3W1ZA

Heat shock protein 16.0 from schizosaccharomyces pombe
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
134
structure length
134
Chain Sequence
PPTVNDLFSDFVSYSPRLNNQIPGELSPSIDVHEGKDTVSVDVELPGVKKEDVQVHYDSGKLTISGEVVNERKNESTEGNQRWSERRFGSFSRTITIPAKIDADRIEANFSNGLLTVTLPKVEKSQTKKQIAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Heat shock protein 16
publication title Nonequivalence Observed for the 16-Meric Structure of a Small Heat Shock Protein, SpHsp16.0, from Schizosaccharomyces pombe
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 18
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3w1zA00
2KLRA 4M5SA 1RL1A 1SHSA 3L1FA 4JUSA 3QORC 2Y22A 1WGVA 3QORB 5DS2A 3GUFA 2WJ5A 4YE0A 1GMEA 2BOLA 3IGFA 4MJHA 2Y1ZA 4RZKA 2CR0A 2N0KA 3QORD 3QORA 3VQLA 3VQMA 3W1ZA 4YLCA 5LUMA 4M5TA 4ELDA 2N3JA 2XCMC 4FEIA 3AACA 4PCKA 1EJFA 2KMWA 3GT6A 3EUDA 3L1GA 3L1EA 2K8QA 3Q9PA 4I88A 3J07A 2JKIS 3AABA 1WH0A 2RH0A 2O30A 2Y1YA 4JUTA 4PBDA 4YL9A 1X5MA 3GLAA 3Q9QA 3N3EA 4ZJ9A 5DS1A 4YLBA 4YDZA 1WFIA 2CG9X 2MNWA 2WJ7A
chains in the Genus database with same CATH superfamily
2MQGA 5C3TA 4EO5A 3BKYH 3QJQB 4TUJB 5JW3H 5DJYB 1G1CA 4YHLL 1E28A 1XQ4A 5F3HB 3L17A 1M7DA 4RGOL 4XO9A 4LHUG 3NJHA 2O1AA 4OB5L 1F2XK 2HX9A 3FQRB 4G9FE 4UYQA 2H3NA 2L7QA 3EFFA 4TPRL 3TBVB 2CRYA 4X5LA 1UUNA 3U1SL 5L6YH 3DPBB 4TN9A 3SDDD 4KXZH 2Z35A 4N5ED 2ZSVB 2FJGB 3KWXA 3JTSB 1AMYA 3WSQL 5I6NA 4XVSH 2BNUA 1N64L 3T2NL 3ABKB 1DVYA 3GMRA 4NXSA 4KOBA 3MROA 1O6SA 3BP5A 4HS3B 1ZOXA 3ILPB 3CC5B 1CQKA 4L9LB 3HKFA 1MFMA 1DDHA 1RJZB 2UY7A 3FPYA 4AJWA 3JWOC 1PY4A 4JKKA 4YMPA 4JDEB 3WTYA 4PP2A 5ANHA 3DHJA 5EU6A 1P5UB 3X1EA 4OJAA 3ZL4L 3ARUA 4QT5A 3UEQA 2X4SB 2YMXL 2HG0A 2LTQB 3FT2B 1R3JA 3L7FB 4WFEE 1M71B 4JZNA 4YLBA 2QSVA 4OFPA 1IGCL 1WFMA 3NCEB 3M7OA 5TDNB 2A77L 2XTSA 4E41E 4GSDL 4OI7A 4DGIH 1TYJA 3ARFD 3WO3B 4PJCF 5DJ2B 3FO9B 4A7QA 2IANA 1CG9B 2EDYA 3IFPB 4GNKB 4PJ7E 4FTVB 5F1OB 1XF2A 4FQHA 1SBSL 2QQNH 4GQRA 4ISVB 3W0WA 3DUUA 5GS0L 3IDNB 1T6VN 5I24A 1IAOA 1M57B 4NQEB 4DO6A 3G6JE 5G2NA 4IBVA 2G5UA 5MENE 3J27A 5F9DC 2VZVA 2YAEA 1VZHA 4ZQKB 1UM4H 1N6QL 1NGPL 5I73B 4ODTH 1JV5A 4Z3FA 1TDQA 2WLMA 1BQ5A 5ABAA 3U4EA 5BRZB 3CFBB 3NEEA 4EZKA 2VDKB 4L4VB 1A7NL 5JO5A 4LHUD 2WC7A 3GHBL 1E4HA 5D96B 3S37H 1NWOA 4CVZA 5E1HB 1GZQA 2BSTA 5JIIA 1VERA 3QIBB 5DD3L 4GP5B 5C0CB 2H2PD 3EJYC 1EK3A 4ZOEA 4AEIH 2VT0A 1TSHA 3QSKB 3RWEA 3LEXA 1FG9C 1ZVNA 5MERA 1EO5A 2P5PA 1H3WM 1R5IA 1Z66A 1XMWA 2A1WH 4ZMTA 5IHBA 2D7PA 4GO6B 5A6IA 2ZOKB 4NFBA 4ZD3L 3UAJA 5DQJB 1EO7A 1HN1A 3BAJA 4PJDE 3SYAA 4GMSH 5EIIB 3JYBA 2V6HA 1G6RB 1UM6L 2F8OA 3HZKA 3F7LA 3RIKA 5JLZB 5I8OL 4ZZFA 3S0PA 3FUIA 5LJYH 3ILEA 1OZUA 5EUOF 1UGKA 5ACZA 1VLXA 1NEZA 4PTTA 4PQXA 4AE0A 1TFHA 1YQVL 1WFNA 1F97A 2AXGA 1GY1A 2D8KA 5LQBL 4YZFE 4A7SA 3PHSA 4N2NA 3T9WA 4DNLA 4FXLA 3ARDC 2DQ6A 4YGVA 3VFGL 3DUHA 2L04A 2F7IA 5JYLA 4OCSL 5JHAA 2F54B 3CHXA 3RIFF 1TO4A 2QJDA 2LAGB 1RD6A 1NLBH 2AZUA 4F7CA 1TZHB 5AYUL 1JOIA 1W2KT 4HKJA 5TQ2H 3KWUA 5I28A 3DVNA 1KTJA 3EIFA 5JORA 3C87A 1A6TB 4QGYA 4JK0D 2G2NA 1YUHA 3QEHA 4MA8H 2DH2A 3TVMC 1I8LC 4GKSA 1JF5A 2ID5A 2FX9H 3GLEA 5L2KE 5B38B 1U3HC 1OCCB 2FNWA 3SN6N 1QBLL 4NSKA 1IGYB 1HZHH 3MNZA 4UQEA 2LLLA 3V10A 4P2OD 4K71C 1QPPA 2OL3A 5DHDA 5IMMA 3CVIL 4LMQE 2QHRL 4LSTH 3SY0B 3J7HA 2VIRB 2Y06H 3MBWB 1J8SA 3V4VL 1JJUA 1G87A 5ALBH 2BRRH 3QIWA 4PLKD 4N8UA 1CICC 5B1JA 4KV5F 3V52H 2VZSA 1NDMA 2PCPB 3P4OA 2TAAA 2WANA 3QNYB 2B15A 2VAJA 3QDAA 2J1XA 2G3XA 5D1QA 3C6LA 1GTFA 3CXHK 4XB3A 2CHZA 2R0WL 3IPFA 4XCNA 5DD5H 1UCBL 4PI0A 4H8PA 2HT4D 5D1ZD 1FZMB 4B7IA 1UC6A 4ZPTA 2JSFA 4XVUD 5F7KC 1H0DA 2WZPD 1CE6B 3H9SA 3LKOA 3WN5A 1X5HA 5FB8B 4DAGL 3LJ3A 5CU9A 4EN3B 1A9BB 1XXFC 1CFQA 4NWUH 4UQBA 1CLZH 3G04A 3S7GA 4X5RA 5IW3A 5CGYD 1IC4L 5DHYB 3D39E 5DSCB 3FTZA 4G71B 1DVUA 3BWZA 3FT9A 4WEEA 1KELH 2Q5BA 3QULA 2YEZA 1E4WH 3HC0A 4N26A 3QFGA 2X70B 1LE5B 1MLCA 3PP3H 1S7TB 2BP3A 3OKKB 4XOBA 4XMKL 2IALB 4UTCA 2BSEA 1PLAA 1F86A 4XH2A 1NKGA 3T4AC 3QARA 5D7EA 3AT9A 4KKBC 1P7KB 1KEMH 3IRCA 2XFGB 3US9A 4B9PA 1JHTA 1SJEA 4QHUB 1T66D 3M88A 5CCKL 4I4WA 3ZT6A 3SKMB 3FQXB 1AGFA 4M7LL 3LNEA 3LKPB 3S3SA 2VAAB 1MVFA 4NQCA 5ICXA 1HWGB 4M5TA 3BSHA 4PJ9C 3SQBA 2D2OA 3MLYH 4XAWL 3HMXH 1CI3M 3L9EA 1ZKAA 3VFTA 5IFHL 2QSTA 1J1PL 1NC2B 2DEXX 3WD5L 1N6VA 4XXWA 3O45A 4HEPA 5E5MB 3B2UD 3BGMB 4LCIH 4WO0A 4WEBL 5E8EA 1N10A 1CD1A 1ZWIA 5D7IE 4LU5L 4Z7IA 3LD8C 3AW5A 1PKOA 2DIJA 3N42B 1CZ8L 2VN4A 1SJHB 2CRMA 5ILTL 4HHGA 5INDB 1LO5B 2R9HD 4UU9A 1GIGH 4PGJA 5I16A 2DB8A 3R4RA 1KYUA 3IJYA 3MV01 4H20L 3B2VH 4MHHI 3OTTA 4KVNL 5EOCH 5DK0A 3BVUA 3BP4B 3DOHA 3KL5A 4HIIB 4UTAA 1I9IL 4UQ3A 1MDAA 4YFLF 3VE0B 1TJGH 5KS9E 2A0LC 2AQPA 2W0FB 1T1WA 1I8IA 4JM4H 3QQ4B 2E6JA 3CDGA 3O4LD 5GIRA 3RIAK 3LS5L 3P9MB 3P2DA 2OMTA 1T22A 5F44A 2AVGA 3BSGA 3GDCA 3GXUB 5TFSH 4Y5XB 3WLBB 3ZTDC 1P84J 3RL2A 5EF2A 1CGUA 5GRZA 4Z7QF 1YSOA 1GZPA 1F11B 3K46A 4X6BA 4LDCA 2W59A 4IJ3C 3CVHH 3F6LA 4GW1A 1NIDA 4ZOBA 2ZUUA 1EO8L 4UTBL 2B1OA 1JXKA 2J88L 5F97E 1DBJH 2YZ8A 1MG3C 4LK4A 1NFIB 4OZGE 3MNMA 3WNMA 4MCYA 4XX1E 3W82A 2AJXH 