1FO0L

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ALLOGENEIC H-2KB MHC CLASS I MOLECULE)
publication title Crystal structure of a T cell receptor bound to an allogeneic MHC molecule.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 16
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fo0L00
5ACMA 5FO9B 1MVUA 1VHPA 4HBQA 2X89D 5CGYD 3VG0L 3VXRE 5EBMB 5EDXA 4MHHI 1L7TL 5MEOB 3N9GH 5BV7L 5L88L 2ZCKL 2PTVA 5GSVB 2NY3C 3HG1E 1MRCL 5F7DB 1IL1A 1MQKH 1WISA 3TVMA 5IMOB 4G43B 1BVZA 4P4KD 4S1QH 4NQXB 5E08L 2Q6WA 3O4LD 4P5TB 5LWYL 2YHGA 2YPKB 3EYQD 4D0BB 4PRNA 2DQCH 5C0AE 3VXPB 5J11B 3FQWA 4P2RE 3T08A 5L6YH 2CRZA 1NMBH 3GI9L 4HK0A 1QFUL 5IV2A 1GC1H 1MFBL 4GQ9H 1A1MB 6CGTA 3V6FA 5E8PB 4NM4L 4PGCB 3NPSC 1MVUB 1MFAH 5ABDE 1MY7A 3EKCA 3H9ZA 1PLGH 4IIQA 1EXUA 1YY8A 2AI0L 4XXDA 5HHXH 4LVEA 4POZD 3QUXD 4PJEF 1QRND 1IL1B 4MAYD 3TVMB 4NC1E 2P44B 2QHLA 3O2DL 4UIMA 3TJHD 2DDQL 4PS4L 4UQ2B 3MNVA 3DSNA 4LF3B 2Q6WB 3GNML 3OB0K 3P0YL 4ZFGL 4PRNB 2IH1A 5BMFL 2NY0D 5FAAA 1XCQA 4XI5D 3FQWB 2DQJH 4NO3A 2Q87A 4NWUH 1U3JA 5CGTA 3U7AA 5DRNA 5CJXC 1CE1L 3NTCL 4QEGA 3BH8B 3V6FB 2Q3AA 5I1HL 1T3FB 3KVQA 4JFDD 4PB0L 4NT6A 3O6LL 4PJGA 5GGRA 1NFDF 4IIQB 1EXUB 3IJYA 3FQUA 4XXDB 4JFFE 4UB0L 3D3VE 2OZ4L 4BSWA 3TLRA 1GOFA 3HNSL 3BVNA 1ZVSA 3TBSA 2YD9A 2WQ8A 4X8JB 2HFTA 4NO2B 5DEZA 1KCRL 4FFWC 1F97A 4UZGA 3T3ME 5GJSH 3MNVB 3WJLA 1HXMA 3EYFA 4LL9A 4OZIA 3G5ZA 4CMMA 4TULH 1KUMA 1UCBL 2IH1B 5EU6A 1XCQB 3DXAD 4C4KO 4NO3B 3S9DB 4OCMC 1T2QH 4GJTB 3DO7B 5DRNB 4KUZL 5EFIA 3ETBF 5K9OA 4G6KL 1V7MH 1KN4L 4WFEE 5C0RL 3QH3A 4LDEB 5GGRB 2YPLA 4PJGB 3FB8A 3REWA 5DURB 3KPLA 1G9MH 4DTGL 4GBXA 1YYLL 3TNMA 3ZKXB 2PNDA 1T03L 4X4YA 1OTSC 2FLRT 1LD9B 3BVNB 1ZVSB 3BZFA 3BRGC 3PWPD 3LKSA 1YEKH 1A1NA 3C6SA 1FE8H 4PJCA 1LGVA 3QUMA 3T0ED 1B88A 4OZIB 5E2JA 4CMMB 1FFQA 2IQAA 1QA9A 1WVZA 1JWSA 4PTUA 1U3HA 2HMID 1XGQA 1Q9KB 5F71A 4P2YA 3B5HA 5EFIB 4R96A 5K9OB 4HUKB 1T66C 2EH8L 2HJLB 1A47A 2VWEE 43C9A 3Q3GA 3QH3B 5FM8A 4LFHD 1ACZA 1RIHH 5CJ8A 1KLFA 2YPLB 1OAYL 3R06A 3FB8B 3REWB 4GO6B 3RTQD 3RVWC 2BCKA 3GJFH 4J3SA 2CR6A 3KPLB 1SMAA 5DMJB 5E2TL 4P59H 1CL7L 4GBXB 3TNMB 3X3FL 1CR9L 3OKKA 1IC7H 4X4YB 5D5ME 4DOHE 2EIBA 3QWRD 4YEEA 1J0ZA 4YHIA 2KPNA 2B2XH 4MQ7B 1A1NB 3QXTA 3C6SB 3GK8L 2AK4E 2DYPD 3P9WB 4PJCB 2FX9H 2CO7B 3DJ9A 3IVKA 4XCYA 4JM2D 2K9UA 3QCTH 4JDTL 1CBVL 4TTDC 2V5TA 2IQAB 5C08A 1JWSB 2VDNH 4JFXB 4PTUB 5FO7B 2P48B 3VGBA 1U3HB 1XGQB 1GPOL 3C2AH 5LAXA 5ITBH 4R96B 1DSFH 3PGDA 1S7TA 4JO1L 4NQCB 3SE9L 4PJHA 2HFEB 43C9B 5L2KA 3Q3GB 4S0TD 4LSRL 4XCCH 3HCVA 5JQ6H 4UINL 1KBGH 1TVHB 4QY8A 