3W1ZA

Heat shock protein 16.0 from schizosaccharomyces pombe
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
134
structure length
134
Chain Sequence
PPTVNDLFSDFVSYSPRLNNQIPGELSPSIDVHEGKDTVSVDVELPGVKKEDVQVHYDSGKLTISGEVVNERKNESTEGNQRWSERRFGSFSRTITIPAKIDADRIEANFSNGLLTVTLPKVEKSQTKKQIAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein 16
publication title Nonequivalence Observed for the 16-Meric Structure of a Small Heat Shock Protein, SpHsp16.0, from Schizosaccharomyces pombe
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Chaperone
total genus 18
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3w1zA00
3Q9QA 3GT6A 3L1GA 1WGVA 3J07A 2O30A 3IGFA 3N3EA 1SHSA 3QORC 4I88A 3W1ZA 1RL1A 2CG9X 3QORB 3GUFA 2RH0A 2KLRA 5LUMA 4ELDA 4YL9A 2Y22A 3EUDA 3GLAA 1WH0A 3L1EA 4PBDA 4PCKA 4YLBA 2K8QA 2N0KA 4RZKA 4YDZA 4YLCA 4YE0A 2MNWA 3VQLA 3QORD 4JUSA 3L1FA 4ZJ9A 2Y1ZA 3QORA 4M5TA 2KMWA 2Y1YA 4FEIA 5DS1A 3VQMA 2N3JA 3AABA 1EJFA 1WFIA 1X5MA 3Q9PA 1GMEA 2XCMC 2WJ7A 4JUTA 2CR0A 5DS2A 3AACA 2BOLA 4MJHA 2WJ5A 4M5SA 2JKIS
chains in the Genus database with same CATH superfamily
5FYJU 5DGQA 3RDTD 1NAML 1SHMA 4AV0A 3D3VA 4XPHL 4Y2OB 4JO4H 3APFA 3SGDH 4GSRA 3L4ZA 4Y4HA 5SWZA 3APDA 5TDOB 1MIEH 1AOHA 3FCSB 3MNMA 3H6JA 2HX8A 3ARED 1HH9A 4X6EA 3C2SA 1JDCA 4KI1A 1NGYA 3K2UL 4XOEA 4JFXA 1NICA 3P2DA 5DJ2B 3LH8A 2IBBA 4POZC 2QELA 3HNTH 4NQXB 3CVIL 4ODXB 2R69H 4LVHC 4XCNB 1N12A 5ISZB 5GPRA 4YHZL 1MCOL 5DZNA 4PJ9C 1NOAA 2B1AL 3T0WA 1NBQA 1UQSB 1DP0A 2CO7A 5K9OA 3QQ4B 3HBZA 1TXKA 1RIUH 1U93B 2AXHA 1MVUB 2MQGA 4U0RB 2WBKA 5JOFB 5DUMH 1ADWA 1DQLL 4XMKL 1ZLDA 3QRBA 2BXYA 1PY4A 3KJ6H 2Y2YA 5FK9A 4AV4A 4G9DB 4E0RA 5I5RA 1CF8L 2OJ1A 2BRRH 1A3LH 5KVDE 3C75A 4PJ5D 3CLEH 1BZ9B 1JUFB 1IARB 2FECI 4OLEA 2CALA 4NZTL 1T1WB 1Q9KB 3B9AA 4JDEB 5SX5H 1TCMA 2O26U 5GRZA 1F86A 4H88L 1PG7H 1W0WA 4XOBA 3BUDA 4F80A 3MU3A 4FXKB 3FFCE 2F7QA 1RIHH 5CGTA 4HS6B 4L2LA 2GSIB 1HSBB 4PTUB 1HX0A 4GQ9H 1RZFL 3T6QC 4RWYH 4M7ZB 1KJVB 5CCKL 3MCKA 1KJ2L 4DP4X 1OAXL 4NKOA 3T2NH 3ZE2E 2UWEA 2EDYA 2IG2H 3BZ5A 3FFCB 4JR9H 5EORL 4MMYB 2N7AA 3R0NA 1KIPA 1RUPH 2Z8WC 2J8OA 3DX6B 2WLYA 4YE4H 4WTZA 1S9WB 5CP7A 4F3FB 1QEXA 3L9BA 5KSUA 3V55A 3FW6A 4XN5A 4LIQL 4PJFA 1JWSA 2MCPL 3QP3A 5JUEL 5IOPA 2WSDA 1OQOA 4CU6A 4AM0Q 2NW2B 1NWOA 5B7MA 5MERA 4GG6A 4ONFH 3MJ7A 4WV1B 3OJDB 3DHPA 4K7PX 2R59A 3PWUB 5DZJA 1PLGL 4MXVE 1OAUH 2WNGA 2VLKA 5FYJL 4UT9H 2ZUQC 3DIFB 3LZPA 4LQ1A 1VSCA 4NQVA 1QFPA 3O45A 4R4ND 4O58L 3VGFA 4YHPB 4PHZA 2WKOA 3V4VB 2HTLC 3T0EC 3MLSH 4JZJC 5E9DE 3GMLA 3MRBA 2IH8A 3QWOA 4R7NA 1IGFL 5CD3B 4L4VD 1PCSA 5ABAA 1RFDL 3RKPA 4QRRA 5L4FA 1TIUA 2J71A 1FZMB 3I9IA 3N9GL 5E9DB 5C0RH 4JDTH 1ZT7B 1CC3A 2JCCF 3QJSB 3CUPB 5LXVA 1UFUA 2ZOKA 5EBLA 2GYSA 2VW4A 1SLUA 3NTCL 4OGXH 3SY6A 2DH3A 2D7OA 3FB6A 3GSQA 4NPYB 3WIHH 3KYKL 4ZNCD 2WZ0A 5BUPA 4HIIB 1AAJA 3L3OC 2VITB 4WFHD 3F84A 4PYGA 3ARVA 5AW5B 3QPKA 5GGRB 4BFEA 2IH1B 4N5UA 2OSLA 3HG1E 4X98B 3ILDA 2R4SH 2HX9A 1WT5C 2FSDA 1RVFH 2VRAA 3LMJL 4LZKA 3W3BA 2DPKA 2W60A 2AEPH 4ABUA 3FU7B 4WI6A 5C3LD 1T3FA 2GK0B 4F2MA 4EN3A 1NEZA 1RJYB 4U1JA 5EU3B 3HG1B 1H15A 2PETA 3US0A 4Z7QE 3GSRB 3QK0A 1S3KH 3C6SB 1A4AA 5F6HJ 1IT9H 1WGOA 1X5LA 2CHNA 1T5XA 4OD1H 3P0GB 4OD3L 1KMGA 3TN0C 3ZRFC 3FN9A 3K71A 3MRIB 4IBSA 4W6XB 3TH4T 4YXLL 5T1MA 1E5AA 1MFCH 3C8KB 1DQIA 2OYLA 2VR7A 2XKUA 3TT3H 5DMIL 3P9MB 1NGWA 4S1DD 1NGPH 2ITDB 1T6WA 2FX7L 3D8MA 3H53A 1O7SA 4OI8A 4G42B 5GS3A 5C3TA 4GI6A 4BINA 2QADB 4IU3A 2C3GA 3GMMB 3P40A 4NN7C 5DD6B 1JPST 4H0GA 4Z95H 1MCJA 1UB6B 5TH2A 5HHVL 3JWOL 1UWFA 3KLKA 1I9IH 1GOFA 3W0WE 3VI3E 4DSYA 4HHAB 3V4PA 1F90H 2Y72A 4F33A 5I1HH 1L9RA 3Q8BA 1GC1L 5CJBA 1MOEA 4NSKA 4X6DE 4KVNH 2BW5A 2WO3B 4NCDA 5FEBA 3WFCL 3VI3B 3RNQA 2AK1H 1JCKA 3S0PA 2XWJA 1AZBA 1UUNA 1OHQA 2HG5B 1MCQA 1X9LA 3CIAA 3ML9A 2HKFH 4L9DA 3TBCA 4BZ2A 3SDCA 5AKVA 1O5PA 3FT0A 2APFA 4X7TB 3WENA 3N04A 4X6DB 2O6FA 1FNGB 1RZ8A 2J21A 5A6IA 1FG2A 2HFFB 2QZ5A 1K6QH 3OQ3B 4NRZB 5E08H 4E41D 5B8CC 4NT6B 4AUJA 3ARBB 4YPGB 1TZGH 3TYGL 5I0YA 4BKTC 1JZ5A 3C5JA 4RIRA 3O0RH 2XG4A 1LP9F 4JS7A 1U8LA 2JNZA 4IEFA 4NZRL 4ANXA 3MFFB 5KYNA 3V4PL 2WNWA 3BN9D 3UAEA 2GJ6E 3L17A 1HWGB 2PCYA 3L3GB 4W9EC 3RUGE 5IFHL 1CMOA 2QKIA 4OBRA 2EKSB 5EU6A 4PV1C 3NH7H 1OB1A 3B9KC 1MVYA 3EJSA 4TVPE 1IAKB 4JPKL 2J1YA 3UBXI 4AXWB 3OXRB 2GI0A 4HPYH 3G6AB 1GTNA 4OQTH 1BZQK 2Y36L 2GJ6B 1NDTA 3HHSB 3SDAD 2NY7H 5CM1A 1QKZH 4BZ2L 1Z66A 3VFPB 3VXSA 2E6JA 4L2YA 5CZRA 1G7LB 1E90A 4FQLH 2NOYA 3T0EA 5DS1A 4AMKH 4U3CA 4PV8A 4WWKC 3QXDA 4F15C 1YEDB 4N2AA 5F7MC 4JREB 2YD9A 3KG5A 4KUCF 1VHPA 2Z0UA 5IQLA 5B4MC 2E8YA 2EXYD 4FJYA 2QR0B 3FFDA 4GKOA 1AQDB 4MVBC 2XT1B 3VX0A 4RRPG 4GAJH 4P2OB 3U7WH 4WKXA 2J8HA 3CN4A 4A2EA 3EJRA 3AFLA 3GMPB 4PS3A 2PW2B 4OJCA 2EDNA 4H44C 4JCLA 4EQ2A 3LQZB 3N40P 1O0VA 4FL4B 3BZEB 4M48L 5C6TH 3IN2A 3K1DA 2OPCA 3W11D 3VWJD 3L3OA 3SODB 3E8UL 5AW0B 3NIDF 1WA1X 2ZKWA 1E5BA 4IOFD 5D2NE 1TVDA 1JN6A 2Y2TA 1J0ZA 4YSTA 2DKMA 3S5YA 1F4XH 4JN1L 5D7KD 5CZXD 1DO6A 3QYMA 2GBVA 3PUUA 4UM8A 2JJWA 4GQQA 3QDGA 5D2NB 3ZYJA 4BXSV 2BVUA 3ZT5A 1I8LC 2IQAA 4A39A 4RDQG 