3DMMA 5C07B 1FHGA 4L18A 2WAHA 2WTRA 1SFHA 3I3DA 5E8PB 2K7QA 3HFFA 2ZOUA 3FTVA 4WGVB 5JOFB 2C9XA 1IGTA 2RGSA 2VZ1A 4BUHA 32C2A 4P46D 3RA7H 2HJKA 2EKJA 3MYJB 4W9LC 5ICYA 4JHWH 4ECNA 1PDKA 2NY2D 4HJSA 1Z0NA 2BFGA 3T1WA 4XTRD 1WZKA 3CIQA 2XX1A 4AENB 2PMZA 3ETBJ 1ZHNA 2CHDA 2BZ7A 2K8MA 1HXMB 3KE0A 3MLPA 1NFDB 3W11C 1NCWL 5GS0D 1HE7A 1C5DB 1JVOA 4XNXH 1CIDA 5F93C 3VSQA 5F7BA 2I5YL 1V3JA 3BDYH 1S9VB 1G43A 3JWDH 3OAWA 4BKTC 5GRVK 1COBA 5AFAA 2XTJE 3L5XH 1G9ML 5IQMA 4LCUA 3SSGA 1JPST 4CC1A 5FO8A 3NAAH 1D7CA 1PZBA 1AJ7L 3V0WL 1G9NC 4A66A 1KLFB 2NX5A 7TAAA 1RZGA 1TQWA 2KBGA 4I1PA 1DBBH 3I9GL 1CMOA 4NUJA 3GSNL 4NIKB 3ZX1A 1EZUA 1E3XA 5FWQA 3QZOA 4LP8A 4PWHA 3HE7B 2IPKB 2F53D 5DZNA 5IQNA 4N8VA 4AV5A 4JQIH 3JV6A 2WK2A 3LSOB 1F4AA 2WXGA 3FT3B 1PIFA 4U1HA 2Z31C 2ROYA 2OXGB 5C0ND 2YUXA 2VYRE 3NIFE 4N2LA 4DKAA 1Z9SB 5KTEH 2VITB 2WCGA 3CMOH 3N1GC 1FIGL 4PRNA 2W38A 2EABA 1MHPH 3V4PB 1BJ8A 4QRTB 1VADB 3KGRA 4H26A 4IIQB 4XMXA 1ZT4A 2BOCA 1JGVL 1QLEB 2B1HL 5EORH 2NY6C 1YMHA 1FC2D 1HL8A 1IC5H 2KI6A 3G08A 3WS6C 4E9VA 3RI5F 3GMQA 1FFNA 3D4GA 4O02L 4UZUA 3QORD 2XIBA 4P04A 1IO4C 4WI3A 4A2LA 4YHLH 4Z3IA 4RGOH 3U2SB 1H8OA 2GTZA 1IBDA 1GOGA 4OB5H 1UZ6E 1HZKA 4WQOA 1QEXA 1KG0A 4LKCB 2MIZA 4JFSA 4JN1L 3H7LA 4U3XA 4X7DC 1WA0X 3AMLA 1QA9B 4G8FB 1ACZA 2CJSA 3T1FB 3WSQH 2R1YA 1UQSB 4KK5C 1N64H 4G6JL 1QYGL 2A4ZA 3MKGA 1CE1H 3GIZH 4LARH 5C92A 3LIZA 4ABVA 1X5ZA 1KTLB 3L5WA 3UACA 5HP5A 4Y4KD 4JB9L 2D4DA 3NCXA 2I27N 5ID0B 1M2VA 1AO7D 1QRNB 2HZHA 1DTUA 4EUPH 1R3HB 4HUCA 5BV7C 3DBSA 1A66A 3FW6A 3ULUL 5DLLA 4KXAA 1L9SA 3DETC 1QWUA 4OT1L 4P5TA 4U1SA 1QFWM 2HRLA 2DOCA 5EU7C 1K3IA 5D71L 5HGBB 5HBBA 2YMXH 5I1KH 1JZ4A 5ITFA 4BCZA 1YEJL 4UT7H 2N1TE 3QG6B 2A77H 1RSFA 3EYQC 4AK2A 4GSDH 4MAYD 5DA4A 1QWNA 2XZCL 5FLVA 4JPWL 2QQQA 3LH2L 4PH8A 3LXAA 2W65A 5HHOB 3RVWC 4AM0Q 1B6UA 3ALXA 1SBSH 3QDMB 3FTSA 5C7XH 5EO1A 4MVBC 4DETA 2FNBA 5GS0H 2W9DL 3VD2A 1ZLEA 2IG2L 4L8DA 2OK0H 4YS4A 5DZVA 1HZLA 2ZT9C 3OJVC 3ZMNA 4I9XA 3TIDB 2J73A 3X12B 3RTQC 1G5GA 4M48L 3GMOA 4PJHE 1NGPH 1N6QH 2YRZA 2AKRB 4DWHA 4PUBL 4Y5VC 2NY1D 3WNKA 1YPZB 5J9PB 3WHXB 1G7HA 2H3KA 1DJZA 5SWSB 3WTWA 4LVHB 3NRPA 3QDGD 3KLSA 3GHBH 3U0WL 3L1GA 1U4EA 2BNQD 4GSQA 4LBAA 5KBLA 1A1NB 5HYEA 5EEZA 3NQKA 4R3SB 4MAZA 5DD3H 3PFUA 5DHVB 2MNWA 4Y4HB 1G7LA 1JZGA 4ES8A 5HDBF 2YPVL 4WJG3 4ZNEA 1KLUB 1CGYA 1RMFL 4ZD3H 5F7HA 2FSEA 3VJ6A 1ASPA 4ANWA 4CN4A 1PLCA 1UM6H 2NNCA 3DVGA 4HKZB 3H9HA 3Q9PA 4JKNA 3JWDC 4NENB 4JM2A 1N5AA 5C9JA 3WIHL 1YQVH 4S1DD 5FFOA 2BHZA 3QUMA 5LQBH 1HWHB 2PYFA 4R7DB 5F2FA 2AJUH 5HJBA 1IEBA 3VFOA 4K7FB 4BKLA 1FWXA 5IQ9B 5A2LH 1C16A 2CKBL 3VFGH 5FKAB 4JUSA 3UTSD 4OCSH 2PTTB 3U4AA 1A3LL 5I75C 1I1AA 3ECBB 4LLUB 2E3VA 5AYUH 4K3GA 4QUOA 4HGKC 2VC2B 5IB4A 1F3RB 3OJ2C 3HI6L 4OQ1A 3N55A 4Y5YB 2BZDA 5K9QI 4XVTL 3ARXA 4WO4D 5D2NA 5F7DB 1IJ9A 4ZW7A 3DHPA 3COOA 3VI3E 5IUSA 1E28B 1ASQA 1XAKA 2Y7NA 2G3ZA 5DZJA 3OXRA 5EEUA 3CX5J 1U8IA 4LPWA 3CFJA 4QF1A 1CURA 1K9TA 3NCBB 1YN6A 2H3NB 3CVIH 4KO7A 3EFFB 2QHRH 3PJSB 2WW8A 3IKKA 1CQYA 3HRPA 3TLRA 1G7IB 4KTEL 5TE6L 2V5MA 2FHFA 2Z35B 2DM3A 4MLIA 3QNZA 1RUMH 4D0DA 4JAMA 4X80L 5EHFA 5MI0B 2B9BA 3QPQD 5K69A 3REVB 5CIPB 3MROB 3IPBA 4ZMZA 1O6SB 4OLZL 2IPTL 1T2XA 1YY8A 1URIA 3D2UD 2ICES 2J1YA 1EA9C 2Q8BL 4KK9C 2P49B 5AWNL 5CUSL 3JZ7A 1DDHB 4WHTA 2UY7B 2X2YA 1BAGA 4Z0XA 4WFHE 3KPRD 1IM3D 4CSTA 4IOFC 4ZI8A 5EU6B 5A3IC 3ZKXC 1OOAA 3KG5A 2J3SA 1WEJH 3S2CA 4AYEC 3APFA 1JI2A 4QT5B 2WINB 3LHAA 4N8CL 1ORSA 1CVRA 3NCYS 3GUTB 1R3JB 1I1RA 1NOAA 4PHZA 4H8VA 3BZ4A 4JZNB 4X98B 2DTMH 3RWHB 4LRNL 1L3NA 1O9WA 1WLHA 1Q9KA 1CR9L 1FQ9C 3ARGA 2MTAA 4S1QL 1FYHB 5JXED 1KCSL 4FXKA 1FFRA 3SDCA 4HJGA 2B59B 2IANB 3CHSA 1WFIA 5FK9A 3ZTJH 2E4TA 2EINB 4Z7VA 1TZIB 2EQDA 1XF2B 4FQHB 2DLGA 1MRDL 5I15H 2CBPA 2G2PA 3W0WB 3DUUB 3RU8L 5H2BA 3QO1A 1RZQA 3QZMA 4NPYA 1ADQA 1IAOB 2YN3A 2EDEA 4YQXL 1C5CL 2DM7A 3D7PA 2FUQA 2GVYA 1GHFL 4NX0A 2WYZA 1LD9B 4GAAA 2XICA 1TZAA 1MRFL 1JV5B 2P28B 5DEJA 1NJ9B 4BZ2A 3ULUF 4J23A 3U4EB 3KPMA 3RVUD 1JBJA 1L0XA 3M1OA 3VW3L 1DE4A 4XAWH 1IQWL 1J0YA 5GRUL 5IFHH 1LMIA 2ZUXA 2YXMA 2XN2A 3T8MA 2OJZH 1GZQB 1OLLA 1TETL 1CT8A 4WEBH 5H35A 1UXWA 2BSTB 4M93B 4UYPA 3VX0A 3KGUA 1B4RA 3HLKA 2AJ3A 2KC0A 4PWIA 3LEXB 4JMNA 2G0KA 3ZZQA 3QUGA 4H88L 4U3SA 1R5IB 2L0DA 2OI9B 4HHAA 4N2AA 2ORBH 1KB5L 3IU4L 2NOYA 3MODL 3T6ZA 4TUOB 4MZRA 1AQMA 5L9DL 2OAAA 4PREA 2P44B 1ML0A 2V9RA 3F64A 2MQCA 3KJ4B 3S3PA 3LHPL 1YECL 3BAWA 4YK4B 1NUNB 2VDLL 3JWNC 4H20H 4DFIA 3L5JA 2BSRA 3KCPA 4JO4L 4KVNH 3D08A 4QRPA 4RMRA 3RLSA 2QR0A 3WE6B 5D96C 2BOLA 2E47A 2AF2A 1I9IH 4MNGE 1SN2A 3S88H 1PZ3A 2ISDA 2Q10A 4OR1A 4N9OB 1ZTXL 3L1EA 1YPZF 1GY2A 3CLWA 5CZVL 1WBYB 1Z1WA 3QVAA 4HKJB 4W9JC 4DSYA 4ODXA 5KSAB 3DVNB 1RURL 5JORB 1F00I 3PCYA 1QUPA 3QHFL 4X9GA 5IJVA 1FVDA 3N85L 3CPLA 1YUHB 3GXFA 3QEHB 2WXOA 3FH8A 4GKSB 3WEXA 1BVOA 4Z8FL 1EO8H 5JXAL 4XXDA 1IL1B 3PP4H 4YSPA 3WXWL 2HYMA 2J88H 4N8PA 4A6YL 3CE1A 4NSKB 3MNZB 3O8XA 3MCKB 3QJUB 4FTDA 3V95A 5L4IA 3ULUD 1RZJL 4C4BA 2Y2WA 2FTAA 2IWEA 3CMGA 5HYJA 3MBXL 5ANME 3HBGA 3QIWB 2ESVA 2DI7A 1MY5A 1DQQB 3P4OB 2OQJB 3KWWA 1FYTA 4MHHG 