3VMOA 3OKKB 5T3ZH 2D03H 4YO0A 4M1GH 3ORJA 2VZ3A 3O6MH 4YHIB 5BVPH 4PJXF 2VDOL 5EULV 5KSUA 2HVKB 4LLUB 4JFYB 1TJIL 4MDJA 4XCYB 3TV3L 4BK4A 2NR6D 2DQGH 4U1IB 5C08B 5LAXB 2FCBA 3N1PC 4R4BB 3PGDB 1S7TB 3G6JF 2HH0H 1L0QA 3EZJB 1FZMA 5L2KB 2ZUXA 4WO4A 1BZ7A 5JNYB 4NFBA 5IEKA 3B9KC 5GXBB 5HXMA 5IIEA 1E6OH 2NY2C 4QY8B 1TJHL 4LKCA 4OB5L 4PJ7A 2BJMH 3HPLA 4G8EA 1MCDA 1N6QH 4Y2OA 5FA3B 1JYXA 4OQTH 4PPTA 2CIIA 1FFRA 5SX5H 2PF6A 5KW9L 2PYFB 5KSUB 2VKXA 4MDJB 1IGMH 2V9RA 4P0DA 1FVEA 1OPGL 1AIFA 1GSMA 1U3YA 4M43L 1Z9OA 4U0RC 1FZOA 4NO0A 5ELIA 5IESH 1LO4H 1LQSR 3WLWC 1LDPL 3ULUE 2OBGA 4XNUH 3RUGA 1JTPA 3GMNB 3OPZL 4KPHL 3BISA 2H26A 1FZMB 4A2MA 4EN3A 4WO4B 3C5ZA 1BZ7B 1NQBA 2NTFA 3UJJH 5IEKB 4PJ5E 5IIEB 4Z5RB 5EA0H 2VZTA 3PHOA 4LKCB 2NMSA 3HPLB 4G8EB 4NUGH 4FTVD 5AG8A 2JJVA 1CXKA 2X4SA 2CIIB 2LE9A 3UTSE 1NDMA 4KJWC 5CP3A 4KVCH 2YD1A 4G8GE 2KUTA 3BN3B 4F7MA 1FZOB 4NO0B 4JM4H 5FCUH 4GXVH 1Z9SA 4ZUVA 4PP2A 4XCFH 3NMEA 1DUYA 2EEBA 5IWLC 1G7JA 3RUGB 1KJ2L 3BWAA 2H26B 5DT1H 1Q1JL 2ADGB 2XTJC 4MA3B 3N06B 4HPOH 4EN3B 3X12A 1ZA3A 3C5ZB 4PJAE 3VXRA 2F53E 5MI0C 3IJHA 2NTFB 4LAQH 4NM8L 2XKNA 2UY6A 3MUZ1 2P8PA 1HINL 3PHOB 3VXMD 1HXYA 2N1KA 3HG1A 1MREL 4LSTL 3VI4F 5A2KH 1QBBA 4WHTB 5I8EB 2QQKL 4HF5L 1S9KC 5E9DD 1NDMB 4HV8A 4TPRH 1JWUA 3EYUL 1Z0NA 5C0AA 3Q48A 2XZQL 4P2RA 1NGXA 4F7MB 4Z7QE 3UDWC 4QXTA 1OGTB 4ZUVB 3BO8A 1DUYB 1G7JB 2DBLL 3AAZB 2KH2B 3BWAB 2DRUA 1YNKL 2HG5B 3X12B 4QOKE 1DQTA 1ZA3B 4QT5A 5L2JB 3VXRB 3IJHB 4F8QA 5I1AA 1S8DA 1X3DA 5TE7H 2P8PB 5GS0L 1KJ3H 5CS7A 2KQMA 1YMMD 5ALBH 1CU4L 2VLJE 3HG1B 2GHWB 1HDMA 5K59E 2OM5A 3V6OC 1NDGA 3FFCA 4HV8B 4I0PC 1AGCA 1C12B 4HUUB 4ERSH 1AD0A 1NKOA 5C0AB 3QISA 2NTSP 3CUPA 5CJOL 3ZE0E 4P2RB 1NGXB 2C4FU 2UZYB 2F54D 3BO8B 3VGDA 4UT6L 1UYWL 3O6FA 4J3UA 3ARED 1CK0H 4LIQH 1Q0YL 4LK4A 4PUBH 3PHQA 1FDLH 4QT5B 2NX5D 4HDIA 3VXOA 5I1AB 1S8DB 4AIOA 4GRWH 2EH7L 4JFFA 4OT1L 4LSSH 1BFOB 3D3VA 2ICES 2OTPA 5CBAA 4LFHG 4E5XB 1HDMB 3E2HC 1XR9A 1ACYL 4D0CA 4O58H 1NDGB 3VGGA 1AGCB 1RMFH 1AD0B 1UACL 5E8DH 3CD4A 1AXIB 3CUPB 1MAKA 2NY6C 1K5NA 3SO3C 1B0GA 3ABZA 4ZFOA 3HFML 3LQZA 3O6FB 3WN5A 1XH3A 5DC0A 3X14A 5M7QA 5DK2A 2MCPH 1JI2A 3DMMD 4NZRH 5IQ7L 4U1LB 5DYOA 4HDIB 3VXOB 4U1GB 3VE0A 3NIGF 5A43C 4HIEA 1AGFA 3EO1A 1B2WL 4RRPA 3PQYD 1N4XL 3BIKA 5TQ2L 2E7MA 4JFOA 3EDFA 1XR9B 4MD4A 4PREA 4W6WB 2EDHA 1J18A 2OP4H 4MXWH 2ESVE 4KGLA 4FQIL 4HT1H 4EDXB 1K5NB 3ZE2E 4N0YL 4ZFOB 2QQLL 4AEIH 1B3JA 4V1DD 3WN5B 4C57C 5GS0D 1XH3B 4JEGB 4WI3A 3X14B 5F6IB 5DK2B 1KCUH 3KYOA 4LRNL 3FTGA 2GY7B 5DYOB 3VE0B 4L4TE 3Q5TA 4H20L 5IT2L 4FG6D 4HIEB 1T89C 1AGFB 1A6TA 