A7RL 4NLHA 4PJAF 5HHOA 4XCNB 3SY0B 5L4MA 2RR3A 2Q8AH 4U6YA 1U91B 2XQYG 3WAJA 2FQEA 3D1MC 3BSZA 3TBYB 4Y4FC 3S8GB 4O2CA 2MSPA 4JN2A 3WN5A 1MHHA 1S7XA 1GY2A 3K7UA 4YHLL 4DPBX 4U1NB 4QRUB 4Q74A 2X4UA 3DYMA 3QDGE 2I9LA 2EDQA 1LK2A 2OLDA 5CJQH 4YHYC 4MJ2A 4NUGL 3GRWH 3UGXA 5E0FA 1T6VN 3R0NA 1T2QH 4J23A 4D3CL 5DT1L 3C6SB 3MBXL 1BYNA 1DQTA 2C3GA 2GSIB 5IK3A 2XKSA 3N40F 4D9LH 3QDGD 1MFNA 1VADB 1KXQE 4N85A 3EGXA 3VNZA 5GSRA 3L4VA 2ZUTA 3VFPB 2P1YA 3RDTB 4P2OA 1QSVA 4MDJB 4B9IA 3M07A 1CICA 1I3GL 2K6WA 4TVPH 3VFTA 3QYCA 1WZ1L 4X83A 3EG9A 4FQCH 1CG9A 3QRGH 1IGFH 2JJTC 5EU6B 1NCCL 1ZTXH 5ABZA 1Q72H 1DQLH 5I1HL 1IM9D 4NNXA 5DJDB 1IEHA 5B38B 4CMMA 1OZUA 5DS8A 5CLXA 3U1SH 2HX9A 3MDJA 4YPGA 2WKLA 3KLAA 3Q6FA 3G5WA 2XVKA 1RZKC 2A9CA 1KTLB 1GMIA 3NG5A 2WLIB 3TVMC 4PBDA 4YSAA 3HG1E 1WA2X 1G0YR 3LNHA 1JNHB 4JG1H 4GP4B 2KBGA 4LLDB 2HUHA 2GY7B 1C1EH 4FEMA 1OARL 4XVSL 3L3JB 3ZO9A 4WLCA 1LD9B 3KXFB 1I1RA 4AWJC 3CZLA 5DF0A 3NGBB 1A3LL 2C9UA 4F33B 3HG1D 4OCYH 4WFFE 2DQUL 4AENB 4LKXB 5EIIA 5MEPB 4ODWA 3B7RL 4ZNEE 1YDPB 1RJZB 2VDKH 2DIEA 2E3VA 2RQ8A 3L9RB 4YIQB 5GZND 3RFZC 4UI2A 4DP1X 3HZMB 2YPVH 4CSPA 5EUOB 4WFFD 5AUMA 3ESMA 4YBLB 5JW4N 1IKNA 3B9AA 1QFPA 4NJ9H 4LSRL 3CVHB 1GJUA 1R46A 3P9MA 3WIAA 1LNUA 2PP8A 4EXPX 4BUQA 5FYLE 1PZUB 3BDYH 1H0DA 3MLTB 4YHNB 2ZAIA 1MW1A 3OBAA 3NUKA 4IIQC 4OCMC 4WWPA 4HIPA 5FV1L 3TA3B 1QQDB 4P04A 2CUIA 2BWDA 2D9QB 3CZSA 5E8DL 4AMKH 2HWZL 2PYEA 3FSZA 3C5SA 5I26A 2NR6D 4MA7L 5FYLD 3VMNA 3HR5B 4YR6A 4Q9QL 4PJGE 3NT0A 1BQHB 3ZMRA 4ODSL 3GMMA 1MREL 3EYVA 1F4WH 3P4LA 1CDHA 3D3VE 3KBFA 4RAUB 3S3DB 3T0DA 5HGHB 3SPGA 4I48A 3RPIA 3AXHA 2EO7A 3IETA 6TAAA 1I1AC 4DUVA 3D2UB 1HXMA 1ND0A 3FB7A 3QCVL 4Q6YA 2EDEA 3ZR6A 3JWOH 2C9AA 3MRHB 1NAMA 1WWBX 3D3VD 4L3EB 5F7YC 4QJ5B 1YEIL 2FO4B 3V0JA 4DPRA 5IQOA 3VGAC 4Z7NE 4G3YL 4X6BA 3T3PB 1OAYL 2UXFA 3QK0A 4ZW5A 5PCYA 3US0A 4A37A 2NQDA 4PLKC 5E2WL 3QEUB 4R97B 5D1ZI 2F7RA 2J1WA 2WIIB 2O1AA 3B5HA 3DSNA 3OJDB 4M29A 5GPRA 1IZKA 1WD8A 3IJHB 4GLRH 4AG4H 1UCBH 4LPXA 2E6QA 3JWDC 4UOQA 2IAAC 3U4KA 3JT2A 4ENZA 1JJUA 2UX6A 4V33A 2FIRT 4MTMA 3T4AC 2DLEA 3OAZH 3EYUH 1INEH 1KG0A 3PWVA 4TRPH 4LPVA 2ZQKA 3HMXA 4H8WH 5HY9B 1PNDA 1ULVA 3VFRB 3ATAA 1OANA 1SMDA 5BXFB 5DK2A 5CEXB 5IEHB 2GCYA 5C0IA 2OZ4L 3MV9E 2B4CL 4JPVL 1TEFA 5JIHA 5F7UA 3NZHL 3NP3A 2Z3FA 3VXRB 3QIWA 4P23B 3RWHB 4X8CA 2C9XA 4PJ7F 1OP4A 3LXAA 5AB9A 1F3DJ 3MV9D 1DFBH 4B53A 4MD4B 1LK3L 1F58H 2VERA 1HILA 3F84A 1A5FL 4OR1A 3WKMH 1AS7A 1AQDA 3S5LG 2YLKA 2BLFA 4YJZL 3QWOA 2DM3A 3CFCH 1N7MH 4F8PA 4XB7A 2H9GB 4MJJA 2XY1A 4J27A 1YECL 5AOKA 2YXFA 5J3HD 2BSRB 3MUJA 3O3EB 4RGNC 1KYOK 1BIIB 4P57B 4POZD 5JQ6H 2GT9B 2BNUA 4NGHH 5D2LA 3CPLA 5FYJE 3O6LH 3BGMA 3P77B 1EAPA 1PFCA 4TTDC 4NN7B 4A04A 4UNVA 5BUGA 2EE2A 4MZIA 5BVPL 3LEVL 5SWQB 4G9FA 2DMHA 3W9DA 3E1F1 4CJ0A 4DP6X 2W60A 5FKAA 5BZXA 5FYJD 4IOFD 4LLYB 4UT7H 3MRRA 5KYXB 2UUDK 1T83A 2H1PL 3W81A 4CUCA 3RWGA 1AANA 1FVEA 3S3PA 4ES8A 2PCPB 3KS0H 1WEJH 1G7LA 3ENEA 3QQ9C 4NIKB 3TN0B 1OAZL 3UO1H 3QUXB 4GFXA 3LRKA 5IQMA 5JYMA 1OL0A 4KRNA 4QOKA 4KZCA 4UYPA 1NMBL 1EO8H 2I27N 2C1OB 1TO4A 5GS0L 1RU9H 1AG0A 5IWLA 4MNHA 2HJKA 1BZ9B 4ZXBA 3LRLA 4HWBA 4KDTC 5I76B 2F1AA 1E28B 5SV4A 1FN4B 1B4TA 4X9HA 3U36B 4RQQB 2X6BA 1HHGB 5CCHE 3D4YA 5FFLA 4S1RL 2E9IA 4OZHA 4KH9A 4M93B 4NWUL 1JTOA 4W9CC 4DKAA 4OT1H 1KJVA 3KJ6H 1IEBB 2SEBB 4OV6F 4P2YA 5TQ0H 2AC0A 4ODUB 2VM9A 5CZXD 3ZKQD 1NOAA 2JCCB 2VZ1A 4FTVE 1JZ5A 3W0WB 1SXBA 1T22B 4MQ7B 4K3DL 5D7JC 1UWFA 3VW3H 1P7QA 1S8DA 3O0LA 5SX4I 5D1QE 4W9DC 3AC0A 4FTVD 1H8OA 2UZIH 5D5MB 5EF2A 4F7KA 2CRZA 1ZS2A 1O6TA 2NXZC 3PJNA 3GSNA 3VFMA 3P2BA 2VDPH 1UKTA 5IGXH 1TG8A 4UF7C 5D1QD 1HHJB 1YY9C 4YXKH 1OAJA 3MLSH 1VGKB 1SEQH 1CU4H 2XACC 3QQDA 1E27A 2NY1B 1LO5A 4EUPB 5DZPA 1R17A 4Z3TA 4N0UE 3Q8FA 2WV3A 4N1HB 4HUWA 5E8EB 4WK0B 4F7PA 1E6JH 3GI9L 5GGTH 4LAQH 2BIIA 3FO2A 2HRGA 3B9KD 3FQ4A 4MNGE 4DZ8B 5FHAH 3OZKA 1CDBA 1MHCB 5F97E 1JGEB 1KB5A 2XA3A 1KCVL 4W4OC 2EC9U 2DEWX 4QWWD 1OTSD 1T04A 4EDWL 1EDYA 2G60H 1TJHL 2OBGA 5LNEA 1A1NB 4AEFA 1QSFA 4Q2ZB 5I74B 5DGRA 1FYTA 2VTFA 4LEOA 2WXIA 2VLKE 3AWEA 4XBPA 1K4CA 3GINA 4HOXA 4XC3H 1N6QH 1O6VA 5FW8A 3KGUA 2Y24A 4JO1L 4TUKH 1GYWA 1TVHA 1Y6MR 1L9OA 2FQGA 1IU1A 1XQ4A 4FS0A 2F9BT 3HR6A 3HRPA 3H42H 3MO1B 1QLEL 4YE4L 1MRFL 3OAYH 5GSVB 4JY6A 1J86A 2VLKD 3APCA 4YDZA 5LQBL 5ESVB 3PF2A 1KN2H 3TCLB 3UTTE 1SYVB 5K1JA 3BP6B 1KENL 4Q7DA 2IPTL 4TQ8A 3JVFC 4JMXA 3QUZB 4BSVA 