3W1ZA

Heat shock protein 16.0 from schizosaccharomyces pombe
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
134
structure length
134
Chain Sequence
b'PPTVNDLFSDFVSYSPRLNNQIPGELSPSIDVHEGKDTVSVDVELPGVKKEDVQVHYDSGKLTISGEVVNERKNESTEGNQRWSERRFGSFSRTITIPAKIDADRIEANFSNGLLTVTLPKVEKSQTKKQIAIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein 16
molecule tags Chaperone
source organism Schizosaccharomyces pombe
publication title Nonequivalence Observed for the 16-Meric Structure of a Small Heat Shock Protein, SpHsp16.0, from Schizosaccharomyces pombe
pubmed doi rcsb
total genus 18
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3w1zA00
4FEIA 3AACA 5DS1A 3GLAA 4RZKA 2O30A 3Q9PA 2Y22A 4YLBA 1SHSA 2WJ5A 3L1EA 3QORA 3L1GA 3QORD 2N0KA 4JUTA 4M5TA 4PBDA 3IGFA 3AABA 3L1FA 4JUSA 2WJ7A 3VQLA 2Y1YA 2Y1ZA 1WH0A 3Q9QA 3VQMA 3GT6A 2KLRA 3GUFA 4M5SA 1RL1A 3N3EA 4PCKA 4YDZA 5DS2A 2CR0A 2RH0A 4ELDA 3QORC 2BOLA 4ZJ9A 2CG9X 3W1ZA 2XCMC 2MNWA 1GMEA 2N3JA 1X5MA 3J07A 4YE0A 2JKIS 4YLCA 1WFIA 4I88A 4MJHA 3EUDA 5LUMA 1WGVA 4YL9A 2KMWA 3QORB 2K8QA 1EJFA
chains in the Genus database with same CATH superfamily
4MBRA 2LAGB 4ZD3L 3B7SA 4RA0C 1HOCA 4G8EA 1O0VA 2F53E 2WGXA 3K71B 1WC7B 2R2BA 4QXTA 5EC1A 2R1WA 1NCHA 4LL4A 1S78D 2MHAA 3A24A 1BX2B 1JZ8A 2ATKB 3UZEA 7CGTA 4G6AC 3SZ6A 3LNDA 3WFCL 2AAAA 1XCTA 1AGEA 4AQOA 3WTWA 4G5ZL 5IW1A 2DQUL 5CFHA 5EZIL 1QTSA 2EO1A 1P4IH 2XX0A 4IRJD 4I0PA 4K94C 3AG4B 1SM3H 4IU2A 4MAYD 5DHXB 1N2RA 4R3SA 3QEQE 3CXHJ 2L7QA 4RAUB 2APTA 4JG1H 5DQJB 3D18A 1JGLH 3OC8A 4UBDC 1SMOA 2FJHB 1FNEB 4YIQB 4KO7A 4ETQA 4OCNC 3VMPA 1KTBA 1NBZA 1CFNA 4YZFF 4F92B 5I2IB 2EDJA 4TNGA 2XC8A 2DWXA 3VFSB 3WAJA 1A7RH 2A74C 4OZGA 4Y2NA 1U21A 2NYZA 2P1YA 5ETUA 3S8FB 1OM3L 3NIFB 5E4IA 5E70A 4P07A 2FSEB 4DEUA 3L9RA 1H6EA 2DOCA 1JS4A 4TVSa 1JZ3A 1LE5B 3LZPA 3RZWA 1XGPA 5D1QC 4QKXB 1R3HA 2BERA 3OXRB 3MNZB 4Z3FA 1J8HA 1TENA 4YNYA 2VN7A 4LPWA 1OF0A 4PJXF 1MAMH 2XG4A 5IROD 1HXYA 3UTTB 3P3UA 4GIOA 3KG5A 1U8NA 4NPYB 2ETWA 3SPJA 5ISZE 4G1EB 3NSDA 2DH2A 4QGYA 1UB5B 4XR8C 2YARA 4C55A 3OZLA 2CO6B 4OFVA 5D5MB 2PTTA 3QHTC 5JDSB 5BOJA 1T22A 1O6SB 1A6UL 3O81A 1AAJA 4PJ7E 1A6TB 2F1BA 1QSED 3HNSH 5CBAA 3UG5A 4K8RC 4HOMA 1RZFL 1CF8H 2YUVA 3ARBA 3MJ7B 1T1YA 4JFEA 2OP4L 4OGAC 3NJLA 3EGDB 5F6IB 2G2RB 4JN1H 5CWSB 1H6TA 3ESUF 4IMLA 3NAAL 4PRHD 2BY1A 5DLML 3UTSD 4Y1SA 3IAPA 1OPGL 3EH4B 4KKCC 4QXGL 3B6SB 2VRQA 4O2FA 5C07D 3W3BA 2FECI 1MY7A 5GGVY 1N0XL 2EC9T 3RBGA 2AQ3A 3BO8B 3C60D 1BFOB 3VXSD 4M6OH 3VYNA 5A7EA 1OB0A 4Q52A 3RQ3A 1FYTE 5ES4B 1KPVB 4FXGC 4XHJD 5D4HA 5INCB 4LCCB 4ZZKA 3TN0A 2IJ0C 2P5PA 1UYWL 4KTDL 4BH7A 4WGVB 3OLIA 4QYOA 5KYWA 1I8LC 3C5SB 1F11A 1NIFA 5DD0H 1LDPH 3HRZA 2BX5A 1A7QL 3TH4T 4GRWH 4MS8D 4UUJA 1KN2L 3HC4H 2VZVA 4X7EC 4KZDH 2RB8A 1OLLA 2J1WA 2QVTA 3AU1A 2R1YA 1LP9B 5JOFA 1LDSA 1YEDA 3PP3K 3T2NL 4MQTB 2MOVA 3HTLX 5EEZA 3CVHA 1CLZH 5LDUA 5CU5A 4JZJC 5F1KC 1RVFL 3FTWA 2VL5B 3FFCD 3IFOB 4NFDA 4JFVA 1WWBX 2XVGA 4YLQT 3FN0L 1D2PA 4YNYB 5D5MF 4HU8A 5FUZL 3BOVA 3MNZA 1M2OA 4LCCA 4WI8A 5JTWA 2B4CH 3I6GB 4HJ0C 3ZE2E 1IM9A 1XIWC 1KPVA 2VXUL 3H3PH 2NY5L 3DMMC 2BCKB 1OW0A 4QTIL 3LEYL 4WI9A 4X7TA 1CLOH 1U4EA 5L4JA 5JIQA 2AF2A 2H45A 4K71C 4PCTA 3QB7C 3L6FA 3WO3B 1PF3A 1P1ZA 3FULA 4LVNB 3IAQA 4MD4A 3RWCA 4M7LL 2VDQL 2WUBL 3HVNA 5EWIL 1N0LA 3U6XS 3VACA 1BWMA 2PUQT 4XN9A 1H3PH 4AZUA 5C0DB 5E1IA 2QHRH 1ODUA 4ZO8A 1M71B 5B4MC 2X12A 3RX7A 2AK1H 1BZ7B 4A1RA 3ZTEA 5CBAB 2Z31A 3JSSA 2V5MA 4DN3H 1A6TA 4NLAA 2GITA 2HFGL 3GINA 3IGAB 2KMWA 4PWEA 1T0PB 3BQUA 3SDXA 3UROR 2NNRA 1G0YR 1REIA 5LXVA 1T80A 2WVVB 2PCYA 3BH8A 2OV0A 1FIGL 2A83B 3FTUA 2R8SH 4UM9B 2BOCA 2LVEA 1ZLSH 4IOSD 4NPYA 5HHMD 3VU2A 5LNGA 1HAWA 2ZCHH 1WK0A 3DV6B 3GRWL 3O6FC 3K71A 2CBQA 5DVPA 3BAYA 4WLCA 4XOBA 1KG0B 4JO1L 2XNAA 4LARL 3WDIA 4Z7WF 2DYPB 5F7LB 2AJVL 3O11B 4KVNH 4OUUB 4N2IA 3TURA 2MPAL 4TTDC 3ZDWA 5CJ5A 2WIIB 5DZNA 2RTTA 3V4UL 2PCXA 2W65B 1I1FA 2J1YA 3E1F1 3ABKB 5KTEH 4XXWA 4GQ9L 3GLAA 3VRJA 2CO3A 3FRUA 1NPJA 4GMTL 4CA4A 1NCDH 2PPEA 3ZKNC 3RWJB 2XA8L 1KBPA 1AZVA 4IMKA 5AZEH 4BWUA 1K5WA 1ZAGA 1S7UA 5B3NA 3ORJA 1GGIH 4HS8H 3M1BB 5FCSH 1LGVA 3WLBA 2RH0A 5JHLL 2X4UB 1Y0LB 2A6KB 3POHA 4PW9A 4CMMA 2QTEA 3BKJL 3WKYA 3TESA 2CJUL 4Z7WE 3DX6A 4WI0A 1ZLWK 3SDDC 2J8UE 3GSNB 4I85A 2FJHA 2PP8A 3LPWA 5D2NC 4RFNC 1NDMA 1T5WB 4YXKH 3JZ7A 1W91A 2OSXA 3UH8A 4PRHE 4QHUB 2ZJSH 2WXGA 5IW1B 4LVNC 1AO7A 3OB8A 2G0LA 5J6SA 3CFJA 3T1FB 5HGHA 4UQ2B 4CW1B 3DVNB 1GIGL 5MEOB 1RU9L 5IB3A 4EVNA 2MHAB 3CQQA 3MLUL 1U6AH 2AW2A 3NJGA 1YEFH 3O2DH 5HJ3B 5I1AA 1ZTXH 5AL0A 2FH8A 4JFDA 3QZBA 2LU5A 2WQUA 1KJ2L 3MRHA 1DANT 2X4SB 1TZHA 3BFQG 5DJ2A 4GXVL 3OKKB 2C3GA 3QO0A 1KIPB 4P5MB 4IRSA 1UJ3B 2B08A 3PG2A 3MV9D 2DLHA 2HJLB 5IB4A 2IAMA 4OF6A 4J6RL 5EBLB 1FO0B 2GHWB 4MA8L 5I24A 1FV1A 3DK0A 4MXVE 3H2PA 4AYDC 4MXVF 5K9KB 1HINL 3VD9A 1T2QL 3O3DA 4P2RE 5GJTH 2ZUTA 1JXKA 1PPIA 2O6FA 2C3VA 3A23A 2IH3A 3FU5A 2WANA 1JK9B 5EIIB 3WBDA 3C5XA 1A6PA 5EN3A 4GI9A 4HJGB 1MEXH 2JE8A 3Q6GH 3FSZA 5EUOB 1UM6L 3UBXB 4TSAH 1IKNC 4PVLA 2ICWA 2AQRA 2NY2D 3QPKA 3SBPA 1D5RA 1IAKB 3WUWG 4F9LC 