4XX1E 5BVJA 5L0QB 5D5MA 1R3JA 3BIKB 3BPOC 5IOPA 3DYPA 4JFOB 4ZUSB 4N0UE 1CF8L 4PREB 2AK4A 2VITA 3UTTE 3IXAA 4KJPD 4NJ9L 4MVBC 4GW4A 3LKOA 3VG9B 1S7SA 2XY2A 1FL3A 2Y36L 3ZHDA 4JQVA 1NANI 1TZIA 2FJGA 3R4DA 1J05A 1AP2A 1Z3GH 3QO0A 4J6RL 4TSBL 1KGCE 4MMXC 2AKRB 3LPGA 4ENED 3GIZL 2NY4D 4BFIA 4KQ4L 1PAMA 2R39A 4X8XA 3WIHH 3KYOB 3FTGB 1QFWM 4ISVB 3BKML 3O45B 2M8XA 3AM8C 1I1RA 4LU5H 1A6TB 1N5YH 4OKVA 5BVJB 4DOHB 1R3JB 2GI7A 1I7UA 5IOPB 3R8BB 3WUWA 1KTRL 4FMFA 4ZTOL 3K1DA 3HZMA 2R0WH 3LPWA 3B3IB 2AK4B 4F2MB 3O2WL 2FATL 3KPRD 5KVGL 2VITB 3VH8G 4E9LA 3LKOB 1S7SB 1FL3B 3FN0H 1A7OL 4RSVA 4G80A 2FJGB 4KK6C 1J05B 1AP2B 3QO0B 3M45A 1FO0B 4M1DH 3CMOH 4IRJD 1FVDA 2AP2A 1FNFA 4BFIB 3ZT5A 5D1QD 1QKZH 2H2SD 3KDMA 4X5XA 1RZIA 4DVRH 4PTTA 2PN5A 3GO1H 1IT9L 2EXWC 4OKVB 4AYFA 4MWFA 4FQLH 1I7UB 4L29B 3WUWB 2H3NA 4OIBA 4PD4J 4FABH 1OAXH 4L9LA 2UV3A 4HH9A 3C5JA 1CDUA 4JB9L 5EU5A 4G80B 5JXAL 1B0WA 3SKUD 4NRYA 1ZLSH 1VPOL 3OAUH 3BKCL 2Z35A 5GRUH 1CICD 4JG0H 4L3CA 1DZBA 1FVDB 3F58L 2OTWA 1JZ8A 3EOBA 3KDMB 1KT2A 1ZLVK 3IDYC 3LN4A 3UCRA 4PTTB 2D0GA 4PG9B 5CEZE 4PJ5A 1MWAB 4FQ1L 1BJ8A 3U2SA 1I1YB 1ZANH 3SGEI 2GSIA 1G7QA 2BVTA 4EOWH 4MWFB 3SE8L 3SE4A 2NY5H 2FBJL 2YA2A 3VFPA 1UA6H 3UTSA 4Y0GA 4L9LB 4ONOA 3PL6C 1YJDH 3VGHA 4HH9B 5LCVL 5AG9A 3MOBH 3T2OA 2I27N 1NEZA 4G8GA 4OLVL 5EU5B 4TOYH 3SCMA 1T0MA 4OBSA 1ADQA 4Q9BA 1ZA6A 1MJ7L 4L3CB 5LKNA 3JWDH 1YEJH 3V9FA 5AYUL 3EOBB 5FDYA 1KT2B 3FAWA 4PJAA 4H0GA 2F53A 5BQ7A 3FO9A 3OKNA 1MFEH 4PJ5B 3E8UL 5M95B 2WNGA 4RIRA 1HWGB 5CUSH 2GSIB 1G7QB 5IMMA 2HJFA 4ZAKD 1Y6KR 1YEGL 3V4UH 4HG4K 1S7RB 3VFPB 1N59A 4RMQA 4NKOA 3TCLA 5GGSY 1WCBA 2ZKHL 2X1PA 3D69A 4F9PA 5FHAH 35C8H 5D2NE 1NEZB 3C5SA 4AL8L 4KZEH 5JW4N 3DI3B 3SCMB 1CQYA 5F9WC 1T0MB 5D1XA 1ZHKA 4NKIL 1OVZA 1ZA6B 4XVTH 4RMUA 1UADC 3I84A 1UJTA 2ORBL 1JZ2A 3QG7H 4QOKA 4PRPD 4PJAB 5BQ7B 3FO9B 2CUMA 3OKNB 5DLML 1OT1A 2EE3A 4RIRB 3AVEA 5IMMB 2HJFB 2VLJA 3K46A 4JGJA 3LV3A 1FPTH 4NCDA 2JF1A 3T2QA 1M71B 4NQVA 4U05A 4NKOB 1WCBB 3D69B 4PLOB 1KB5A 5B8CA 3GMPA 3V6BR 4RDQG 3SKMA 5T1LA 5ESQA 3C5SB 4G7VL 1MAML 1NCWL 1R3LA 5D1XB 1ZHKB 4JFED 3KNBA 2IG2L 4L8SC 1IEAB 5I15L 3BD5A 4CKVX 4MXVF 2PETA 4J23A 4TYUA 4YXLL 4J3VA 3BZDA 4OFPA 5DD5H 2VLJB 5GISH 2HFGL 4KV5F 4UOJA 3QUYD 4NQVB 4Z77A 2P1YA 3RI5F 5IB5A 3VD4A 5I8KL 1QSVA 1KB5B 1A3RL 3IDXL 5B8CB 1I75A 1UWEH 5T1LB 3LMJH 1R3LB 4XT1C 4MS8C 4IOFC 3UTQA 4HEPG 2ILLA 4X5LA 1A6AB 1ZT7A 4NSKA 4MAUL 4DKAA 2YD2A 4L5FL 4OZFA 2X05A 5I18L 3MA9L 3OZ9H 2R29L 3WDHA 5IB4A 3NCFB 4OZGE 2VLRB 2EDNA 1S9VA 1VACB 1BZ9A 2G5BB 4GXUM 1M7DA 3QQ9C 3OJVC 4YHZH 3RU8H 4X0KA 1DBAH 