1BXAA 3O6FD 3MNZA 5CJQH 3MACH 2DIAA 3HC4L 1I3RA 3B7UX 2R9HC 3PWVB 5BZXA 3RWIB 2SEBA 3IJHB 4PRHA 3MX0B 3O3EA 1HXMA 1KN2H 1S7WB 3L5WB 2BVOB 1U8HB 3PXHA 1NFDE 5I9QB 1S46A 5T1LA 4MLSA 4X6CF 5DJ6B 1DQDL 2R1WA 3WKYA 2F54D 3LDBB 3CU7A 1CT8B 2ZNXA 3NMEA 4KHXH 4LVNC 5C07B 3QIWB 1R5VA 5LCVH 5CEYA 1BXVA 1NFDB 3QAZB 4WU5A 3N1PC 3BPOC 1CXEA 1JGEA 4H26B 4MQ7A 5F9OH 1TQTA 2R4RH 3CLFH 4IM8A 5DEJA 3M88A 4GQRA 1VESA 4YMPA 2D31A 1MCKA 1UGKA 1ZE3C 4QTHB 3RFRA 2R23B 4FQXC 3IXAA 4IOIA 1PAMA 2C9QA 2PO6A 4Z3FA 1DZ0A 2ICWJ 4LKCA 2O5ZH 5IQ9B 2WUCH 5HD8C 2D0FA 3JZYA 1MFDH 4QRQA 4QPEA 1NOLA 1AC6A 3X3FH 2DRUA 3QUZA 1QOKA 4QHPA 5K39B 3OJ2C 2PYEE 2E59A 5EU5B 1GXEA 4HBCH 1G1YA 3D4GA 5IHZA 1FCCA 5AUMA 4IKLA 3NUKA 5LNEA 3RX5A 1Z3RA 3GB7A 5F3HA 3HS0C 4RRPM 2NSXA 2Q7YB 3AS2A 3I50H 1RZ7H 3ALXA 1JWMB 2J44A 1XD0A 4KKLD 4WY7H 3V52L 5KAQF 2PYEB 3DMMD 3PJNA 4G7RB 4NKIL 1A1OA 1BVNP 3TL5A 3X12A 2WW8A 1SXNA 3TWCH 4X9GA 2HVBA 3U46B 2VR4A 4DPCX 1S9VB 5IZ7A 4AEHL 4U6TA 5CBEB 1E27A 4M43H 5E5LA 2EEXA 1U30A 3IF1A 3QJQB 5AYUH 4RFNB 1SDDA 5A6MA 2V2TB 3TU6A 4BDVB 2AKRB 2BWQA 1BEYH 1LO0H 1XZ0A 2NTFA 3FF8A 3IJEB 3IMVA 3LS4H 3UZVB 3REVA 3B9KA 1QVOA 4G43B 1QR4A 4P2RD 4QIRA 3IU3B 3OKOB 5I6LA 4J8RA 1A6WH 2GUOA 4KGLA 2VRQA 5C7ZA 1KLFB 2IJ0C 3H3PH 4JM2C 3TO2A 4L1TA 1QRKA 2CXKA 4AQ1C 1UXMA 3NDZE 4S11A 4OGYH 3N1GC 2VM9A 3BWSA 1SFDA 3TA3D 1CIUA 3TO4B 4FFYL 4JPVH 3ZQXA 1M3IA 5LN8A 5HDLA 3M07A 4F9LA 1LLAA 5DVOA 1WZ1L 1IC7H 4PS7A 3THML 2CHDA 1HQRA 3SKJH 2Z8RA 4F7EA 4D9LL 3L3JA 1YN6A 2Y1ZA 1R3HA 1D5BB 3KBFA 4G8AC 1IGCL 2NZ1A 3E9UA 4O5LL 4N24A 1XH3B 1EZUA 3F7RA 5CLWA 3LIZL 4W81A 3GHBH 4O02L 3Q8CA 2Q3ZA 4HUWB 1DVYA 1MSPA 4ELMB 3AB0C 3HMXH 4MS8D 5IR1A 4GXVH 4PJBE 2ZQKA 3FUIA 3N55A 4YHLH 4LRNL 2GVYA 4WK2B 3P4MB 4KTEL 1G0XA 1BLIA 5ESVA 3HLAA 5E5MA 1GL4B 2DI8A 3APCA 5KW9H 4XNMA 5BO1L 5K9QI 3DBXA 2V5MA 2XA8H 4PJBB 4WI9A 5ACZB 1RUMH 4MNQA 2JIXA 4M6OH 1ZDQA 3N5AA 1B4LA 5IVZB 3W56A 3HI6H 5L0QC 3MNVB 1NDMA 1YEGL 3FB7A 1JYXA 2Y1VA 1W15A 3NSFA 5BS0D 1KC5H 1LEKA 1I8LA 3JXAA 4NCC1 4PRNA 1FO0B 5HHQA 4P59L 2XIBA 1VFAB 2MMXA 3VGBA 1PF3A 2DH2A 4I85A 3K2MC 4XTRD 2NSQA 2W1NA 3BDYL 1VACB 3CVBA 4E5XA 4HAFA 2C9XA 1J05B 4J3UA 3VGGA 1V3KA 1VKXA 2EYTA 3H9ZA 3ABKB 3KEDA 1F6AA 5L2KE 5BZZA 2Y3AA 2DYPB 4Q14A 3WL9A 1KENL 3H2QA 4Y19D 3UPCA 3LJ3A 2V8MA 4MBOA 4FI6A 5DS2A 3MAWA 5JW4Q 35C8L 4NNPL 4PY7B 4XNUL 5L2KB 3CK0L 4KXDA 3UMTA 5ICZA 1M1SA 1WAAF 2VDLH 3T0VA 5I26A 4HCFA 1G7QA 2CG9X 2FZ3A 4AIOA 1G7IB 4LLUA 3LNFA 4C4UA 4TF4A 3JTBA 2W9DH 2R0KL 1FSKB 3QFJD 4JG0H 1I4FA 4KX8A 4PD4K 2ZP9A 2ZXWB 4WW1A 1CE1H 3H7BA 4JO2H 3GMQA 1L9OA 1QFWH 4M7LT 4Q4IA 4HIEB 4UQ9A 4CGUB 2XRAH 3BVWA 4AYID 3KPSE 5JW3H 4JCMA 3CZLA 4XAWH 1JTPA 3ZQWA 1P7KA 4JJ5A 5FLUA 4L8BA 1WVZA 3L3KB 4JFDD 4TOYH 1D2PA 2WQXA 3EOTL 1WF5A 3GUFA 1R47A 5LGHL 4P3CH 1X7QB 1E5CA 1OLLA 4ONOA 3JYBA 1K5NA 1SY6H 1FZJB 1GSKA 3KPSB 1KPVB 5D93C 4MZ2A 1FF5A 1YY8B 1J88A 1HEHC 1GHFH 1OKEA 1SF3A 4YDLB 1MH5B 1WD8A 3KGRA 2J56A 4GUPB 1E4WL 4BYHA 5K59F 3T08A 2OXHB 4PRID 2Y7QA 4KVCH 4KPHL 3C5SB 4OT1L 2HT3D 2GC4C 4OAWB 1OGPA 3Q0HA 3OC5A 5CNHA 2W5PA 3EFDH 2XWEA 1AKJA 4AQ1A 4OZGA 4WEBH 2VXQA 3A4FA 4YLBA 3S98A 2F9BT 1TNNA 4PI0A 4UDUB 3HUJA 5GRUH 2ZSVA 5HHXH 3O2DA 4AEFA 1YJDL 2V17L 2Q8AL 2CGZA 2WAQA 3HI5L 5D1ZA 1CDGA 1EJFA 3EO0B 3LQAC 1W72A 4Y4FB 2VSDA 2OK0L 1YECL 2WV3A 2PKDA 4B7LA 4GKNB 4NC2B 1U95B 2HPTA 3DARA 5E6IB 1PDKB 5GS0L 5FF6A 4L48A 2UX6A 2D03H 3V9EA 3FONA 4AQ8A 1XGTB 4JZNB 4ZFGL 5K69A 5A2JH 1MCNA 4IHBA 5DHDA 4LF3B 2D4DA 3T4YA 1NCWL 1ZA3B 4DGWC 1OCCB 5E0QA 5DZAA 3VA2C 7PAZA 2FJHA 5B1KA 2MKWA 3NJJA 3NSJA 4YO0A 1G9EA 3ZVVA 1TR7A 4OFDA 5I5JA 1T6BX 4M5YL 3PLYA 2GPZA 2NNFA 3QS2A 3D2UA 4JPWL 2E0PA 4Y4HB 2VXQL 2G5RA 3MA9H 4JRXD 3RY5A 1GGUA 3PXJA 3U6XA 1HH9B 3HE6D 4YBQC 2X12A 2WBWB 3O2DL 2YD7A 4JFXB 4IGBD 2UY6B 5I2IA 3S97C 3TCTA 4G8FB 4WO4C 3H42L 3JT0A 5EU7E 5LG1A 5I6XB 5JHAA 4UUJB 2P8MB 3SBWC 3DXAA 1Y0LB 2PTTA 3DKHA 3MV7E 3COOA 3G5ZB 3NSXA 1UCTA 2A6KB 1LNUA 5T1KB 2IANA 3D2TA 2FEJA 4NN5B 4E36A 1YAZA 3O8XA 4PJHE 4NKDA 3I6KB 2FYVA 4NQSB 4LVEA 1OTTC 2HUEA 3MV7B 4GMTL 4LSUH 4F1SA 3ARQA 4JFZL 5G4MA 2G75A 3VVWA 5BQ7A 4ZAKC 3WKNA 2HN7A 1FZOA 3U48A 1Q0YH 5JIPA 3DX1A 1COBA 4PJHB 2YIHA 5FM5M 4JJOA 1LHZA 5HGDB 4IIQB 4U6XB 2BOBB 4L5FE 4YFEA 4QJ3B 1DN0A 4OGAD 5HHMD 1YMMD 1W0WB 2BSEA 4I0CC 5ECGA 2C3HA 2CR6A 3L5IA 2UWEE 2VXSL 1RP8A 2JJSA 2BSBA 4FQHB 1YQVH 5KVFL 2V6HA 2VISB 5A2AA 5CEZH 3C6LD 1EMTL 1VZHA 4R2GB 4NHCL 5JIKA 3ARGA 3MCKB 5H35A 3MRGB 1E3ZA 2V2XA 2H32A 2VLJD 3LKQB 4IRSA 1AI1H 1QX1A 3QDJD 5DRNA 1BVKB 4LPWA 3UBHA 1RZIB 2ZWZA 4KWUA 5I1KH 4XBGA 3QG7H 1TSHA 1JRHH 2YWZA 4HJGB 4DN3L 3L1EA 5T1DL 1AS6A 5IJBC 2BY3A 1A02N 1KGIA 1MCPL 2F5AH 1YEFH 3GINA 1XGYH 3QUMB 5KSUB 1M42A 3UDWC 4EIBA 2IPKA 3PJSB 4FZEL 4D9QE 1TETH 4GI8A 4X0KB 3QI9C 2AHIA 1I1AA 1EDHA 2DTMH 3GSNA 2YD5A 2EDTA 1YY9C 3R1GH 3NIFF 5F1NA 2R39A 1E8YA 5I16B 1SYVA 1A7RL 1UVQB 2XN0A 4GT0A 1DVFA 3RB5A 5FO8B 5JQIB 2LAGB 4BBWA 3WN6A 4G6JH 4UTCA 4A7TA 3WJMA 3H4FA 3S6CA 5HGHA 1TVHB 1C1EH 1FLRH 1QD0A 3O2VH 4XXDA 1FAKT 1YCSA 5KWYC 2WLKA 4V11A 2R2BB 1VFBA 3OB0H 3WN5C 3FSZA 4MAYD 