5B39G 4K0OA 1OARH 2A9ML 3EYFB 3QT2A 4N2LA 4S11A 5F3HB 3REVA 1FVCB 1QRND 4XBEH 3CK0L 4JM2C 4KVPA 4C59B 1RP9A 2IALB 1PIFA 1N5AB 1MCOL 4JG0H 5T1LA 5I6NA 5DJXB 4ZFGL 4GQPH 1C1EL 3HG4A 2VRKA 2PETA 4NZRL 4ZFOL 5FYJU 1UZ6F 3D39B 1A7BA 5GS1B 4PRIE 1S5HA 1KFAH 4MNHB 1UWEL 5F1IB 1Q4NX 3RUGF 2V2XB 4KHXH 3A6CH 3FF7A 1SOKA 3U2JA 3FQUB 3KCPA 5FWRA 1CN4A 2OL3A 3CLWA 1Q9OA 3QG7H 5JIDA 1DQLH 3D4GA 2E56A 3QRBA 5EU4B 2D0HA 2IIJA 2CDEA 5HHME 1BMZA 3OJ2C 5DQDL 5DFVC 1B0IA 1Y1UA 2P46B 1E28A 3BGAA 1G4RA 4JVUA 3H0TB 4PJ9A 2CDEB 2FRGP 3LRMA 3RGVD 4E9XA 4IHOB 1CVSC 3OBAA 3TZVA 2VXSL 5JQ6L 2X4QA 5T5FL 5H37H 3BKML 1A5FL 4HDIB 3VVVA 4JO2H 3CTTA 4POUB 1NCTA 3GF8A 2X0VA 4HKZA 1HEJC 1PX4A 2A73A 4HIQA 3PUCA 2XZCH 1F56A 2B2XH 4KZ0A 2YWZA 4ZO6A 3SQBB 3EIFA 2LFEA 2OR8A 1KXHA 4IGBB 4AEEA 4D9RE 3RGVC 1LEGB 3B2MA 2BO0A 2Q20A 4FQCL 1RJLA 5SWSA 2XSKA 4O4YH 5ICZB 3RX8A 5GISL 1GGBH 2ZF9A 4FYSA 1RPUA 1RZPA 2Z3FA 1PIGA 5T3ZH 4P9HH 1EAQA 3QUXA 4LSTL 4YXKL 5CD5D 2M1KA 2H1XA 5F3HA 1EEZA 2VSMB 3BAXA 4TQPA 4AV4A 5I1IH 5JYMA 3Q8BA 4OLVL 1CICB 3TCXA 5JW4N 1GSMA 4OJEH 4D9LH 3EHBD 2ICWB 2VMCA 4ABQA 4BHUI 1MCDA 2P48B 3BGMA 3GSOB 3SGDH 3RI5F 5B3JE 1PU0A 3Q48A 3R1GH 4TSCL 3ZTJG 2HJKA 3VGFA 5JA8B 1F45A 3HS0C 4OLYH 1M05A 2K6WA 4HDIA 4OY9A 2WXRA 4Y19E 2D4DA 1MG2C 4HVBA 1TZ8A 3EHBC 2HX7A 5I73B 4APQC 2EDYA 4Y19A 1I8KA 2NZ1A 5E2WH 1YN7A 1GS6X 2HVKA 4O51B 3MR9B 3WY2A 5ICXB 5L8KB 1FE8H 4POZD 2HKHH 2QQLH 1F2QA 1HH9B 1J5DA 1NMAL 4JL1A 5AUMA 1LTXA 5A40E 3KPSE 3UOAB 2DQCL 3RFRA 4BWWA 1B4JH 3HEIB 2AJYL 5AVVB 4OCMC 3MGTA 1YDPB 3MV9E 2VMFA 1BFVH 5D71H 2OJEB 4ZMZA 3CC5B 3EO0B 4PJ7B 4XB3A 5F1IA 4IMKC 5GRVL 3PJSA 3BXNB 2GPZA 3T2OA 1A7QH 1NGXA 2X4SA 1AXTL 3FQXA 4E0RB 1BEYH 4YDKH 3HZKA 3UAFA 2XUWA 5KBLA 2XICA 4H0LC 4DERA 3UO1L 2MCAA 2IALA 1T1WA 1N5YL 2BIQA 2N56A 3RB5A 1OKEA 1UOVA 3T1FA 2V17L 4ZAKD 2VISB 4N0CC 4X4XA 3NIDB 5CSZA 3P30H 3NZ8B 4HZ1A 3V95A 2WBJC 2NXYC 1CGUA 2JELL 3T3PF 3GPEA 5JORA 1YYLH 2IWGA 1U91B 1FO0H 1RURL 1T2JA 3Q05A 3DVIA 3VTTA 1AKPA 2CM5A 3WTXA 2VW6A 5FYLL 1MF2L 3BZDA 4X8GA 3QIWD 4HETA 4PJ5D 1T21B 3M17B 1AC6A 1ADQA 1S7UB 2GBTA 3GLDA 3CN1A 3QPQD 3N0PB 3F7VA 4PRBB 4LLVA 4EBQL 3MUGB 2DQJH 3SBQA 1J18A 3K2KA 4UQ9A 3T0ED 2VE6A 4HHAA 4TTGA 3RWIB 3RAJH 4P3DA 3O4OC 2FVNA 5HYQB 2DTMH 1NANH 1IT9L 1BQLL 3KYOB 3P4MA 5I6KA 3LHAA 1PJWA 1X9RA 3E80A 4MNGB 4DT2A 2ZXDA 2F5AH 2IVFC 1W80A 2XBZA 3QAZC 4Q0XL 4M00A 3P73A 3KM1A 1D6EB 4PJIE 1X5ZA 1K4DB 2LFGA 5I1HL 3QUZA 2GT9B 4WTWA 2NX5A 2MNJB 3CLFH 1Z5LB 1XZ0A 3D2UD 4AK1A 2NRDA 4AQEA 4O58L 5GS0C 3CFCH 1L4IA 2VL4A 4HG4K 2VM3A 3ES6B 2GSGB 2RD0A 3BH8B 1TEFA 4PB9H 2YRZA 3FT2A 3VQLA 4CL7A 3LXCA 2H32H 2ZSWA 3D9AL 2C7FA 4JBSA 2XA3A 4JFEE 2OYPA 3UGXA 5I0VA 4ERSL 4P23C 1O5PA 4D9RD 2X41A 1KGYE 3O0RL 1BMWA 2ZX8A 2KUTA 4KMLB 3DHPA 1U4FA 3CZGA 4EI5B 3HN8A 4JM4H 4KY1L 4QHLA 4WI0B 3ZKMD 1FL5B 2YAPA 1E8YA 5L8LB 1B90A 4MMYB 3I9AA 1AKJA 1ED3B 3LH9A 4KJYA 1OAYH 4Y16D 5DD3H 4MA8H 3WLBB 1UH3A 4LEXH 1ZDQA 4KJWC 4F7CB 1NC4A 2EKJA 3IRCA 5A2FA 2J20A 5AALA 1N18A 3BKYH 1U3HC 5CKGA 3PL6C 4YGVA 1ZOXA 4BFOA 3KD4A 4J3OF 1N9PA 1Q9LB 1XT5A 2JJUA 3LZNA 4P04A 3FRUB 1UG9A 4TF4A 1I7UB 2GG1A 4Y16C 4NJ9L 3AQDA 3I6GA 3M1OA 1GJUA 3L54A 1NCAH 1VEPA 2WIIA 1T6VN 5CEYB 4OU3A 1CLCA 3UYPB 1E40A 4QHKI 5HP5A 4GY4A 3GK8H 3LS4L 3HG3A 4AH2B 2FTAA 4PI2A 4LIQE 4CC4C 3F7RA 4HCRA 2FE0A 1QG3A 5T5NF 1AMYA 1LK3L 1WISA 4WW1B 5DC2A 4G7VL 5FF6B 4KKZA 1A65A 5LCVL 1I7RB 2ZCLL 1FL3B 4JFOA 4FTVA 2L0DA 4UDTB 3CBKB 3T8XA 1WD9A 1ZD6A 4M48H 1G87A 2YPVA 4RETB 3BQUB 1F11B 1ZIAA 4BFFA 4E9TA 4Z8FH 2V9UA 3VJ6B 4IGBD 3MRQA 2V2TA 5TDPB 4NP9A 5BRZB 5IMOB 4RDQG 3VFWB 3ZE2B 4KMQA 4A2MA 4R9HA 4WI4A 1XD1A 4JRYD 2EDTA 1PKOA 4YO0B 1A4AA 4Z3JA 1CYGA 1RV6X 3PFUA 4L8BB 3KPLB 2XVBA 3P0GB 3SE3C 4BE5A 3G08B 1QSFB 3NSCA 4DZ8B 1QO3B 5BZDB 4LDOB 1YLBB 1MH5B 5EOCL 3UJIH 1I4FB 4PP1C 1AGFB 3HC3H 2E59A 5F6HJ 4LHUD 2R29A 4PB0H 3TPUB 4D0CA 1UZ8A 5H37G 2CKNA 2ZTBA 4ODBD 2ICEA 1G7QA 5C08D 5DO2D 4X7TB 5HGGS 1YNLL 1CFMA 2VLKE 4JPSA 3VXMA 3FQ4A 3NA9L 4WWOA 4G6JH 3LEXA 3U83A 5SX5H 1UM5L 3CHXA 3ZX1A 5EO1A 5KEZA 2Y25A 3W5NA 4EN3A 2AXFB 4W81A 1LO0H 3H6JA 4JANB 1J0IA 3ZTCC 3QR2A 4HLEA 2E47A 5BS0A 3BUTA 3FU8A 1AR2A 2VDNB 3RL1B 4OGYL 4LSPH 4IOIA 1MHHA 5E9NA 4DUWA 1HK6A 4R90H 3VXTB 4TPRL 5BS0E 4HXBL 4NM4H 3FFDA 2NY0B 1X44A 1KPRB 2F61A 3WEAA 2XXGA 4Y2LA 1IBGH 3ARQA 1Q94B 4TVPH 5C1MB 4V1DA 1G84A 3G5ZA 3IXTA 4X7DC 4QYOB 3LQAC 2FQFA 1NH6A 2VLKA 1C5CH 1GHFH 3CLFL 4ANXA 4BZ1A 4JPKL 5D6DA 4XVUD 2DIAA 3RA7H 3S37X 4MJ6B 1I9JL 1NAMH 5BJTB 5E51A 4KQ0A 1FLRH 2FSEA 4TUKH 2P5WD 1NEPA 5ETUB 2IFFL 4HOWA 4L1LA 4HIIA 1FVDA 1KBGL 1QQDB 1IC4H 1U8PB 2X6UA 3OKEB 4M5SA 1DZ0A 4QRUB 4MJ2A 3Q1EA 5HBBA 4BCYA 1NA8A 4X5XA 1BZEA 2GIMA 4K7PX 4J3XA 4N0UA 3K4ZA 3QEUA 5EC2A 4PGCA 1XTMA 4DZ8A 1KGIA 3IMVA 4N5UA 4XOCA 4BYHA 3UPRB 1MCEA 4DP5X 4PS4L 4YDNA 2J8UB 1ZXQA 5CGBA 4LNVA 6CGTA 4WIQA 4RAUA 1ORQB 5FKAA 2A3TA 2OX5A 4WEUD 4F2ME 4G8GD 3GS0A 3D4CA 1WFMA 4OQTH 1PQZA 4F58L 5EOCJ 3UBXG 5GRVK 1XF5B 1DJSA 2XKSA 4MBOA 5CMAB 4G7YH 4KNSA 4AL8L 1LDPL 3PWPD 3LXAA 4FNSA 4GRMB 4GW5A 4M03A 2NY3B 5KOVC 2JELH 2GAZA 2EIZB 1GS8A 1RPQA 3RG1C 