1FF5A 1A4KB 1JFQL 5DRWB 1DN2A 5K9QI 4P5TB 1ADQA 4JGJA 3S4SB 3UTTD 3P69A 1K3ZA 2NNAA 1EV2E 1JE6A 3A6BH 3MJ7B 2OCJA 2X4OB 3BX7C 4PTTB 2GK2A 4M8QA 2R15A 1MVYA 2X4SA 4L5FE 3DV4B 2WP3O 1CN4A 1CT8A 2PETA 4NKMB 3S37H 3X11A 3QXWA 4DCQB 4EOWH 2DI9A 4GIOA 4U6VH 3WHXB 4RFOL 5KZCD 2FLBT 1WBZA 3LIUA 4GXUN 4JX0A 4TNGA 4Y4KB 2D7NA 5ICXA 1AI1L 2PR4L 3FQXB 1C5CH 3DJZA 4R3SA 4ZOBA 5F9OL 2F74B 5F7KC 1CDGA 2XA8H 1ZT1A 3ESOA 3HG1B 4ADJA 1G6RA 1OTUD 2B15A 3HUJE 4PJFF 3MRMA 3PL6C 3F01A 4RH4A 1FNEA 4G80B 1GOGA 4PJCB 3BXNA 4NB7A 5EZOH 4W9JC 3BZDA 5C3TA 5LBSL 2X4NB 4EI5A 5J12B 3VMOA 5BQ7B 1I82A 5AB1A 5SWSB 4AUUA 4GO9A 3A47A 2AS5M 2NYYC 4ZTPL 3W39A 1EEZB 1NC2B 5IUSA 1C5BL 1WA1X 3ISRA 5DA0B 4XPHL 1HH6A 3UJIL 1R3IL 5E7BA 1WFOA 1QRNA 2LVCA 2OXGB 1EMTL 4S1SH 5HYIA 2APWA 4JQXC 4L9LA 4YHMH 5E4AA 3REWA 3ECBA 1GJIA 4P2AA 4CVWA 2AJXL 1DLFL 4HJGA 3F7LA 1FVDB 4K07A 4I89A 5B1CA 1WSST 4GG6E 5DYOB 3CHPA 3S36H 1Q1JH 3KDMA 4XNZC 3U0PB 1U58B 1USQA 4KI1A 5DMGD 2H2SD 1KEML 1QWHA 4IGBD 5JLZA 2TRHA 2VQUA 4OLWL 4E9QA 2AHIA 2RH0A 1C5DB 1PTZA 1E30A 3E2HB 4NKOA 3G6DL 4FXKC 1INQB 4M4PA 4OIIL 2C4XA 2F5AH 1TITA 3GIZH 4XC1L 3FYEB 1E9OB 1SVBA 3BPNC 2X0VA 5GIRB 3QO0A 5T33H 2XRAL 3AABA 4X7SH 3ZQWA 4CJ1A 2R4RH 1JDCA 5KSAB 4OZGA 4E41B 2VABB 3Q8EA 1BG1A 1RZIB 4LCVA 1CGWA 4DK5A 4PTUA 4BCZA 4OD2B 4HPYL 4WV1B 1A7NL 3V6ZA 5CCJA 3ULVH 1SHWA 4P9HC 4N8VG 4P5KA 3C6LC 3PHOA 3TBVA 4MMYA 3QZLA 3FTZA 2O6CA 1ZJAA 1SJVA 3PUCA 2ZP0T 4K7PH 3EYSH 4YLBA 5E7FA 2BP8A 2L3BA 2NY4B 5K93A 3TO4B 3WO4C 3L5HA 3PS6A 2BCKB 5I66A 3NSDA 3Q8AA 4KKNA 5J06A 1ZE3H 5HHVL 3H54A 3ILQD 1W15A 4HWZA 1KIQB 1YYLL 1K3IA 4PRDA 1XH2A 4K23L 1FH5L 5H4YA 3QO1A 1P5UA 2PO6C 5CMAB 4FQQA 2OMWB 3DX8B 4JRXA 4TNVF 4ABQA 2EDBA 3NSCA 1JXKA 1WISA 2C9SA 1HVXA 2E47A 2P5WA 3RTQC 4UINH 5AVRB 4AT6A 3OVUB 1K4DA 1YPZF 4GAJH 4GQ9L 4QR7A 3MBEC 4CSSA 3JUZA 4LHUA 2V2TB 2NUTA 5CJOH 3HG4A 3G5VB 3F12A 3O41A 3X2QB 1PX4A 3LKRA 5D7HA 3MRGA 3FQWA 2VW6A 1VEPA 3D25B 5LDUA 1ES0B 2D7TL 5TDNB 3HE6C 3JQOB 5F96L 3SE6A 4JL2A 2NUPB 3HCVA 5JHDA 1DVZA 1AO7E 1C08B 3A6CL 4UIKH 43CAB 2EH7H 3EJTA 1IM3B 2WN2A 3R4DA 4WUKH 3SE9L 4RDQF 4J3BA 4GQZA 2MOQA 4YDMA 1QASA 1NCIA 2CJTA 4NKIL 4U7KA 3BE1L 5EF0A 4HH8A 4BSWB 1UASA 1AO7D 2Q7YA 3CZUB 2ZG3A 4G42A 2R7EA 3L3DB 3O2DA 2XQYK 3EHBC 2OJZL 2HPOA 1CB4A 1FORL 4FG4A 1YMMA 4AV4A 1NUFA 5DSCB 1F97A 3TYGL 5CSZA 5KSBB 2D2CC 1EQWA 3R1GH 2ZYSA 3DVIA 2M8XA 1NQBA 4BD4A 4GPVA 4XR8C 4JUSA 3ALPA 3PNRB 4E36A 5C0DB 5IJKC 3ZE1F 3F7YB 5I1LB 1MEXH 4UOZA 3AVEA 4JK0D 3UCQA 2PTTA 4XPAL 1LHZA 3OQRA 5F2FA 5F9JA 3AGVA 2PPEA 5CP3A 2G30A 4QRPE 4MJ6A 3T1WA 1UOVA 4KXDA 1Z66A 3H6AA 4CW1A 2OYLA 5JOPE 4L4VA 4U1GC 1UZ8A 1ZLWK 3MUUA 1OM3L 3GSUA 5INCB 4RMSA 4ZO7A 1U6AH 1U3JA 1E65A 4KZEH 5K9OB 2OMZA 1KELL 3QORA 4KBPA 4QRPD 3HBQA 3VI4F 4ETYA 1KC5H 5CAYB 1WZLA 2RB8A 3WEXB 4XHQA 3AU1A 1KCSL 1AKPA 3FU0A 5JOPD 3MPCA 1DSFL 4ZX4A 2GB2A 4CVXB 5JNYB 1V54B 2NCMA 1I75A 3IM1A 1EHNA 2PPAA 2FQDA 2J8UE 4MRBA 1GGBH 4D0DB 3RY6A 1I8UA 4F57L 3G6JB 3CK0L 1UM6H 1YNTA 3AY2A 3P30H 3D09A 1MIEH 4RMVA 1U8HB 3MRJA 4HF5L 4LEXH 2QADD 3GRGA 4X5QA 1ZSDA 4OF3A 1L6XA 1KXTB 1TJGL 2H1XA 1XCQA 5GRUH 2NW2B 2CGZA 1PPIA 3BZEB 1IVLA 1PG7H 1AC0A 4F15C 1TXKA 1E8ZA 2IOIA 4NM8L 4OZ4A 3EJCA 4KK8D 3EW3B 2G75B 3HEIB 4HCGA 2E59A 1D5MB 4S2SB 3IFNH 4MS8C 3KVDD 1OE1A 2QBWA 1PEZA 2XZQL 3RX8A 5FYJU 1FWXA 1U8KA 5JZ7C 4LVNC 3K6OA 5A16A 1HZLA 4Y16C 3EO9H 2B59B 3LNFA 3STLA 5TE7L 4FTDA 2NXYC 3FRPA 3GTTA 4NBYB 2FGZA 4QXVA 4GKNB 3QA3B 5FYLH 5C97A 1M71A 4FA8A 5DEFB 4XCCH 5D6CB 1OE2A 3ARGA 1QEWA 1Y6NR 3T2QA 1Z2KA 1OGTA 2WZ6A 1M6OB 4UT6L 1BWMA 2MHAB 4L8CB 3QC5X 2DQFA 1ZT7B 2X1OA 2NY6B 4FHBD 3V2AR 4RRPG 3O6ML 4CSTA 1FBIH 1GHFL 1WA0X 2LR4A 1OCWL 2FWOB 2A9NL 4J28A 5FHBL 3F2LA 4B41A 3DO3A 5IG7A 2C26A 4HIEB 1I7ZB 1Z9LA 1XCTB 1XSJA 3V4UL 3OZ9L 4JM2A 1J18A 3I9GL 4XP5L 1KPVB 4LU5L 4N2AA 1QNIA 5DI8A 3SKOB 3MNMA 5AAWA 1AXSA 4ANUA 1LM8V 3K81A 5TPWL 1PX3A 2HB0A 3JUYA 1XD1A 3K46A 1RZQA 1CD8A 1L9SA 4WI0A 3N0AA 3LNEA 1MFDL 2MCMA 2BHZA 1NAKH 4KWUA 1IC7L 2HMID 2ZX9A 3GLAA 4YN3A 1MW3A 3VCLA 4PJBB 2OK0L 3OLDA 1ZK5A 5T3XL 3MLVL 3MRNB 4HP5A 5E08L 4IMKA 1IQWL 4PJ9B 3WCYA 2ODHA 1JPSL 2VDLB 3I3EA 1HNFA 2V5MA 3QS2A 4EI0A 3IVKB 4KAQL 2DQDH 2F18A 4OM1L 3T1FB 3C8KA 3JYCA 2G2RB 1ZHNB 3ILEA 1T2JA 2YD3A 4XXWC 1D5ZA 5F72S 3AQDA 1CI3M 5DJZA 5B3JF 4UTBL 4U31A 5AZUA 5JXAL 1ICTA 4PGCA 1XF4B 1LDPH 2QJDA 5KTEL 4ELME 4ALAL 4BA8A 5BV7B 1NCUA 4WFEE 4Z7WE 3K1KC 