3W1ZA

Heat shock protein 16.0 from schizosaccharomyces pombe
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
134
structure length
134
Chain Sequence
PPTVNDLFSDFVSYSPRLNNQIPGELSPSIDVHEGKDTVSVDVELPGVKKEDVQVHYDSGKLTISGEVVNERKNESTEGNQRWSERRFGSFSRTITIPAKIDADRIEANFSNGLLTVTLPKVEKSQTKKQIAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonequivalence Observed for the 16-Meric Structure of a Small Heat Shock Protein, SpHsp16.0, from Schizosaccharomyces pombe
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Chaperone
molecule keywords Heat shock protein 16
total genus 18
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3w1zA00
1RL1A 1WFIA 1GMEA 4RZKA 3L1EA 3Q9PA 4JUSA 2WJ5A 1WH0A 4YL9A 2BOLA 1SHSA 3N3EA 3QORA 2CG9X 2KLRA 5DS1A 1X5MA 4MJHA 2Y1ZA 3EUDA 3L1FA 3VQMA 4YE0A 3GLAA 3AACA 2MNWA 3QORD 2N3JA 2KMWA 3QORB 2Y1YA 5DS2A 2Y22A 4FEIA 2O30A 4M5TA 5LUMA 2XCMC 2RH0A 3GUFA 3IGFA 3L1GA 1EJFA 4PCKA 4M5SA 3QORC 3VQLA 2K8QA 3W1ZA 4ELDA 3AABA 4PBDA 2JKIS 4YDZA 4YLCA 3GT6A 3J07A 2CR0A 4I88A 4JUTA 1WGVA 2N0KA 3Q9QA 4ZJ9A 2WJ7A 4YLBA
chains in the Genus database with same CATH superfamily
3GSWA 2R59A 2DQEH 3ZTCC 3WL9A 4KTDL 3BEWA 3MCLL 4OCNC 1YN6B 2GI0A 4P06A 1OP5H 1DBAL 1WHPA 1HNYA 5D9SA 4DQAA 5CEXA 4TF4A 1ZLVH 3LEYH 5IFJA 2PABA 1F3JB 1ANUA 2H2PD 1BQKA 3EADA 4TRPH 1F02I 3VWKB 1MNUH 3L3IA 1WZMA 4GKNA 4L9LA 4HFUL 4FABH 1IEAB 4Z7VB 4CC1A 1KULA 5A7BA 3TEWA 5DT1H 1N2RB 4S1DD 2OL3B 1U33A 3LKPA 3K6NA 1GZHC 5HJBA 5ESVB 3BGAA 5J12B 1E90A 1ZSHA 3CZGA 4BZ1L 4IBVA 2H0PA 2Y2WA 2GJJA 5J57B 5ESVA 3WFBL 5EEXA 3QEQD 2VLKB 3C87A 4TUUA 1FFPB 1QAWA 4NPJA 3TFBA 4UB0H 4GW1A 4PJAF 4OLXL 3FFDA 3OJVC 5M7QA 4R90L 3QULB 2YRZA 3PXLA 2FH6A 1I3RA 4PJXE 3WKMH 3M1CA 3DWTA 1T04B 4RAUB 5IVNA 4PD4J 1I8LA 5A1AA 4E5XB 5FGCB 3HC3H 2G4EA 4LSQL 4IMKC 3UTPE 5MEND 3ILEA 5GIRB 3V0HA 4V1DB 4WHYH 5CWSA 4UM9B 4KUZL 3QQ4B 3X1NA 4Y1AA 3D3VD 2BVEA 1IC4H 1QW9A 1PTZA 3PHQA 5GZOD 5I71C 5F1KC 4JG1H 1P4IL 3GBML 5A2FA 4HIHB 5CSZB 5BRQA 3SODB 3QRGL 1YY9C 4HGWB 2AQQA 3O3AB 1K8DA 3LX9A 4MS8C 3OG4B 3V6OE 3D39A 4U1JB 1N8ZB 4JHUA 1ONQB 3EUUA 2DD8L 3M8OL 5F1IA 3LNHA 5AAWA 3ARDB 1FNSH 1HL5A 2VZ1A 2D03H 1E7VA 4ODHL 1TTAA 1DDTA 4KK5D 1MI5B 2Z31D 2IQ9H 2DKMA 3CTTA 3N9GL 3QFJE 4B6ZA 3DK0A 2NY4B 1YJDH 2H3NB 3MGOB 1ED3A 4M1DH 5JXEA 4FP8H 2FJFB 2IOIA 5G2NA 1CL7I 4JJ5A 1UD8A 4XMPL 5FUZL 4H4NA 1NMCB 4OI7A 3OKLB 1Q90A 3VFOB 4DO6A 3WE6A 1IRAY 2FJFA 5CLTA 4XP1L 1O6TA 1OF2A 4QHLB 3GJEB 5CGYC 4DSYA 5L9DH 2VN4A 3MA9L 1H3XA 3FQNB 2DQFB 1SOXA 4LPVA 1UM5L 3A67L 4A68A 4BFRA 4PJCA 4TQPA 1F3DJ 5LWYL 2ATPA 4I77H 5A16A 1AKJB 1G7IA 3E7JA 1LQBC 1JPFA 3QFDB 4Z77A 3HG1B 5F97E 4MDIB 5D7IE 4BXSV 2CDEA 2G2RA 1YY9D 1ACCA 2HZHA 4JFSA 4N8UA 4AI7A 2AK1L 1E6JH 5AW6B 3IAQA 2R56H 1AXSA 3BZFA 1H6UA 4O5LL 5DZ9A 4XX1G 3DPDA 3LRKA 5HPOA 4WUKL 5KYWB 4PRDA 4X5WB 4P48A 3O6LH 1I7TB 4G6JL 4Q8BA 1LO3H 4IKKA 3WUWB 1AC6A 3OAYK 4XCYA 3OLIA 1QACA 1TG8A 2NYYC 3ARGC 3QXAB 5GS0D 3MXVL 5I1EH 3HJEA 1CFSA 5ALBL 2LU3A 4L8BB 3HEIB 1AC0A 3ARZA 4PUBL 5LAXA 1EMTL 2G60H 4OD1H 3RUGF 4LLVA 3EYQC 2C3VB 4JQIL 3DJ9A 4X6CA 3EFOA 1E28A 4HX1B 3RNKA 1YAZA 3NIGB 4WHYG 1MDAA 2QFRA 4QGTA 1HNFA 1TUPA 1M1XB 4UT6H 4F7PA 2OL3A 3BLBA 1JYNA 4Q7DA 4Y4HD 4S1DC 3K4ZA 3CVDA 3ZK0A 2J3SA 2ITCB 4JFFD 2CK0H 4OQTH 3V0FA 1I1AB 1WQVT 3LEYL 3DJSA 4XXWC 2NY7H 5I28A 4OY9A 3IGUA 2QQQA 4FJ6A 4GQPH 3US0A 1KTRL 1D5MB 4PREA 1CXEA 4D9RD 4DHLA 2WQXA 1KIUA 3HZKB 4PGZA 5KG9A 3H9YA 4PG2A 3GDCA 1JGIA 1K5NB 3EOTH 1ZWIB 4B9GA 2BSSA 2WVUA 3GO1H 1P5UA 3GXMA 2ZIDA 5IJBC 1FL3A 3BZ5A 1BVLB 3GSQB 1M7IB 5DU7A 1TIUA 3V4PB 5C0GB 3E80A 1BMZA 5DUML 4F93B 3JYCA 4N8VG 2MOGA 1I3GL 2LFGA 2WVVA 2J4WL 2O6PA 2NX5E 4G6FB 3N1MC 3CSPA 2FIKA 3DX7B 4WI3A 3FHEA 4UDTA 1IJ9A 3KBPA 3DYMA 2X6CA 2JCCB 4ZXBB 2C7UA 2IAAC 3BVXA 3DUUA 3MLSL 4K9JA 3GLZA 2AQTA 1A21A 3MV11 2EC9U 1CL7L 2YQBA 1A02N 1GMIA 4DESA 4HIXL 4PG9B 2XZAH 4K7PH 3FUIA 3T3PE 3OKKA 1IKFL 2A9ML 2PCYA 1CT8B 4JR9H 4N8VA 3N6YA 4PJHB 1QSFB 3FCGA 3MYJA 3BIBX 3OKKB 1J9TA 1JGUL 4O51B 4Y5YA 3WMQA 5C09D 4OF5A 2LU5A 1CZ8H 4Y4FD 3L7EA 4HCIA 2JV6A 5CN1A 5C0BE 4L18A 5HHQB 1PZCA 4AGPA 5D7JC 2EC8A 4PRHA 2I25N 4X7DC 5HVGB 1XGQB 1CDYA 5BVJA 1QTPA 5EBWB 4F37K 2X4SA 4QJ5B 3KW8A 4XPFL 1M1SA 3FK3A 5C9JB 1PX8A 2X40A 3MBEB 1M3IA 3O41B 2PP9A 5DUJA 1KJ2A 2LV4A 4GSDL 4XBPA 2QDVA 1NH6A 1ULVA 3VI3F 1XH0A 2YPLE 4NT6A 4MJID 1DVFC 2KZKA 5F7DA 1TR7A 5TK4A 4QKTA 1U8NA 3KLQA 4IOSD 4LIQL 1EEYB 1A4BA 2BRQA 3BUDA 3FB8A 1UXMA 2WSPA 1UA3A 1ZT1B 3MV8B 4GO9A 1IGIH 3BD3A 3SGDH 1ZS8B 4F27A 4DQOL 4MGXA 2HLFD 2OYMA 5MENB 1CDIA 5JXAL 3TEYA 3FTVA 1MCHA 5E99H 3S5YA 3L3JB 2Z4TA 3CFMA 3KL5A 4F9PA 2UUDH 3QWQB 3TONA 4PW4A 4N68A 5LG1A 3MFGB 3BYTA 2BWQA 3B7RL 3TH3T 5I82A 2ZYSA 3N1FC 5HDRA 1MWAH 5EOTA 3QEUA 4YXKH 1HI6A 5DS1A 1MCLA 1XGUA 1BYPA 3FQWA 1FFOB 1U4FA 4BFIB 2H1PL 3V6ZB 2DQUL 4ZZFA 4V1DA 2VL4A 3LPWA 5ACLA 1TZ8A 1O0VA 2O4EA 2WSDA 4WLCA 2BS8A 4P05A 3CLEL 3CZFA 4B7LA 1CICB 4G7QB 4GXFA 4PRBB 3MMEB 3WAKA 5K1VA 3BAIA 1AQKH 2AXFA 3CIAA 3BPNB 5I1GH 5HYSG 3QYCA 1NCOA 3RDTB 1UXSA 2B8OT 2DQIH 4UB0L 3J7HA 2C8NA 6TAAA 2R0ZL 3CFIC 4EUPA 1MEXH 