3W1ZA

Heat shock protein 16.0 from schizosaccharomyces pombe
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
134
structure length
134
Chain Sequence
PPTVNDLFSDFVSYSPRLNNQIPGELSPSIDVHEGKDTVSVDVELPGVKKEDVQVHYDSGKLTISGEVVNERKNESTEGNQRWSERRFGSFSRTITIPAKIDADRIEANFSNGLLTVTLPKVEKSQTKKQIAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonequivalence Observed for the 16-Meric Structure of a Small Heat Shock Protein, SpHsp16.0, from Schizosaccharomyces pombe
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Chaperone
molecule keywords Heat shock protein 16
total genus 18
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3w1zA00
2WJ7A 4MJHA 2Y22A 3QORC 4ELDA 3GT6A 2BOLA 1GMEA 4PBDA 1WGVA 3Q9QA 2Y1ZA 3Q9PA 3GLAA 4YLBA 5DS1A 3VQMA 2XCMC 3L1FA 1X5MA 2N0KA 3L1GA 1SHSA 3AACA 2N3JA 5LUMA 1WFIA 3AABA 2KMWA 3J07A 3QORB 1WH0A 4M5SA 3IGFA 4RZKA 3W1ZA 2MNWA 3GUFA 2CR0A 4JUSA 2WJ5A 3N3EA 4I88A 4JUTA 2CG9X 4M5TA 4YL9A 2K8QA 2JKIS 1RL1A 4ZJ9A 3L1EA 4FEIA 2KLRA 2Y1YA 4YDZA 3VQLA 4PCKA 3EUDA 5DS2A 3QORD 4YE0A 4YLCA 2O30A 3QORA 2RH0A 1EJFA
chains in the Genus database with same CATH superfamily
3NCEB 4JZJB 1J48A 4E5XB 3MA9L 4Q9BA 3WY1A 2HWZL 2HFEA 4AYGA 3B5HA 1RUQH 2KQMA 3VRJB 1J8HE 5DZVA 4MCYA 1DJXA 1FNSL 4XP6L 4X80L 1MWAB 2D3JA 2Y24A 3UBHA 3WSQH 5DQJA 4Z7AA 4NDMB 3W2DL 4KV5E 3F7QA 1IBHA 2MQGA 5FUOH 1IKNC 4XNQA 3DBSA 2YXVA 3K1KC 5F89A 3N42B 1PEWA 1UHVA 4P5KA 3CH1B 5DVKA 4EQ2A 5DRZB 1TJGL 4ETQB 3F5WA 4JCWA 3WEBA 5F3BA 4M61A 4OI9A 4RAVA 2XG5A 4FAAB 3TT3L 3VG0L 1XF2A 4XPTH 4PGJA 3EO0B 1EBAA 2O6PA 4X7TB 3ZR5A 1JZ8A 3FRUB 3L4VA 5IHWA 3HUJA 4HH9A 1D5BA 4RDQG 2HRGA 2I60L 3N6YA 3WBDA 4M4RA 1KGXA 1RL1A 3UZEC 3MQIA 5F3HA 1C08B 1DJYA 2OMTA 4I0PC 5E2TL 3RGVC 5D72H 5FYLH 4YSUA 4LIQE 2ROYA 4FJ6A 4WO4C 3MTRA 4U1IB 1S7WA 4I2XA 4KK6C 4XCEB 2H3XC 3SDDC 3EYOB 5FYKU 4DGYL 4ZFOA 1IGYA 1G84A 2DQFB 3V6ZB 4EI5D 2O5XL 1UOLA 1DUZB 3HHRB 2ZUUA 3UTOA 5KVDE 1NC4B 4E41A 5E8PA 3LSOA 1AP2A 2X2HA 2FLRT 2EIKB 2OJZH 4Y4FA 4LEEA 2JK5B 5F0MB 3HUJE 5IM7B 3I2CL 1NAKL 2VR3A 3K7UA 3RBGA 4OV5B 3SDAB 1WTLA 1CCZA 1M4KA 1EANA 1Z5LB 4TSBH 1BM3H 1A7PH 3S98A 1WWWX 1DSFH 3G08A 4YHOL 1FO0B 4LAQH 1WGVA 1XIWC 3CK0H 4YOKA 4JY5H 2Q9OA 5EU4A 3RA7H 2X6CA 1P7KA 3GO1H 1Q0EA 4F2FA 3LY6A 4FYRA 5JPMA 2OI9C 4Z7UA 5TK4A 5C0DB 1NCCL 3ZO0A 4HK3N 3BP6B 5CEYA 5JQHC 3HC4L 1KCVH 3GMLA 3JWNE 5AW1B 4NI3A 4HZLA 4WEEA 5KSBF 1F45A 2LQRA 4JE4B 4X9FA 4ZFZB 4K9EL 3PPSA 2CR6A 4FKKA 2C9AA 5EZPA 1MCKA 1K2DA 4DSYA 4IRSC 2V3DA 1EEQA 5HI5C 1KTBA 4UQEA 4N2LA 5IQNA 5DVLA 3MACL 3BFWA 1ZT1A 5I2IB 1S2EA 4YPJA 1NMAH 1CFSB 1BZ7B 3PDDA 4C8XA 5I0VA 5A2JH 1J18A 2QTVA 5BZZA 1AQDA 4BDVA 1AR1D 1DJSA 4W9FC 4ZTEA 1F97A 3WLWD 3U82B 2WBJB 1HXMA 2WBXA 5IJKA 2X4TA 5T8IA 2OYLA 2E8ZA 4DUWA 2R4SH 4AC4A 1JPSH 3BP7A 1IMHC 3QNYB 2WJ7A 4R90H 2L7JA 3SPHA 3WY2A 3QEQD 1SYVA 1FZOA 3BYYA 4JRYE 1BOGB 3V0WH 1X4ZA 1CGTA 4MMZC 3GMOB 3OJ2C 1DHKA 2HUEA 5CWSB 1RZ7L 4LCIL 4LCUB 2FECL 2JKLA 3FT1A 3PWNB 4X5LA 5ACZB 5IT2L 5CN1A 5HDBB 1AE6L 3MRJA 3W9EA 3B1TA 4ZW5A 1FHGA 1Q1JH 2QDWA 1CE1H 3MRRB 4QY8B 5D1QA 2G5RA 5EIVA 2OMVB 4F7PB 3FNKA 4LCCA 4I3RL 1IM3B 5AYQA 5A3ID 5F88B 3DUUB 5F44A 1KWGA 1NGPL 1K5NA 2Q86A 5AOMA 1KCUL 5IBLC 1MHEA 3BZDA 4NHCL 4QRBA 5DS1A 2XSKA 2JIXA 3MUGA 5HYEA 4PGCA 1ZLVK 2PMZA 1E8WA 2LW3A 4HC1A 1AQDB 1HL4A 1S46A 3N1PC 3F85A 3V4VL 2X0UA 3A6BL 4CU8A 5TJWK 1HHIA 1KGCE 3FSZA 2OSLA 3WFBL 3P3UA 4HSCX 2WN2A 3LN5A 3HE6B 4OGQC 3D7PA 1PJWA 2UX6A 3UERA 2ENJA 3LZFL 2VABB 2VMEA 3EO1A 4M9PA 5AZ2L 3ZVVA 4U6VH 1YEKH 2D4FA 4I3SH 4EVNA 2OBGA 3MA9H 3PUCA 2CAKA 5BJTB 1TTCA 1ET7A 1JAEA 1RH8A 1HNFA 1SBSL 1KXQE 1QUPA 1YPZA 5KYUA 4W6XB 4W9GC 3D34A 5E6UB 1FO0L 4MNHA 2FR4B 4D0CA 5I66B 4JCLA 1XZWA 2KS0A 4PGEA 1USQA 4BA8A 4HX1B 5JNYB 3FN0H 1FSKB 4Z7UF 4G83A 1ZTXL 4MDIB 2HAZA 1DL7H 2L4OA 3JTSA 1LMIA 2JWYA 4NB7A 3UGXA 3VSQA 5IQLA 1GAFL 1Z66A 2C8NA 3ASNB 1OTSC 4ESKA 5C7XL 3PYCA 3FMGL 4W6WB 2UXTA 1PLCA 4G82A 5JLZA 2AQQA 1R33A 2VH5H 4G43A 2FQDA 5JHLA 2I69A 3F6JA 1A6VH 2EYTA 4HFUH 4P04A 4P8QA 3ULVC 4KITB 4WWID 7TAAA 1HXYA 5JTWA 3AABA 3ZDXE 1TXKA 4OF7A 3RKPA 4LLMB 1KJ2B 4NBXB 4QHNB 1V3KA 2WCGA 5T3ZL 1XH3A 3S5ZA 4PUBL 1CR9L 2VL4A 2DWEB 1KLGA 1T1XB 3PJSB 3BZEA 2GYSA 1DEEB 3L4CA 1HXYB 2JV6A 4K3HA 3H9SD 5ACZA 1YPZE 5JPNA 5JUEL 4EI5B 4I5BB 4WV1B 3VFNB 3QXAA 4ZS6D 3HE7D 5BRZE 4XMLL 5J56B 5DHMC 2GBUA 4MZRA 3TH3T 4PJDE 1MVUA 1ULVA 4X50A 1FGNH 2BLFA 4P2OC 4F8LA 2H6PB 1PNCA 1P84K 1VADB 1AYOA 2H7WA 1UKTA 3WNMA 3FUIA 3P11L 2BJML 4V2BA 1WCBA 3THML 3VM7A 1S7XA 3P69A 4HCRH 3QFJB 3VWJC 3WFZA 3QW9A 1VRSA 3D8MA 1JF5A 1NC2B 1MHCB 1P4BH 2A2QT 3D25B 2LE9A 3VRLE 4LOUC 5FCUH 4E36A 1T0NA 1QBAA 1XVSA 2JB5H 4O9HL 4NUPA 4M1GL 2Y2TA 3WIAA 4YHNA 2YA1A 1AG6A 5DRXA 2GIXA 5DJ0B 4L3FA 2WLJA 2R2EB 3OMAB 4FXKB 1M3JA 2YPLB 2LR4A 2CO6B 4ZX6A 2ZYIA 4I18B 3MV8A 5KVDL 5EIQA 3GLEA 1JZ3A 2VDOL 4IJ3B 2FJFB 3OD3A 3TPUB 3S37H 3DOIA 1YNKH 4JY6A 4CN1A 5IF0B 4GSDL 2DQCL 4UQBA 4NQED 2C4FT 4WSJA 5HJ3A 1X5JA 4BCZA 1SJHB 2F1EA 3TWCL 4BBWA 3O6KL 3MRNA 4K9JA 4NXKA 3TVMA 4N2HA 3RB5A 1U8LA 1N10A 2BOCA 2JCCA 4M6ML 4N0RA 4XP5L 2WMPB 5IQ7H 2I27N 5EFIB 