3KLQA

Crystal structure of the minor pilin fctb from streptococcus pyogenes 90/306s
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
137
structure length
137
Chain Sequence
STVQTSISVENVLERAGDSTPFSVALESIDAMKTIEEITIAGSGKASFSPLTFTTVGQYTYRVYQKPSQNKDYQADTTVFDVLVYVTYDEDGTLVAKVISRRAGDEEKSAITFKPKRLVKPIPPRQPDFPKTPLPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative pilus anchoring protein
publication title Crystal structure of the minor pilin FctB reveals determinants of Group A streptococcal pilus anchoring
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
total genus 18
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12892 FctA Spy0128-like isopeptide containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3klqA01
3KLQA 3GLDA 3B2MA 3GLEA
chains in the Genus database with same CATH superfamily
3LNFA 3V7AE 2OSYA 3GTTA 4YSDA 1H6FA 1T6WA 4DP2X 4K5OA 5L7XH 1LD9B 1HIML 3WNLA 4BH8B 1RMFL 5G4MA 5JIMA 2CBQA 3CX2A 5GSVB 3GKWH 4RMRA 1DBKH 4AENB 1CU4H 4OLWH 3P0VH 4KUZL 2E9JA 5J6GA 3QHZH 2EDEA 3GSNH 3MLYL 3SDYL 1TXKA 3CGTA 3NSCA 4POZC 4CAGA 5D1XC 4X8XA 2D31A 3QPXL 1LO4H 1WVZA 2B14A 2RQ8A 2MQ3A 2XPYA 3CFQA 4NC1E 5BZXA 4JDEB 1TZGL 3FHQA 5I8EB 4G8EB 5KYWA 5BPPA 3CLFL 4IBSA 4ZSOA 3VNYA 1AE6H 3BSZA 5EEUA 1BQHB 2XG5A 1JPST 3DTXB 2P7TA 3U1QA 5DRZB 1QI3A 4S10A 1OAKH 4ZUVB 1GS8A 1K9TA 1PKQE 4OLXH 3FTGA 1KXVA 1UENA 2APTA 4AMKH 1MOEA 1GAFH 3FOMA 3R7QA 4Z7AA 1QRND 2LLNA 5L7XL 2Z93B 5HYIA 3HE6C 4ZMXA 4FZEL 5HHVH 4TNWK 3ZE1F 5HHMD 3GKWL 4JQIL 1DBKL 3NCMA 1CU4L 3C8KB 3QFJB 4HZLB 4CADB 4LPWA 1LP9E 4GG6E 3B5GA 4ZNCD 2H2PC 4R0LA 4YL4A 5D1QD 3QHZL 3L4CA 3GSNL 2HMID 2HKAA 1KG0B 1A4KA 2B77A 1L6ZA 5HJ3A 4GKLA 1U36A 4YXKH 2G5RA 1PLGL 1LO4L 5FO2A 2GIYA 1G7LB 3H9SB 1S8DB 4PP1C 3X1FA 4UTBH 5ITBH 5KUKA 5EU3A 4IBZA 3FFOA 4AW4A 2HLFD 4WUUE 2YPLB 3GIVB 2F54D 1AE6L 4TL5A 5FYKL 4QPEA 3RHWF 4QOKA 4FLSA 4PJXF 4ZRGA 4EF3A 1JERA 1AQDB 3ZPDA 1OAKL 5TD4A 2Q7YB 3TVMB 4AGLA 2AQRA 4TF4A 3HUJB 1MJUL 3ENEA 2YAFA 3B7RL 2D3VA 5BQDA 5F8QC 2I32A 2V33A 4KAQH 3GSWB 5I1KH 3VYOA 5LCVA 5HHVL 2NTFB 3AFLA 4PJHE 4LLAA 4OU3A 5IQNA 2VMJA 1A4CA 2Z91A 3EH1A 2NNRA 5ESQA 5D5MF 3CK0L 3HE7C 3KR3L 4ZUTB 2JJTA 3VXRA 5JDSA 3DYPA 2N3JA 2W95A 4OT1H 1E9OB 4NQEE 4ZMTA 3UAEA 1C5BL 2NYYD 3EBAA 4YXKL 4BWTA 4L37B 3QZLA 1Q4NX 5DJ6B 1AGCB 3KEHA 4PFEA 5J9PA 3LNIA 3AWFA 2Q2EB 3DOSA 1AIFB 3FRPG 3EOAB 5AVRB 5KBMA 4C47A 3REVB 5ITBL 4UTBL 3F6LA 3UADA 5CP3H 2YGQA 3KCPA 2FWSA 2ZSVB 1W2KT 1KIQB 2X6UA 3W39A 2BS71 1DSWA 1FL6B 1FFQA 3AY4A 3PQYD 1KY7A 1MCWM 1HZHL 4PJDA 2B2XH 2BP0A 4POZD 1YMMD 2X88A 1HDMB 4PRIE 4U1GC 4NFCA 1E28A 1BM7A 1UOLA 1F41A 1Z5YD 1XSIA 2C4FT 4NYLB 5I1KL 4Q56A 1NCGA 1W8NA 2OJEB 4KAQL 3ZR6A 4G80A 3BGMB 3QIBD 4YAQA 5JLZA 1G7JB 2VDKL 4Z3IA 1OZTG 1CDUA 2FQEA 2ZXAA 1WSST 3RTQC 4ZMVA 1FFRA 4KDTC 3Q3GA 5E7BA 5F0LB 1EJOH 1UXMA 2QQLL 3I9AA 3IN0A 3CFMA 1O6TA 1WPCA 3F01A 2BVOB 2GK0A 3L3GB 3PPSA 2AQNA 5HD8C 2X89D 1VFAB 1X5LA 1X9UA 1RSYA 3CZFB 4L2YA 4BK5C 4TKWA 5D7JC 3ULVD 4GS7C 4PTTB 1HH9A 1JZ5A 4F8QA 3L9RA 4HH9B 3DOHA 3GSXB 4GINA 1ACCA 3BH8B 4QTIH 3EYQC 1ROWA 5IB5B 3LJ3A 4R5VA 4F9PC 4QRPE 1D9KC 1W91A 2AJYL 3B3IB 3G7TA 3RPKA 3EFOA 1U91A 3GMMB 4O58H 4DEWA 2ZOTA 1MVUA 2DF3A 3LQAH 3QUYC 5C0GA 3ZO0A 3NZHH 2PWDA 1TQTA 1I85C 3MTRA 4PP1D 2WBWB 1O7DE 5IB2A 1KGCE 3G5WA 4YH6A 4IW4C 1DUYA 3U82B 3U4AA 3WENA 3A0OA 4CILA 4UQDA 5J1AA 1VESA 1UWXK 2PPDA 4KTDH 2EIZB 5CCHE 1TF4A 4HIEA 1J8HA 1FZMA 2X0VA 2CO1A 3IB4A 1NBZA 4OAWA 3QEQB 1WK0A 4U6XA 3GBDA 3HG5A 4LEEA 4GSRA 1WWCA 1U3ZA 4WGWB 4NAJA 4QTIL 4ANKA 1GTNA 3IDXH 3BDXA 4Q6IA 3SDXB 4ZOCA 5KZCB 1GW0A 4H7VA 3LQAL 1BGXL 2VERN 1QSVA 1O9ZA 1M1XB 4CMMB 1R3IH 2IWEA 2MSPA 3OHXA 1N9PA 3X3FH 5J56B 5SWQB 3X12B 4Y4KB 3MLWH 3L5WA 2DIJA 4QF1A 1YJDH 3C5ZC 3CU1A 3U36B 2OLDA 5A6IA 5JHDD 2XQYG 3C60B 1DBML 3O3BB 3QI9D 4JREC 4G3YL 2NZ1A 5F7NC 2F7QA 3O6LH 1DQQB 2WO2B 4ZG1A 3WMSA 1H5BC 4P23B 4A7GF 3IPEA 2VDRB 3K5SA 1OTTC 4U6YB 4GI6A 1YPZB 3KH3A 1HINH 3BLPX 4JFOB 3V0EA 1D5MA 3QO1A 1WAAF 5C0CA 3HZMB 3IDXL 3DPBB 4XMZA 2IH9A 4NKIL 2NY6D 3TCLA 1NL0L 3TJHC 3M6DA 3KS0H 2YN3A 5IMKA 4LSRH 4PJ5A 3DBXA 3L4VA 4H8HA 1JK9B 4NRXA 1R3IL 1MJJA 3X3FL 4M8RA 5CGMA 3DUSA 1VSCA 3QO0B 3EYQD 1MCSA 2RMNA 3BEWB 4OZGE 1R5VB 4Y4HB 5AAMA 1KEML 5SWZB 5DXWA 4JW3A 4M7JL 1A7PH 1J0HA 2C3GA 2HN7B 2X10A 4GQ9H 3FO2B 5L4FA 3EO9H 2ETWA 3O6LL 5DF0A 2OYMA 3KPNB 1CGVA 2P5WA 4H0GA 4ECNA 1L7TL 3GSUB 1T1XB 4N2KA 4GXVH 2XN1A 5IMLB 4JO5A 1HINL 3S97C 4U1KB 5FKAA 3SEPA 3H85A 1ZK9A 4M93B 2A6JA 2VXQH 5IFAH 3QIWB 2AK4B 4HQQH 1ZDSA 5I76B 3TX4A 1XXFC 4JM2C 1PEZA 1HTYA 4LSRL 2PTTB 1IFGA 2QKIB 4PS4H 3K80A 4U6VL 3IXTB 4WQOA 3BWSA 5HSFA 2IAMB 3K71A 1HCVA 2ICEC 1LK2A 4D3CL 4YFLF 2M26A 4KXAA 2FHFA 1VGEH 5CJOH 2XWDA 1AGEA 2AHIA 1T3FB 2WWMD 3NIDF 3MRRB 1A7PL 4L9LC 2J44A 1FZOB 4GQ9L 3W0WA 5F3BA 5E2WH 3EO9L 2RCSH 5F72S 1KOAA 2JCCB 5AYTA 3GTVA 5DJ2A 2J6EA 4UT6H 4EXPX 3WAKA 3MUJA 3QWRA 4F92B 1FE8H 1MFAL 1X7TA 4GXVL 2O5XL 4MQSB 3X1GA 3C08H 3FYIB 1E2ZA 1JI1A 4PJ8A 3C5ZD 1KTLA 3ILDA 2UZXB 1Q72H 3BOVA 4YDVB 2E9GA 4FNLL 5IFAL 1RLBA 2P43B 3AT8A 4HQQL 3OKKA 3E6FB 1NEZA 1JWSB 3SE6A 4LKCB 