4N22A 2JJTC 4JHZA 2I24N 4RFNB 4XNAA 1HKFA 4M6ML 3QNXA 1T2QL 4NKMA 4OH2A 4XCNB 1A02N 2APFA 5C08E 2F15A 2SEBA 3SDXE 2BIHA 3WKQA 4ZPTB 1NCWH 2J55A 2PO6D 3EJZD 3Q8FA 1H0DB 3QUZC 4XCEA 5GSVA 2ERJC 4J5VA 1HEJC 2ALAA 2I5YH 1WVZA 1BW8A 4PJBE 1CFQB 4GUPB 2UX6A 3QS3A 3G04B 1UT1A 1WZLA 3P30H 1JUFA 1G9MH 4KMTH 2ZWNA 4PJFF 5AVSB 3F62A 4Z5RA 3H8NA 3T4YB 1A5FH 4MXVF 4OGZA 1JZDC 1AJ7H 2FX8L 1C9SA 4PJ8C 2YEZB 1CXFA 1M1XB 3I9GH 3GSNH 1PX3A 3TESA 5DFVD 2ALWA 3VA6A 3U7WH 3D2TA 4XH2B 3S8GB 5CR8A 4LPYA 4WI9A 5C0GA 3DROA 4HGMA 2DQJL 5TF1L 1OP9A 1T83C 3TNMA 1SJEB 4I4WB 4EN3C 4X9YA 1AGFB 1J0ZA 1TTAA 2WXKA 3E8UL 4LL4A 4MA1B 2WN2A 3TBWB 2F53E 2N1KA 5DYFA 1FIGH 3P11L 4J6IA 3SQBB 1Y6KR 3TNNA 5IK3A 4GO8A 3S48A 5DEGA 1JGVH 3PF2A 1JMZA 3NFPB 3OWRA 1JDCA 2B1HH 3NSYA 1SMDA 3FAXA 5D9SA 2N01B 5E8EB 4O02H 4GG6E 3J07A 1ZWIB 2AJSL 2FWSA 3B2DC 2Q7YA 3QZLA 1MZYA 3BAXA 1SPDA 3C60D 4LL1A 4HWZA 1P2CB 4FFVD 3K6DA 2YK1L 1HXYA 5CLZA 2Y6SD 2UXTA 1KJ2A 1UA6L 4UU9B 3IJ9A 1OSPL 2Y7QA 3D6GA 4G7SB 4GI6A 4JN1H 4IW4C 5I16B 3BJLA 1NCNA 1EEYA 3GLZA 3IJYB 4QTHA 1CVSC 3DJZA 1RP9A 4JFFA 4X9FA 4FFYA 2AQQA 5AB9A 4FFZH 2VXQA 1A7RL 4G6JH 1QYGH 5CEYA 3UO8B 1VACA 3GPSA 3VRLF 5DK0B 2HJFB 4XWOC 2OA9A 3TT3L 3W3BA 2O61A 1O7SA 2LABA 4JB9H 1DQTA 1PJWA 1JTOA 3CGTA 2OKMA 3VXPA 1I8IB 1P4LA 2NYZA 1PU0A 1AG6A 5J6GB 1A65A 2OMTB 4BCXA 4JHAL 1T22B 3ULUH 2ZXGA 3QJFA 4KI5D 1ITCA 1RUPL 3ZL1A 5CM1A 1ZLWK 3RL2B 2D9CA 4WU5A 5D71H 1ZHKA 4HC1L 4X6BB 4M6NL 5ETUA 1YEJH 1AO7E 3CFKB 3MO1A 4GW1B 2FIKB 1KV7A 2V9TA 2JELL 2PP8A 1NC4A 1GJWA 4NRYA 4S11A 4WIQA 5FFGA 4YXLH 4FP8L 2MOVA 3ECUA 2XZCH 4JPWH 4A2DA 4J27A 3LH2H 3WMSA 4MCYB 4JGMA 4IRSB 2QFPA 3DMMB 3FU7A 5JTWA 4UZGA 2WIMA 2ZG2A 1CFVL 3MSPA 1F58H 1I7RA 2H2SC 3OF6A 5DGRA 5FA3B 4BUGA 2F58L 2IG2H 4IGBD 4PW9A 2RCSL 4LHQB 1SLWA 5EN2A 1J05A 1YN7A 2WQVA 3MJ9L 1S6NA 2HJKB 2WIIA 3CU7A 2G60L 2B3IA 3GC3A 2FIRT 5ICYB 5DHMC 1U58A 1T0NA 2YAMA 4Y5XC 1PDKB 1OK0A 3FBKA 3P73A 4M48H 4M3JA 4NC1C 3ESVF 1KPVB 4HK0A 1ZHNB 3QQ3A 2ZKYA 2Q3AA 5LAXA 1PQZA 2PXYC 1OE3A 4R84A 5FEBA 1NAMA 3CZGA 3HC3H 4XNQB 1W0YT 4YZWA 2DKMA 2X12A 4WFFD 4GO9A 3TJHC 1XCXA 3U0WH 4IBUA 5IW1A 5DZOA 2E46A 1YLBB 1DVFC 1JIBA 1QW8A 1A64A 1H15A 3SZ6A 4LCUB 2F9BT 3KLAA 3QDGE 5T33H 1KCVH 2GJ6B 2YPVH 3H6JA 3X17A 2BNQE 1RMFH 5L2JB 3D85D 2I69A 1LDPL 3DUSA 3FT1A 4TLTA 1JHKH 2A74A 4KU1A 4K5LA 1PJ9A 1YMMA 3QDJD 4O4YL 4YVUA 5FM8A 5JIDA 3VACA 3MZTA 3NJJA 4YO0A 3EYVA 3B8YA 2NDGA 4I87A 5JNYA 3PWPD 4HCRA 4AYBA 3U9UA 4GQPH 2KLRA 2CXKA 1MFUA 3WIHH 5T1LD 3T3MB 3ATEA 3I6GA 2IGFH 3HHSA 4AYSA 2WLNA 3PG2A 1CXEA 4WUUD 1MELA 4NYLB 4UB0H 2IAMD 3RZCD 4RMBA 1CBJA 4U1NA 4AOFA 2O93L 1S7WA 4JG0H 1A3LH 2W0PA 4J28A 1VKXA 4PRNB 1NMBL 2K6ZA 3KBFA 4ODVH 4H26B 1XB8A 4P9HL 2BOCB 5LBGA 4KTDH 5AEAA 1MI5A 4HWBA 4FKHA 1BM7A 1FA4A 5CWSA 2VH5L 3HBPA 1Q9LA 1YMHB 1X5AA 5C0IB 3HI6H 3TV3L 3G08B 4OF6A 2X42A 4HBCL 3UTSE 4S0HA 3GMQB 1ZVHA 1WA2X 4XVTH 3RIAF 3EBGA 3UZEA 4HKBA 4BINA 3VDAA 1QLRA 3HG1D 2WZAA 2EE0A 2ITDA 4MB1A 2YHGA 2QPEB 2GTZB 4G7QB 4NBXB 2XWCA 4NZTH 2OLDA 5SWQA 2HVJA 3KYNA 3OKDA 3LEYL 4HBQA 3BXNA 2Z1KA 4PMFA 5F0MB 3FSOA 1KG0B 4TNWF 3WFCH 4WF7A 5JR1L 4NN5C 4HJIA 1P4UA 3MRGB 5TE6H 1AGBA 1XD0A 3TIEA 1V3MA 4NEHB 1JZ3A 3FK3A 4LASH 5INCA 4OJDH 3ESOA 3F6JA 2CCLA 2IADB 4N5UA 2CNZA 4FAAB 3EH2A 4OLZH 2IPTH 5T5NF 3G5WA 2YD7A 5E7BA 5E23A 1E4XH 1E8YA 4Y16D 5AWNH 1FPTL 5CUSH 5IQLA 2P8MA 1KIRA 3UBXI 4H2AA 1M2VB 1R47A 4M7KL 3WDHA 4K94C 3BHBB 4TLSA 5EWIL 1YEEL 2VDML 2RMNA 1ZGLM 4P5TB 4U1SB 3BX7C 4IBSA 3C8KA 4B9CA 1SZNA 3N1FC 3HZVA 4Y7MA 4B9YA 3RRQA 2FUTA 2LFEA 4Z7WE 4YSTA 5F21B 5ITFB 3BFQG 3N1QC 5LKNA 3B2MA 4XMUA 5K9QG 3KPRE 1VFMA 4LRNH 1GJIA 1BZEA 1CLYH 2BP8A 4HULB 3H53A 4TNFA 2NY4C 4HA1A 1OGAB 3HC2A 4GT7A 2W65B 4OUOA 4ERSH 2J5LB 4Z23A 1NINA 3H2QA 3ZDXB 1MRDH 2FX7L 5EO1B 3FU0A 4NQSA 3GI8L 1EDYA 3RU8H 4EQ3A 1BEYH 2R1WA 2UVEA 1PZ5A 3EJSA 3DSFL 4FLRA 4X5WA 4WY7L 4D7PA 3GMNA 4YQXH 5I1EL 1C5CH 5J4MA 1GHFH 4JZJA 5DF0A 3GMOB 4R2GC 5DMYA 5CZRA 4M5YL 4NQUA 4X8JA 4JFWA 5DK2B 3ZRFC 4NI6A 5CINH 5DMGC 3U46A 1E8WA 1G7HB 4PBXA 3VW3H 4CC4C 1IQWH 5GRUH 5FV1L 3QZWG 1EHLL 3UG4A 1NBVL 1TETH 1NMAL 4M7ZC 1D5ZA 5L8KB 3LEVL 3NCMA 2XQYA 5IIEB 5I1CL 3RUGB 4U6HA 3PQYD 1PD6A 1G7LB 1K72A 1PZSA 3VXQA 1QNZL 2OTWA 4H88H 2NY0B 5I6XC 3KXFA 2J21A 2E9GA 5GZOC 3QZPA 1KB5H 3BDBA 3IU4H 4JLRA 3RWDA 2RJMA 1XH0A 1MFDL 2K78A 3MODH 4EMZA 5L9DH 4LLAA 1F3JA 4DPCX 4AMWA 5BZDA 3U0PA 2ZD0A 2VXTH 4PRHA 1PY9A 3Q8EA 3DVGB 3LHPH 1YECH 2BNRB 4KDTA 4OGXL 1KGCD 2R69L 1X9UA 4FNQA 5ISZA 2VDLH 2H0FA 4JM2B 1N5AB 2A73A 5C9JB 1U8OB 4LVHC 5C09B 4BXVA 1FH5H 3UABA 2E7DA 4LEOA 5EEVA 2PYFB 5DU7A 5J1AA 1SEBA 3UERA 1IEBB 1LVEA 3FOMA 3QAZC 4BKLB 2AK4D 1C16B 1N0LA 2K3TA 3N04A 4L48A 2E7LC 2VXSL 3MAWA 2GUOB 4LEXL 4OZFB 1D9KD 3Q2VA 3ZE1F 1I1AB 2ATPA 4PY7A 4J12A 4ZMPA 1FSKC 3STBA 3FXIC 3KPSA 3IDYB 1O7DC 3MOQA 3MRCA 5E24E 4MMZC 5IB4B 2R1XB 4JKLA 1IEAA 3QHFH 1YEHL 3N85H 4Y89A 3WE1A 1SVZA 1T21B 5D2NB 5E9DA 5JXAH 3O9WA 1F4XL 1P4IH 3MBEA 3WXWH 4A6YH 1IEHA 4RVBA 2AW2A 2XNAB 3L08A 4N2OA 5AB0A 1F90L 5IKCB 3ARRA 3CFJB 3BQUC 4PRPA 5E70A 1KXQA 5DRWA 3NJGA 1RZJH 3TO4D 3M1BA 