2P80A 4DUVA 4RGMC 4JFUA 4ENEC 4KTEH 1G7QB 1AD9A 1Z5YD 4PRIA 3WDIA 4OFQA 2FX7H 3WS3B 1KTJA 3V5DB 3HE6C 3TWCH 3RVXC 4NERA 2EO1A 3VFTB 3APDA 3ARBD 1TJHL 3IJHA 1FUNA 4PV9A 2ZCKL 3FB6A 6TAAA 3V0WL 4MAUH 1KCSL 4S1QL 4AXWA 3V0HA 1NFDF 4AYFA 4D9QE 2MPAL 2W80C 3QDHA 4OF6A 5I76B 4N8CH 3LZQA 1RZ7H 2VSDA 4C54A 4PVBA 3B2PA 1WA0X 3V5HB 2A4EA 2B9AA 5AVRB 5C07A 1XGTA 2NR6A 3CNKA 4AV5A 2CO3A 2ZSWB 1UZ6F 1RIHL 1QEXA 4C56B 3OQRA 5L7XL 5E2WL 5ALBH 3DIVA 2F6AA 3T1FA 4O02B 3O45A 2JELL 2LLLA 1DO5A 1EXGA 1PEZA 3B2UD 2MSPA 3H4FA 2EABA 3X13B 5J57B 2C4FU 1A3QA 1JWSA 5TTRA 1KXVA 2NTSP 4KHXH 3TYFB 5JHAA 1JYVA 4DTGL 1HZKA 3ISYA 2A4CA 1EO8L 5EC2B 1BJ1H 2FCBA 3S35H 3AVEA 3HN3A 5GISL 3HE7C 5GZNA 3V95A 1INDL 2FBJH 5FYJE 3BKYL 4QF1A 3V0EA 3HFMH 2BNUA 1NPUA 4C83A 2EIDA 4N2KA 3OKLB 1MIMH 3UIZA 1SRDA 3KLKA 4F37F 2ATPB 2I07B 5E2VH 1X6LA 1ZHKA 2PCYA 4A7QA 3VDCA 5IB5A 2GKIA 3F58L 1PZBA 1JGDA 4PI2A 3ZMEA 1GW0A 1EHXA 4QEGA 3QWOA 1YN6A 4AIZA 1GYAA 4EQ3A 3PWNA 5IFHH 2YD1A 1RIVL 1HDMA 2CR3A 2NZ1A 4XNYL 3U2SB 1DVFD 1I7UA 3BLPX 2W1NA 4LPTA 4PJFE 2XWEA 3FSVA 4ELKA 4RSYA 4M43L 3OKYA 2EYSB 1CQYA 4UILL 3V4PL 1KGJA 4KJPC 1AH1A 3KPTA 3QNYA 4MZ2A 2ATAA 1E6OH 4ZOBA 3PY9A 1HILB 4B9ZA 4OLZH 4TULL 5D55A 3BAKA 5HJDA 3GHBL 4QTIL 1CGVA 4KPHH 5E00B 2YPKB 2AZUA 5DSCA 5HP5A 5C0BB 3HPLA 3MRLB 4FTVE 1Z0MA 5FV2A 5BMFL 3MXWL 3UPAA 1MFCL 2F53B 2KDYA 4UB0H 2V5SA 1HQRA 1TLMA 2IMNA 2H0PA 4XP9L 1CDCA 2DQ6A 5CGMA 1A4BA 4LNRB 4YDIL 4OD3H 3GQFA 4PJDB 1TQBC 3C5JB 1BVZA 4ZFFA 5EG6C 4APXA 4Z7OB 1YNLL 4JUTA 2V8MA 4D2NA 4HGWB 4G7VL 5AALA 2CCVA 3VXSB 4F57H 1T1WB 3VI3F 1P4BL 2AEPL 4HKXB 3UYPB 5CJ5A 3S3JA 4HOZA 6PCYA 3JWNH 1QFUL 1IGCH 2MCPL 1QASA 3W57A 1TJXA 3WE6B 1GTNA 1MFEL 2JTDA 3MJ8A 1YNLH 4XZUB 4L4VB 2GG1A 3VXNB 2JJSC 5C08A 1U2HA 4NO5B 3CPLB 2XVBA 1O6SB 4XMWA 1SM3L 3PGDA 3F7LA 4LSRL 1HIML 1CC3A 3GNMH 2QQKL 3GSUB 2WZAA 5BV7C 4HHWA 2ESVD 2WQUA 4K73A 5AVVB 1R3KB 1HCVA 5EZIH 4B7LA 2DV6A 1Q9LB 2GTWA 2Y25A 1E9PB 1OO2A 2UXGA 2XKNA 5GXBB 3RWDA 1RJLA 1G6RH 1AZRA 4LB8A 3MPCA 1HAUA 3N0PB 3D30A 4GQZA 4K94C 4WFGE 4FZ8L 4X80H 4QGTA 2BP8A 4RNRB 1CBVH 2WTRB 1AI1L 1EHNA 1QFOA 3LEXA 4U3SB 3KDMA 2FR4A 2G2RB 2FJUB 4N68A 5CUSL 4WWNA 1CGUA 4C4UA 5EOTA 3Q5YA 3CPUA 3D50A 4QTHA 2A7BA 2Z92A 3F7VB 4DOHE 1MFUA 4PVMA 5G4OA 2Y1VA 2MRYA 2H26A 3IMWA 3KGTA 2BOBA 2J8HA 3IDMB 4OZHE 1FFPB 4TSCL 2FBRA 4Q6IA 5IB3A 3IJSB 4A2HA 3ARFA 3GLAA 1X5LA 1TG8A 1YHPA 1VZIA 5DT1H 5KJRH 3G5VB 1DVZA 1PSKL 1SJVA 2AJVH 5D4HA 1CLOH 2R7EB 1EAJA 1JZJA 2B4CL 3UJJL 3TYGH 5I28A 4PRDA 2DWEA 3ARVA 3GMNB 1Y18B 4OU3A 1P53A 3L3OA 4X0KA 1QWUA 4FP8H 2D7PA 5GS1B 1WS7A 4IRJA 4LO9A 5B1BB 2JIXB 4YDVB 3VXQA 4AQ1C 3UBXI 4D9LL 1VKXB 4HIQA 1YEDB 1KV3A 1CFBA 3UZQB 5TFSL 4AQAB 5IVXB 3GK8H 4O5LL 4R5XA 5EUKA 2V37A 4WTZA 5KYXA 2YBRA 1QX1A 3N55A 3W39A 2Z65C 5EH1A 4MCYB 3HG1A 5HGGS 4MDJA 1MCBA 3KBFA 3O6FB 2Y5TB 4JRXA 5F8RC 1HX0A 3RFZA 2AXGA 1MVFA 1NAMA 1MNUL 2YKKA 4MJIE 3QEUB 3TT1H 2WN3A 4TUJB 4ZZKA 3MNMA 2E59A 2PTTB 4LCWE 1ZKAA 4G42A 5I16B 2XV2A 3BZFB 3V0GA 3WIFA 2WLNA 1GS6X 4N2BA 2W5PA 4LAQL 3S36X 3OGCA 2GK2A 1BQKA 2JFCA 2N0KA 3RZCD 5CIPB 2YGVA 3TZVA 1GYWA 3L4YA 5D7LD 3GSRA 5E4EB 4CVZB 4R83A 3UGUA 4FQIH 1WBYB 5B3JF 2AQNA 4LARL 3VFTA 5DJXB 4DT2A 3Q1SL 4RAHA 4Z77B 2LABA 1E42A 2UVEA 4KPHL 5ECGA 3FU9A 2XIBA 1I3RA 3D18B 4XB7A 5FM4A 5CIPA 1PS3A 5CGBA 3AM8C 2BFVH 1CGSH 5E2UH 5C0CA 5JDSB 5GGVL 3ZYZA 1T21B 4B9IA 3MGAA 4L8DA 5DA4A 2CDFB 4CJ0A 2ZX5A 4G8IB 4IDLA 1K72A 2P48B 4N1CA 3FCSB 1YY9D 2A9ML 4AH2A 1CDGA 3GXUB 4XI5D 3UTPD 4GAGH 4C59B 3ESOA 1NAMB 4XGZA 2EE2A 3MO1B 3PL6B 2DMGA 3KR3H 3VI4E 2NW3B 2UZIH 3QUXB 3UIYA 4FYQA 2ZSVB 2KL6A 4MB5A 3OLEA 4AH2B 5ENWA 3LN9A 5KSVB 3FPXA 2W07A 1ZMYA 1M1XB 2J1KA 1K4DA 1IGJB 3SPCA 1U8OA 1ZLDA 3P73A 5I0YA 3BAEH 2YQGA 1X4XA 2PPEA 4PJ6A 1TZHB 1SY6A 4ZYKB 2AJYH 1UM6L 4JFZL 3C9NA 3VD0A 3VFRB 1GGBL 4OH2A 5CSBA 5EZIL 2J8UE 1VFBB 3PIQB 4Y8AA 2VLJE 4ANXA 1KFAH 1N0LB 2AABH 3ELQA 4CADB 4JQXA 1F3JA 2SEBB 1KIPA 3UAAA 4KUCD 1SUHA 3NFPA 3PHQA 3KVPA 1BIIA 4YIQA 1PFOA 5I1AA 3HAEB 5K1JA 2P52A 5EWIL 2J88L 2X4NB 4HMDA 3DX4A 3DIFB 1MFAH 2CQVA 5DJ8B 4EPSA 1MH5A 2CPUA 2X4PB 4M4RB 2A3TA 3QR1A 3BEVA 4WEMB 4WTWA 3UBXA 1FL3B 5KSBA 1YNTB 1SHMA 2C9QA 4P5TB 3CFMA 3KPOB 3SDCD 3N40P 3VQ1C 4YH6A 3MCKA 5J6SA 3W3BA 4E9WA 4NKMA 2WGNB 4LLQB 3CVIL 4GG6E 3K4DA 4W6YB 5B1JC 1UCBH 1YCSA 3OAZK 3RKDD 4Y5VC 4XCFL 5C0AA 4ELKB 2X6VA 4OZ4B 2X7LA 3EO9H 1NDMB 1TPXB 4NZTH 2QPSA 3LZNA 5TE6L 2GT9A 4DP5X 4POZD 5EZJA 2CGYA 2NZIA 1KBGL 2RTTA 5CINL 4J6RH 4J1UA 4F92B 4OZIF 3SE3A 4U1SB 3IFLL 4BUGA 1MCPH 4FNRA 3VWKD 1VCAA 4EAEA 4DP4X 5TK2A 1R5VB 3HS0A 1A9BA 5FW8A 3D05A 5TE6H 3DRTA 2QVTA 3ARGA 2AFNA 4PJHB 1T0MA 1E8YA 2J57A 3QPQC 1HHHB 4ZUUA 5IB2A 3BPOC 4HP5A 1T0PB 1UATA 2HG5A 4XBGB 3LDBB 1JHLH 3IJ8A 2ENPA 1RJCA 2QFRA 4AC2A 1AXIB 2NY2B 2EIJB 4QXUL 2DQUH 3VUAA 4UMSA 1VZHA 4NI6A 3G6JF 5KJ4A 1AKPA 3ZN6A 3LVEA 4OZIE 3CXHJ 5ENWB 3FTWA 3O41B 1SDDA 5EHFA 2VDOB 5J6HB 4I9WD 4KVNH 3UTZB 1NEZA 5I1EH 1BVLA 1QTSA 4JPVH 1N5YH 3ILPB 1I4FB 3H3PL 3TEZA 5IBTH 2FO8A 2QMJA 4ZMXA 1BYPA 1HHJA 1RUML 2WXKA 2G75A 5I17B 2CLZA 3H8NA 4HETA 2XQBL 4FC3E 4ZMVA 2BDNL 