4Y2DD 4DN3L 5IB5B 4U7MA 4GRMA 1PZ5B 4QRSA 1X5XA 2ESVA 2VH5H 5CSZA 4GRWF 1PW3A 1F5WA 4M62L 4ETQB 3K0WA 3CLFL 2PW2B 3VFGL 5CJ5A 3BD4A 3HE7B 2FH8A 3HC4H 4NCC2 5TH2A 1TZGH 3CXHJ 4LNRA 3ARZA 1QFWH 1NSNH 1ZT7B 4NSKB 5F9OH 3QXUA 4LCCA 4EIZC 5KG9A 5AYQA 1XMWA 1W0YT 4CBPA 3MRDA 4JZJC 4L4TA 1AQKH 4FFWD 1S9VB 1GAFL 3GJFK 3V95A 2J8UE 1QZ1A 1QRKA 3VWJC 1M7DB 4X6CF 3ARFC 3FONA 4X0KB 1JHKL 2R2CA 5FUOL 3WS6C 4N0UA 1OW0C 1W0WB 1UC6A 3FAXA 2CDFA 4GRMB 2X4TA 3UTTA 2P49B 4QRSB 2VSCA 4WV1A 2ESVB 5CSZB 4GSDL 3O4LE 3RZCC 5A2FA 1F58L 2F5AL 4DCQB 4XB8A 1T20B 2ZJSL 4XC1L 3VXQB 3SOBL 1CXLA 1OTSD 5KG9B 1NGQL 4PFEA 1KEMH 3MRDB 2FECL 1I1AA 2BDNH 1Y18A 2Y06L 1UM5H 3H3PH 1H0DA 3LQMA 1UZ8A 4L4TB 4EI5D 3G9VA 3IU3A 1S3KL 3NZHL 4R8WL 4RFNB 3SJVD 4M02A 1FIGL 3BSZH 3FONB 5TE6L 2DQTL 5D7JA 1EIBA 4JAMB 2CDFB 1WV7T 2X4TB 1QRNE 4WV1B 5KJRL 3SDCD 1LO0L 1IAKA 5CINH 4QHUA 4B50A 3WV0A 3GJEA 3HC0A 3RVWD 5E7FA 4K3JL 4QGYA 1BOYA 3UJIL 5F89A 5BXFA 2BOBA 1MF2H 4WI2A 4DKEL 3IYLW 1I1AB 1Y18B 5EUKA 1NC4A 4RWYL 1UZ8B 4ACPA 3MJ7B 5DHXB 3WO4C 4KDVA 3O8XA 4YHLH 5C09D 3B6SA 3IU3B 5I30L 4JFDE 2I9TA 2EC9T 3O3BB 2HA1A 3FT3A 3QHZL 4K23L 4TTDD 1WZ1L 2DM3A 3UBXG 3AS3A 5FGBA 3ZZ1A 3T4YA 5D7JB 2A9NH 4FS0A 5ADOH 2IMMA 3QWQB 5EZJA 3IETA 3B2UC 2DM4A 2SEBA 4ELMB 1IAKB 4QHUB 4GG8A 3QDAA 3UTPD 1NEUA 4I0CC 3GJEB 3QAZC 3Q6GL 2ZP0T 3HC0B 1UWGH 1CLCA 3FZUD 3DXAE 5BXFB 3CNKA 2BOBB 5DXWA 4Y16B 5GGQL 5J11C 3MLSH 1NC4B 3DX6A 3O8XB 1BZQK 1OGAD 5FO8A 4JFQA 4QHKJ 2I9TB 1GRWA 3FT3B 3VFOA 2MWCA 3IDJA 1OAKH 4GAGH 2FIRT 3CXDH 4XAKD 4N8PA 5C0GA 1JRHL 1IKNA 5EZJB 4EUPA 4JFHE 4IEFB 8FABA 1H3GA 3CLEH 2SEBB 1W72A 5EC2A 3O3EA 3PWPE 2C26A 4GG8B 5D8JL 3GBNH 4HIHA 2A74A 4GMSH 3WFCL 5A3IC 4G9FD 3TVMC 3ZYZA 3L3OA 1XF5A 5ALCH 2NY2D 4P2QE 5DO2C 1G7IB 1BBJA 1G7LA 1MRDL 4JHAH 5I9QB 2OL3H 3DX6B 2CLZA 3CFIC 1IBGL 5FO8B 4CN6A 3MXWL 4JFQB 1G7MA 5J3HC 3DECA 3N9GL 4KTEH 9CGTA 1SY6H 3IDJB 2DL9A 4RGMB 1F11A 2Z92A 1GVIA 3H0TB 1JHLH 3IFNH 4IIQC 1H3XA 1EO7A 1Z2KA 4S1QL 1F3JB 5C9JA 1H5BA 5D2NA 1HEZA 1EHNA 1W72B 5EC2B 1KJVB 3O3EB 4XMPH 3GMOA 3GI8H 1VFAA 3MLTB 2F15A 5F8QC 4HIHB 2A74B 5L6YL 4TUOA 1NAMA 3EDDA 3HRPA 5TQ0H 3MJ6A 2VQ1A 5SX4H 1GC1L 2DD8L 4GQ9L 1FRGH 2R69H 4PJDE 3JWDC 3H9SD 4QHMB 3CFDA 1A6UH 3RI5K 1MFAL 4U3CA 5IB2A 3TESA 1DLHA 3MCLH 2CLZB 1PLGL 1WQVT 4KJWD 1DBKH 5HHXL 1G7MB 5HGBB 3P3YA 3RVTC 4K8RH 1F42A 2Z92B 3M17A 1Q9OA 3MXVH 4OCRH 1TETH 5FGSA 4GAFB 4NOBA 4NZDA 1H5BB 4FRWA 4NO5A 1I1CA 1OTTC 3ZKXC 4RAHA 1VFMA 4I77H 2DQJL 4TUOB 1NAMB 1ITBB 4NWUL 4M5ZH 3QFJD 2VQ1B 3WJLC 4BZ1H 1INEH 4CDHA 1G7PA 3CFDB 3UZVB 5CGMA 4JY6A 5IB2B 1N6VA 