4JO1H 2ICEC 3DVNB 3O45B 3RG1C 4QRRE 4AQAA 1YQ2A 4MCZB 2VDNL 4IQHA 1EQWA 2VJ0A 4TTDD 1TQCB 2ORBL 3BOVA 2XZQL 5JHDD 1QA9B 3MRDA 2VB5A 3LPGA 3RGVA 4W9HC 3G6DL 3IEAA 5FUOH 2LVCA 4QRSA 5DUJA 3PXLA 4HDIA 3SHSA 4F8TA 4O4YL 4YDJA 2AJSH 3CVHH 2P8PB 2XVLA 1WZMA 3VFMA 2NNXA 1MRFL 5DHVA 3BQUA 3I75B 1ZLSL 2GT9B 1XMWA 3BGMB 4XPFL 1N9PA 5AVXB 3AQYA 1MCIA 4OLUH 3ECWA 2FO4B 3GM8A 3LRKA 4ZS7H 3BISA 5DZ9A 3BGFB 1WD9A 4PJCA 1O6SA 3BPNB 4LPTA 3U0PB 5ABZA 1AQHA 2HTKC 4OLZH 1T1ZB 2EVFA 1AQKL 5D7LE 2YAFA 4UBDD 4HISA 2OSLB 2WWNA 1RU9H 2H6OA 4KY2A 5DJ8A 5I17B 2Z31C 1S7XA 4MD0A 4ZTOL 4I8DA 5IQ7L 4CDHA 5BV7H 3FO9B 1JHLH 1DQQB 2GIXA 2O5NA 1MAJA 5D7LB 1U8NA 2E7CA 2VMFA 1NEZB 3BEWA 4JY6B 1KBPA 2XZCL 3O3BA 4Q6IC 1NLBL 3VB8A 1G9NL 5BXFA 3B7YA 4IDJH 4Z7WE 2AGJH 2CK2A 5EOQH 4WO4A 5FGBC 2ATKB 5H8DA 3VI3F 1KJ3L 3UTSE 1NIBA 4LVHB 5CGMA 3SBWA 3RWEA 2FE0A 1NLDL 1CD1A 3L6FA 4NP9A 4PJ9B 4XOAA 5KYXA 4P46A 5CMAA 4Z7WB 1J5CA 2CU9A 4HP5A 3OKLA 3UC2A 3ZN6A 2JK5A 5A7BA 3UTSB 2E75C 2CO3A 3MV9A 4Z3GA 5CO1A 4F7TA 5HYQA 4LLWA 5I5MA 1D6EB 4WZ9A 5HXMA 4JVPA 1HCVA 3JQOB 4HIJB 4ZAKA 2EH7L 4L4TD 3PL6C 1RURH 4Q0XH 5CS7A 2O6CA 5BZWB 3FB8A 3AABA 5IM7B 1R24B 4MJ5A 1TITA 2ERJC 4G6AC 2Z7YA 4DTGL 2DL9A 4LKXA 3SDDC 4F33B 4O02H 1Q1PA 3QEQD 1CLOH 3G08B 4FCHA 1T4KB 2Z65C 2R1XA 1IZJA 1XMEB 3S34H 1KTLB 3LV3B 3CFUA 2M8XA 3UJIH 2WM0A 2C3XA 1AHWC 2GFBA 2CK0H 1GGBH 3TFKC 4YQXL 2EC9U 3FTZA 1BG1A 1J9QA 1MPAL 1C16A 3AXLB 4GBXC 4LNRB 1R3JA 4ELKA 1KPUB 2NZ9D 5DJCA 4HFWA 1BPLB 2WBJA 3P3TA 4LOEA 2X4TA 4ACPA 1ZVYA 1N0XL 4P9HL 4BHUA 3SGDI 3ML8A 2XN1A 4D0CA 3V0EA 2HSIA 3FQWA 5EUKA 2IBGA 5F0JB 1JGLL 2WLIB 5CFAA 1OAZL 3BVXA 1XT5A 1JZJA 2BJMH 2OX5A 5EU6E 3WXWH 5T1JA 5FCUL 1IL1A 4NDMA 4HZAA 4OB5H 1G7MA 5EUOF 4N2EA 4CL7A 4WAFA 4PP2A 1OCWH 3QISA 3CXDH 3GHEH 1CFNA 3JWDL 5D1XC 3DIDA 2EUZA 5L7XL 1CICB 2FATL 5IKCA 4HX1A 4AI7A 2HJKA 1LK2A 4H0IA 5IB1A 3T0EE 1L6XA 1G9MC 1RZJL 2WZ6A 2ZUQB 4GLRH 3OF6D 3RPIA 3Q6FA 3R7QA 3WN5A 2HMID 1LEGB 2DD8L 1MNUL 2JKJA 4OD2B 3BD3A 4M4RA 1QSFE 4JZJB 4K5MA 4DKDC 2BIIA 4KTDL 1A64A 2KKQA 3WFHB 3GSOA 4U3HA 1UOKA 3EJQA 3WTVA 1AY1H 1KGUA 1Y7VA 2P48B 4PS4H 4KQ0A 1GH7A 1RZKH 1AACA 2DAVA 5TQ2H 3SPCA 4N68A 5EN3A 2X6VA 3VXRA 1QSFB 1UENA 2OLDA 5CN1A 4YUEH 1AGDB 2J2ZB 1HHKA 3QVAA 4OCWL 4R84A 4KH2A 4PGJA 2W80C 4R83A 2NW3B 4OLVL 2W8CA 1MG3C 2A5UA 3P54A 2EE9A 1NFAA 4XC1H 3DYMA 4ZPVA 2P5WE 3AS0A 5IEKA 2A6IA 2UYLA 3L3OB 4HSCX 5I76A 3QDGE 4TYUA 5EPMA 2EO1A 2XHNA 2YQ3A 1M9SA 4F91B 1UADC 5KSVB 4BH8B 2Q7NA 3EBIA 3IN0A 3S35L 1P4BH 2VDOL 1C9SA 2P5WB 4S2SA 2FEDC 3MBEA 2CD0A 3VFNB 4YEFA 2X0WA 3OKKB 3QUYD 5AENA 3SE8L 2QVIA 2V4LA 3D85A 4QRTA 1W0VB 4AH2A 4KJQC 3FQUA 3IFOA 3UZQB 3BUYA 2BVQB 2WXGA 1JDDA 4YSCA 5KYWB 4APXA 3PDOB 1X6NA 1HXKA 2G5BB 3O3EB 1O75A 3TN0B 4HHGA 1IGML 4LSVH 1B4TA 3S96A 3OPUA 2CDGB 4JY4B 2HJFA 4HCRA 3IVKA 1S5HA 4KQ3L 4PG2C 2CUMA 4K8RD 1GMEA 5DEZA 4DGIL 4BSVB 1R5VB 3CFBA 4K23H 1HU8A 4Z7OF 4MD4A 4NN7B 2EEBA 1C5DB 1CCZA 3NIGF 3STZB 1SGKA 2YPLD 3OAZH 3V6ZA 1TKWA 5AW8B 4FQPA 1ACZA 2AJZA 1EEYA 1Z0MA 3JVFC 1DFBH 3BVDB 3BPCA 3P77A 4HWZA 4XWGL 5H37G 1UACL 3PNRB 5IBUG 4D2NA 4UDTB 5M94B 4YNYB 4ZO6A 3SDXA 2EXWD 1A6VL 4LCUB 5HPMB 4X99B 3BZFB 5IGXH 3OLDA 4OJFH 2Y5EA 1WO2A 2VN7A 3ILPA 3KYNB 4PJ7E 3WTWA 4NJAL 5AOJA 2OTPA 1AXTH 4Z0BH 2R56L 1LD9B 3F3HA 3CFEA 1AVAA 3IFLH 1V10A 5C0EB 2DQ6A 2JB5L 4HWNA 3GXDA 5J9PB 1WG3A 3D0LB 5HDQH 1T66C 4HCRL 2R83A 4LDLB 4PJ7B 1A4JB 2NT0A 4BFFA 3VE0A 4BKSC 5B8CB 3OKEA 4I0PA 1GR7A 2AV1A 1TTGA 1HE7A 1TYRA 2JKLA 3ESOA 1SZNA 2C1OB 4TNVF 4YVNA 3L9YA 4XMLL 2WK2A 1L0XA 1K4DA 3PUCA 3SPIA 1XF3B 1DBBL 4B6ZA 1PLCA 3H0TB 4HKZB 1SDDB 3IYLW 5D1XA 3WXVL 1WICA 1WGVA 1FI8C 4ELMF 1P4UA 2JTYA 2OMWA 4YAQA 2J20A 2YHGA 2FVNA 1NAKH 3DO3A 4XHQA 3DX7B 3WNLA 5AB2A 3GIZL 3GGWB 4F9PA 3U6RA 2AK4A 2ALAA 3TZVD 1R3LB 5DEGB 1G6RH 3KLQA 4NO0D 3ZTJH 4UQ2A 1JK8A 2DM4A 1OP5H 4BIKA 1OW0C 3LKSB 3F7YA 5C1MB 1KTBA 3NCJH 1D5MA 2F58H 2Z7ZA 1TJGH 2Y1YA 2HT2C 1HSAA 3EOAA 1EO7A 4WENB 1JVOA 1JZIA 1BQSA 3VH8A 2P8LB 1UYWH 4XVJL 5EF1A 4WWKB 4PV9B 4F15B 1UD5A 2HZHA 4Z7AA 3CFJA 4KO5A 3ME0B 1SUJA 4P3DA 3HNSL 2MKLC 2R2EA 2X4PA 5DD5H 2FLRT 2JXMB 4G1EB 3DPBA 2EH8L 1IVTA 4AKOA 5DURD 4WCYL 4MA3A 4QKXB 2NXZC 4B9IA 2V9QA 1T0MB 3EOBA 2IVFC 4XZ4A 1AXIB 2QGCA 2XQBL 3BMWA 3S8GB 4NB7A 3DNKA 4LOFA 2DWYA 1OTSD 4NIKB 3MLRH 1A3RH 4XB3A 4HBQA 4YIQB 4GRMB 4UIMA 2IWEA 3GMOA 5E5MB 4HWBA 4ERSH 4GW1B 2VIRA 5HYSA 1CDJA 3FT9A 2AJ3A 4IBYA 4LRIA 4W70A 1E7VA 3DV6B 5GGRY 1KNOA 4JG5A 1C5BL 3VYNA 4Z3HA 1QSEA 4X4KA 3KJ4C 2ZWYA 2C4FT 4LMQE 2Z7UA 5H2BB 3RLSA 4NKQB 3K8LA 2VDRL 2H8PB 1DE4A 4OIIH 1K3ZA 1E4KC 1SOXA 4N2NA 3BWAB 2ZF8A 3WFEL 1CGSL 5IG7A 5I8CB 4MJIA 4QHNA 5GRWA 4WW2C 2GBUA 4I5BB 3ISYA 4PG2A 1NBVH 5IB2B 5FM8A 3N41B 4LVNB 4N5ED 1S78C 5F88A 3SKOB 3Q2LA 3TBSA 1DVZA 3MGTA 4HWBL 1FZKA 4QD2E 2JQMA 2PCFB 3BO8B 1MIEL 3BPOB 2G2PA 5IVOA 4KNSA 1KB3A 1HZHL 2E27L 4TM9A 3QJRB 1TTAA 3VM7A 2I7SA 2COVD 4FQXB 4IS6A 3KD4A 1GOHA 4XN4A 4I3GA 4N8UA 1CFBA 1QFUL 2VC2B 4QXVA 1JOIA 1YDPA 2F5BH 2R69L 2Q1EA 4NUJB 2J1ZA 3TH3T 1I4FB 3P4OB 3GMRB 4AC2A 4K94C 4NQCD 3LNHA 1MI5E 3NCFB 4LHUD 1G7HA 3J27A 1NUGA 