3CU1A 3V5KB 5D7LA 1P7KB 4X8JB 1TZOA 2IXQA 1UFUA 3Q5TA 3SKNA 4HUCA 1Q72H 3MRBB 3NSDA 1D2PA 4BHUA 1YNTA 3LQAL 5G5DA 5IKCA 3EUUA 4YBLC 5BW7C 4QRRB 4O2CA 5DGQA 1JN6B 5L6YL 1KWKA 2F68X 1MH5B 3OB0H 5M94B 3X3GL 4XNAA 3QPKA 2EDTA 3MRFA 3PCYA 2OJEB 3ABZA 5IB4B 2VDQB 4IS6A 4AKPA 4ISVB 2QKIB 5HI3D 3DV4A 1YMHB 3BWAB 2WWOA 4HIPA 5H37G 2EACA 3S7GA 3FU7B 2M2DA 3TH2T 4IM8A 4LCCB 3GDCA 2X12A 2JVUA 3ZZQA 1JK9B 3HG1D 1CLZL 1FV1B 3D39D 4JDVA 4MMXB 5L8KB 1YECL 2Q1EA 4AT6B 2VRAA 1AKJB 1WZMA 3GSOA 4N22A 4KTDH 4X6BB 2UZIL 4P23A 5KVGH 3UOAB 5BS0D 4MD4A 3CSBA 4ELMA 2IH1B 1ADQL 1MZZA 5CP3A 1VPOL 2OMXA 2JKWA 3FT9A 4FKEA 4M3KB 2ZAGA 2OPCA 4PJ5A 1SXCA 4L9LA 4PJ7F 1SJEA 3CAFA 3TLRA 4ZW6A 4EZMA 2AXGB 2AK4A 2JF1A 3IETA 4H5SA 3IMSA 3DSNA 2FGWL 3T2LA 2ZCHH 3WENA 4JO3L 5C0GA 2AMGA 3QCVH 4G8EB 1IGTB 2IH1A 4NKDA 1Z32X 3A67H 1PZ5A 2R2HB 2IDCA 5K5YA 4BH8B 5B39A 3OHXA 1FVDA 3VX1A 2CIIA 2QGBA 5FDWA 3RDTA 3B37A 1VKXA 4B27A 5EUOA 1U8KB 3FXIC 4PJFB 2XYBA 1IM3A 1BQHG 4ELDA 4YJZL 4LSSL 2YAQA 1JNJA 2V5YA 2R1WB 1QSED 4QAWA 4BQCA 2VDQH 2VJ8A 3OC8A 2Z4QA 3AROA 2A6IA 3GM8A 2ZXBA 3U30C 3UYRL 4RZCA 2LV4A 1BJ1J 2Q2LA 3DOHA 5DQ9B 1NEUA 4JRFA 4OZGA 4XT1C 5BPPA 2UYLB 1S78D 2L04A 4TVPE 5JQ6H 3G6JE 2EINB 2IWKA 2NY2D 5FGSA 3V79C 2N7SA 2E75C 4UTBL 3INOA 2NCMA 4GAJH 3F3HA 4PYHA 1PNDA 4FNPA 3DSFL 3UAJA 2HWZH 3WLWC 4L8DB 5D1XD 4OF8A 1RIUH 1W8OA 1F2QA 3WTWA 4ISVA 3RPIB 4LQFL 4PREB 2CJ3A 1C7SA 4W93A 4M03A 4P05A 5CD5C 5JXEC 1U3HD 4I1PA 2QZQA 4U1IA 3CDYA 3QQ4A 4PRAB 1B6UA 1Y1UA 1BFOA 2A77H 1YMMA 3NIDF 5FO8A 2CO6A 2WSKA 2HJKB 5I0XA 4HX1A 1IIKA 2E7HA 2MQ0A 2QSQA 2Z64C 5L8JB 3SQBB 4NM4L 5HY9A 5KVFL 4Y16B 5D8JL 4G7YH 4Z95H 1HKLH 4XBMA 5I19L 4K94L 4HMCA 1V3JA 4ICXA 1MAMH 2FBOJ 4JCMA 5IFHL 3LH8A 5AVQB 3VXQB 4UMGA 3X1EA 4KXZH 5DJCB 1RJZA 3TBBA 3BW9A 5TF1L 1QI5A 5BXFA 4OFVA 5GGQL 5E6YA 3TT3H 5MEQB 2I9LB 3HE6D 4PWEA 4L1HA 1TZGH 3TTSA 4PJCA 1NDTA 3CTTA 3O11A 4PJGA 4UBDD 2PF6A 3ME0B 4MWFA 3HZMA 3QJQB 2GHWB 1SEBB 2F5AL 1JG9A 3CX2A 3RX9A 4ORGA 2J6EH 3GMLB 5D7KE 3VD2A 1M9SA 2VE6B 4D8OA 2CHWA 1XF2B 2B14A 3QK0A 3QJHB 4GMTL 4GNKB 1P4IH 2EDHA 2X38A 4I5BA 1QBMH 3I6SA 4UTAL 3ISRA 3FB6B 2FNWA 2OP4H 2N1KA 3IRPX 3EFOB 3ZDZF 2O5ZL 3E6FA 2FAUA 4OF5A 1FAIH 4R5VA 2QHLA 3NAAH 4X9GA 4EN3A 1KIRB 1CGWA 2P8LA 1FPTL 4P2YA 3LPGA 5DJDA 4N4YB 4N2AA 1OAXH 3BXNB 1MWAA 4GYBA 1KC5H 3X3FH 1FHNA 4E9LA 3HCVA 5EZLA 4MCZA 4U1GB 1BYNA 4NIKB 5DGRA 3VD3A 4LOUD 3B2VH 1AQKL 1CU4H 4OUUB 1EHKB 2FJHB 2O5XH 2IH3A 3VNYA 4FEMA 2WXOA 1TCRB 2CE6A 2DYRB 3ULUE 4NS0A 4M5YL 4X7SH 4KQ3H 4OCSH 2E27H 5DEFB 5GZOD 3RIKA 3NCFB 3SN6N 4OGXL 3QNXB 5ESVA 3MMEB 3K72B 3IJ9A 2AXFA 5CKAA 5KYWA 1SYSB 1GMIA 3JWDC 3P9LB 4PN6A 2XX1A 1KPUB 3L13A 5K1VA 3UG4A 3G7TA 3DI2B 3GT6A 3E6HB 4KQ4L 1ACYL 2OW6A 4WHYG 4X4KA 3T04D 1C5BL 1BREA 2NW2B 4IJ3C 4E9VA 1D7CA 4M62L 3GI8L 5E1GA 2NCEA 4QXTB 5HVWA 4CMHC 4AYBA 1WC7B 3MYJB 4LRNH 4P9HH 3LJ3A 1FE8H 3IAPA 2UY7A 4N8UA 1RVFH 2Y69B 1MAKA 3C5JA 5I1KL 3DWTA 3MACH 3OKNA 2AQPA 2VZ1A 5I8EA 1WFUA 2L7QA 3I50L 4Y2DC 4GO6B 3LN4B 1B0GA 1L6ZA 1KNOA 3Q1EA 2FJSA 5FYLL 4PJIF 5FGCE 4RAUB 4BK8A 5LNDA 4KZDL 4A7VA 5HSFA 1DQLH 2C34A 1D5XB 5CCKH 3H3BC 2VLRE 3SPVA 2CDEA 1PZUB 4H1LG 2XBZA 1U21A 2AKRA 1NMAL 1T5WB 2BMKB 3KYMA 4W4OA 3HNVH 4FD0A 4G1EA 3VAEA 1PPIA 3BGMA 1H3UA 3E38A 4Y2OA 5ES4B 1ZXQA 3LNDA 4R26L 3SDAD 3SDAA 4KRMB 2DQJL 1TCMA 2CIKB 1AQHA 5A6MA 4QRRA 5BNXD 5I23A 2X4NA 3X2QB 2XQ0A 1KIRA 3D9AL 3NG5A 3HNVL 3CMGA 2ADIB 5E4AA 2Y7SA 4YLCA 3OZ9H 3BH4A 1MWAL 1FF5A 2FX9H 2GBAA 4LSSH 2ZAIA 2W94A 2AV1A 1OSZA 1NGZB 4FQHA 1V54B 1U3HC 4LCIH 4Y1SA 3D18A 4WJKB 5LVEA 5DFAA 4MSWA 2DWDB 2PW1B 5AYUH 1SPDA 3MX0A 5E6ZA 1RURL 2ZKXA 2BNUB 3QUMH 1QA9B 1L3WA 3TC9A 5L9DH 3SGDH 1UFGA 3EXJA 1WBZA 1THCA 4KDVA 4Y19B 4ZW8A 4MD0A 1KTCA 2CKBH 1BXUA 3ROLB 3RGVB 3MRCB 4MNQD 2R1YA 3EYSL 1ZGLB 3FW6A 5AYUL 4X6DF 4ZO9A 2CLRB 1WBZB 4MHHI 1R3JA 1BQHA 5DO2C 4C56D 2D3VA 4FXLA 4KJWC 3FB7B 3VQ2C 3DMMA 1HHGB 4DKTA 3ZL1A 1ERNA 3MREA 2UWEA 1KMGA 4JDTL 4J27A 3EBAA 4D3CH 1J0HA 1T6BX 2VUOA 3QEHB 2GB2A 2YUXA 1FO0H 1NBYA 1ZSDA 4ZOAA 4NO5A 5EPMB 1U8HA 1HFUA 3UPCA 3RVTD 3ZE0F 2D7NA 2FHCA 4PTTA 5B4MD 1T6WA 3UL4A 4S2SB 1UXSA 4EI0A 1X5YA 3PWVB 2X4QB 4ES8A 3QNZA 4HG4J 3ZKQD 3QJTB 4A2MA 5EO9B 1HNGA 3ARFB 2XIDA 1RJYB 1XGYH 2F53A 5JIMA 3PQYD 4NWUH 3V8CA 2FECI 2HRLA 3O0RH 2B59A 5HYSB 1PIFA 1J86A 4OJEH 2GPZA 2IFFH 1JZ6A 2Y2YA 4OJYA 1XH1A 4YBQD 3CFEA 3GKWH 1K8DA 4ZFFB 4RDBA 1ORSA 4XVTL 5CFAA 3LS5L 4XN2A 1T3FA 1KCKA 3T6XA 1NLDL 3IFPB 3T3PF 2A6IB 3GSNH 5IMMB 1GS8A 4XNXH 4HXAH 3H4HA 2BSTA 4U1HB 2ZF8A 3JYCA 1A6TB 3U9WA 3O3EA 4IRZA 1NGYA 4U2ZA 2XWJA 1I1FA 2YMXL 3QQ3A 5KYYB 3FU6A 2V2XA 1T3FB 3E80A 1U93A 5AG9A 1IEAA 4B97A 3FUMA 1B9ZA 3TNNA 3P40A 4HJGB 3IDYB 3MOAH 4ONFL 2C1PA 2VDMB 2COVD 1TO5A 4LLWB 4NO3A 2VLLB 5IQMA 2EEAA 2EH7L 4KXBA 2WMPA 3DVGA 2X41A 1OTUC 1FLTX 4CUCA 4HCFA 1ZA6A 4QRPD 1OD7A 4U1JA 3E7JA 3ILDA 1QLFB 4Y9EA 1ORQA 3FT3A 4UT6L 2ODHA 2VC2B 3HR5B 3CVHH 4P48A 1KLUB 4JS7A 4HPYH 3VFVB 5I8CB 4RMSA 4UINH 2QHRH 1YEFH 1OAYL 2WLLA 1ZA6B 1I9RL 1ZGLM 3KBHE 1WIOA 3FQTB 4UT7H 2YA0A 3ZBMA 1U36A 4PJ5B 1UTDA 5A1AA 5K9KA 4GB9A 3QO0A 4FMVA 2HB0A 