4YDIH 3GMQA 5DJ8A 4MA8H 2GJJA 4PS4L 3S98A 2DYPA 4N6RB 2ZXCA 3TH3T 4FFZA 1ID2A 3RGVB 3MCYA 2XY1A 2R0KH 1OTTD 3Q2NA 5CJOL 3L95B 4HWNA 4U05A 1JWMB 5AVUB 1UACL 3OKLA 2JKSA 1F2XK 1QA9A 1BMGA 5GZNC 1KULA 1AZNA 3MV01 4YE0A 4MHHG 5E2WL 1UWYA 1FN4A 2RCSL 3T08A 3O4OC 2DQJL 4PUBH 4UT6L 4BA0A 3X17A 1MEXH 3MJ7A 2ZX5A 2JNZA 3IMUA 3OC8A 5AOJA 5B39A 2GJRA 1SF3A 2EQDA 3SE9H 3A6CH 4AXWA 3C08L 2F53A 3P73A 1HZLA 1FWXA 3QUZD 2LQRA 1T7VA 4FFVD 4NQDE 5F21B 3UZEC 3L5HA 1OSYA 4WFEE 3A4DA 4WV1A 3ZY7A 3PP3H 1EXGA 4HEPA 3NGBC 4ISVA 2QL1A 3RHWK 4YC2C 3AU1A 5HGHA 5E99H 1YDPA 2YRLA 2ZKHH 4XI5D 5GZOD 4NPJA 3GRGA 4LB8A 4MCMA 2R0KL 4LPTA 3TV3H 4M7KH 1JXGA 1WFMA 4P46C 2YXWA 4HEMA 2A0LD 3SCMB 1LEKB 3NIGF 2YKLL 2X4OB 4UNTA 5F9OL 4LSVL 3U4EB 5BVJB 1OVZA 3AMLA 4HUWA 5CSBA 4F3FA 5FDYA 5HGDB 5ID1B 2N01B 3OSVA 4FCHA 3BIKA 4PUBL 2YA0A 5A3IC 4QTHA 2E76C 1MEXL 4Z7UF 4HKXB 5KYUB 2XKNB 3A6CL 3V6OA 2VDQH 2B1HH 2WUCH 2G4EA 4OLZL 5CP7B 1EEZA 5I71C 4OCWH 4HKJA 3VXUD 1ZHBB 3QUXA 4AKOA 3ZR5A 3ARDD 3ESOA 4XP6H 1G7QA 8PAZA 1RJCA 3FAWA 5D1XB 1N7MH 3RIAF 1JNLH 1BZOA 1EK3A 1M2VB 1BYOA 1JMZA 2QVKA 2ZUQC 3HZKB 1I8IB 2UXVA 4WWOA 3I6LD 4M7KL 3QHTC 4KTEH 4NN7C 4UQCA 2XZCH 3T3PE 4K5NA 4QYAA 4PJGA 5CR1A 5E95B 2CK2A 3NPZB 2ZP0T 3ABLB 4H26B 4UBDD 1A3RH 1OGTB 3WE6A 5C08D 2BVPB 3BXNB 4P2QB 2HVKA 4DEPC 2QKSA 2V7HB 3VA2C 1DDTA 3HE6B 4APXB 1JV5B 1NGXA 3HN5A 1I1CA 3TBBA 2E7LA 1D5XB 2B1HL 2G3MA 4NZUL 2R0WH 1ZA3B 1Q94A 3JYBA 2V5TA 4XXDA 5L88H 1OL0A 1NFDE 4J5VA 4OCWL 4HDIB 5GZND 2TRYA 5BMFH 4F57L 3QNYA 1M42A 1N7ML 2Z6FA 1KIRB 3CQFA 3RY6C 5LHDA 3BPOB 3LZFH 4P49A 4UNUA 4EQ2A 2WTRA 2A4CA 2Z4QA 1IAOA 4J2XA 4B3VA 2GUOA 5C3LD 2YEQA 1WC7B 1J1XH 2A6KB 2YAQA 1A6UL 2CGRL 2KBGA 3AZUA 3H6AA 3QZNA 1T83C 3QJXA 4UB0H 4W1TA 4UINH 2WXFA 1A3ZA 2KZKA 3W3BA 1NQBA 2EZ0C 2YFOA 3ABGA 4YSTA 4AOFA 1C8PA 4RWYL 5IOPB 2GC4C 2CWRA 3H0TA 4J3SA 2YQBA 3GJEB 4FLOA 2R0WL 1EPFA 1U58B 1UM5H 2J12B 4DN3H 1KXHA 3HE7B 4N87A 1GHFL 2VDLB 1JS4A 1YMHA 1MZYA 2ZX7A 1Y07A 3NCWA 1KIPB 4IDJH 1QFPA 4ZTPH 2V8MA 1I3GH 3GPSA 2K7PA 4BQBA 3A4FA 2X4QA 3CXDL 2H8PB 3LZFL 1HCYA 4PGDB 1T66C 2X1WL 3I6KA 2WD0A 1LEIA 4QEGA 1JPSH 1FORH 5H37A 3NBNA 4AV4A 3K8MA 1J0ZA 3HMXH 2AK1H 4Q4EA 1BJMA 4HETA 5FB8B 3IFPB 1E6JL 2GSIB 3KW7A 5D9SA 4S0TD 5EUKB 1UXWB 4UB0L 3AJ7A 4JG9A 2BVTA 2WYIA 4U1GB 3SBPA 3UXFA 1BOGB 5DEFB 2OMTA 3FQXB 3SGEI 3TT1L 3VD3A 5FDWB 5E24E 3OB0K 3QNZB 3APMA 2B59B 2WCGA 4WHDA 2FEDD 2EDOA 4NB7A 4RRPA 3D0LB 3QQXA 5TDOB 1UM5L 5MERB 3W11D 5LCVH 3SDAA 5CUSL 1CB4A 3T8XB 2H3XC 4XBPB 4IDJL 3QJHB 4ZTPL 4LSDA 2MCMA 4EN3A 1H15A 1IE5A 1I3GL 4JGUA 2VZ1A 1YRKA 4KKLC 2ZP8A 3S34H 4Y88A 5D7JB 4QRQB 1SHWA 5HPOA 2GT9B 1GYWA 1M71A 1JNNH 2RBLA 4OZFA 4P2RA 3P4NB 4ZXBA 2H32A 1R6VA 1JPSL 1UWEL 5CEYA 4HPHA 1FORL 1XTLA 3BD5A 3BMVA 3HMXL 5DTFA 4LVOB 4X9IA 5E70A 5ES4B 2X2YA 1D9KB 2YGVA 3M45A 5C0EA 5JXEC 2JKTM 5TE4H 4H8QA 2CU9A 3RWHA 3DETD 3QP3A 4UQ2A 1IL1B 3FB7A 4EI6B 2HUHA 3QUYB 4G6JH 3EUUA 1PBYA 2WXNA 1XF1A 4E2OA 4JO4L 1S2EA 2O5ZH 4KPHH 4RSVA 3VMNA 2FO8A 2MNWA 3MA9L 1L9PA 1BVLB 1R5IA 3DYOA 3HI6H 3RNQB 1ZKAA 1J18A 2GY7B 2FGWL 3KPLA 4APQC 4ZYKB 2ZOUA 2RB8A 4KHTH 4O02H 4WZ9A 7PCYA 3FQWB 2IBZY 5M94B 2EZ0D 3ZYIA 2FD6L 4M8UA 1PNDA 1DVXA 3S34L 1XCXA 2VW7A 3BP4B 3VQ2C 1X5JA 4UDTB 2K45A 4MBOA 1JNNL 4P2YA 1E0OB 3PXLA 2EDHA 2MHAA 2OMNA 4PRHA 2YUWA 2PPEA 5HYQB 2E7HA 3H4FA 4WRLA 1H6TA 2YMOA 2NLJB 3MFGB 2WWKT 3K6DA 3M17A 3VW3H 5TE4L 3ZE1B 2X41A 1F6FB 5IHZA 4UAHA 4DVRH 3DGDA 4Z7QE 3A24A 4RZCB 2EVHA 3MUGA 4G6JL 5GGUA 2O5ZL 4PV1C 3ZO9A 2BHYA 5LGHH 3LKNB 4DO4A 1LM8V 5EV7A 4J28A 2XIBA 4R9HA 1MRFH 1LHZA 3LD8B 2F5AL 2XV3A 4RWHA 5GGVH 4O02L 2MTPA 2BIHA 2FGZA 1PY4A 3U6XS 3WV0A 1NJ9B 3VX1A 4JREB 5BOZG 5E00B 1J88A 4MCNA 1KNOA 4JR9H 3S0PA 3BO8B 2AQ3A 3ZT6A 4N2NA 1SOXA 1X44A 4JO3L 1KIUA 4PJXB 1KJ2B 4YPJA 5D7LD 3PG2A 3UO1H 2DLTA 2ZWZA 4N90E 4KRPC 2B08A 1LEGA 5BRQA 1ZHLB 5KVGH 3FT1A 3VFTA 4GFXA 4IRZH 4MX7A 2DYRB 3VW3L 1YECH 2Z1KA 5TF0A 4DVRL 3IN2A 3DOIA 5GISL 4PRDB 3ZBMA 2GUYA 1TU2A 3DECA 3O2VH 5D5MB 5I0YA 3BRGC 2YN5A 3FPYA 1JN6A 1F11A 1RHFA 4F7MA 3PWUB 1XGYH 3BVNB 4JPSA 4L8SA 4PJAA 2EUVA 5LGHL 3GS7A 4QHKI 4BKSC 1Q9LA 2R83A 3HLKA 3MCLH 4PTUA 3VDAA 5FGBC 5DEJA 1XGPA 4JDTL 1E27A 1MRFL 3TBVB 5I1HH 2NR6D 2ICWA 4HJIA 1JXFA 3PLYA 1I8KB 5JPNC 1U6AL 3K6SA 1RZ8A 3LH8A 1TLMA 2UWEE 3QEGH 2X6CA 4ZMNA 2FWOB 2CE6A 1SHMA 1H6UA 2IALB 3GGWB 5EPMA 1A9BB 3UAJD 3UABA 3I75A 4X4XB 5E1HB 2OSWA 1R19A 1T5XB 4ZAKC 1U8KB 3MODH 3VFRB 4F7EB 4IRZL 2MPAH 2XBDA 2DB8A 1GTFA 4F9LC 5E8DL 2OCCB 1JCKA 1RH8A 4IBWA 1FVDA 2UZYA 3Q0HA 1L9NA 3O2VL 2V2WB 2NSQA 2VO5A 3N1MC 4V1DE 5AZ2H 2WAQA 4LSSH 3CN1A 1EMTL 2F1BA 4JPIB 4L3AA 3RKDD 5ADOH 4UTCA 1AANA 5DFAA 4IHBA 2ICEB 4E42B 1TQBC 1J0YA 4DO6A 3HG1B 4ZX3A 2FECI 4H0LC 5SX5H 5ELIA 3WS6C 3MCLL 4TSCH 3KE0A 1M1SA 3BE1H 3L3DA 2WO3B 4ONHA 1JRHI 1MN4A 3ARUA 4L23A 2AI0L 4L9LB 3K2IA 4K8RL 4ABWA 5T3XE 3NMEA 5IJDC 4AQEB 2A77H 5ILTL 5H2BA 3TYFB 2J4WL 4OQTA 4PLNC 2AJSH 3QEGL 4XC1L 1KWKA 1QMUA 1NGZA 1QLEH 4LVEA 4TLSA 1OSPH 5I1CL 4AVHA 3RIAK 2HB0A 2UY6B 3Q5OA 2WTPA 5D2NA 2D9CA 1AKJB 3MODL 3VXQA 2MPAL 5E6IC 3T0EE 1RD6A 3VWJA 4ZFOA 5CLTA 3DIFB 1GOHA 