4LCIL 1Z9NA 4M5ZL 3SQRA 1J10A 4IMLA 2VKWA 2Y1AA 4ODTL 3FQ1A 4FFVD 3ARTA 1NEZA 1NIFA 4M03A 5CHNA 1SEBA 3FH7A 1MHPH 4ZO9A 4NSKB 3HUJB 4GRLA 1I7RA 4PD4J 5HGBB 5T3ZL 4PQXA 2XUWA 2CE6A 4WFED 2F53A 1I85A 1OTTC 1M3IA 1LP9F 1HS6A 3V9EA 5I6XB 1NSNL 3C5JA 2MTAA 4XPBH 4HU2A 3TNMA 5KJRH 2XXCB 3M86A 3NH7L 1F56A 3ZE0B 4GB9A 2O72A 3EUDA 1SY6H 3IDJB 5FYJH 4PJEA 4NP4H 5BRZA 3V9CA 1UTDA 1U8NA 1WIOA 1YAIA 3BQVA 2ZXGA 3R7RA 2Z7WA 5D4QA 3G08B 1VENA 3KPLA 5K59F 1G1CA 3TTYA 1S9VB 3IDUA 3ZMNA 2Z31B 3CSYB 4PJ8C 3MX0B 2XQYA 1CVRA 3BFQG 3QDJB 4I5BB 5EU7C 1DSYA 4HT1H 3HE7D 2R9HC 3B2DC 1XDTT 2MTPA 1TLKA 3G6AA 2H6OA 2V2WB 2XWZA 4H8HA 5D7IE 1AHWC 3TT1L 1DBJL 3F58H 2EXWC 3RZCC 4RLDA 1ZA6A 2DJUA 3SDAB 3H2PA 3CBKB 3LZFL 4QRTA 1WIPA 2EYTA 1QSEE 1UGNA 1KTDB 1BOGB 1AZBA 5TJWK 3JWOC 1JG9A 1I4FA 3FFCB 2JB5L 3HLKA 3MV8A 5L4JA 4JQIH 4CADB 3ECUA 4C56B 3PUUA 1U36A 4UQ3B 3MKKA 1QSED 1A8JH 2DKMA 4G8FB 5AW7B 3AJ7A 3P0GB 2GJZA 4UNIA 4AEIL 1TZAA 3HI5L 1F6AA 2GJ6B 3HJEA 3V4VB 4KRPD 3UOAB 3MRBA 4KZDL 4J3SA 1EXGA 5EF1A 4LLUB 5CEYA 1AGFB 3OZLA 3IKKA 3L5XH 3ROLB 2KPWA 2GTQA 3RVUC 1WBYA 5KG9A 4ZQKB 4H8WC 3EH4B 4ZZKA 2ZJSL 2WKGA 3N0PB 2WTPA 2X41A 3GIVA 1BDYA 4RETB 4HDIB 2X1QA 3VI3E 2W07B 4EPSA 1GH7A 1TQUA 1NMAL 1WFMA 2E9JA 3BO8B 3TWCL 1YYMH 4QAWA 4LGPB 5AL0A 1OP3K 2CSPA 2VDRL 1WHOA 3WIIH 4WHCA 4NPJA 3IXTA 4X98A 1ECYA 1I7UB 1P69B 3QC6X 2UZYB 3AREC 1BVOA 4HJEA 2PWDA 1PG7W 2BY1A 3QNYA 1EDQA 4UCFA 3PAZA 2WNWA 2QKIB 5JQHC 1SOXA 1CFMA 2XYCA 2ZOOA 3GB7B 3RAJL 4RNRB 2WW8A 5C0ND 4NI6A 4ZK8A 4I85A 3RKPA 4ZMAT 4G43B 4KXBA 4S1QL 3L2MA 3RGVD 3GS4A 3FQTB 5DRNA 2WVUA 4P46A 4QYAA 2WUCL 1NC4B 3W38A 3D30A 2AI0L 2X2YA 2Z6FA 1W0WA 2C3XA 3SDDD 4OKDA 4HMDA 4ZFZA 3NTCH 2P8MB 3WJMB 4JGUA 5H94B 1W80A 2BNQE 3WFHA 5KVFL 1F4YL 4UAOB 3QG7L 5E8NA 5FCUL 1UD5A 4PWKA 4YSOA 1TCRB 2VRQA 4NHUA 3VGHA 1DBBH 3U30C 4E5XG 1EHLL 2BNQD 3M6DA 4BGLA 1ED3A 4PVNA 2DYPB 3GSRB 1X5HA 3MRIB 4DJMA 1JZ4A 4YBHA 4IBLT 4QRPB 4PWFA 2BRRL 2VDLH 3D39B 3BVXA 3Q2WA 1ZTMA 5LAXB 1NPJA 2P5PA 1QKZL 4GXVL 3WIFA 3DYPA 4JRFA 1XEUA 4GAGL 3DJSA 4DGVH 5DQDL 2ZWZA 3UJTL 1T2XA 4XGZB 2BHYA 4Y4FA 1B0RB 3L3GB 4AL8L 4E9VA 2X10A 4APQC 2GI0A 3HHSB 4JFQA 1SXNA 5D7SL 1ERNA 5AKVA 4Z78A 5I1KH 3MOQA 3T71A 3ZDZB 4L5FH 3EJRA 4MMZB 1LEIB 1BQLL 4WNQB 1MOEA 4LLWA 1AS6A 2GK0B 4PGBA 4EZMA 5DRXB 1QW9A 2YJQA 4Z9KB 1A6VL 5FK9A 5BV7H 4CDHA 4G9DA 2MPVA 3CDGB 2A6DB 3BVUA 5B1AB 2O5NA 4LLVB 3NGBC 1EJFA 4GUPB 4POUB 2WVVB 1GGCH 2R4SH 5FOJA 1MHEB 1ZRUA 3AROA 5TGBA 1U8MA 5IM7B 3BN3B 2DTML 5D96B 2UYLB 4YHIB 4HHAB 1KCLA 1KY7A 2CR0A 2P26A 2QQNL 1H3GA 5DMJB 3RWEA 2BWQA 5EN3A 3MOAH 4YBLC 4G1MB 1MNUL 4LCWE 4Z77A 1MWOA 2VDQB 2OTUB 2JWYA 2Z7YA 2CMRL 3KPRA 3OX8A 3QH3B 1LEGA 4HIJB 3P3YA 3MJ9H 4UILH 5JUEH 3HNVH 4LCWD 5DJ8B 2HA1A 3IMTA 4L3CA 3EJUA 1KB3A 3CLFL 3C09B 3BH8B 4MS6A 3LN4B 1E9QA 5TF0A 4Q6IB 4ODVL 1T0PB 4Z5RB 3ABGA 2EDTA 1BP3B 4PUBL 1CF8H 4QXUH 1S7VA 5IW6B 3QUYD 2CDGA 4AM0B 4ZPTA 3BQUB 2OQJB 2M2DA 1ASPA 1BBDH 1AD9B 4FJZA 3UPCA 5AB0A 5AOJA 7PAZA 5D2NB 5BZZA 1PX8A 2JNZA 4DN3L 2E27L 1FNLA 1D9KC 1KJ2B 3PWJB 2B0SH 1FC1A 2O5XL 3VO0A 1IGCL 4PN6A 3U2SA 2PTUA 4QF1A 2X4TB 1MCFA 3ZKND 1NINA 4MA8H 4P06A 3ZVVA 4LLMB 1E90A 2AMUA 1ETZA 3NIGF 4IIQA 4N20A 3SD2A 3NCEB 3OC8A 3UBHA 1AP2B 5IZ7A 2A2QT 3QPXH 2D0HA 5IMKB 1XIWD 3RJOA 1DP0A 3X3FH 1YNLH 4JREB 1DO5A 1RIUL 2ADFL 4M6NL 3U4BL 4Z8FL 2G9KA 3PXJA 1E4XL 5IBUG 2ZE0A 2WHVA 4R2GB 4RFNC 2XV6B 3VWKB 1H3XA 1L9TA 1X9LA 1EEQA 1FCCA 1SDAB 2DQHH 1USZA 4R7NA 5E2UL 2ZXDA 2DH3A 2Y69B 4F7CA 1IBBA 4HVBA 1CURA 2VDML 2FUTA 4CC1A 4YZFE 2W0FA 4GBXD 2Z8RA 3HIZA 1UJTA 4K3EH 2BHUA 4FQXB 2F19H 1C7TA 4TSCL 1ZHLB 3QUMH 3VXSE 5B21A 4P23C 3PPEA 3VXPB 5DC4B 1R3LB 1VFUA 2EQDA 2IEPA 2K1MA 3GSVA 3QAZC 4JDVA 2VISA 3K2IA 5F71A 2ICEC 3BWAB 1FQ9C 3LH2H 3H0TB 5A2KH 5GS0D 2OMTB 5EC2B 1CL7L 2Z0UA 4I3RH 4K9JA 3W57A 4CGTA 3VXSD 4ELMB 1Z9MA 1VZIA 4PG2C 1EUTA 2IPUK 2JK5B 4OZGF 2X88A 4NO5A 4KJPD 1JPFB 4HKXB 3HN5A 3KG5A 1OK0A 2CLVA 2YWZA 3T4AA 3FT1A 1CFTA 1TSHA 1ZV9A 4RESB 4AH2A 1T1ZB 1FG2A 5L4FA 4BQ6A 1KJ3L 1HHKA 2ZIDA 5F7MC 4PJHE 1U2YA 4NHCL 1BLIA 3ARPA 3HZKB 3FTSA 4ZUUB 3RIAF 1M1XB 1MFCH 1F02I 2IGTA 4YZWA 3ARBD 4NPYA 2PW2B 5BS0A 3IJSA 4DK3A 3T6XA 2IG2H 4YXLL 3A67L 5A2IH 1BM3H 3WTSA 4ZS7H 1G4RA 4JZOA 5G4NA 4LRNH 2EVHA 4XWGH 2FLMA 1OE3A 4MFHA 1T1YA 1OOAA 2MPAL 3E9TA 3EYQC 4WUUA 3TN0C 5F8QC 4IW4C 4HUXB 2FECI 4AW7A 2WYZA 1VB9A 5FAAA 3CWGA 3LPOA 5IW1B 2X70B 1IQDB 2KH2B 5C7XL 1LL1A 