1W72B 3H42L 3S3SA 5FFLA 3BUPA 3MOQA 2FLBT 4JQIA 5HY9B 3MFFB 4PJ5E 4JHZA 2ED7A 5EBMB 3CWGA 3MBEA 3QZOA 4C56A 1L6PA 5DTFA 4F1SA 4B53A 4B9GA 1SN0A 4ELME 4QXGL 3TOPA 1U6AH 5I75B 1EHLH 2F7QA 5E6IA 4KJYA 4Y19D 1CFVL 3EADA 1BEYL 5DC2A 3SBWA 1ZANH 2HVJB 3IDIA 2G5UA 3D85B 3EGSB 4OKVB 1BVKA 2G4EA 4JFFB 3RTQA 1YLBB 1LDPL 3CIAA 2HT4D 4WZ9A 1PZ2A 3GBMH 3QEGH 1JFQL 3TASA 4WK2B 4I3GA 5HYSA 2W9LA 5CBEA 3BEWB 2J5LB 5L2KD 2Q76B 1FNLA 2EADA 5G5DB 1OM3H 3ZDYE 3WNKA 2NXZD 4KZEL 4WKZA 4Z7OE 5LUMA 1T03H 4M1DH 2CKBA 3SE9H 3QBTB 4I85A 1BLNB 4MJ6B 2G75B 2PO6D 4CVWA 5DMGC 5I17A 2NXYC 2TSBA 3L1EA 3QO1B 3CFJB 1KYAA 3K91A 4UZSA 3EXLA 4A7GF 4PRID 1UYWL 5BZXA 3DETD 5CKGA 2A6DA 5BS0A 3NEEA 4PP1D 2BSRB 3K71B 3VFOB 4FHJA 4HWZB 4Y19E 4FG4A 5FB8A 4DGYH 3AGVA 1CE1L 3TVMD 1E5ZA 2ZOOA 1ZV2A 4DKFL 2I7OA 5INCB 3UCRA 3C5SB 2NX5B 4RGMB 4WFHE 5DJAB 4HBQA 1ZWIA 4HIJB 5BVPH 2YUZA 4I9WE 4ACPA 4WK0B 1KPUA 3SQOH 1IKFH 4GRMA 1T1ZB 4NN7C 3T1FB 3V6OA 3RGVD 4X8XA 1KDIA 1NAKH 4WNSA 5D2NC 4MBOA 1S7QB 1WCQA 3ZTDC 1YEHL 4QXTA 4F7EA 2E9JA 1DBAL 3N85L 4OQTA 4WU7A 3RWFA 3CBRA 1MNUH 2JIXD 1OAZL 3LPFA 1JGVH 4W9DC 5FUCC 4AXWB 5C2UB 3FFCD 5I24A 5PAZA 2IPUG 4GUQA 3HC2A 4JM2C 2BXYA 4R7NB 3KLAB 2ZSWA 3NVQA 4QOKD 3VXUD 2H3KA 2Y3AA 3MO1A 3NACH 2IDTA 1NH6A 1QI4A 2GJ6E 3MLZH 1AFVL 2M26A 4ZAKD 4UILH 5KANI 2GABA 1A6PA 2V6HA 1H19A 3BUYA 1QVOB 4PJ7E 4FXGA 3F6LA 5CP7A 4G1EB 1PAZA 4LE8A 2GI0A 1I7UB 2EKSA 1KIQB 2WWMD 3U25A 3V5KA 4GKZA 4M6NH 4KK5C 5C7XH 1B0RB 1EDYA 3N2JA 3C60D 2RA1A 3BESR 1AVAA 4R84A 1N0XL 3T0EE 4ZS7H 5FV1L 1GOHA 2Y6TE 3RWHA 1CFSA 2AJSL 1JZDC 3DX0A 3VNZA 4Q97A 2IG2H 1NEZB 1EJFA 1F11A 1N0LA 1QAWA 3MNVB 4EDXB 4MNHB 3Q8CA 2WIIB 2EDQA 1R3JB 1P7QB 1DQVA 3QS2A 4LEOB 4KMLB 3FS9A 3FOLA 3KYKH 4BZ2L 2K1MA 2X6AA 2Q10A 2IBBA 5LAXA 3IFNH 4WRLA 3RZCC 1WLHA 1OK0A 4XP4H 1OT2A 3JWOC 3K2IA 4ZK8A 2CJTA 2WAHA 2P46B 1U4EA 1EERB 1AE6H 3GXTA 1CS6A 3M1BA 2VUYA 4JL2A 2P3YA 1EAQA 1I1AC 2AQ2A 2ARWA 4MQXC 5AUMB 1T1ZA 4YDNA 1C1EL 4CGUB 1D9KC 2DBLL 4KK9C 2X1WL 2J1XA 3MJ9L 2OJEA 1KV7A 3BUIA 5EO1A 4KRPD 5CZXC 4PGDB 3VI4A 1NINA 5F70A 2ZF9A 3HI1B 3IKCA 1CD1B 1DVFC 2X9YA 4AYFB 3KLSA 1A6AA 2BW4A 3L5XH 1AANA 5KS9B 1HH9A 5J13C 1N3NB 4NKQB 2VW7A 3BVNB 3GYRA 4YSAA 3MNWA 2VR4A 4FZ8H 3N9GL 1L9MA 2BY0A 3D4GA 5H94A 5C0CE 2BIHA 1II4E 2XN1A 1F56A 1L9QA 3BT2L 3JWOH 3FQNA 5FECB 2FATH 1A7QH 1UB6A 1R0AL 3D2TA 4N9GA 1BM7A 4DP2X 4YX2H 2IH8A 3LH2L 2OW7A 3QDME 3UAJD 5D4JA 2ZE0A 1XT5A 1YVLA 5BVJB 2HN7B 1Z9SA 1AS6A 4LLAA 4M5TA 2BS9A 2D7TH 1MFMA 2ICWB 4PD4J 5C09D 1NMCC 5I26A 2OYMA 1I9JL 2AJZB 2B1HH 5SWSB 1FNSH 1REIA 1RERA 3VFUB 4JFWA 4KI5E 1DYZA 3SDYL 5DDHA 2HXAA 2YN3A 3JUYA 3RU8L 5CBAB 1GOFA 2O5ZH 4YWGH 4F8NA 5AL8A 2X9WA 4FQPA 4L3EA 4LEOA 1ZT1B 1AGDB 4XP5H 5HJBA 3X1BA 5E4OA 2D0HA 1PKQB 5FKPA 3T6QC 3BQUC 1PLGL 3RDTD 3ZDZB 4EDXA 5FC9A 3VGAB 4GXVH 4ZXBD 5KSAD 1OHZA 3U0WL 4J3UA 2E8YA 4N8CL 1FFQA 5A2BA 3EUDA 1CFTA 1INQB 3RTLA 2XC8A 5DJZB 5C0NC 1YEDA 1RZFL 3PV6A 1HAWA 3LRMA 3NJMA 1T2JA 4S1DC 1DQMH 4BXSV 1KYOK 2COQA 3HRZC 4GG8A 3B9AA 3BKMH 4L9LB 4F33A 1B4JH 3SDDB 3FCTA 4BK5A 1QPKA 4IOSA 3B9EA 1MRCH 1S3RA 4XZUA 5F6IB 1OLZA 2PN5A 3NBNA 5DLMH 4OFYD 4ZUWB 2DAVA 4WI2A 5EOQL 3OKDA 2KZKA 4FQIL 3G3LA 1K5NB 3BDYL 4CSSA 1XZ0B 5E99L 4X7SL 4AE0A 5JPNB 1Z9SB 4V1DE 3CHPA 4GXUM 2F0CA 2FO1A 4N0YH 2ZUWA 4JDVB 3HI6H 4YFLI 2CK2A 2CU9A 3JTTA 1CL7H 1TEGA 3FL7A 3L2MA 2BW5A 2ITCA 4MLIA 1HQ4A 1BIHA 1TQTA 2A6KB 2HFEB 3X12B 4AVIA 3CX5K 2H0EA 4M62H 2VLRB 2OSXA 4J3OF 4N25A 1OTSD 1WP6A 2Z91A 1KGWA 4PJXF 4PCTA 4DP6X 4RX4D 1NA8A 3HG5A 2WXMA 3CC1A 2YRZA 5B8CB 5AENA 1E4WH 1XIWB 5DUPL 2XWJB 3QQ3B 3CFCH 5DJ0A 1CK0H 1IVLA 5DFWH 2ZUQC 4IRJD 3HUJB 1AGCB 5EUOE 1FORH 3JT0A 2XXGA 1UD2A 3S88H 4XVUC 4ZSOA 2D7QA 1GW6A 2NNFA 1TTFA 5CJQH 1UM6H 2NY6C 2CD0A 4LLDA 1QFPA 3VD5A 1M42A 2LLGA 3K8LA 4Q6KA 2FWLB 3WIFB 2P5WD 5IHUH 1G5GA 2L7EA 2F61A 4MZ3A 4W9EC 1JYNA 3PHAA 1TNNA 2CG9X 3POCA 2X89A 2K6ZA 3FUEA 2ALWA 3MROB 5JHLH 4TULH 1LEIA 1MHPH 2ZXQA 4MX7A 4NPJA 3U7WL 4P2RE 1IV8A 4QXWA 1SLXA 4J3OG 5DVPA 2WLLB 3F7PC 4MA3B 3BGAA 5EF3A 2AEWA 3O4OB 3SGEI 1LQBC 3Q8EA 2D3NA 5CLWA 4APQC 4ZUUB 4R7NA 3G5VA 3WOVA 1E6JH 4HUVB 2P44B 2QVIA 3ETBF 4TQEH 4QHLB 1HC1A 2CGRH 4R8WL 2RQEA 3AG2B 3EOAA 3P4OA 4JKLA 2Z31B 2IC2A 5HBBA 4XP1L 4LPYA 4YFDB 1JPFA 1HWWA 3VI3E 1L7TL 1AO7B 4H20L 2BZ7A 5CP7B 4AWJC 5C07B 1FBIL 1MXDA 1NTDA 2H9GB 6PAZA 3VDAA 1UCBL 4JRYB 4FCAA 3JTTB 3W11D 4XXCA 1JV5A 3ALWA 3M17B 1YEEH 1MIML 5A16A 4NQEB 4NZTL 1QPXA 4H0IA 1WBYA 1QATA 1KTDB 3A0OA 4OBRA 2DM4A 4TS6A 3SCMD 4JG1L 1G9NC 5LBSH 1MJJB 5I2IA 2XHNA 3P0YL 4JB9H 4MMXC 5F1SA 4D0DA 4X8JA 3WSQL 3KPSA 3LOWA 3V52L 2Y36L 2PTTA 3UBXG 4V33A 5GIRA 3P2DA 2BOLA 4WCYL 1FNHA 1ZVSA 4NHUA 5BOZG 3BSGA 5I5IA 3GSUA 4EEEA 1JCKA 3T77B 4PS4H 3HPJA 4UQIM 1AR2A 4FQXB 1KIPB 1TMQA 5D2LB 5T3ZD 2J72A 4R4NC 1F11B 1FZKB 3QWQB 2WXIA 3AAZB 3GBDA 3DTUB 4HWZA 1HZLA 3D2UB 1T7ZA 3B3BA 1UGKA 4X4ME 1TJIL 4NQVB 3Q8BA 1W91A 2BP3A 5JW5A 3P77B 4JKKA 3EOBB 1SXNA 2VN6A 2R2BB 3DARA 2WIIA 1KCRL 4OM1L 2YAOA 3ULUH 4APQD 3MLYH 4QMEA 2NR6C 4JHAH 5FA4B 5DZAA 3BSHA 4N8VA 4MHHG 3ISWA 3UJJH 5I0ZA 3PABB 3QDMA 4GQ9L 4PY8J 5GJSH 