3WJJC 5KVEH 2XDHA 2DBJA 1IC5H 1I53A 3BVNA 2KH2B 4ZXBA 3A0OA 3LVEA 3HS0B 4PJAA 2ZYIA 4BGLA 4EKJA 5LNGA 2OMTA 3PGFH 1MI5B 5JQ6H 1YEWA 1OPGL 2VXVH 5C0CE 1S4IA 3CLEL 3CJJA 1HHJA 3FH5A 4U1GC 3ZL1A 1NMCC 3P0YH 4HUCA 5DSCA 4L0PB 3HCVB 1K5NB 3B34A 3CMGA 3S48A 5CN3A 3W9EA 1KCRH 5JPNA 1PG7L 3HZYA 3T9WA 2X1OA 5L2JB 5C0CB 3MJ9H 5FYKD 5DJYA 1AZZC 1P4LA 1RIHL 1HHHA 3QWNA 3KS0J 3UGXA 2CIKA 1F1GA 1EZVX 3EZJB 2XWBA 4IBLT 4GQ9L 5E8OA 5GZNC 1GJWA 2WMPA 2EQDA 2EINB 3E6FA 2Y7QB 3AT0A 4PWIA 3BEVB 3HUJE 4GFTB 3O3AB 2VL4A 2XZAL 3IDJA 3BJLA 4JR9L 4QXUH 4JM2B 3FHAA 1RUPL 4AQ1B 1UATA 2IMMA 5LGJA 3BIKA 4YE4L 3SE3C 2A9MH 2Z34A 2ESVD 3HUJB 4GMSH 4U1HB 3BAWA 2OW7A 3KHOA 4WI0A 3VXNB 3AREA 5D71H 1KY7A 1BCIA 5EO1B 2ZPKH 4EUPA 1W72B 3FXIC 4A2FA 4W9ZA 5DQJB 5GS1A 3IKCB 3IBEA 4H25B 5IB3B 4JFED 5CU9A 1XFPA 3BKMH 4QNPF 2VXTH 5CXPA 3KH4A 4ONFL 1XSOA 4ZYKA 4JUTA 1KT2A 2WN3A 4UYQA 4XO3A 3A6BH 2GY7B 2WY3B 2FR4B 3I9GL 4G7QB 4G6FD 5DJDA 1N5AB 4UV4H 3T4YB 3AB0B 1NDGA 3S5LB 2PWGA 3VFVB 5SWSB 5T3XH 3ASWA 3FUMA 1M2OA 1MFUA 3D2UB 3AY2A 2LTQB 1IAIM 4N28A 3ABMB 4PJ5A 5I0WA 2IAAC 3DTXA 1JK9B 4N0UE 4RFOH 2H2PD 4WWOA 3H1ZA 3F7LA 1XSKA 4AVJA 5IB4B 5L0QB 2BNRE 2ICWB 1PX4A 3LSOB 3FHEA 1JNJA 4JDTL 4AZ8A 4N0UB 5KSAA 4NRYA 4PJDB 3PF2A 4HLZG 2VH5L 3CGTA 3D69A 2FAUA 4AL8C 3U1SL 2BNRB 3QEUA 4ZPTA 2I9LA 1JXJA 1LEIA 1JNNH 4FFWD 1Q4NX 2VUOA 2ZUUA 4LOUC 4NI6A 2B0SH 2BK8A 2Z4TA 3ZTDC 1UA7A 3BVUA 4WW2A 2EDBA 5FOJA 2EDXA 3OMNB 4PWEA 1ZANH 5B1AB 2D3VA 2CHXA 2R4SL 2OR7A 4LLYA 3MBWA 1VGEH 1RVFL 4PGCB 3V5KB 1VADB 2AEPL 5JW4M 2YGOA 4PJ8A 2W95A 1P9MA 5D2LE 1QHPA 1P7BA 2CR3A 2X53A 2VOTA 3ULUC 3VW3L 1DTUA 1QNZH 2PWFA 4OF6A 3VFTA 1ASOA 4R5VA 3QDMA 4HC1H 4PGDB 2J72A 4M8VA 1S7RA 5FYKH 4OD1L 5D2LB 1OAJA 1WHOA 4N2BA 4OTXH 5HDOA 1PY0A 5JHLH 2ZWKA 3WFDH 1IBZA 3HR5B 3AUVA 3LNEA 3NEOA 3NYKA 3NN8B 4ZFOL 3FFCD 3WJJA 4A66A 5IHUH 1J87A 3DSNA 1I7RA 2XFGB 1TTRA 1XTLA 5HPOA 3QR1A 4MB4A 4JDZA 5FHAH 3LKPB 3VCLB 1UZGA 2HVJB 1MWAH 4XR8C 4Y88A 4KKRA 3EHBB 1KBBA 4MQTB 3CZEA 5IK3B 2MPVA 2OMZB 4HA1A 4OIFA 5MEQA 3O3DB 3A24A 3GRGA 4Z95L 4UM9B 2CKBH 2IADA 3MLWH 3PHQA 1I9IL 4RGOL 1M6OA 3MRNA 3ZLQC 4UYPA 4KX9A 1OOAA 5I1HL 2BSSA 5D93B 3JVGC 4YSSA 1KB5H 1GY2A 3CZSA 4H8HA 4RMQA 4DGYH 4HS3A 1DJHA 4Z5RA 1SBSL 1U92B 1E65A 1QWHA 4GKZB 4OQTA 4N1HB 2AXGA 2QVTA 4YBHA 3P3SA 4ZUVB 5J12C 2HKFL 4U1SB 4JQXA 1WHPA 4K2UL 1R46A 1CXLA 3VAEA 4YHKL 3AU0A 1S7UA 1T5WB 1FBIL 3Q8FA 4OCXH 3I6GA 2B4CH 3JZ7A 1KULA 5HGGS 5E08L 4CJ0A 4EI0A 5EIQA 4XNQB 5H94B 2MFNA 3T4AC 4D3CL 2AAAA 2VGLM 4O00A 5E9DD 3OZ9L 3O0RL 4PB9H 1F3DH 1LILA 4JM4L 4FG6C 4NWUL 3K6IA 5HDBF 2BY1A 3O6LH 2ZWLT 1TLMA 1T89A 5I1JH 2ITCA 4JY5H 5F6IC 5E6UB 3HC2A 3CDGA 2AQRA 3TCLA 2YKLH 1QFWI 4Z7UE 3BESR 4HPYL 1HVXA 4OQTL 5JA9A 1OD9A 3VMNA 3HN8A 3O11A 5DI8B 4OKDA 1KLUA 2D73A 2OMYA 1QKZL 2X70B 3TXAA 1DEEA 1QYGL 2KQNA 2CJ3A 4NP4L 4XN1A 5CGBA 4JHBA 1NC2B 2P7TA 4Z7UB 4DPAX 2CR0A 1FGNL 2WWMC 4WTWA 3ZIMA 2UUDH 5IF0B 4AMKL 5J11C 4UZSA 2V7NA 1MZYA 1SFHA 1T80A 1SEBA 2IDSA 3VACA 3F6LA 3BEWB 3BAXA 1DL7L 1FL5A 3HG1D 5A2LH 3MO1B 1KEGH 2WXJA 1SHXA 5EZLB 3UROR 1QBLH 2XG5B 4G1MB 4TPRL 3CH1B 4ORGA 4RX4D 4UT6A 1U8QA 3MV9E 1AGBA 4GAJL 3CIQA 4LARH 4FFVC 4JKNA 4KFZC 4OCMC 3RWEB 3L6FB 1X3DA 4OLYL 2VABA 4Y9FA 3QHZL 2R8SH 2FB4H 3L4WA 3OKLB 2JK5B 4KMTL 2HT4D 4TUOA 3FTSA 2I85A 3M8OL 4N9GB 1XCQB 1S7QB 2QADD 3QCTH 5LCVA 1OAYH 4U6YA 2WLLA 4ATWA 1W8NA 2X38A 5IEHB 1F4XL 1U2YA 1IAOA 1F4YH 3GBMH 4MHHI 2NR6C 3UPRA 5DHXB 2FUQA 4QMEA 3NAAH 2V5RA 4GYBA 2YLKA 3G9VA 5CINH 4DT2A 2J1KA 4ZMAT 3WTTA 4UT7L 4X7EC 1E6OH 4JHVA 4XVUD 1KXHA 3OSVA 2Q2LA 4GEIA 4XAKD 5CJQL 2XKSA 4S10A 5CUSH 3MACL 3W0WD 4LLQA 4UT6L 3ULVC 2GFBB 1I1YA 2J5WA 2UY7A 3F05A 2R15A 4A6YB 4YLQT 2PPAA 1EAOA 4P57B 5EDXA 2VO5A 4HOXA 2X4TB 4UV7L 3EXLA 1K3IA 2WXLA 1UT9A 3WLWC 2F8IA 3QUXD 4FYSA 5LDUA 3T8MA 3KPPB 2VUYA 3NZUA 4CNIA 4DHLA 1U8IA 4QHUA 3A23A 2D7NA 1OCRB 4YS4A 4KKZA 1BVOA 4P2QA 3ARBD 3JV0A 3O41B 5LCVL 5LHDA 1EK3A 1SYSA 1LK3H 1SM3H 5KBMA 3MRHB 1XQ4A 2R4RL 1X9RA 3QI9B 1ASPA 3BRFA 1UB5B 2DBLH 2HFEA 4IBQA 4PJXE 3RBSA 1A7PH 1G9HA 5HHPB 1H6UA 4MAUH 2XWDA 2WUCL 3JVGA 1XR8A 3LZRA 4HX1B 1G1KA 4TKWA 4F7MB 4LAQH 4UQIM 4GAGH 4I2XA 2OZ4H 4JL1A 4PJXB 3FB5A 2GJ6D 2VDQB 4HBCL 3UG4A 3HBGA 1NL0L 2ICEB 1PLAA 2BINA 3VWJA 2V9TA 3U7YH 2IEPA 4YK4C 3MCLH 1AQ8A 3K74B 4DEUA 4E2OA 4QHKJ 2NXYC 3I50L 4M4RB 2AQQA 3STLA 3VXRE 2BOLA 2C7UA 2NY2C 4WY7L 1KPRA 1MZZA 4NNXB 3QNXB 3EJYD 1ZGLP 1FNFA 2KZBA 5FUZL 1ZLVK 4TN9A 3VXTB 4XE5B 3OLEA 3AG4B 4LL1A 4IBZA 4KI5F 3AQZA 3TWCL 3QUGA 4QRAA 3RA7L 1ETZA 4AIXA 4UU9A 3VXRB 4JRWA 4BM7A 3CSFA 4M43L 4LCIH 4ZX4A 1JGIA 4HALA 5M95B 1ZHKB 4P2OD 4L3EE 5ANMA 4JN2B 4AIZA 4GXFA 1WBZB 1KFAH 2BS8A 2EE3A 3BHBB 3CZFA 4HF5H 4HKJA 1BEYL 1LO0L 1CTOA 3QQ9C 5GISH 3RNKB 4K9EC 1UURA 1FVEB 1JRHI 5TDPB 3HPJA 4L3EB 3GPSA 1HJCA 2GAZB 2F54A 2QVFB 3H3PL 2ZNWA 2B9AA 3ELAT 4FYRA 5LXGH 4ZRGA 3H85A 5H4YA 8FABB 1W80A 4FCAA 3HRZA 4OGYL 1MFAL 1BX2A 4ONGL 1R33A 3ILQC 3OGCB 2NT1A 2Z31B 5FV1L 3PHOA 4JPVL 3U36A 1A1NA 4PVNA 4ZI8A 2YUVA 4LESA 3L9RB 2P46B 3KYAA 2P5EE 4LBAA 4AZUA 4MB5A 5IUSA 4CN1A 5B3JE 3KL5A 3W2DH 5HVWA 1DQMH 