1A1OB 5E2JA 5EC1B 2AJUH 2WKOF 1SOQA 3HLAA 1ZHBA 2G3NA 4ONFH 4OF5A 5ETUA 2IXQA 5ERWA 3GNMH 5KYYB 1PY0A 1HHHB 3IMWA 3GSQA 3OR6B 4FI8A 4JZJC 5KANG 5ADPL 3OG6B 3K5SA 4LXFA 2QKSA 2WZPA 4FFWC 1DQML 1XB8A 3V0VA 5EOTB 3ULVC 2XQ0A 1NLBH 4KRPB 5IVXB 2NDFA 1BLNB 4NZDA 3KH4A 2BSBA 4MASA 4Y9BA 2AK4E 3T0AA 4ACPA 1EZSA 5EBWB 2VXVH 4YWGL 4YHZH 4N2KA 3DUUA 1DVQA 1RUAH 4H40A 5EZPA 1ZE3C 2AEQH 5AZEL 1T89C 1NH6A 2QFRA 1N10A 1NL0H 2JJVA 4HUCA 3VD9A 2AK4D 2EYRB 4Z7VF 1YNKH 2FHCA 5EU4B 5JW4R 3C60B 1ILSA 1MAJA 1OPGL 3PV7A 3GMQB 5SX4H 3C08H 1YEGH 3ZDXB 4A7VA 5IMOB 1EXHA 3DI3B 3VE0B 2R1XB 4N0YL 2EYSA 2CLRB 1FHGA 3NCFB 5HJBA 1AOZA 1FAIH 4XPGH 1FRGL 2GPZA 1QLFA 3O45B 3TEWA 3HPJA 4TVUA 2WXHA 3LHPH 5IUCA 1MWAA 5B39B 5GHWL 4OZFH 5ISZE 3UYRH 1KTRL 4UDUB 1JV2A 4Y1AE 3BWUC 4X8JB 3MRLA 1IC0A 2JXMB 5HYJE 5CCKH 2XSKA 5FKPB 5D7JA 3ELAT 1M7UA 4Q6KA 2QVMA 4CVUA 3KPSA 3CC5A 5ISZD 1JVOA 3IU3A 4GKZB 4Y1AD 1EZLA 1ACYH 5JIMA 1T1WB 3SO3C 1ZWIA 2WWNA 5H37A 5HYJD 1TQWA 3HNTL 1CZ8L 4AI7A 5TF1H 4QYOB 1A7BA 1NBCA 2FR4B 3MNVA 2YA0A 3BVVA 4JPWL 5IBTH 5SWZB 5I0DA 4I3GA 3LN9A 4K94H 4DQAA 2ITCA 2IF7A 3KYOB 2QHLA 1G0XA 3IB4A 5CKAA 2DQGH 3FUHA 3JV4B 3ZE2E 3B9VA 4H8UA 5I1DB 1A6PA 2HT3D 2BNQB 3PXHA 3BWSA 5E5UB 1HSAA 3WYRA 1NCDH 4AKQA 4YSPA 4Z3IA 4WWID 5DHVA 5DC9B 2CBPA 3ZX1A 4BQBA 3CFKB 3N43B 5T5FA 4EO5A 3FTUA 3WKPA 4RMWA 2YXVA 5EU3B 1PBYA 1NCHA 1W0VB 2W38A 4LDEB 1CXHA 1QBAA 4P4RA 2AEOA 1UENA 3IEAA 4LSQL 3SDXA 3BGFB 3IGFA 2MNWA 2XWTA 5AKSA 5EOQL 2IC2A 2WQRA 1WQVT 4GMTL 1N64H 4N2DA 4P5TC 1V3JA 3OB8A 1NBQA 4PGZA 3T0WA 2NMSA 4N8VA 3DUSA 1EHKB 4TNFA 1IAKB 5HHPB 2XFGB 1FCGA 2PNDA 2X0UA 4HIXH 4L4TA 3U6RB 4R6UA 3NK3A 5CM1A 3QFDA 2DQIL 4Y4KC 5FO9A 3VFGH 9CGTA 1Y18A 4XO3A 3VRIA 2C3WA 5I8OH 5LVEA 1FZKA 4QTHA 5ELIA 2NY5H 4XAKE 5JW3H 5J12C 4O2EB 4G82A 3KWXA 3P4OA 1GZHC 1H6EA 2XN1A 3DX7B 2GI7A 3FO0L 2HKHL 5DLLA 1RUML 4NN5C 3QEGH 1SGKA 3O9WD 2VL4A 4XAKD 3ES6A 3GPSA 3ARRA 4HEMA 4JFZH 2IH1B 3EIFA 3H3PL 4X4ZA 3MXVH 4NZFA 2VLRE 1QPXA 2H0PA 5T1MB 4I2XB 5I1AB 4DP9X 3SO5A 4UNTA 4PRPA 4PCYA 4XP1L 1R33A 3O3DA 3RNKB 4R8WH 2PPFA 2VR7A 2NR6C 3ARDB 4X8GA 1AACA 1LO0H 1OGPA 1FC2D 5DJ6A 5HHME 1L0XA 1A66A 2XN9A 4OLZL 2VLRD 5CUSH 1B0GB 2RALA 3U46A 2OYPA 4GUQA 1YQVL 3LN5B 4F93B 1JZFA 4HXBL 2ZSVB 2F2HA 3DX1A 4OGZA 2VDNB 4L8DB 3RI5F 5HHMD 4ES9A 2OR9L 2ICWA 4HEPA 4U1KB 4OQTA 3SSGA 1SXSA 3CX5J 4IBSA 1GTNA 2FYYB 2D0FA 2FX8L 1MFAH 5H35B 5IHUH 5JOEA 1CK0H 4XNMB 1HJBC 2QGCA 3RIFK 2XXMB 1A7RH 3F62A 4JHWL 3I9PA 3LQMA 3UBXG 1IFHL 4ZFOB 1F11A 1M4KA 4F3FB 1LO3L 1AQKL 4JQXA 4WV1C 4YO0B 3CVBA 4JO2H 3IN0A 1LWJA 4XXDA 4Z0BL 5EEVA 2AXFA 2HZHA 2W1NA 4BKTC 1YA5A 4FKHA 1D5XA 5KS9A 3TO2A 2O30A 4J3OF 4UQ2B 4YHLH 2WB1A 3G5XB 2A9ML 1CUOA 2Q9OA 5T1LD 3TO4C 1U3HD 1AIFA 4N2LA 4ZSOB 1F2XK 3PGFL 4WJKB 4NUGH 1SYSA 1MRDH 4R7DA 3X12A 2VLJB 1CGSL 5DT1H 5GGRB 4D3CH 3MBXH 2NSQA 3MJGX 3NIFF 2EVIA 4QGYA 1ROCA 4FXKA 4KKCD 3H9HA 4BKLB 1I3GH 2LU3A 3IF1A 5FW7A 5I18L 1C16A 1WZ1H 5IHZB 5BOPA 2DYRB 3L17A 1DCLA 2ZWLT 3D69B 1U2CA 2R0KL 4ZTEA 2V5TA 4TV3A 1NCCH 4S1DD 2HT4D 4J4PD 3VXSB 3FCTA 1G5GA 3QQ3A 3C6LA 5I1HH 4O2CB 4ENED 3X14B 4BFIB 3TIEB 4O4YL 1S7XB 4AGNA 3QJRB 3QCUL 2KZBA 2IANB 4QNPF 4KJWD 3EOYG 3T0EE 1P1VA 4NO0D 4PI2A 4HJUA 4QLRA 4WZ9A 5J3HC 3VFNB 4KK5D 4AVKA 3QYNA 3X13B 3L2LA 4POZC 4XVSH 1OARH 1AXTL 4PS8A 3GKZA 3L5JA 5LGJA 1X7QB 3EZJB 3T0ED 1A3LH 4P2QE 4N0CD 2XIDA 2DQUH 5IK3B 3S37X 3WMPA 3RTQA 1IC5L 3DBXA 3MR9A 4MAYD 1IGYB 4MAUL 4NUPA 4MCYA 3S35L 5CLWA 4QTFA 1CLZL 2JJWA 4A7UA 4IOFC 1JUFB 3WO3B 4P2QD 4GW1A 3ZHNA 3ZQ9A 3WE1A 2J20A 2V7NA 3GUFA 4D94A 5CJBA 4LSRH 4RRPA 5AOLA 3HE6A 4CU8A 3SCMD 5GGUA 4M8UA 1WZAA 3LKOA 2BJML 3FU3A 2O26U 4MNQA 4GIPD 3ZTEA 4MA3B 1CD1A 3DVNB 4KRMB 2A77L 3FT0A 1F1AA 3S2AA 5J9PB 2YZ8A 1JZ8A 1J7VR 2DQ6A 2BM3A 5E8DH 1KCBA 1FL3A 1N0LB 2HWZH 4WI6A 3NJFA 3T2NL 5BZDB 1BD2B 4MA7H 4LZKA 2NY2D 2Y7QB 2EDJA 1GGTA 1WCBB 1MFBL 4WI9A 4Q9QH 5I16A 4ODSH 5EOCL 1MREH 4FI7A 5EWIL 3T09A 4HJ0C 4PJXE 3AB0B 3EFOA 2BY3A 2VJ0A 4URKA 5T1KA 2OL3A 3H53A 1ZA3A 3S36X 5CZXC 3QCVH 5IJKA 1MJUL 5F7BA 5J11C 1E4KA 3QXDA 1IGIL 2ZCLH 2APVA 3FT3B 1YEIH 1JTTA 4P49A 4JKNA 2XWXA 1DUZA 4B5ZA 3MZGB 4G3YH 1A21A 4ZMWA 2IDTA 1SFHA 1OAYH 3B2MA 1Q0EA 2DM2A 3ZKMC 3KJ4C 1LNUB 4G7SB 5E2WH 3NK4A 2OAAA 1I8KB 4RA3A 1Z9SA 5I82A 4DAGL 3VXOA 1EJOL 1W72L 3S3CB 5D1QC 1PJ9A 5T3XE 2V7HA 3GC3A 3C5SB 3CXHK 4PV8A 1FFNA 1OIOA 1G7JA 3Q01A 4YR6B 1PQZA 3BSZL 4MKTA 4FXGB 1ODUA 4YVNA 2FT6A 