5GS1C 3TZVC 4A04A 5EU4A 3MNWA 1P4LB 1AP2B 1NCBL 2FCBA 4NN5C 5KSBE 4LSSL 2Y7OA 4JG0L 4LARH 5LBGA 3SOBH 5ADOL 3Q7JA 1RP9A 4OGQC 5DD5L 1ODUA 3HS0A 4LLWB 2VDKB 3IGLA 2Q76A 3U0PB 3CH1B 5DVPA 3V4UH 3QR1A 4LBEA 4PLJD 2AXGA 1GYCA 1N10A 2FATH 2ZUVA 2A77L 1MWAH 1GZPB 2FB4H 3O4OB 3L3OC 2YAMA 2WLIA 2AJSL 4RESB 4HV8A 4YQXH 3ES6A 1QLEL 2BY2A 1OSPL 1XGUB 3O11B 4L1SA 2WKOA 2Q7AA 3IXAA 2J6EH 4CW1B 1UCBH 3HZVB 5D7EA 5SX4H 2JIXB 3R06A 3V5KB 4ZOBA 4L4TA 1Y1UA 3OAUH 3ZYJA 1WS8A 3I74A 5TF1H 4NQVB 4UM9D 2Y24A 4PQXA 1RIHH 3ZHLA 1KN4L 2VSKB 1SN0A 3NGBB 4KH2A 4ZUWB 4LARL 4YC2B 1ZLVK 4BSVA 3RX8A 5A16A 4JHBA 3SOBL 3RGBA 4TUUA 1URLA 4HMEA 3VGGA 3BRFA 3II3A 2Z31A 2DQMA 3MOBH 3MUUA 4P46B 2DEWX 4DZBA 4RGND 4FFZH 3DVNB 4Z95H 5EBWB 4ANWA 1HU8A 4PJ7A 1AMYA 3QULB 1D7CA 1T7YA 1DQVA 2C1PB 2FATL 1NCAH 3B3BA 4N86A 4AYFA 1A7OL 1MWAL 2P42B 3BSGA 3F04A 2A74A 2FB4L 2AEWA 2X2HA 1FV1B 1CFTA 1RJYA 2CDEA 4XPGL 5GRXG 3EJQA 4GAAA 4YQXL 1T1YA 3C5XA 4D0BA 4DGVL 2R56L 2CRZA 4YDMA 3V0GA 4CDHA 1UVQB 3JTTA 1IGCH 4G72B 3HJEA 2JQAA 4WO4B 1H3UA 3LV3A 4NIYE 4HLEA 3PWNB 4K3JH 2AJVH 2YC1B 4MAZA 5I71B 3VXPA 3HPLB 4E36A 4NQUA 5EU6A 4QKTA 5SV3A 3U0TB 3DX9B 3MGOB 1JFQL 3DJSA 3FCBA 2MMXA 3OJ2C 3PYCA 2GJZA 2ZOOA 3PV6B 2W0FB 3QFJE 2ZUQB 2HKFH 1NCDH 3FQNB 1QPKA 4EMZA 1SMAA 5JUEH 2BERA 3ATDA 1QFUH 5FECA 3C6LC 1WH0A 1EFQA 2B5IC 4V11A 5LG6A 3K5RA 3Q8FA 1VFOA 2Y6SC 3IWVA 3QHFH 2Z8RA 1WCBB 4KXZH 4I0KA 3GBNL 3VGFA 1Y0LB 2YPLE 1U8NA 5DC4B 5DMKA 4HK3J 5CEXA 1E4XI 1QBLH 2YRBA 5BS0E 3O8XC 1A1NA 1VLXA 3PGCB 1OF2A 4AYDC 1SXCA 5FW8A 1OP4A 1PD1A 4K3JL 2AJVL 3HUJE 1PL3A 4AVJA 2W81C 4HUVA 2VLRA 3DO7A 2EDKA 2BM3A 1ZGLP 3FO9A 4HFWB 5FX3A 3VGEA 3CZJA 3WEAA 5ACZB 3QJFA 5AVYB 3TJEH 1A4JA 4MS6A 2FJGA 1NCDL 2AEPH 3NIDB 3Q13A 1H3GA 2Z0BA 5T1LB 2FQDA 3N85L 2WN2A 4UDUB 4PRPB 2O1AA 1QFUL 4L1BA 5IVOA 4EXKA 1K72A 3TTSA 3P4LA 3G6JB 1EHAA 3OKDB 1JZHA 3MTXA 3RUGB 3QHFL 2CRMA 2BVYA 4YHZH 4QOKD 2P8MB 4M00A 3AREA 1FL5B 3BSHA 4NFDA 2CDFA 4HXAH 4UOW0 4YHIA 5DK0B 4EE2A 2OMVA 2QTVA 4EKXA 1MF2H 1RERA 1S7RB 4JO8A 5JQIB 3REWB 4N1EA 2GITB 1OTSC 4Q0XH 5IM7A 1UKSA 1MI5B 3VFUA 2P80D 1IM9D 1XF2B 1PCSA 3IMWA 5K39B 1KXTA 3QUMB 3MRQB 1MLCB 1A9EA 1ZPLA 4QJ3B 4N8VB 3VXRD 5LAPA 2AEPL 1MXGA 1UM6L 2F9BT 3OZ9L 5EEZA 4JFSA 2AV1B 3DO4A 5A2LH 1KBWA 4YDJA 2LU5A 5EO9B 5JZ7D 1CR9L 3OLIA 4XVJL 32C2B 1ET5A 4HIIB 4N2FA 5EF3A 4K8RC 2B1OA 1OW0C 4MAUH 4UV4H 3DK0A 2XN2A 4HXAL 4OFPA 1BPLB 4U4BA 3ZQXA 5KG9B 4QHUB 4DHLA 4KV5E 4D0DA 1MF2L 4JFQB 2VNCA 4OLEA 1N19A 1BECA 1DVZA 5BO1L 5IB3B 4PP2B 2WGNB 1BIHA 4HJJH 3L3KA 4Q0XL 2MTAA 5F2FA 4HJ1A 4Y1AE 1QSFB 3UC0H 2VLKD 1HH6B 2H9GB 4PJFA 1QFWI 3ESVF 1P5UB 2CR0A 4GPVA 1T4KB 3S5LB 2BNQA 1OAYH 3F7RA 2RFXB 4S1DD 3KLKA 3OWRA 2ZUXA 3JVGA 2IADB 2H6PB 3NIGB 5IIEB 4YNYB 3LAFA 4X0NA 1TO5A 2IGLA 1JGDB 1MW0A 1YEIL 4NBYB 2VLJB 3HR5B 5F89B 4NDMB 1G6RA 1B0GB 3SKOA 1H6EA 2YD3A 3WTUA 4Z7UB 4KOCA 3MR9B 1S78D 3FC8A 2QVFB 4NZTL 4P0DA 5F0JB 12E8H 1OKEA 3PDDA 3QEQE 4FLQA 1J1PH 2UZPA 4XMLH 5H37H 5KANI 3EG9A 4MAUL 3T4AA 2QELA 4UV4L 5KW9H 3AM8C 3EH4B 4M6NH 4ODBD 3NCJL 3V6ZB 2CA3A 5GGQL 4J4PC 1G7IB 1HILB 1O5DT 1FVCA 4PBVC 3LHAA 1KPVA 1QNZL 4QLWA 3LDBC 4LCWD 3SDXE 1GOFA 3FT2B 3P4OB 3RVUC 2W9LA 2HVJA 3UC0L 4GO9A 1TT6A 4APQB 4OIIL 1OAYL 4WI3A 1HEZB 2K3HA 2FZ3B 4XNDA 2XQYK 3G5XB 3ZTCC 2NCMA 4GRWH 4KQ3H 5INCB 3SDCA 3QWOB 1N8ZB 2GTZB 3VH8B 2R23B 4RMVA 1INQA 1XCTB 2YKKA 1KF9B 3V0JA 1FAIH 1JF1B 1DR9A 2VLLB 1J8HD 4DESA 5BV7H 3B2XA 3D39B 1DJZA 3F7YA 2Y06L 4QNPF 1X9RA 3H55A 3I2CL 1HE7A 4K3DH 1BYPA 2H0JA 4OZFH 5L8LB 2W0PA 2H32H 12E8L 3K3QA 3ZIMA 4BHUI 1BVKA 4XMLL 4M7LL 3ASNB 1EO8L 2BNUB 3OMNB 4AZ8A 5KW9L 2BPBA 5E1GA 4M6NL 2GTWA 1ZLSL 2VDPH 2GAZB 1OP5H 3SIKA 1YPZE 1ZLDA 2XKSA 2R2EB 1BF5A 1ZHNB 1HESA 4KTGA 5EO1B 1SJMA 1Z5LB 4F7TA 3EHBD 5LNDA 5GSRB 5C0RH 3I02A 3WJMA 5HYJA 1CFSA 5AOIA 3G5YA 5DVOA 1JP5A 4JJHA 5DGQA 2JELL 3W5NA 4XCYB 4MAYA 3VWKB 3CSPA 4KQ3L 4MD4B 4WW2A 5K1JA 3TNMB 2QHLA 1MSPA 5M95B 3S7GA 2ADYA 1C12A 2IQ9H 4EBQH 3IVKB 5DVLA 3TBYB 1MELA 3V5DB 2L7UA 3F12B 1FAIL 5C09B 4MRCA 4HPOL 1F4HA 1IC4H 4KRPB 4Y1TA 1E2VA 2F8VA 4K3DL 2C9VA 3IMSA 4U6HB 1JZDC 2WSKA 3LMJL 4Y5YC 4OM1L 3NJXA 1LMIA 1GH7A 3JV4B 1P84K 5K9QG 1GA2A 5JW4M 1GZQB 3GQFA 5MEOB 5FV2A 1BAFH 5C0CD 1KT2B 3N44B 2VDPL 4BFIB 1JF5A 4GRMA 4K71B 2C7UA 2UXTA 3S4SA 4I3RH 3UACA 3NK3A 1OSZB 3BAKA 1E5AA 1BQLH 1K5NA 3QXDB 3KPPB 3VXNA 2YWZA 4PJ5D 5JW4Q 2AK4E 5GIRA 1LNUB 1MHCA 2DL2A 4HJGA 3UZVB 4K55A 5MHSE 3K6OA 3MRIB 3KDMB 5DD3L 4JY5H 3ARFC 1PLCA 5CZKA 5FC9A 1E4WH 5I19L 4M43H 2GCYB 3TF4A 2FT8A 4M4RA 3UTQB 1Z9LA 4MXWH 5JPNB 1ADWA 4U49A 4XB8A 3FBKA 4BHUA 4J4PD 3THMH 3HPJB 3T09A 1IGTB 4WSKA 3RVUD 3BD4A 3C5JA 3K4AA 5D70H 3SYCA 3V6FA 3LZLA 1J5CA 3JV6B 2VN5A 2P5WD 4GAFB 3EO1B 4ZAKB 1M7DB 2JCCE 4D9QD 4MNHB 1N3NA 5B3NA 4M5SA 3H2QA 1ODAA 4GMSL 1FNFA 1N0LA 1FSKC 1BAFL 1WA1X 5HJBA 5IOKA 2J2ZB 4KKCD 4JFZH 4I3RL 4MD0B 1A8JH 5I6OA 1BQLL 3ZTDC 4XMTA 1TQBB 4NNXB 4JGJA 1MAML 1RU9H 4OVVA 5FUOH 3I3BA 1GKOA 1HI6B 1AO7A 1PX8A 4HALA 4HK0A 2NYKA 1IT9H 1N4XL 4I18A 4JY5L 1AD9A 4G8FB 3OAZH 4F91B 4JO2H 4M43L 3QG7L 2F61A 3IF1A 2DQEH 3GFUA 3LPOA 4TLTA 3DHUA 2Q20A 3V7AG 