3BZEB 7TAAA 1AO7B 3ZY7A 3AS0A 3UGXA 5GSRB 5IFAL 4OIAA 3F64A 2DH2A 4M5SA 1RUQH 3WIAA 2XNAB 3K2UH 4P2OB 5F88B 4QOKE 3HC3L 3A3YB 1JZ3A 1PX3A 4E41A 5AYTA 1CFBA 1NFDB 3KCPB 1N70A 3MJ6A 3CDZB 4WWKC 4HUWB 1RJCA 1UB6A 4E41B 3U9UB 3MJ8A 4M61B 4G11A 5KVEL 4ABWA 1TNMA 3II2A 3GO1L 3CFBB 3KPSB 4FYTA 5H4YA 1UD5A 2EDFA 2UYLB 1OWRM 1MCBA 4M93B 3O0RH 1DP0A 2J55A 5FFLA 3RVXC 2TSBA 3WFBH 3ZKMC 1RMFH 1VEPA 3ETTA 3HE7A 4PR5A 4OVVA 3KDMB 3FB6B 3VQLA 4GKOA 3MO1A 4IRSB 2ESVA 4N6QA 3VXMB 3K8KA 3ZKNC 5I76A 3U6XS 1CT8A 5F7AA 4B9PA 1KCLA 2EDLA 1J88A 3WTYA 2B4CL 4NX0A 3N85L 4OT1L 5E8PB 2A0LD 1TQBC 1P53A 2NPLX 4KY1L 2APFA 4TSAL 3UTTB 4DVRL 4G3YH 4MCZB 5D1XD 3FQ1A 3MLXL 1J5IA 2BP0B 4JAMB 1P4BH 1OCWH 4JM4L 3OMAB 3DJRA 3CHXA 4L9DA 1QFWI 1W2KT 2FRGP 2JQAA 2KZBA 3U7YH 1P9MC 1P1ZB 3PHSA 1KF9B 5F44A 3G3LA 3GRGA 4JN1H 3L17A 5D7JD 3B1TA 5CXPA 1U6AH 3D05A 2YXMA 3DXAE 5D1QD 2QKSA 4BZ1H 5IKCB 2NNAB 1FP5A 2VJ8A 2ODHA 2YKKA 5JHLA 3M46A 4LE8A 5SX4I 3VWJB 1NGWA 3ULVC 5DJZA 4MDJB 2NY4D 3V0VB 3ULVF 4I3GA 5I5MA 1G7HA 4YHNB 4ANVA 2CM6A 4HOXA 4BM7A 4BH7B 3QJQB 2X53A 2Q20A 3FCTB 3V5DB 1OARL 3GBNL 3HI1B 1RIVL 4NYLA 4YZFF 2PYEE 1T3FA 4Z76B 5CU9A 32C2A 4JG9A 2G30A 2X89A 2DQJH 3HNTL 4Z7NF 1NCWL 1TTCA 5AZ2L 3IXTB 5IW1B 3ULUD 1H5BC 5AKTA 1ZDSA 3QAZB 5I74B 1QHOA 2AKRA 1RUAL 5GRUL 1FNGB 3OKEA 4L05A 1SHMA 2VDPH 1GKOA 1M7UA 2F7RA 4HZ1A 4YZFE 3ZRFC 3SGJC 2UXGA 4NZFA 4AJYV 4MX7A 4RETB 4HLZG 4QY8A 2FATH 1DVFD 4QOKA 5AL8A 3SY0B 3A4EA 4LNRB 1HILB 2O1AA 4XWOD 1H8LA 2J5LB 3VFRB 4I18B 1QZ1A 3DJTA 1GYCA 1QRNB 4YUEH 1KXTB 3VQ1C 1RZ7L 4KK9C 5IBUB 4YDZA 4JG0H 1G9NH 3MV01 4K73A 1BBDH 2ALAA 2O6CA 4PRPB 1T1WA 3FOLB 2WCPA 2FUQA 4I3SH 3VSVA 1XGRA 1ZXKA 1WBYB 5BRZE 4PRPA 1G6RA 4XH2B 1BXAA 2HFEA 4PMEA 1CE1H 3HN8A 1R5WA 4L4VD 4XN2A 1H5BA 4IBUA 2WUCL 4PYHA 5IHUL 1EO8L 5EF2A 4W93A 2X4PA 1A3RH 3D85B 4R0LA 4S1RL 1MJUL 3N91A 3MREB 4L4TB 4X8JA 1AIFA 4E9QA 4NO5B 1KGJA 3U9UA 1GR7A 2CGYA 3OR6B 1QSEE 3VI4F 2ZOWA 2QGEA 1V55B 1A22B 2AXGA 4FJYA 4HK3N 4L1BA 1JBJA 1HVXA 5IJVB 1T0NA 2P5EA 1JUFA 2QHRL 5M94B 1FNFA 2DBLL 5HYIA 1MVUB 3WNPA 2R0KH 3PWNA 3QFJB 4AQEA 4EZJA 3WFDH 5TE4L 1OIOA 4HWEH 3GS0A 4RMBA 4YFLI 4RMWA 1YEGH 1DJWA 3KJ6H 2WAHA 4HIHA 2G5RA 4Z18A 5T5FH 1CZ8L 1Y1DA 1EEZA 3UG4A 3ES6B 3QA3B 3UBXA 3D0AA 1HHKB 1V3LA 5A6IA 3B43A 3EJYC 5DUMH 2F7IA 4HIIA 2XRAL 5KEZA 1XGPB 1RMFL 1WAEA 3S37H 4HHAA 3FTXA 5B38G 5I18L 2IBZY 2VR5A 2JXMA 5HP5A 4KI5D 3LDBC 3BLPX 3FQXA 4IGBA 3L4ZA 1YEHL 5GGVH 3IF1B 1KJMA 3MRCA 4JO5A 3GPSA 4GP4B 4UV4L 3EYSH 4XZUB 1FJ1A 3V5HB 5KVFH 4MMYA 3OHXA 1MH5A 5GS1B 1NAMH 5F7HA 2YD7A 1OCWL 3U82B 5C09B 4Q97A 2WYZA 5T3XE 4BUQA 1BF8A 1V27A 1RK1B 3ASNB 4KX9A 3ZE1E 2NY0B 4HOMA 3ARGD 4OKDA 4TQ8A 3VXOA 1M2VB 1PPIA 3P9MB 3PJNA 3MRNA 1OVZA 3F12A 4XPGL 4MXWL 1AXSB 4ZFGH 2YMOA 3LEXA 3MRJB 2HLFC 2NQDA 3TZVC 2EKSB 3AS3A 4L9LB 2BVTA 1HOCA 4KC3B 5KVFE 2XKUA 5IW1A 2Y7MA 4B95C 1TO5A 4U7MA 3TCTA 4YHMH 1T1YA 2YMTA 4NQCB 1JNNH 2NTSP 1JS4A 3R19A 3CDCA 3LPFA 3PQYE 3B8SA 3FH5A 1MAMH 3FT1A 4PTUA 3MSPA 5I74C 2DQDH 2O30A 4JL1A 3IN0A 4EIGB 2H26B 4HUKB 4X6FA 4HUWA 2A9DA 5FYJD 3QEGH 3TGXA 5IEHA 4H0IA 4PJXF 3FFCA 3G6AA 1VDGA 4XN9A 1L9MA 1A7OL 1FNAA 4XBEH 2D4FA 3C5SA 3ZN6A 1SJHB 1IC7L 4I18C 5D7JA 1FZJA 3PABB 1IBDA 1R0AL 4YDLC 2CRIA 1E6OL 4W81A 3S48A 2X2JA 3LZLA 2ZAIA 1Q0XH 2OMZB 4FZ8L 1U8HA 3DX6B 4P2QA 2E4TA 4R84A 4XPFH 5EPMA 4HJEA 4J6IA 2NTFB 2WZPA 4YUEL 1CVSC 1ADQL 4WV1C 5ENWB 4AJ0A 4CMHC 4Y19B 3T0ED 1NGQH 2X4PB 4IIQA 4JO3H 5DSCB 3HVDA 1QRKA 4KMTL 3H9ZA 1OAQL 1J0YA 3CSFA 5HJ3B 3QJFB 3SE8L 4DPBX 4FZEL 4XMLH 2TRHA 4CJ0A 4F2FA 5C0ND 1TZHA 4LF3B 3UIZA 4OLVL 2GC7C 5DVLA 3L1FA 5L0QC 4FQHA 3VI4B 2AV7A 3PGCA 2EXYC 4FNUA 2VL5A 1JV2A 5J5EA 4B9YA 2CSPA 1CD9B 2OJEB 2KZ1B 3UC2A 4F2MB 4XPAH 3LRSA 4GFXA 2H6PA 4J3SA 4PN6A 3RWIA 5ISZD 4MSWA 1KBWA 3LVTA 4D0CA 4KVCH 4Q58C 2ZOLA 4TSCL 3RY6A 4CADA 4UQ2A 5F70A 4M93C 5BS0B 3D4GA 2V6HA 4HV8B 4YLBA 2W9LA 1VRSA 4NJAH 2ESVB 4DP6X 5F9OL 4FMKA 1A65A 4JDZA 4G9DA 1LTXA 3Q1EA 5AAMC 1YLBB 5FGBA 1ET5A 1LD9A 2FECL 2GJ6B 4HUVA 4HWBL 4WO4D 2BNUB 4AYSA 4X50A 2R0KL 2H3XC 1AP2A 4JRWA 4KOCA 4AL8C 1M7DB 2AJ3A 3QIUA 5D5ME 1GJIA 4KJQD 5B1BB 2IH9A 3O41A 1ZANH 4WNJA 4HPOL 4JFZH 4PRPD 4E9RA 1NGXA 3MLYL 3RWHB 3KW7A 1SDYA 5I1GL 1OLZA 4LSPL 1YN6A 4XAWL 5IHUH 1KC5H 3WKPA 5AW0B 4JN2A 4KKQA 2HG5A 1MRCL 5C9JA 4L4VB 1DFXA 4Y9CA 4BBWA 5FECB 4Z1PA 1L0YA 1MRDH 3WSQL 1MXGA 1E4WH 4QRTA 1HZHH 2VXSH 3BC9A 3P9MA 3VG0L 1HH6A 2Y6SD 1T0OA 4YFLF 1PSKL 4OIIL 5IROD 2XBTA 8PAZA 1DJSA 3QGVA 2R1YA 2D7OA 5E2VH 1X44A 4AEEA 4UTAL 3SPVB 1F3DH 1K6QL 5AWNH 3ZVVA 1BEYH 2B39A 2IWGA 4CN6A 4OCYL 1E3FA 4JPIB 5FA4B 3ZTNH 4G1MB 1KTDA 3ESMA 5ID1B 5KAQG 1O9VA 3L95A 2G75A 4WFED 1MWAA 2Q6WB 4F9PC 3SDYL 3I84A 4UBDD 1XL4A 3APDA 2GT9B 4HF5L 5I8CB 1JZFA 2OMYB 3ZMRA 3O2WL 2WM0A 1HZKA 1R1CA 4KJPD 5AOLA 5AZUA 3MGTA 2Z8RA 3V9CA 3ARQA 3QIBD 4GW4B 2O6DA 1Z3GH 1UM4L 1VADA 1ZTXH 4Y2DA 4MLIA 4OLXH 1KELH 1GS6X 1J18A 1XGUB 2AANA 1MELA 3V52L 1O6SA 3KNBB 4EDWL 2AVGA 4HC1L 4QNPE 2OBGA 3EYSL 2DQJL 1IBGH 4CSSA 3TJEH 5MI0B 2WVVB 5HGGS 2HYMA 1GGCH 4KK5C 3TA3A 1CFNB 4HFWB 2C4FT 4WFFD 5DJ2B 4MVBC 4AL8H 4N2CA 1BJ8A 