1AGCA 2FB4L 3LX9A 3L1FA 5LWYL 3G5YA 5LXVA 3MBXH 4JFOA 4KO9A 2VR8A 4M62H 1BG9A 2XYCA 4JAMB 4L4TA 4KZDL 1JVKA 3LN4A 3T0ED 4BXSV 3R7RA 2Y5EA 2VLKD 5ADOL 3MJGX 4AW7A 3HFML 5BW7A 5D6CA 4JJOA 1EANA 3K6NA 1XZWA 5I17A 2EVIA 1NBYA 4M6MH 3T6XA 3I9PA 4FYRA 4F8QA 1IILE 4J3UA 4WHTB 2MWCA 5TE7H 2D7TL 3FKUS 3U0TA 1XEDA 4FI8A 3RWIB 1QSFA 4XODA 1H8NA 2VN3A 1FP5A 1O7VA 4KGJA 2PCFA 4G1MA 1KZYA 1OB0A 2IH9A 2K4WA 4JDTH 4QY8A 1DQIA 3X3FL 2MCMA 1YY9D 3ELQA 3MRBA 3WJMA 2KS0A 1ORSB 4GAGL 5I18L 1AQKL 3BZ4B 1EZLA 1KIQA 1QFWI 3BESR 2K70A 3QWOA 2A0LD 3ARGB 2FX8H 3BN9C 4X5XA 1G6VK 3KHQA 4HJGB 4Z7OE 5FK9B 1A2YA 4HEME 3VXUD 4Z7VB 1QFPA 3QEUA 3VXOA 1W80A 4HV8A 3VXRA 4U1JA 5H2BB 3EDJA 3QO1B 4GRWF 1F5WA 4NPYB 2ZNWA 2A6JA 2Q3XA 3UH8A 3OJDB 4C8XA 2VLJA 5TF1H 3K81A 2IF7A 4ATWA 3VWJA 1YEKL 4H1LB 5J12B 3E8UH 1T0MA 3NJXA 3WJLA 4BFBD 3P11H 4NXKA 1A1OB 4EI5D 2UXGA 2KZ1B 1DE4B 5JPNB 3U30B 3VB8A 1RV6X 4HZLA 3C8HA 1Q90A 1J1OL 1UH4A 4MDJB 1FZKB 3TEXA 5H35B 2MOGA 1UXWB 1WGOA 3SOBL 2W91A 3T3PB 4NAMA 5J6HA 4YSAA 2AJSH 1LILA 2NTFB 4AX3A 3I02A 3BUPA 2XBTA 2Z93A 2EE6A 5AALA 4C56D 2GI0A 3DTUB 2WOBA 3QI9C 4BFOA 1OSPH 3O6FB 1WFUA 5D8JH 5DC2A 4NAJA 2VISB 2K8QA 2WTPA 1PKQE 3PNWB 4N0UE 4P06A 4FF9A 4HS6A 4RGND 5K59E 1A7RH 3MFFA 1NDTA 3KH3A 5F0PB 1EHNA 1B6DA 1SOSA 3ATAA 4HJTA 2CLZA 5GISH 2C5DC 4M93C 2KPNA 4UQ9A 2X4PB 3M46A 1IBGH 4L0YA 3UTTA 4TQ8A 2HRHA 4KK6D 3RAJL 3CDYA 3CNKA 2QPFA 3FUDA 1RUPH 2NTSP 3MRMB 4EDXB 5A43C 3DO4A 3UAJC 2ZCLL 4HC1H 3R8BB 1E8XA 3FTGA 1E2ZA 4M6NH 4NO3B 4PIBA 4RWHA 4N0FB 3WEXB 5SWZA 5E4OA 5T1KB 2JELH 4NOBA 4KI5E 2X2UA 1YCSA 4FP8H 3O2VL 2OM5A 4U49A 3EW3B 3O8XB 4RAVA 2UXFA 5GGVY 2C3VB 3RURA 2AJVL 4IS6A 1CFVH 2F58H 2RCSH 5HYJB 2O6FA 1QQDA 4L8SB 2CGZA 1FJ1A 4YSQA 3MJ9H 4FYTA 4FADA 2ESVB 2DKUA 1YEDA 3ZMEA 2X4TB 3AXLB 3BPLC 4FFWC 1U6AL 3SPHA 5CILL 4QYOA 2DH3A 1IAIM 1RIUL 1VCBC 3VFPA 3QNXB 3RVXC 2MOQA 3NZHL 4KQ3L 4NKMB 4XMWA 2HB0A 3UC0H 2SEBB 4MNHA 3AU1A 5BS0A 4NC2B 4LLWA 3MNDA 4JFUA 3LV3A 1W0WB 5BUGA 4H40A 3C5JA 4XCEB 1YO4A 2XLLA 4XPTL 5GSVB 4POYA 3NZ8A 1FFQA 3MV7A 4WNJA 5MEPA 3HOGA 2A4EA 4GQ9L 1FAKT 4F15B 1G6RL 5PAZA 4AJ0A 4WEMB 2QPDB 3JUZA 1U4FA 1T7VA 4WFFE 3IN2A 5DS8B 1XL6A 3ZKND 3QIWC 4TQEL 5B1JC 3FO0L 4FQCL 3B9VA 1UZGA 1AIFA 1WQVT 4O4YH 2OW6A 4RFEA 3ULAB 3HRZA 2YD0A 5JQ6H 4JFTA 4RFNC 5D1QC 2FH6A 3C6LC 3QS2A 3VMPA 3TA3B 2W8CA 4H13C 4HJEA 1MIEL 5C0GB 1SOQA 3DROB 2VR9A 5E1QA 4PJ5D 3FCSB 2VZUA 1E4JA 3QUYB 3QDJE 4JFXA 3TNMB 3WN5C 5CLTA 4FULA 2CM5A 1K8IB 1IGJA 3JTTA 2DQGL 4ONGL 1GL4B 3GSOB 1E27B 2XIDA 2YBRB 4OF5A 5DUJA 3S5YA 3AGWA 4ADGA 3TNNB 1QSZA 3EYUL 4P9HH 4I0PD 5IK3B 3D4YA 3RL1A 2CWRA 2VH5H 2E7BA 1WCBA 3H56A 1MCCA 2DWDA 5D9SB 5A40E 1G1OA 1LO0H 2IO5A 3TV3H 3ZDZE 2LLGA 1T7XA 2H32H 5I6PA 3MXVL 1X3DA 4MKTA 3SKJH 1DO5A 5C0BD 5J3HD 1TQCB 1W72A 4LPCA 1X6NA 4C58B 2P80D 4HWZB 1FNAA 1JPTL 4OLUH 3KPPB 4UQAA 3BSZA 4DP4X 3RHWF 3LEYH 5F96L 1HXYB 1PFOA 1KCBA 3PWJA 4PJAE 3QRFM 1JMXA 5HI5C 1OVZA 4WK4B 3Q7JA 3TO2A 1EEYB 2AQ2A 3HG1E 4QTHB 3SE3A 2I25N 1ZTXE 4QHNA 2EVFA 5CEYB 1PVHA 2X7LA 4MSWA 4RAHA 3DPDA 1VACB 5AZEL 4BWWA 4CVWA 4XXWC 2O61B 2DWEA 3ARED 3E1F1 2BINA 5B1KA 3Q3GA 4TSBL 3QP3A 1JFHA 4XOAA 1FPTH 3MNVA 1OCRB 3MUZ1 5I71C 4PD4J 2JKIS 3VXPB 4G6ML 3UYPA 4FJZA 1TMQA 3K4DA 4M7KH 2R29A 5E03A 1XTLA 5IFAL 5EWIH 1MAML 1YEEH 1QFUL 2VDMH 3QJFB 4ZUWA 1JNJA 3PV6A 1M2OA 4IJTA 4WU5B 4FCAA 1CN4A 2WUCL 1DFXA 3H3BC 4GAFB 1WIUA 4Z76A 5ETUB 4ZAKA 4NB7A 4KK8C 1MWAB 2BIMA 1NC4B 2BOBA 3L3JA 1ND0B 1EMTL 2KZKA 1L3WA 3K0WA 3EOBA 4NKDB 4KVCL 5B3SB 3MRLA 3N9GL 3D0VA 3FU7B 2Z0UA 4BE5A 2AP2A 3Q43A 4DQAA 3RWFB 3F12A 5LAPA 2HH0L 1I7RB 1ROCA 1VZGA 5D1XA 3IJEA 3BUBA 3MV8D 1Y6MR 5EN2B 4M03A 3Q6GH 1YN7B 4WY7H 5I1EH 2WIIB 3RFRA 1SOXA 1U58B 1T0NB 1BQHG 2OTPA 3P73B 2Y7LA 4J3SA 2VDNL 5K1NA 3MKKA 4HK0B 1CXLA 4Q97A 2QEJA 4ELKB 4HIXL 3QFJA 3RNQA 3SCMD 1WTGT 4OCRL 1SY6A 3QQ3B 5LAXB 1PQZB 1L7IL 1S9YA 1MHHA 1NAMB 2VR6A 4CNIA 5LLIC 3B7SA 2HVBA 1EHLH 2FR4A 4J8RA 3D09A 1NBVH 5IW1B 1NMAH 3NSCA 3D05A 3V6ZA 3ORJA 3LEVH 2AAAA 3DMMC 5IG7A 1HYRC 5KVDL 5I1CH 1NCBL 2LGNA 1Z3RA 1H15B 4Y4FD 1WBXB 1QNZH 4F93B 1FDLL 5KSBB 3KLAB 3GEWB 4JRYD 2FBJL 1CYGA 5E08H 4EPSA 1WBZB 1U8KB 2UWEB 3ZKMC 3OAYK 4AGLA 1NGYB 3BUIA 5SX5H 1MFDH 4FEMA 4LLQA 3TJEL 3F01A 3DUSB 2YD8A 1EEUA 2A74B 1UT2A 1YMMB 3GB7A 1UB6A 1EBPA 3PQYE 4YO0B 3DV4A 4KZEL 2NCEA 2R69H 5JNYB 2NYYD 4RDQG 3U9UB 1CYWA 1IFGA 2GHWB 1XBRA 3VM5A 4G6AD 3AT0A 3I6GB 4BGDA 2WCSA 3AU0A 1ZS8A 3HHSB 1JPFB 1L9OA 1O6TA 5BVJA 4ICWA 1TKWB 4M1GL 1IAIH 4WWKA 4U1NB 3WXVH 2C3WA 3DHMA 1S7WB 1VKXB 1OWWA 3QUMH 5EIIG 1FO0L 1NCCL 1MI5B 2YXWA 1N6UA 5CWSB 2AK4E 1FNSL 5JDSB 3VYOA 3N06B 4A55A 5CN3A 1PLGL 4Q7DA 4RSYA 4Y8AA 1HIML 4APQA 4NP4L 3A3YB 3H85A 4DKEH 1VB9A 5CEXB 4HKBB 1BD2A 2WQ8A 3MV9E 3TN0A 4P07A 3GYRA 1QLRB 1VDGA 3CN0A 2J6EA 3KEHA 4F3FA 2ITDB 3ZE2F 5EF3A 1F90H 4JFDB 2HVJB 3OKDB 4BK4A 4XC1L 3E2HC 5F7NC 3BXNB 1OD7A 1KIUA 1QVOA 3F7QA 4PLNC 2K0RA 5FECA 2FB4H 1EZSA 4P4KD 4FTVD 1JF1A 5I1DA 2YD2A 4QWWC 5HHMB 4DERA 4KZDH 4Z7NF 3RJDA 5INCB 4NNXB 4H8UA 4AIOA 1DQDL 4JKWA 5HHVL 5ADOH 3HFMH 1EJOL 1MRCL 4NQED 5B38G 5DQ9A 4UV7H 1OKEA 