4RX4A 4EQ2A 3VWJD 5JXAH 5HPOA 3GZQA 2WK2A 3OF6D 3F5WB 4U6VL 4H2AA 3KMDA 1IV8A 2VN4A 5EBMB 3C5ZC 2GTZA 1J8HD 1R3JA 2BP0B 2V17H 1Y07A 1HXYB 3UTTA 2OMVA 2XPZA 4KK6C 2EDKA 1IB5A 4IDLA 2VXQL 2YS4A 3BWUF 3HZMB 3H9ZA 3VI4B 2G2PA 4QWWD 3OXRA 5EOQH 5TE6L 2NY0D 3QDGB 2UZXA 4FFVD 2QMJA 4ORGB 3D4ZA 5BPPA 4RRPA 1UWGL 2ZSVB 2DKSA 1E65A 2HT3D 2BH0A 2Z35A 4OZHE 1O7VA 5GGTA 1DLHA 4BE6A 1ACYH 3QNZA 4DVBB 5BUAA 4MA3B 4ZMOA 2EVHA 4U2YA 1F2XK 1L9MA 1KGCD 2NTFA 3CMGA 2VDOB 3F7QA 3QRFM 2B7DT 3Q8CA 1OT1A 2J55A 5DK0A 3ZZSA 2HUHA 4GAFB 5HVHC 4FADA 1HN1A 4FQXD 1FL5A 5JZ7C 2XA8H 2DM7A 3PQYB 2EIEA 3ISWA 2KLTA 3B7UX 1M7DA 1CB4A 2XQBL 4IU2B 2FO4A 1A7OL 5C07A 3NYKA 4RMSA 5IHBA 1FC1A 3G6AA 4LDCA 1AFVL 4R8WL 3FQNB 5IOPB 2K7QA 1RUML 3F7LA 1Y6KR 3G04A 5DT1L 4LIQL 1CDYA 4J4PA 4GAJL 5MEQA 1HWGB 1F58L 2BNQA 1Z9PA 4F8TA 3B2VL 4G8GA 2PYEA 4DN4H 4PY8J 4ENEC 1MCBA 4Z3IA 1RIVL 3PGDA 2D9QB 4XCNB 2IDFA 4PGDB 1W6LA 2CM6A 4JE4B 1V3MA 4UV7L 1TJXA 5J06A 3CCHB 1CTNA 4PJFA 1ZIBA 2Q86A 3MZGB 4CSSA 3UACA 1IAIL 4PHXA 2Z92B 1N4XL 4ODHL 3O9WC 5LBGA 5IGXL 4QAMB 4Z7VF 2YIHA 3IDMB 1FSKB 4GBXB 4MJID 2EE2A 1JGUH 1NMCB 1YJDH 3C2SA 3FHQA 1JMXA 2XYBA 5GS2H 2LQRA 2FB4L 5GSRA 3IPBA 5C0AE 3S4SB 4YSAA 4AIZA 1ASPA 3N1MC 1AGDA 4XO8A 1JN6A 2DDQH 2R7EA 3OG4B 4NQXA 1A3RH 1RY7B 1BLIA 1N12A 1YEKH 3P9MA 5BRQA 5EV7A 4LPVA 4Q74A 4X5WA 1QSFE 2D3JA 4N2FA 4MXWL 3K74B 4N6RB 2R2HA 2NY4C 3GS7A 4PV8B 4AG4H 3OX8A 2BLFA 5CSZB 4M4PA 4JFPB 4TSCH 2ICEC 4HAGA 1SXSA 1HILB 2DJSA 2CMRH 2Y1YA 2QQKH 4NKMB 1X7SA 4YFEA 5DTFA 2NTSP 3M8OH 4P0DA 2K4WA 3GJFK 5CJXA 1JZIA 2B4CC 5HJGA 4E0RA 2ZWKA 2WLLB 5T1JA 4XP1H 1OB1A 4HFUL 4LLAA 4ZX5A 2NQ3A 3FUEA 4WHDA 5J9PB 2HFEA 4J28A 1T0NA 3FAWA 4KZEL 2R2EA 2A1WH 1E5YA 3V6OA 4PH8A 5LBSA 3TM6A 1F02I 4JE0A 3L3JA 1KEML 4MVBD 4X7FC 5ID0B 2PR9A 2Z34A 4HXAL 1EHKB 3NJXA 4UQ3B 4X0KA 1ACZA 4M6OL 4F15C 5I71B 3ECBB 1YEHH 2WYIA 2ZNXA 4HJ1A 5HPMB 2CD0A 4QRRA 1WIOA 2A1WL 1A6WL 3PWUB 4L18A 4JN2A 2AFNA 3II1A 4MVBC 4MNQE 4R7DA 3V0EA 3NSFA 3QISA 5DI8B 2D7TH 2AJXL 1SEQL 4ZMQA 1R5VB 3STBA 1M1XB 4U1NA 1HQ4A 4E9YA 5CN3A 1QSEB 2XWEA 1KCVL 3DSFL 3HFML 2Z91A 1G1OA 4YDJB 5DS8A 4YSUA 5AWNH 1Y18A 3VYOA 1NGZA 2AEPH 5B7MA 1PZAA 1V55B 1H15B 3PFQA 5EEUA 4C83B 4JHVA 1EWHA 5E1QA 2CRIA 1AS6A 2MCPH 4LZKA 4MAUL 1GC1C 4P49A 4AE1A 1J12A 3V0WH 2YKLH 2DDQL 3ARGA 3WIHL 3VUAA 3GBNH 2QPFA 4WNQA 4HPHA 3FAXA 4HEME 4MMXC 4KDTA 1NGZB 4Z0XA 2P26A 4ZFGH 1F4YL 1EX0A 5DS8B 5D7LD 1S7XA 1D5BB 1U41A 1QYGL 2UY7B 4HK0A 5I8CA 2P4AB 3SQBA 2IPTH 1QPPA 2XQYA 2W91A 3N40F 3FQ1A 4OSUH 4TXVB 1G1YA 4U1MB 2YRLA 4ZS7L 1FHNA 4ZTPL 3TNMB 4C58B 3ARFA 4JRYB 3GMPB 1P4UA 2CK0L 4IHOA 3PUUA 3H85A 3TZVB 2NR6C 4MMZA 2WNGA 4AW4A 3Q2LA 2G4GA 4PJ9B 1X5GA 4JDZB 3OAYH 1DVSA 3ULUF 1WICA 4JG5A 4N2EA 1AG0A 4X0KB 1CD1B 1KIRB 5EU4A 1OAKH 1UOWA 1A8ZA 3GWJA 1N8OE 1NCWL 3GSVA 3LZQA 3OMAB 4X4KA 5E9DB 1CGYA 1IJ9A 4LESA 1F41A 1FRGH 3ALXA 3ELQA 1RK7A 1QKZL 3WLWD 1S9KC 3I02A 2NW2A 4MAYB 3CFNA 5GS1A 1RLWA 1IGJB 5KBDA 3D85B 3WELA 4L8DA 4N0UE 4B3EA 4OQTL 4XBPB 3PQYD 3L4YA 3IKCA 1T4WA 4LPCA 1LQBC 1NBCA 2P8PA 2Q2LA 4FLOA 1DJHA 3NESA 4GUCA 1H6UA 5IBUB 3FSOA 3IEAA 1U95A 2DMKA 1MCIA 3VFOB 2A2QT 1EZUA 4QI3A 3VXUB 2BIPA 4NHCH 3TXAA 5IQ7L 3P77B 3QWRD 1TTBA 3QZWA 4XMLH 3CX2A 2VDLB 4OFPA 3VMOA 3RWHB 4Q7DA 4BWTA 3C8KB 4HIHA 1NGPL 3MZTA 4WRLA 1XCWA 1JGEA 4Y16B 3MI6A 3T4YB 3S5YA 5BVPL 2ZKMX 4PY8I 1FCGA 4BSVA 5FW8A 4FABL 2KPNA 4DFHA 5C8JB 3KPNB 1MLCA 4HULB 5AD0A 1BLNA 4QF1B 3V4PB 1XR9A 3EFDL 4CU7A 5LGKA 1WUNT 4PG2C 3KR3L 1H8NA 3TNNA 5ANHA 3CFQA 4WDIB 2BFVH 3AT9A 5ALCL 3TEWA 1MI5B 2G2NA 2QSTA 3AXIA 3D25A 1A9EA 1C5DB 1NUNB 1TITA 3N85L 1F3RB 4O2CB 4AGLA 5IM7A 1MY5A 2BNRA 4U6XA 2IWFA 4O9HL 1TSRA 5C0IA 3AWGA 2QVKA 1EBPA 2Q76B 1ZT7A 3Q6FA 1JPTL 4QXUL 3RGVB 3HZVB 3U9PH 3PDOB 2EKSA 4YXLL 1I3GH 4WJ5B 2CALA 3V5HA 3QUMB 3SE6A 3Q5YA 4NRYA 5EZOL 5ACMA 5KSUA 3I75A 2X5PA 3O6LH 4G8GB 4PD4K 1WRFA 1TVHA 2X1XR 4LQ1A 2OQJB 1IE5A 4KGJA 1GAFH 4JFDB 4KXZI 3MAWA 4QRSB 3WXVL 4WHTA 1YSOA 2EXYD 3MRJA 3O2WL 2NZ9C 4ODVH 3ZRSA 4AUJA 4FDWA 5LAXA 1A4KA 3B83A 3FO2B 1TTRA 5IB3B 2L4OA 5E7FA 5D1ZB 4ELMB 4OD1L 2WUCL 5KYYA 3RP1A 2EVGA 1XMWA 4JO8A 1ULVA 2ED7A 2VR6A 5I76B 3HR5A 3JWDC 1ZWIA 4RZCA 4AQ1C 5F7BA 4Q2ZA 1E2WA 3DTDA 3M7FB 4HKBA 3V4VB 2EILB 1FAIL 1MREH 5EB9A 2OM5A 1CO1A 2WLHA 3HUJE 3L7FA 3TVMC 4XBGB 2NDGA 2ZOTA 3AM8C 3MRBA 4FQQB 3LKSA 4L8SC 4P5TD 2C9VA 3DURA 4H88L 2DQEL 2EICA 4NEHB 5CJQH 4QJ3B 4RBPK 3IXAA 3QJZA 3BDYL 5D70L 4H8HA 4ZFFB 1UEYA 1BW8A 2FHBA 5I19L 2D2CC 4BIKA 5D7LE 5I15L 3DV4A 2HN7B 4ZODA 4GO9A 1NCJA 1YYML 3C5ZB 1YY9D 2BOBB 4BHUA 5TPWL 3DROB 4PJHE 1NFDE 4CN1A 5CD5C 1U58B 4ZS6D 1RCYA 1VFUA 5FYJH 4H8WH 4L3CB 4KX8A 1Z9OA 4E9LA 1I9RL 3LRSB 3K6SA 5CJOL 3L7EB 1KG0A 1IQDA 3T0EA 2X05A 2FGWL 1T3FB 2WGNB 4KKBC 1ACCA 5IB5B 2N01B 2M83A 3B9KC 2J43A 4OJDH 2AEPL 4U3SA 5I16A 1OZUA 3II3A 3LNIA 2W9DH 1AZBA 4UB0H 2EH7H 3VI3E 5DJYB 1AGBA 1KELL 2X4TA 2H3NA 3NGBB 1RUQL 3GGWA 1WLHA 1PQZB 3K8LA 4NO5B 1L3WA 5FDYA 5T1KB 5F89A 3MOQA 1AJ7H 4I13B 4RVBA 5BO0D 1JI1A 1MFNA 3K2UH 1HCFX 1L9NA 5GS0H 2NPLX 3PQYE 1T1XB 2ZP0T 4ZAKA 5DEGB 1EZVX 1JZHA 4OLXH 3S3JA 3RVWD 4Z7QE 