3IDNB 2P8LA 4N2DA 4R4ND 1A64A 1CICA 2A1WH 2J8HA 2BNRA 5L2KB 4P2OB 3NP3A 4OSUH 1J12A 3THML 3W0WD 2WYZA 5IV2B 3FRPB 5HI5C 2A9MH 4OF6A 1S9VA 3L9EA 4ONFH 1DEEB 5D70L 4PRAA 2VKWA 3LN5B 1I75A 3BFQG 3QWRD 5CXPA 4YGVB 1HNGA 1EDQA 4HS3B 3WIFB 3NH7H 1ZVSA 3DUUA 5I16A 5E08L 5HVWA 3W9EA 2F5BH 1P6WA 4NN5B 5E6SB 3O2WH 3LN4A 4JFZL 1WFUA 2EDBA 2XCMC 2WTOA 5MP6L 2EEBA 4HAKA 2DYPD 3VFSA 1IT9L 3R19A 4J3TA 4N8CH 4PRIA 4LPUA 4JO2L 3T4YA 1TQSA 2DQEL 1HCFX 3GMNA 5DUPL 3G5VA 2EE6A 3TLRA 2VJ0A 1ZD6A 3BEVB 4YX2H 5DJAB 2AFNA 3L3OB 3STLA 3QDGB 1A4BA 4WWKB 4OSUL 3NYKA 4XP9H 1PKOA 3RG1C 4AQ8C 3LQMA 1E9QA 3LCYA 1NMBL 1HXYB 4BBWA 3J27A 2F8XC 2GJ6B 1S7QB 1AGFA 3ARFD 4HP5A 3VXSB 1NUDA 3WTWA 4L4VB 1JWUA 2F53D 5F7LB 1IC0A 3C6SA 4O2EB 1VGKA 1ZLUK 3ARBA 3U30B 2NX5A 2F5BL 4HJ0C 3O2WL 5DEGA 4Y2OA 3JWNC 3W81A 5E6RB 3TO4C 1NDMA 1MFCH 4ODTH 1NCIA 4WTXA 3S3CB 5IVXF 2G75B 4IJTA 2CUHA 5BUAA 5IROA 3D2UD 4QRPA 2VISB 2YD5A 5HY9A 1MFEH 1HHIA 4N8CL 5D1XE 1HC1A 5ANMB 3QDJE 2OAAA 3MRBA 3N41F 2Q2LA 1I7UB 4YX2L 3D51A 4EUPG 1C08A 1KB3A 2OMZB 4JANB 1CXKA 3N50A 4IJ3C 5L8JB 4HIJB 4QYOA 5LN8A 4ZO6A 4L29B 4AT6A 4OZIE 3B2PA 4N0UA 5ALBH 3DVGA 3QGVA 4JRXB 4RGOH 1RKRA 1U21A 4QXVA 4X6DE 4NP9A 1BIIA 3FTSA 4P2QE 2P49B 5E9DB 5AYUH 3T0WA 4ZMLA 3OG6B 1WHOA 3B9KA 3Q48A 1W6LA 1T89C 5SWSA 3EO0A 4OCSH 4BRVA 3O4LA 4MJ6B 5DS8B 1UA3A 4JKPL 2H26B 1A6AA 3RFZC 4OV5A 5F97E 5E2VH 1MFCL 2FYYA 4ODTL 4XMWA 3RL2A 2A5UA 1GJUA 4AQAA 4XPHH 2A9BA 4WHYH 4X7TB 5I23A 1MFEL 5FW6A 3C6LB 3RVWD 1CGXA 2B9AA 1KCLA 4XXCA 2JVUA 5F7AA 4PB0H 3EFFA 1TQWA 4XP4H 3FQTA 5KVEH 1NBYA 3BZ4B 1UT2A 1MVYA 4WI6A 2FK9A 1CE6A 3PWJB 5JR1H 1LO3H 4L5FE 4DSYA 4OZ4A 4K94H 3QDMB 1TYEB 3ZZ1A 3O8XB 5ALBL 1ZXQA 5CCGE 2OYPA 5CEZH 1S5IH 4RGOL 4PJCA 1XH3A 4P5TC 1MFMA 4MJ5B 4CSPA 1I1AA 3T0BA 1SXBA 3AG3B 1CXHA 4G43B 1WJ3A 3GHEH 4WI2A 2Y2YA 3KLAB 3LQZB 2J56A 3G04A 43CAB 2D0GA 4AE0A 4B0MB 2L8AA 2HG5B 1F0LA 3V4PB 2F08A 4GO6B 4DP5X 3I9IA 3L7EB 5AL8A 1DQMH 1M7IB 1I3RB 1MCQA 4I0PC 3CZUB 1LO0H 3L3JA 1I7ZB 4LSQL 5C70A 1NGQH 1PU0A 4PB0L 5I2IB 1X7SA 1C5CH 4XP4L 4X8JA 2CO7B 3BUBA 4ZFQA 4XO8A 5JR1L 3M8OH 3TO4D 3CFKA 4K94L 5E1QA 3PWPA 4MDIB 3HNTH 4JG1L 5B38B 2YMTA 2MCAA 1ETZA 4BV1A 1DLHB 5CEZL 2L7QA 4F1ZA 5IB4A 1OCWH 1UD4A 1RL1A 4R90H 1HHKB 3O9WC 4A7SA 2BY0A 3C09C 1MCKA 3GHEL 1H8OA 4JO1H 4TUJA 5DI8A 1R1CA 3SKMB 2X87A 1A6ZB 3FAXA 4LPYA 4OFYA 1EWHA 1L0YA 4Z6AT 3MO1B 1MUJA 1XR9A 4FQXA 4I2XA 1LK3L 2EYSA 2ATPA 2JJVA 4KGJA 3FUFA 4OZHF 3KNBB 1DQML 3UBXB 5AW1B 3UZQA 1GZHC 4IRJC 1B0RA 4FTVB 2WANA 4Q7DA 4F37K 1NGQL 3FU6A 3VD5A 2HT2C 3EKCA 5C9JB 5EIQA 1C5CL 2IOMA 3M8OL 1KBKA 1NC2B 5ENWA 2IC2A 2PP8A 4Y9GA 4GRLB 1OGSA 1ES0A 2VJ8A 4L4JA 3HNTL 2E6JA 5E0QA 4BSJA 2E3VA 1EEYB 4RX4A 2O5YH 3SO3C 4TQ8A 3UIZA 3BAXA 4E9XA 3MX0A 3OKNB 1CLCA 1WHPA 1E40A 4PJEE 2CIIA 1MPAH 2QGCA 2XJKA 1A6TA 3NA9H 4AM0B 2W38A 4ETQB 2EE0A 3QJOA 3QVAA 1VFBA 3GJFK 3HLAB 3RRQA 1WFNA 4L1DA 5FO7A 1COBA 3MRKB 2R27A 4I1PA 2YJLA 1M7UA 3L8QA 3AWEA 1GSMA 1T80A 2FBOJ 3LS5H 1IZKA 4XCEB 4BFFA 4GLRH 1CLZH 4XBEH 1RZJH 2HKHL 2IH3B 2QPUA 4F93B 2NY5C 1BQSA 4HZAA 4XE0A 1OARH 4CC4A 1I7RB 4OJFH 2M83A 4KRLB 4P2RD 4XX1E 4ZXBD 5GJSL 3EJZD 4NRZA 4L8BA 2VRKA 3ML9A 2HFTA 3M1CA 2NXYB 4PHXA 3KL3A 1EDHA 3HRZC 3WIHL 5JNYB 5EN3A 1JV2B 1AGDA 4R96B 2EUZA 2EYRB 3WLWC 2YQGA 1A6VH 2IPTL 4LHUG 2V6HA 4UOW1 4PCSA 2O5YL 3LDBB 4YJZL 3ZE1E 4I0PD 4AQZA 4P3DB 1AXSA 1KYOJ 4XO5A 4KXBA 2OQJA 4NQCB 3ARYA 1MPAL 2KQNA 4X9HA 5BOPA 1TEGA 2PWGA 3I6GB 4AEIH 5IR1B 4TQEH 4LHJB 3SPVA 5TQ2L 2YWYA 3LS5L 4QTFA 3DNKA 2BSSB 3TIEA 4XBEL 1WQVT 1RZJL 4PJBF 5E56A 3G6AA 3R18A 1IE4A 2NRDA 3PUCA 3NAAH 3ILEA 3VXMD 3ZE2F 3VQMA 4J23A 3B7TA 4H1LG 2BY1A 1KPRA 4PRHD 4GAYB 3ELQA 3EGDA 4PJXE 4F2FA 4X50A 2XIDA 4JFYA 1HEJC 1G6RH 4J1UA 3FRUB 5KSVA 1KJ3H 2BOBB 1S7WB 2LVCA 4NO0A 2EUWA 1KMGA 4JPKH 5EUOF 1A6VL 3MJ9A 4OJAA 3QRBA 3STZB 3HI5H 1ESOA 5EOTA 5DHMC 4FFYL 2BC4B 4WI8A 4FN0A 3H7BB 5ISZD 3D3VA 2EE2A 5KS9A 4NKDB 5EZJA 2R15A 3R4RA 4GSDH 3WDHA 5DVKA 4BCYA 4G70B 1CDCA 4U1SA 1X5GA 1JDAA 2Q1EA 2LAGB 1PYWA 3DV4A 3NRFA 4HISA 4Q74A 3EYVA 1DE4A 4AJWA 4FNTA 3HFMH 4MDRA 4DKDC 4GY4A 4FXLA 1BREA 3KPRD 3WKPA 3KPMB 2E74C 3NAAL 3P77B 4AUUA 4DGIL 3NFNB 5ESAB 4HS6B 4HX1A 5EEWA 3DRTB 1BVZA 4ZUUA 1TVHA 2A9AA 1Y18B 1KJMA 4Y5YB 1KLGA 5K33A 4XH2B 5BZZA 3SGKA 2C9AA 4TOYH 1MIML 3TA3A 3LOWA 1ZT4A 2XY2A 1ZANL 3P0GB 4JPKL 4NM4H 4P99A 3ROOB 1WFTA 5EEVA 2ORBH 3HB3D 4CNIB 2DI9A 4H2AA 5KJ7E 2FSEA 3HI5L 2BS9A 4DUXA 4UQAA 3SE4C 4KUCD 1JD9A 2NXZC 5KSUB 4ODXA 2ROYA 5IG7B 5HDOA 3IFOB 3DWTA 3LKQA 2GBUA 3HG1E 3K2UH 1E3XA 1FNLA 4P57A 4PJ9C 4AY0A 3T6QC 2ODIA 4K3EH 1YSOA 3WLWD 1OB0A 1YEDB 3HFML 3V4VA 1BBJA 3ZL2A 4X4ME 4BXVA 1JHLH 2G3XA 1YEGL 3DX6B 2XN9A 3WFEH 4OLUL 3WNPA 1YQ2A 2EEXA 3MI6A 4FYSA 1FSKB 4JM4L 5ACMA 1IGYA 2AJXL 1ANUA 3ALXA 3OZKA 1TJGH 4GW4B 4HC1A 4NNYB 1E50A 1SJHB 1V54B 3NJGA 5D1QB 4NM4L 5FYJU 1DYZA 2HWZH 5FGSA 4AIZA 2E4FA 3LB6C 4B0MM 1ZGLA 3U6RA 3FHEA 4K94C 1QLRB 4JDZB 2DQHH 1KYOK 3W2DH 1NCOA 3DSNA 4JZJC 5FUZH 4MA1C 4RMBA 4IS6B 3KM1A 4JZNA 2KC0A 3QXWA 3K2UL 3GMRB 1L3NA 4XCNB 2VQ4A 4YVUA 1T1WA 4XNMB 4NKMA 1TIUA 2Q3AA 5E94B 2MNJB 3WJJA 1RJZB 2VMEA 