4UT9L 1OAUL 2P8MB 2OZ4L 4JFYB 2D7TH 4JJHA 2FCBA 4Z9KB 3UYRH 2L8AA 4BD4A 3X1NA 1MN4A 3P3YA 2P5WA 1L9RA 2VLKE 4L4VD 4FLOA 2APWA 3C8KB 3KS0H 3X3FH 4BWUA 2HMIC 1KTCA 4YAQA 2F7RA 1TQSA 1BVLB 3GSWA 1J9RA 1LWRA 4GAGH 4P5RA 5A16A 5I18H 1H3XA 2EDJA 4ZW5A 3QIBD 5T3XL 1BREA 2EDFA 2XA8L 4KQ4L 4JBSA 3AS0A 5IHZA 4D9LH 1WICA 3D33A 3GEFA 1F1GA 1WAAA 3OKEA 4PTUA 4LNVA 2AERT 4F2ME 4FYSA 4UM9A 3W38A 4IDJH 2V7NA 3W1ZA 2R1WB 2PWDA 1PZ5B 3V4PL 1INDH 1XCQA 2R15A 1H5BC 4X5WB 3UBHA 4F8OA 3GMNB 3KHOA 3MU3A 5IVZB 4KJQC 4U6VL 1E9QB 1BXVA 1QLEL 4P5TC 2BC4A 3OWEA 1IM9A 1YNKL 1YEKH 2Y1YA 3ARTA 4BA0A 3QCTL 2YD9A 3EJTA 3U46B 3STLA 1RPQA 3IBEA 4M5SA 4K94L 5AYTA 4KTYA 2F54D 4FA8A 2VJ0A 2CIIA 1NA8A 4O58L 1O9ZA 4OM1L 3HUJE 4IKKA 5F7EL 4U1MB 4DTGL 4KZ0A 3Q2WA 5KUKA 1MPAL 4U6HB 1F41A 5JMRA 4IEFA 2V3DA 1MCDA 3KPQA 4O5LL 1NGWB 1IKNA 3VD7A 3A6OA 2FEJA 5D7JA 3QH3A 4O2EA 1P9MC 2VLRA 3S3CB 3RWDB 3NP4A 3TJPA 1WT5A 1D5MB 1MJJA 2EIBA 3U0PB 2FLBT 3PABA 4PRHB 5AW5B 4MA3A 4RISL 5BQ7B 3IDUA 3AQDA 3BOVA 1KTDA 2Y24A 3VXMB 2YUWA 4AWJC 4P49A 3QRBA 5ISZB 3HE6C 3JV4A 4WDIA 4C56E 5B7EA 2ZP0T 3AG3B 5GGRA 3SKOA 4LEOB 5IB5B 4N2HA 5CGTA 4KFZC 1SEBB 5J1AB 5D7SL 3VFNA 4LQFH 1KGUA 1JN6A 3X13A 5CCJA 2DICA 4P3CL 4Z7UA 1FNGA 5HYSA 3ZJAA 4RGNE 2Y7OA 4ZTOL 3RAJH 3GSQA 4L3EA 2ATPB 3F7YA 1PBYA 4PY7B 2NY0C 3FFOA 4FJ6A 4HFUL 4L1BA 1SLXA 1Z32X 1LE9A 1KT2A 3CXHJ 2ZCLH 4R7VA 3LRSA 4BQ6A 4XCYA 4ZUVB 2R23A 2UY6A 2VZ3A 3GSVA 5MEQA 3H0TB 5CFAA 2NYKA 5E9DB 3NPZB 3FB5A 4WWNA 3O2VH 2XIIA 4ZZKA 4RESB 1AOHA 5FOJA 1M05A 3LZRA 2P46B 5DRWB 4Q6IB 1SDDA 2AJVH 5DJZA 4F7KA 4XPAL 4WHYG 1CXHA 3OC5A 3PWUA 3VGHA 1JPGA 2PABA 3BVNB 2ZYIA 4ALAC 3OLDA 4JFOB 3JXAA 1O0VA 3OMIB 5FYKE 3ZYIA 2MEJB 5C0AB 2JB6A 4L4TB 1PMYA 2R83A 2NLJA 2VR4A 3OSVA 4X6DA 1U6AH 5CILH 1CFNA 5D6CB 1RIUH 4MZ2A 1OW0A 4B5EA 1UJTA 5I17B 2PTVA 2E56A 1NBYB 4IU3B 5DFAA 1ZHLA 4KQ3H 2DBLH 5D2NC 5KVGL 2OMUB 3U0TB 4G3YL 3OHXA 2HFFB 2BCMA 3GJFB 4H0HB 4XPTH 1AZRA 3RBSA 3V5KA 3Q6FB 4JO8A 1KYFA 1MFEL 3HLAB 3P9LB 4DK6A 1X5LA 4QY8B 4GQ9H 4EKXA 5B3JE 1DQVA 4PJXE 1G6RH 2R56L 4B9FA 4FG0A 5CAYB 3WJMB 1NC2D 3RX7A 2YGNA 3IETB 5A6MA 2AVFA 2X4RA 1A14H 2E8YA 4MASA 3QWOB 1NBZA 2ZX5A 3EFOA 2FBRA 3FO0H 4N1EA 5D2LE 1BF8A 4IDLA 5AVWB 3W37A 2KERA 1A2YB 1SXCA 3D12B 5FO9A 5A7EA 1SGKA 3QEUB 3VXOB 5HPOA 1QPXA 4L1DA 15C8H 1GYWA 5F1IA 3VXRB 1CDJA 2C26A 1MIEH 1MCNA 4LSSL 4FQJL 1XV8A 2A6JB 2XTLA 3RFZA 2VLJB 4JFQA 3US0A 3Q1EA 5GS1A 5J0BA 1EHKB 3VWJB 1GGTA 1UOKA 4MNQB 4ONGH 4PJIE 1CL7L 2QGCA 4OJEH 2HVKA 2ZOLB 5LN8A 1XCWA 1Z9MA 4PJ5E 1ET5A 1C12B 3LKQB 2Z8RA 4G9FA 4HZLB 4P5MA 1WE5A 4EAEA 4FQXB 4AVHA 4FXKC 3SDCC 4HPHA 3DRTA 1RK0A 2WVUA 3FONA 1ZV9A 3ZDYB 3MXVH 2HUHA 3BW9B 4ETYA 1W9XA 3U36A 3QR2A 4LSRL 1BX2A 4XNYL 3SDAB 2LT9A 2F61A 2Z93B 3UPAA 2VR3A 2R2BA 4F24A 3DX7A 4KVPA 1FFPA 5J12C 2J4WL 4J7RA 3MLVL 3UTPD 1OF2B 3VFMA 3HW7A 5C0BE 3LXUX 3VRIA 5C07D 4HS6B 3VWKD 4XNMA 4FZEL 2AQTA 2OMWA 3U30C 3VD1A 1SNRA 5CJXA 2W92A 1Q72L 2D3VA 3DRQA 4ILDA 2CLZB 3L2LA 3GBLA 5FCUL 1XF3A 5LO7A 4TSBH 4YBQC 5E1GA 4DKDC 2EO7A 4G6MH 4WNSA 1LEIA 2VM9A 3K74B 2DZEA 2EH7L 4E41A 4KY1L 4TVSa 2XSKA 5IFAH 1MAMH 1QFUH 5KAQF 2QMKA 2F68X 3L4XA 2EYSA 5H37H 3CTTA 2DQEL 5F7MC 5GGVH 3Q05A 4HX1A 1F42A 4WENB 3FTGB 4R7XA 3EH1A 3FRUA 3NGBB 3WTSA 5SWZB 5JUEH 4MWFA 2CE6A 4G82A 4TNVK 3I85A 5I74B 3G6JA 4UQ2B 5MENA 1EMTH 5ICZA 5LGHL 1R3IL 3IDJA 4KVCH 1UWEL 1JZ2A 1QSEA 1XWVA 3N9GH 3EAKA 2PYEA 3IGAB 2HH0H 4KKCC 1UOWA 4KJYA 1ECYA 2B5IB 1S9WA 3NJNA 1QQDB 1FJ1B 2ZOOA 4N90D 3VFVA 3U82B 4ZO8A 1TPXB 1YEDB 3G6DL 3HE7D 3OAZK 5CD5C 4P0DA 1YNTB 4QYOB 5T3XD 2VDNH 2X44D 4NKQB 4IBTA 1ZLUK 4NUGL 4OZHF 4HIXH 3MV8E 3N6YA 2OMVA 4MQSB 2FT8A 1L7IH 1KBGH 4MNHB 3V6FA 5BS0B 2AITA 3BPOB 3IFNL 4HUXB 1L0QA 3LV3B 1DCEA 5F7LB 3C5JB 1JHLH 4KHXL 4ZXBB 2DYPA 3O8XC 5MEPB 5I8EB 4G8EB 5D5ME 1NCBH 5E1AA 3UG5A 1LTXA 1AR2A 1AGEB 1HS6A 2AFNA 4N6RA 1TLMA 1K5NA 5DJ6A 5K39A 3TJEH 3IS1X 1RJYA 3DBXA 1MF2H 1VAHA 3HRZB 3B37A 3WY4A 3OR7B 3CZLA 4GIPD 1ZSDA 4UANA 2N0MA 5FGCB 1HVXA 2OFQA 3GI9L 4JRYE 1Q9WA 4ZX5A 4LOUD 1J9TA 4X99A 4QI3A 1GGCL 2JIXB 2DRUA 4ZPVA 2IMNA 4PWFA 3C08L 3L13A 5HVFB 1B4TA 4JFXB 3H7BA 4K9EC 1IGJB 3RE0A 4NUPA 1AHMA 4M1GH 5BZWA 3VD4A 5E6YA 5L2KA 4ZFOA 3FCTA 1FI8C 1E5ZA 1FO0H 1XR9A 1NCCH 2Q3ZA 3UPRA 2W95A 3LPOA 4NQVA 2WBJB 1AY1L 3RL1B 5DLML 3SE4A 1WCBB 1FNSH 2DWDB 3V0GA 3C09B 2WD0A 3OMNB 1PLGH 2VGLM 2XQ0A 1EIBA 3NA4A 1HIMH 4WI8A 4NP4H 5LGKA 2YQ2A 5I82A 3L5IA 2YIHA 1QFHA 1N4XL 1W72B 4JFEB 4DEWA 4BM7A 4D3CL 4MD4A 1UWXK 5E5LA 5HYFA 1T1XA 1FLTX 3FNKA 4XC1H 1NQBA 3RWJB 3REWA 4JREC 3PWJB 3NSJA 1MLBA 3U6RA 4NHCH 3RG1C 5LCVA 5HHOD 4ZUSA 3TO2B 1FG2B 4R8WL 3S35X 4BFKA 4NUQA 7FABL 5JYMA 5FM5M 1BQSA 3N41B 3QDMD 1LEGB 1N67A 2KUTA 2WLIA 2QT6A 4QHNB 5E4IA 1UADC 1EJOH 3QJZA 1YVLA 2DWEB 1TQVA 1U30A 2ZPKL 4U1GB 5F9OL 1MDTA 4UT9H 3MNVB 1U8QB 5FM4A 2OZ4H 4FTVE 3HZMB 3D39A 3LKNA 5DD0L 5DO2D 3UYPB 4ELDA 1T0OA 2J12B 5IR1A 4ODWB 1HT6A 3TONA 1EJFA 4HCIA 4UOW0 5E5UB 4KKAD 3JVGA 2DAVA 4ZUWB 4NQEE 5SWSD 4KJWD 4HK3N 1IV8A 1DQKA 2EC9U 3MRKB 3B7RL 4HJ0D 3CLFL 1XF5A 1E65A 4DKFL 3A21A 4U3CA 3S3DB 4A2GA 5BRZE 4HUVA 2BOBB 3L3JB 