12E8L 5I8EB 3PXLA 3MRLA 3MRGA 1XGRB 4B3VA 5AB1A 3MOBL 3KYNA 5H2BA 3KPSB 4HOMA 5C9JB 1LE5A 3M7FB 3ZE1E 2WQ8A 3GMRB 3EG9B 1UB6B 2F2HA 1FPTH 1BGXL 1D5IH 1NC4D 3L5WB 4TVPL 1RJYA 4PJIB 4RWYH 5FHAL 4Z7QE 1QR4A 25C8L 3QCUH 2NYYC 3DX6A 1HSBB 5HI5D 5T5FH 2VO5A 4YK4C 2V9RA 2Q87A 3WJLA 3GJFH 1FFRA 5C8JB 5DHEA 1JGUH 2CK0L 1J1OL 1SXAA 1KGYE 1MY5A 3FT2B 2QQQA 3HS8A 3CZFA 1T83C 3FQUA 3QORC 4UWQB 1MCLA 1WWBX 1L9OA 5CMAA 1G7MB 4GRWF 2G9HA 3LZPA 1AYRA 1CBVL 4HLZG 1OF0A 3ZL4L 2AKRB 1GZPB 4G5AA 3LB6D 4ZBJA 1Q9LA 2GTWB 2GQHA 3Q2WA 4DPBX 2D9CA 2HJFB 3FO2B 3LKSA 1XIWD 5FPIA 2Q8BL 3PDOA 4LF3B 4EBQH 4CL7A 1IFHL 2ICEC 3NA9L 4YXLH 4XBPB 1I75A 3RGVA 1ZGLA 1OB0A 2GC4C 4XMPL 4ALAL 1MCWM 3DRTB 3UROR 5HPOA 2ENSA 4URTB 4FS0A 3MGOA 4PJBA 1HNYA 3KXFD 4P23D 1ZLEA 4YDKH 3M1BB 3D0LB 1T80A 2IGFH 3V0FA 3KR3L 2Z31C 2R27A 2V0AA 4PJXB 4JPWL 2YSSB 5FO7B 1JNNL 2CHZA 1F4XL 4PG2A 4J3XA 2GT9B 1BXXA 4PJIA 3C87A 3GSWA 4HKZA 2PUQT 1NGYB 4Y4FC 4KK6D 3AT0A 3BP4A 5J3HD 3HZKB 2YOAA 5ELIA 1X44A 1XH3B 2ARJA 2M8XA 2I26N 1IEAB 1IT9L 4DJMA 3VFNA 1L7TH 1PG7W 4LT7A 3V0AC 3ES6A 4G8IA 2OXGB 3U7WH 2R7EA 1PZCA 2JCCF 3II1A 5H2BB 2MCAA 5AZUA 4LVNC 3V8OA 4BZ2A 4FFZH 3D2UD 1H15A 1DANU 1NMBH 3DJ9A 1QBLL 3ZT7A 4JO1L 3TFKC 2FX7L 4N20A 4TQ8A 3F62A 5IGXH 2JKJA 4JKPL 2PWGA 1J5CA 3DV6B 3EG9A 2HFFA 3T2PA 3N3EA 3CSGA 4JFEE 1O6VA 4H0HB 3VQLA 4R4FH 3LZFH 3VFWB 3K5SA 3LZRA 2XXMB 2ZUQB 4V1DB 5CN3A 3MRPB 1JWMB 2EZ0D 3NSJA 3ATEA 4W68A 5T3XL 3B7TA 3S36H 1UJ3B 3RFZB 3IJEB 3WFBH 1U8HB 2R0KH 2MQ3A 2EDKA 4ZS6C 4JZNA 3S96B 1DN2A 4KHTL 4PI0A 1OP3H 1NBVH 1OSEA 3WL9A 3NSFA 2J1ZA 2XKNB 2G9HB 5FGCB 2BVQA 4N6RA 3C8KA 5I1GH 2J6WA 1EFXA 4Y4KB 3DO4A 2ZP0T 3LRGA 1LP9E 4KMTL 4DGWC 2WINB 1WQVT 4OJFL 2CXKA 4WNQB 5KVFH 2W88A 4DKEH 4BSJA 4BWWA 3MCYA 4WUKH 3BLKA 5DEFA 1CZ8L 4F80A 2UZXA 2ZWZA 5FKPB 5GHWH 3HR5A 5DHVB 5F7MC 4IDJL 1SJEB 3RWHB 5T1MB 4PYGA 2H8PB 4WGKA 2E0PA 1E27A 1JNLH 1QO3A 2XWZA 4POYA 3WI9A 4IU3A 1I8UA 1EZSA 3ZTNH 2ZD0A 2J6EL 1HZHL 1FFPA 2HLEB 5EOCH 3QWRA 3WS6C 1CR9H 4IRJC 3GMMA 2AK1H 3MV7D 5E95B 4AT6A 5J13B 1TFPA 4GAYB 1JRHI 4LSPL 5EOTB 4PP1C 3CFJA 3WKMH 2PYFA 1A02N 4M43H 4PB0H 5IEHB 5IFJA 3EGXB 2H6PA 5T1DH 1ZLVH 2I60H 3U4EA 3U9PL 3GJEB 2F08A 1YJDL 3X14A 4XB3A 5E2TH 5ABAA 1F1AA 4M8QA 4X9HA 5CZRA 4GP4B 4LQ1A 2BOCB 1EZLA 2YD7A 1FH5H 4IK6A 3BVVA 1GXEA 5EU3B 2QJDA 3FQNB 1B9KA 3GXDA 1JZIA 3RURA 3AADB 1IC5H 1BZDA 2LVEA 4UAOC 2XI9A 5KVMC 1OAXL 1F0LA 1T7WA 2Y7NA 3LD8C 4JPKH 2VZUA 4PJGB 4EIGB 1XF1A 1E90A 4MMYA 3SE8H 1P7QD 4HAKA 2RALA 2A9DA 2A0LC 1UOKA 2I9LA 2ODIA 4U1NB 5T1LB 1CDHA 1DJIA 4LSVL 3I02A 2XXFA 5DTFB 3R7QA 1QFWH 4UDTA 3P54A 3QHZH 5AOJA 4C4KT 4P2CG 3H55A 3RIAK 3GBLA 1E9OA 4WO0A 3U7YL 3U4BL 2NXYD 2BPBA 1DVUA 4TRPH 2AEIT 3P4LA 3BPNC 5CBAA 3A3YB 3EFFA 4WO4D 3CN0A 4HLEA 2FGZA 2Z34A 1G7HB 4FQXA 1A4CA 4PLJC 1A7PL 2V7NB 5IB1A 4LSRH 3ARPA 3BVTA 2J43A 4NNPH 5M95B 3K6DA 1JDDA 1GTFA 5FFOA 3PL6D 4QRTA 3HHSB 3GS4A 4LDEB 5G55A 3FYIB 1JXFA 4OUUA 4WFEE 4GKZB 4KKLC 4WWKB 3ARDC 4FI6A 3IK2A 4Z7UE 3WFCH 3U7AA 1WEJH 4JDEA 3S9DB 3LS4H 1G6VK 5HI4D 1EZVY 2FJHA 2PWEA 1I53A 5DMIH 1HQRB 3TF4A 1D9KB 2DTSA 3L9YA 2XVLA 3LEVL 4Z23A 5KTEL 5HXMA 1U41A 1ADQH 1OT4A 3I84A 3Q6GH 4OCXH 2F5BL 2GJ6D 2ENYA 3F12A 4AIZB 1GJUA 1FC1A 4OCLC 4M48H 1HH9B 2ZJSH 5DK2A 5C09E 3UO8B 1PLGH 2XTJB 4Q6YA 2P8LB 3VWJA 4F33B 1A7BA 3DO7A 5D7LE 4QJ4B 4KI1A 2CUIA 3F84A 3LN4A 1T1YA 5H4YA 3PHSA 5MEOA 1DANT 4XO3A 5DC0A 1U3YA 2CBMA 1T03L 1JPSL 1YPZF 3QNFA 2UXFA 3AQDA 1S7QA 1PG7X 3MLXL 1BYOA 3QEQE 4R7DA 4JEGB 5FM8A 2FX8H 3GBEA 4MA1C 1MJJA 5HTSA 5EO1B 2WSPA 4NWTL 2VDQL 4KX7A 4NQXB 4WTQA 4B6ZA 5CS7A 4UQ9A 1E9OB 2DQGH 1RUKL 1M6OA 5KS9A 1ZHNB 1TO4A 3GTTA 3RWIA 5B1JA 1TTAA 3K72A 3WTXA 2J20A 1TETL 2J8UF 3K8KA 3BEVB 1CI3M 3UC0L 3QVAA 4XPBH 4DH2A 1TQCB 1NLBH 4K3DH 3NFNA 1KEMH 1E40A 1G7MA 2OL3L 2VXQA 3TIDA 2NUPA 1DR9A 1RFDH 1NGXA 2V9TA 3NABH 2BCKA 4PW9A 1YQVL 4XPHH 1QSFD 5AUMA 3OKOB 4FQ1H 1OKEA 3BT0A 4LSTL 1DJWA 4PBVC 1FN4B 3IF1B 2ZX6A 4K94H 3MBXH 4WGVB 3HS0C 2QQNL 3GHPA 4TM9A 2QKIA 2DWXA 1KXHA 3G5ZB 4YZFF 2H1PH 3WUWB 3O9WC 1JGLL 4DK5A 2D31B 2OR8A 5IBUB 4DCQA 3DUUA 1E43A 3IMUA 2GTZA 2XJKA 3MXWH 2IFFL 4XNUH 2YQ2A 1YJDH 3DOSA 3QIWD 3EOAB 3P4OB 5B4MC 3QUKB 1N3NA 1MAML 5FEBA 4R2GC 3Q06A 2ZXEB 1JNLL 4HGMA 5MENE 3K6SB 1EUTA 4QRRE 1KSRA 3Q43A 4LCUA 3FDWA 4KGJA 5D1QB 1TEFA 4PGZA 3C2SA 3KVQA 4MA8H 5E6ID 4V1DA 1QUNA 4TUOA 5JR1L 4LOEA 5I5MA 4J23A 4DIXA 4DZ8A 3MNWB 4PR5A 1ND0A 4XHJD 4J4PC 1CIDA 1OOWA 1BAFH 3KBEA 3JUZA 3BP7B 5HHPA 1BECA 2WQWA 3RX8A 2Y22A 2ZKHH 5MI0C 1HE8A 3QIBB 1TQSA 2ZXCA 4ABUA 5BXFB 4P2AA 1G7JA 3LKNA 1GGIL 2DM3A 4YLBA 3RWJB 1NGXB 2XQYK 3O3DB 5L4MA 4PJ9C 3DDFA 1JZGA 2OP4L 4FI8A 3MV8E 5EC2A 3HZMB 2Z7ZA 1I4FA 1Z5HA 3CK0L 3P1VA 4OLVL 4NQXA 1B2YA 5A2FA 2VWEE 4J39A 3BAWA 3FZUD 4TUJA 5E5RB 4G5ZL 5GGUB 5I6LA 1WAAF 2XWTB 2EH7H 5MHSE 5E03A 3HE6A 2DW5A 5AW3B 8PAZA 1X7QA 3WEXA 4K07A 1UJ3A 3ROLA 3ABLB 2DIBA 2OYPA 1VACA 1MI5A 4FZEH 3E8UL 5F7WC 4BELD 1N2RB 1CF8H 3CN4A 4ODXB 1INEL 1EFXB 4Y4KA 4OQ1A 4Y89A 4PGCB 3SDCA 4DK3A 2BY3A 4O2CB 1C8QA 2YBRB 3AU1A 4J3OH 1MI5D 4POUB 5F1IB 4OGYH 3NCJL 1H9DA 5BS0B 1FLRL 2EDRA 2W60B 2WXRA 