2BSDA 3PU7A 1MJ7L 2R4RL 4RAVB 2VDOH 5J06A 1HTYA 3B3IB 1U95B 4L5FH 5K59E 2EVJA 3Q5YA 3FNKA 4G7RB 1A6UH 2NCEA 2DQTL 4HJ0C 1NCJA 2PWGA 4GS7B 1FYHB 1J9SA 2FQFA 4JHAL 4HPYH 1TYJA 4HJUA 3RBGA 1FNSL 3NEXA 5B8CC 3CZJA 4BH8A 3IS0X 5LGYA 3DUHA 4YHKL 4O2FB 4A7TA 1EAJA 2FHFA 5D72H 1DR9A 3ESNA 4AQ1C 3VD4A 4PRHB 4Z5RA 4P5TD 2DQFA 5ANHA 1S7WB 4PTTA 2OKMA 4Y16A 4U6XB 5DA4A 5IB3B 3B9AA 3WY1A 4YDKH 4K7PY 4OGAD 1LE5B 5KSAB 3OKLA 3U6XA 3VRJB 4ZUVA 4U05A 4PSRA 5DRXA 5T5FL 4ANWA 2O72A 2FYYA 3CHSA 1KCBA 3R8QA 2WXLA 3OZKA 4ZPTB 3IPBA 4Z23A 5IMLB 1DVXA 2VSKB 5B22A 1OHZA 1LO2H 3Q48A 2IPTH 1N6QL 4MBRA 4PR5B 4M3HA 3PLYA 2OFQA 4E5XG 2YGVA 4ZPTA 3P30H 1LP9E 1ML0A 4G9FE 4HKZA 5CLXA 5AW3B 1HIMH 2EICA 4EN3A 5C0BD 1YECH 2CDEB 3T6XA 2RMNA 2G4GA 1IC5L 2ZZUT 5DVKA 5HDQH 3KWTA 3QG6B 4X6EB 1KFGA 3EOBA 4FI6A 3QH3B 1JPSL 4IEFA 4PGJA 4LHQB 4PV9A 4XPTH 3RB7A 1NGQL 1YYCA 4JO3L 4YBLC 1OSPH 4LCIH 2VR7A 3QHFL 2YAHA 3ZZSA 3U36A 4HLZH 5LAXB 2E7MA 3QPXH 4HD9A 5CJQH 2UXFA 5IREA 2VUYA 3L3OA 5A2KH 2A9NL 1YQ2A 4JCMA 1F45A 3NCBB 3D9AL 1ZANL 4N0YH 4JFUA 3CDGB 5BMFL 1KNOA 1A2YA 1CTNA 5D1ZD 4L3EE 2UX6A 4PJAA 1INEH 3E6HA 4AT6A 2YN5A 3EW3B 2XWTA 4MB5A 3AMKA 3OB0H 4N2NA 1THCA 4KY2A 4BA0A 2KS0A 4BSWA 4J39A 2K4AA 4WUUB 1F42A 2HLEB 2WAQA 4PGBB 3ZL4H 3X3FH 3QUYB 4V11A 4HS6B 4JCWA 3ARGB 4ZMNA 1FE8H 3OX8B 4P3DB 4IW4C 2MCG1 1NCDH 3CK0H 3UH8A 5ERWA 2J88L 1R6VA 4JM2B 5IM7A 2BC4B 2G9HB 3CE1A 1GZHA 2ZXEB 5D2NA 2W0FB 3O6FD 3RA7L 1E2ZA 1TZIA 4UNIA 3ZTNL 4YWGL 1DQLL 5L8LB 4R96B 5IM7B 3GIVB 2XG5B 3FCUB 4JFZL 4WV1A 2DICA 2R9HD 1BPLB 4HUCA 1R3IH 4Q0XH 3QR2A 3VACA 2X05A 3S37L 3HZMB 3VFRA 1T89C 2MOVA 5HHOA 5IGXH 4UF7C 1S7UA 1F11A 1KB9J 2B14A 3P0YL 5AKVA 2CHZA 4BDVA 4D7BA 3BO8A 4MB3A 3QXDA 3K8LA 3CFBA 3KPSA 4L1TA 1MRDL 2PWFA 3WSQH 4I87A 1RQ5A 2H32A 1KJVA 4UIMB 3CZNA 4JZJB 3MCKB 3ASWA 2DEWX 4IJTA 4PJHF 2D7TL 3X13A 1Z6JT 1BJMA 2EE0A 1YEIL 2WBJC 2YBGA 1P5VB 1Q94A 3KPLA 2X6BA 4G8GE 4HIEA 4X7EC 4ZMTA 5AD0A 3M6DA 3RE0A 4M7LH 4K7PL 1IAII 3RI5K 3C8KA 1KCUL 3P73A 3NSCA 3DHPA 3OZ9H 4QRQA 1AE6L 4ZS6C 4MAUL 3GBMH 5I5JA 2P47B 2CHNA 2VISB 5DLML 1QLRB 3U46A 1S8DA 2GITA 3CFJA 5I66A 3L7EB 3EH3B 3DARA 4U6XA 4WENB 1NFAA 3MI6A 1LEGA 2OMVB 2RIKA 3PHOA 4NQSA 3QPQC 3CC5B 1JDAA 3GMOA 2C5DC 4XTRC 3VYOA 1MLBA 4UV7H 4ERSL 2OMXB 4F2EA 3I02B 1QATA 4JHWH 2OMUA 3JV6A 3PWPE 3LRSB 3DX8A 1I3UA 1A4JA 1WA0X 2BFGA 3I6LD 3QA3A 3UBXB 1A0QH 3LH2L 5LJYH 1RIHH 4UQ2B 1JNHB 1NC2B 3C5ZC 2AEPL 5I6MA 3CJJA 2NZIA 4QLRA 4EN3B 1J5CA 3E2HC 3MA9H 4PHXA 4R7NB 3MXVH 3QORB 1N8ZA 4FG4A 5J0BA 4BFBD 4UQAA 3HMXL 4N1HB 4N90E 4X9FA 8FABA 3SDCA 3RKDD 1U8CB 5E9DA 1KJMB 2I85A 2YIHA 1MQ8A 2DV6A 2W60B 5DYOA 5DURD 1X4ZA 4DGIL 4NKDB 3OHXB 1ZTMA 2HT3C 2V0AA 5IHWA 1I7TA 4K8RD 1SFDA 4XI5C 3HG3A 5EULV 2X2UA 2R0LL 4G42B 4Y9GA 5D55A 1NLBL 5DYOB 3V8CA 1CLOL 2VXQL 2FAUA 4M6OL 5AVTB 4ACTA 4MS6A 2X1XR 1ADQH 4B97A 4N0UE 4KXZH 1LO4L 1KGXA 1TJHH 1YRKA 4QEGA 4ZQKA 3AREC 3DI2B 1MJ8H 1Q8MA 4LLQA 3P4NA 1UOLA 1LO3L 3KPPB 4PV8A 3QIUD 1JNLH 3EJPA 4FLOA 4AQAB 4FNPA 4Y19D 5DUPH 2QQKH 1IILE 2FNBA 3QRLA 2WXNA 5I16B 1URZA 1B4RA 1LWRA 2IDTA 5C0CD 2DY2A 3D7PA 4JHVA 5D8JH 3DUSA 2EIMB 2V2XB 2CCVA 2DL2A 1E4HA 4RGNE 3GI9L 1F4XL 4OD1L 1XHHA 2AEWA 2QFPA 3WGUB 5DD1H 2CMRL 4UQBA 3S5LG 3U30C 4NUGL 4PTUB 1E4XL 3MACL 4DP4X 4J6RL 3FRUB 1N18A 4Q2ZB 2IF7A 1XH1A 4FFYH 4KGLA 2W0FA 2WWKT 3EHBC 3WNIA 1E27B 3EF4A 3WIFB 3MLUH 3GYRA 5CZXD 1ROCA 3GIVA 1ASOA 4BHUI 4DUWA 1IFGA 3RVUD 4I0KA 3FTWA 4HH9B 3K6SA 3QO0A 4M61A 3VWKC 2YBRB 1L0QA 4UTAH 1YCSA 2J1ZA 5F88A 4YR6A 4R0LB 2DLEA 1EDHA 1NCDL 1JZIA 1SVBA 1DJYA 4R3SA 4LLDA 4M4RA 3L7FB 4N0FA 1S5HA 3FCSA 3FU5A 4R0LC 5CS7A 3S34H 4APQC 4GUOA 2UY7A 4ZX6A 2K45A 3G04A 3WHXB 1MXDA 1MHEA 2VE6A 3MLPA 3C8HA 5DK0A 1L6PA 3IJ7A 1ZLDA 3V0GA 2F5BL 2Z7WA 1J05B 4HKZB 2JF1A 1KN4H 4O58L 3HUJB 2VO8A 2XYCA 3MLTB 1RZGA 3OL2A 3Q9QA 3SOBL 4BJLA 4A55A 1RL1A 4GSDH 3ILQC 3UAEA 5JR1L 1ZMYA 2XPZA 5K9KA 2AZAA 2A74C 1K3ZA 3C60A 3HRZA 2G3MA 4OIIH 5HYJA 4DVRH 4Z7WA 3RL1A 4OJFL 1RERA 5E0FA 2CRZA 5C0EA 5L4JA 1HSAB 4XVJL 4XXWA 5KBMA 1VZGA 3MGOA 4HW6A 4NBYB 3MCYA 5I15L 5CCJA 5I26A 5BQDA 1JG9A 1YEEH 1HS6A 3PNWB 4HETA 2WBXA 4DP7X 2K7PA 4JQIA 3TVMB 1KIRA 4PWHA 5I19L 1XF2B 1ZVSA 2NY2B 5JW3H 4NFDA 2F0CA 1EZSA 1I9JH 5BOJA 3MZGB 2HH0L 4PJAB 5J1TC 2ZXWB 2P5PA 4I3RH 4TLUA 2F1EA 1WUZA 4FQQA 5IVOA 3VWJA 1ZS2A 4L3CB 4X5PA 1G7LA 4JRYA 5JYMA 3ZJAA 4XC1H 2MEJB 3QIBB 1A7QL 2VDNH 2C1PB 1BD2E 1MFAH 1N8OE 3BVUA 3RWEA 2EDEA 2OMTB 2CLVA 2X9YA 3ZO9A 3W5MA 3NIFF 4X4XB 3ATEA 5E5MA 4QLWA 5I1HL 2LTQC 1BX2B 2A83A 1OSPL 2MQGA 2XY2A 1MIMH 4LCIL 5FM5M 4L0PB 4XXCC 5GGQL 3W0WB 4X6EA 1JZEA 2YRLA 4OIFA 3BUPA 3O2VH 4A7QA 4YHPB 4HCGA 1KIPA 3KWWA 4IEFB 3GGWB 2ERJB 4K23L 3DLQR 5H8DA 4JFXB 2AKRB 4YQXH 1EMTH 2G60L 1CIUA 4AUYA 1Q9LB 3QHZL 3TO4C 1HHGA 4QHNA 5IT2L 1R46A 2OTWB 4LGPB 1E42A 2H26A 4HPYL 3P4MA 2BSED 3HMWL 4OZIF 2EINB 1LO5A 1GYVA 4L3AA 4YHLH 1D9KB 1W9XA 1WT5A 4GLRI 1T1ZB 1N2RA 2ED6A 4L29B 4WCYH 4M62L 1KXTA 2Z1PA 3K6DA 4A38A 3P69A 2DF3A 1JXFA 4BKLA 3UEQA 1RUMH 4GKZA 1UB5A 2OCCB 1INQA 4N6RA 2PCXA 1F90H 3RGHA 2B5IB 1JE6A 1VENA 4FDWA 5HVHC 3DURB 5DWPA 3VSQA 1KV3A 