3QEUB 1H9DA 1WSST 3EUUA 3S97C 2WXPA 2WLNA 2LR4A 1KYAA 1JV2A 1IC1A 1GH7A 3K1DA 3BSZH 3HZ3A 3FQTB 2UWEE 2V7NB 4FE9A 1UWXH 2G9HA 5E5RB 4PLKC 5AVZB 3P9LB 3QQDB 4BSWB 4K71B 2BZ7A 2VKXA 4KNUA 1T6BX 4DEWA 1NSNL 4W9LC 4XB7A 4W9GC 2FD6H 4HQQH 2ORBL 4EZMA 2IADA 4AT6A 1XMEB 4K7PH 2AJ3A 3LPOA 4TL4A 4XMVA 1JRHH 1JZJA 3C5JA 1AQKH 4UNTA 3SDDB 3B7RL 2TRYA 3OAYK 4JCWA 1DN0A 2UXFA 4XODA 4JFXA 5CGYD 1HNFA 2BSED 3WKQA 3RFZA 3DI2B 5BZWB 3DUSB 3WTSA 2W80C 5FO7B 3HCVA 3S5LA 1H8LA 2XWTA 3SKMA 3RHWF 1UOLA 1E0OB 1E4XH 2C7UB 4Q6IB 4Z77B 4UTAA 4FKKA 5E1AA 1NMBH 1GY1A 4MSWB 2AXGA 2J56A 3ET9F 3HAEB 3L1FA 4HK3J 4QRAA 4AKQA 1LJMA 2AXFA 4NQQA 5CGYC 2B59A 3VXRA 1GYWA 2IPKA 1LE9A 4BK8A 1VZHA 2ESVD 2FBOJ 1A9VA 2VXQA 4QO1B 1USQA 3LKOA 2O61B 2AV7B 4R0LB 2E7BA 1UT9A 4CADB 1BFOA 3TFKD 4I48A 4LCIH 5EN2B 1ZSHA 4ZW5A 2CJSA 3TPUA 4AI7A 1FZMB 1KB9K 1NAMB 1ZVSB 4M6NH 1CD9B 1UUSA 1WZKA 2AQ2A 5ANMA 4A38A 2FYVA 3BH9A 1MNUL 1WBXB 3AREB 4IMLB 4YFLI 4PWGA 1WF5A 4M5TA 3HAEH 2C34A 3PABB 2IQAB 2YMTA 4LOEA 4PJXE 3VDAA 5CN1A 2Y6SC 4HMDA 3TO4C 3JTSB 3OMZA 4H8QA 5JPMC 2VTFA 4D8PB 3BPNC 1N5YH 3WKPA 4PRID 2GC4C 3DDFA 4PIRF 4RSVA 3E8UH 1JNHA 1NCUA 3F6LA 4OLXL 3EKCA 3OQ3B 2XV2A 1CXHA 5LG1A 1S7QB 4LU5L 5LCVA 4OBSA 5C97A 5LBVA 1VB9A 2AABL 2CO6A 4HPOL 3QUZC 1IKFH 1YC8A 4P2AA 3ZYOA 4NO3B 3B43A 3ISYA 1ZS2A 4XN2A 4ZFZB 1FZJB 2AK4B 4H5SA 2VW7A 5CILH 4RGOH 4WO4B 1QLRA 2NY4B 4FCAA 1J87A 2X4RB 4J5VA 3K5RA 2G3NA 1A4JA 3FQWB 1WVZA 4JHBA 5EPMB 4A2EA 1HCYA 1JERA 5JUEH 4YC2B 3D4YA 5E5UB 1K8IB 4YPJA 1WV7T 5ERWA 4XX5A 2C1OA 1TPXC 4E41B 1FFNA 1QA9B 4I2XE 1JTPA 1YEKL 1HTYA 1EIBA 2XRAL 3QJFA 3AQXA 1BF5A 4ZX6A 3NP3A 5D1XB 3QI9B 4A6YB 3CE1A 3GXMA 5I26A 4ZTOL 1K2DB 4JFHD 5IREA 1D9KA 2XIIA 4NM8L 2BPBA 2BP8A 1E42A 4N3UA 2XTJC 5CZXD 2G75B 1MFCH 1IAIM 5DGRA 3OXSA 4QCIA 4XPFL 4JKWA 4Z7WA 5IMMB 1DCLA 3ULUC 6TAAA 3L13A 3VE0B 4ZFQA 1VIWA 1W0WB 2J88L 1FFRA 3QWRA 2WHVA 1P6WA 2CBMA 1H3GA 4W9CC 4X5QA 4TUUA 1G7HA 4W9EC 5FKPB 4OF3A 3UTSB 3OZ9L 3BDBA 1AE6H 1WT5C 4IGBC 5HDQL 4PIBA 4LEOB 3I50L 3N43F 3FT2B 4DO5A 5DFTA 3PWJB 4KTYA 1UT1A 5JW3H 3IVKA 1UH4A 5LQBH 4AQEB 1NAKH 4KDVA 2EIDA 1UADC 4QXTB 1HYRC 1MCHA 4PJAB 4LMQI 3MNWA 3QR1A 2LVCA 1YC7A 3U4EA 2Y72A 5FYKH 3SQOL 2NYKA 4RNRA 3U30C 4MMXB 5DWPA 3PWNA 4R8WH 1XIWA 3U36B 3QE5A 3MLWL 4UOW1 4IKLA 1LXMA 2AGJH 1B4LA 1TTUA 5HYQA 2G3XA 2JJVA 1IGYB 1RIUL 5FAAA 4HS6A 2RCSH 2QPUA 3NZHH 2N7AA 3D85D 3CZSA 4FYQA 4OB5H 4DESA 1UXWB 4XMXA 3UDWC 1SEBA 3TCTA 4OV5B 2BOLA 4Z7UA 4UAOC 3M17A 4EKXA 5EF0A 4WAFA 4H26B 4XXCC 4PRPA 5DD1H 1BJ1H 2YLKA 4ZUUA 1S4IA 4BUHA 3TZVC 3O0LA 3BW9B 3AXLB 5GJSL 3V0FA 5E94B 4F8LA 4LHUG 3PV7A 4QTFA 2GSIB 4MA1B 4PJGA 1L9PA 3ARGD 2XV3A 3BUYB 4JFZL 3KLHD 4YR6A 4TULL 2ATPB 3M88A 4Y1AA 2YC1A 1FFQA 3HE7D 4PUBH 3ZE0B 5KJ4A 4Z3HA 2EVIA 2ZWLT 3TIDA 2IGLA 1ZHNB 3CZUB 4JRXB 3OLDA 2WWNA 5E2JA 1RUAL 3G5YA 2OZ4L 1BPLB 2H0JA 4IKNA 2I5YH 1ZGLA 4LLYA 1KCSL 5T3XD 3LHPL 4DTGH 4U1GC 1EK3A 1EJOH 2J2ZB 1URZA 3T0EE 3T3ME 3PJSB 3X12B 2V5RA 2XG5B 2OJEA 3EG9A 3NZUA 4QHNB 3MREA 4KX7A 1N26A 2JB6A 1BM3H 1T0OA 4FLQA 2YO3A 1K3ZA 4LKCB 1UM5H 4JPIB 1LK2A 3QG7L 4LAJH 3P1VA 3MR9A 1JF1B 2BSRB 3L2MA 4NOFA 1V10A 1WA1X 3VFMA 3MFFA 3NCYS 4H25B 2GEQA 4HJJH 1PZ3A 5AW0B 3Q5TA 3ASOB 1SN2A 1OAXH 5D4IA 3SJVB 2CWRA 4ERSH 2O26U 1BWWA 1G6VK 3OGCA 4NZUL 4JFED 2QTVA 4MFHA 3GSOA 2F8IA 5I8KL 3NJVA 3CXHK 3IJHB 2OTWB 4DEPB 4C47A 2NY2B 3V5DA 2Z93B 5C0FA 2R4SH 2RQ8A 4JM2A 3FB7B 4KNQA 2FUQA 4N9GA 5IESL 2HWZH 1DEEB 2X1OA 1DN2A 4OD3L 4TULH 1A7NH 3CGTA 3Q13A 3QQ4A 1I8IA 1T20B 1NGQH 4GUPA 4IIQA 5IBTH 3VRLF 4KK8D 4NQVB 3WHE1 3DJ9A 2Z6FA 3ZKQD 5GJSH 4G9DB 4WY7L 5SWSB 3KPOA 4Z7OB 2CGYA 5BCAA 2YSSA 2O4EA 3NPZB 3AY4C 2VR9A 4RMWA 4UU9B 1R24A 1BQHA 2P8MA 5F7EH 2WLIB 1X5MA 3F58L 3GSXA 1XGYL 3P3YA 4U6TA 3VWKB 3QJUB 3RTQC 1OVZA 4RISH 3L3IA 3K0WA 2VDNL 4Y5YB 5A2CA 4L37A 3QDJB 1YPZB 4MKMA 3HPLB 1DQJA 4L4JA 3GLEA 4HEPA 4ENZA 4KTEL 1E28B 2YXMA 3CFDA 1TZIA 3TIEB 1DJIA 4BGDA 3QJOA 3HR6A 2OPCA 4OLUL 4XXDA 3V7MA 4AJVA 4GW4B 3SDCB 2F6AA 4KK9D 1WFTA 5CIPA 3CMOL 3PE9A 3CN2A 2MTAA 1L0XA 4N1EA 1ESOA 4NZTL 1NIAA 1EEYB 3H4HA 5DCCA 1JK8B 1E8XA 4AGOA 4YHOL 4QXVA 5FYLD 5A1AA 3CPUA 1KFGA 4NQDA 2ZUYA 4Y4KA 3HE7A 1F97A 3OC5A 4Y2OA 4APXA 4B0MB 3IRPX 5TE4L 3EJSA 4KITB 1BJMA 4HGMA 2GJ6E 1CXKA 2F7RA 5ABDE 4F24A 5KSBF 1GZQA 3MJ6A 1N5AA 2AK1L 3UIZA 1PDKB 2ZUUA 1RZGA 3BPCA 3ZKXC 1P84K 1X5IA 5DYOA 3ABLB 3NN8A 3MV7B 4QLWA 3AG2B 3A21A 1E2VA 3U0PB 1TFHA 1SY6L 1XGRA 4R4ND 2G5UA 3RVVD 2W95A 3PU7A 4G7VH 5DLLA 4YHIB 4WU5A 2DWSA 4U1HA 4NNPH 4N85A 4KHTH 3ZQ9A 2X9WA 5JMRA 3HUJB 4XE0A 2XFXA 1EMTL 3NZHL 1JNNL 3FHAA 1QRNE 4MDRA 4Y2DD 2AKRB 5TFSL 5BVPH 4NDMB 3JWNH 3SEPA 3CVDA 1QBLH 1WTLA 4UAOB 5FO2A 4AITA 3BPLC 4QRRD 3L3GB 3F12A 4TRPH 1ZPLA 3CD4A 7FABH 4JZOB 2X2UA 4IOSA 5HHMB 5LLIC 1XIWD 3LRHA 3CH1A 2X7LB 4OCWL 2VDKL 1DQQA 1KCWA 3P0VL 2JKWA 4MS6A 2PCFB 2G5BB 1CYXA 5C0RL 4N0YH 3IN0A 3QO0B 2Z31D 5JW3L 4L0YA 4HPOH 1J9CT 5KAQG 2ZCZA 4X7SH 4MQSB 1NC2B 2V3EA 2HFGH 4YDKL 1PCSA 3UEQA 3IFPA 1KCSH 3VGEA 1P2CB 2P7TA 4BK4A 4L3EE 4CW1A 2C9UA 2E9WA 2Z31C 4P2RB 5BXFB 3O8XD 3H54A 4PRIB 3DX2A 3N55A 1GYVA 3O2DA 4N2HA 