5CJXA 2ED6A 1MCJA 3BWAA 4P23C 4JG1H 3MJ9H 1UM5H 4R7LA 5JDSA 4OZFG 5LBSL 4NUJB 4AYID 4DZ8B 3CN3A 1PX4A 3C6SB 4G59C 1OCRB 2Y72A 4GIOA 1G1KA 1WWCA 3V0JA 5T33L 4PRDB 2P43B 3CJJA 3QXAB 4KJWD 4OCXL 2Q7NA 3Q9PA 2X9ZA 4FG0A 4UT9A 1DSWA 4LEXH 3GMMB 2VN7A 4R90L 5K39A 1I1RA 1PY9A 3IMBA 3IDIB 1KBBA 4RMWA 3V7AG 5D1XE 4L3EB 3OHXC 3EGXA 2KHAA 5EDXA 3RL2B 1BQRA 1MJUL 3WFCL 5CP3H 5IIEA 2EE0A 4L37B 3NRFA 3FTYA 2FSDA 4RMQA 4F9LC 4LEXL 1NC2A 4Q0XH 1M3IA 3LXAA 4ZO6A 1NL0H 2VQ4A 3WNJA 3N1MC 1GMEA 3GRWA 3QUXD 1J0ZA 1MI5E 4HWNA 1DE4A 4RFEB 2R0ZL 5CEZE 3A23A 2ZCLH 1KNOB 2YAFA 1Y6NR 2OR9H 3KXFB 4CC0A 3W9DB 1MVUB 3QI9C 2FWUA 3VCLB 3BE1H 1Z9PA 1G9ML 4YXKL 1V7NL 4R7VA 3O2DL 3TBSB 1IGTA 3I02B 1WCBB 1TF4A 4KMQA 2E6PA 3QQDA 2PTUA 5JIKA 4FMKA 5D71H 5E9DA 5J11C 2FX9L 4HBCH 4XC1H 2HA1A 2LHAA 5ANMB 5KSVA 1YMME 5JXEA 4P06A 1XL4A 5SWSD 1KACB 4LLYA 2CUHA 3MNVA 4DEUA 4JPVL 1N5YL 1HEJC 4WEBL 4IKLA 3ZXAC 3HCVB 2ADFH 1RIHH 3AXLA 3QXWA 1HU8A 3TCLA 3C6LC 5IWLC 3ZQ9A 3U6RA 1PAMA 3GKZA 4L8BB 4Z6AT 2C3VB 3UO1L 4AVKA 4CU7A 4D0DB 1NCHA 2DMCA 3IJHB 3IJYB 2FEDC 1LEGB 1ZHLB 2Z6FA 3MKKA 2VT0A 4B50A 1LK2B 1MCRA 3N85H 4LMQE 1DZBA 2VDMH 3Q1SH 3CZGA 3MX0B 4GRLD 1QLFA 4R4ND 2CO7A 5IW3A 5JDJA 4NHUB 3L3KA 1P5UB 1R1CA 2DEYX 4XP6H 5DK3A 3FFDA 1G7QA 4PRIB 4KROD 4LRNL 2JJSA 2XUWA 3MRIB 4DP7X 4L5FL 3E1F1 1DSFL 4U6YA 1OQOA 3UTTB 5KZCB 1LD9A 3US9A 4B9PA 2GSGB 1VERA 1M1XA 4PJEE 1AHWC 5LGHL 5CWSA 3F58H 4JMXA 4LSQH 3RAJH 1JZFA 5T3ZH 4AY0A 2ZG2A 4GI6A 4P0DA 3P77A 3DROB 4AV4A 3VFRA 4UT6A 4ZUTA 3O11B 3INUH 1SDYA 1QRKA 5I30H 5E6IB 4PTUA 5C3TA 2Z93B 5IV2B 1F4AA 4LHUB 2JJTC 3HG0A 1XBDA 3V6OE 2OL3B 3NUKA 5CILL 4XWOC 2Y7OA 3OKEA 3PAZA 3SPVB 4BINA 5DJCA 2I07A 1IAIM 5AAWA 1F58H 2W0LA 3T77A 2YMXH 3T0AA 3S88L 2ATKB 4DGVH 1EZVX 4Y16D 2WVSA 2OTUB 1N6QL 1C5DA 4AK2A 2N4IA 4AJYV 3MV7B 4D7PA 4PCYA 1F3DJ 4XNXL 3SO3B 1NIFA 5ICZB 4R7DB 1BVNT 2NDFA 1KFAL 5CHNA 1HWGB 2VLMD 4L1DA 2HFGL 2WQSA 3G08B 3TV3L 2RQ8A 1KB9J 3L7FA 1KIQA 4EZJA 2OTUA 4ZX5A 4K3JH 2FEJA 5KUKA 4XE0A 3BZ5A 4PVLA 1QVOA 3HZYB 4MRCA 5C09A 4O02A 2BXZA 3IN0A 2X2YA 3DC0A 4ONFH 3WD5L 4FDWA 3QC5X 1OSZB 2OMWA 3QORA 4MAYD 4TSBL 4OFIA 4RBPK 2V8LA 1FGVL 4F7EB 3VD1A 3NGBB 4RRPM 1S5IL 1QFUH 2VN3A 1XSJA 3DV4B 2H2PC 4HKJB 1INEH 3KPQA 3IXAB 3N9GH 1I8LC 3ZR6A 3E8VA 2B4CC 3FU7A 2QADC 2UWEF 1OPGH 5KBDA 1A8ZA 4HIIA 4U1MB 1LO0H 3NZ8A 4WLCA 4ANWA 3DGDA 3GZPA 4WI6A 1BZ7A 1I9RH 3BVNA 1OAKL 3SE4A 4A66A 3SOBL 3IS1X 3KM2A 1Z9OA 5EU6E 3WIHA 1TPXC 2R2CA 1HILA 1AXSA 2MQCA 3VGFA 43CAB 3ILQD 5HDBF 1JN6A 5HI3C 3GTVA 3NJIA 3QZPA 1IBFA 3V4VH 3TESA 1ETJA 4NZ8A 5DWUL 4IDJH 1DDHA 1TVHA 1HHGA 3R8QA 2HTLD 4P46D 2AK4B 3D0LA 3C08H 2FUQA 4WWOA 3CPLA 1AXTL 2JQZA 3BRDA 4P5TC 1WK0A 1BVLB 4JRLA 3QUZB 1AACA 3SDYH 4HOWA 4MCMA 1JZ5A 2ZYRA 1AS7A 3AREB 3IDUA 3UXFA 3VG9B 1MJUH 1R3KA 4QLWA 2XNAA 4ZYKA 1MF2H 3GSOB 1VACB 2APFA 5C2BH 4OM0H 4UCFA 1WZKA 1GGYA 4NXSA 4JX0A 1BBDL 2Z0BA 2J44A 2DQHL 5JHDD 3NIFE 3CHRA 3UBFA 1YG9A 5F96L 1NAMH 3JSSA 2VZ3A 4Q4IA 2JLLA 3RG1C 5D7IA 2XFGB 1DSYA 2ZOLB 2OR9L 4H0GA 3II3A 1FO0A 4NRYA 2YMTA 5EU4B 3RWGA 3UJTH 5K9OB 4GKSB 3MAWA 2A83B 1I7TB 5IB4A 1WT5A 2IPTL 2NX5E 2APWA 4IIQA 4UDTB 1L4IA 1BF8A 5EN3A 3FUNA 4M7LT 2MCG1 1XCXA 4Y8DC 5FUZL 3CMOL 2PW1A 1GGTA 4R97B 3DLQR 5TFSH 3KPRA 5LAPA 3KAAA 2ITFA 2WLIA 4XC1L 4I1NB 2EC9U 5C09B 4Z76B 2VDLH 2QVMA 4NCC2 4PH8A 5DDHB 4L4TD 2G0LA 2BVUA 4OD2A 3TA3A 4AEHH 3DMMC 4RNRA 1A7RH 5E99H 4YHOH 2XOTA 1OV8A 1RIVH 5AAPA 5I15L 2PPFA 2FWSA 4QWWC 3F7YA 3U1PA 4Y5YB 3KW8A 1NFDA 2GSMB 2PYFB 4GKLA 4A39A 2EZ0C 4XRCB 4CN6A 4GEJA 5K39B 4OLWL 4G7RB 1UXLA 5EFIA 5D1ZD 1B4RA 1KJVA 3WKNA 5CJQL 1AGFA 2O5YH 5E9AA 1R17A 2YLKA 1P6WA 4UNUA 4ORZC 3GSXA 1IAOA 2JJUA 1SQ2N 2CHDA 1SEBA 3EDKA 4Z7VB 3FJTA 4JMNA 4BFJA 3IJ7A 3F05A 3QEUA 4H8HA 4ZFOL 2Y7QA 3K6FA 1N59A 1TENA 2D9QB 3QQDB 4FI7A 5DUPH 2BIQA 1VEOA 2BP5M 3EFOA 2MH4A 3RJOA 3WN5C 3DECA 2K9FB 4JFDE 1MIEH 2DI9A 2JKNA 1OM9A 3HR6A 1ZHNA 2HFGH 4HT1H 2Z7UA 1B4LA 1EEZA 2NY3D 1EV2E 3KXFA 3MI6A 4U1GC 3VMPA 2BVQB 1THAA 3I6LD 1O9WA 3VU1A 4XTRC 4S10A 1T2XA 2VDKL 4JBSA 4WJ5A 3NZHH 5D2LE 1CG9A 1HOCB 1NFIB 4PRBA 1IKNA 2YWZA 4JG0H 3T6VA 3ZQXA 3V4LA 4EI6B 3ML8A 1XIWA 4G80B 4N5ED 1CTMA 4FTDA 1O7DE 3PNWB 4W9JC 5JHMA 3WXVL 3IGLA 2PCPB 3MUHL 4PSRA 4E41D 4AYEC 3HEIB 2ATPA 1Q0XH 4ZW3A 1ZHBA 1G9EA 4XI5C 1DJHA 4Z77A 3G9VA 4AI7A 5C97A 4HJJH 1QBLH 4YUEH 4KO9A 1IQDA 1ITCA 3U6RB 1QEWB 1QNIA 1VAHA 4JFDD 4LFHD 3ETSA 2NSXA 2H32H 1LE9B 3A6BH 4MJ2A 1JHTA 2JNZA 4WWPA 4YE4L 3TU6A 2I9TB 3CIQA 3BDXA 5DJZA 5B38G 3ATAA 2DJUA 2BERA 2H3NA 5INDB 3O9WD 3MRMA 1Z1WA 3OR6A 4R6UA 3IMVA 3RX7A 4KK8C 1KN2L 3BPOB 4TSCH 5IZ7A 1W8NA 5HJ3B 3VD7A 3OKEB 2B77A 1J8SA 3MBED 3MSPA 4KO5A 1XB3A 3S4SG 1RP8A 2JQMA 4ORGB 4ZUVB 2GITA 3RY6A 1BBJA 1SBSH 3QUXA 3DSNB 3WHE1 4G6ML 2OJ1A 3ZJAA 3U0PA 1YUKB 5CINH 1MCEA 3T2NL 4WHTA 3C12A 3SO5A 3NIFB 1LK3H 3O81A 4TTDC 2WANA 5DURB 3VFGL 4NUMA 1PIGA 3K2UH 2BHUA 2Y7QB 2CJSA 5FGBC 2YPLD 3NQKA 4M7ZB 3RL1A 5CGYD 1EGJL 2UV3A 1F4YL 4LLVA 3IEAA 4TNVF 4EZKA 2WXHA 4LLUA 1E50A 3NCCB 4PIBA 3CSTA 2G30A 3RWIB 1AQ8A 1L0QA 1XGTB 4GUPA 5FS5A 3Q44A 4IHOA 3BSZH 4NQDB 4Q56A 4PG9A 2BVOA 