4I18A 4I0KA 4YFEA 2CXGA 5SWQA 3IKCA 2Y25A 3NA9L 2E7LA 4QHKI 1FZKB 1RFDH 3KPSE 1Q9OB 5EO0B 2BXZA 1A6VL 2C7UA 4XWOC 5ESVA 5F7FA 4GBXC 4NO5B 1TFHA 2BHZA 2J5LB 5F7UA 4TULL 4H8WH 5DMGD 1KELH 2VLMD 5BJTA 1T2QL 2BVQA 3T2NH 2CK0H 2DB8A 1AY1H 1G7PB 2CGRH 3MRPA 3VGAB 1QFOA 3F7PC 4OZGA 5HVGB 1U3HC 3W11C 3BPCA 4YE4L 2DS4A 4I0PD 4Z0BL 5SWQB 1IGCH 4MNHA 1UVQB 4BYHA 3IKCB 5HY9B 3SGDH 3TNNA 5GSRB 2E8YA 2WBWB 4LLQA 4WFHD 3HPJB 4RGNB 3LKRA 5FYKU 3GBMH 4DGYH 4FTVE 1IGIL 4KI5F 4HX1B 5ESVB 4N90D 4OZHE 4JO3H 3UC0H 5ERWA 2DQIH 2EKSA 3U9PH 5BJTB 2ARJA 4KRNA 4NGHH 2V2WA 2QBWA 5DUPH 1UKQA 2CKBA 2BERA 4HZLA 3T3PE 3MRPB 5DQJB 4OZGB 1RIHL 2NYYC 1NCCL 3BPCB 1PSKL 2J8UA 3J8F7 1MIMH 4HEME 5J6GB 3OMZA 3TNNB 1CFTB 3MQIA 2NY6D 3LKRB 4JZNB 4Y4KA 5HI3C 4Z8FL 5J56B 3V0AC 2DWDA 4XP6L 2R4SH 2FX9L 2XQYK 1NL0H 1WTGT 3EGSA 5E9DE 3CCHA 2EDTA 4DW2L 2LAAA 5ERWB 3U4EA 2B0SL 2EKSB 3O4LA 1T0NA 2R0ZH 1S9XB 1ZTXH 4KRPC 5KZCB 1FBIH 3C2AL 2V2WB 1W0VA 4M7KL 1B4RA 1JJUA 5ITBL 1BD2D 2PTTA 1DSFL 4HXBH 2OCFD 1UKTA 2CKBB 5HD8D 1H3WM 5IJKA 4GLRI 4UV7H 2EDRA 3AC0A 4XCCL 1U6AH 3QHFH 2UWEF 1LK2A 4U6VH 4ZO6A 2FIKA 4NPYA 4FNLH 2CUHA 5DMYA 5I6XC 1KEGH 1I4FA 2XZCH 4XPBL 5T3ZL 2J2ZA 4WO4C 2ID5A 2WUCH 1OWRM 1QRNA 2DWDB 4WFFD 1OWWA 4OGZA 4JFZH 4MAYA 4KHTH 4XNMA 3EGSB 4P4KB 3TA3D 3CCHB 5FA4A 3U4EB 1S7XA 2DQGL 3O4LB 2H32H 2WP3O 1QYGH 2PTTB 5K9JH 4HCRA 2HH0L 1CGSH 4QRQB 2IPTH 1CGVA 1JK8A 2YD7A 1QBLH 5F7KC 1QTYT 2YK1H 1KLGA 1IFHL 2FIKB 4JFDA 4NPYB 1UM4H 1BGXH 1J0HA 2IAMA 4MVBD 3VWKA 5GRVL 3FB5A 1O5DT 3HI6L 1C7TA 2A6IB 1RPQA 4EN3C 1N6QL 4O51B 3LRHA 4XC3H 2OSLA 3C5ZC 25C8H 1K6QL 1QRNB 1I9JH 1ZVYA 2F19L 3H42L 5DRWB 4FP8H 4MB3A 4MAYB 4XNMB 1IGML 4GH7B 5F7EH 1CWVA 2F5BH 5FA4B 5IESL 1LO4L 5J12C 4GG6F 1KN2H 1OSPH 3I2CH 3K4AA 2NY0B 3DXAA 3OAZH 4XNUL 2GFBA 1R5IA 2YN5A 1KIPA 3BHBA 2YR3A 4CNIA 1A6WL 4LLVB 5DHVA 1BQUA 2EYSA 3WSQH 2BNQD 1T5XA 3QZWA 4DGIH 1KLGB 5EA0L 4JFDB 3V5HA 4JLRA 3S35X 1VFBA 3VWKB 4HS6A 3PV6A 3FB5B 3MUHL 1J87A 4HKXA 5E6ID 2JJUA 2OSLB 1P69B 4RGOL 1QD0A 2XNAA 1U42A 2WWKO 3IGAA 3PWPA 4KVCL 5FCSH 5HGHA 1L6ZA 4RX4D 1RJZA 2FRGP 5IGXH 4JM4L 5FCUL 4GAJH 4GXVL 1U8NA 4XCFL 4P2QA 3DXAB 1ES0A 4Y5YA 2EXWD 2GFBB 3X13B 1R5IB 3F6IA 1KIPB 3BHBB 4CNIB 1F02I 2GKIA 4Y1AD 2DQEL 4HPOL 2EYSB 4V1DE 4F7EB 5T3ZD 1T5XB 5BV7B 4GUPA 1VGEL 1H9VA 5EBWA 3V5HB 4JLRB 3O3DB 3RTQA 4HS6B 4DJMA 1MEXL 3PV6B 1D3CA 3CVHH 4HKXB 4NQED 1J0JA 1U8KA 4KDWA 2XNAB 1WAAE 1VA9A 2JELH 1J8HD 4TPRL 3D25B 5ICXA 1BQHG 3PWPB 5HGHB 2RAMA 2AVGA 3KHQA 4U1SA 2P4AB 2DYPA 1RJZB 4JM2A 3V6ZA 3RJQB 4NC1C 4P3CH 4LBEA 2OR7A 3KJ6H 4Y5YB 5C92A 2MTPA 4TQEH 1DDHA 