4JFXA 4Y4FC 4I87A 3CHOA 1J0IA 1X7QB 1QR4A 1GCFA 4N26A 1B2WH 4PI0A 4FZ8H 4PM1A 2DD8L 3ECBB 4IM8A 1E9PB 2QGEA 4KKNA 1V5JA 1JNJA 4JGMA 4MB3A 2KKQA 4OQ1A 1CF8H 1F3RB 1TJGL 1X5AA 4J3OH 4LCYA 3MV8B 2HWZL 4XBGA 1MCOH 2VM3A 4Z7NF 8FABA 3U83A 2OSLB 5D1ZI 2HJLA 2EO7A 4NWTH 3D06A 1ZSHA 5DJYA 2DQHL 1YG9A 3EOBA 3RDTA 3W2DL 4LSPH 1KB5L 5FUZL 1VB9A 5CR8A 1DJIA 3U79A 1AKPA 2VZUA 1DQDH 5F71A 5CSZA 2J5WA 2H1LM 4YHPB 1J5IA 3FN0H 3NEOA 1QUNB 4KJQD 5EOCL 1B2WL 1QI4A 1UGKA 1V7NL 4N6QA 2YBRB 2WQWA 5F7BA 1BD2B 4ZX6A 2D2CC 3F7VA 3K74B 3QIBB 3U7WL 3IDJB 1R3HA 2ZXEB 2NXZD 3CDGB 1WAAE 2JE8A 2ZWLT 3X13A 3RWCB 3RVTC 5IQ9B 4PJ9D 4X99A 1AXTH 4L4TD 3T65B 1DUZB 4F2MA 4M5ZH 4NCDA 1G7PB 2WSPA 2VL5B 3NJVA 1Q9KB 3MV9B 5C0BE 5EDXA 4NJ9H 2ESVB 1XMWA 2WQUA 4AM0Q 4WFGE 4WJ5A 4G11A 1DANU 2CLVB 2Z31D 3JT2A 4F58H 2HJFB 2V3FA 1E5UI 4JQVA 3NJFA 2VIRB 4Z77B 5E5RB 1MVFA 3UTTD 1DQDL 1MCRA 4A2FA 4OIFA 4RZKA 4UQEA 5BRZD 2X9WA 4YXLH 2B3RA 3GDBA 3ZQWA 1CLOH 2V9RA 1A7QH 5D1ZA 3GNML 5KN5A 5E8NB 3T77B 1M05A 3WLBA 2EDRA 4LP8A 5TE6H 4NHUB 1AXTL 2DDQH 4M5ZL 1ERNA 5EU6D 1J9CT 3RFZB 5F1NA 2K6ZA 2DBLL 1G9NH 3KYNB 1LP9F 5FK9B 4AEHL 2EADA 4B9FA 3UPRA 1I8LC 4WHTA 3CFDA 3FCTA 1O6SA 2A9CA 1UUSA 1AD0B 4F58L 2HJKB 4CU8A 2EC9T 3KGRA 3NIDE 4UQBA 3DDFA 3NACH 4R7NA 4FLRA 4OIAA 4RQQA 3WKYA 1RSFA 4PRPE 2F74A 3HG0A 3TJPA 4JY4A 1FZJB 4YXLL 2BS8A 5K1VA 1CLOL 1I4FA 4G82A 1F4WH 3WOVA 4P5TB 1TKWA 1X5MA 1A7QL 2EXWC 2WNKA 3D09A 2QJDA 2VUKA 3H9YA 4GBXC 2LW3A 4X5WB 1OXYA 2LR4A 3RWGB 4MNGA 1OGAA 5TE6L 2EXTA 5CU5A 3BUYA 3WXWH 3DGGA 4O51A 1YEEH 3P4MB 4PJHF 2YD6A 3O45B 3UTSB 4XNAA 3IWUA 5KVDE 4LOFA 3QI9B 1G9NL 4G9FE 1MI5E 1ADQA 1S7VA 4LLDB 5F3HB 4JJ5B 1KGYE 3UEZA 5B1JC 1NDGB 4Y19A 2H1PH 2PKDA 3JSSA 3OXRB 4J8RA 5EO0A 4CDGC 5J13C 1M7XA 4W6WB 4H8PA 2CGZA 3ISYA 3MMEA 4OW6A 3WL9A 2P5EE 4OI7A 2R4SH 4ABVA 3RVTD 1V8HA 4U0RB 4HBCH 1CTNA 6PAZA 2E7CA 5DHYA 5HVHC 3CVHL 3NACL 3GC3A 3U2SB 5L4JA 2QMJA 2RQEA 1EBAA 5D7IA 1ZHKA 5KJRL 4I3SH 2PYEB 3K4ZA 2HFFB 3O2DA 4W9HC 3PXJA 5K9KA 3JWDL 1BZ7B 1UADC 4MA7H 1L9SA 1NAMH 1W0VA 4MB1A 1NCNA 2BWQA 3KXFD 3JVFC 3O9WB 5HHNA 1OM3H 2P28B 2YPVH 1XR8A 1U2YA 2XWBB 3C09B 5FKPB 3EYFB 3DRQB 2ZOWA 3WO3B 2KUTA 1GXEA 1JNHA 1YEEL 4LKXB 3MYZA 3ML8A 3KLQA 5JW4R 3B9VA 1QSFE 4FI6A 2XWJB 5FM8A 4LK4A 1F8TH 3VO0A 2ITDB 3ZE0F 5BW7C 3IMBA 1A66A 2R29A 2H1PL 4TYUA 4LNVA 4IRJB 3GZQA 5CFAA 3NIGE 1QOKA 2Y5TA 1ZIBA 35C8H 1MHEB 2CZNA 4HBCL 1FYTA 4V1DA 3E6HB 4AQ1A 1NKGA 4C56A 5B3SB 5CM1A 2ZAHA 1AZUA 2JK5A 2XZQH 4KY2A 1FAKT 5HI4D 3CUPB 1LE9B 3MYJA 2DQUH 5BXFB 2PXYC 4Z7UE 4X7FC 1KFAH 2HFGH 2XU9A 4DP9X 3SO3B 4IKLA 4NC2B 1DCEA 2CO6A 1G7HA 4Z78B 1W0WB 3VRJA 1NAML 3TO2A 4YLBA 3L4UA 2PCXA 1CK0H 5IVXB 3II1A 2HAZA 1WDAA 2YPVL 4ALAL 4UIKH 2VR6A 3N0PB 4XC3L 5C0AE 5I18L 1C16A 5EN2A 3GMLA 4Q14A 2FL5A 2CBMA 4EI5A 3N41B 2B15A 1F8TL 5DC9B 5F7MC 4CU7A 3TWYA 3FT0A 3VAEA 4M7ZC 3UGEA 2X4PB 3IM1A 1N6VA 4XOCA 1P4UA 1DDHA 1FNGB 2CLZB 4H1LH 3ZIYA 2AAAA 2NY3C 2XIIA 3MV7E 3SBRA 35C8L 3MLUH 4Z3FA 3GINA 3LNDA 2Y1AA 4OKDA 1QEWB 4QRBA 3HI1B 2XZQL 4YHKH 1DEDA 3TXAA 1QTYT 1XF3B 1U8CA 3D39E 2DLHA 3B2UD 3QUKB 3L2MA 3RAJH 4QJ5B 3T8VA 1T0PB 1ZTMA 3RU8H 1FFTB 2X5PA 4JPVL 1JOIA 1KFAL 2FLRT 2UV3A 5C9KA 3RY4A 3QNXB 1P0SE 1U3YA 3FHAA 1BXAA 1JTOA 1VACB 4E41A 1CK0L 4QI3A 5CCKH 5MEQB 5D4HA 1RI8A 2GIMA 3APNA 1KCVH 1CE1H 2V9TA 4KI1A 4K7FA 1DN0B 1TJHH 4HSAC 1MH5B 1B4TA 1KTRL 1TMCB 3HBZA 1Q0EA 3DI2B 4I9XA 5SV4A 1HYRC 3SDCD 3ARQA 5A7EA 3ZMEA 2B0SL 1OE1A 4NLHA 5D6CB 5E5LA 4F7KA 4POUB 4QO1B 4N0FB 3VE0B 1UWGL 4BH8A 3WDJA 1A25A 2YUZA 5DGRA 5I5RA 1PSKH 3MLUL 3LSOA 4QR7A 4OD1H 5IBUG 4ACTA 3QRFM 3BISA 5F88B 4U6TA 3SBWA 5GSVA 2FHBA 4YHKL 3WFZA 1L0PA 5C09E 4PJDF 1OF0A 4PJIE 3VJ6A 4A2MA 3RAJL 2IV8A 4WTZA 4CN1A 2XQBH 3RU8L 3RLSA 1P7QB 2CRIA 3RTLA 5AG8A 1VZHA 4CVUA 1AS8A 4P4RA 1XIWA 3LXUX 2Z92A 1PW3A 2MFNA 3C8DA 4KZDL 3L1OH 3SQBB 4LP4A 4NI6A 2GFBA 4G8EA 5I8EA 4ZFFB 1NKRA 4KMLB 3GXPA 5LXVA 1IBZA 1KTKE 1ZLEA 3IJSB 1ORSB 1KCVL 5HYJD 3EXLA 1J5OH 1IAIH 4A7QA 5DVNA 3IT8D 4P5SA 4KX8A 3DTXA 2QADC 3OJVC 3KL5A 5DRZA 1U3JA 3CN4A 5FLVA 1LGVA 2FLBT 5K59E 2CBOA 4UT7L 2Z93A 4MMYB 3FCSB 3GSOA 1J05B 4U2ZA 1Q90A 5LVEA 1JMXA 1PSKL 1AHKA 3HHSB 3W37A 2PW1B 4XGZB 1MDTA 2EILB 2FQGA 1CFVL 3C8KA 3DX0A 3GEFA 3QFJA 3APFA 4HZLA 4LL4A 5LN4A 3TPKA 2BRRH 4ANXA 1B6DA 4G71B 4XWOC 1WA0X 4TTDC 2WLLB 3INUH 1KG0A 3NCYP 5A2JH 1CD0A 8CGTA 3SGDI 3OV6A 2XXCB 1SVBA 5T1KA 4ZMQA 4HLZG 5J6HB 3F62A 3SKJH 3MJ9H 3IJHA 3MREB 3L1OL 3HBQA 4KK5C 4KHXH 3D48R 1G7LA 3H9SA 4FJ6A 2WQAA 4DKAA 3II2A 2Z35B 4OZHB 1J5OL 1Q0YH 3FTXA 3EYUH 5AZEH 1YNLH 1HWWA 4U7KA 2LV4A 2Q7YA 3IBOA 3TVMA 1CURA 1ZLWK 1II4E 3HUJA 2BP8B 4CN4A 3R8QA 4WGKA 5CJBA 4AW7A 5BNXD 4QRRB 3BKYL 3GSWA 1XO8A 2JFCA 4UAOC 4Z7VF 3A6OA 3DXAE 1M9SA 3Q8BA 4NC0B 5TE7H 4KVPA 3M07A 4FG6C 4J3OD 1DVFC 2DMKA 1NC4A 1W16A 4JRYA 4LEOA 5I0WA 5F0PB 1E9OA 4R0LC 2Y7QB 3MRJA 2HUEA 4OGAD 2VWEC 4FQHB 1O7DC 4Z7WB 3D69B 3JWDC 4WUUD 5DJ6A 5HTSA 1AIFA 4JZJB 4KHXL 4QRTB 4MA1B 1EERB 5HHOE 1FO0B 2YAHA 2V0AA 1AO7D 2WVUA 4L1LA 5K9OB 1H8LA 1KZQA 5LAXA 1FL6A 2X44D 4IBTA 4AUJA 4D94A 1K8DB 3FOLA 5EBLB 5AZEL 2FEEI 3WMQA 4Y4FB 3P3UA 3P9LA 