3DJSA 2GTWA 3AS2A 2OMXB 3SYPA 3UBHA 3CDYA 3FK3A 4QR7A 4YVNA 3WTVA 1OF2A 3DX1A 3E9UA 3RNQA 2KZ1B 3HPJA 3VWJB 1K3IA 1KLGB 1DR9A 5T1MA 3KJ6L 1VHPA 4Z7QB 1MRFH 2UZYA 3WGVB 3C12A 4LVHC 4YLCA 4KRMB 1OAUH 1AD9A 1WO2A 2B9BA 2J1ZA 2QKIC 1MVYA 2UY6B 2OSLB 3BSZA 3L5WB 4HCRH 5DZPA 3ASNB 5PAZA 3T3PE 3PWPE 4UYQA 4BUGA 3MJ9A 2DQHH 5ID1A 5IFAH 2DQJL 4XVOA 2D03L 5CIPH 5A2LH 4WENB 4IIZA 4P4KD 5C08B 4GS7B 5DWUL 3INUL 3P11H 1QBAA 4NN6B 4GRLB 1J8HE 4DO6A 3OKYA 4NC1C 3PIQB 4AIOA 4KROB 4X5PA 2ID5A 3GJFA 5CILL 4BFIB 1W0VB 2LV4A 2X0WA 3VI4E 4Y19D 2G0KA 3T65A 4P2CG 3T0DA 3WENA 1IEAA 3QCVL 4JREC 2WAHA 3MRMA 4FQLL 4OW6A 4OJYA 3RTLA 4WUUE 2NZIA 3HRZC 1TU2A 1NUGA 3NCJL 1P7QB 3D69B 3BCDA 3KYNA 4ZSOB 5AVTB 2Y06H 5E2UL 1JBJA 2HPOA 3CFBA 3FT4A 5DURD 3LVTA 2DLGA 4KXBA 2I32A 1MNUH 1ILSA 1UKTA 3QEQA 2VDMB 2ITDA 1VLXA 2WD0A 2J44A 1E8ZA 4HIJA 1OPGH 4QXGH 4RMVA 3TA3B 5HHPA 4HD9A 4F58H 4DGUA 1V7ML 3VA6A 2J88H 1O6TA 1N0LB 4YAQA 3OHMB 3AY4A 1G5AA 3NRQA 1JZ2A 2OCCB 4M1CC 3BZFB 3HI1A 4YHNA 2PW1B 3TWCH 2DWDA 3KPQB 3L6FB 3QJVB 1YNLH 2DIEA 2UX7A 3IWUA 4DP9X 4S1QH 4KNTA 3BP7A 5E1HB 5JPNB 3MV9B 1JZ7A 4JRFA 4WEBL 4NKIH 1DFXA 3MJ9L 4YUEH 5ADOL 4QAWA 1BOGB 4G3YL 5IQOA 5MERA 3LN4A 4LSSH 4LSUH 4XMPL 4PJ5E 5TGBA 2R23B 3S37L 4ZX3A 1KT2A 2VL5A 3L4CA 3O6ML 4A39A 3VSTA 4GAYA 4LCUB 2Y22A 2BSTA 4XMKL 5DVOA 5MP6H 3QZOA 5C6TL 3HG1B 1VJSA 2W60B 2PTUA 2UZIH 1TO4A 2EAEA 1GS7A 1I9RH 1LP9A 4JPWL 1GW0A 2HSIA 4K5OA 3ZY7A 3LV3B 5JOFB 2Y1ZA 5LN8A 2W0FB 3B9VA 2FIKA 2B15A 3AMLA 5AVWB 4WVRA 5GSVA 3BIAX 5G4OA 5IBTL 5G4NA 4A7UA 3ZE1F 4H2CA 4PR5B 4F9LA 5BOPA 3UZEC 4N2CA 2ZKHH 4EIZC 4UM8A 3G9VA 2EDDA 2P24B 4A67A 1PKQB 4AYFB 5INCA 5KAQF 3EJUA 3IDYC 1EXUB 4JM2D 1HQRA 4DKFL 4DZBB 4HIEB 1DUYA 4H8VA 5I1EH 3O4LE 1RJCA 4IKJA 4FGMA 4PJ8B 1OCRB 2FK9A 3BD4A 1AC0A 1CGTA 1TEGA 4PEEA 4H4NA 3B6SA 1YUHB 3EDEA 4U6YA 5MI0B 3GMMA 5C0CA 3L1OL 5FCUH 1EJ6A 5IV2A 3MKKA 4LLUA 3C6LC 2YUZA 5E8EB 5E23A 1AIFA 5A6MA 3CZFA 2WYHA 4PP2A 1MHPL 4D0DB 1IAII 1RHHB 4LCIL 2QADD 3L2LA 5SWQA 2VDMH 2BNUA 4FFTA 3FFOA 1YYCA 4LF3A 3RDTC 4QT5A 3ULVE 3VXRE 4Y4FC 5FM5O 2BVTA 2BY0A 3AS0A 1KB3A 1BM3L 1CD0A 4WEEA 3MMEA 2HT4D 4DKEL 2JI2A 2R0ZL 3SYAA 1PZDA 5D5MA 3GD1C 3BIKB 3T8MA 3NCXA 1ZEAL 3F8UB 4LAQH 4I4WA 3C9NA 1XB3A 3ATEA 4L4VB 3TT1H 5FB8A 5IHUL 1HU8A 2Z0BA 2AANA 5B8CC 5GZOC 3U7AA 4JX0A 1ZHBA 4NYLA 5DHVB 1KYFA 1JPFA 5DEJA 1QFUH 2HFFB 2K45A 5L0QC 4FD0A 2AJUL 2E8YA 1OGTB 3P40A 1AI1L 4IBQA 4PJEB 4ZFOB 1ZSDA 1UM4L 3WL9B 5HHQA 2XKNA 5I19H 4JREB 1DE4A 2V0AA 1MUJB 4GOSA 1TJMA 2C8NA 3FQYA 5C6TH 5MP6L 1BF2A 1QACA 3QYMA 1N8ZB 3L95B 4WUUD 1AR1D 3DO4A 5DJZB 1DO6A 4GKLA 2E4FA 4UNIA 5IF0B 3TBBA 2AS5M 5G2NA 1CG9B 3QWOB 1IC7L 2GCYB 1OE1A 4Z7NE 4HSQA 3O4LA 2Q7YA 4F57H 2HKFH 1SJHB 5C0ND 5E6IC 3B9KD 1DHKA 2CH8A 2IANA 4N2AA 2EJ1A 3VDBA 4FL4C 1NBQA 1SPDA 3QEHA 4HHWA 1XVSA 5JW5A 5IKCA 1MW3A 4WO0A 4NQCA 3QUYA 4K7PY 3E38A 3KHQA 4CRPA 4R3SB 3WXWH 1QR1A 1KXQE 3X13B 4N0FB 2ZWYA 1B4RA 3MCKB 4JHUA 4OGXL 1FNGB 3K72B 1NINA 3EH3B 5DUJA 5H94A 3U46B 2Y7QB 4CBPA 3JBG7 2ZUQC 1AQHA 4CC1A 2ZQKA 3BC9A 1SBBA 3QK0A 2NUTA 5B1JC 2APBA 4L05A 4WTZA 3GMNA 3BAIA 3DVGA 4C56A 1A9BB 3IN2A 3WNKA 5KYNA 4JNXA 3EBHA 2GYSA 4AKOA 1DVFD 3C09C 5JO5B 4F15B 4HJEA 5DZAA 1JFHA 2BC4A 1NM4A 4MAZA 2GK0B 3E0GA 2WW8A 3VXSB 4AYBA 1LEIA 1T6WA 4DIXA 2YEVB 4TQEH 1VCBC 5DC4B 3HNTL 5LBSL 2CLVB 2OYKA 2FECL 4TQ8A 4DEPC 4D2NA 3WOVA 2VDRL 2AC0A 1CIUA 4PLOB 4A6YH 1YYMH 1A1MA 3FW6A 4BJLA 2CJUH 4NO2B 4I1NB 1U8JB 4R5XA 2AJUH 5L9DH 2YGOA 4PTTB 4YK4C 4P46A 5DWUH 2QV4A 3Q9QA 3VQMA 2HKHL 3NABH 2EIJB 3QPXH 4XMLL 3ABGA 3B2DC 1TR7A 3JV6A 4FJYA 1M9SA 1ANUA 1OCCB 3ABMB 5FA3A 3SDCC 4MKTA 1YZZA 4GMSH 3T8VA 3X14B 3QIWC 4EXKA 2A6JA 3P3TA 1KYDA 1W72H 1DQTA 3R06A 2YPLB 2GUOA 5GXBB 1J7VR 4ZPTA 4HMCA 4APQA 2I7OA 4F27A 1Q0XL 4H0GA 3TEXA 4LP5A 5JPMA 1OQXA 3VWKC 1I3RB 2H8PB 4U1JB 1NCIA 1D7FA 1EQWA 4D9LL 4FYRA 2VW4A 5FFGA 4OCXL 3DGGA 4K7FB 4AKPA 4N2NA 1S7WB 2VUOA 3QHZH 5J6HA 3ZHLA 3IMBA 4J23A 3ELAT 5M7QA 1EAOA 3TT3H 1X4ZA 2NNAA 3ULVD 2DQTH 5C3LD 4AGNA 4YSSA 4ADIA 3MRGA 4JK0D 3HBGA 1UT2A 3MJ8A 2EXSA 1NEZB 4ODWA 5D1ZI 2ICES 3RL2B 5A2JH 5CJBA 4NKOA 2UWEA 1M1SA 1MZZA 2DQFA 3U4KA 1SBSL 1UC6A 1WAEA 4K5MA 3RY6A 3UC2A 1NDGB 3SO5A 3LIZH 3DIVA 2XWJA 3NIFF 4UILH 4FFZH 4EUPA 2PWDA 2B1AL 2H3KA 5F97E 3QCTL 4MCZA 3X11B 2JJSC 5TD4A 5T5FH 4ONHB 1BBJA 2MNWA 1LNUB 4ZDHB 1I7ZB 2XN1A 2E9IA 1PKQE 2FWOB 1BJ8A 5E24E 2APFA 5AKTA 2W88A 4HP5A 4J8RA 1A64A 3MLXH 4MCYB 3LEYH 3RDTA 3STLA 3PV6A 2VC2L 1TVDA 5LGJB 5CP7B 5JLZB 2B0SH 3NDYE 3QIUB 4HW6A 5C0CD 3FBKA 4ZD3H 3RWFB 4XX1G 4M1DH 5E2TH 1MAML 4NCC2 2PPCA 4XNZB 1RP8A 1M7XA 4XCYA 3ARFD 4X6FB 4JDTH 5H35A 4RAVA 4Y5VC 1P53A 1OT2A 3PGCB 3HHSA 2YN3A 3UYRH 4L8CB 1NKOA 4W9FC 2GI7A 3HRPA 5D7KD 3Q8AA 3VM7A 4XCCL 4ODXB 4WGWB 3LY6A 2ARJQ 4CKQA 3C6SA 15C8L 5C9KA 3SO3B 1V3JA 3ETSA 1R4XA 5GGTL 1ZHLA 2G9KA 3QULB 1XH2A 3IJSA 4OZ4A 1QRNB 2W59A 3AFLA 1I7TA 1CI3M 1B0RA 2Q8AH 25C8H 2Y23A 3ZK0A 2ZT9C 4NUJA 4IRSC 3VX0A 1RJYA 2EH8H 4I77H 4MDJB 4P46D 1FAIH 1MREL 3BWZA 4P9MH 4HIXL 2DQTL 3QJRB 3VRIA 4Z7VA 1F13A 1UXMA 2FIRT 3C6LA 3KPSB 5DFAA 3FCGA 25C8L 2ITCB 4P05A 3QDAA 