4AEIH 1BZEA 3KNBA 4M9OA 1GSMA 3QHFL 4WFFE 5DS8A 3OMIB 4KKBC 1CU4L 2DQHH 2VITA 1I8IA 3QDJB 1N5AA 3OSVA 2AJ3A 1KFGA 3TTYA 3OLGA 1AR1B 3NH7H 1AHMA 3NJXA 2GAZB 2C7FA 4XMKL 4Y2OB 4UNIA 2Q76A 1DQML 1S7SB 2QTEA 3V2AR 3C2AH 1ZHBB 4KJQC 3IVKB 4M00A 1I8MB 3F65A 2CK0H 2VITB 5C0AB 3NK4A 3LDBC 2PCPA 1F02I 4J3BA 5ETUA 2GJPA 5I1EL 5IROD 3L3KB 4DCQB 1BLNA 2DBJA 4LLQA 4AQZA 5HHME 5D72L 1JTPA 3GMRA 3NFPB 3HI5H 1ESOA 3C5ZB 3GZQA 3OKMB 2YKLL 3PHQB 4PQXA 1A66A 4JFHE 4H88L 5GJTL 3HTLX 4E9QA 5I1DA 1GS7A 3D07A 1EJOH 3NPSC 2CUMA 3NCJH 1S7WB 4I2XB 4WIQA 1H8SA 3JZ7A 1ID2A 4GXFA 5D7HA 5B7MA 1YAZA 1ZE3H 2EEFA 3W0WD 1DQDH 4HUNB 3N40F 1F4HA 2VQ1B 3CCHB 1S9XA 5MHSD 5TE4H 3SEPA 5I6XB 5KBNC 1EVTC 4GSDH 5I5RA 2XTJE 1F4WL 3FCGA 4RGNB 4FFVC 2WXGA 3FH8A 1RZJC 2EDNA 3RIFK 1FE8L 4LCCC 4FFYH 2APTA 3KGUA 2BNQB 2DWYA 2P4AB 4JJ5B 3TA3D 5SX4H 4MDRA 5F72S 1G0YR 1HHHA 3KL0A 7CGTA 1LEKB 5C71A 2LAAA 4TNWF 4B9FA 4TRPL 2R1YB 2YAMA 3AREA 4NGHH 2ZOKB 2O5YL 3LH9A 5DU7A 3KPRD 2IOIA 2NY0D 1PBYA 1OHQA 1BPLB 2KZWA 3QUZA 2VN4A 5TD4A 3BGFB 3GZKA 4XCCL 5IHZA 4GQRA 4YBLB 4AIXA 4BFBD 4GMSH 4X4YB 5SWQA 2V2TB 2V17L 2FRGP 2HPTA 1P4LA 2IAMD 3ZSSA 4TN9A 2Y07L 3Q48A 5FOJA 2NY5C 4X98A 3MC0A 3GXNA 5IHUL 4KO7A 4FQQA 4K71C 1TSHA 5CUSH 3VWKC 1VIWA 2OTPA 5CEXA 2O61A 1A6ZA 4FJYA 3L9BA 5TDOB 4HS6A 2ID5A 3DJSA 4ETQA 3MRBA 2B08A 5KYYA 2MTPA 5FA4A 2AQ1A 1N5AB 3OZ9L 2FGWH 3B43A 2J88H 1E5BA 2NY6D 1G9MH 5CXPA 2WVTA 4EKJA 3N0AA 4PJ9B 4WI4A 4BH7B 4PS3A 1IQWL 5DS8B 1PJ9A 3FB8B 1AGEA 2XZZA 4N9OB 1MCIA 3RUGA 4ODTH 5JLZB 2KLRA 3GS0A 4PRNB 2FEEL 1A7NL 2WLIB 4FQCH 4FX5A 3ILPA 3S5LA 3OZLA 2B4CH 2GAZA 3TO4B 3ZHNA 4UZGA 4FFZL 3OAYH 4MDIA 2CLVB 3QUML 3B2XA 5A2IH 5CJOH 4FNQA 4BV1A 4FJZA 4Z7VE 3NA4A 3KH4A 3VTAA 4HISA 1ETB1 1FZOB 1OB1A 4U7KA 5FX3A 2XWXA 2PWFA 4QHMB 5K59E 1G1YA 4GRWB 3II2A 4PRHE 5K59F 4I88A 4RMRA 3ZKXC 2BCMA 4HKXA 4XN8A 4RESB 3OHXB 2Z4TA 4J6RL 4BZ1A 4TVPD 4UV4H 4WEUD 1MFVA 4FADA 1BZ9A 1KT2A 5MEPA 5AKTA 1CFNA 3PWUA 1VADA 4XNYH 2VQ1A 5SWSE 1P5VA 5F88A 5JHDB 4W9HC 3T6ZA 4N2CA 5E9DD 3WL9B 5KS9F 1IZJA 2QMKA 5HVGB 3OV6A 3U79A 4KV5F 2HJFA 3FTVA 3LKSB 4N3TA 4NUQA 5D93B 4M7ZC 4QCIB 1U8JA 2VQUA 3AT9A 2FEDD 1A4KA 2I85A 2W9DH 5DLLA 4X6BA 4ZUTB 4HKBA 1L9SA 2A77L 1WUZA 1YRKA 5C6TH 1A6TA 4PS4L 4KTYA 3IGKA 3NCWA 1K4DB 2FO4B 5AZEH 2DYPD 1OAQH 1HINH 4X6CB 4B5ZA 1JRHL 2XZCL 1J9TA 3T0BA 4MNGE 1U2CA 4MJ6A 4KNSA 5DQJB 4J12A 2IDSA 3TNNB 3QFJD 3HZVA 4XVTH 5LG1A 5DQ9A 5I30L 4R97C 2B1OA 4F7TA 4FQ2H 3DGCR 2Y7LA 5EOCJ 5FYJL 3ZHFA 4GS7B 1WHPA 5T3XD 4XNBA 4NC2B 3LAFA 3MLZL 2KYIA 4NKDB 4MYPA 2C3GA 3LNFA 3CHXA 1Q9WB 3AU0A 1LO3H 1CWVA 1P4UA 4FE9A 3JWDL 3T3MB 5L0QB 3IAGC 1IGCL 1SJXA 5EUOB 4LSPH 1NGQL 1T4KA 3FU8A 1H8NA 4D9QD 4NP4H 5MEPB 2R0LL 3QDAA 2IAAC 4E2OA 1LJMA 3VFPA 4BK5C 3HN5A 1M2OA 4Z7QB 4IYKA 1P9MA 4IBZA 2PW2B 1X9LA 4QD2E 3WHXB 5I5JA 2X2UA 1EEYB 2WTRA 3FQ1A 4ODXA 2P5EB 3EFDL 3PLYA 1AD0A 4D0BB 2YSSA 2VDLB 1QSFA 4FFYA 4ENED 4UT7L 1E27B 2GJZA 5C0AD 1FH5L 3FTSA 3QXDB 1QKZH 1U95B 2X6BA 3ULVH 3QIWB 4OZIA 9PCYA 3C6LA 1U42A 4LHJB 3FCTB 4DVBB 4B0MM 1A1OB 3MUY1 5DR5H 1WBXB 4PLKC 4WU5A 3RFRA 1CXFA 1QBBA 3HBZA 2OFQA 1I85A 5FHAH 3IFNL 4HVBA 1VGEH 5EU6B 1T89A 3MLRH 1KBWA 2DD8L 3MREB 2QV2A 4M5YH 4R2GB 4MDJB 3NSXA 4PVNA 4U1SA 4RH4A 5C0BE 3KL3A 1OE1A 4LP4A 1M7XA 5T3XE 3U6XA 3B83A 5CU5A 2DIEA 4IHBA 1AQKH 3BZ4A 2DMKA 1M71A 1VPOH 1U8CB 1LO0L 35C8L 2D4DA 1MHEB 2R29H 1NCUA 2N01B 3JVGA 3OAUL 4MA7H 4PV9B 5E0FA 5DZ9A 3W9DA 3L4XA 3T4YA 3X12A 1JF1B 3TXAA 1N67A 4IRJB 1FCCA 4KRPC 4L0YA 3H54A 1HESA 2Y07H 4XAWH 1M53A 4LU5H 4YEEA 1SY6H 3P2BA 1GHFL 2FTAA 3OHMB 1Q0YH 1OPOA 2XKSA 3KG5A 3QXVA 4G3YH 4ZMZA 2WB1A 5EU3A 4KZEH 3DX6B 1QPPA 3RIFF 4Y2DB 1PVHA 3LNHA 4PJ8B 2JB5L 1FCGA 2QSCL 1VCBC 3B34A 3WFDH 3B9DA 1CG9B 1HOCA 4PRBB 4CVZA 3CLFH 4BSVA 5D93C 1DUZA 1CLYL 43C9B 2NYYD 1KTLA 3QJFA 3S3CB 1NCTA 3FT2A 1MCSA 1H5BB 4NZDA 1FYTA 2VSCA 3M07A 5ESVB 3P4NB 5D1QD 3X17A 1BSIA 2B9BA 2F19H 2WPGA 5GGSB 2CO7B 4IHOB 4TLKA 3S37L 3AMKA 2JCCE 3LD8B 1RPKA 3IF1A 1HOEA 4WNQA 4WF7A 1FZJB 3ZDXB 2VIRA 4EKXA 4WUUE 2JKRM 1NAML 1L3NA 2A9AA 3IU4L 3UJIL 4D9LH 3P9MA 3BO8A 1DEDA 3X1FA 5T1MA 2MNJB 4P2QD 2DQDL 4WI5A 5F0JB 1GPOH 1YN6B 3ZGHA 2WV3A 3QZWB 4TPRL 4Z1PA 2HMIC 1RULL 1QTPA 4YHKH 1LL1A 1JPEA 4LZKA 4HFWB 4XHJC 5DRZA 4HLZH 5E6IC 4MMYB 4N5UA 4UUJA 3S3BB 3A6OA 2Z8VC 3DDGA 1NWOA 4QNPF 4K23H 4FF9A 4QYAA 5EBMA 3VSVA 2UY7B 1BDYA 2DPKA 5T5NF 1XAKA 3MBXL 4XAKE 3VVVA 4K3DL 1RUAH 4JG9A 4X4YA 5B3JE 2R23A 1TZIA 2BNRA 4ZFGH 3NFSH 4OV5A 1XAUA 1RUMH 2P5WE 1RMFL 3KM1A 2ZPKL 3C6EA 4YZWA 1LVEA 1UH3A 3ZZLA 1KG0B 1TETH 2OMZA 5AZEL 4PJDA 3LX9A 2D03L 3FQXB 5A6IA 1HSBA 2YIHA 3GGWA 4IMKA 4QHUA 4X4XA 1WFTA 3GJFB 3SCMC 3ULUD 4P5TA 1NZRA 2O72A 5CZXD 1ZRUA 2R1XA 5GGTA 2ICCA 4AVJA 1A6UL 1D5ZA 1NUFA 4O2FB 4BUQA 4F37K 1AHKA 4I77L 2VH5L 4GKSA 4EBQL 1DVQA 3N04A 3F7RA 4AQ1A 4Z7NB 3MRJB 1BLIA 2DQTL 4NQSA 4NRXB 3UZVA 2WUBL 1U8OB 3P73B 4YDZA 2MCMA 1IEBB 1I1AD 5HHNB 4WUUA 3B7UX 3QUYA 2WLMA 3BH9A 4NQEA 2AQRA 3J7HA 3K6OA 3KDMB 4TV3A 4ANKA 4JY6B 2F1AA 2Z8WC 2ZNWA 3KPQB 2HT2C 4WK4B 3ZDYF 3ZE1B 5JORA 1J9CT 3RJQB 3L9EA 2YJQA 3I9IA 4NQTA 2OX5B 4F3FB 1C8PA 