3QDGD 1YQ2A 2C3VA 1E4KA 3PDGA 4PJDA 2BZDA 5KAQG 2EDDA 4NHUA 4KY1H 2OZ4A 4GUPB 3PL6D 5TE7L 4F7TA 5J13B 1T21B 2C4XA 1EHLH 3O6FC 3RTQB 1KJ3L 5ALBL 2FNBA 5JPMA 5E8EB 3PP4H 5JZ7C 3RWJA 1RU9H 4HKBA 3MRKA 4U1GC 2GT9A 1NCAH 5GGVH 5ICXB 2Q86A 4ERSL 3L7FA 1LP9E 4U1SB 4BK5A 3UEZA 1XF2B 3K80A 2IF7A 1CDYA 2DYPB 3Q5OA 3KPRE 4JM2B 3V6ZB 5HYIA 5TFSH 3ZSTA 4LBEB 5DDHA 4QXGH 3GSNH 4AIXA 2C3VB 1W8OA 2AJZA 4PJDB 4UOW1 5D1ZA 1FORH 3O4OB 4LIQL 1DVFA 1F6AA 1FDLL 4NHUB 4YZFE 4F7TB 4MSWA 1RJCA 2YEZA 4LSSL 4YC2B 1Q38A 3WN5C 2B4CH 3EHBD 5F6IC 4R26H 4OUOA 5JPMB 2XWTB 3KPSA 3RWJB 4O58L 1CLOH 1I9RH 3T1WA 3DRTB 5IVXE 5E8DL 3C9NA 4OCYH 5FUZH 1CFVH 4MJ5A 1RURH 4Y4HA 3BQUA 1XGUA 2EXYD 2IMNA 2AJZB 3MBED 1D7FA 1DBJL 2WZPD 1X6NA 4NZRL 5C0DA 1F6AB 4O00A 1UG9A 1Q8MA 2AJSH 5CEXA 5I0ZA 3A6OA 4MSWB 2YEZB 1HKLL 5C0CD 4QWWD 2PYED 1I7TA 2BOCA 2VWEC 1U8OA 2JCCE 3RWCA 3ES6A 3F7VA 3KPSB 3U0WH 4FTVA 5BW7A 4IDLA 3VH8A 4WJ5A 1FGNH 5C6PB 5JW3L 4OZHA 4I4WA 4HGKC 4MXWL 4NUJB 3C9NB 5F6HJ 4PJ8A 4HT1L 1CD0A 1BVLA 4MJ5B 5CZXC 2XG5A 4C55A 5I17A 3NACH 3BQUB 4AEIL 1XGUB 1OARL 1G9NH 3D5OF 4LVHB 3PF2A 4JQVC 2OR9H 2DMCA 1CLZH 1KCUL 4LGRB 3AFLA 1L9NA 1I1FA 3TYGL 5CEXB 1F13A 1Q9WA 5BRZE 4WFGD 2BOCB 4WI4A 4O5LH 1U8OB 5SWSD 3QCUH 2YRZA 2FYYA 3RWCB 3ES6B 3F7VB 4OF6A 5KVEH 3QO1A 4IOFD 4FTVB 4XPTH 3VH8B 4OFDA 1X5AA 4WJ5B 5FM5M 1X6LA 2ADFL 4PV9A 4I4WB 1TPXB 4ZSOE 3V5DA 1KENL 1MELA 2VIRB 1Z3GL 1BVLB 5I17B 2E6PA 3UYOD 1RIVH 3QQ9D 1DCLA 2X42A 2YD4A 3HAEH 4HJGB 4NP4H 4P2OD 5AZ2L 1I1FB 4N0RA 4HBCL 3O0RH 4PRPE 1Q9WB 4LU5L 1N5YL 4AEHL 2I9LA 3MJ9H 4IMKA 5HYJE 5DGQA 2A83A 3RWEB 1DEEB 2NZIA 3EAKA 1HYSC 4RMRA 4PV9B 4XNZB 3HLAA 2CH8A 3QG6B 5E9DB 4JN1L 3MX0A 2HT4C 1ZKAA 1SEBB 2H6PA 2A77H 4M1DL 3CMOL 4L9LC 4O4YH 2VTFA 4YH6A 3LVEA 4PLNC 1CL7I 1MIEH 4NFCA 3ARFD 3LS5H 5B3NA 2ITCA 4XMLH 2AABH 4KXZH 15C8H 1A0QL 3AREA 4DVRL 3TIEA 3ULUC 3DVFA 1N8ZB 4P57A 3GO1L 4YGAB 1MCJA 4K2UH 4S1RH 1QNZL 2I9LB 4RMTA 3W81A 3BN9C 4FQLL 2A83B 3UTZA 5TDPA 4FABL 2X09A 5CJQH 3RZCD 1P4LA 2XFXA 3QIWA 3HLAB 4GW5B 3A6CL 1KJ2A 2YN3A 3V7AG 1CFQA 1ZLSL 4AT6B 4LARH 4MA7L 1INQB 5GRUL 4JG0L 2F54B 1RK1A 2VDML 3NAAL 2IFGA 3SDXF 3DGCR 2ITCB 2XRAH 3AREB 3SCMC 3TIEB 1R3HA 2DN7A 2J12B 3DMMA 3MODH 4XBEH 2X10A 4G8FB 1ZANL 3MGOA 2VUYA 1OT2A 1UB6A 3MV9D 2OTUB 2X9WA 3B83A 3JBG7 1UA6L 3SDDA 1FP5A 1P4LB 2XFXB 1K85A 1YJDL 4BZYA 3QIWB 3SKOA 3MOBL 5CHNA 3SY0A 4TOYL 1KJ2B 2PO6D 1JZ4A 1CFQB 1ED3A 3GSXA 4V2CB 4YPGA 1WWBX 4F9PC 1RK1B 3JWDL 1JGLH 4X9HA 3QXAA 3ME0A 4V1DA 3VFRA 1BMGA 2YD6A 4U3XA 4L9DA 2W1NA 1MFEL 2D7NA 2YUXA 4TNWF 5D1XC 3DMMB 3B2UD 5CUSL 2X4OB 3MGOB 3JUZA 