4RLDA 2BIIA 4G1MB 2WINA 3E6HB 1U3HB 3QUHA 1WH0A 1XCQB 1ERNA 1U93B 1OO2A 2D3NA 2W9LA 4Q14A 1OTSD 1JNJA 4WFHE 3EYQC 5FS5A 4KI5F 3QO1B 3CH8A 1RFDH 3RWDA 2QR0A 3SYQA 3GSQB 4JO4H 1DBJL 3DVFA 1KEGL 3MBXH 3TBYB 2VC2H 3OPZH 1PGRB 3DYMA 1VGKA 3WJLC 3U4AA 1AQDA 4OQTA 1F18A 4UV4L 1ZA3A 1DBBH 2P9RA 3KH4A 1WAAA 3QJSB 1HHJA 5E4OA 4U6HA 5EA0L 2QKIB 3WE6A 1HYSC 3DOSA 4G7SB 3U30B 1LD9A 3HHMA 4YQXH 5IFAL 2VO8A 4G6FD 4MWFB 3PJLA 3X1FA 3FB8A 3PGFL 1FQ9C 3FO1A 3MYJA 4HJTA 1JGUL 2E74C 5IQLA 2V9RA 3N2JA 4K3EL 1INEL 1F3DJ 3PLYA 1S7VA 4RFOL 2DQDL 5DUMH 5FYLH 4KI5E 4X9FA 1P5UA 1HHKB 3MRFA 4R4BB 4LLMB 3OSKA 1HHGB 4FFZA 2F7OA 5AOKA 1SXBA 1ZVNA 5EU5A 2AMGA 2DBLH 5T3XL 1L7TH 1D7DA 5I6OA 2MSPA 4E42A 2YUWA 1HHHA 4NWUL 3WEXA 5JHLH 4B97A 4YSRA 5FPIA 2Y07H 1DJXA 2FEDD 3NCFB 4LNRA 1GA2A 1M7IA 1F58H 3BGFB 4LLDA 5F0JB 1P5VB 1YEWA 1EDYA 4KVCL 5JIHA 3REWB 4CMHC 1K8DB 1U8HB 3HMWL 1BVZA 2VT0A 5IUSA 3TBSA 5EIIG 4B41A 3GMRB 4F7PA 1JGLL 2X70B 1RD6A 3EJTA 5D72H 4LP4A 1OCWL 3DUUB 4YL9A 2BJML 2EYRB 3IKKA 1EZSA 3MOAH 2NUPA 2OMUA 1AOZA 1JHTB 3CLEL 3FQRB 3LSOB 2IFGA 4D9QE 2EYRA 3ESNA 3SQOH 1G1KA 1EJOL 3TCLB 1I8MA 3KLLA 2BXZA 3QIUD 5AW2B 2WQAA 5HYSB 4HUXA 1K5NB 4XNQB 3S34L 3B2UD 4QOKE 5E0QA 3VFNB 5CEXB 5T3ZD 1NCGA 1ZLSL 3QUMH 1G9MH 3TC9A 4KO6A 4FQXA 3V0IA 3US0A 1E30A 2CA4A 5C0EB 3ML8A 5AVSB 3I6KB 1OWRM 4DKTA 5EO9A 4NQSA 4J3OH 1E50A 4QY8A 4AVKA 4AW7A 3C5ZD 2AXJA 4Z0BL 5HGDA 3O6KH 4B9GA 2JB5L 1EHLH 1JD9A 1FNFA 1FIEA 4NC1E 1ZJBA 3NABL 3ROOB 5D6CB 1GW6A 1DVQA 1QAWA 1RK0B 5AVUB 1G4MA 2C9PA 3W9DB 2FBJL 2I7SA 2ZCKH 2DLTA 5D7KE 5DZ9A 3N85H 4FFZL 4CVXA 1A14H 3WFDH 5AFAA 2HVJB 3V0VB 4XMTA 4JFSA 5HGBB 2BVPA 3WJMB 1YO4A 2FJGB 2ZX6A 3BE1L 4OIFA 5H4YA 3IRZA 5B21A 3LQMA 4BEIA 4IU3B 2DM4A 1FFTB 2XRAH 4PJCB 1BVKA 4K3GA 4K73A 3SJVD 3KWXA 4R90L 5TQ0H 1FL6A 4GG6B 1KCRL 4M1GH 1T0MB 3EYSH 4UDUB 2OSWA 1I1AA 4G83A 2WXQA 1CXFA 1VAHA 2YEZA 3U6RB 4RA3A 1PY0A 2CAKA 1P7BA 4ORZC 3M45A 2FLBT 4QRQB 4Y5VB 2KQNA 5JZ7D 3QNXA 3GS4A 2C9XA 3RTQD 4NUQA 5ESVA 4X4YA 2EYSB 5KJRH 2C4FU 5JR1L 4AEIH 5DT1H 4OD1H 1NMAH 1NICA 4RGND 1UD2A 3CUPA 5IP4A 1P9MA 2CE6A 2WINB 2E7DA 1M6OB 3FU0A 4G80B 1VACA 3LIUA 4J3OD 5J6GB 5DDHB 5DR5H 3IJEA 5GGUB 4JY6B 1OV8A 2HKFL 1OCWH 3BP5A 4Y0GA 3SDAD 3V52L 4WW2C 4G8FB 4JMNA 2K6YA 1KCRH 2HTLD 1UQSB 3U25A 3BPNB 3DJRA 1D3CA 4X80H 2ARJA 2VIRA 4P2OA 3W0WE 5F0MB 2HLEB 4MDJA 2QSCL 2YOCA 4J3OC 3WFEH 2BSBA 5IHZA 3X3GL 5DEFA 1YN6A 2VQUA 3KM2A 2A9DA 1ID5I 3D08A 1CT8A 5I1DB 1HVXA 3OR6B 2CKBB 4K8RH 4X4ZA 4YWGH 3BP4A 1X9QA 4HSCX 5EUOF 3UZVB 3PWVA 3IS0X 3O3BA 1E4KC 2DEXX 3P0YH 4HPYH 1NGQL 4HZLA 3IAGC 1M2VA 1E27B 2SEBB 4XO9A 2ZIDA 3EO9L 2WMPB 1G7PA 2CU9A 2HG5B 3POCA 3O9WD 3KLSA 4NM4L 3TBTA 5JW4R 1Y6NR 1UOKA 3RY4A 1M56B 2HRHA 2V3DA 4FQCH 1EO5A 2HX9A 5FO8A 2CJTA 1BZQK 2FWLB 1P6AB 5DRWB 3DX3A 4GG6F 5ACZA 2ENPA 5DK3A 4MA7H 4LO9A 2J7LA 3BMWA 1Z7JA 3UJJL 3IGKA 3GUTA 3ZDZF 4NZDA 3RKPA 4IRJB 3BJLA 1QW8A 1R75A 3L48A 5DGQA 1HSBB 5F3FA 5F6HI 1G6RL 1RUKL 1RZKL 4IBWA 2YWYA 4M6AA 3RI5K 1HI6A 1VGEL 1XDTT 3ALPA 3US9A 3BUDA 4CMHB 1V5JA 4XNDA 3MOAL 5DJ0B 3BVVA 1I7ZA 2Y5TA 1GR7A 3G5VA 4HWUA 5F1SA 3AWFA 3WD5L 4KK5D 2JXMB 3PWLB 5KYUB 3O3AB 3WAKA 3JZYA 4P2QB 2ITEA 4GO6B 1LQSR 2EVJA 1XB6A 1FVEA 1CXLA 1CCZA 3BIBX 4V33A 1VCAA 5I1EL 3TEYA 4P4RB 1DL7H 3DO7B 3GRBA 1TXKA 4LVOB 2QBWA 2O6DA 4UV7H 3PAUA 1QSZA 1UFGA 1CC3A 2EXWC 3OKNB 1OSPH 1KLFB 3QXWA 1XSIA 1SJEA 1YQ2A 2YJLA 2YR3A 1R5IA 2JMRA 4FTDA 1VEMA 1L7TL 4WNJA 4PV1C 3DXAD 1Q9WB 4L9LA 2Q7AA 2UUDK 4IHBA 4HUWB 3D8MA 1EGJH 1MCRA 2PXYB 4LEEA 4B9KC 2W9EL 2X4NB 1D5ZB 3MJWA 5CF3A 4NENB 3ILPA 3KWWA 4UANA 5E08L 3PAVA 2WXHA 1N67A 3O6FD 3B2XA 4LFHG 5DA4A 1HZHL 2KDGA 3ARZA 4FMKA 4K5NA 3PRZA 5CO1A 1ONQB 3QZNA 3HA0A 4NHUB 2V7HB 1WEJH 3D0LB 4M62L 1A1NA 4XHQA 1RK1B 5B4MD 3H3KA 1TO5A 2ARWA 1IGIL 5FDWB 1S9WA 3NBNA 1JL8A 3GM0A 1G43A 1T5XB 2JCWA 4KUCF 3RKDC 1EO7A 2QVMA 3APMA 4MJJA 5JHMA 1JDDA 1KCKA 2DTML 4JPWH 5DHDA 3VGAB 3WJJA 2JJWA 5G5DA 4LKXA 2A6JB 1TJIH 2F15A 3FB5B 1PTZA 2HT2C 5EU3A 2VABB 3SJVE 1GGIL 4P5RA 4HH9B 3T6WA 4AM0Q 4HKXB 1QFPA 1A6AA 2XZAH 1BVLA 3MTXA 1JVKA 4LOFA 5B7EA 3RIFK 1CE1L 4X4MA 4G9FB 4RIRA 4GO8A 2QV2A 3JYCA 3F7YA 4I2XB 1MFBL 4JL2A 1VRSA 5EUKA 1F3JA 1QFOA 3ILDA 3LPPA 4GAGH 3U7WH 4BRJA 5CFAA 1J0JA 4G5AA 2VLLB 1HFUA 4PRPE 5F7KC 3EBAA 2CO4A 3NGBC 5AAPA 2YBRB 3CDGA 4OZFA 2H32B 3L1OH 5FCUL 3P3RA 4DTGL 2EP6A 2OS7A 3KDMB 5IJVA 3OZKA 1PG7W 3WN5A 1C08A 4LLQA 2UVEA 3SCMB 4FC3E 3O2DL 3CVIH 4PRHA 4GKNB 4L0ZA 3EOBB 3UERA 4PRAA 3WFEL 3SPCA 4S1SL 3L3DB 1J9TA 3I85A 1NGYA 2MQCA 4Z95H 2BIMA 3PHOB 4IEFA 3S36L 5AVXB 1R34A 1RZQA 3UTSE 1AE6L 5JXAL 3W9EA 4NI6A 1KXTA 3D1MC 4GYBA 2LLGA 4FNRA 5B1KA 5ESAB 2D2OA 4PAZA 2W8CA 4XPHL 5EOTA 3B2VH 2K9FB 3ZKSD 4TSBL 3VGDA 1PD1A 1PJ9A 3ZE1E 3MRCA 4MD0A 1NGYB 2B5IC 2W92A 5DJAA 1LK3H 5TDNB 3QUYB 4OH2A 3SCMA 3QYCA 2IH8A 5CSBA 4Y5XA 3SN6N 5IBUG 3LN9A 5FOBA 2ODIA 3U0WH 4PN6A 2OMYB 3EF7A 1KF9B 2ADIA 3ETBJ 3MJ9H 1OSEA 4OLYL 4YUEL 1BVNP 1TKWA 2WQRA 4OV6F 2ADJB 1U92A 1D7CA 1WA2X 2DN7A 2W07A 3FTVA 3W0WA 4Y5YC 1N70A 1KJ2A 4OT1L 1I1AC 4U31A 2CO7B 1UHVA 1MFDH 2NY2C 2FB4H 3RA7L 2HJFB 5CZVL 1TFPA 4JFQB 