3GMMB 3OAZK 5ECGA 3PWPE 1BIHA 3EYVB 2X3CA 2CBQA 5T3XD 4PJDA 1IKOP 4K7PX 1ESOA 1OGAB 5H2BA 2AANA 5I1JL 2WXKA 4I48B 3UTQA 2LV4A 1AVAA 1J8HE 1G7MA 2V9UA 3IETB 4NT6B 3JTBA 5CKGA 2OZ4H 4XNUL 2B4CH 3B9KC 4JPVH 2YPLE 5DCCA 1SF5A 1ND0B 3F7PC 3PWPD 3FOMA 5BVJB 4R4NC 2BNRB 3NZHH 1PKQA 3WNMA 4ONGL 3TNNB 1J8HD 1ZV5A 4Y1AB 1OTSC 1X6NA 2YAPA 4L2YA 2YPLD 3DETD 1ZPLA 1JFHA 2EDDA 4X6BB 4PRIA 3NAAL 4ORGB 2I9TA 1LK3H 4BDVA 2ENQA 1JK8A 3ZIMA 1A5FH 3VNYA 5FF6A 4JFEA 2X2HA 3NACL 5SX5H 3FKUS 1V7NL 5EBLA 5T3ZE 4F2MA 2MMXA 4FLOA 1B0WA 3EBGA 5CEZH 4P2RB 5F6HJ 4Z76B 2C9PA 5B8CC 3CCHB 4Z95L 1YECH 3PQYE 4MSWA 5DFTA 3MFGB 3MJ8B 4Z7OF 1KG0B 3RJDA 5T3ZD 2VR4A 1VHPA 3AMKA 3VFWA 4IEFA 4Y7MA 2E8YA 3WFBL 4J8RA 3RUGB 4X9IA 4XWOD 3ZE2B 32C2B 1NICA 3PQYD 3Q44A 3BZFA 1RK1A 4NQEB 2WQ8A 5BVPH 1MJ7L 3LEVH 4A55A 4JGMA 5E51A 3T65A 2ADYA 2F1BA 3OLIA 4XP6L 4IRJA 2IDSA 4KV5E 3MRDA 1U8PA 3P4NB 2R83A 2H1PH 1N59A 4HKJB 1XF5B 2AXWA 4WW2A 2ZNXA 1OAZH 1HILB 5KSUA 1KCKA 4XX1E 4HWNA 2OX5A 1NMBH 3IKCA 3QWOB 1SJHA 2ATKA 1PYWA 4IHBA 1RIHL 2KZWA 2P8PA 5G5DB 5GS0H 4NAQA 3RWDA 5B3NA 1BPVA 3MROB 2IPKA 3DMMD 2G5RA 2H26B 1ORQA 3WV0A 5BV7C 2YBGA 2X6MA 1H3VA 2DWDB 3C6EA 3I02A 5D70L 3VXUA 1GR7A 2YWYA 5D2LB 1WZKA 4S1RH 2YFNA 3IS0X 2F1EA 5E9AA 4B95C 5GS1B 1XSIA 2BMKB 3KPNB 4NWUH 2J5LB 2QHRL 4OFDA 5LUMA 2DLGA 5HHQB 1P0SE 5HYQB 3FQRB 3OKEB 4WU5A 5I6XC 4LHJB 3ZHLA 2KLRA 2JB6B 4IDLA 4K3DH 3BD3A 4NRYA 4O58L 4DQOL 4BXVA 2HRLA 1G7LB 4JDZA 1ZGLB 2ZWYA 4L8BA 5T5NG 4J1UA 4XXWA 3DOSA 3F6IA 4AIZA 4CRPA 2VLRB 3IGAB 3FNKA 3HAEA 4HFWA 2IWKA 1MZYA 5DMGC 1Q0XL 2QFPA 3WXWL 5BO1L 4GO8A 3T77A 1E9PB 4M7ZC 1PG7X 4ZXBB 1QX1A 3GMRA 3ZRSA 3KR3L 3RVWD 4PRHA 4W9HC 4OCSL 3CD4A 4FNUA 3JV5A 35C8L 2WO2B 1H3PL 3LDBB 1S46A 5C8JA 2ZICA 4LVHC 4OZHB 4MQXD 3GI9H 3HG5A 5MP6H 3BC9A 1JZ2A 4ZPVA 1GYAA 3MACL 5DFAA 3GBLA 4DVRL 4EQ3A 4Q8BA 3D6GA 3P9LA 2VWEE 5HYFA 4N86A 2YPVA 1RPUA 8FABA 4YDJA 4PJIE 3HMXL 2FJGA 3ZSSA 2NZIA 2ERJC 3O8XD 5C71A 4JFPB 2ADIB 1P7QB 1S8DB 2XWJB 4U0RC 1D5BA 5HJDA 1A4BA 2BW5A 1I9IL 1TJHH 4GSRA 5CIPA 2X4PB 4KKBD 4HIIA 3NIDB 5AW2B 1FP5A 3ILQC 3VFMB 1KGYE 1OSZA 4M7JL 1CR9L 1WUNT 4HX1B 4YGVA 5KVFE 1WAPA 2TSBA 4QRQB 1TKWA 4PJAE 4MA1B 3WENA 4JRYE 4F7EB 4JO1H 4LL9A 4LCUB 4M1GL 1BCIA 2A7BA 2CCVA 1LO5B 4GW4A 3UDWC 1QLEH 4YE4H 1MRFH 3VWJD 1C12B 1W6WA 1SHXA 3SKJL 5LQBH 3OAYK 4GKOA 4F7PB 3RZCA 1IJ9A 1AY1H 4GI8A 4JRYD 1PLAA 1XCWA 4WWKD 1KENH 4M4RB 1XL6A 3NDYE 2IPTH 3P40A 4B5EA 1PDKA 5KBMA 4ABVA 1KB5B 1SDDB 1OLLA 1JFQH 5DJYA 2H6PB 3T2OA 1OP9A 3H4FA 4MMXB 1K5WA 1NEUA 1QP1A 3OKOA 3FQNB 4JFDA 2WYTA 3EF7A 1JN6A 4N5UA 4PWIA 2ZG1A 1G1KA 2QKIC 3CUPB 1PLBA 1M9SA 1M57B 3C5XA 4RFOH 1YN6A 4FNRA 3CFJB 2I24N 3AY4C 5I2IB 3MLYL 2PR4H 1RZFL 1YCSA 3EBIA 1DQQB 1S9YA 3GBDA 4I1PA 3NFPA 1ZY9A 1TVHB 4J2XA 2KUTA 4YFEA 1FG9C 1U8IA 1C9SA 1E5UI 3H9SA 4N26A 5LBSH 2XZCL 3M46A 1O7DE 5B7FA 1IBDA 1JBJA 4P2QB 3T8VA 2F08A 3QEQA 2ZPKL 1G5AA 3S6CA 4ZTPH 1EA9C 1M7DA 4YL9A 1C5BH 3QDMA 3QXVA 2WQAA 4FADA 4HWBL 4XPHH 3UTSE 3EOTL 2D4FA 1R3IH 3UJIH 5T5NF 4V1DE 3P0YL 1EMTH 3US9A 5GRYA 2K9FB 4OGXH 3X1EA 3L1FA 2EDKA 2FEDD 2YD9A 2AJXH 1CE1L 2BIPA 1DLFH 3UTSD 1KOAA 3ZK0A 4PW9A 4A66A 2NY2B 4V1DD 2X4SB 5KWYC 1CT8B 2R2CA 2VZSA 1QBML 4HETA 1UT2A 4MQSB 4XCNA 2XCMC 1WBZB 2K4AA 3LCYA 4KJYB 1P1ZB 4ODBD 1H15B 1U91A 3EFDL 4G8GE 2A6JB 5ICXB 4ABUA 1SJXA 1KEMH 5I9QB 3TBYA 4ELDA 4BZ2L 4ZOCA 3TIDB 4OLWH 3IFPA 4PD4K 2ZXWB 4LPCA 3LEYH 3MRMB 5ES4B 3NQIA 1HHIB 2IO5A 1OSEA 2VN4A 3G6DH 1CBJA 4U1NA 4QRUA 4MGXA 4L05A 4XOEA 4G8GD 3WMQA 3GSNL 1LO4L 3HI1B 2Y2TA 2QADC 4TYUA 4WFHE 4CBPA 3KBPA 1ZPUA 5DDHB 4G59C 3ZYJA 1L0PA 4JHBA 2XRAH 3AUWB 1Y0LB 4MHHI 4OUUB 1L5GB 3P54A 2E7MA 1MDAA 4U2ZA 3K6SB 3KL3A 3N50A 2WP3T 4XCEA 2W91A 3C6SA 1HH6B 1J5CA 4B9KC 4WFHD 2GSIA 4HPYH 5I71B 1F13A 2AQ1A 2ZX5A 1VADA 4KK8C 4CILA 1FA4A 1MJJA 2HFEB 3VFPA 3RDTA 4PS3A 5D96C 4OV5B 4MDJA 4JM0A 1WUZA 4HPOL 4Z23A 5CZVL 4PP1D 3ELQA 4HJGB 5DMYA 2PN5A 2MQGA 5C08E 3ML8A 4H2CA 1UKSA 3SBPA 2BS9A 2E5EA 5MENB 5GRJL 5I5IA 5HHVH 2Q86A 3KDMB 2WY3B 2PYFB 4GKSA 1Y7VA 1YYLH 3EDDA 5EU6A 1HQRB 3OAWA 1L9NA 1FH5H 2LW3A 3FC8A 2BIQA 4K23H 5DJDA 5B38A 2GIMA 1QW8A 5C08D 1KSRA 1R5IB 3VYNA 2IWEA 4YAQB 3EDJA 4AK2A 1KTLA 1FNGA 4P8QA 3PWPB 2WLIA 3SDXF 3QZNA 4GQ9H 4KROD 3C09C 1AGCA 1P2CA 3EJQA 4LLDA 3IJ8A 2OFQA 4P5SA 5GZOD 3L3JA 4X6CE 2GVYA 1LD9A 4FQPA 1KIPA 3KXFA 1L9PA 2I69A 1T5KA 4HLZH 2D7TH 1BZ8A 4F33A 5F96H 2Q8BL 3HG3A 4LKXA 3ATFA 3BQUC 5MEPA 