1HDMA 1BQHG 2DICA 2FX7L 4M6OL 3L16A 1CICD 3O6FA 5JW3H 1G5GA 2BNRD 2F18A 3L4XA 3V4VH 1ETA1 1HN1A 2X4NB 3U4KA 1NBCA 1HJBC 4KJPC 1EZVY 4XN7A 3QDGE 1GGIH 3BUDA 4I1RA 4WHCA 3VFMA 4NQED 3UL4A 4ENEC 3B8YA 4HK3N 4QHNB 3QYNA 2OMYA 1O7SA 2J57A 2BOCA 2BVOA 4HC1H 5IQOA 3L3GA 1A3QA 4L4VE 1EFXB 1VFAA 3TF7C 2JJSA 4UI2A 5I5MA 5E8EB 3TV8A 4PJBB 1U8PB 4A2DA 3S88H 1T03H 1XB3A 2FBJH 4JKKA 2X1PA 1SY6H 3GSXA 3S5YA 4X6CE 3UTZB 3ZE2B 4ALAC 4PRID 3BVTA 3FO1B 5IB5A 3CTTA 1KBVA 4IBLT 3QZWA 5IUCA 3EYSH 2AKRB 2ZOKB 3GMMA 2XPGB 5JW3L 5CIPB 4JHVA 3WKNA 2NZ9D 1FP5A 4KZEH 5EUOB 3HAEG 1TG8A 1UM4H 1QWNA 4EIUA 1VFUA 3ZHDA 2VM9A 1GGIL 3IJ7A 1DZ0A 2FTAA 4KZCA 2CUMA 1I9RH 2OXGA 3US0A 4JRXE 2X9ZA 4JFHD 1YUKB 2NX5D 5E9DE 1BAWA 3ZKXB 2EIZA 3GXUB 4F5CE 1UD3A 5DD1L 1ZEAL 1WEJH 3CXHJ 3MLZH 5IROD 4KRMB 4QRPD 2A4ZA 3V0HA 2APBA 1SY6L 4WENB 3MLVH 3R0NA 1GC1L 2TSAA 4N25A 5DC0A 4RAVB 4L3FA 2R2HB 3EYSL 3VD7A 2QVMA 1BFVH 1FCGA 2QSVA 4QRSA 4XODA 4YHMH 4XN5A 2ZWNA 1TNMA 3K1DA 4PVLA 2JWYA 3JZ7A 4KZEL 2ERJC 4G7VL 1UM4L 1M1XA 1XB6A 1A0QL 5B7FA 1QHOA 3ZN6A 4AIOA 4R4BB 4ORGA 5BZDB 1AQKH 5DQDL 1K4CB 1PG7H 3X12A 5F93C 3QWNA 2OMXB 4EDWL 3QDME 4OGYL 1SOKA 2Y7SA 2CGYA 3NJHA 2PW2B 4BZ2A 3U36A 2LE9A 1U8JB 4RFNC 5TK4A 3B9KD 5SWSD 3C60A 1CMOA 1TZHB 1QAWA 3O4LD 4HPYH 4PSRA 4PV8B 3OPZL 2A2QT 3SQOH 1NFDF 1SRDA 4NQSB 3WY4A 1DQQA 2BSTA 1WEJL 3MLZL 2XWEA 4KZ0A 1JZGA 2IDQA 4P23A 3HFFA 1E4KC 3MLVL 1CLYH 2KL6A 5FO8B 4PGEB 1TLKA 3IMRA 4JFOA 1EA9C 4MJIB 2E9WA 3DPBA 1F1GA 3U46B 4UTAA 3BP5A 2R69H 3KZ8A 1J86A 1NLBH 3OM3B 3RWFA 3FO0H 1OPOA 1TEFA 5AB0A 1L9TA 2W9EH 4JZOB 3QXAB 5CO1A 5EEYA 4QCIA 4GBXB 5CLYA 3MRDA 1PG7L 2A7BA 3OXSB 5AW8B 3S9DB 2X6VA 1T04B 1JG9A 1JZIA 1WBYB 4PGBA 1A7NL 1U8HB 3BEWA 1T1ZB 4FG0A 4N68A 5AD0B 4Y4HA 3MBWB 5SWZA 5A2IH 2X05A 2YA1A 5FFOA 3S3DB 4HPYL 2HN7A 1Q8MA 2J1YA 3SQOL 1KB9K 3FO2A 1EAPB 2WP3T 5J13B 4WFHE 1KJVA 2CJTA 3P0YH 2I85A 3NTCH 2VH5H 2ZKYA 3GSUA 5FHBL 1NINA 4IKIA 3UGUA 1T1XA 3JTSA 4DP7X 5I8CB 3QYMA 5JOPD 1EGJA 2EAEA 4U1HA 4G8AC 5HVHB 3VI3A 4ANUA 4NRYA 3GMOB 2OS7A 4U1KA 3AXLB 1NUFA 4QXUL 5LQBL 3QIWA 4FTVE 4WEBL 3GSRB 4LRIA 5F6IB 5IW6B 2R69L 2SEBB 4G42B 3F85A 3GBLA 4N9GA 1A1MB 4W9IC 4JFFB 4Y5VC 1AI1H 2PTTA 4KY1H 1K8IA 2QKIA 3FO0L 4Z7NB 2WBJC 1HXMB 4BKLA 2IAMA 1QKZH 3ZKQD 1RZPA 4JE0A 5IREA 2ZF8A 2HA1A 1T2JA 1BOYA 6TAAA 5DSCB 1L9RA 2XWZA 1T3FA 3MRRA 2DI7A 3BP6B 4L8DA 2BZ7A 1FZOA 4R8WL 4OFYD 2JCCA 2QDVA 1W72L 1JK8B 4GI9A 1ADQH 4KKQA 4NENA 2A6IA 3NTCL 1FVEB 1U9KA 2VH5L 3ATBA 4TRPL 5E4IA 3CFTA 4YWGH 3UYRH 2HFEB 3CZEA 2XHNA 1PIGA 2DAVA 1ETJA 2CALA 3FH7A 3ILQD 3IKCB 4PJGF 1NMCC 2XTJE 1JTTA 2WVSA 3EOYG 5DUBB 1URIA 4YDVA 3ZKMC 1U3HC 5ETUA 3VFWB 1U8MB 1DLFL 2ADGB 3FF7A 4J3VA 3MRCB 3Q9QA 4Z7IA 1JWSA 5E6ZA 4LKCA 3IRZA 4YGAB 1AI1L 4HH8A 1P2CA 4BFNA 2IG2H 1MFBH 5DRWB 4RX4D 1QKZL 3VD0A 4QXGH 4GQPH 4MDJB 4RH4A 2AXWA 3ZT5A 4GEJA 2CSPA 3H3PH 3L95A 4P4KC 3F7KA 1GVIA 1THCA 1JWMA 4HBQA 2B20A 4IGBB 4RIRB 1H3PH 3BT0A 3WGUB 3IE4A 5DQJB 4MNQB 2EVFA 3GMPB 4H25A 3H54A 4NQCE 2DMCA 4M7ZB 4J6RH 1A5FL 3TNNB 2YK1H 4RAHA 2DWDA 2VDOB 3UYRL 4YWGL 2FE0A 2NY3B 2IWFA 1KB5B 3FN3A 3QAZB 3SN6N 2CJUH 4NO5B 1GYVA 3FZUD 4QT5B 2QVIA 2OK0H 4NKQB 3UTPE 4DP6X 5DUMH 1MQKH 2F54A 3KBFA 5IJBC 2WLYA 5DZNA 1PKQB 4AYBA 3VGHA 3OBAA 4PJ8C 4M03A 5JIDA 4KO7A 4AGPA 3QDAA 4MJJA 3BWZA 4N4YB 1HQRB 3ARGC 3CWGA 1BXVA 2YGPA 2IG2L 4ODVH 1MFBL 1QP1A 3GB7B 1DQLH 1Y6NR 2V4LA 4GUPA 4RA3A 4QXGL 1LP9B 4GG6B 4YXHH 1AHMA 1WIOA 4LOVA 4FKKA 3NSDA 3DJ9A 5BJTB 3FU3A 3FT3A 5DJZB 3H3PL 3WHXB 5T3XH 3SCMA 1WBZB 2X4OA 5GS0H 5BVJA 5BQ7A 1H3PL 6CGTA 2X1OA 4ICXA 1DSFH 4MJ2A 5EBMB 5ID1A 3IYLW 2OX5B 4J6RL 3TEZA 1P69B 2P24A 2YK1L 4FQCL 1U93B 3GUFA 4JHZA 2LAAA 5FOJA 5JO5B 2J72A 3D85D 4HKXA 1OAZH 4TVPE 3ROLA 3VFVA 3KD4A 2CJUL 5IBLC 4U1JA 2OK0L 2QQKH 1QI5A 3NIFF 3QJVB 4EUPB 3CFEB 1GC1C 4PS7A 3PQYA 3QR2A 1B4JH 1QQDB 1FNEB 2QSCH 4F27A 4UZSA 5BZWB 4XNUH 4NO0D 2DM3A 2Y4SA 3RWEB 2K0RA 5CN1A 4PJHB 3FONB 2ZZUT 4ODVL 5J0BA 1DQLL 1I8IA 1MNUL 1NH6A 3FF8A 3D6GA 4AX3A 3DMMC 2ZXQA 5IT2H 2JTDA 3D3VD 2N1KA 5T3XL 3IGKA 3KBPA 1XGZA 4WNQA 5GS0L 1FGNH 5IFHL 3WDIA 2QADB 4X7SH 2NNFA 3HN3A 5KEZA 4YFEA 3BXNA 3GRBA 4P2QA 4RSYA 4LMQE 4YIQB 1RFDH 2J25A 4KFMA 4ODHL 4APXA 3HE6A 5I75C 1JV5A 4OF7A 5IEKA 2E4TA 1MRCH 1D5XA 3IGUA 1Z1WA 5D72H 1ZA3A 2J1WA 4ZS6C 3VTAA 1BV8A 4LOEA 1YHPA 1QRNE 2NNXA 2GBAA 5I8OL 2NY2C 4HDIA 3TA3D 3CDCA 1EIBA 2QSCL 4XHQA 3BP7B 3L3HB 5IESH 2I5YH 4XNUL 3MLSL 1AQMA 4WI0B 1LVEA 3ZZLA 4D8OA 1KIRA 1T5KA 3EZJB 1IKOP 2EIJB 3D2TA 5D1QE 5KANG 3VI4A 3ZE0B 4HWEH 1F90H 1Y6MR 1P7HL 1ET7A 5IT2L 1GL4B 2JKRM 5KYWB 1WC7A 1IC1A 2FJHB 1MDAA 1M56B 3TT3H 4DUWA 2CHZA 4JY6B 3KWUA 5H4ZA 2ARJA 3OLGA 4WEEA 5EBGA 3V0DA 1XH1A 4WKZB 4JHUA 3TU6A 1FQ9C 2QPDB 1NM4A 4PLKD 3FTGB 5EF1A 2WIMA 3V0VB 4EO5A 2Q3XA 3D4ZA 4P5KA 2R8SL 5GHWH 4HWBL 5CGYD 2H0PA 2XN9D 4FYRA 2BJMH 3U9PL 1KYUA 3WMPA 3CVHB 3HE7A 3ZYOA 1DVFB 3F5WA 4F8OA 5IMOB 3NA4A 4WFFE 4X80H 4NHCH 2FT7A 1DZBA 5IESL 2I5YL 1KIPA 3C2AH 4FULA 4R0LB 5DK2A 4DVBA 3A47A 3KPQB 4RMTA 5J3HC 5CN3A 2C3HA 2H8PA 4LEXH 2CO4A 4AYSA 3MV8E 5GS3A 4TUOA 4HWEL 4PW3A 5KSBF 1F90L 2DKUA 3QCUH 2GPZA 4I13B 5B1AB 4FQIH 