4L4VE 4Y4HD 2XA8H 3WENA 4KQ4H 4F7PA 2GEQA 3SD2A 2D7NA 1PSKL 3K6IA 1MIML 1JZFA 3EOBB 1XF4A 5L8JB 3WNJA 1JZ5A 3MRLB 4OZIB 2VR7A 3D0VB 3EDEA 3HB3B 4JRXB 4ZTEA 3BUDA 3F12B 2JK5B 3IXTA 5F9WC 4IHOB 5D1XB 4XVJL 5EU4A 5AD0A 5C0CE 2ICEB 4UOZA 4JQVA 5DWUL 2WWOA 3NCJL 4MXQD 3QXAA 4PJEB 2ZSWA 3ARDA 3WJJA 3SKUD 1ILSA 2XN9B 4G5ZH 3B34A 4U6VH 1YNKH 3QJSB 5FA4A 2PP7A 4GKLA 2JKLA 3RB7A 3QCTH 1RZKC 4XCCL 4XNZB 3PHOA 3QFJB 5D7IA 1KV3A 1HCFX 1XR8B 4UUJA 4N0YH 1S9YB 1MHHB 4B50A 3BLPX 4LZKA 4CNIB 3C5ZA 4EVNB 2X1PA 3QEGL 5F7EH 5GRVL 4OM1H 4DTGH 4J8RB 2FR4B 3DHUA 2J2ZB 1THAA 3TVMA 3ZSTA 3V6ZB 5IG7B 1HNGA 1MPAH 2E8ZA 1TMCB 3EGSA 4EDWH 1M3JA 2R51A 3EYFA 5HY9B 5G4OA 3QBTB 4J6RL 3WNLA 1ACXA 4JEGB 2F54E 3I2CL 1UG9A 2H0JA 3F8UB 3TPUA 4LLQB 2AEPL 1BYOA 3GB7B 1EHXA 3ABGA 4UTAL 2X89D 4XNBA 4RISH 1A3QA 2ZJSL 35C8L 2WSKA 3VFRB 1KF9B 5I5RA 5GGTA 5IV2A 1CD9B 4RMWA 2JKRM 4LCCB 3TCLA 4NQDB 3K80A 2EEXA 2WQUA 1I3VA 3ZGIA 1KGWA 1WRFA 5FDYA 3K1DA 4B9GA 2WWKT 1ETZA 1RUQL 3EOTL 1RXLA 2XV3A 3QCUL 5BVJB 3ZIMA 1KIPA 4P3CH 5HD8C 1ZLVH 1ZJAA 3NSFA 1F6LL 2ZICA 5AOJA 4ZTOH 3KDMA 3CBKB 2AJYH 2XN1A 4F9PC 4JM0A 2RIKA 4XP9L 4HFUH 1FN4A 1DN2A 2CDFB 4HPYL 2DQFB 1MREL 1UD6A 3WAKA 3HHRB 2A74C 3NSDA 3TXAA 4K3HA 2EE9A 2NY3B 4APQB 5AKRA 4DH2A 1MQKH 3VM7A 1BD2B 2C4FT 3TASA 5D72L 2IBZX 1NIEA 4F3FB 4RZCB 3ATFA 3DJSA 3KYKL 5G55A 2JTDA 3ILQD 1W6WA 3MRHB 2HP4A 3BVVA 4K8RL 5AOZA 7CGTA 2P9RA 1QVOB 1KIUB 4XPAH 5FECB 3HS8A 4ENED 4DIXA 2C1PA 5LGYA 2DQCH 3II3A 3HI1B 1YHPA 3MREA 4CKVX 2KLSA 1JF1B 4M02A 3Q13A 2ZCKL 3W0WD 1AE6L 3TTYA 3NPSC 4NCC1 1WTLA 4ODUB 1L0YA 2KZWA 5HI3D 2ED7A 3GINA 4KITB 1MCKA 1DCLA 5DHVH 3ZE0F 5FKPA 4RWYL 3UZEC 1HJCA 3O2DL 5E6RB 2K9FB 5IUCA 3RY6A 4F37K 1DYZA 4HIEB 4JE4B 5FUZH 1AG0A 2P5WB 3A22A 4MRCA 1J10A 3WMQA 1XEUA 4XWGL 2NNXA 3DX0A 3SGEI 1YYCA 4M8UA 2R56H 2FL5A 4TQPA 4YXKL 4DKTA 2MPAL 1I4FB 3G5VA 4WGKA 2ZCZA 2D0FA 3ALWA 3MCYA 2J1WA 2O72A 4X6CB 2ED8A 3NJFA 1DLHA 1MCBA 1XX9C 3LQZB 2JVUA 5IBTL 3LCYA 3V6OE 2N7SA 3L6FA 3OKEB 4PTUB 1OSZA 4Q4EA 4UM9B 3AS1A 2VW4A 4X4YA 4QKTA 5JIMA 4ZODA 5DJCA 2MCPL 5HDRA 5T3ZL 3S8WA 2XJLA 2ICWA 2BC4B 3VCLA 4GT0A 2EH8H 3K2UL 2DLFH 1CL7H 1MJ7L 4CAGA 5EU5B 2WWMC 1A6WL 1J48A 5KVDE 2YAHA 1CFMA 2Z65C 4HSQA 2HFTA 3JVFC 1TYEB 5HDLA 3RPIA 5C0DA 1PNCA 3SQRA 2O5XH 3QIUC 3LKSA 1J11A 4ZO6A 5KJRL 1PG7L 4HXBL 1ZA6A 4R90L 5F72S 4KH9A 1FVCB 3VFUA 1TQBC 2YZ1A 2GBVA 4G43A 1XIWD 4MQ7A 1HILB 5DVMA 5T5NG 4PLOB 5I8KL 4LSRH 5KSAD 3BVTA 4IEFB 1YEGL 4FG6C 4XNYH 3AQZA 3K5SA 3RDJA 3N40F 3LQAC 4IMLA 4LFHG 5D7JB 2QZQA 4O2EB 3VNZA 3H55A 3Q2LA 4JZJC 5IROC 1MXDA 2ENQA 4KXDA 5F6IB 1XGUB 4F7TA 4MA3B 2J4WH 4MB4A 3SDDA 3MLVH 4YHML 1KTDB 4XMTA 4OD2A 5E2TL 4HEPG 4FZEH 4F33A 2Y7MA 3JV4B 4WDIB 3QR0A 3SKOB 5GGRB 2ZF8A 4R4NC 2X1WL 1Q72H 3QIWD 4M3HA 2FEDC 5FCUH 3K71B 5AVVB 3T0AA 3GPEA 3HJ0A 3UTPE 3X13B 5L4MA 5HYSB 5C07E 1FNGB 2VM3A 2A9NL 4MJIB 4KRPB 4YGAB 2V5SA 1J7VR 2EH7H 3GSQB 4KY1H 4LESA 3CG8A 1UB5A 4BEIA 5KYWA 1D5XA 3EYSL 4WV1A 1FFTB 4IOIB 4Q89A 2DQEH 1V05A 1KT2B 5DVOA 3LRSB 2CHNA 2R23B 1WUNT 3S6CA 3GSVB 3VMOA 5MEQB 4KDTC 5HI4C 3ARFA 4CILA 1CF1A 2CNYA 4XP6L 4XBGA 3TH4T 4E42B 5BZZA 3A4FA 1R3IH 1NFDE 1DHKA 1UWEH 1AD9B 3HIZA 1EAOA 2EDLA 4D9RD 1SDDB 2NR6D 2OSXA 4QAWA 4YBLC 2V33A 4OLYL 4XC3L 1ROWA 4Y9CA 2FWOB 2R4SH 4TMPA 3PWUB 5HPMA 5B7FA 4PJGA 1ET8A 2E9BA 4AQAA 3V7MA 2BY3A 2NY5C 2JB6B 1AC6A 2OYPA 3G6DH 2NLJB 4X6DB 1IX2A 1CFNB 4MJJA 5CO1A 1I7ZA 4GSUA 2ATKA 4POZC 3H4HA 4N90E 4FMVA 3HPLA 3AWFA 1HWWA 4K5NA 3O9WC 3QWQB 3E38A 3IFNH 3MBEC 4IBWA 2J56A 2VMJA 2WLZA 2NZ9D 1DQJA 4KHXH 3V5KB 5T3XE 3EHBD 5L0QB 2VDPH 1Q0EA 1T7WA 4ODSL 4OGAD 5B4MC 1HHHB 1ONQA 2JH2A 4LNRA 4XN7A 4H25A 4FG4A 3UTZA 4R4BA 4NPKA 3BPCA 3F5WA 1NBZB 3PGDB 2XWBB 3HMXA 2DBJA 2HT2D 2HLAA 1AR1B 5DJ8A 3C12A 5BW7C 3TF4A 2FATL 5FO9B 2ED9A 3MI6A 4FLQA 4XE5B 2A9DA 3GI9H 4I7ZC 4V11A 4UI2A 4TTDC 5JHBA 2WO3B 1A7PL 1JK8A 2MJWA 3EJJX 3C08H 1X44A 1URLA 4JFQB 2H47C 1GMIA 5GS1B 1X5FA 2VXUL 4JANB 4HD9A 4H2CA 4R97C 2Q7NA 1FNHA 4ELMB 3VI3A 3UJTH 3HA0A 2Y69B 5JQIB 4Y9GA 5M95B 2WY3B 1AY1H 1HINL 5CNHA 5DJDB 4UF7C 2ODIA 1GVIA 1KB9K 2VLMD 2JNZA 2ZX6A 2WXNA 2ARJB 4KROC 1IZJA 2W60A 1CXKA 3U36B 3U48A 4I88A 1BX2B 1N4XH 4GUQA 2A3TA 4P2OA 3U4KA 2I26N 4P05A 2ADFH 43CAB 3VWJC 5CLWA 1FFPB 3OG6B 1U2CA 1FORL 3BCDA 4IRSD 3WJLC 3CVHA 4R8WH 3ZY7A 2QTEA 4RDBA 4BFIB 5AKSA 5AB1A 3R8QA 3B4NA 3QJHA 4I48A 7FABH 4XNMB 3I6SA 1KCLA 2OMWB 4WWPA 1WC7A 5C0EB 3PP3K 3QE5A 3ULVL 4Y5VA 1NL0L 3O41A 3P3SA 3RGVB 2ZPKH 3FTXA 4HPOL 5F9OH 5HHOE 4K8RD 5DD0H 3A6BL 1LEIB 3L3DA 1UJ3B 3QDME 2MMXA 4HQQH 5T5FH 2CBOA 1JWMA 2IBGA 1JF6A 4I0CC 2XKNA 4UOJA 2EDBA 2EYSB 5DZPA 4BZYA 4HX1B 4KKLC 2RALA 4MDIB 4NRZA 3IDIA 4Y2NA 2V8LA 3EOAA 2K6WA 3EYOA 1IQDA 3JV5A 3BMVA 4DKFH 5KWYC 4PRAA 5E8NA 4KDVA 1SRDA 2DQTL 2J57A 5MENB 5SWSE 1PSKH 3O3BA 1I8UA 1MIMH 4Q6YA 3IDJB 4GP8B 4RCAA 4D8PA 1QSEB 2GJ6D 2JI1A 3IB4A 2PYEB 3QAQA 5EZJB 4F7MA 4XVJH 4KJYB 4AEHL 3Q44A 1BFSA 1S9WB 3RB5A 3NCJH 2WXJA 2EAEA 4M1CD 3VFVB 5KVGE 1GYAA 4GW4A 1RLBA 3FTUA 4QLRA 4A37A 4DVBA 2P7TB 2XZQL 4ZW6A 1JV2B 1D5BA 4YFEA 3QR1A 4UQCA 5FW6A 4XCCH 4W93A 3S5ZA 1NCUA 1OAKL 