5I1EL 3A6CH 1YDPA 1RJZA 5LGKA 3ZKXB 1I1YA 2Y7LA 3L9RA 4K0OA 5D2NC 3SE9H 2PF6A 3KYKL 5AKRA 3HZMA 1FDLL 5EUOA 4PREB 3HS9A 3CDYA 1BMWA 3N40P 3VXME 1TU2B 4NKIH 3BE1H 5IVZA 3F7RA 1NDMA 1MCWM 3CVHA 5KVMC 2AQPA 3UTOA 1ADQL 4PRDB 2OR7A 2OJZH 3SQBB 4K94C 1FORH 1W8EA 3TA3A 3VXMD 3TYGH 3V4PB 5CBAA 2XXGA 2HMIC 1QQDA 2ZAHA 3ARFD 1KBGL 2P5WB 1P7BA 1SN5A 4Z7UB 3I75B 2JFCA 4AT6B 5AFAA 3VMPA 4OI7A 1ZANL 3HR5A 4LHUB 5GGTA 1BQHA 2NUTB 4XPAH 3APMA 2CO7B 2O6PA 4ZODA 2DQEL 3F12B 4YSRA 2R29A 3BLPX 1G6RL 3FQWB 4RAUA 5HGHA 4AE1A 2O6FA 3QWRA 2AJYL 5E23A 1O9WA 3B4NA 4BQ9A 3N41F 4K5PA 3QJQB 4FRWA 1KDJA 1J11A 2P52A 4GG6F 3FUJA 3MRHA 4UV7L 1OM3H 4L3EA 1J87A 1S7WB 3F5WA 4YDIL 4AOFA 4FQXC 4AIXA 3Q5YA 1KELH 1VPOL 5F3BB 2YKLL 1NGYA 3O4LE 4PY7B 2QPUA 1KCSH 3HZVB 4FHJA 1J9SA 3GZPA 5E5MA 1DSFH 3LD8C 2BW4A 5CR1A 2A83B 4DGIL 4G7YL 2APSA 3GDBA 3MYJA 2CO6B 1YMMB 5FYKL 1E3XA 2WIIA 4OZIE 3I2CL 3OJDA 4G6FD 3O4LD 2HAZA 4R5TA 4W6YB 3GSXB 4F57H 3CK0H 4H4NA 1NCAL 2NY5C 1MFMA 2NQCA 3BUBA 3OMZA 4RAVB 4XBMA 4HF5H 5CLTA 3DBSA 1GYUA 3BH9A 1TJGH 2D3NA 5HY9A 3VFRA 4KKAC 1BVNP 1UA6L 2WN3A 4HGMA 2P24B 5BXFA 5CEXA 1XT5A 5IEHA 4MJ6B 4NM8H 3ME0B 4CW1B 2IIJA 3FU8A 4L4VB 3ARYA 1VACB 2XZQH 2ED8A 1R24B 5IV2B 3WEMA 4P23A 3RWHA 3QORB 3VACA 4F8TA 1SJEA 2A73B 5E2TL 3AXLB 1RUPL 4MD4A 1FO0B 2ICEA 5TE7H 4NKQB 2ZT9C 3MXWH 3HHMA 4XNDA 3IFLL 5DJ2A 4HHWA 3WEOA 4WGKA 1RP9A 5KBNC 1WCQA 4PG2A 4H20L 1ID5I 5BCAA 2GW5A 2HKFL 3VYPA 4UT6H 1E5ZA 1T6WA 5DS2A 4OZFG 2H9GA 1GKOA 4R5XA 1J1XL 4F80A 5AZ2L 3O3EA 3V95A 1XGPA 3COOA 3HG0A 4P57A 3O6MH 2XWEA 1HE8A 2GT9A 3SKUD 1GHFH 5ICYB 1OCWH 3HC4L 2A9NH 1NIBA 3KWUA 2IV8A 3P77A 2IBZY 5EDXA 1DJHA 3VH8B 4Q0XL 5D7EA 4OZ4B 3V4UH 1SF3A 2B20A 3GGWB 3OZ9H 4FQ1L 1HTYA 4M3HA 5SWQA 5KAQG 4KRPC 4NOFA 4OH2A 1DUYB 3I9GH 1VSCA 2FX9L 4LU5H 3K4ZA 4XP5H 1QUPA 4TMPA 3VU2A 1Z3GL 2AV1B 1U8KB 3PV6B 4LLYA 5TPWH 5IQ9B 1BHGA 5KYXA 5A16B 1UVQB 3CVCA 4K3GA 4PS4L 2PCPA 3STLB 3TN0A 2EKJA 4GT0A 1K5NA 3FRPB 1Q90A 3FBQA 4M02A 1MFDH 4U1LB 5DVMA 1HCFX 2ZOLB 2KMWA 5CFAA 4JRYB 1HU8A 3QZWB 1PZDA 5EO9B 3S3SA 4XZUA 1IC7H 2C1OA 3ARGB 3FONA 3EJPA 3TT3L 3TFBA 2J25A 4F5CE 2OK0H 1OGTB 5T3XH 3MLVH 3V7MA 2B3RA 5E08H 1BZ9A 4HZLA 1IQWH 4P9ML 2NY0B 5TK4A 2DQFB 3A4FA 5J0BA 1NEPA 2D3VA 5I76A 1JPSH 1E28A 4TUUA 3U36A 4LAJH 4RQQA 4JZJA 1HHGA 1TZIB 3V8OA 4C4KO 3VRJB 2D3LA 2VNCA 4LASL 4KAQH 4D0BB 1N67A 3IGKA 2DY2A 5IJDC 3PAYA 3FTVA 1OKEA 4OM1H 5C9KA 4GG8B 3UTZB 5C0NC 2B1HL 4ODUA 5AVSB 3GFUA 2JCCA 5DD0L 2WO3B 3NABL 3W0WA 4XE0A 5EZLB 1T22A 3RGVC 1AXSB 4MQ7A 3OAUH 4UTBH 5JXAH 5B7MA 4OFPA 1KXVC 1KLFB 1Q9LA 4GQQA 4ALAH 1T89A 2J8UF 3GS7A 3SDDC 4LCIH 4M5ZH 1HOCB 3LY6A 2XVLA 5D5MA 4ODTH 5C0RL 5J1AA 2IOOA 3CZEA 3MUZ1 4E9YA 5DD6A 2V5RA 4X80L 4PV9B 2D7MA 4LSDA 5T3ZH 1UGKA 3K80A 1Z9PA 3ZDYB 2YRBA 3VCLB 4KHTL 3DKHA 1HHJA 1XGRB 3FUEA 1XAUA 1NSNH 1VGKA 2F54E 2X3AA 2QELA 3BP5A 1AXIB 3IMSA 3NH7H 5IROD 2F61A 5E8EA 4I9WE 3JYBA 2MQ0A 4PJFE 1KFAL 2F54D 2XFXB 4HXAL 3IBEA 4FJYA 4JY4B 4DZ8A 5BMFL 1D5ZB 1JGEA 4KO9A 4I9WD 3BGFC 5D1XE 4M5SA 2DV6A 4GUOA 3UX9B 1JD9A 3BDXA 4PGCB 6CGTA 2GEQA 1P84J 5BUAA 3F7QA 1TTBA 3UROR 3F04A 5D1XD 1A1NA 4N0FB 1UD6A 3VFUB 3DK0A 4G8EB 1GSMA 4Q2ZA 3TT1H 1DBJH 5CN2A 4BK4A 4NCC1 3DJRA 3ARZA 1L0YA 2VSDA 1RL1A 3LZFH 4FYRA 4OGAD 5M7QA 2HVJB 3V0FA 4L1LA 4JCWA 3TBWB 1H5BB 2JB5H 4ISVB 3MO1A 4EI6A 5KAQF 1JZEA 1CXLA 1UACL 1V55B 2CKBB 4KOBA 5IFJB 1HWWA 1II4E 1KT2A 5ESVA 2YK1L 1LE9A 2XTSA 4NI3A 2PWEA 1BXUA 4KMLB 3VVWA 3BP6A 4AEIH 3HI5H 2OMVB 2DL2A 4RFEB 4KZDH 3QUZA 3BLKA 3AADB 1YAZA 4KQ3L 1A4KA 2ZWKA 3QHFL 1BQ5A 4XCFL 4AX3A 1BG9A 5DRWA 4FLQA 4OLYL 4P5TA 4FABL 3NYKA 2CHDA 4NAJA 4JVUA 3RA7L 3WY2A 2X4OA 3GJFB 1W8OA 1RVFL 5DHXB 2ZJSH 1DVFB 4DCQA 3G6AB 3ARDC 2E6PA 3NCYS 3WHXA 4TQPA 1S2EA 4HA1A 2LTQC 1V7ML 2W81C 4P3CL 3B3BA 5DZ9A 4Y4KA 1FO0H 1WD9A 4YSQA 3FQXA 2B4CC 1NMAH 3QFGA 5C0GB 3TWCH 4POYA 3RPKA 1KV7A 3VXNB 2F74A 5IOPA 1A22B 4WW2F 3HG1A 5C09E 3QUYC 5I19L 2VDRH 1OW0C 1RKRA 4G80A 3MV8B 4PJCA 1X5FA 1JL8A 2E46A 2X4NA 3A0OA 4NP9A 2DWSA 1YEHL 4XO8A 4A6YB 1FIEA 5CP7B 3TEXA 5FCSH 5BQ7A 3QFJE 5HI3D 5SWSA 5C09D 3DO7B 4ZYKB 1OOWA 1NC2A 3RAJH 4QHNA 3LAFA 1YPZE 1VFMA 1MH5A 1YSOA 2DLFL 1T4WA 5HPMA 2OXGA 4S1QH 2Y7SA 2AJZB 3QFJD 4UB0L 2G2NA 3VA2C 7FABL 3FUMA 4XN4A 5AVZB 1CJYA 1O6SB 1EBAA 2A3TA 4XN5A 1KULA 1N12A 3ILPA 2WUCH 3CTTA 1CLOL 2JCWA 3I9IA 2PTVA 2ADJB 1CTMA 1XIWC 2NR6A 4UM9D 2O6EA 4OVUA 5KG9B 4PJ7B 3U2IA 1FVDA 5LO7A 1BXXA 3BP4A 