1IUZA 1WCBA 5EF1A 1SY6H 1FG9C 4FA6A 3Q8FA 2R51A 1BVLB 2WQWA 5B22A 2XACC 3WSQL 1JYXA 2BFGA 2XKNB 3MRLA 1PZ2A 1L5GA 4LSRH 3TA3D 5C0BA 1TUPA 1FSKC 3GSRB 4LCWB 4OM0H 2J73A 3FQ2A 1UA3A 2A6DA 4FZ8L 2L04A 1MOEA 4HLZG 1DSFL 5KVDL 1MWAA 5J12C 4AYSA 4A68A 1KIUB 1AS8A 1FJ1A 4ZYKB 2K9UA 3OZ9H 4JFYA 1RK1A 2Z1PA 3D06A 3VFPB 1IC5L 3AREC 3CVHL 4RGMB 5AW5B 4B5ZA 4F1ZA 4TVPE 1G9EA 3DXAE 2VWEE 2E76C 4QRRE 2Y7MA 2QJDA 4XAWL 2FWSA 1EJFA 4PJIA 2JCCA 5DMGC 1IBBA 3H9HA 1KTLB 3F7KA 3KW8A 3S98A 3ATDA 1AS7A 2ZWSA 2XVLA 2BNUB 2XU9A 3D2TA 5AG8A 3O45A 4UZUA 3ZUCA 4EIGB 4R0LC 5GHWL 5D7SH 4E41D 4KO5A 5CEZE 4ODTH 4X9BA 3S88L 1KLFA 3MUZ1 4UT9L 5AZ2H 5JNYA 1F0LA 1CGSL 4NAQA 2HX8A 3EDJA 2QELA 3IGUA 3I74A 3LS5H 3HHRB 4Y4FD 2M2DA 4YHLH 2EEFA 1E7VA 1NTDA 4PJ8A 1WBYA 3BVNA 3FF8A 4OAWB 3O3AA 1G9NL 3B1UA 4PJDA 5K39B 3RTQB 3EFOB 4L3ED 3FMGL 2EE0A 5M94B 3APCA 4OLVH 3NIGB 1MRFL 3MNVB 4UM8B 2BFVL 3SPIA 3NP4A 4KDWA 4CVUA 4W6XB 4A7TA 1A1OB 1AZNA 4K3DH 4Q56A 4GI6A 4PRPD 2HA1A 1XGTA 2FIKB 3OKMA 1YVLA 4WWKD 2P5EB 5KSAD 1QVOA 4YH6A 2IPTL 3HS9A 4MZ2A 3RWGB 1MFAH 1QYGH 3SKOA 3LQZB 5F3BB 5IOKA 5BO1L 1F4YH 5FV1L 2R9HC 3LKPA 2YPVH 5F8QC 3TL5A 1KN4H 1I9EA 3BESR 3P2BA 4JLRB 4UIKL 3VFGH 2D7PA 5I1LB 2SEBA 4KKBD 4L4VD 2FR4B 4BQ6A 1FYTB 2DEWX 4Y4HA 1QHOA 2F58H 5MENA 4KPHL 3O3BB 2H4EA 4IYKA 1ZANH 1RPKA 5FFOA 3U7WL 3E2HC 1JDAA 1FPTH 3AB0B 1YEJL 1QLFA 2N1TE 3IDNA 3HI1B 4YHNB 3MRKB 5DEFB 4EZLA 5IHZB 5HHOA 1GMIA 5IQNA 4KHXL 2ARJB 5KUMA 2D7TL 2HLAB 4WJG3 3H9SB 2Q87A 4G5ZH 3SHSA 4JHAH 4ZUSA 4KTEH 5JA9A 5B3SB 4HJ0D 4PB0L 1WZ1L 2CKBL 3MXWL 3VFUB 4YHYC 4R4FH 4P9ML 2F68X 1DQVA 1ASQA 1XF3B 4HEPG 2ESVA 2X3BA 3SD2A 3IDGB 3L8QA 3BZEB 2C26A 3UAJA 3VB8A 3D9AH 4MNQA 5GGSB 2CXGA 4ZAKC 4F3FA 1AXSA 4WV1A 1Q9KA 2Y2TA 3I2CH 1DVFC 4R2GC 2RAMA 2EYSA 4PY7B 1CBVL 1CFQA 3ZL4L 2N0KA 4WY7H 3GBEA 5JQIB 4YK4B 3G5WA 3T3MF 3ZE0F 5HYJB 1TYRA 1PMYA 3FC8A 4NWTL 1RHFA 2FT8A 2V37A 1CXIA 1T04A 4M3JA 3A4DA 5LJYH 1ZS8A 4MB5A 4PJCA 4TPRH 5GISH 4HS3B 4JDTL 4ACTA 4Z7AA 2OXGB 4HGWB 3QPQC 2J6EL 1ET8A 2BNRD 1AHWA 2ZYRA 4J3WA 3T0EC 2BP3A 3HC0A 4POYA 1AYOA 4BK5A 2OR9H 5I1KL 3W9DA 4CNIA 3EXJA 2OJ1A 4JFWA 4CVZA 2NXYD 1A6ZA 1JUFB 2NMSA 5DQ9A 1IQWH 1OOAA 4I3RH 1ORSB 1QFHA 3FOLA 3FT3A 3IJYA 5T3XE 9CGTA 2OJZL 4TUOA 3DKHA 5GHWH 1A0QL 5GGQH 2ZXCA 4ISVA 4AQ8C 2X38A 3I9GL 2XJLA 5F7UA 3VWKD 3OAWA 2CBOA 5A43C 3PS6A 1W0YT 5DQDH 1BZ9A 5TJWK 4AQAA 3CSGA 1EERB 1K85A 2AEWA 1ND0B 1NJ9A 3TOPA 4JMXA 4OCYH 4BSJA 5CEZD 5J13C 4AZ8A 1OCZB 2OMXA 5IB1B 3BD3A 3TBVA 5I6PA 3ZYZA 2CIKB 5C09A 1DQKA 3AM8A 4QHMA 3IFNL 3ZYJA 4PRIA 5F7MC 2PPFA 4WSJA 2R0KH 2VR4A 3D5OF 3PPEA 2Q5BA 5SV3A 5KSBA 5H2BA 4ZPVB 1P2CA 3KLAB 5HI3C 1IGML 2EO7A 1OK0A 1WP6A 3FQRA 3LSOA 3O4LD 3QUKB 4ODUB 4UCFA 4Q9QL 1J1XL 1UZGA 2FDBP 4JQVC 3K91A 3RU8L 4YJZL 4AM0A 2VCOA 1TTCA 5IVXE 2H2SC 3BAEL 1DBMH 1INDL 3QXAA 5TE7H 3T3MB 3U4BL 2NXZC 3KYKL 1MFVA 5I30H 2YD8A 4MXQC 1U33A 4YOKA 3R0NA 2KC0A 3CH1B 3N40P 2R69H 1E7UA 4CU6A 4NZJA 4OT1H 5I8EA 4HS8L 4EJ1C 4NQCD 2Q9OA 4Z7OF 2PABA 3IWVA 4YBLC 3LS4H 3NMEA 4PSPA 5AZEL 5JPNC 3DC0A 4AENB 4GP4B 4G6FB 5C6PB 3UDWA 3QG6A 3DGDA 1DVZA 3K80A 1JZ5A 1R0AL 4LGPB 1F86A 3GSWB 3QG6B 2ZOKB 4CNIB 1T83C 2E27L 3K8KA 4PWJA 5D2NA 3S6CA 5HY9B 5GJTL 3SGDI 3R1GL 2CBTA 3QORB 4F2FA 1EANA 2XFXB 3NQKA 3FN0H 4XPAH 2XPGB 4L4VE 2FL5A 2V4LA 2WV3A 2RCSL 5DZOA 4JDEB 3UIYA 2E7HA 3B9KB 4BA8A 4CN6A 2MJWA 2ZXQA 3LH2H 2OXGA 2VNCA 3DX8A 1E3XA 4YSDA 1XGRB 5HDBE 1L9OA 1TQCB 2XWZA 3O2WH 1MIML 3PL6D 1JV5B 3FXIC 1IC5H 2H6OA 2X28A 3MYZA 3PF2A 1HHJB 3WE6B 1P7KB 1KBVA 3DSNA 4LRIA 4XNYL 4N5EC 4A7VA 5BQ7A 3JWDH 4X6CE 1E4JA 1HJBC 3HMWH 3GLZA 2AVGA 3OKOA 3QH3A 3KYMB 32C2B 2E9JA 1FFPB 1OGAD 3DBXB 2Y06L 3VI3B 1F3DH 5E00A 3JUZA 5IWLA 5KSBB 2VLRB 3G3LA 1VADB 4F8NA 2CIKA 3LD8C 5C09B 1KB5A 5IB1A 1TDQA 1S5IH 3IDGA 3A3YB 4Y9BA 1TETL 4HCGA 5E56A 1DQDL 2CBPA 1RI8A 1ZK5A 4CGTA 5I9QC 5DRXA 4UMSA 4U4BA 5B8CB 1T66C 3MRPA 4M6NL 2VR5A 4XXDB 4Z7VB 5BMFL 4PJ6A 1I1RA 2ZP9A 1ETZB 1F1AA 4QRPB 1QZ1A 1Z66A 1S8DB 3GMQA 3O3EB 1CF1A 3IU3A 1EZVY 5SWZB 1HE7A 5B39A 2YLHA 2X6AA 4DH2A 2X1WL 5EF3A 2WVUA 1MCWM 3DRQB 5AW7B 2DQHL 3WGUB 2X4OB 4FA8A 1IAOA 5D7HA 4V2CB 4PCKA 4XP9L 4FXKB 2BNRE 1P4BH 1E3FA 3JVGA 2QKSA 5CCHE 4X98A 2J5WA 1MFEL 4HKJB 5E8PB 4HF5L 1HKLL 3STZA 4JFDD 5DFVD 1DBJH 1MRDH 4E9WA 3ML9A 3AAZA 4GBXD 3TV3L 5FO9B 4XBEL 2ZXGA 2HAZA 3A67H 4X6FA 4FEIA 3UZQB 3EDFA 3SKNA 4JPKH 4MCMA 4NNXA 4WF7A 3MCG1 4LCCC 3F00A 4NERA 1QVOB 1A02N 4XAWH 1OAZL 1XH3A 4LSVL 1WYJA 1IZJA 5E95B 2JV6A 1NAKL 1JGIA 3FCUB 3Q3GA 3SKJH 4XVJH 3ARGC 4LVEA 4B3VA 3VI3F 4JCMA 3UTZB 1FH5H 4JZJA 5CEZH 3I50H 1MWAL 1MI5D 2LAAA 1QPXA 2P49B 3LN5B 2PXYD 4Z5RA 3HE7C 4NKDB 4OKVA 1LO5A 3WY1A 2E4TA 1MAKA 1G0DA 3ESPA 1ML0A 4KMTL 3JWDL 5ENWB 3S36H 4BD4A 5C9JB 5JHBA 4G9FE 5E8NA 1BBJB 4D0BB 1KPUB 3IE9A 3L9BA 4G7RB 1M7UA 1RULH 3D3VB 2ILLA 1MJJB 3P4NB 4PV9A 3E3QC 3FFCA 3QFJD 3VFMB 3KXFD 4DKDC 4XPFH 5D1XD 3TA4D 1B4JL 1TG8A 3GMLB 3S5ZA 3DIFB 4HWNA 1RL1A 4Z7QF 4EE2A 2APXA 3WIIH 3S9DB 4EZJA 4BZ1L 1UCBH 5GIRB 1U8LA 1L6ZA 3INOA 1A2YB 3MREB 4ADGA 4U1KB 3MX0B 1C7TA 1JGDA 3HC3L 4XOAA 3LKNA 3CHRA 3UX9B 2P80D 4TM9A 3ZDYE 3VH8A 