5F1NB 1ZLSL 3R1GH 1ZLWH 5FYKL 4UNUA 4LZKA 1JGVL 2NSQA 4F5CE 1NC2D 1MCJA 4X83A 5BRZD 3QUMA 4TS6A 1Q0YH 2P5EE 3MODL 3MRMA 4OM0L 5FGBC 3RTQD 3X1FA 3BT2H 1G84A 1WD9A 5DD1L 1FL3B 4U6HA 3ECVA 5I1CH 4GW4A 4XAKE 1LEGB 2OMVA 3LXBA 3CCHA 3HBGA 2OSXA 4PWFA 4ISVB 5K93A 1S5IH 1UT1A 2GHZA 2JNZA 2YXFA 4GH7B 4KY1H 1S7UB 3GB7A 2X2HA 4GRLB 5SWSE 2ZXQA 1UD3A 3FB6A 5GIRA 4Y7OC 1CFNA 2COQA 2ESVE 1KDIA 3I3DA 3LXCA 2QEJA 4UMGA 3S4SG 4Q56A 3MMEA 3BJLA 1RI8A 3IGAB 3GXDA 3UFIA 3AQDA 1MCWM 5EDXA 1IJNA 1ZXQA 2WUBH 3AQYA 3DVIA 3KYMB 1R3HB 4HIIB 4JN1L 4XT1C 2GEEA 1OK8A 1QSED 2I69A 3KVQA 2F7OA 2AS5M 3NFSH 3JUZA 4E36A 1U8KB 3IWVA 4K9EL 4DUVA 4HUNB 1MSPA 4Y4KA 2RJMA 4B9JA 4AKPA 5KN5A 4FC3E 4AM0Q 3EHBB 4BZ1A 2AGJH 3TS8A 1J1PH 4TMPA 3FPYA 3MXWL 4FNLL 1L7IL 2CNYA 3BX7C 4P2OA 1GS7A 2E9BA 2X4TB 3ISWA 2CA4A 1N4XL 2DWDB 1O9ZA 1XCQA 3O2DL 1N68A 1OARH 3GBNH 3D18A 5LGJB 5AKSA 1MW1A 1RVFH 4A7GA 3AUWB 4JFVA 2ITEA 5JW4M 5LNEA 2UWEF 4H8WL 3FS9A 3CC5A 3GMOB 2BNRB 4GYBA 3ZT5A 5EBLB 5DS8A 4LSVH 3MUJA 3RVVD 3WD5H 5A40E 4Y5XA 2VRKA 4EXKA 1DVFA 1TXKA 4BCXA 3D07A 4LBEB 1NINA 2IH8A 4MNQB 1N5YL 5EEUA 2JJTA 3SOTA 3RPBA 3MLZL 1QR1B 2UWEE 3VG9C 1UH3A 4EEEA 2BZCA 4ZFOL 3BUYA 1YHPA 2QJDA 1K4DB 3HS0C 1MFMA 1CLZL 5ICYB 1IQDA 1PLGL 1QA9A 3I2CL 4MAYB 2K0RA 1E9OA 2BP0A 1NKOA 1SUHA 3MRFA 5KW9H 1I9RL 4PLJC 1GC1C 5I73C 3L95B 5GRJH 2R0WH 2XIIA 5L8JB 4IRSD 4ZUTB 2AEQH 4RWYL 3A4DA 1XD1A 4GRWB 2X12A 2XZQL 1N59A 4ZNEA 4K3JL 3W37A 2AEPH 1G7QA 1T1XB 4LLYB 4NM8L 4RFNC 4W4NA 1JZ7A 1NIFA 1QHQA 4H1LH 4JY4B 4Y9BA 5GGUB 1EX0A 3K0YA 1QYGL 4HWNA 1KCUH 3KL0A 2YGPA 1R5VB 4NC0B 1W80A 3QEGL 5CUSH 5EN2A 2OZ4A 1YEEL 3NZHH 5B39A 2DIJA 2IC2A 5EUOB 4XP9L 5AOZA 2EP6A 2XVGA 3D34A 5BZXA 5DK0B 4UUJB 1BGXH 1XBRA 4MWFA 1F3RB 3HZYB 2J72A 2CPCA 4JFWA 1SDDA 4XP5H 3DHJA 1DLHB 3CFNA 3HC4H 3JWNC 4POZC 4Y5YC 1A6WL 3VXTB 2ADIA 1DQDL 1M1XA 1XGRB 1JSYA 3FO9B 3QEQE 1QPKA 3PL6C 2VZVA 1F86A 3GSVA 3AG3B 3VWJD 1E4XI 1K8DB 2CHDA 4PGBA 5AVRB 1GCFA 3D51A 5FK9B 1FRGL 1M9WA 4MJ5B 2CIKB 3OKDB 3CDFA 1AO7A 3KBHE 1OSZA 3R7QA 1CGSH 3JXAA 4R97C 5FUOH 5GZND 4BK4A 1KIUB 5AZ2H 3S3SA 5HDBF 3KPRB 1AIFB 1W91A 3O8XD 4AK1A 2BSSB 1AOHA 3NP3A 4X7TB 1BW8A 5DSCA 1H9VA 1XAUA 3VSTA 5ID0B 3BP6B 2C26A 3B5GA 4KNTA 3W9DB 1COBA 4NAMA 5I30L 5DVPA 1QFHA 2XQBL 4CKQA 4Z7UA 4MRCA 2GW5A 3MKKA 2VOTA 4IU2B 4XRCB 2X70B 3UP1A 5C0JA 5BS0A 1MFCL 5DJ6A 1ZLWK 1SOSA 4HBCH 5D5MF 4IU2A 4H44C 4I7ZC 2ATPB 5DC4B 4AC4A 1E7UA 2WY3B 1BZ9A 2ATKA 4LLWA 1ESOA 4XNDA 4H2AA 1EEZB 4XMWA 1KEML 4DKEH 5L4FA 1QWNA 4WFGD 3IFOB 2JVUA 3VD5A 1QRND 3H7BA 4KQ0A 4PLKD 3Q2WA 2X6AA 1I4FA 1PYWA 5LN4A 1OB1B 4ES9A 2ZXDA 3CVHA 2CO6A 3FZUD 5DD5L 3AQZA 1N0XL 1R3KB 2AI0H 4XVSL 4PJBF 3NJXA 3IF1A 5MEOA 5D71H 1J0JA 2IFFL 4PJGE 2EEBA 5KVGH 2IJ0C 4LKCB 1AJ7L 4WHCA 2X2YA 3FU9A 2GCYA 1F6AB 5EO1A 1JK8B 4MQTB 4P4KD 1JGEA 5DCCA 4F37F 4R7DA 4AGLA 4HC1A 4M7ZC 5LBSL 1KN2L 5IMOB 1GY1A 4HJIA 1KMGA 2ZKHL 4AENB 5BRZB 5J11C 3MTRA 4UTBH 5KYNA 1GXEA 2XC8A 3RUGE 3D85D 1BFVL 3E6FB 3I02A 4PJIA 5KYYB 2CR6A 4AXWB 1QLEL 4XNXL 5FM5O 5HYJD 1QR1A 3B5HA 3QAZC 1E28B 4XVTH 2AQRA 3RNKB 2HTLD 3FXIC 3JWOL 3P3RA 1NAMB 3QI9D 1U93B 1BVZA 2BW4A 1SMAA 4WWPA 5DYFA 2VSDA 2ZSVB 4QO1B 3RFZC 4M3KB 2QQNL 2E9GA 4PJIE 3VXRA 4YNYA 5LGHL 3H9SD 1QSEA 1N5YH 4MNGB 4ODTH 4M1CD 4IGBB 4P2RD 4JB9L 4NKDA 5I1IL 4GG6E 3PJLA 4PP2A 1RJYA 2BHUA 3APFA 4FYQA 4YXLH 3HMWH 4ZX3A 4NPYB 1IGTB 2LFEA 4YDMA 5LBVA 2CO7B 1NQBA 5I18H 1DUZB 4XNMA 2ZICA 4WJG3 4PJXA 4K0OA 3O3EB 2N1KA 3OAUL 1FFOA 3SE9H 3C5SB 1CN4A 5BV7L 2A2QT 5TDOA 5E51A 2V2XA 2XN2A 4AV5A 5L8KB 2HFFB 3ZE1F 1UOVA 4GKNB 4NQUA 2X9ZA 2SEBB 1SHXA 4YBQC 3MV9E 3BO8B 2Z7UA 3C8DA 4NP4H 3K7UA 1CICA 4IBTA 2O26U 4KO5A 4DIXA 4MD5A 4OVUA 3H53A 5IK3A 1J12A 1SM3H 4E9WA 3BUIA 3MLRL 1D6EA 4EO5A 3PL6B 4TL4A 4HIQA 3CFDA 4X7FC 4YJZL 5DMGD 5E4IA 3KE0A 4RBPK 5DD3L 1CLZH 4OIBA 3CDZA 2WN2A 1XCQB 1KTJA 1W6LA 3DBXB 4I2XE 4QRAA 5DJ0A 1DQVA 5EU4A 3VU2A 4FQHB 4GXVH 4APXB 1MNUL 2RFXA 2VLJB 3LZPA 4J4PA 2DQCL 4NN6B 5DJ0B 3ALXA 3BH8B 2YMXH 3IJYB 4F7KA 3IJ8A 4X9IA 3EBIA 2IBBA 3BKYL 1A9BA 2PWDA 5MP6H 1YDPA 2PN5A 1MNNA 1BMWA 1BP3B 1OGAE 4LLDB 4GRLA 2ZOKB 1UXLA 4DGVH 1EERB 2B59B 5MERB 1GJUA 1MUJB 4QRBA 1EHNA 1A4JB 2YLKA 4JFDD 2AQ2A 5I30H 2BNQA 2MQ0A 3HE7B 3RU8L 2ZT9C 1EHLH 3S2AA 1AZVA 5GS0H 3L5HA 1N6QH 2BNUA 5HI5C 1FAKT 4EBQL 4PJBB 1IQDB 5C2BL 4YPJA 43CAA 3AXLA 3KWUA 2ZQKA 1I8UA 3B9KA 2K70A 4UZUA 4KHTL 2I7OA 1WWAX 2D3VA 4QRPE 2OXGB 1AACA 3MRBB 3Q6FB 4QHKI 2P8LA 4RFEB 5IB1B 2PPDA 4MA7L 2F8IA 1JPTL 4UINL 2A5UA 3WE1A 4YDNA 3IKCA 3OQ3B 5IMMB 5C08D 5TF1L 3IFLL 3DOHA 1DCLA 4G8EA 4K7PX 3V5DA 5D71L 2EO9A 3FBQA 5I6PA 1UZ8A 4OUUA 4YDIH 3NCJH 2EEDA 3L3OB 4NO0A 2C1PA 5D7EA 3BKCL 4PP1D 4FFVD 4OF7A 1B9ZA 2F74A 4MDJA 2CLRA 4P23C 3C6LB 4HV8A 1AR1D 4LOFA 4G1EB 4H0GA 5DJYB 5I1CL 4DK5A 2DQ6A 5JPMB 2ZX8A 3QCTL 2NDGA 4BK8A 4M8QA 1VSCA 5HDBB 4CGUB 3B7TA 2D8KA 4RESB 2F54B 5D7IA 4LRNH 1WFOA 4RWYH 4U3XA 3FRPA 4TPRH 3SGKC 3K5RA 1PZSA 4MAYA 3ARSA 2XA3A 3GSNB 3P3UA 1JZ6A 5I9QC 2C4FU 1TZIB 2OW6A 4DN4L 2E86A 2NQCA 1XH3A 2WD0A 1EDYA 3WBDA 2QL1A 4KQ4H 2YUZA 5D7SH 5L6YL 1AYOA 1C7TA 1MCOL 2E9WA 4U49A 3CXDL 2GSIA 