1JAEA 2XV2A 3GXPA 3OMIB 4JHZA 4QCIB 4ZMXA 2BP0B 3U0PA 5ANHA 1U58A 1ML0A 4WI4A 1SLXA 1PZSA 2NYZA 5KVFH 2CHWA 5FGRA 1F4YH 1OCOB 2MCG1 3QG7H 3UZQA 5FCUH 1MCRA 2WVTA 1ASOA 1JF1A 1IGTB 3TU6A 3T3MF 1EHLH 4IBQA 1INQA 1CE6A 4GBXC 2B39A 1ZVYA 3QXTA 3D3VA 4PW4A 4W81A 1QBBA 1PD0A 5FW6A 3NMEA 1CFQA 2BRRH 1MCCA 4WU7B 3OR7B 5KSAA 1QKZH 1F45A 2VABA 4GXVH 4E41A 4YSEA 2X1WL 3FF7A 3ZE1E 4GAGH 4OD2A 2HYMA 5DQDH 3UJTH 2Y1YA 2BIHA 4WV1A 5GS0C 2QVTA 2YAMA 4AL8H 4NFDA 3PXLA 5AALA 4G6FB 3O4LB 3CFEA 5CLZA 2BIMA 3BPOB 5E9DE 3Q05A 2W88A 2WQVA 2XNAB 3PP3H 4KJPC 5D7SH 3UPRB 4R0LB 5EU5B 4ZFZB 1XMWA 3TO4A 1ZMYA 2R51A 3P11L 3ZRCC 5DUBB 1BQLH 3KVQA 3FT2B 1T5WA 4HJTA 2K6ZA 2JI3A 3DUHA 1A6VH 5E9DD 1CS6A 3AG2B 3VI4E 5A3ID 2J6WA 4NRZA 2VQ1A 5CMAA 1B3IA 5HDWA 2OMWA 3DX8A 4OGQC 1NIDA 1QBLL 4LQ1A 5JPMB 1S78D 3ARBC 5LDSA 2AQSA 2HH0L 3OD3A 4Y4HB 4N9OB 3MUY1 4OVVA 4S0HA 1U8QB 2DTMH 1HNGA 3U4EB 1ED3B 2CO4A 4NZ8A 4HCFA 2XWBB 2V2TA 2Z92A 3IDYC 3QQXA 3TURA 3P0VL 5HHOE 3G5VA 1AKJB 3D25A 4TXVB 1ES0A 3DJTA 5TDNA 2NUPA 1UB6B 1C08A 3NJXA 2CMRH 4Y4FB 2FRGP 43CAA 5ID1B 5EBGA 5HHOD 1IM3A 1O9ZA 1QTYT 4WTQA 4DVBB 5CGBA 1AGBA 3CLFH 4BSWA 5IW3A 1E8WA 3PABB 4PGBB 2VN5A 5F3HA 3RX9A 3L3DA 4ODVH 3P02A 4HJ1A 2EH8L 4K9EL 2E86A 4PUBH 4RMRA 5DSCA 4AGOA 1CBVL 5KSBA 1FNHA 3EJYD 3VJ6B 1S6NA 1KYOJ 5TGBB 3ET9F 1AZUA 4HISA 5C0DA 1DVTA 2H3NB 3F7YA 4M5TA 4DN3H 2E27H 1IE4A 2V3FA 2O5XH 3Q0HA 1IGCH 2CHNA 1DLHA 4W4NA 5E1HB 3RWEB 4F2EA 1IGJA 4IYKA 5T8IA 2CKBH 4FG0A 1RSYA 4N0RA 3UADA 4KK6D 3Q6GL 4YDLB 2YD5A 2DWTA 4XVJL 2QLYA 5HGDA 5EDSA 4Q9RL 3OX8B 5CGYD 3WUWG 5EO0A 1XF3B 3S5LB 3KCPB 1ZDSA 4HIHB 4GIAA 5LWYL 5AYTA 3TVMB 4B3VA 5B4MD 1YG9A 4EIUA 3DTXB 3I3DA 4MCNA 3WEXA 1RIUH 1TZHB 1U0QA 1L7IL 1DTUA 2ADFH 4M6NH 3U4BH 4Z8FH 1NFDF 1E4XH 3CX5K 3GJFH 4HK0B 4RGMB 3S0PA 4FXGC 4OF8A 4CVXA 5JNYA 4XPTL 2XVGA 3IFOB 1JPTL 3KLQA 1S7VB 4RA0C 2AJSH 4HOMA 5E2UH 4D0DA 3IAGC 4JQIA 1NANI 4QLWA 3G6JA 3UAJD 2XC8A 3RVTD 5C0FB 2VC2L 3RFZB 1QVOB 1U8HA 3PLYA 2BXYA 4NCC2 3VSTA 1SZNA 1HINH 4LMQI 4PIRF 1KXTA 3HA0A 4TSCH 3VGBA 1GIGL 2NW2A 3WTVA 1MFEL 1SHSA 2OCCB 4OW6A 1O7SA 1G7PA 1XZWA 5F89B 3J07A 4QXTA 1BJ8A 4MXVF 1CL7H 1ETZB 1TLMA 2K7PA 1D5MA 4S2SA 2EXTA 2PYEE 3RG1C 5D1QA 1RZ8A 1BFOB 4JVWA 4ZRGA 3PY9A 5DMKA 3TXAA 4RZKA 1NCJA 2B59A 3CFQA 2HT3C 3KHQA 1B90A 3ZMEA 3FN3A 5B3JE 2PYED 3M7FB 2OP4L 2CK2A 4GKNA 2G5UA 4LLAA 2UX7A 1KJ3H 4R4BA 5I8EB 4EI5B 4QRAA 2F54B 4NHCH 1YYCA 5CLYA 3U4AA 1D6VL 1I1AB 1ZD6A 3B9KA 4F7CB 4R90L 3RVXD 1M6OA 4L8CA 4J6RL 4NZTL 2NYKA 5DU7A 1H6FA 4FFTA 4BZ1L 1ZT7A 4YXLH 3T9WA 5L8LB 1J0YA 3K2UL 1JD7A 4MJ4A 4AZ8B 4NO3B 2CA3A 5IB1B 5JMOC 3TJEL 3GZQA 3VGAB 1LP9E 1X3DA 4MNGA 2ZCZA 5ESAB 3GSVB 4JDVB 3CU7A 2MPAH 1UM5L 1I7ZA 3ZL4L 1XCTA 1GTFA 1GC1L 3KLSA 4LQFL 1KPVA 3HMWL 3SKOA 3L7FB 5C7XH 3W5MA 4NO5B 4H1LH 5B8CA 3GWJA 3GTVA 3MREB 2CNZA 5CJ8A 4ZW6A 5AG9A 4QRFA 4WHTB 3P9WB 4IKKA 2VLKA 4LOVA 2K8MA 1FG2B 3FOLB 4HJJL 5KOMC 5ABAA 5ADPH 1FNFA 5EUOF 1DQMH 1HZKA 5IHLB 2F68X 4RDBA 2A9BA 2ZXAA 3MC0A 4PJBA 4NPYB 3MRNA 1ZHKB 3O9WC 1IX2A 4PJ9A 3DXAB 1Q0YL 3WKQA 4DKDC 1H6UA 4JZOB 1M3JA 4ZUVB 4JFOB 4ZQTA 3AT8A 3UBFA 3KWTA 1GOFA 3IPFA 5AZEH 3NEXA 1NUNB 3UP1A 4WUUB 2R2EB 1HAWA 3AM8C 3T1FA 3WEAA 5DD5L 1UA7A 2G2RA 1ZHNA 1OPGH 3K5RA 4AKPA 3ZIYA 3WKNA 2R56L 3GS0A 2DS4A 3U79A 5F3FA 1TZGL 1XF4A 4N0YH 4XB3A 3SGKC 1FJ1A 3PAVA 1MIML 3NFNB 1H8NA 1K6QL 2EABA 1FRGH 3OF6A 3QWQB 4H8VA 3VM7A 3EUUA 1PCXA 3HUJA 3LRSB 4G9FE 5GHWH 2ZZUT 3QGVA 4HKBA 1TTUA 4DT2A 1XTMA 5KOVC 5CGMA 3T3PF 1O75A 4JFYA 2LU7A 4IRSD 4DPAX 2L7JA 4BH7B 1UOKA 4AKOA 3RHWF 2YQ3A 4G9FD 2CU9A 5JOFB 1RLBA 3IDJA 5F21B 4WY7L 2N7AA 2IDFA 1TQBC 1N4XL 4PH8A 4QOKE 5GGQL 1J8SA 3HNTH 5E99L 1CZ8H 2X2JA 4R96B 1U3HC 3G08A 3POCA 1E3FA 3IDXL 1EO5A 1KUMA 1D6EB 2OR8A 1MI5B 4KZ0A 4UV4L 1S9VA 4JPWH 3QJUB 1P7KB 2GBVA 3DHUA 1LEKB 2Z31A 3MX0A 4QOKD 2FO1A 4JLRA 4MA1C 4X9BA 3QDJA 4I5BA 5E6ZA 2HFGL 3T6QC 3FXIC 4OF0A 4Y9EA 1KACB 2B77A 3IBOA 1BV8A 4KKCC 4BRVA 2V2WA 3KLHD 3PFQA 1UD3A 5EHFA 1R5VB 5KJ7E 2HG5B 3QR1A 3HPJB 3QI9B 2YGPA 4ZTOL 2JE8A 3T6VA 3GF8A 2DIJA 2Q0ZX 3I84A 1E6OL 3WY3A 2IH3A 4N87A 3MRLB 1KTDA 1BOGA 2AERT 4LSQH 2DJSA 1C8QA 4KVCH 4S1DC 4M1CD 2HT4C 4J4PC 5D7JB 4CADA 2ID5A 5EOQH 3L1GA 4GMTH 4MMXC 5B22A 1U95B 3KPSB 4YK4C 5KVDL 4C56A 4ENEC 4E9SA 5CN3A 1I8LC 4KJWC 4G8FA 2W9DL 2ATPA 4N2NA 3SKNA 1ZWIB 2XV3A 3OB0K 4EEEA 2YPKB 1QO3B 4BHUA 1NLDL 4KK5C 2GJ6A 1MCSA 3TEYA 3WFDL 4PBWD 3V4VA 3ZHKA 2DQIH 3AW5A 