4HCGA 4R5TA 2OMVB 1BSIA 1OQXA 1S4IA 3NGBC 5HXMA 2J8UB 4Z7UF 3WKPA 3B6SA 4HT1L 3B9AA 1YJDL 4S1RL 2DWYA 4DZ8A 5DRXB 3QEGH 3Q2NA 4M00A 4JQIA 2B4CC 3OHMB 4L1HA 1HESA 3LZLA 2VE6A 4UDTA 2DYPB 3OR6A 3VH8A 1N5YH 4M8RA 4MD0A 4MS8C 3CSPA 5T3ZD 3SGDI 1S7UB 2P45B 1J8RA 5E1AB 4TYUA 5EC2A 3O2WL 3AAZA 4JRWA 2B5IC 3I2CH 2D7OA 1V7ML 1K5NB 5K39B 2BHYA 1TPXC 4GEJA 2CJUL 4NO2A 1RJYB 4OIIL 5FUCC 4MNGA 1CFBA 3EUDA 3PHQA 2ZJSH 35C8H 4OF8A 3AMKA 3EOYG 5EU3B 1VGEL 4KX8A 2X4UA 2GC7C 3FL7A 3WFEL 1Q9WB 3NIGB 1DUZB 4X99B 4X7TA 4ZPVB 1OB1B 2G9KA 2FECL 1ADWA 2EXYD 3EOTH 1RUQH 1U3YA 3H7BB 3QCUH 1D7FA 4QNPF 3O4LA 5BZWB 1RFDH 3LRHA 4X9BA 5TPWL 3IYLW 5FYKU 4ZFOB 1U91A 1HSBB 3CFUA 4G8GD 4XP9H 1XR9B 3UBFA 5KYUA 2JKXA 4CSPA 2CALA 4EN2A 1QZ1A 2CLVB 3CPUA 4HPYH 4NQVB 1YEWA 5FW7A 3VI4F 1MREH 4P8QA 2P8LA 2COQA 2P26A 1UOVA 3PL6C 4NBYB 1FUNA 1LDSA 4NN6C 4EEEA 5IF0A 5ANMA 1KACB 1UTDA 1JE6A 5D72H 1G7QA 4EUPA 2AQSA 2HLFC 3LN5A 3KYKH 4HMCA 1JZEA 4ZNCD 4MD4B 3HC4L 4QRQA 1T1XB 4X7FC 3REWB 3VQ2C 1PFCA 1MLBB 3BUYA 1OGAD 4P46A 4B53A 1KBWA 4AZUA 3T65A 5DVPA 4E5XA 4ZUSB 4YEEA 1TTUA 4ORZC 5DDHA 3QCVL 4URTB 2C9QA 2YGOA 2F0CA 2VO8A 4NQTA 2WLIB 25C8L 4K5PA 4U7MA 1NCTA 2DQMA 2RQEA 2G5BA 5D4IA 3HJEA 1A4KB 3C09C 2IANE 4QO1A 3L54A 4P2RD 4RWYH 3NFSH 3O2DH 3AG1B 3D39B 3LKNB 5CJ8A 3S36X 1KCWA 2LE9A 1ZXQA 5IR1B 1NSNL 3W0WE 1L9QA 3GMPA 1JYNA 3ESUF 2IBZY 4XWGH 5KG9B 4UAOB 4BH7B 3HG0A 3NRFA 3SHSA 1IB5A 4FD0A 5DD6A 4YXKH 4Z6AT 4L2LA 1R33A 1BIHA 4PWEA 1XF5B 4PVBA 2MPAH 4ZOCA 5KVFL 4BSVA 4HUVB 3B7YA 3A5VA 3E6HB 3SE3C 4F7PB 3QYMA 1K4DB 2EDOA 5HGHA 1F3DJ 1XF4B 1BAWA 1DUYA 1F4WH 3L4WA 3QEQB 4HIQA 1BPLB 5IBTH 3IXTB 4X8XA 5ESVB 1HEZB 5GGUB 2GBAA 5EU4B 5AD0B 2GABA 2XWDA 2MCPH 2BNRD 2D3JA 4GQZA 3ARDB 3UAEA 5T3ZH 3NJIA 3BAKA 2APSA 2BW4A 4JM2D 1TG8A 4LLYA 5FA4B 4DW2L 5C09D 1MJ7H 3H4FA 2JB5L 3PHOB 3DYMA 2MQ3A 1A6WH 2FQGA 4IU2A 1NANH 2RFXA 3M86A 4G11A 4ZAKC 1J1XL 2G5RA 3EO0A 3C5ZB 3OKNA 5HHPB 4ZO9A 4K3DL 5KJRH 4HXBH 5AG8A 1I1AD 1KTKE 4R90H 2E6PA 1XGQA 5G5DA 5FCSH 3QORA 3TVMB 3GTTA 1P69B 4PJ7F 1EXHA 5DXWA 1T4KA 3EGSB 1U3HB 1VJSA 5KBDA 5D1XC 3MA7B 4AY0A 3FB6A 1ICTA 4K71B 2VB5A 4N0RA 5FHBH 2QADD 2V7HA 3FB7A 3G6JF 9CGTA 4Y2OA 1EAQA 1CDGA 4HUNB 1BJ1J 4J3OD 2B39A 1JG9A 1S3KL 4YHMH 3S4SB 4AC2A 4XNZC 3E80A 1CICB 4YDKL 2BIOA 3NACH 2FEEL 2VM4A 4WI5A 4EZLA 3TCLB 5GGSA 4HU8A 5IV2B 3G3LA 5I5IA 1Z2KA 1T89A 5AVUB 4HUKB 4CN1A 1FZOA 2Q76B 5GHWL 4Y4KA 4BKSC 1ETZB 5E2UH 1I3GL 1KIPB 2Z91A 3QUZA 4U31A 2A9NH 1N7ML 2V5YA 3KDMB 5E56A 5F7FA 1MWAL 4AXWB 2FHCA 3BAYA 1FN4B 4OIFA 3FRPA 1IVTA 5CZXD 1MAJA 2PR9A 3ULVD 2CU9A 4RZKA 3MTXA 4MAYA 1H19A 4G1EA 4MQXC 4PJ8A 4XP6H 5SV4A 3D87B 3STZA 1GGYA 1QO3B 1EXUA 3U9PH 3LZFH 4LVNB 4KBPA 1EDQA 4RSVA 5EIVA 5AW2B 4YZFF 5IESL 4HLZH 4MRBA 3ARGD 4OLYH 4OKVB 1R3KA 1L5GB 4OFYA 3T4AB 5KZCB 3K8LA 4WWKC 4BV1A 3AXHA 4Y19A 4IMKC 1KPUA 3DC0A 3MREB 2R4RH 4RNRA 2R7EA 2A7BA 4AVIA 1I9RL 4D9RE 1B88A 2O6DA 3VX1A 1JZ6A 4G42A 1HQ4A 5IVOA 3UMTA 6CGTA 1SXZA 5KBKA 2WGNB 4AUUA 4APQC 5FKPB 4KX9A 3RKDC 1P6WA 3FQTB 3ABLB 1EEZA 3PU7A 3QDGA 3I9IA 2IMMA 3FN0L 2BS8A 3TN0C 3ZBMA 2BNQA 1EDHA 1NKRA 4CDHA 2GUYA 4JE0A 3GXMA 3P4LA 1UVQA 2BERA 3BE1L 2HKFH 3LD8B 2X0WA 4ODSH 2HFGL 2PN5A 3ZK0A 4OJFH 4PLJC 5HDQL 5I1LA 3MACL 3F7VB 5ECGA 5AVXB 4M8VA 3G5VB 5BO1L 3K6SB 3T77A 3FZUC 2NNAA 1W15A 1HX0A 2DMBA 2OSLB 3B83A 1DLHB 4O51B 4OCNC 1A1MB 5SX4I 2EZ0D 5EOQL 4EIGB 2B2XH 3B9KD 3L6FB 3L9BA 5CF3A 2CXGA 1OSZB 2DQIL 4OZFH 3O6FD 1T1YA 4YDZA 5CJBA 5T1JA 1Y1UA 3MZGB 4JZOA 1I9EA 1JRHI 4YXHL 3IN0A 4M8QA 3UTSA 3ESPA 5TK4A 1YDPA 1BFOA 4KX7A 2PTUA 3R06A 5JW4R 1KLGA 2EXTA 3EGXB 3WFZA 1JXJA 2QQLL 2JMRA 4J3OH 2ZWSA 5HVWA 1HINH 1MCWW 2QPSA 3LKSB 1Q8MA 4RQQB 1WHOA 1ZA6B 1YEIL 4M4RA 2V3FA 3EO1A 4WO4A 3FUMA 1KMGA 4G43B 1OTUC 1HC1A 5LVEA 5F9AC 4H5SB 3VXSA 4BA8A 4DP7X 4APXA 2WZ6A 1HCVA 1DDTA 3D48R 1GC1C 2QV2A 3U7AA 3LS4L 2QKIA 2VWEC 3I3EA 1PY0A 3SJVB 2VLME 5LBSL 3CUPA 5T1KD 3VSVA 3BZDA 2AXHA 1A7QL 4NZ8A 1XB6A 1OPGH 4F7TB 3SDDB 1DQLL 1FORH 3O8XD 2WLKA 1S7SA 3B56A 4OD2B 3IT8D 2DI9A 1IAMA 5FOBA 5IW6B 1KFAL 2NUPB 2OBGA 4F33B 4ZG1A 2GTWA 3VD0A 1OARL 2X6CA 1DANT 3VQ1C 3ULVH 4YUEL 2XG5B 2GY5A 4AQEA 2ESVD 4Z7WA 4HPOH 2KYIA 5EPMA 4WSJA 3KPRA 1IM3A 3A6BH 2IH8A 5D7IF 3B3BA 3QUHA 5DUBB 3WI9A 2OZNA 3OGOE 5DJXA 1EV2E 1UB5B 2XPGB 1IKNC 1D5XB 2IQ9L 4XP5H 2DWTA 4WV1B 1LK2B 3P0VL 5D7JC 1YNLL 2OMZA 1LO3L 5I6OA 4HIJA 1WT5C 2CLRA 3WIAA 1IGMH 5IHHA 1JTTA 5I66A 2D0GA 3H9ZA 4HKXA 4WSGA 2F8XC 2C34A 1OTTC 1UFGA 2Z9TA 3CD4A 5JXEA 4BK8A 4OCWL 4X6FB 1WISA 3VB9A 1JPSL 1WD8A 2V37A 2WPGA 2GAZB 5E6UB 1DN0A 1LP9E 4H1LH 3D0LA 5ICUA 3WCYA 3KVDD 4QHKI 1WS7A 3OPZL 4HP5A 4AEHH 5KS9F 3JT0A 4PJGB 2JCWA 4JG1L 4DGYL 1A7BA 2Z31B 3O0RH 1KBKA 2WLHA 3TA3D 2GJ6E 2XZQH 3VXNB 4AW4A 5I1IL 1BYPA 4KAQH 2ARJQ 5A2FA 2ATKB 1OAKH 2D31A 3GSNA 3QUYD 2W07B 3LKRA 3HPLB 2IWGA 4PS7A 1JAEA 3T2PA 3TWCL 3MLWL 1B4LA 4XOEA 2CAKA 1DSFL 3T3ME 4LL9A 3MPCA 1N3NA 3U7YL 5CS7A 1NPUA 3OZKA 3L3IA 5IEHA 1LO2L 3P0GB 1DSWA 4LNRB 2XVLA 2F18A 1WD9A 5AUMA 1FH2A 1ID5I 3O2WH 4H25B 5AB2A 4R4BB 1UEMA 3BPCB 5DEFA 1GSMA 3F5WB 2W80C 3DGDA 3ZXAC 2HLAB 4JKPL 4WCYL 