4GRLA 1IC7L 4Q6IB 3UZEA 3SKJL 4MYWB 2AEIT 4X5XB 5D9SA 4MA8H 3N42F 4ISVA 2CH8A 3KDMA 4APXB 4DUXA 5K9JH 5E94A 2WQSA 2C1PA 4NAQA 4XODA 4N6RA 5DVLA 5GJSH 4EN2A 2P5EB 1ASQA 3GHBL 4IMLB 4ACTA 2JWYA 2AQSA 2EZ0D 1HH6A 1ZCRA 3HMXL 5HI4D 4PWKA 1YUHA 4BSJA 1IEBA 2WIIA 1QBML 1AMYA 3QIWD 1AGCB 5FUCC 3ORJA 1ZHNB 2EIZB 1LO4H 2SODB 4UTAA 3DDFA 1JZEA 3U9PH 3JV4B 3SDXE 1QATA 1KWGA 3DMMA 3PL6B 4V33A 2VCOA 4PJEE 4DCQB 1RUML 1M71B 4Y16C 3P77B 2ERJB 4HS8H 2ID5A 3HI6L 3RE0A 2BVTA 2Z91B 3SDDB 1YEHH 1ZK9A 5FKPA 3ATFA 4Y2LA 3O3UN 1PLBA 3SDXB 4HWUA 1E0OB 1KC5L 2ZKHL 1H3UA 4PJEB 3S36L 4Y4KC 4Y5YC 4GUCA 4UQAA 3QJHB 1U8JA 3FUJA 1TTCA 2BFVL 2WP3T 1AHWB 3C60C 3FT3A 4GBXB 4OI7A 1AP2B 3NESA 2JLPA 4B9CA 1FL6B 4QHLA 2AC0A 2ZG2A 4APQA 2A9AA 3TA3A 4GRWE 3MOBH 2PYED 3VRLE 4MBRA 5DYOA 3O0LA 2XFXA 1JERA 3GJFK 2L8AA 4KK8C 4UTAL 5D1XE 3BWUC 3IDNB 2BS9A 4YR6B 1T22A 3GJEA 4GO9A 2CCLA 2ZCLH 2UX7A 1T7WA 4H13C 5IBUB 4DZBA 2VDLL 1JZ6A 1JZ7A 2VMJA 4U31A 5D1XB 1MREH 1WWBX 5I71C 4IRJC 1NINA 2W9DL 4AVKA 1PIGA 3LN5A 1U8KB 1T20B 2WXIA 3SGJA 3TESA 2ED6A 2KZKA 2GTQA 4RQQA 4OM0L 2H2SD 1PFCA 2DYSB 1CE1L 4H8VA 4JO2L 1EJOL 3LRGA 4W4OC 3UBXG 4E5XG 4DW2H 4HEME 1BMGA 1VJSA 2BFGA 3ASOB 1JYWA 3QFGA 2K70A 4XCFH 4KX7A 1J8KA 1R3KA 4DVRL 1N2RB 4UNVA 1CU4L 5DD3H 5EDSA 5CSZB 3TO4D 5EEWA 5JW3L 3BVVA 3VH8B 4ADGA 1XGUA 1J5IA 4P48A 1WBYA 4OZFA 1Q0EA 1MWOA 1TQVA 3MDJA 4P3CL 1RHFA 2O6EA 1MVFA 3L1OL 3VFUB 4X50A 5BS0A 4HJIA 4LB8A 3QULA 2FSEA 4RMVA 4R96A 5D7SH 3RFZC 1JHKH 1G7JA 3ATEA 4GAYA 3F7VB 4HXBH 5I18H 3QZPA 4WQOA 1WUZA 1WFUA 3OAUH 3VFWA 2WBXA 3DJSA 1SJHA 1KACB 3I85A 1OY3B 3ZO0A 4PRDA 1D5IL 1K72A 4KDTA 1E5UI 2BCKB 4PBXA 4R9HA 4UIMB 5DK0A 3BP6B 3GLDA 4L29B 2YAMA 3EFDL 3ABLB 3PWPE 3CAFA 1NH6A 2DL2A 5LVEA 3Q7JA 2VIRB 1JGVH 3QPXL 4OGQC 4Y19A 2F1BA 5GRUL 4QF1B 1ECYA 3G04B 1GS7A 3CLWA 4LP5A 3AADB 3CSTA 2C9VA 2UZYB 4YDIH 5AG8A 3PWPB 2VSMB 3FFOA 1JIBA 4OQ1A 1EAJA 4CILA 1SXBA 2B39A 4MDJB 4MJIE 2H1PH 1E6JH 3UCRA 1SLWA 5ESAA 3HZMB 3MCYA 2YMOA 1Z9LA 4GLRI 7FABH 1N0LB 4TUKL 1F3JB 5SWQA 1M2VB 3MRFB 1KIRA 3EGXB 1PQZA 3UJTH 3FOLB 3L7FB 3VU1A 5JXAH 3VXUB 3MUHL 1IX2A 4OZIE 4FNLH 2FYYA 1ONQA 1XDTT 4H1LG 1CLYL 5B22A 2DYPD 4GW4A 1BW8A 1F6LL 4YGVA 5B39G 5I1EL 2NZIA 2XX0A 3KMDA 32C2A 3FDWA 1Q0XL 4JFDA 1IC0A 3QHFL 3MLTA 4NBXB 4RCAA 1HZKA 2L3BA 3MA9L 1CZ8L 3B5GA 2W0FB 4FQJL 4R3SB 3WY2A 5HYIA 4OZIB 4EI6A 1TJHL 3WS6A 2XY2A 3FNKA 4OY9A 3WNJA 1P7HL 15C8H 2IQ9H 3AT8A 4Y4KA 4N2FA 3TTSA 3ARDC 4ZFQA 3DUSB 1DVXA 3ZDYE 4PRIA 3C2AH 3LB6C 3V10A 5IESL 1MF2H 1K4CA 3Q06A 4U7SA 4Y7OC 2IFFL 4D94A 5DEFA 5T5FH 3SOBH 2NY4C 4I18C 1EXUA 4O51B 5F0PB 1INQB 2OMTB 3HC0A 3KAAA 3PJLA 4FMVA 4IKNA 3RVVC 5GSVB 3ZDYB 1IGJB 4ETQB 2V0AA 1OM9A 2BVYA 4ZZKA 2X2YA 1E4HA 2NYZA 1C5CH 2W59A 1DBAH 3FQNB 3UL4A 5I75C 1YYMH 3F12B 3GSUB 2N7BA 4ODTH 3KPSD 4E42B 3ZMRA 2ZKXA 2CUHA 3H3KA 3HZYB 1ZVNA 1AZCA 3QGVA 2QSTA 5GGUA 3SKUD 4AENA 1DJZA 4S1SL 3V0JA 2RA1A 4HWEL 1YQVL 1D7FA 1WYJA 1OOWA 4ODVH 3ZMNA 3GMNB 2X4RA 2O5YH 1A2YB 1P5UC 5D72H 1UEMA 1AI1L 3MRCB 4KUZH 3IDXH 3AGVA 1G1CA 3I6SA 1FFOA 1KXVC 4W4OA 4Z78B 3TLRA 2YPVH 2PCPA 2QFPA 5EWIL 5I1KL 5BUGA 2HX7A 3K72A 3TWYA 1F41A 1BMZA 2YAEA 4NFDA 3LYRA 1QRNE 3LEVH 3LEYL 4BZYA 1R5IA 3RI5F 5HYEA 4WI0B 5ENWB 4DEWA 2X4OB 3NZSA 1TETL 2AEOA 2CRZA 1VERA 2ZSWB 4Y4FD 2N01B 5J56B 3PP3K 1IGYA 4J4PC 4PJDF 1QRNB 2GUYA 3LPWA 4F8LA 2X0VA 3H2WA 1FFNA 1SDYA 1I3GH 2X89D 4LSQH 4ZYKB 5TE4H 3RWGB 1EO8H 4G6JL 1A14H 1C1EL 1NBYA 2WLMA 1FLRL 1KJ2B 1Z2KA 2NXZB 3B6SB 5EOTA 4D0BA 5ADOH 4BRVA 5ITFA 1NDGB 3LNGA 4FABH 3EH4B 5ADPL 3CHQA 4WSKA 2IWGA 4Z8FL 2HJLB 5GZOC 4JFYB 1UD8A 5EC1B 4BCZA 4Y4HD 2FJGA 4FYQA 2YMTA 1H3XA 3DTXB 3GBNL 2A83A 5FUOL 2Z7WA 1INDH 4XB7A 3QCUL 1IFHL 1CTMA 3CG8A 4KK5C 2NY6C 3AITA 3CVHL 2VTFA 4J6IA 4F7CB 3NA9L 3UAFA 5F70A 2H6PB 3KJ4B 3HE7C 3G5YA 1KGYE 2HRGA 4ZBJA 2Y2WA 4LT7A 3MUUA 3NABH 4JVUA 5HI3D 4F5CE 4IHOA 5ICXA 1OT4A 4OLUL 4G5AA 1ZAGA 5CWSB 4YSPA 2WNKA 2I9LB 2FHBA 2J8UA 3IM1A 1H3TA 2VLJA 4GXUN 3DURB 2WXRA 4LPCA 1ES0A 1A6UH 5LN4A 4D9RD 2L7UA 2PTUA 2K6ZA 3MV7D 3CN1A 5FIEA 5I19L 1GPOH 4F93B 3EYOA 1ACYH 1XZWA 5AAPA 5D6CB 1HI6A 4LLYB 3HTLX 1KYAA 5HVHC 3QDME 4NHUA 3MYJB 3B2VL 5IVXA 1MFNA 5B7EA 5CLTA 1JHLL 1T7ZA 1INEH 1YN7B 4EDXB 4UZUA 5C9JA 4O02A 2ICCA 5F1IB 2EC8A 3H8NA 4WSGA 2EDDA 3VFTB 1RUQL 2DQUL 1TEFA 1CFTA 5DUBA 1EAPA 1L7IH 4ZT1A 3QDMB 1RI8A 4OZHA 5FYJD 3IDMB 5C0GA 2ZX7A 1BBDH 2FGZA 4I77H 1XSJA 3A67H 4JCWA 5ICYA 1IM9A 2Y69B 4HU2A 3ARDA 4DK6A 4XZUB 3TEWA 1UT1A 3KLHC 5D70H 3NFSH 3LEYH 1S6NA 2C7FA 2WVUA 1NAMH 3MPCA 3MOAH 1UTDA 4XPHH 3V6OC 5GSRB 1I1CA 2CA3A 3FOMB 1Y18B 1BG9A 4LSDA 5LDSA 5J6GA 3S8WA 4G8IB 1MHEA 1PYWB 3CHXA 4I9XA 4M1GL 2DB8A 1K9TA 1GCYA 1BQHA 4U1GB 4YXHL 1NMCB 1BYPA 5KBLA 2OSXA 3AWGA 3BLKA 1URIA 2BSSB 1CLOL 1U42A 2FBOJ 3H9YA 1TU2A 3M1OA 2KZWA 3KE0A 4BK5C 4YHZH 3S34L 4D9QD 1MCOH 3TF7C 1UM5H 2B1AH 3N6YA 2CJTA 5I6OA 4JPIA 5E1GA 1LE9A 3HN5A 1GGBL 1AD0B 4QOKA 2G9HB 5CJOH 1DQLH 3I02B 4IBTA 4Q52A 1USQA 1D5XA 2JSFA 4Z7UF 3M6DA 3GNML 2CO6A 2G2NA 3HHMA 1CF8H 1O6VA 4M9PA 1MCSA 2X7LA 3GSXA 2JV6A 3HAEA 1VGKA 4NZTH 4R26L 3QJXA 4QRRD 4NGHH 1VEMA 1LO5A 4TSBH 