3E80A 4I13B 3V5HB 4LLUA 3HC2A 1AGFA 1HYRC 5DHYB 2ITCB 3T0EC 4HD9A 4N0CC 3ROLA 1NGPL 1Q4NX 2ZXEB 1HSAB 3GKWL 2H7WA 4MAYC 3DWTA 2Q10A 1NJ9A 1XH3A 2JKXA 4H7VA 4FLSA 3R0MA 4HDIA 2ENYA 5LXGL 4ZDHA 4GOSA 2W07A 2VJXA 3FO0H 2HKHH 3BO8A 3D85D 5IIEB 4UWQB 4P4RB 1CYWA 3D5OF 4PBXA 1I7UA 2UZYA 3H3PH 3LKQB 4KFZC 2ARJA 4CAGA 5C3IA 3TTSA 3MLRL 3V0WH 4XP1H 5K9JL 5I17A 1NOFA 1A9BB 2QKIA 1QSFE 4N8VB 3DUSB 2HPTA 4CVZA 3SOTA 2NY2C 3GB7A 1FYTE 1EERB 1XZ0B 4RNRA 5BW7C 4OLZH 2A99A 2XIBA 3AY4A 2GTZA 3QFDB 4G43A 5LNDA 1YQVH 1DJWA 3FQTA 1QSFD 4HXBH 5I9QC 4HCIA 5ALBL 1FYTD 1Y18B 4NO2A 2IAMD 2OR9H 4PG9B 4HLZG 4UNUA 2CJUL 2CLZA 2YSSB 2HTKD 2JCCF 1YC8A 2P8MA 2FX8H 5TD4A 4HSQA 1OB1B 2J88L 4WEBL 3EBAA 3L4ZA 2JQAA 3INOA 3P4OB 4BJLA 2J73A 4E9WA 1T03L 4UYQA 4AYFA 4JHWH 3UXFA 3L3IB 1IFHH 5KEZA 1LO3H 3K6IA 5D5MF 1AQKH 3FYIB 1TCRA 4NQUA 4Z0BH 4DP8X 1XR9A 3QJFB 1UURA 4LARL 4PW3A 1MWAL 2DYPA 3GSRA 1PW3A 1VZHA 4QRPA 3O3DB 3D39A 3BRFA 2P80A 3GO1L 2A9MH 5A7BA 4V11A 1JF5A 2NPLX 5HJ3A 2MWCA 3PGFH 4XGZA 2UWEB 3MRQB 3QWNA 1FNAA 4JDTL 2I26N 2P3YA 3J7HA 4J3WA 4TS6A 2P7TB 5ACLA 2ZXQA 1CGSH 3T0XA 4Y2DB 3INUL 2YQGA 3HHSA 3PL6B 2C9RA 2ICWB 4BCXA 1R0AL 3ZPDA 2KYIA 2XN2A 4AW4A 3NIGE 3JXAA 1TTGA 3SYQA 4MMZA 2CRIA 5E4EC 1LEIA 3V0EA 1A7QL 4UQ9A 1F3JB 3Q8BA 2GK0A 5DRXA 4OQ1A 3AS1A 1W8NA 5JDJA 2VQTA 5E5LA 4N90E 5I18H 1RPKA 4PGEB 4MLIA 4KTYA 2JTYA 3DETC 1QRNE 2A9AA 2ZOTA 4LLVA 3Q1EA 1F11B 5ITBL 2R0KH 1A4JB 4GUPA 2WVVA 4UBDD 4LMQE 3BWZA 1RURL 4UQDA 5FYKE 3VTAA 4XXDB 4N90D 5IM7A 2AXFB 2AEWA 2UYLA 1XB6A 4YHIA 4HHAA 1YQ2A 3C9NB 4O4YH 1Q38A 2DD8L 5T5FL 2X05A 1QRND 3QCUH 2CA4A 4A2LA 1TMQA 3QAQA 4NENB 5EPMB 4OAWA 3CHQA 2Y5TB 4XNZB 5FYKD 2YARA 3W5NA 1AIFB 4G71B 2OTUA 2OULB 4IS6A 1YY8B 1ACXA 1AXTH 2B5IB 3SPCA 1SYSB 3DECA 4XWOC 4HIJA 3GUTA 4KJQC 4LSPL 5ESQB 4BZYA 1IC5H 2QSVA 4V2BA 5EG6C 4MAUH 4MJIB 1F5WA 4JKKA 3S35H 2DW5A 1CLZH 3BPNB 3LN4A 1FE8L 5L88L 1UHVA 4OZGE 3GPEA 4Q6IA 2GSGA 3LH9A 3ROOB 1A7OH 1C16B 1WWAX 2EILB 3IDMA 4APXB 5KYWA 4N68A 2RTTA 3E6FB 4PI0A 1AQHA 2FD6L 2FTAA 2RGSA 4AM0A 2X6AA 1KEGL 3BQUA 5BUPA 2OQJA 2BJMH 1XH1A 3JV6B 5F93C 1TPXC 4ODHL 3C6LB 4N9GB 5DLML 5D2NA 3OKDB 2A77H 4OLUL 1R3HB 1IJNA 4HFUL 4BK5C 2MCPL 4M7LT 3RURA 1CLCA 2EDYA 3QUGA 3T2NH 3UZEC 3WO4B 1NZRA 2QQLL 3DMMC 1MFBH 2X4TA 4PJCF 5D6DC 1A0QL 3GMPB 2VUYA 3KH3A 2Q3XA 5EOCH 3ISWA 4LLMA 5EWIH 2CPUA 2PO6B 4JRXE 4Y0GA 3H9ZA 5LGJB 5EV7A 3OGOE 3SQOL 4XO5A 4ZMNA 3ETBJ 4B9JA 4FQLL 2I7SA 1T7YA 5J1SC 1OZTG 1ROWA 5L2KE 5IMKA 3FAWA 3RTQB 2BH0A 3BPCB 2Z4TA 2EKSA 3DBXB 3MR9B 1MJUH 4MCYB 4N1EA 3MBEB 3VA6A 2WUBL 2ESVE 4XNBA 4JRXD 1G9HA 2X2UA 4AUYA 4DP2X 1IGIH 2NNFA 1X5LA 1LWRA 4IBUA 3FK3A 3WNPA 2VM4A 3VD3A 2V7NB 4FQIL 3VWKA 4W6WB 5L2KD 5JHDE 4CC0A 2K0RA 3NZ8B 4OQTL 4EJ1C 2ESVD 3BDBA 2BS71 4FNPA 4MNQB 2GFBB 1Q1PA 2NSMA 4DAGH 1PF3A 4Z7AA 1EJOH 2OXHA 1W72H 1W16A 3IJEB 2QMKA 4FQXA 5JHDD 3C8HA 5I5JA 1FL3B 1ZHLA 2YD6A 3U0WL 1G9EA 3U2JA 3VXPA 5BQDA 1R3LA 1TTFA 2IDCA 3D8MA 5B1KA 3RVWC 4YDKL 4P59L 3BSZH 5I16B 3EHBB 2VIRB 3H0TA 2N4IA 2OMTA 2Q76A 2YAQA 5EC2A 2X42A 3LRMA 4WGWB 5DJCA 1XWVA 2C8NA 4GSDL 1MXGA 4ELMA 5I1JH 4F7TB 4MQXC 5T1KB 1LVEA 4UMSA 1ITCA 2JK5A 4Z7WA 2IVFC 4XNUH 4Z7VE 3N85L 1ZA3B 3Q5TA 1JYVA 5EULV 3FH5A 4IRSB 4PB9L 1NCNA 1X7TA 2G2PA 1ITBB 4Y5YC 5FM5M 5E94B 3O8XC 2YQBA 4BBWA 4ONGH 1A8ZA 1PZAA 4K5MA 2AFNA 1L9MA 3FTGB 3HS0C 4HC1L 4BFJA 4AQOA 3N55A 3MN8A 5C07E 3NAAH 4GINA 2VWEC 1F4XL 3HZKA 4HS6B 4ZUUA 1M1XA 4KKBC 1HAUA 5HHXL 4G5AA 2YSTA 4X6DB 2PW2A 2B2XL 4OB5L 4U1GB 3NACH 1Z9SB 2IBGA 3V10A 1BEYL 1V7NH 3VXOB 5C07D 5SX5K 5BO0D 1IUZA 2EADA 4LRIA 3M1BA 4BFFA 5DWPA 4Z95H 3DX9B 4X7DC 2XETA 3JTTB 3HN8A 4Y9CA 5D72L 4BFRA 3VWJC 1TTRA 2NNXA 4HUXA 4A2EA 1F6FB 4GP8B 1FFPB 1TYEB 3WFBH 1D5IL 5IW1A 1HSBB 2X70A 2VMCA 4JO3L 4WWKC 2BSDA 5EC1A 3DOIA 1EFXB 2Y7OA 2R2BB 3FOMB 1A47A 1MVUA 3BH4A 4RX4D 4MKMA 1PKQB 5KYYA 1HHHA 4DK6A 1KIUB 3A23A 4H88H 4O02L 3ZYOA 5JIPA 1GOHA 4F15B 4PRIB 5HHNB 3IJ7A 4BDVB 3BSHA 1JK8B 3WMSA 4AL8C 1AR1D 5FF6B 3WU1A 3B7UX 1BLNA 3WDJA 1ZLUH 1CVSC 4TL5A 5C0JA 1RIHH 4XX1G 4LVNB 3SODB 4YH6A 2GJPA 3A24A 2Y6TE 3LNGA 4Y16B 3Q1SL 2I07A 5KSBF 2FSEB 4KVPA 1DJYA 4XP4L 1OP5H 2NXYB 3V0AC 5AB2A 4OD3L 4IJ3C 4A2GA 2H0FA 2EYRA 5D70H 2AQ3A 2X12A 5EU4A 3C60A 3FUKA 4IIZA 3MV01 3GMQA 4J8RB 3CSTA 3LX9A 2QHRH 3WS6C 3BZFB 3RIKA 3U1PA 2FWSA 4EAEA 3VE0A 4OIBA 2X6VA 1O7DC 3VI3A 1O7VA 1UD4A 2DYSB 1OT1A 1I8AA 2CLRA 4N5ED 4N25A 2VDOL 3QR2A 3S2CA 1KBBA