5T33H 2ZWNA 4QXGH 3SQOH 3JZ7A 5DQDH 1MRFL 4D9LL 1BGXL 3O3DA 4Y19E 5IBLC 1LK3H 1CE6B 2WJ7A 2WB1A 1H19A 4WY7L 4DTGL 2KC0A 4R4ND 3D4ZA 1OGSA 3PV6A 4BKLB 1UEYA 3UTSD 1XSJA 1ZIBA 5F7KC 2O61B 2F5AH 3LRGA 5CKGA 5F89A 5J13B 5GGVY 4GO8A 3UCRA 1BBJA 1GHFH 2OA9A 2B15A 2UZIH 2ZXGA 4O5LH 3SGJA 2R1XB 1JF6A 2OTPA 1N26A 3V6OA 1LWHA 1PCSA 5MEQA 4PLKC 2HB0A 2E27L 3NVQA 3O45B 5EUOE 5DGQA 3MLWL 4U1NA 5CN2A 1I8MB 4EI5D 2YKLL 2O6EA 3HA0A 4MJ5A 1IFHH 3ARRA 4U6HB 5I8CA 3AC0A 3ZE0B 1NBYA 1YVLA 4AY0A 1VKXA 3MGTB 1DVSA 2X4SB 3MV7A 2EDJA 1TQUA 4UWQB 3UAAA 1CBJA 1ZK9A 2LHAA 2BRRH 2XXCB 3RL1B 4Z7WB 3MNVB 2BHYA 1JZHA 2ICWJ 1XVSA 2VXTL 4XPBL 4R7DB 3GC3A 3MOBL 4X8JB 1NBQA 3FTUA 4YVNA 5F7WC 3H9SB 3B34A 4A7VA 5E03A 5I66B 1CTOA 5FYLD 1ZTXL 2XWXA 4WU7A 2FL5B 2R0WL 2WWMD 4R5XA 4Q6IC 3T3PB 4QAMB 4FYSA 1FIGL 4EDWH 1QWUA 3R18A 7PAZA 4PMFA 5ACMA 2GFBA 2YSTA 1A5FL 2XWJB 3MQIA 1PKQA 2DYSB 4AIZA 1IM3B 5CD3B 3L54A 3BP5B 4HHAB 5DMIL 5DVMA 4LLUB 5AG8A 2FK9A 2R2HA 1JPGB 2WLIB 3PDOB 4QTIH 1J9CT 1YAIA 4MZIA 4NHCL 3CAFA 2I07A 4R6UA 5DLLA 4BSVB 1KGCE 1SN5A 3K6OA 3B4NA 3PY9A 3TPUA 3QRFM 1K72A 3HI5H 5F7NC 4OF6A 4TSBL 4A2FA 1FC2D 1FGVH 3HMXH 4O02L 1JPGA 3HE6A 3PDOA 4XX1E 5CZVL 4UDUB 4KZEL 2XN9D 4DKFH 3IDUA 4GXUN 1BX2A 2NXYD 3QEUB 1IQWL 2B16A 2K7QA 5E94B 3DX0A 2DLGA 1Z1WA 3FTYA 1X9QA 4KFZC 3RDTD 1Z9NA 4LQFL 3U4BH 4NM4H 4N3UA 2W65A 1OQXA 3BE1H 4LEXH 1CYWA 1DL7L 1U3ZA 4LQ1A 4AV0A 2B9AA 2JK5B 2BWIA 5DD0L 2RH0A 2QADB 1IIKA 3H9HA 3RWJB 4BK5A 2K3HA 2Q3ZA 1FI8C 4WUUE 2WIMA 2VABA 3V4UL 4CU6A 1T1ZA 1VCAA 2YAMA 2WSKA 1JGUH 35C8H 4OFYD 3U7WH 4ZFFB 5DUPL 1U36A 1BG1A 3JVGA 3ESVF 4OLUL 4OJAA 3V8OA 1JTOA 3UZVA 3FRPB 3FUKA 3O0RL 2BOLA 3LKPB 1AHWC 2DTML 1IM9A 4YXLL 3QUML 5IP4A 1DQQB 2BIOA 5JHLH 3KPSD 3O6MH 4BHUA 4A1RA 1JCVA 2XFXA 2NSXA 3BFOA 2Y5QA 3CFCL 5J12C 3BN3B 2W1NA 5E0QA 2F08A 4AEIH 1TYEB 4OAWA 4OZFG 5CF3A 4ZMVA 1S3KH 1FL5B 2B5IC 1JP5A 1BECA 2I24N 2VUKA 4KHTH 4NQVA 5DI8A 2OZ4H 1KJ3H 4OB5H 5HHVL 1NUNB 1UZ6F 2DJUA 5B39B 3O3DB 2ICWB 1LWJA 4KKLC 4LIQH 4F1ZA 1VFMA 3RZCC 4KAQH 1S5HB 4RX4A 1KB9K 2YUXA 1OQOA 3CX5K 2H0FA 1I8LC 2VE6B 4WSGA 4PWIA 3UJJH 1C08B 2DMCA 4YR6B 4KQ4L 4A2LA 2VJ0A 3MRHA 4KXCA 3L9YA 5K9OA 2GTZA 2PPEA 1ZT7A 3L1OL 3MROB 2QSTA 4OGYH 5A2AA 4AZ8B 2IWKA 2QHLA 3HR5B 1QBAA 3OHXC 4X9HA 5CSZA 1Y6KR 3KCWA 3WXVH 5JZ7D 3O4LE 1S3RA 2BCKB 3C6SA 1LLAA 2CAKA 2EXSA 1KPUB 2WQSA 1V7NH 43CAB 5IIEB 1OALA 1VLXA 4NZRH 3PCYA 4XOBA 3ZQXA 2NY3D 1P2CA 2D0HA 2XXGA 3PGFH 3SDCC 3W9EA 4IGBC 1E8XA 4G2AA 2PF6A 4H26B 1BM3L 1KTCA 2EH7H 4M7KL 5KSUB 3E2HB 3KHQA 2B4CH 4UILH 2GJZA 3NIFB 4PHZA 1ZE3C 4WK2B 2RQ8A 1SF5A 5IROA 5AEAA 3S6CA 4L8CB 1WE5A 4CVWA 3NZ8A 1KYFA 2VLLA 4J27A 4M5TA 4YDKL 1ED3B 4MD0B 3WJLC 4GQ9H 1G4MA 1NPJA 1PLAA 5IMMA 1SVCP 5E2JA 5KJRL 1WFUA 4ABQA 1QLFB 1S7WA 3HI6L 3QI9C 3UPRB 1HEHC 5HSFA 2ED8A 3QW9A 1EFXA 3D8MA 4EKJA 1F4WH 4KU1A 3ZTEA 3U9PH 2PPAA 4MCMA 4OFKA 4UDTB 5DHVH 4C56A 3JQOB 3M1OA 4NWTL 5DK2A 5EU6B 2AV1B 1DEEA 4JFHD 3P9LB 3F01A 1XF2A 1RK1A 2JH2A 2JCCA 4ZXBA 1RU9L 2VW4A 4D3CL 2X42A 4X7SL 4EOWH 1N10A 1TVDA 3VXQA 2DMKA 4JJOA 1OCOB 1RH8A 5C3LD 3OAUH 4IS6B 1MFDL 4P4KC 3CVBA 3KG5A 4P59L 1MFEH 1XSOA 3HB3B 3WIIH 3CC1A 3E1F1 4YSEA 4PJHA 4LKCA 4PW3A 4K71C 2CNZA 1Q1PA 2CGRL 1P6FA 2YZ1A 3RGVB 2OMTA 1TQBB 2Z34A 2VMEA 1URIA 2Y0SA 3L3DA 2WBJB 5IOPB 5BV7B 3FF7A 4YPGB 4NHCH 4ZODA 5DRNA 3D12B 3CZEA 3PAUA 4L1HA 4PQXA 4P57A 3ELQA 5EA0L 1PAMA 4KKCC 4Y4FA 1C5DA 4YK4B 2Q86A 2WZ6A 1ORQA 5FYJH 4TN9A 3IVKA 3VCLB 2W91A 2ITDB 2VKXA 3BQUC 3NJGA 1MW0A 1ZIAA 3KYKL 5FXCH 4JN2B 2N7SA 3MBEC 3MBXL 5HHXH 2YPVL 1ORQB 2VDMB 3UAFA 3IVKB 4HJTA 4ECNA 3GT6A 2PPFA 4Q52A 5F3HB 3VD7A 5IFJB 1T1WB 3FOLA 3BGMA 4AT6B 4TV3A 4Y7MA 2NT1A 5DRZA 2BIMA 4RZCB 1RURH 3K74B 1IEAA 2Y1ZA 4Z7VA 1MJ8L 2DIAA 5INDB 1X9RA 3BKMH 4PBVC 3O8XC 1UB5B 2J73A 5K9JL 2OSLB 1YEGL 4Y8AA 4GW5B 4X6CE 3I6KA 3L3KA 1WIOA 4WTWA 4OSUL 3UC0L 4NO0D 4RAUA 4JQVA 4UOW0 4MX7B 3DOSB 2UV3A 5DC9B 3WNMA 4BELD 1WEJL 4PJGB 4DKAA 3VWJC 1ROWA 2HFFA 4OZGF 5F9JB 3GHEL 4GO6B 1DUZA 1OAKH 4MXQC 1NEPA 4YFDB 4YSUA 3B9VA 2K1MA 2WYIA 4ZQKB 4ZTOL 2GEQA 3OJ2C 1X5GA 4G80A 1DBKH 1DN0A 2CLZA 2LAGB 3ZIMA 1VEMA 5LQBH 1F11B 3AITA 4J23A 1CCZA 3BVWA 3FSWA 4NC1C 1BVNT 4H25B 1KY6A 1LEKA 2R2CA 4P2AA 1XGZA 5BS0E 2HUEA 3GMMA 3VFVA 2LVEA 3AREA 2WKLA 4JM2C 3MLTA 4FG0A 1YNLH 3ABZA 3DNKA 3AXIA 3BXNA 2CM5A 3STZB 1CLVA 3ZDZB 5E4AA 1IBFA 3WV0A 3KLHD 4WTZA 4Z0XB 2NNXA 3NZUA 5IUSA 2EXWC 1I1RA 5HYSB 2WO4A 4RVBA 1DLFL 4YHZH 4AMKH 4PLJD 5KN5B 4R4BB 2R23B 4JL2A 4N4YB 2EE3A 4OQ1A 3VGAC 4XNAA 1JVKA 5TTRA 2DJMA 3KPRE 4HJGB 1BQHA 2B2XH 1OP5K 1J7VR 4OCLC 3QCVL 1AY1H 2YD9A 1AKJA 1A0QL 3LH2H 1P6AB 4HJGA 2HRPL 3GBEA 4U1LB 2MQCA 3V55A 4Y16C 4Z6AT 3QDJB 5FYJE 4ZW6A 2AQ1A 1N64L 1NZRA 3IYLW 2VERA 4O2EB 5CJ8A 3X12A 4P46D 2XN9E 4D0DB 4W9EC 1CE1L 4FFZL 4A2EA 4DP1X 4M6NL 2V2WB 3UYRH 3B9KB 5F0LB 5E1IA 1A8ZA 3WJJA 5JXEC 1HEJC 1G9NC 2PKDA 4NO3A 1L7TL 1U41A 3LKOB 4UTBA 4MA1C 5E5RB 1OD9A 1EANA 3NSDA 5ES4B 5JIDA 2QV4A 4R9HA 1E9PB 2FBRA 3CN4A 1Q4NX 5CKAA 2BJMH 4JAMA 5CR1A 1CGTA 4JG0L 4PEEA 3QUKB 4X4KA 2Q6WA 1QA9B 1IM3D 4PGEB 1I9RH 3T0AA 2NMSA 4P59H 3FT9A 1EQWA 2X3BA 4RFEA 