5FB8A 2E56A 3IFPA 2YUVA 2GSIA 2WB1A 2XBZA 2IJ0C 3IBEA 3BKML 3NSJA 2JQMA 4OM0H 2VDML 5EUKA 3KVDD 5JHDA 4FABH 4LOUC 2ATKB 4B5ZA 1W9XA 3DROA 5J12C 4BFBD 2BHFA 5K69A 1F02I 2NY0B 3GPEA 1NOAA 3EH3B 4X5QA 3B7YA 3QNZA 2BK8A 2IBZX 2XZZA 1YMME 1AR1D 4UILH 3D0LA 2BJML 4JAMB 4Y5XC 3RTQA 5C3IA 4KDTA 2Z91B 2AERT 3WHE0 4RISH 4X80L 1Z9MA 2EDDA 3U0WH 3C2AL 4HS8L 4LHQB 4J3UA 3QJHA 5EOQL 2NY7H 4K9EL 4BK5A 2CHNA 5D7JA 1G0YR 1E8YA 2C9PA 1RZ7H 2GT9A 5JIKA 4GKNB 5J9PB 3JWNE 2VC2B 3DOSB 3MV9E 3QCUL 2ESVE 1QR1A 3KCPB 3NCCB 1YNTF 2I26N 4FQIL 1D9KA 2DLEA 5E6UB 1XGQA 3WFHB 4OM0L 3H1ZA 3LZNA 4FABL 4JHWL 2NSXA 3AUWB 4A6YA 4FKHA 4EI6A 1Q38A 3ABZA 4PJDB 3Q06A 3QUYA 1U4EA 2BP0B 2UX7A 4HXBL 5DHXB 1I85A 4UZUA 3F00A 5JHBA 4H88H 2G9HA 4F15C 3CX5J 1LQSR 3M1OA 3N2JA 4QWWC 1JGVL 4UILL 1N70A 3RNQA 3HC0A 3V0WH 4DP0X 5JLZB 3OQRA 4N2OA 1YYLL 3C6EA 4ZYKA 3QXTA 4RISL 3CFNA 4K2UH 3FQWA 1OAUH 3SDAC 4LHUB 3ELAT 3RBGA 4HA1A 1OALA 1BF2A 1VENA 2H1XA 2NY7L 2H5UA 4F8TA 2GK0B 3NCEB 1MREH 2OMUB 2C3XA 1SYSA 1O7VA 3BH4A 3WEBA 3VSTA 1RZ7L 1CI3M 5I9QC 3A4AA 4NO2A 1MWOA 5CZXD 4YOKA 3I9GH 3L9RB 2NLJA 4UCFA 1NIFA 3FT9A 2DQGH 4OR1A 5BO0D 4FJYA 4NEHB 4UIMB 1RUPH 1W8OA 3K2KA 1X4XA 1BA9A 3FTYA 3EFOB 3QCVH 3O3DA 3FQRB 1U91B 4RZCA 5LBSL 2ERJB 1USQA 5T33H 1FZKB 3K91A 4H88L 4XVUC 1U8OB 2K1MA 3CQPA 2G3ZA 3AXIA 2AJ3B 2FNBA 3V0WL 2H2SD 5IB2B 4P3WA 3C5ZA 2Z1PA 3QEHB 4RFNB 4AL8L 2I24N 3ZTEA 3OKMA 1OAUL 1MFDH 5E00A 5J1AB 4UWQB 3BO8A 1MREL 2YR3A 3QSKB 1PDKB 4HIEB 1H5BA 3UTSE 1ZTXE 1NBZB 3KPTA 4K9JA 5KTEL 2PP7A 1UT1A 4U6XB 3L1EA 3I9GL 5T1MA 1L6XA 1RUAL 4IBQA 2QHRL 5GS0C 1IIKA 4Z7VB 5CNHA 1RUPL 5KSAC 3CC5A 4HIHA 5DJXA 4Q6IB 3QCVL 4WI9A 5D5MA 2O72A 2W65A 4GP5B 4FQ2H 1MCDA 2WKOF 3PWUA 4XMKH 5JA8B 3NCYS 1UJ3C 4M9OA 3LKPB 3QPKA 5CGBA 1JZ7A 3T0EC 4JQIA 3L5WB 2CJSA 1OCZB 2F15A 2E9BA 5AAWC 3PHAA 3GSNA 1MFDL 1FH5H 2YXFA 3IGAB 4BZ2H 1WS7A 4L3EA 4BFEA 1JYNA 1JZ6A 1TSHA 4HAFA 2V2TA 3IRPX 4N90D 5GGTA 5IUSA 2BCKB 5I5JA 1P1VA 1KXQA 5F1OB 2FWOA 4XX1G 2H41A 1Q1PA 3GGWA 5LGKA 4XPAH 2NUPA 4X4XA 1RIUH 5E5UB 1T5XA 1U8KA 1PZ3A 4X7CC 3VFRA 4F7EA 1N64H 3BAEH 4N2GA 3RVXD 2VDRH 5HHQA 5BCAA 1D5MB 5C0CB 4MS8D 1ZV9A 3HBPA 1IX2A 4LL9A 1JZJA 4JM2A 2ZF9A 4HAGA 4KJYB 4JPIA 4FQ2L 4UTAH 2WBJB 5I1IH 5IMKB 3G5ZB 4YR6A 2ICEA 3QQNA 3CX5K 2E6PA 3D30A 3NJNA 5E2UH 1MJJB 4KV5F 2JV6A 3EDFA 3DUSB 5T1DH 5E4OA 1KGXA 4Y1SA 1BFOA 4L9LA 3WFDH 4DETA 1WGVA 3VXUA 1FH5L 4X6FB 3T6XA 4AQEA 3ARDA 3E38A 1RZQA 3MN8A 4BZ2L 1YEKL 5GRUH 5IVXE 3WY1A 2JKXA 2V9UA 3TYFA 2GTQA 3H9HB 1XGRB 1SXAA 2EO1A 5IFJA 2ZX6A 3W82A 3HC3L 4I89A 2UY6A 4ZTOH 4L0YA 4XPAL 4XO3A 1NMCB 1HL8A 2C1OA 1RIUL 4BH7B 3AABA 4LNRB 1N64L 4V1DD 5K9JH 1U3HB 2ZPKL 5FKAB 3DIFA 3P3RA 4OBRA 4GKOA 4PV9B 4W9EC 1AP2A 1DVTA 2P44B 2YUXA 2ICWJ 3QXUA 2V3DA 2DQFA 5I1IL 3GD1C 5AW3B 3M1BA 2Z0UA 1G94A 5E2UL 3NJMA 4LLWA 2HX9A 5C0JB 1XX9C 4ZFZB 3U0PA 1LK2B 4P4KB 5T1DL 4KQ4H 2JKWA 3TP4A 4AE1A 3E1ZA 2X4SA 3TCXA 3WKMH 5GZNA 4G6ML 3CJJA 5GRUL 1Z9PA 1GZPA 2OL3L 1UXSA 3QCTH 4EI5D 4K9EC 4P5MA 4PWHA 5F3BB 4YSCA 1F86A 1MLBA 3ZT7A 1XGUA 5I1LA 3FFCA 1NWOA 2BRQA 3O11A 1OP3K 3RJOA 3T0ED 4ZTOL 1YAZA 1IIIA 4JFVA 2JIXA 2ZUUA 3QBTB 5K9JL 1JXKA 4PJ8B 2PR9A 1KTLB 3BIBX 3UZEA 2NNAB 2EEAA 4PIBA 1JGEA 2CKNA 3VWJC 2VAAA 4ZUWA 1VFMA 3ARGB 3JYCA 1NEZB 3PGDB 5A2CA 4ILDA 3PAVA 2AQTA 4OV6F 4RBPK 3GMQB 5DJ8B 1XVSA 2ZJSH 4AC2A 2QFRA 4Z0XA 4LPXA 1NFDB 4P46A 4DNLA 4YSQA 1J48A 5FFGA 4YDZA 4E41D 5D8JL 2FEJA 1OSEA 3KVQA 3WKML 4G9DB 1O6VA 2C1PA 2EIKB 1UQSA 3OKLB 1CZ8H 4QHKJ 3DJZA 3UERA 1GY2A 1QA9B 3QCTL 4U3SB 1FV1A 3V0AC 1FI8C 2X0UA 4FRWA 1K4DB 3QUGA 2L7JA 5I0XA 2IIJA 3MJ7B 4LQFH 1UVQA 4Z1PA 5B39B 2X7LA 2GVYA 4IQHA 3GS4A 1FIGL 1BJ1H 4AXWB 3PWNA 3MZGB 2AQSA 3HPLA 3PHSA 2A9NH 3WU1A 2XT1B 5I74C 3QORC 1MHPH 4Y9EA 4ZODA 1HQ4B 3RB5A 1Q1JH 4DW2L 3MNMA 3PV6A 3QZMA 4MXQD 2W0FA 1SBSH 1M9WA 4HHAB 1LYQA 2OP4H 3PDGA 3EJYD 1UKQA 1J0KA 3AU1B 2KI6A 3LKSA 3DMMB 1PPIA 1OQXA 2GJPA 4PCTA 1PQZB 3OZLA 4AL8C 4XX5A 1AZBA 5TQ0H 2IQAA 2VSDA 3HMWL 5JOFB 1CZ8L 3QFDB 4HUWB 4H0IA 5E4EC 3I6LE 4HWZB 2L4OA 3QG6B 4W81A 1Y0LA 1QFWL 4W9JC 3KWTA 5I75B 4PMFA 3LNEA 3I3DA 4DWHA 3AG1B 3PGFL 3CFUA 3TBTA 2HLAB 4ZFGL 3D7PA 3SDDC 4EKJA 1NCCH 4KO6A 1FNAA 3TASA 5AWNL 4KROB 4QRRE 3QFJD 5JW5A 1GGCH 1MHHA 1EEZB 1MHPL 2M8XA 4GI8A 4HFWA 4WKXA 4BCXA 1Q1JL 3QUXB 3QJSB 4GG8A 4OLVH 2Y3NA 3MRHB 3RY6A 3DVIA 1SBSL 2WN3A 1G7QB 4D8PB 5DR5H 4G7YH 2AW2A 2DQDL 2J55A 5T1LA 4A2GA 1E30A 4UDUA 1TEYA 2BZDA 2F2HA 1PZCA 2PCFB 2V2XB 3CHXA 3H9SD 5C8JA 3EDKA 2R4RH 4TLKA 3T0XA 2B1AL 5AKRA 3G6JA 3IJ9A 4JUSA 1V3LA 4Z7WE 5TQ0L 2YPLD 3G6DH 1T83A 4GMTH 3V79C 3RUGA 1TETL 3FDWA 4PJGB 1SEBA 5E8OA 5DK0A 1CGTA 3LX9A 4NCC2 3WE6B 4WI7A 1UWXH 2RD0A 2HVKB 2W94A 3N04A 5EZIH 5IVZB 3TVMD 4AK2A 1T0NB 4N9OB 3C5SA 2ZX8A 1SNRA 1ASQA 1NGXB 3B83A 3DA0A 3GXMA 4KGLA 4M56A 4KQ0A 4MTMA 1QEXA 1NCCL 1WZMA 4EIBA 4MA3B 3EH5B 4XXDB 3SY0A 4QD2E 1MLCA 2E8ZA 1ZXKA 4WTWA 3HN8A 4N8VA 3Q05A 1EUTA 3QNYB 2ZAIA 2HP4A 2V5MA 1GCYA 4G7YL 5DR5L 3U7YH 1NFAA 3O6KH 1MJ8L 5D2LA 4GIAA 2WTRB 2UYLA 4JK0D 2GUOB 1F45A 3FMGH 5EO9A 5TGBB 1GGYA 32C2A 4OFVA 4Y4KC 3G6DL 4GMTL 4HIIA 1S5HB 4PRBA 2IH8A 4D9LH 1A3LH 