1CFTA 2NY1D 4OD2A 3LKPB 3VXPA 3Q5OA 1RJZB 1DVFA 4MQ7A 4M6MH 4OCRH 4WV1C 2VRAA 2WLJA 2DLEA 4G59C 3LQZA 5I28A 4JRXA 3OKLA 5JPMB 3GPSA 4PTUA 1N59B 5FGCE 4BK5C 5D4JA 3EJZD 4JO5A 2P5EA 5SWZD 3KYKH 4ZYKA 1FP5A 1SQMA 3T71A 4KDTC 3LD8B 2F18A 1IGIH 2NY7L 3P4OA 3TTSA 3VNYA 4BKLA 4X7CC 4RDBA 3NJFA 4N4YB 5EDXA 2BMKB 3HB3C 5KANG 4PPTA 1X5HA 1Z3RA 5C0GB 5IESH 3VWJC 3AS1A 4UT7L 3RZCB 3DYPA 2YAEA 4F7EB 4Z95L 2IAMC 3PDGA 4PJDB 5K39A 3RTQA 3D3VE 4HWEH 1HH6A 4OAWA 2CO7A 2VM4A 3C08H 3H7BA 2YEQA 5CINL 2R69A 5KSVB 3GI8H 2D7OA 2IGFH 4MQXC 2VAAA 2D4FA 3PWPB 1HT6A 1E9OB 3G9AB 4PBWD 5CJXC 2CRYA 4MA1C 4QWWC 3UPCA 1HHIA 1G9NC 2VMDA 1GGCL 2G60H 5D7LB 4PLJD 4NI3A 1F4WL 1EFXD 3MACH 2K3HA 2G4EA 4TV3A 1VPOL 2PMZA 1DL7L 4KROC 1SN5A 2DW5A 2GC7C 4MYPA 1U8CA 3SDAB 3M8OL 1RUQH 4JRYE 3L1EA 3PWNB 3MOBH 4X4ME 5DUBA 3U2IA 5KJRL 5JXED 1W6WA 1K9TA 1WBZB 2V2WA 4PLJC 1DQLL 2FT7A 4TS6A 5KW9H 4PJIB 4Y7MA 2XX1A 1IEHA 2BVQB 3DTXA 3ZL2A 4XZUB 1MQKH 2PR4L 1V7MH 2TAAA 2Y24A 3CSPA 3I3BA 2DM3A 3G6JA 2WBWB 5EOTB 2WTOA 1B0GA 4DPCX 2NUTB 1GYUA 2QADB 1XSKA 3IE4A 3L2NA 3B9AA 3PWJA 3NDZE 4LEOA 3KGUA 4H8WL 4NAMA 4ZSOE 3RPIB 1FJ1B 1UCBL 3Q7JA 5EFIA 3IDXH 3K3QA 4PCSA 1ADWA 1W8EA 4DGYL 4RFEB 4HUVA 2CLZB 4PJGE 5F88A 5C0BB 4OD3H 2H9GB 4WTZG 3RY5A 1JRHL 1L5GB 5JW5B 3IJ9A 4JQIL 2FZ3B 2X1QA 3QIBC 2D3VA 5D7IA 4FS0A 1QUPA 4L5FH 1K2DA 1SJHA 4XHJC 4U1GB 1RKRA 1H3TA 3ZYIA 3VG9B 4MLSA 1RERA 3V4VH 3RVVC 5FA4A 3BDYH 4NUMA 5DD1L 1AP2B 3QIBD 1BZDA 1S7SB 2WXLA 5ITBL 1U3NA 4ZQKA 3ZKMC 3RZCA 3TX4A 3GXDA 2BVYA 2H1PH 1CL7L 3MLSH 2XWBB 4AOFA 4AEIL 5LXGH 2VITA 5I1CL 3VB9A 3V2AR 1HSAA 1JYWA 5ICYB 3KXFE 4JG1L 1LILA 4QRPE 2Y5QA 1ZANL 3PCYA 4JZNA 4OGXH 2DB8A 2SODB 5CZRA 3GO1H 3HE6D 4PJIF 5JQHC 3F84A 5EZIH 4KI5D 1C16A 4M7JH 4N86A 3BHBB 1NEZG 1XGUA 1A1NB 1RUKH 1LWJA 3CXDL 4XC3L 5LXGL 1JJUA 3LZLA 3GRWH 5FGRA 2EH7L 2H6UA 2UXTA 4HH8A 5ITBH 3VH8B 3WU1A 1QBBA 4QT5B 4Y1AD 5ABAA 5DC0A 3HE6C 3LKNB 4HBCL 4G8GE 4PRAB 5KZCD 4TUJA 1IBHA 2Z1KA 3UMTA 1N0XH 2WOBA 2X44D 1C08B 1WWCA 4LLQB 4A6YL 2FX9L 1GJIA 1BEYL 1KY6A 4MJ5B 3AREA 4JS7A 5BMFH 1M4KA 5EHFA 2FEEL 4NQEE 4TNVF 4HPYL 3EH1A 4X6BB 1NAMA 3H55A 2ODHA 3F85A 1INEH 3CV5A 3NSYA 5IK3B 4FQ2H 5MEPB 3SDXE 4S2SA 3FTSA 4CADA 3U1SL 5AYUH 4M56A 5E4EB 3ROLB 1PL3A 5CJQL 2ITFA 2AZAA 1ZHKB 2F54A 5HHNB 2DYSB 5IVXB 1PKQA 3VH8G 4AYFA 5DJ0A 4Z0BH 3VXRB 4JVPA 1WHOA 4NHCL 4NIYE 3LS5L 3V6FA 5T3ZE 3MLRL 4PP1D 3G5XB 4WI6A 1JMZA 2Y1AA 5LKNA 1S9VB 3AQYA 1PZ5A 2BRRH 4AMWA 4IRJA 3QIBA 4PGBB 2ZOWA 2BHFA 3WEMA 3RFZB 5FDWA 1N59A 1OTUD 1JRHI 4JFXB 2C1PB 5D8JH 1ODAA 3JV4A 5I1CH 2CA3A 3AZUA 5I1GH 2XWDA 4GRWB 1MCWW 4NRXA 4RCAA 2YRBA 2CDFB 4XPAL 3VXPB 4JO3H 2J4WL 1NCWH 2FHFA 4N1CA 4MD5A 4KZCA 1OAKL 4OI7A 4G6KL 5CHNA 5KVFH 2DWYA 1BIIA 3FU7A 4U1KA 1Q9WA 4ZRGA 3S3SA 5TDOB 1H5BA 5TQ0L 3UP6A 3L1GA 3VSUA 1L9SA 1IRAY 1AXTH 2XN9E 3U9PL 4TUKL 4L1HA 4EN3C 3D2UB 3GRGA 2P5ED 5SWZA 3W2DL 3FH8A 1TJHL 4OFQA 4JHWH 2OYLA 2CHDA 2VIRB 3CN3A 4P2OB 4JJ5A 4KOCA 3CIQA 3V0HA 3CMOH 3C8HA 1ECYA 2AMUA 3AUWB 2IO5A 1KYUA 1IEBB 2AJZB 1J8SA 1DBML 1FGVL 5DRNB 3RVXD 4LOUD 2Y5TB 2E46A 2ITDB 1JZ4A 1AH1A 5GS3A 3TT1L 3WIHH 4G80A 4Z5RB 5F89B 4HC1A 5IVXF 1H8SA 1Z2KA 3SY0A 3ILEA 2IBZX 3MA9L 1HSBA 4HUNB 3G6DH 4M6ML 4OCRL 2YA1A 3GUTB 3F58H 3NACL 5HDWA 3KYMA 4P4KB 4NNXB 3H42H 3KH3A 3KEDA 3LPGA 2BNQD 5EA0H 1PSKH 3S0PA 3H53A 2IDUA 1MSPA 1IEAB 3T77B 3VGGA 4I9WD 2OL3H 4J8QA 5F2FA 5TH2A 1FN4B 3BVXA 4GRWF 5CKAA 4JG9A 1JXDA 4BFIA 4X98B 1FNHA 1QSFD 2EYTB 4OLEA 4YBHA 1EO8H 4M43L 2DD8H 3DROA 5DF0A 2GQHA 2HVJA 3T6VA 4R96B 4CC4A 4ZTEA 4MZRA 1BG1A 5K59E 4XNMB 5KYXA 4DOHE 5HYSG 3EYUH 3WS3B 4P23B 5K9QI 3N41B 4S1SH 3N91A 2QEJA 1PW3A 5EBWA 2Q8AL 4DGIL 3F7PC 1GGUA 1VKXA 3BFOA 3Q06A 5IHLB 3HJ0A 2GHZA 2UV3A 5T1MB 5EULV 4JFFE 4Y1AE 4CDHA 3KBPA 4KZEH 1JZFA 2KQMA 1A5FH 3BSZL 2HP4A 4JKLA 5DRZA 5IROC 5AEAA 1HZKA 4ONGL 1XX9C 3V4VA 3ME0A 3Q2VA 4QTHA 4B95C 1VERA 2O5ZH 2VSKB 1BSIA 1M6OA 4ZTPH 1C12A 3UEZA 4CUCA 4KRPB 1VADA 4NQED 4RMQA 1WE5A 3DNKA 4Z18A 5HI5C 5CBEB 1TVBB 4X4YB 2GIYA 3DMMB 4FXKC 4WK0B 3C6LD 5ESQA 5IJCC 4M7LT 3QNXB 1T5KA 1PNCA 5LAXB 1LEKA 4Y5VA 4K8RD 4YQXL 1JAEA 1NDTA 3LRLA 4GH7B 4ETYA 2ZOLB 2DQMA 3IDJA 3NJMA 3DUUA 4MNQD 4N22A 2EUXA 4OGAD 3DSNB 3QA3A 3OQRA 1KYOJ 1OSYA 4GSQA 3RDTD 3ZHFA 2FLMA 2VLJE 4FFWD 3TBSB 4DPRA 3EBIA 4Z7UE 3UG4A 5IMKB 2EE6A 4S0TD 5CNHA 3BVTA 3NACH 3ZDXB 2HT4C 5L2KD 3OKDB 5IEHA 3QXDA 1DQQB 2N1KA 1ND0A 1NJ9B 4NJAH 1OAUL 3WDHA 1ADQH 1T4KB 3AB0C 1W72B 4P3WA 3FTXA 5FK9B 3ZGIA 1HHHB 4PUBL 4U2ZA 3WEXB 4P57A 4XNUL 1EVTC 2Z7ZA 2JH2A 3EOTH 1SRDA 1ZY9A 2FD6L 3F6IA 4F37K 4PS7A 2ZOKA 2F53B 3O9WA 5A6LA 3S96B 3CBRA 2FJSA 1MCJA 3Q6GL 3L3KB 1SDYA 3MACL 2F8OA 1B88A 4JGJA 5HGDB 5C2BL 2F7PA 1A47A 3MBEB 1NQBA 1FH5L 5J4MA 3I6KA 3NFSL 3TT3L 4N8CL 2DF3A 2HRPH 2FJUB 1QSVA 4UNUA 1T7VA 3TVMA 2YMOA 1VFBB 3OKDA 5IEHB 3MGOB 3MRIB 2LLNA 3MRNB 4EPSA 3LTVA 3AY2A 2XN9D 3N43B 1UB6B 2IV9A 2P42B 3MV7A 4B60A 4IQHA 1AFVH 1UATA 1F6AB 5KN5B 1HXMA 4PG9B 1DANU 1LHZA 2JQZA 1OE3A 1AJ7L 3NJKA 3QUKA 3FSWA 4FA7B 1OK8A 1HXMB 3O4OB 2OTUA 4FI7A 5F96H 3D39E 5F9DC 5H2BB 2NLJB 5D9SA 2ZXAA 3KNBB 5D93B 4QHMB 1JGVH 1RH8A