2BJML 3WXWL 1JV2B 3IDIA 4FQQA 1WITA 4LQFH 1FJ1B 3ZT6A 5C8JB 1GZQB 1AMXA 4OB5L 1HYSC 3CXHK 3OLGA 1H8NA 3MA7A 4BE5A 1J1XL 3GHEL 4QAMB 4J4PA 1KDJA 1BQKA 4TNEA 4PJGF 1RZFH 4ZMYA 2JCCA 1ADQA 3AACA 1OAXH 2VDMB 2J5LC 4HKXA 1YEIH 1RJLB 5EORH 2YXFA 4ODWB 5DYFA 4QY8B 1NMAL 3H9SA 2IAMC 4AVIA 3GSVA 4RESB 1KLUB 1MUJB 1Z9SA 1FN4A 3AQDA 4MMXA 5BUAA 5DFAA 4HV8B 4TL5A 5C2BL 4LOVA 3DROB 4N87A 4FXLA 2H9GB 4LIQH 4R0LA 3RY4A 1MCDA 1HFUA 3FT4A 3WY3A 5D7LD 1AY1L 3UYRL 4EN3D 2DMHA 5JUEH 4PS4L 4OV5A 1T1XA 3N85H 3Q6GH 3Q5TA 5EZIH 1QLRB 3QEQA 1XIWC 1OP4A 2HLAA 4YUEL 2G3NA 3Q44A 5HHNB 5DXWA 1H3PH 3LNIA 1PLGH 3Q13A 4M61B 5FYJH 5CJXA 4Z77B 4L5FH 4PJ9D 2BM3A 5DZVA 4Y2DC 4XC1L 4CC1A 1RK7A 1Z9NA 1C12A 2F15A 4TUOB 4NO3B 4PTTA 5F97E 1Z5LA 4GSDH 1X5MA 2OTUA 1OSPH 5DGRA 3UTQA 4BD4A 4R8WH 3RWJA 2MSPA 3ULUE 4NWTL 5DWUH 3AW5A 1RFDH 5JOEA 5DA0B 1CIDA 1ZXQA 3D07A 3N9GH 4I48B 4QR7A 5F6HI 2EE6A 1CURA 3SKNA 1QI3A 3TJHC 5HSFA 5DA4A 2PPFA 2B20A 4Y5VB 4EZKA 1XH2A 3L3DA 5CGYC 3E7JA 3NJLA 4NN6C 3IJSA 4LBEA 1MNNA 3NTCH 3UOAB 2BOCA 1DZBA 3LAFA 3FBQA 3KYKH 5I1CL 2UY7B 2IOOA 2FIKA 4RMUA 3TP4A 5KS9F 5C3IA 3MROB 1PU0A 4LSVL 4OUUA 1ILSA 4L8SA 3IGAB 2XXGA 5IB5A 1JGDA 1PG7W 4FDWA 4KKCC 4KMLB 2ADIB 5C0FB 3CDFA 5F2FA 1WC7A 3OHMB 1AR1C 5T5NG 3QAQA 3BT0A 2IF7A 2LU4A 2MTAA 4GAFB 4PCSA 4PBWD 5DZLA 1XCTA 2XYCA 3C5XA 4K23L 4AUYA 3ZT7A 1ZVSB 3CDYA 2C3VA 2EE2A 4WHTB 2NYKA 3KYMA 1PGRB 4D0DB 4NQDA 2UXFA 1OGTA 4FKHA 3EFFB 3ZY7A 3ZRSA 1LP9A 5F89B 3BCDA 3VYPA 5EBMB 4XO8A 3VU2A 4OD3H 5EU6D 4FA7B 5KJ7E 3JYCA 3M86A 4KAQL 2A73A 4JNXA 3UTZB 3TH2T 3SJVE 3WKPA 4WEEA 5DMIH 3FB5B 4MSWA 2GITB 2KZ1B 2CJSA 5E51A 3O4LE 1AXTL 4Z0BL 1PX8A 2FX7H 5HGBB 5J12B 4HT1L 2VW6A 3DPDA 5E4EC 3STLB 3SJVB 3T0ED 4NNYA 1SJEA 3FH7A 4QXGL 1JNHB 3O4LB 5HHVH 3TJPA 2BP0B 2KYIA 4H5SA 5F7EL 3ZK0A 5A2CA 3B7RL 4ZW3A 2XCMC 4MX7B 2ADGB 3FT1A 3T4AB 3VWKA 1YLBB 4OCYH 4UU9B 1GC1H 3DVFA 1E4XL 3WKQA 1KN4H 2G2RA 3KYOA 1Q94A 4RNRA 3PFUA 1A6ZA 3B7SA 4ZW7A 3WFCH 4AIZB 2Y7OA 4HOWA 1BVLB 4M8UA 2XXFA 3WEMA 1A6TB 5F6IB 4Y5XA 1SLXA 1SMAA 1NAKL 1KTDB 2XPYA 3K2IA 4NYLB 3KGUA 2CBMA 3P9LA 4S0SD 4CC0A 1UJTA 2R0WH 2JKSA 4WU7A 2EE0A 3NCJL 1IGTB 3KM2A 3TEYA 2P5WD 3WY1A 3VXQB 4N8PA 4PJIB 1A1NB 1QFHA 3QDGD 1GKOA 1F13A 3E80A 5J11B 1UYWL 4KK6C 5FGCB 3UYPA 2WUBH 4M02A 4NZRH 3FUFA 3OJVC 1RMFL 5BVPL 1RZGA 1VEPA 1MAKA 5IFHH 4PBVC 5I6MA 3WE6A 1GKEA 1U8MA 3MUJA 4HJ1A 1F58H 3QSKB 3AM8C 4JPKH 1CGXA 4U3SB 5E8NA 1KBGH 2G3ZA 2D7PA 2J55A 2Y36H 1QEWA 1IO4C 5IJCC 3V4UL 1IUZA 4BZ2H 5DTFA 1YUHB 2A4CA 3RZCC 3MLRL 1J8HE 1ULVA 3V79C 1FDLL 3QQDB 3Q2CA 4HLJA 4K8RL 4ERSL 2OR9H 1FVDA 4PSRA 2ZUTA 3UTPE 1A3ZA 4UQBA 3D34A 2LU3A 5ESQA 1J8HB 3B8YA 3WUWA 1AO7A 2ZXAA 3ULVE 1ZVHA 3D48R 2N1KA 3I2CL 5EB9A 1N6UA 3ABGA 4X4XB 2PO6D 2XWRA 1HEZB 3KHQA 4FXGC 4X5LA 4KVPA 3HIZA 3RTQB 3X13B 3ZDZE 1EFQA 2E56A 2VR9A 5DQ9A 5FPIA 4LXFA 1NBZB 3TBWA 2A9NL 1E2WA 3M45A 3TPUB 4K5NA 3TZVA 3ZDZB 5FECA 1HILB 3E8UH 5EZJB 4L8CB 3RVTC 5EOCH 2EDOA 3CSYA 2AJUL 3T8XB 1MKFA 4X2UA 1NCJA 4JN1H 5C0IB 3RDTC 4CSTA 4P23C 2A4EA 2XFXB 4B5ZA 1DDTA 3E38A 4IBUA 3KPMB 1FRGH 5D4HA 4MB1A 3GJEB 1OLZA 3CXHJ 3OLIA 2EEDA 2BSRA 2VL5A 3LKRB 4MXQC 4X8CA 3ZKXC 4ZMQA 4OF7A 4QUOA 3IKKA 4ZUTB 3QQ3B 3FT2A 3EJCA 3B9KD 1BOGB 2E5EA 3HG5A 2VN3A 2V9UA 4EVNA 1T0OA 5GGSB 5JA8B 1AZNA 1DQDH 3ARTA 1BEXA 2G4EA 1FVCB 3NZ8A 3BVTA 1CBVH 4LLAA 1PD0A 1BXXA 3D12B 4YK4B 4BGDA 1M7DB 4JVWA 5CKAA 1TJMA 2NXYB 5JW5B 4HK3N 3DUUA 3PGFL 3NOIA 3VM5A 2X4QB 4FLSA 1UUSA 2NY2B 3UP1A 3WHE0 5GRVL 3LHPH 2VXVL 1XWVA 4OZFB 2DQFB 4WDIB 1BZDA 4DEPB 1BD2E 3GZPA 1IBBA 3P0YL 5B4MD 5KG9A 3P0VH 4UF7C 1L0QA 3QYNA 5AVWB 1KCRL 1I7TA 3GXNA 4XBPA 3QULB 3FQXA 3MJ9L 3BI9X 4U4IA 5F7DA 3S4SG 1BD2B 5C08E 4M6AA 5IMKA 3HG0A 2YC1B 1UH4A 4YH6A 1X5HA 2QQKL 2FWOB 4L9LA 2Q8BL 3S35X 1T2JA 3CFKA 1P53A 3UBXB 1L6ZA 3ECBA 5GJTH 1M7UA 2CIIA 3MRLA 2X2HA 5C08B 5B38G 3BAJA 4QXUL 1PZSA 4X5RA 3QWRD 3TNNB 4ELDA 4RFEA 4KHTL 5AKSA 5HTSA 3AXIA 4NKIH 1LE5A 3S37H 2HVKA 2Z35A 1FV1B 4NAMA 4WGWB 4DQOH 3QG6A 4AEHH 2FWLB 5D71L 5PCYA 3KLAB 5J6HB 2OL3B 2Q87A 2ZPKL 3KPNA 2BMKA 3ES6B 3K8MA 2H7WA 1DVTA 5D7JB 2EADA 3BKML 3JTSA 1JPSL 2IBZY 1TVBB 3ULAB 3VRJB 5I1LA 4ZUWA 1ECZA 1CGUA 2WC7A 2F1AA 4YEEA 3W37A 3PV6B 5FUCE 3A47A 1BOYA 5MEOA 1PQZB 2BSDA 4RISH 1CGTA 4Z23A 4LDCA 2D3JA 3OAWA 2W07A 2XV6B 3B1TA 3RZCA 4M5TA 3R4RA 5IV2A 1WSST 2NX5B 3KZ8A 4ZX5A 1IBFA 3EYSH 3KNBA 1U8OB 1ZLWH 5DRZA 3WEBA 32C2B 1DJXA 3MVSA 1UOLA 2V5TA 5C7XH 3GWJA 5DJ0B 5JZ7C 3H9HA 3T77B 4X8JA 4M8RA 3FZUD 4FNRA 2H26A 4PWGA 4Y16B 1OSYA 4D9LH 2AXWA 4FQXD 5IB3A 4EUPG 1IGCH 3QC6X 5HD8D 1IFGA 3J8F7 3LRSB 1B3IA 1FG9C 2O93L 1TTFA 4Y5YB 4G5ZH 1J11A 4TNGA 5FB8A 5JHLA 5KSBA 4FEIA 3T3MF 3C60B 5E00B 1JNNL 4OV6F 1X6LA 1N8ZA 4DO5A 4KTEH 3WIFA 4QRPE 3II2A 1F2QA 3OHXC 4H1LB 2Q5BA 4CSSA 2NUTA 3BRDA 5HJDA 3PHAA 5B39B 1PKQA 1ZANL 5G4OA 3IGLA 3AMKA 3G9AB 1TCRA 3K4DA 1KBVA 1NMBH 4G6KL 3M1BA 2IGFL 3FPXA 4MD5A 3GDBA 1CN4A 5IFJA 3V0HA 4QRPB 2RMNA 3HVNA 3ISRA 1FWXA 1YEGH 3NJKA 1X4XA 1I8IB 3DI3B 4PU2A 3OX8A 3V0FA 4JFEA 4XI5C 3IDGA 3BZ4B 5C0CD 5DJAA 2OXGB 1GAFH 1E67A 3L16A 1FHNA 4IRJB 4HC1L 5I71B 1GA2A 3IXTA 3BDYH 