3KS0J 2DEXX 4FEIA 2F1BA 4NAJA 5ESAB 5AVWB 1CXHA 2XTSA 3IPEA 2CJUL 4HCRH 3SIKA 3WOVA 3QXAA 1WCQA 3NK3A 4OLEA 1UUNA 5EUOA 2V4LA 4HSAC 1IFHL 1SOKA 3R8BB 4KK8D 2NR6C 3RJDA 4L29A 3GSNH 5KBNC 2WXFA 1EHXA 1UM5H 1DJXA 2ADGA 4ZMQA 4ZZKA 3HE6D 4GRWF 1A6PA 1F4WL 4RNRA 2DTMH 1OP3H 2ZCHL 5KAQF 5CR8A 2I5YL 1M7XA 4ELKA 2PCFA 3CN0A 5CBEB 2ZYRA 2X38A 2FCBA 3EYFA 5BZZA 1I8KB 1R5IB 2BC4A 3SN6N 4H26A 3QZNA 4NGHH 1VFOA 5HHVH 4Z7NE 2NX5B 3QORC 1TVBB 4WW1A 2BNRE 3RY5A 1YYLL 5G55A 2OTUA 1IGMH 1ZGLM 1TZHB 4RZKA 3WIFA 4U4BA 3CMOL 3DIDA 4Y4KD 4IU3A 5JA8B 4Z7UB 2XUWA 2VH5H 2ITFA 1ZLSH 4RMQA 2H0JA 3FU7B 3TEZA 4I0CC 3V0IA 1EO5A 4YMPA 1FA4A 1KGYE 4N2HA 3RGVD 1CR9H 3EBHA 3QIWB 4WWKA 3W0WD 1IM9D 3IGFA 2OULB 3RVWC 2MOQA 4M6ML 5DRWB 4X6BA 3RQ3A 4UU9B 5DJCA 5HGBB 3LTVA 3T2LA 1W8NA 3T8XB 5DRXB 1N4XH 3MBXH 2IAMC 2N1TE 5L4IA 5F96L 3WO4B 3MOQA 3CVHB 4X0KB 3TCLB 1SJVA 1NBYB 3A5VA 1KJ3L 1QFWM 3EFDL 4OB5L 3WEBA 2ATKB 4LLWB 5E8PA 4QTFA 4U1NB 4ETQB 1JAEA 2VZTA 4HULB 1NCIA 4NQED 1M3JA 4PAZA 4HWBH 5DMJB 2XKNA 35C8L 4U1IB 3FUDA 4L4TE 4ZXBC 2VTFA 2ZKMX 1JK8A 2CUAA 2HJKA 2VXUL 3ABKB 2VDQB 3HBZA 4XPGH 2GSGA 2FL5A 1PZ5B 1AXIB 1OGAD 1TQWA 3DRQA 2NY3B 4BRVA 2W94A 2X5PA 2KH2B 4K5MA 1PJ9A 5AB0A 1WEJH 2ZXBA 1V7NL 3DI3B 5L0QB 1TT6A 3KBEA 2Y1VA 1A6TA 2AK1H 5F1SA 2LE9A 2QKIC 1J0HA 4D0DA 2P26A 1CI5A 2ENPA 2QVFB 4PRPE 1BVKB 5JW5B 4L8SB 3NPSB 5CCKH 5DEZA 1JPEA 1MZYA 3OPZL 4W9ZA 3V52H 1OPGH 2YA0A 1JZ5A 1V7ML 1ZRUA 3REWA 4XP6H 3WENA 4CMHB 1JNJA 1U0QA 3QJRB 3SE8H 3ROOA 4KTEL 3QBTB 3O11B 4NQDA 2GT9A 1G7MB 1XZ0A 3SD5A 5T8IA 1UOWA 1A7RH 1KGIA 2NDFA 4R8WH 2GUYA 2ZUSA 4HS8L 4S0TD 5FLUA 1ZEAL 3UYRL 1C5CL 2R2BB 5D6DC 3SYPA 5I6LA 4N2DA 4WHTA 3R4DA 4JQIH 4ATWA 2JK5A 5HPMA 4LHUD 3O4LD 4K3DH 1L3NA 1QSFD 2F2HA 3MXWH 5HXMA 4MQ7A 1BQLL 1WA2X 4OFQA 1HXMA 4P5KA 1BG9A 4J3OH 4DF9A 3HLAA 4DKDC 1C12A 2CRMA 4LNRA 1VFBA 5SV3A 4OZIB 3ARDD 2N59A 3MFFB 2XG5A 3W56A 4HFWA 1B0IA 3DX1A 5DS8B 1FRGH 3BVNA 4YO0A 1WFJA 1WZAA 1BD2B 3GSXB 5EIIB 2V7NB 3HVNA 4YSPA 2WINA 2CGRH 4KTYA 5TDOB 1GPOH 4WU5B 1QUNB 4XVUC 5HHPB 3MUUA 4KROD 4MZ2A 3X3GL 1UASA 4FQ2H 5CD5D 3H7LA 4NIYE 5TQ2H 2OMNA 3DX2A 4X5XB 3STZA 2VDOL 4N8PA 4NP9A 4ZUUA 3U9PL 3DURA 5FYJL 3GKWL 1MREH 2E46A 3WHE0 5BUAA 1HX0A 4UQ9A 4OZIE 2JKLA 5F7UA 4BQBA 4JRXD 3T5WA 1XF1A 4X7TA 1QPXA 4IU3B 4XE5B 4WJ5A 1MG2C 2W95A 1N59B 4XBGA 1HJCA 2BVUA 3C2AH 3MRDB 3WNOA 3N40P 2R29A 3UX9B 4OQTL 1H3PL 4PFEA 4ZUSB 1JMZA 5CEZD 2HT2C 1L4IA 4P5TC 3OF6D 2EDOA 4PJ8D 2DMHA 4GXVL 3TVMC 4AEFA 1AXTH 1EJFA 5E1QA 1U58B 1FZJB 4APQA 3ZR5A 4RCAA 1FZMA 3FCSB 1TZGL 3QPXL 5CJQL 4K15A 4OSUH 3UC0H 1JGLH 1UVQA 2YWZA 2DJ4A 5CZKA 5JPNA 3NZSA 3OWEA 4NHUB 4PG2C 3DGGA 3MJ7B 1FNEA 3Q8CA 4XCEA 3LQMA 1ZAGA 2AJUL 1MUJA 5LLIC 3PGDA 3GXTA 2FJSA 4LT7A 4PY8I 1JTPA 5LCVL 4IM8A 5B4MD 2H5UA 3KL3A 1LMIA 4WW2B 5AVYB 3U2JA 3AG1B 5MEOB 3SQBB 5GSVA 4XI5D 5KBPA 1QD0A 5HVHB 4PJBA 4M43L 3HKZA 1UEMA 2X2IA 3QC5X 2F53B 4HHGA 3D52A 2Y7QA 5EZLA 5F0MB 1PZ5A 1DCEA 4QXTA 4YDVA 5DHVA 2CR0A 3OMNB 4YL4A 2E6JA 5TDNB 3D18B 4XCCH 5LGJA 3EJSA 4P99A 2YK1L 4I2XA 3CHQA 5I1AB 4NAQA 4XPTL 4KVPA 4E68A 3ZGHA 1YMMD 1WA1X 1QNZL 5JIPA 4XGZA 4KRPC 4F8NA 1KB3A 5A16B 2FSDA 4KJPC 2K6YA 4B9CA 2DAVA 3TIDA 1QZNA 2ZCLH 4GG8B 3D2UD 3GZPA 1FLRL 1KBPA 2EVHA 4QRRE 4BH7A 5KBDA 1NKGA 3RBSA 4Z3TA 4HBCL 4DP0X 3ROLB 3KYOB 2E74C 1JFQH 2JIXD 4ICXA 4MXVE 3TBWB 2CO6B 1DUYB 1WAAF 1E2WA 3N3EA 2O5NA 4OT1H 1T1YB 3S36X 1DQJA 2CJUH 2A73B 3B2UC 4E0RA 1WISA 2B77A 4WI8A 1OT2A 5CGTA 4F15C 2L4OA 1QYGH 3ECUA 2R51A 1PCXA 2ROXA 3P4MB 3OB8A 5MEPA 2R4RH 1UTDA 4ZW7A 1AE6H 4NN5C 1FFQA 4CU7A 1NBVL 5L2KD 4CC4A 2FSEA 2CZNA 3S36L 3I75A 2KQNA 2WYHA 4WI6A 3HG2A 4DZBA 3ZKXC 1TTUA 2NLJA 3POCA 1JL8A 3J8F7 1A2YB 1JERA 1IARB 1M9SA 3NG5A 5J9PB 3KMDA 4G7YL 4I48B 1T21B 3GXIA 5ITBH 1FVCA 3BKJH 4F91B 1NLDL 1QFWL 4QT5A 4N0RA 1T4KB 3GD1C 1NDGA 1L6XA 4JFYA 4WRLA 5DRZB 5D4IA 1AS7A 3DO7B 4NLHA 1D6EB 3DETC 4JVWA 1QHPA 1HWGB 4ZOBA 3QDHA 3T2NH 4OF0A 4XP6L 1YEJH 5BO1H 3ABGA 3KPNB 4E2OA 3MRKB 1S9KC 5SWZB 2Z8SA 2VDOB 3LN5B 1DQIA 4LCUA 5BOZG 4JPVL 5LGHH 3MRKA 4U3HA 4P46B 2ADFL 2RFXB 1D5IL 3U79A 4PS3A 4TTDC 1JK9B 5CP3A 1N9PA 1UHVA 3AWGA 3B9KD 5FCSH 3Q6GH 2FZ3B 3C6LC 2NX5D 4QYOB 3ZE0E 4EBQH 5HHOB 1QSFE 2HVJB 3DO3A 4TUOB 4CVZB 2XTLA 3BZ4A 3NJHA 3UPRA 4DZ8A 3OHMB 3QXDB 3DSFH 5C0AD 1KACB 2XLLA 3OXSB 1JV5A 3QQ4A 4CU8A 5JLZB 3K2UL 1OCZB 5TE7L 1JF1A 2DYPD 4KRNA 1ZLUK 1OAXL 4G9FA 2KERA 3D30A 5T1KB 3HFMH 4PJCE 2QQLL 2D31B 2UZXB 3BRDA 1OB1A 4M5ZH 3ATBA 4RGND 5A6LA 1KCRH 1KJ2H 4U2YA 5D70H 4O02A 5C09E 2AQ3A 3S4SA 3T04D 2ZUWA 1MF2H 2A1WH 5TQ2L 1I9IL 2BSRB 3B6SB 3H3KA 3Q8BA 3DHUA 3DVFA 4Y88A 5KS9F 3WY2A 4YDLB 3NFPB 1GGIL 1IZKA 4YHPA 2EIZB 5C2BH 2VLJA 3QG7L 1RPQA 5B1JC 3TA4D 3EJCA 4JFOA 4P5MB 5E9DE 1E8YA 3VXOB 3WKYA 4AVHA 3LVEA 4RMTA 4MMYB 3BWZA 4LSDA 3ZYIA 3NCWA 1YUHB 3MDJA 2OAAA 2XZAL 1NGPL 1V7MH 3D4YA 1BAGA 4QRUA 3X2QB 1F3JA 4NZUH 1ZSDA 4XP4H 1T5KA 5LDUA 2EVGA 4JFEA 2JQZA 3U7YL 1F13A 4GQZA 3WDJA 3OZ9L 5I75C 2QR0A 2K9UA 3K6FA 4NIKB 3WEOA 3QQ9C 2BP5M 5DGRA 1NL0H 3L9BA 4BE6A 4OV5A 1Z32X 4I1PA 1AH1A 4I4WB 4ZMXA 1ZEAH 3MNMA 3VXNB 1OGTB 3VFGL 3EXJA 2GVYA 3ARYA 