3DGGA 1CZ8H 1UB6B 4GT7A 3PQYB 3QDHA 5E1AA 3ROLB 2EYRA 3SDDB 1WAAA 2PXYD 4ZG1A 5DVMA 5H8DA 5FHAL 3SKOB 1QSFD 35C8L 1C1EH 4WW1A 5CHNB 1XGTA 1BM3H 4GMTH 2CSPA 4KZEL 5T5NG 3WNMA 1ED3B 4YPGB 3QFDB 4XVTL 1MHEA 2VXUH 3BT2H 4HJJH 4X4ZA 5B8CC 4DKFH 3K4DA 3QXAB 3QG7L 4JO4H 4V1DB 4QRUA 3GRWH 1RUPH 4ZYKA 4R4FH 1YEFL 1YDPA 5ENWA 5I1KL 1BHGA 3FO2A 1ZEAL 3DGGB 1RULL 2FX8H 1DN0A 3GKWH 3GHBH 3RJDA 1DL7H 1LO3H 2DQFA 1FPTL 2ZCHL 4QRTA 5E1AB 5A3ID 4ZS6D 2QHRH 5FYKH 2EYRB 3SJVE 2PUQT 3DUHA 5DO2D 1NLDL 4CJ1A 1LP9A 4WW1B 3KPRA 5IBLC 3RKDC 1J10A 2R0KH 4M9OA 3HTLX 2DJUA 2R0LH 2VDKH 2XN9E 4JGMA 2Q8BH 3K2MC 3QUML 1MHEB 3EOAA 5GS2H 1NBVL 3MACL 4P3DA 3ISWA 4IRJA 4QRUB 4PJBE 1A6PA 2NY4B 4ZYKB 3TH4T 4O9HH 3PV7A 3D85A 3FO2B 4KQ3H 5DD5L 1F8TH 5F7HA 1DN0B 3BE1L 5GISL 2Y6SC 1U8HA 1TVBA 5C09E 2DQFB 4QRTB 4Z76A 3C6LD 3ALWA 2IJ0C 3BMVA 4JRXD 3SN6N 4KJQC 4N1CA 2DQHL 4KK9C 1NLBL 5JA8B 4OBRA 5IVXA 2K7QA 1LP9B 1WFUA 2YOCA 3KPRB 4Z9KB 1UWEL 5JW5A 1DFBL 1TTGA 2A73A 1ZLUH 5GGSA 2WANA 1SJVA 4PJXE 3EOAB 1J1OH 3ARXA 4P3DB 2AEPL 1CICA 4NC0B 1T1YA 4IRJB 1PG7W 4TVSa 3OZ9L 4X5WB 2GYSA 2KDGA 5D1QB 1RZKC 1SJHB 1X5KA 1NGPH 3D85B 5IVZB 4YNYA 4LCCC 5KVFL 1ZSDA 2JCCA 4YHZL 3RU8L 3G6JE 1DBAL 4PGBA 1TVBB 4Z76B 3MYZA 2ZWLT 1CFBA 4PJFF 2VUOA 4PV8A 2NW3A 5IVXB 3M07A 4RFNC 3RL1B 1SBSH 2XWBA 5EU6D 3QEHA 3HC3H 2K1MA 5CIPB 5DJAA 2NY1C 5KSVB 4X4ME 4M7ZB 2A73B 3N85H 2GUOA 2HKFH 5I8OL 1QFWL 5EU3A 5GGSB 4QNPE 1NSNL 2VDLH 4WV1C 4G9FE 2Q1EA 1CICB 1T1YB 4J3OC 4MCZA 3MUGA 1AQKL 4R90H 3DRQA 2BVUA 2AV7A 4XWOD 4AG4L 3UBXA 3FT4A 5BRZA 5D9SA 4N0FA 4YNYB 4DEPC 3RX8A 1CG9B 4J1UA 1DEDA 2JCCB 2A0LC 3VD3A 4PGBB 1I1AC 4ZAKA 4PV8B 5DVNA 3FL7A 3FT2B 5EUOE 1HYRC 4ZSOA 3B9VA 3DSFL 3WNKA 2JKXA 1JMZA 4LVOB 4G5ZL 4NDMA 1HNGA 3OR7A 5DJAB 5D7JC 3W11D 1AH1A 2GUOB 2R9HC 2EE2A 1REIA 4KUCD 4WW2F 1OAZH 2ZPKH 5EBLA 3NCYP 1KEML 2BDNL 3IRZA 3QWOA 4L8BA 4P4RA 3RGVA 2LAGB 1DQJA 1KC5L 1UM5L 3H3PL 3S98A 2LABA 3DRQB 5KSBF 4U1HA 2AV7B 4PRPA 2W65A 3UBXB 3FT4B 4N0FB 2W38A 5KVDH 3L5IA 3L5JA 4NKQB 4J1UB 1ORSA 1GGCL 1DBMH 5HYJA 3BSZL 3TO4C 3BEVA 4ZAKB 1RVFL 4OCLC 1NCDH 3LIZL 3UJTH 3O8XC 2NZ9D 4ZSOB 3RFZC 1F4XH 5HHQA 1II4E 5GRZA 5T3XD 5CINL 4J3XA 5FUCE 1YPZE 4UQ3A 2BSRB 5FGBC 2NYYD 3U46A 4JQXC 2P24A 3V4PL 1CGWA 1K4DA 5L7XH 1PGRB 3BX7C 4D2NA 1A3LH 5ECJE 5I73C 1QG3A 4H88H 4P4RB 3RGVB 3SHSA 1DQJB 3B9EA 3FO0H 3AB0C 4U1HB 4PRPB 2W65B 5T1KD 5F8RC 4EKXA 5C0NC 5HYJB 4HPYH 2B7DT 3BEVB 3ZDXF 3MLRH 4KRPD 5DFVC 4W68A 5ADOL 3QUYA 5HHQB 4ZD3L 2DL2A 5T5FL 3BI9X 4UQ3B 5HGDB 4TNWK 2FSEB 4WI8A 2P24B 1UWGL 1IKNC 5D2LE 1M7XA 1MFDH 4JFEB 4I3GA 4YK4B 5D6DA 2VLME 