2PCXA 5JPMC 4FE9A 1N68A 1P5VB 2WLJA 2W9EH 4OTXL 2YAPA 5JHLL 2X4RB 3WFDL 3K0WA 1DQJA 4X80L 3MRPB 1KXTB 2BNQA 2MJWA 3ARUA 4G8EB 5IHUL 4S1DC 2EYSB 1RP9A 4JM2D 5C09B 3RVUD 3EH5B 1IM3B 1MRCL 1KENH 2PW1B 3ROOB 4LLVB 4Y2OA 3GRBA 3K72B 3Q3GB 4WI8A 3ZKQD 4I7ZC 2H3XC 4J3OD 5TDOA 2GIMA 2QKSA 3FCSA 1QSVA 5AD0B 2CDFB 4NNPH 4XNUH 1S5IL 5ITBL 2LLGA 2NNCA 2CKBL 1ZRUA 1TTBA 1ZT4B 1OALA 3MLWL 5JR1L 1UXSB 5DJ2A 1VZIA 4W4NA 4ES8A 3L3HB 1A7QL 1IGYB 3ESVF 4ODXA 3HG3A 4X8GA 4XCNA 3ZO9A 4B97A 1IBYA 2R0LL 1FFNB 3DO7B 4NRXB 3CX5K 2HFTA 3KPRA 2IH9A 3BE1H 3OB8A 5ISZA 1YEJH 3RFZB 1N5YL 2XN9E 5FHBL 1UQSA 3L95A 3QQ4A 1BIIB 1U93A 4Q2ZB 4U7KA 3UO8B 4QXTB 4BE6A 1MVUA 4NLAA 4FHJA 4LSTL 1EDQA 5JOFA 1H8SA 1Q9WB 4ADJA 1KTRL 2XN9B 4KBPA 5HHOE 4DO6A 3D2UD 4G9DA 3M1CA 9CGTA 1I82A 3EOTH 2ZG1A 1BZ9A 1JUFA 1DQVA 1EH9A 3CC5B 4PJFF 1T1WA 1Q9KA 4JDEA 4XP5H 5AOIA 4XNAA 2D2OA 3CDZB 5HHOB 1BLNB 4LCCC 4LAJH 3RX7A 4FXKA 1AHKA 2E8ZA 4GG6F 3CTTA 3O6LL 4YDKH 4EMZA 1E4WH 2IDFA 2VC2H 4HS6A 3RDJA 2GSIA 1HSBA 3KLSA 4PTUA 4KQ4L 2ZUYA 4BUHA 1NGQL 3MV11 4XBEL 2QQNH 1FNHA 1JJUA 1KJVA 3MJ8B 3UBFA 1VA9A 3A4DA 5FA4B 5K93A 4OT1H 2YKLL 4ANUA 2MNUA 3FFCA 1A6AB 1FPTL 2VXUH 3PAYA 4MMYA 5ICUA 1TYEB 4HQQH 1J9SA 2WKOF 3DX6A 2C3WA 4NIYE 1DYZA 4LSRH 1K8DB 2MHAB 5F96L 3EYOB 3IGFA 1S9WA 1NCDH 1U91B 4F3FA 1CDUA 3HC3L 3ZE1F 2V17H 1BQUA 2DMCA 3IE9A 3HI5H 2BIPA 4S0TD 4ODSL 2B1HL 1TO4A 1KGJA 4IOSD 2ZAGA 2BSED 2L0DA 4K55A 3VFSB 2NW2A 2EXYC 1KEGL 3K6NA 3QA3A 1QBLL 5KVDL 2WXQA 3EFOB 1BVNT 2W88A 3OJDA 2WYHA 3QT2A 4WV1A 5E2UH 2B7DT 1JYNA 4ZFGH 3PWUA 3BD5A 1BWWA 2DQDL 1QUNB 1IM9B 2ZUXA 1NCWH 3ARDB 4IRSD 3DIFA 2YN3A 1KEMH 1CR9H 3IDUA 5GRJH 5L4JA 3U9UB 2FB4L 3ZMEA 4YHPA 5JTWA 3V4VA 4PGBB 3Q2WA 4JAMB 2NY4B 4I18B 2VXQH 1T03L 1IBGL 3QCTL 3E2HB 1U8CB 5ACLA 5CD3A 4HZ1A 1J0KA 5E5UB 3VVVA 4J3OH 4LPUA 1PG7X 1F4YL 3GBML 1A7OH 1SF5A 5I75B 5HJ3B 1FZMA 2DWEB 1H3VA 3H42H 1W72H 2WANA 3NAAL 4K3JH 5HY9A 4BV1A 2ZYRA 4QOKE 4CBZA 1ZT7A 3QRGL 1K5WA 1CBJA 1DVFD 4N9OB 4RMBA 3CUPA 4XVOA 2BWIA 3O6FC 1V55B 5CUSL 3T0AA 4HH9B 1QASA 1Q38A 2OYKA 4NPYA 2P43B 5A16B 4HIIA 1B0IA 2VITA 1SBBA 1P5UB 4BQ9A 2NDGA 2XPZA 1YMHB 5GGRA 2IH1A 2G4GA 4HK0B 2XX1A 1MEXH 4X98A 3Q1EA 3V4VL 1UZ6E 1J9RA 1IVLA 5F7YC 3FU7A 2JCCE 5K33A 1RJYA 3BUIA 4HUXB 5EU3A 5ECJE 2VXSH 3GSRA 2P28B 2DBLL 4LVOC 4CW1A 3SGEH 5JLZB 1QLEH 1C8PA 5KVFH 3C6SA 5TDNB 2X6CA 1EMTH 4MAUL 3WUZA 4GUQA 4NHCH 4MDIB 2G0KA 5I5IA 4XWOD 3MRIA 3HPLB 4HKXB 2E9BA 2QLVB 3NRFA 3C8KA 4LAQL 5AW7B 4N2GA 1JNLL 4GAGL 4F24A 2Q3XA 1UZ8B 3P9MA 3CN2A 3ZHLA 1TQWA 1I8UA 4DN3H 3EYQD 4JFHE 4LL4A 1MCPH 4G42A 4G71B 4H0LC 3MCLL 1NC2D 4KO6A 1PX3A 5I15H 2Q7AA 3GMMA 4JFQB 5DD6A 3T2QA 4XP1L 4EIGB 1UB6A 2X6UA 4P2AA 4NQQA 3KW8A 4OV5B 3BKYH 4YBQD 3WI9A 4HHAA 4BRJA 3K5RA 4ZDHB 2NY6B 4PVBA 4WO4D 3WTSA 4F20A 4KXBA 4HW6A 3HE7B 4DWHA 4YHNB 1VRSA 1KFAL 3VI3A 4FQ2H 3QH3B 4XNZC 5D7HA 4WSJA 2HG5A 1G4RA 1WQVT 2H32H 5F1OB 4JKLA 5EIVA 2XETA 4URTB 5GISL 5TQ0L 4AEIH 2DLGA 1NCIA 4X7TA 1B0RB 3MV9D 4PWFA 4X6DA 2AXJA 1FNGA 1GZHA 1OTTD 5D4IA 2XZQH 2HFFA 2YUZA 5CHNA 3ECUA 4ZAKD 4NRZA 1JFQH 1WIUA 2ODHA 3G6DH 2KHAA 2OSYA 3ARBA 2ROXA 3CE1A 4YPGA 2C9UA 3I3BA 5HVHB 3N40F 3SKNB 1MRFH 4M7LL 1ZLSH 3DC0A 4Z7OB 3B2XA 1GS8A 3MFFA 3GSNH 3BAIA 3TIEB 3WAJA 4HHWA 4C56E 3X14B 3U0WH 3VYOA 2EKSA 3IJSB 1PY9A 1RIVL 5K9JL 3RX8A 3NJGA 1IAKA 3V6OE 4L3AA 5A7EA 4XBMA 1NCAH 3TBVB 4AXWA 3OXRA 3G6AA 1WZAA 2FIKB 3JWNC 5B1JC 2AJYH 4GJTB 2GJ6A 2J73A 2WBJD 3DGDA 3HHSA 3IETB 4C56B 3POHA 1JGDB 3BDXA 1Z6JT 6TAAA 2A38A 3ETSA 2A6DA 3VFPA 2PR9A 3LKOB 1G7LA 4OGZA 4ZTOH 1LO4L 5IQ7H 3U9PL 3KGSA 3FQYA 1YEDA 3VGDA 2DI7A 3QI9D 2XZCH 1JAEA 1NLBH 2QR0A 1G9NH 3A22A 3PWLB 5DHVH 3OAZK 1AQDA 1YY9D 4Z7NF 1YEHL 4QRUB 3FTGB 3MUGB 4P2OA 5FAAA 1DSWA 2ARJB 2P52A 3IJ9A 1NLDH 1RSFA 3GHPA 3GMPA 2PW2A 4RETB 3LQZA 1TPXC 3FSOA 1TQBB 3WS3B 3BZEA 2GEQA 2A74C 2O4EA 3EDDA 2WVVB 1UXWB 2QMJA 5AW1B 2XTJC 2RAMA 2EH7H 4PJIF 4FI7A 4KZCA 4TVPL 4AGMA 4LGSB 1USZA 3R0MA 1KWKA 2XLLA 3RQ3A 3F64A 4DTGH 4JM0A 4E9WA 5D2NA 4N8VG 1ZGLM 2GSMB 3VXRD 5L8JB 1BM3L 1CE6A 1EDYA 2ZCLL 3FQTB 1Z9MA 4QXWA 3CWGA 5GRYA 1ETJA 4MCNA 3P30H 4PLJC 1DDHB 1WIPA 1M7IB 1YC7A 2P26A 3PQYE 1MREL 3GI9H 3PWVA 1PAZA 2JQAA 1XGPB 2YGNA 3IJHA 2LOEA 4J3WA 3K2KA 3MX0A 4XRCA 1MPAH 3NIDE 1S7WA 3L5WA 2BVOA 2J5LB 1U8HA 5C0BE 3FMGH 2CLZB 2BNUB 5DC2A 5DJ6A 2HTKD 2IAMB 3PQYB 5C07A 1CT8A 3GJFB 1WISA 4OJEH 4PLOB 4DW2L 2AV7A 2OMVB 4AYBA 1N6QH 1JGLH 3K91A 4XCFL 1CTNA 3SE9L 3KLLA 5IQMA 1G43A 5C0BB 1BFVL 1OAZH 2Z31D 1NFDA 3B2DC 5EF3A 5I8OH 1LMKA 4H26A 2XBTA 4IBVA 1PJWA 2ENQA 1YO4A 2A2QT 4QTHA 3ZR6A 2BC4B 2R23A 3JWDH 5AAMC 3ERXA 4BH7A 1XL4A 5BOZG 5IQ9A 1XIWB 3K4AA 5L7XH 1HL9A 1FSKC 3CCHB 2FATH 2DQCL 4H8UA 4X6BB 5D7SL 4X6CE 1RZJH 3LRHA 3EH2A 2VMDA 2FNWA 1CB4A 5K39A 5EU5A 1KGCE 2Z9TA 1MELA 4Y2DB 1A9BB 1KCWA 1F1DA 4OLXH 1MNUH 1SXZA 2VAJA 4W9GC 4M6ML 4CVZB 1AO7E 2Q7YA 4PREB 4X6CB 5FYLE 4KTDH 1JWMA 4TVUA 3TVMC 4CADB 1R3IL 3CZNA 3MV8E 2PYEA 3GYRA 3X1EA 1YNTB 1NJ9B 4XGZB 2LAAA 3PL6D 4HD5A 4JK0D 1N6VA 3JBG7 1TEYA 3U46A 2AMUA 1S9VA 3FRUB 4G6AD 4N90E 5CBEA 3SDDD 3MV8B 1P6AB 2CGRL 2AVFA 1RJZB 3UTTE 1TZIB 