4HCGA 4S0TD 1WZAA 1XSIA 2X4TB 3CFCL 1IKOP 1PGRB 2ZWKA 4HXAL 4M61B 4PJCE 5T1KB 5C3LD 3IT8D 5ERWA 3K71A 3KD4A 1XCQB 4AW7A 2WKOF 1S7UB 3NZHL 2OMBA 1E3ZA 2UWEB 4YK4B 5B1KA 3ZUCA 4A2FA 4B9CA 4FA6A 2H6OA 3ECWA 1QWNA 1ANUA 2BO0A 2H8PA 4ICWA 3G5ZA 2AJYL 3DX7B 4Q14A 4TNEA 5D6DC 4KK5D 3SKJL 1EBPA 4Y19A 1QLEH 4JN2A 1MJ7H 3UTTD 4AOFA 5F7EH 3P30L 2J2ZA 3WY4A 1IQDB 3WFEL 1XBRA 4R7XA 4K5NA 3KGRA 2HJKA 4JM2A 5C9KA 5T1JA 1JWUB 1DBML 5HYJA 3CQQA 1TTUA 1N12A 3CFQA 3O2WH 4HIIB 4U1MA 3V10A 3VSUA 1X5FA 3BKCH 1JV2B 1QLEL 1KBVA 3G6DH 4HPYL 1HN1A 1G9MC 2RAMA 3IFPA 1BMGA 3D6GA 3IKKA 3MLTA 1AKJA 4WVRA 3U4BH 4CMMB 4NZRL 4J3WA 1IUZA 1DBMH 3QDGE 1D7DA 4XBEL 5IVXF 3KYNB 4R5TA 1UWXH 2VC2L 5FF6A 3O3EB 4I13B 5E1HB 1NBVL 1MCOH 4UQDA 2Z91B 4FNSA 2QQLL 1R6VA 3WD5H 2DH2A 3FO0H 5EU7C 1AZCA 4XMUA 3EF7A 1ZVNA 3LKPB 3AG3B 1V3LA 4G2AA 5IJCC 3L1OL 1G43A 1A6ZB 4OZGE 3PJNA 3CC5B 5IMOA 1HVXA 5KN5A 1DEEA 2V5TA 3CFEB 3JYBA 1A65A 3DTXA 2XFXA 2GTQA 3R19A 3S4SB 3O6ML 3W2DH 4JFTA 4GP5B 4X6CA 3GPEA 4H40A 4PBDA 1OP3K 1OD9A 1CLVA 1WD9A 2WWKO 3H0TB 5DD3L 1X5XA 3RDTB 5I1HH 4D8PB 2BHZA 1A3RL 4UOW0 5D7LB 1OCWH 2IO5A 5DC4B 1QMUA 3IJYA 1MFDH 1P1ZB 1BEYH 2R69A 3DHPA 2C4XA 5F1IA 2AMUA 1A47A 1H9VA 4Z95L 1NGWB 3WO4C 1XB6A 2R0ZH 5E1QA 4MA3A 4RFOH 1AJ7L 4H1LH 2ZP9A 3SDDD 2VSMB 3KLDA 5DD0L 4MNGA 4TL4A 1RSFA 4X5RA 4JM4L 1K6QH 1HWHB 4XRCA 1Y7VA 4TUKH 1ED3B 1P2CA 2I5YL 1Z3RA 4GUOA 1DVSA 5IUSA 3PV7A 4OZIB 2ZCLL 1XD1A 5KYUB 3FQTA 3N44B 2OCJA 1BG1A 3US1A 5DCCA 5CGYC 5F1KC 1JK9A 5GRVL 3BAIA 3P9LA 3GUFA 3WU1A 2X3BA 2VLLA 2ZZUT 1EO7A 1BZOA 4QUOA 4FFZA 3Q5OA 2AERT 2VKXA 3ULUL 4ELMB 3IDXL 4U1JB 1YMMB 1FFTB 1ZT7A 1HE7A 2VDML 3CCHA 4K5LA 3ARED 1WV7T 2RHEA 2X3CA 3KWWA 5A16B 4CKQA 4FTVA 2YD2A 3S3DB 3D3VE 4PRPD 4QY8A 1W0WA 3MV7E 1ILUA 2HVJA 4FQLL 4XC3H 3S5YA 3T0DA 4JFOA 5F1NA 2DL2A 4NM8H 3ZMRA 4MLSA 4XN9A 1U3NA 3DBXA 3MBWA 1B6DA 3N5AA 2YQBA 3D85D 4IEFA 5GS2H 2AAAA 2K70A 4BEIA 4CVXA 4Z7VA 4CN4A 1TQWA 3MA7A 4HS6B 3QPQD 1I1CA 1R46A 2C3VA 4YC2C 1NCCH 4ZMLA 2VRKA 3F64A 4PJFA 2VW4A 4JQXC 5ESQA 2UX7A 3HLAB 3RPKA 3O0LA 1U3ZA 4XPBL 4A68A 3NYKA 1UZ8B 2DMHA 2W95A 1UG9A 3TEYA 3VXSD 5F2FA 1NLDH 3D2UA 3NACL 4BFIB 3SDCB 4N6QA 4U7MA 2R1WA 2YBGA 5IROA 4LL9A 3QAQA 3LQAC 5E9DB 3ATBA 3F6IA 4NUGH 1IC7H 5FYKD 1AY1H 1MFBL 1L6XA 4NJ9L 3BUDA 2CO2A 3QDGA 3WIIH 1MHCA 4M6OL 1ZT4A 5LGHH 3QCVL 5C0RL 2OZ4L 3I74A 2E5EA 2XG5B 2IQ9H 1EX0A 3FONA 1JXGA 4GAGL 1MUJA 3SD2A 1QYGH 2MJWA 5JQIB 3QUMA 3K1DA 3VXMB 4DAGH 3D39A 5DRXB 5AB0A 3SYPA 3VM5A 1A9BB 4KZDH 1MRFH 1KYUA 3D0VB 4BUHA 3CLEL 3ABMB 5DHVA 1NJ9A 5DJAA 5EO0A 3R0NA 4FXTA 3M1CA 4XWGH 3UG5A 4UINL 3PPEA 3Q3GA 2BHYA 1EZUA 5AVUB 5C0IA 4XPFH 1A0QH 1EJ6A 4IKNA 3R8BB 1QEWA 4HJ0C 3V55A 3BKJL 1LE9A 2VXSL 5KOVC 3MVSA 3GJFK 5GRXG 1T4WA 4G8AC 4UQ2A 3BI9X 3APCA 3HNSH 5KOMC 1MREH 3LHAA 4NPYB 2EYSA 1N4XH 4PJ9D 1TMCB 4LCYA 5FW6A 4UTCA 2XN0A 4EI5A 2AEQL 2VL5A 4ZFQA 4QIRA 5D6CA 1PYWB 3O3AA 3OPZL 4WNJA 4PBWD 3SOBH 3BXNA 4K4KA 5IBLD 4M8QB 3T2OA 1SVZA 3BQUB 2CNZA 5DRNA 1NKOA 4B0MB 1GR7A 5A3IC 4FQXC 2G9KA 1MJ8H 3MLVL 3PS6A 3D48R 2ZNXA 1BQLH 2VL5B 1RUQL 3UTZA 3AREC 2IV9A 2GK0B 4CC4A 5GZOC 4NQSB 4NRXA 4C83B 3J8F7 2RB8A 3NEOA 2EQDA 4GBXD 3SZ6A 3MV11 5DJ8A 1JGEB 1EO5A 4LLVB 4QLRA 5KJRL 1EDHA 5DWUH 1T5KA 4IGBB 3CFUA 1J9RA 2HT3D 4BA0A 2IQAB 4U1LA 3IPFA 3MGOB 4PJBB 5J6GA 4FXKA 2YA2A 3O9WB 4AX3A 2A74A 3L4UA 4H44C 3REVA 3BP4B 4MGXA 3TNMB 4BE6A 2XTJD 1BQ5A 5DD3H 1FAIL 4MX7B 4BQ6A 4HDIA 3L3HB 3TJPA 2BNRE 2VYRE 1MRDL 3OKNB 1IRAY 1YSOA 2I24N 2OMWB 3D39B 3FCBA 2C9PA 3FRPB 3T4AC 3UABA 3FOLB 2XICA 5L4FA 4P99A 2PXYB 4IIZA 4WI7A 2GEEA 1ICTA 1A6VL 4JK0D 3MMEA 2WXNA 2Z31D 4X4ZA 3T2QA 1G1CA 2FD6L 3CSYB 4H8WC 3QUKA 4I87A 1OTTC 4KH2A 3IETB 4H5SB 1YO4A 4GH7B 2DL9A 1NBQA 3ROOB 3ARUA 3QFJE 2CA4A 4H8QA 3BH8A 5SWZB 2B7DT 4X6EB 2AXFB 1HT6A 1W9XA 3VGAC 1ZPLA 2WUCL 2GCYA 3SJVE 4X7FC 3SKUD 1WH0A 4E41B 2E27L 4HSAC 2WM0A 1I7ZA 1QKZL 1TTRA 3SJVB 4XHQA 3DIDA 3VJ6A 4N0CC 2XETA 2OL3A 2VXQL 4EMZA 1J1OH 1YMMD 3ALXA 3V6FA 2NNRA 4DQOL 4NIYE 5DK2B 3EYQC 4OCYL 1FWXA 2KT6A 4LHUG 4LDCA 5I18H 2OXGA 3LCYA 2LT9A 2APVA 2BJMH 2BNRD 2JI3A 4M7JL 1H8LA 1OL0A 5DO8A 1IFGA 4AL8H 1UXWB 2E7CA 2HLFC 3GEFA 4GAAA 2G2NA 4H8WH 1A21A 1VF5C 4WKXA 3LHPH 5TPWH 3M46A 4LCWA 1XB8A 4AQEA 5I0WA 4GLRH 5BZDA 1DBJH 4F7MA 2K4AA 3DK0A 5HGBA 4AMKH 5EO9A 4NQUA 1UM5L 3HKZA 2BP0B 1RJLB 2IVFC 2IXQB 4K9EH 5E08H 5IHZB 3TBYB 3HI6L 1Y0LA 3TO2B 3PXHA 3OF6A 1KCVL 4M1CD 1GA2A 2BP8B 4NQVA 3RX5A 4PRPA 3OJVC 3VW3L 1NGWA 4BFRA 4MXVE 4P2QA 2R8SH 1UQSA 1USZA 3CLEH 3DMMB 2Y5TA 4JRXB 5BJTA 3HLKA 4R0LC 2EE6A 4Y16A 1M7DB 2XRAH 5D7SH 5ID1A 4M56A 4PLJD 5TQ2H 6FABL 4BJLA 1M7UA 3Q2LA 3GXIA 5DEZA 4G7QB 2AJXL 4MKMA 4YHIB 2APBA 4M6OH 5C0RH 4MMXA 4PFEA 1NM4A 3BKJH 1SXBA 2E56A 1PCSA 2F54A 2OQJB 4LSQL 4Q58C 5BO1L 3RAJL 2E7LC 5F6IC 3V9CA 1IT9H 2DDQL 2FL5A 1C1EH 4MASA 3MJ9A 4PY7A 2YPVA 2QPDB 2R4SL 2DTMH 1ORQB 3FFCA 5FYLD 2HPOA 3KPNB 1N9PA 4RISH 5M7QA 2CRMA 3PHOA 2P5EA 2MNWA 1J5OH 4U0RB 4H0LC 1OOAA 1DQIA 2ITCB 4KX8A 1UD5A 5IMLA 5JIQA 1FIGH 5GS0L 5JIHA 4FTVB 1SEQL 2R56L 4EF3A 3EGDA 3VD4A 3KWVA 1OAUH 2PXYD 3SPJA 4HF5L 2HFTA 1DUYB 2D73A 1MHPL <