4OIIH 2O26U 1SJVA 4RX4A 1RU9L 5C71A 4ZOAA 3ZGHA 1OW0C 1U2YA 4M6OL 4XP1L 4XX5A 4O02A 3WKYA 1VGEH 2W9EH 2VRQA 1TR7A 4PV9A 1XTMA 1KPRB 3OHXC 5AW9B 4ADIA 1JK8B 1RJCA 3UZQB 4CU6A 2CGRL 1XH3A 3OGCA 4WUKL 4R96A 3V5HA 4GAYA 3ZTEA 2GFBA 4ZT1A 2F6AA 5JW5A 2WWKO 5BV7B 5TPWH 3BUQA 4PJCB 4POUB 1FGNL 5EOTA 3VYPA 3BO8B 1BHGA 2GY7B 2M1KA 4KFMA 3WKNA 1M6OA 2OCFD 3B3IA 3ILDA 4B9JA 4C59B 1AR1C 1PYWA 2KT6A 4FFZA 3FSVA 2XV2A 4WKZA 3WTTA 5F8QC 3D69A 2B0SL 1RZIA 2AI0H 3NJVA 4QHKJ 1MVUA 1OT2A 1SVCP 4GAJL 2W60B 4G8GE 3K3QA 2F1EA 3ABZA 4E9TA 3SKNB 3LB6D 1JWUA 1WO2A 3B1UA 5FYLL 4LSDA 1HYSD 1DVQA 3IF1A 3RFZC 3HC4H 1OHZA 5GS1C 4K3EL 4XMLL 1FAIL 5DFTA 3NIFF 5AOIA 1FCGA 3LVEA 2ZWLT 2NT1A 1EGJL 5I8CB 3CVHB 3M45A 1BVKB 1KXTA 3QCVH 4I48B 5AVQB 3RTQB 3V8OA 1BQKA 1WC7B 3KLKA 1ACYL 1VFOA 2R0KL 3KLHD 4Y5VB 1RK7A 4BFFA 1I8AA 3O41B 3UGUA 1OGAE 4ONHB 3GXPA 1MJ8L 4YHPA 5I9QC 5DVKA 5EA0L 2PO6A 1S7XA 4XHJD 3L3DB 1ZLWH 3ZDXE 1NGZB 1NSNH 1JWMB 2P5EB 4NFDA 5IY5B 5KEZA 4XRCB 2XKNB 4DEPC 4HEMA 1UZ6F 4NLAA 4NRZB 4P2RE 5EUOB 1NMCB 1REIA 3IDIB 3UJIL 2XA3A 3EYOB 1EJ8A 1S78D 3MJ8A 2I7OA 1IQDB 3U25A 5GZOA 1QI3A 3FO1A 1G0XA 5KVFH 5E8NB 2BIPA 4B95C 2Y1ZA 1OTSD 2WLLA 1RK1A 5CEZL 3O3BB 1LXMA 4WI0A 1BLIA 1F45A 4D8PB 5CJXC 3FU9A 1Z5LA 2FJFB 4F7MB 2RH0A 1Q9OB 5FGSA 3RUGE 2ZP8A 2YGVA 1J8HA 5IHUL 1FBIL 2YPVA 3DJTA 2PR4L 3PIQA 4MYWB 1U2HA 3G6AB 1FNEA 3VG9B 4DW2H 5B39A 1D5BB 4JMXA 2JXMB 2E7LA 2JB5H 2FJHA 5I75B 5DMIL 1I1YA 4O2FB 1J1XH 3MJ6A 5BMFL 4DN3L 3TCTA 2BNRE 2HTKC 1BOGA 5IBUB 2JV6A 2YAQA 5EULV 4OVVA 3WIHA 3QGVA 4AL8C 3P2BA 4K3DH 4IK6A 4DUVA 4LRIA 2XACC 5C09E 2GG1A 3VH8B 4MD0B 2I32A 4K73A 1RZFH 4OKDA 1HHIA 3L4UA 4N0UA 3C60A 2VLLA 5F6HI 3AAZB 3G5ZA 1EH9A 2X4NA 3NESA 3Q5OA 4JY4A 4D0CA 2E9WA 1DBAL 2H7WA 4ZRGA 1NPJA 4JN2B 3DXAD 4MNGB 5KAQG 4RRPM 1MEXL 4GXUN 4PJHF 4J39A 1S3KH 3PHQB 4Q0XH 3KGSA 4JFDD 1RERA 4YDKH 4ENZA 1CWVA 2XU9A 4AIEA 3CZFA 3KPNA 5D2NE 4PRIA 1MG2C 5DJAB 3JUYA 3OB8A 5LG6A 5GHWH 2JJVA 3IXAB 3OX8A 3CHQA 2A6KB 4GKNA 4QIRA 1HQRB 3O4LB 5JIPA 2ZUSA 1N7MH 1DEEA 1DL7L 2OR8A 1U91B 3Q0HA 1P6FA 4E9YA 1MWAH 2CJTA 3ZKXB 4A39A 4I85A 4W4OC 4CVXB 4QEGA 5HJDA 5HHNB 1MHEA 3D30A 2WAQA 3K4AA 3OZ9L 1CDBA 3RNKA 1EWHA 1X4YA 3BI9X 5GGSY 1TVHB 2DQDL 1NAKL 5IF0B 5CBEB 1CBVL 4UBDC 1WWWX 3RVVC 1CTMA 5ANMB 4GFTB 4JKMA 4R26L 2WQXA 4L8CA 1G7QB 4XBPB 1SJMA 5DURD 3LN5B 1KN2H 2NQCA 4LPVA 5IESH 4QRQB 4WVRA 3O4OC 3EG9A 1RJLA 4QXTA 2AABL 3ULVE 1ECZA 4EZJA 1YAIA 1WA1X 4O2CA 5CKAA 1J9SA 2HXAA 3WLWC 4E5XB 3O3DA 3UEZA 3D18A 2WXHA 3CH1B 3BN3B 4TLUA 4ZFFA 3IE9A 4QTIL 1S8DA 5CZKA 4WI2A 3UGXA 4Z78A 5IOKA 3DOSA 1I9RH 3RBGA 1W8OA 4NUMA 3SE4C 1KWGA 2G5BB 1H6UA 2EVHA 3X11A 3BZEB 4G5AA 4I5BA 4QO1B 1BQHB 3SODB 4AGPA 4GSRA 2KHAA 3ROLB 4Z7VE 2FAUA 5F6HJ 3FN0H 4G6KH 3VGGA 1I9JL 3IDMA 5I1JL 2XPYA 4U1KB 5E1IA 3GMPB 3VI3F 1X5GA 5KVMC 1WS8A 5DI8A 2WB7A 3RDTA 2XX0A 2P4AB 2WGXA 3QWRD 3BE1H 4LLDA 1HFUA 3UBXB 4GIOA 2GB2A 3Q2CA 3UC2A 4LPUA 4QOKB 1FZJA 5HDQH 1BAFL 2HTLC 1IFHL 3MACH 4PI2A 1U8HA 3D85A 2E75C 4BSVB 3S36L 3D3VB 3AS2A 3QI9A 4TUUA 3QDJA 2GJZB 5EBMA 3WGVB 4AT6A 3SBWA 1D5IL 1DUYB 3ZDWA 3PWPA 5EOQH 3K7UA 1R3LB 4TULL 2EDDA 3WTVA 1RP8A 1CK0H 3CBRA 1JPEA 2DQIH 5T1LA 3T3PE 2EEFA 4C83B 2HCZX 2VL4A 4Z7QB 2HFEA 3EF7A 3KNBB 3WEMA 1UA7A 3VXMD 1LQBC 2WXQA 3FTYA 1E5UI 4WUUA 5ISZD 2IAMA 3JVGC 1KB5A 4P9ML 3CSBA 4N87A 5GRJH 4EIBA 3RZCA 4UAOC 2DQUL 1J0KA 4WEUD 4A2EA 5T8IA 2RFXB 1UKTA 2QGEA 3DGCR 3DTDA 3OC8A 4GRLD 2QQLH 3L7EA 3EO0B 4HIHA 3OKNB 2I07A 4OVUA 3VGAC 3UO1L 4DK5A 4AGOA 5IVXA 5K93A 3BH9B 1YEIH 3A47A 4K5OA 5F89B 5G5DB 3QORB 4FNLL 3C5SB 4PJAA 5KUMA 4PGBB 4CMMA 1T4KB 4ZTPL 2XG4A 2VJ8A 4X42A 4XB7A 2TSBA 3BGFB 3QC6X 3FC8A 1FF5A 1E2VA 3L48A 4JQVC 4POZD 5C6TH 2YKKA 2DF3A 3FB6B 1XHHA 3LS4H 3FB7B 3WJJC 4OIAA 2L7UA 5LBSH 4FA6A 3CFDA 1ET7A 1A7QH 1DO6A 1ZT7A 5DZLA 3IGLA 3R0MA 3CN4A 4W6XB 1U33A 4XO5A 5FF6B 1DQLH 3PHAA 4J2XA 1RZ7L 3NCWA 1XD1A 3L3HB 3HAEH 1KFAH 4GW5A 4A6YA 3C5ZC 2CDEA 4YUEH 3GS7A 1FZOB 4AMKL 5IHLB 4ZUUA 1LL1A 1RIHL 2GK0A 3NA9L 1Q38A 4Y16A 2DYSB 4Y4KB 5FYLD 5C0AD 4YSDA 3L3GA 4L4TD 1S7VB 2NUTA 1IE5A 1SYVA 3X14A 1BQLL 2Z91B 2CUAA 3QUZB 2DKSA 2X1OA 3NJKA 2ERJB 2IQ9H 2X6UA 5D7KD 2EIZA 5HYJE 3FRPB 5I76A 3P0VH 1YNLH 2AXFA 4G80B 2EDQA 2VDOH 4QAMB 2ESVE 1AXIB 2BVOA 4G9DB 4M61B 3HNVL 4P48A 2YWZA 5DMKA 2XT1B 3TBSA 4ZMNA 1T2JA 2E7CA 3E7JA 3RX8A 2AMUA 1E5BA 4M4PA 4UIMA 1HL5A 1CPUA 4WFHD 3D25A 4MAYB 1KGIA 4G1EB 4PJ8B 4OCWH 2DJMA 5GQBA 3HMWH 3EUUA 3TH3T 3STZB 1JPSH 1EXUB 3FUHA 1LGVA 4IIZA 4MD5A 4FKEA 3WNNA 2Z34A 4MJ5A 4Z0BL 3OPZH 4YX2L 3FN9A 2ZX9A 3P0YL 3IGKA 1W8NA 5C8JA 2C1OA 4Y19B 1NWPA 3BP6B 1KYDA 1LLAA 4JG1H 1NOLA 1UXSA 3FFDA 3DDFA 5I1IH 1R19A 1ZDQA 1R1CA 5AG9A 4G42B 1HQ4B 1ILUA 4ODBD 1G94A 1KJVA 5CEZD 2W0KA 1U8PA 3QWNA 4ZX3A 1EEZB 1WV7T 1ZV2A 3TBCA 4MNQD 4KC3B 2ZG1A 1OK8A 5KVFE 1AC0A 4FEIA 1DSFH 1H6TA 3ML8A 1HI6A 1NGXA 4LVNC 2GHZA 3BRFA 2X3CA 1E6OH 3QO0B 1CFTA 1LO2H 3P3UA 4FQXD 2R2HA 5I1LB 1YZZA 4FQ1H 3G9VA 3TFKC 4DHLA 3BKMH 4MCZB 1OAZL 3LZQA 3OXSA 1SOKA 3A0OA 3CV5A 3IRZA 3T8VA 3T77B 3S3BB 4CBPA 1K8DA 4JKPH 4WCYH 2NNAB 5E4EC 1JCKA 5T1DL 2HT3D 1F6FB 1D3CA 3DX4A