1LK3L 1UZGA 1CK0H 1EA9C 2X6UA 2RALA 4FEMA 4R2GB 5AQ0A 5FO7B 2NZ9C 4M8VA 3TH4T 3P4OB 4L48A 1P4LB 5GS0L 3T2QA 1Y7VA 2XY1A 3QIWD 2IDCA 2P42B 4F8PA 3MRLA 4CKVX 1IAOA 1IVTA 4ELMB 4FJZA 1ZHLA 4FERA 3UOAB 2B1HL 2YBRA 1JTTA 4F5CA 5H37A 1DVUA 5C0CE 3L3OC 5TJWK 1QLEB 1FAIL 5FOJA 1WZ1L 1A66A 2AK4D 4N0CC 5ISZE 3ATFA 4F58L 2QSCH 4L8BA 4UUJA 3U1QA 3BSZL 2IOOA 3FT2A 4BFKA 4X6FB 2BSCA 4U0QB 4ZD3H 4FQXD 2C1OA 4OCSL 2ZONA 3ULUL 1XL6A 1DQKA 4QDGA 2NTFA 5F89B 1EHAA 2ORBL 4JPQA 1D2OA 5DQ9B 1GGUA 3NUKA 3C5JB 1J05A 5T33L 4FCAA 1G0YR 3QUXC 3MU3A 2W92A 2EO1A 2FWOB 3F5WB 3VDCA 3DGGB 2FATL 7PCYA 1KLFB 4NI3A 1WDAA 1B3JA 4M7JL 3VD9A 4M48H 2Q5BA 4NCC2 1BWMA 2VJXA 4NC2B 1I8MA 1OGAB 4Y89A 1WWCA 4BFEA 1YQVL 3PREA 2P9RA 1BD2D 1P7BA 1C5BH 3K71B 2VN5A 2WK2A 2YQ2A 3P77B 4PJFE 5E2UL 1DVZA 2D7MA 1XH3B 4U0RC 1VGEH 1QBMH 4PRHE 5CILH 5IEKB 1S7TB 3TC9A 3B9EA 3GLAA 1WAAA 1D5BA 4WJ5B 4L8CA 4I2XB 2R23A 4R96A 1Z3RA 2CRYA 5SV4A 1GAFH 5SWSD 4L4JA 3KJ6L 5AUMB 3VFOA 3A6OA 4PTTB 2JB5H 4QRRA 2APSA 4CADB 2YGQA 4OZFB 4DNLA 1CUOA 2FUTA 4QXGL 3SQOL 4F9LC 1A7NL 3I74A 2BIPA 5FX3A 2Y6SC 5B39G 5INCB 3H7BB 5D4JA 4HPHA 1EXHA 1U2CA 1I9JL 3G7TA 2X0WA 4KXDA 2VDLH 3L2NA 4ETQA 3IJHA 4Y2NA 2R1WB 2VWEC 1FNEB 4KO6A 1G1YA 3M17B 3ZHFA 5JOFB 4P9HC 3N41F 2ZSWA 4JDVB 3TNMB 1G9NL 3EO9L 3BI9X 2XV2A 3VXQB 3NFNB 3JTBA 4J3OG 4BV1A 5I0VA 2AQSA 1CBVL 2EYTA 2GBTA 4E0RB 4L2YA 2PP7A 3V6FB 4BQ8A 1FVEA 1QFOA 2E8ZA 2F53A 3ELAT 3Q01A 4N25A 1YNKL 3ULSB 4KK9D 3GRWL 1G1OA 1VGKA 2FE0A 3ZXAC 4NDMA 3RY6C 3B8YA 3WUWA 4BXVA 4S2SB 2B08A 1RJZA 5H4ZA 4BFNA 3S35H 4JO8A 1HYSC 4KKZA 3PXHA 2N7AA 4NDMB 3SDDB 4RQQB 2F5BH 1OD7A 3CXHK 1VJSA 5H94B 1UWGL 2Z92B 4TLSA 1WTGT 3GEWB 4WFHD 3X11A 3L5XL 2QKIA 3ECBA 4R4FH 5BZDA 2K4WA 2VDRH 4YHIB 5PCYA 1EEYA 3OKOB 4Y2OA 1FWXA 1XZ0B 2H4EA 4TSCH 3X11B 5AZEH 3H55A 4X2UA 4MWFB 2ENQA 4BZ2H 4Z76A 5E8EB 5D2LB 1TSRA 3CN1A 1NAML 2OMYA 5I15H 5K39B 3KM1A 5KWYC 5MHSD 4PY8J 5JORA 3AB0B 2MKLC 3RWFA 2NY1B 3ZUNC 3LZFL 5ID1A 5SWZA 4MQ7B 1EWHA 5T5NG 2HP4A 4PJ5E 4GUPB 3QJHB 5SX4H 3T0EC 5KG9B 2HN7A 5DR5H 4XMTA 4MXWH 3HI5L 1T7XA 2ADJA 1DTUA 1Q9LA 2AXHA 1A3LL 1M6UA 1WZKA 1KBGH 2F5AL 4QYOA 5HD8D 1YEWA 4I18A 1HINL 4N2AA 2WHVA 2C7FA 1VADB 1CICC 3F62A 1P4UA 3HS8A 4PJ7A 4OU3A 1UQSB 1E43A 1NLDH 1QFWH 1RFDL 1MRCH 3WNLA 1L9SA 3VMOA 3KPPA 3CN2A 4PV8B 5J9PA 2M26A 1QBLL 3SDAC 4MA8H 4FMVA 3HZVB 4UAOB 2XVLA 1XEUA 3HAEG 3MLWH 3GSXA 2E76C 2MNJB 1V05A 4TOYL 4MQXC 1KJVB 3BSZH 3LQZB 2Y9RT 3QDAA 4WU5A 5HHPA 1S7XB 3H0TB 4IRJD 4LSVL 1M05B 1NMBH 2YARA 5MEQB 2VDPL 4GBXD 1LM8V 5C08A 4F8TA 1BCIA 3ZKND 2WUBL 4JFFE 2Q7YB 5A43C 3W11D 4JO4H 1MFUA 4PYGA 3FRUA 5D7KE 1YMMB 3JVGC 3VE0B 6CGTA 4M56A 3F7YB 1MHHB 2VXTH 3G6JA 4OFPA 4W6XB 2Z6FA 2DM3A 4XPBH 4D9RE 2FJHB 1KXQA 4WFFE 3BAWA 3F00A 3LCYA 4XVOA 5E8NB 3SJVA 5IVZA 1L7IH 2VO5A 4QUOA 3GZQA 4U1IA 5FDWA 2OZNA 3CCHB 2AJZB 3N9GH 2QGBA 5EZIH 4AYBA 1Z5LB 2A99A 4ZMOA 1A14L 1RHHA 1XX9C 2WWNA 4ZUWA 3SE6A 2NUPA 2HVJA 1HAWA 3E38A 3IDJA 1KJ2B 3IWUA 3BH8A 1DEEB 4HC1H 1MVUA 5IVXE 4G43A 3ISRA 2XZQH 15C8H 3TBYB 3T8MA 2OMUB 3HPLA 3JV6B 4FQCH 2WWKO 2NUPB 2FO1A 2P80D 1A9EB 4FZEH 4YIQA 4IOFC 2DQGL 4A04A 3HR5A 3BP4B 3Q5OA 1NFKA 2XWJA 3L4XA 4LSSL 4L8SA 4LVEA 1F58L 3IGKA 4V1DD 2F19L 3QR0A 4LLUA 4XP9H 2AHIA 2A6DA 4GFTB 3QAQA 4YDVB 4PRDB 3S5ZA 1IMHC 2APWA 3ZE0F 3UBFA 2ZAGA 2QELA 4AYDC 2CXGA 2H3NA 4XCFH 4LL1A 2XQ0A 1BJ1J 1WTLA 2QSVA 5G4NA 1GIGL 7FABH 4KI5C 4KVCL 3U36B 3T3MF 5FHBL 2F58H 3LN4A 5C2UB 1J5HA 5E94A 4XB3A 3UTZA 4KJWD 5DO8A 1NGPH 4CVUA 5GGTL 4RMUA 4YVUA 1R33A 4UT7L 4AYFA 3TJHC 2GG1A 4WUKH 4PJFA 5IW3A 1AIZA 2GJRA 2Z92A 1G7IB 1AKPA 1GAFL 4RFOL 4OLZL 1F4YL 4MDIA 3WN5A 4OF3A 3X1GA 4OJYA 3FTGB 4H8VA 1FL6B 4RZCA 1B6UA 2VERN 4MNQE 5CZRA 1TMQA 2O5YH 1XFPA 1DSFH 3DUSB 3S3DB 1QTYT 1JZ2A 2MNWA 3SGDI 3RWEB 3V4VH 1O9WA 2MTPA 5EOCL 3HS0B 3GMPA 4FMFA 4UV4H 4MD5B 1H8OA 5KVFL 4X9GA 1GA2A 1F56A 1YECL 2YJQA 4PGDA 1X4YA 1MFDH 3RPIA 1WBXA 3A4FA 2FSEB 4P3CH 4U4IA 3ISYA 1TCRB 4Y4HB 3SE3C 4G6ML 5D1ZI 3D87B 4P57B 1W0YT 1MIEH 4AWJC 5IEHB 1OSEA 2C3XA 2HKHL 4OH2A 1EUUA 3PPEA 1H3GA 2DBJA 2OMBA 4LNVA 5EU4B 3LY6A 1QFPA 1KLGA 3KWXA 3AS1A 4WV1B 4OZHE 2BS9A 4PGCA 4GAGH 4PUBH 1YC7A 2QTVA 2A9CA 2AF2A 3HZMA 4Y4FC 2WLKA 3US1A 1JN6B 2OL3H 4OQTA 4HKJA 4I9XA 2VKWA 3ZQ9A 4PGCB 2BHFA 5DFVC 1C5BL 1UH4A 4X6BB 1EXUB 4XWOC 2RR3A 4ZTOH 3CHRA 5GPRA 4C57C 5AVUB 3SY6A 2J25A 4PVMA 1R3KA 3BN9C 4N5ED 1FNHA 2UVEA 3HZKA 4FA7B 5JA9A 3TF7C 1G6RB 1HL9A 3PWLB 1LEIB 4XCNB 1N3NA 3EGDB 4PD4K 1X7QA 1J1OH 3QNZA 1H5BB 4K8RH 1QOKA 4FADA 2FZ3A 3UXFA 2ORBH 1A7BA 1B0RB 2K6ZA 3LS5L 3NRFA 4IOIA 3S88L 1X7QB 3QFGA 3NIDE 5HI3C 12E8L 1FLTX 4MD0A 1B2WH 2HCZX 1EVUA 2RAMA 5BRZA 4AENA 5F7EL 4MD4B 3KLLA 4JW3A 1HT6A 3WU1A 4JB9H 4XRCA 5H94A 3ZYOA 5I1IH 1RLBA 3O6FB 3N44F 1BPVA 1IL1B 5IJVA 1AGBB 4X99B 4X8GA 1KOAA 1XF3B 3G5XA 4GAYB 5CIPA 2NY2C 1KELL 1LP9B 3FH7A 3MRRA 4UNTA 5T1JA 1U93A 1B2YA 2DDQL 1U8CA 2UWEA 4XMPH 3LAFA 4K2UL 4GAYA 4A7SA 4GI6A 4I5BA 2VRQA 5D1QC 3HZ3A 4XVTL 1QKZH 1JXGA 2EAEA 1NM4A 1OOWA 2HWZL 3BUTA 3NIDB 1WO2A 4KOBA 1V8HA 8FABB 5JO5A 4O02B 4AC2A 4FQXB 1IGTA 5L7XL 4BFIA 5I6OA 5D1XC 2JJSA 4CSTA 2A73A 