2V2TA 1Z9PA 2XC8A 4NN6B 2AKRA 5ALBL 4IW4C 4BDVA 1H8OA 1YZZA 3IJEA 1KYDA 2I24N 4PPTA 3UZVA 3WNOA 4M9OA 2HFGL 4G43A 1NIAA 3IU3A 3OKOA 3BIBX 1KV3A 3BYYA 4GBXD 3ZW3A 3UTTB 4NXKA 2NQCA 3UJTL 1KIQB 4Q7DA 1KLFA 2VDQH 1QNIA 3RJDA 5JXAL 2DEWX 3S35H 4FNLL 3RY6A 4J27A 4HUKB 3Q5OA 4X5WB 1AR1B 1OF2B 3TO4A 4A1RA 3EJZC 2OW6A 4DKEL 1TENA 4N2OA 4YE0A 5DJZB 3CMOL 3SE8H 2BSCA 4NUPA 2CDEB 3NP3A 1N8OE 3OAYH 4JGUA 1JPFB 1QFWM 4R90H 1G87A 5DD0H 4IGBC 4XP4H 5TF1L 1RQ5A 1D5BA 1WCBB 2V5YA 5D1XD 3FRPG 1LYQA 1XH3A 3D39E 4K5OA 15C8L 3OG6B 1HL8A 2X1XR 1SMDA 4MA7H 4EVNB 4HUWA 2AK4D 4ELMA 3PV7A 5D1QC 3R4DA 1BM7A 1UA6L 3C2AL 3EF4A 3QNZB 4KQ3H 3QIBB 4KJYB 3D39B 5GHWH 1TZOA 3HEIB 4DGIH 3LS5L 3P4MA 3BRGC 2FIRT 3WYRA 2I9TB 1VIWA 4MMZC 4M62H 4E9YA 5E4EB 4Q9QL 3RX9A 1E8ZA 4PJBA 5BV7C 3W82A 5ACZA 3ETTA 1C7TA 3LVTA 3SPVB 1V54B 4XWGH 5IVZA 1C5CL 4HEPA 3US9A 2AEWA 1YYML 3MNVA 1JDAA 4ODTL 4X6FB 1SOSA 5LAXB 3TF4A 1BFOB 3BUTA 4OU3A 4NOFA 1FO0A 3OR6B 1ET8A 4JFVA 1VFAA 4YN3A 4NJAH 4ODVL 2W91A 2H3KA 4HG4J 4XXWC 1J05A 1CXIA 5D72L 1O7DC 1CLCA 4HCRH 2LFEA 3BPLC 1LL1A 4PMEA 4M7KL 5LQBH 2YPVL 4H2CA 2DYPA 1PS3A 5LKNA 3VXPB 1IGIL 4MCMA 4PUBL 4IMKA 4JGJA 1XF5A 5CZVH 4ESKA 3LEVL 3VFRB 3JSSA 4PY7A 5L2KA 4RAVB 2BCMA 2NNRA 2P24B 2YD2A 3DDGA 3C08L 4B9PA 1DBBH 3ULSB 1KELL 2AABH 1QSED 4KJQD 5AAMA 3WXVH 1G7IA 3HBPA 4MXWH 1GW0A 3S4SB 1SDAB 3AVEA 3G5XB 1FO0L 1MDTA 2QPFA 4KRPC 5TE4L 4HGWB 3V5HB 1A14L 4XMTA 3LN4B 2JF1A 4HJTA 5ADOL 2XBZA 4C57C 3CSBA 4MJID 2EIJB 4MAYC 1QBAA 2UVEA 4FABL 4HIEA 3RZCB 4HCIA 4OZGF 2FJFB 3ZGIA 2V9RA 2GJZB 2FWSA 1R9FA 1W2KT 1WAAE 3ZZQA 3L3KA 2F7PA 3L2LA 4LLMB 3HNSH 1X7QA 5TE6L 4XMZA 2VLLB 3W9DB 3PWJB 4WUUB 1FZJA 3LEXB 3KPSA 2AQ3A 1JZ3A 5T8IA 4TQHA 1KPVA 4ODUB 2EH8H 3S36X 9PCYA 4GRWH 3FQRB 1VFUA 3SE4C 2XJLA 4WCYH 4FXGB 1N18A 4OIAA 1YY8A 3WG7B 2KL6A 3EGDB 1VAHA 4GUPA 4LGRB 4MJJA 3ET9F 2XQBH 3NABL 2WTRB 1PKQE 2OXHA 1QR1B 4CN6A 2H0JA 4BFNA 4CC4C 3EUDA 4JFTA 1G9MH 2FEEL 3BP5B 4OAWA 4ZXBD 3UYOD 5IT2L 2LHAA 4XP6H 1T66D 1R17A 3T2LA 2RB8A 1GPOL 3RDTB 3QXAB 2IFGA 4P23B 4UDUA 3DGGB 5DO8A 5GS2D 2DDQH 3B3BA 4NQEA 3AWEA 1RZKC 1C5BH 4UOW1 1MRDL 3EO0A 1RZQA 5D6DA 2D3NA 5K59E 2VN6A 3NQIA 5E23A 1U95A 2BNQE 1S9XB 4XCYB 2VDRH 4GIAA 5C6PB 3MUZ1 5E6IA 3ZKXB 1JPGB 2H0FA 2X89A 3OPZH 3UAJC 4ANWA 2AERT 1XGTA 1JZHA 2XN2A 3CPLB 4JZNA 5F93C 2WZ5A 2Z3FA 4I77L 3N44F 3A67L 4LF3A 3FN0L 1ZA3A 2WXMA 1J10A 1Y6KR 2BHZA 2TSBA 3F00A 2EILB 1UD3A 1D3CA 3P69A 5D70L 1P84K 3BT2L 3GZOA 4NBYB 2ENPA 3MOAL 1UG9A 5I8KL 4HWBH 4YXKH 3EGSB 3GXIA 1S7SB 4I4WB 1OF0A 1KLGB 4CDGC 3L4CA 1PNDA 3GTTA 4UANA 2WGNB 2XVKA 2ODIA 1HZHH 2E27H 3P11L 1IIIA 3KPRE 5ISZE 2YEVB 5DR5H 4LP8A 4TS6A 4RZKA 2UY6A 3Q05A 1XB6A 1UD4A 4ABVA 4G8FA 1QFUH 1QRND 2CSPA 4R7DA 2YAHA 3A3YB 4TLUA 4UUJA 4ZS6C 2P8MA 5E6RB 4GQZA 1N10A 1EVUA 4AE1A 1S9KC 1Y0LA 3KPRB 1IEAB 3Q8AA 1MCRA 3G5ZA 3FU9A 2Q9OA 1ET7A 3PE9A 1UM5L 1F1AA 2NXZD 2A6KA 4L8DB 5T1KA 3L95B 1XCXA 4EXKA 1XF4B 1IE5A 1QFOA 5KYYB 2EVHA 1FUNA 1AGEB 4S0HA 3LZFH 3I6KA 5CJOL 4ZW8A 1LJMA 4NQSA 3MV7A 5EFIB 2RFXB 1TMQA 5AZEL 3WNKA 1EXHA 1OPGH 4HPHA 4GG8B 1J1PH 2NYYC 2ZWNA 3FTUA 3O6ML 3EXJA 4PJHA 3ARSA 3RP1A 2KC0A 2OV0A 4WJ5B 5HGDA 4NGHL 1CO1A 5J1AB 4IIQA 3U7AA 4U6XA 2BOBA 1JVLA 4TSBL 3WMSA 5F0LB 1QZNA 4H8WC 4LQFL 1BQHG 2WWOA 4FGMA 3M17B 3EH3B 2IWKA 2XY1A 4FQHA 5KSAD 5AAWC 2VISA 1CVRA 1W9XA 4XHJC 3MRGA 2GBAA 3LKQA 2XZAH 4JLRA 2YRPA 1YEIL 5LLIC 4U1LB 2DICA 3N1MC 2Z4QB 1BVKA 1N26A 4W68A 1RZIA 3T09A 2GI7A 1ZTMA 4HJGA 1XO8A 5I1IL 1S78D 3ZQ9A 5J8OA 5DUPL 3BP4B 3QUMA 5CBAB 2BIMA 4G8GE 2NQ3A 4PR5B 2WJ5A 4UTBA 3PJSA 5GS2H 2C4FU 4PJ8D 4X0KA 2MH4A 4L4VB 1R5WB 5EEUA 1KCSH 3LH2H 1ETB1 3N85L 3Q6GL 2UUDK 4ALAL 2R29A 2R2HB 1B9KA 5I16A 1I85C 1FYHB 5EZIL 2ZICA 3QA3B 4G8GB 1UVQA 2P42B 3RI5K 5FO8A 3QDMD 1CICC 3IS0X 4N0RA 4BUGA 1H3PL 2ZXDA 1TVHA 3DJ9A 3OKMB 5EZOL 2DQIL 4CSPA 3VI4E 3I9GH 4L5FL 2R2BA 1WFTA 4M93C 4PJCF 2YA2A 2ROYA 3DVNA 4EIZC 4CC4A 4XPAL 5JIMA 4JGNA 2F08A 4MCZA 5F7AA 2WCGA 2L04A 2Y7MA 1Q8MA 3OHXB 4GSDL 3VI4B 4M1CC 1QA9A 2I5YL 1T04B 3BP7B 1OSPL 3MTRA 4JQIH 4EAEA 4R8WL 5TJWK 4W9IC 2JJTA 4FLRA 3ZE0F 2Y9RT 1TUPA 5DWUL 1A9VA 3NIFE 3QUML 1OGAE 5DVPA 1JZFA 4N2LA 2LU7A 3AXHA 1J0JA 2E3VA 3QUYC 2P8PA 4UTBL 4EUPH 1UZ6F 2XVGA 4K5PA 1V7MH 2YBGA 2IV9A 2GT9A 3I75A 5HY9B 3BGMA 2R29L 4N2HA 1HKFA 1T7YA 1YVLA 1EEZA 2B3RA 2X87A 3NIFB 3RURA 1OGAB 4U6HB 3QZOA 2VH5H 1BQ5A 1BP3B 3U1SH 2FO4A 5I1AB 5JPMB 1DQTA 1YPZB 5IJKC 2MOGA 3BH9B 3IS1X 3U0PA 5KN5B 1A22B 1CXHA 3VD4A 2ZG3A 2WCSA 1CPUA 4GOSA 1T1ZA 4MRBA 2CUAA 2NTSP 5JNYB 5FCSH 3ZZ1A 4J39A 4X8XA 1RK1B 2QSVA 4G80A 5I17A 4ICWA 1F6FB 4X42A 1VZGA 3GI8L 4Y89A 1SOKA 1TFHA 1U3JA 1UOVA 3FO9A 1DQQA 5FA3B 1J1OL 2XWZA 3BLPX 5D7LA 3SB3A 4GKSB 5A2KH 1M56B 3HG2A 4JY6A 4KI5C 1L0PA 1GJIA 3VW3H 1TZAA 4CW1B 1U3NA 3MUY1 2NUPB 2YZ1A 4Z0XB 2ATKA 4KH9A 3MGAA 5BVJB 3VTTA 3C8DA 3CC1A 5CEXA 3FSAA 4PJ9A 5EV7A 1RAMA 3CX2A 2IALB 4L1SA 4Z7WA 4ZFZB 4E41E 2OMXA 3IMRA 3UTSA 2Q2EB 3NJIA 2PP9A 3QYCA 2H5UA 3F6IA 1D6EA 4MWFA 5DFVD 1URZA 3MBXH 4U4BA 4HIJA 3REWB 3PGDB 5BZWA 4E41B 5IM7A 1R24A 3E1F1 1TOXA 3WHXB 4IU2B 4RGOH 1CQYA 1S7VB 2DQTH 2CP