2AEQL 4YHLL 5J12B 1U8QB 3ZE2E 1W72B 4QHUA 1N67A 4YBQD 1HSAB 4GXUN 3LEXA 4HWUA 4PP2A 2IAAC 2EH7H 3ESMA 4AH2B 2D2OA 3O3AB 2LFEA 1BQUA 5D4QA 4ZMOA 4Y5XB 1HH6A 3S3SA 5JQHC 1T4KA 3S5LA 5EUOE 2RFXA 1FHNA 2J8UE 4MJHA 1WZ1H 2VDLH 1ZS2A 1YMHB 3MRFB 2C4XA 4LGRB 4XVSH 3NFPB 4WWNA 3U7YL 1T21B 1X5ZA 3O6KL 4LLQA 2VO8A 5HDQL 2Y22A 4UUJB 3AB0C 2X4QB 4ODWB 5DRXB 3TFKD 1IBFA 2VLJA 3M88A 3I6KB 1LEIB 3QH3B 2G30A 2C3VA 3MR9A 4X9FA 2AQPA 5JXEA 4L5FL 1I1FA 4N5EC 4PR5B 4B9JA 4H5SB 3NIFB 5FGCE 4UT6A 5DT1L 1G7IA 3ULUD 2OMTB 2HT3D 3L7FB 2Y7NA 2Z8VC 4APQA 2I27N 3ORJA 5E2JA 4OZIF 1IARB 1F6AA 2R1WA 1ZT1B 3SDAB 3DYMA 3G5XA 3L5XL 5EIIG 5GGSY 1TCRA 2VZTA 4X6DF 1TFPA 5INCA 3QWOA 1TVBB 1N8ZA 3K6NA 4XVSL 3T2QA 1GS7A 1RUMH 4M93C 4A55A 1H15B 4EN3B 3BMWA 3GBMH 4FQ1H 1JF1A 3MZTA 5I9QB 1FFOA 2ZG1A 2VLLA 4TM9A 4MVBD 1A1OB 3SYPA 3QEQD 1HFUA 1M71B 3GLDA 3WO4C 4ZXBB 1PY0A 4ZMZA 4XMPL 5DTFB 3LH9A 1WTLA 5C0EB 2BNUA 5J89A 1H3XA 2BSDA 3PAYA 1WBXA 5DHVB 1XAUA 2CLRA 4H8WH 3RWHB 1AMXA 4FMFA 5KZCD 1CFMA 4MJIE 2WLJA 4Y2DC 2WZPD 2B8OT 4XMXA 5EO1A 1Z5LA 1GY1A 3EDEA 1VZIA 4YHYC 3S8FB 1F00I 3MRLA 4XCYA 1G87A 1ORQA 4MD4A 1PD6A 3LVTA 4PSPA 4ZBJA 5EIVA 3TNMA 1LE5A 1T20B 3C60D 3NN8A 3SPHA 3TBYA 4DTGH 1N2RA 2XNAA 2VXVH 2IMNA 1OGPA 3I3EA 3MNZA 3OGOE 4FL4C 2XKUA 4GAGH 2BO0A 4HSQA 4LPCA 3TONA 3MNVB 4PRHB 3RGVC 3LZQA 4U6HA 1WA2X 4P23D 4HUXA 4R84A 5DQ9A 3JV4A 3MCKB 5KSAB 1GMIA 1GZQA 3KLLA 3S8GB 3QQ4B 1IM3B 4BFIA 4H8WL 1N6UA 1IAMA 3A6BH 4R5TA 1YY9C 1OAJA 1OSZA 5EC2A 3MUGB 1KC5L 3QXDA 3FU8A 4LZKA 5GGUB 3KPPA 1VIWA 4X4YA 2CD0A 2CM6A 3L6FA 3WNKA 3S2AA 5DMGC 1NICA 5FGBA 4B9KC 5IW1A 3MRIA 3KDMA 2Y5EA 2WCPA 2XETA 1KGUA 3B2VH 4Z7NE 5KSBB 2WXHA 3PCYA 4W9LC 3UTQA 4TNGA 3GXTA 4HKBB 4KUZH 3LRSA 4Y4HD 2P26A 5SWZD 1XF4A 2VABB 3PV7A 3MLXL 2EO9A 1KNOB 1M6UA 3SDYH 3ZGHA 2VXVL 1KIUB 1S7SA 2NY4C 3VH8G 4XMVA 5MENB 5FUCE 3CZGA 4XPTL 1KJ2H 3JV6A 3AAZB 1N6QL 4ZAKA 5H8DA 4TPRL 2D4DA 2OXHB 5DA0B 3B7SA 4PS8A 4F9LA 5ALCL 1EXUB 2AJZA 2CUIA 1C5DB 1ZT7B 2DS4A 1HOEA 4HU2A 4O2FB 3VFTB 2J2ZA 1I7TA 2VUYA 3ASWA 3QIWD 2AK4D 3A6BL 2K8MA 4MD0A 3FB6B 3IEAA 3SKNB 3T2NL 3DVFA 3NZ8A 1F11B 3WS6A 3HNSL 4ZOEA 1HI6A 4L8SB 2IAMD 5DMJB 1EHXA 3FH5A 4G8FA 4FZEH 4XO4A 3B2VL 4QRFA 4MZ3A 1YUHA 1E27B 2LGNA 3I6SA 3QQDB 4JQIH 2UVEA 4CVXB 4AYGA 3GUTA 3HA0A 1KTDA 3ESUF 3IDNA 4P3CL 4MZRA 5LKNA 4PJEF 1YNTB 3TGXA 3OKYA 5L2KA 4XNYH 5IV2A 3FRPA 2Y6TE 3PJSA 1DEEA 1PLGH 4MNQE 5GGTH 1KJ2L 3LN5A 2Q0ZX 4WW1B 2ZNWA 4YGVA 2MNUA 4HS3A 4U3CA 3WIFA 4GXFA 5EPMB 2ZUTA 1BJ8A 5E6IA 4DQAA 1CO1A 2HTKD 5GS1A 3TZVA 2VDMB 2VZ3A 4PWFA 2VQ1B 3SJVA 3VFGH 1JIBA 4GW5B 4KNUA 5FYKH 4ONGL 2FJFA 1MKFA 2FVNA 4PJCF 1X5YA 3KEDA 2Q8BL 1U8IB 2AC0A 4PRNA 1MJUH 2PR4L 5TH2A 3GYRA 4ELMA 1SM3L 4KO5A 4KRNA 4DK6A 3L3DB 2BIMA 2C26A 5AOMA 4GAJH 3KH4A 1MCWW 1A22B 2OCJA 3CK0H 4XZ4A 5DJAA 1VCBC 5KYXA 3KR3H 1YY9D 5C2BH 5H2BB 2EYTA 5CD5D 1CGYA 4XNYL 4X0KA 2PO6C 3BZFB 3PABB 5LGJB 3KWWB 2GEEA 1C5BH 4ADIA 5INDB 4X9GA 5GGTL 1FF5A 1NGZB 2YSSA 1MW2A 3A22A 3BPOC 5HI3C 2GJ6A 1S7QA 3P9MA 3VXSA 3HMXA 5C07B 1DBJH 4L4VA 5TDNB 2HLEB 4XTRC 1RXLA 3VXQB 2CCWA 4OFQA 3VFGL 3VXTB 3V0FA 4ZFOB 2NW2B 3VWJB 5IK3B 3QWQB 2NY1C 2WINA 5BS0B 5ID0B 5EU4B 3BRDA 3MNWB 1KLFB 3SYQA 1HZHH 4S1SH 3HAEB 1ML0A 3MBEC 1QLFB 2G75A 1MFUA 3LXCA 1IJNA 3EXJA 1MIEL 4RDQF 3CN2A 3KWVA 3EBIA 1IEAB 2MOVA 4OD2B 2P80A 3MJ6A 1IM9A 4GUOA 5ANMA 2VDKH 3JWOL 1ITCA 3MDJA 4YE4H 5L0QC 4GAJL 3SCMD 4M1CD 1I7UA 4DUVA 3I9PA 4LBEB 2AXGB 2WVVB 5L2JB 4RGNE 4JANA 2X4TA 3FB8B 5C2BL 2QQLH 4U1MA 4HIJA 3UYPA 4B95C 2WLIB 3PNWB 2XX1A 2DEYX 3TBWB 1AAJA 3ES6B 1R3LA 2R1XB 1BF8A 4CC1A 1H9DA 2HVBA 4Z3JA 4FD0A 5E9DA 3IXAB 4RRPM 1SUJA 5AOKA 1DBJL 4XZUB 5B4MC 1KCWA 5G4OA 2JB5L 5I74B 3BT2H 3FN9A 3QORB 3RWJB 2VAJA 2V7NB 3DIDA 4L4TB 4D0CA 2XA8L 3BKJL 4ZT1A 1T22B 3QDHA 1TTFA 2AJYH 2H26A 2CO3A 3ARBC 5DD0H 3FB5B 4S1SL 1E4HA 5D1XD 2X42A 4M61A 4PWEA 4FGMA 3NZSA 3VX0A 2YIHA 3GK8H 3CFCL 4DGWC 4X7TA 4R7XA 1A4AA 3C6LA 4EZLA 2VLKA 3OB0H 5PAZA 3ET9F 4DZBB 4YE4L 3IPBA 4ADJA 2GBVA 4O02A 3J07A 2XQYA 5E4EB 4G5AA 3ZE0E 1KYFA 4UV7H 3PWJA 4MJ4A 1AJ7H 3K2MC 2XUWA 5L4MA 1G9HA 2A74B 3VG0H 3EAKA 4KJWC 3F65A 4P2QD 3WUZA 2CDEB 5DWPA 3O8XA 2Q86B 4I48A 1NKOA 5F9JA 3HE6D 4OJCA 4DFIA 3QC5X 3SDDB 5I17B 4MJ5A 4MCYA 1ZY9A 1PLAA 3JTTB 3CVIL 4M48H 1FJ1B 3IDIA 3BT2L 3D52A 4TQIA 5F7YC 3DC0A 1XB8A 1MJ7L 2H2PD 3LQZA 4LVOC 3UYOD 43CAA 1QUPA 2KH2B 4H8WC 2EDJA 5DD0L 1M6OB 4UANA 1AZRA 2HG5A 4Y1AB 1UA7A 3PUUA 3K8KA 3L7EA 1BGXH 2JH2A 3GK8L 4LCWA 1M7IA 5AG9A 1O75A 1I3RA 5KBNC 4IOFC 2WYTA 2VWEE 4X8GA 3VRLF 1G1OA 1U2HA 4RMWA 1H3WM 4XTRD 5FECB 5I2IA 3UAAA 3HKFA 2VDNL 2CO7A 4R2GC 4UV7L 1G9ML 2IDSA 1AJ7L 2X1QA 4PPTA 1IC5H 3LXBA 5DMYA 2MQ0A 3VD4A 3MBXH 1DBMH 1FH2A 3VG0L 4FHKA 1DJYA 3VU1A 3KJ6L 2V17H 2VN3A 3D8MA 4MDIA 4G3YH 1DLHA 3CLWA 2J5LB 1RQ5A 1A1NB 2ITCB 2N7SA 1CBVL 1HHKA 2V5RA 4M48L 1CFBA 2EC8A 4IRZA 3QPQC 1TZOA 5F96L 4IIQC 1CYXA 3HE7D 3SKMA 1NBVH 1A6ZA 2H3KA 4HUVB 2VLRB 4L3CB 5M7QA 25C8L 2D4FA 4QGTA 3DO7B 3MO1A 3BVXA 3FO9B 4NKIH 2NDGA 5I6PA 3QJFB 1A4JB 1NL0H 2ED7A 1SN5A 3WUWG 3WNNA 3KNBA 2W07B 5KS9F 3CD4A 1VADB 1CFNB 2FQFA 2Z4TA 2BHUA 3VXRE 1F1DA 5I6NA