3UJTL 4ZTPH 1UWGH 3FQRA 3GGWA 5DRNB 2A0LC 1WWWX 3VTMA 2E0PA 1A6WH 1ZV9A 1DLFH 4XZUA 1DO5A 4WVRA 5KBLA 4Z3FA 1HCVA 3POHA 2PO6A 3CLFH 4GB9A 4Y4FB 1DVTA 3SJVD 2YPLD 5IR1B 4HKXA 1OLLA 1HILA 1RULH 2V5MA 3KR3H 2YXVA 2W65B 3CZFB 4O4YH 5BVPH 1M56B 5FO8A 1WGVA 2YA2A 3TO4B 4BFOA 2OXHA 4GAJH 1U8OA 3QNXB 5EZIL 4UZSA 5E08L 4NQTA 5F7LB 4O2EA 3ZKMD 4CC0A 5IR1A 3BLKA 4WF7A 2AERT 4F57L 4Q74A 1HCFX 4TQHA 4DPCX 5FO8B 1ZLUH 2XPYA 3OKNA 4GRWH 5KSBA 1KG0B 5CINL 3P54A 1S7XA 2Q3XA 1T21A 3H0TA 3OV6A 4FQLH 1YEDA 5FW7A 3KLDA 5I16A 3TURA 2Z8WC 4FAAB 4H1LB 1X6NA 3V4VA 2WXPA 4HPOH 2J6EH 5D96B 5FUCC 1UFGA 2KQMA 1ZHLB 1NWOA 3QO1B 1AJ7H 2VUOA 1E40A 1CR9L 5ICYA 5EO9A 5LVEA 1WBYA 2Y23A 2FIRT 5T3ZL 3ETBJ 4ZO7A 2IPTL 2W38A 3QO0B 1NCHA 3W11C 2FJHA 1UC6A 5ETUB 2FR4B 3GKWH 1HQ4B 5F0JB 2CO7A 4F3FB 3TNNB 4IRJC 3VO0A 1PZ2A 2Y7OA 4JFQB 4Z7VF 4G8FA 1S2EA 4X4YA 4HCRA 3VXUE 3WLBB 1O75A 8CGTA 4KZ0A 5C7XH 2JELH 4G8FB 3WFZA 3IMSA 1NDMB 3H54A 2ADGB 4RDQF 4UQDA 3HUJE 4DZ8B 4HOWA 4MAUH 1HNGA 2FJUB 5DHMC 3EYUH 4OZHA 2GTWA 4I8DA 1U8HB 3F84A 5GRZA 4U1SB 2EEXA 3ARVA 3P77A 3D39B 4U1JA 2N01B 4UMSA 2HPTA 4C4KO 5D2NC 4ZDHA 4KXAA 4ZRGA 2CO1A 4LDOB 5KS9A 5MHSE 4AIXA 3O9WB 4A2DA 1MFVA 2AQNA 4P8QA 1FORL 1TCMA 2XA8L 5AYUH 3CBJB 4MJIB 4X80H 4E41E 3VXSB 4P5SA 4EF3A 5GZOC 5EZOH 3C5ZA 4PJ9B 3SE9L 3C08H 3N42B 1BZ8A 1NFDE 3F6LA 4OCRL 3NSXA 1HH9B 4AUJA 4WW2A 3Q44A 4W6WB 3ZL4L 1HKLH 1RZIA 1MCRA 4G7VH 4BGLA 4Z8FH 4N9GB 5FYLE 5FCUH 1AO7D 3T6WA 4AQZA 4QHUA 1QSZA 3ESUF 3QQ3B 4R26L 4CMMA 4WHDA 1A6VH 3H2PA 5EZPA 4M7LL 4GOSA 1G7JA 4NP4L 1AO7E 4WNQA 4WWKB 4FFZH 4KKNA 5D5MB 2X1WL 3TIDB 4G7SB 3VRJA 3CUPB 5CEYB 1S9VA 2B9BA 3AY4C 4PY7A 1RZ8B 4M03A 5JUEL 3CSGA 1DBJL 3SCMB 5IHZB 2AV1A 3QC6X 3VI3E 5I0DA 1HYSD 3X14B 4DTGH 4I1RA 2JTYA 4FXKB 4A6YA 3T1WA 3H1ZA 3VM5A 5IB5B 1MHCB 4E42B 4MCZA 5D1XE 1TJXA 3RIKA 4FRWA 5I23A 3MNWA 2WBJA 5IOPA 2ZWZA 1Q1JH 2P43B 3DV6B 4GRMB 2V3DA 1M7DA 3QIUB 4RGMC 1WBXB 4YE4H 5BNXD 1KZQA 4K3EH 4TVPL 5ICXA 2P28B 1RIHL 1OTTD 4XX5A 2OR9H 5IQMA 1TTFA 1Z66A 1AGEA 4FN0A 4AKOA 3ULSA 4GIAA 3FO2B 3DRQB 4NKIL 3LHAA 2ARWA 2JKNA 3UTQA 3GSWB 1IBYA 1G5GA 4ADGA 2LGNA 5JXAH 1FVDB 1KLGB 2JE8A 3ZHDA 3WLWC 4EI5B 3UZEA 4YSCA 4TNVK 5DQDL 5EEVA 2PYFB 3UEZA 4M1GH 3TBSA 3L4CA 3EFOB 5AW2B 5LDSA 2WINB 2YD8A 1PG7L 5MENE 1J10A 5D7JB 4AXWA 1PDKA 4XOAA 4DZBB 1BVKA 4GIOA 4LL4A 3KYAA 5FO2A 1UWYA 1IC5H 3MRHB 1ILSA 3MV8E 4XO5A 1WF5A 1OWWA 3CH8A 2ZUXA 1SDDB 1O7VA 2BFVL 4J8RB 3RWCB 1GC1L 4LAQL 3FO9A 5EBWA 4FA6A 5CEZH 3FFCE 3FAXA 2X44D 1MWAB 4I89A 2D2CC 4FLSA 2E7CA 4QHKJ 4FG6D 1ZWIA 1SY6A 1MCDA 5JIIA 1NC4B 1FUNA 4IRZA 5KSVB 1U8NB 2E6QA 2YUWA 1P84J 4X4YB 1B90A 3H9SA 4OI9A 5D4QA 3WKNA 4XNBA 4JRFA 5T3ZH 1AG6A 3NJMA 5D2LE 3QUXD 3TCXA 4YSDA 4GAFB 2BVPB 3ZZLA 4N85A 2Q3AA 4CN1A 2HMIC 2KDGA 4BSJA 3T0DA 1R9FA 5H37G 1JK9A 3TA3C 4TNGA 3E9UA 3KYMA 4JUTA 2NXYB 1LGVA 2M83A 1RZ7H 1IM3A 5CD3A 5JPNB 3EYQD 3AB0C 1U8KA 2UWEB 1HXYA 2R1XA 4Y2DC 2WLIA 1FNLA 1M6OB 3CK0L 1KYUA 5T3XL 2JCCE 2JKTM 2WLHA 2NY5C 1ORSA 2VAAA 4KK6D 3LPPA 5SX5H 3LKSB 4FABL 2NYYD 3LS5H 5TE4H 1FSKB 4JQXC 5T1LD 5E8NA 5BCAA 1BAFL 4XODA 4UYPA 3JTSB 1B4TA 2VLRD 4CBPA 3KPMB 3VGHA 3VE0A 1JGVH 2DLIA 2EYTB 1ADWA 3NCMA 5BOPA 2ZAHA 5ANME 2OMWB 3EBAA 3K2KA 4G43B 2DWDA 4PRBA 3MJWA 4NRYB 3RWDB 2E8YA 3BD5A 1JWUA 3N1QC 1CG9A 2YC1B 4XBPB 4WI9A 4PY7B 5T3ZE 2F15A 4GT0A 3RIFF 3PWNB 2WW8A 3QFJA 2D7TH 5TE6H 4AQEB 4NFCA 4PJEE 3CSTA 1CJYA 3N43B 5I1HH 3IEAA 2MPAH 4TVUA 2W81C 4FTVE 4OV5B 4W1TA 2OJZL 3VMPA 3WTTA 4OCXH 1BVNP 4LXFA 4HISA 1OZTG 1DVFB 4I5BB 2R2EA 3INUL 2EABA 1ERNA 1PGRB 3DV6A 4JKPL 3ZT7A 2ZKYA 1JYXA 1ASQA 3ARFD 3U1PA 4KI5E 2EEFA 1YMHA 1HE7A 2UXVA 4X4ME 1CS6A 2OL3L 4Y5VB 4ZW5A 4FG2A 4O58H 3Q6FA 1ZY9A 1ND0A 2ZUQC 4A66A 1AI1H 4FLHA 3V0JA 1AHKA 3IRPX 1RIVH 5B3JF 4P9HH 5I1LA 4ZUTA 4DCQB 3VRIA 2DWXA 4UILL 5M95B 4MS8D 3MNZB 5I75B 1MAML 2Y7SA 3HZYA 1ID5I 1LQSR 1I85C 1RXLA 1ZT7B 1R4XA 4DGWC 2CDGA 4YO0B 2PCFB 1OE1A 2X9XA 1JZGA 4RFNB 1UJ3C 3G5YA 4ODVL 4E9YA 3UJJL 1MVFA 4BQ6A 4MJ6A 5GZOA 12E8H 2FYVA 4P4RB 5B8CB 1CDCA 5FYLL 4JY6B 2FX7H 5EEYA 3FTGA 4UM9D 3O8XA 1BQHG 3HG1E 1IAKB 4OD3H 2HH0H 3TVMD 1ZVNA 4LPTA 2C9QA 1DHKA 3TTYA 1W15A 5C0RH 1QRNE 2NZ1A 4TM9A 2IG2H 2WJ5A 2X89D 3D2TA 5DZOA 3CBKB 3TV3L 4G6KL 2FR4A 2IXQB 1J8HD 3FN9A 5ESQA 3DTDA 3WMSA 3BDYH 2XQYK 4H88H 3K6SB 4FS0A 3K3QA 3JWNH 2H8PA 5L4MA 1BVLA 1CF8L 2FX9L 3GSQA 1Q72H 3SPHA 1N6UA 2JKRM 4APXA 2D2OA 1ZA3A 5L9DL 4NN7C 3CUPA 3FN3A 5CEYA 5I1EL 1G6RH 3W9DA 1IU1A 1Z5LA 2WIIA 5CD5C 5JW4Q 2F8XC 4TSBH 4ETYA 4S1QH 5KSAA 1K8IA 1PG7X 3DROA 4XBEL 1EO8H 2H2PC 3PDDA 4PJEB 1JCKA 1I4FB 3KGUA 3PFUA 2B59A 5MERA 1FNGA 5IHBA 3Q6GL 1CO1A 1A9EA 4YIQB 5CLYA 3FT4A 2ZP9A 1ZT4B 3O2DH 4D3CH 2ZJSH 4ZDHB 1RULL 4O4YL 1W0VA 5BVPL 1W72A 4W9GC 3B2UD 4Z3EA 3ZDYE 2Y2YA 3FTZA 4JFED 5DFWH 3RI5F 2KT6A 3LKRA 3DXAB 5C0EB 5A7EA 1UA6H 4N1CA 4LF3A 3MRBA 3O6LL 4G6JH 3WCYA 1P7QD 3ALWA 5C07A 3TLRA 5IUCA 3RFZA 4MKTA 2AV7B 1OAUL 2E75C 3IXAB 1CFQA 3ILPA 3PGCB 4W9DC 1HCYA 4ODXB 4ZS7L 3QQ3A 2VLKE 3UG5A 3SKMA 1G6VK 1G7JB 2PLTA 3Q1SL 5T5FA 3BZ4B 2J1XA 3O6FA 2ADYA 1S9VB 5F93C 3SKJH 1GYUA 1JV5B 5JLZA 1UZ8B 2DWSA 1UKQA <