4BUGA 3HS0A 1EX0A 2BY0A 4IOSD 1DLFH 3U0PA 3UBXI 3AS0A 3MLSL 1Z5LA 5AD0A 1IMHC 1PEWA 1CVRA 3RP1A 1T1XA 3ILQC 4HIJA 1K8IA 1SHMA 1XR8A 1WJ3A 4ODTH 2YUWA 3FMGH 1P53A 1HHHB 1OAKL 4GAGL 4K9EC 4UUJA 3CXDL 4Q6IA 5DJCB 2WSKA 3MLXH 2W92A 1FN4A 2UZIL 1A9EA 4JRWA 3QUYB 4Y2DA 4WFHE 1ULVA 3UMTA 3CLEL 3GSRA 4KROC 5CJXA 3IU4H 5DI8A 4ODHH 2Z8SA 3GBNL 4N90E 3U9UA 2R4RH 4F7PB 3QXDB 1NGWB 1CD8A 2KZ1B 1XF4A 1NBYA 1H5BC 5D2NC 5JOPD 5I1JH 1QLRA 4EN3D 3WLBA 1UXWB 2H1PL 3C5ZD 4JHAL 1Z5LB 32C2A 3CMGA 2CQVA 2FHCA 1T1XB 4HIJB 1UH3A 2DLFH 2MPAH 1S7UA 4KTEL 1XR8B 4E41E 3W5MA 4QF1A 4RCAA 1SY6L 4DFHA 1NMAH 4U6HA 4UUJB 4Q6IB 3Q5YA 2A6KB 2V7HA 1A7BA 3IFNL 4M3JA 1A9EB 2MOVA 4Y2DB 3GSRB 3GI8L 5DI8B 4ONHB 3U9UB 3R8QA 1M4KA 5LGKA 3ZDZF 1EH9A 1IKFH 3PWLA 1CYGA 5TQ0L 1XF4B 1PKQE 5D72H 4QXUL 3ULVH 1FRGL 2JTDA 2LU3A 4GKOA 2J5LC 3VFSA 2FGWH 1QLRB 3BFOA 2DM7A 1BD2E 3WLBB 3AS2A 4EXKA 3RVXC 5LVEA 1HIMH 3BKYH 3BUTA 3RVUC 5E2VH 3GSQB 1DBKL 4EI5A 4EXPX 3WIFA 2FHBA 2EDOA 5JO5B 2C3WA 2O5YH 3D39E 3LEVL 4HULB 4U6HB 3CFEA 4K8RL 3H9HA 3SJVA 3L3HA 1P7KA 3MXVL 5EU7E 2V7HB 4I18C 4W6XB 1TETL 2GCYA 1EFXA 3GMRB 4BKLB 5J9PA 1X5LA 3QSKB 5CSGA 5C0AD 3TJEL 2X4NA 2E7LC 4UI2A 3L7EB 3SDCA 2YSSA 2XN9A 3GMMA 1FIEA 4M5ZL 3PWLB 1F6FB 3U0TA 4PJBA 2MFNA 1UH2A 4FZ8L 1DQMH 4EI5B 3WIFB 1TDQA 1NC2D 5C09A 4PJIB 4RWHA 3CFEB 1RFDL 2CXKA 3SJVB 3VU2A 4X7SH 3FFCD 4ZUUA 5J9PB 4IRSA 4M4PA 2X4NB 4H8WL 3SDCB 1VKXA 1KELL 1C08A 3GMMB 3I02A 4PJXA 5DTFA 3T2NL 1E4JA 1A3QA 3MRIA 5DD1H 1FFOA 3U0TB 2CK0L 4HWNA 4D9LL 4PJBB 3UPRA 3SGJA 1UEYA 1J8KA 5FM5O 4JFFD 3D3VD 1IGCL 3ZTJH 2BNQE 3LY6A 2APTA 1OP5K 3G6JA 2A2QT 2I07A 4JCLA 3DPBA 4TRPH 5C09B 3CX5K 1PQZA 1WICA 3GBML 4I1NB 2BVEA 4DGYL 3TEUA 3BDXA 4IMLB 4ZUUB 4TSAH 1JGVH 1GGUA 4JO3L 3UC0L 4U0QB 3NIDF 2DQIL 2VZOA 4WTWA 4YHKL 3U9PL 4X4MA 3P77A 1H15A 4Y4KC 3X11A 4NGHL 1C08B 3I02B 3FFDB 3P9LB 5DTFB 2Z4QB 5DUPL 4G9FA 3MRIB 3TYFB 1FFOB 4WFED 3L5XH 1ZXQA 2BX5A 4PJ9A 4Y88A 2GK0A 3UAJC 4LPTA 4PRIE 3CZFA 4Y1AE 2D0FA 2A6JA 1NPUA 5F97E 1I8KA 5T3ZE 1MIML 3RY5A 2YRPA 4I3SL 1T1WA 2I07B 5FGRA 5E2WL 5IJKC 2X4RA 5D4QA 1PQZB 5EUOA 1A7QL 4XP9H 3D1MC 2R4SL 1NL0L 5A2LH 3V7AE 4X7DC 2R0ZL 3UXFA 1ZTXL 4HKZA 3X11B 1FBIL 3O6KL 3MLWH 4IM8A 2VXSH 4MJ2A 4HXBL 4G9FB 4MAYC 1UH4A 4WWKA 2NY2B 3V8CA 5HYFA 3ARDA 4BELD 4UV7L 2CLRA 4PJGF 2C4FT 1MCEA 3QDGE 5HSFA 3ULUL 1DBBL 4J12A 1U6AL 3QHFL 3CZFB 4DQOH 2A6JB 2NY0C 4XI5C 1I8KB 4FNLL 4MQXC 1RUAH 3RWHA 1T1WB 3JV6A 4XRCA 3VXSD 1J1PH 1L0YA 3WFHA 1OL0A 5F9JA 2X4RB 4LSQH 4XNXH 3T1FA 5EUOB 5I1DA 5L9DH 1N0XH 2WUCL 4U0RB 5E8OA 2D9CA 1Z9LA 3CK0L 3SE3C 4F58L 4JFZL 4OZIF 2IAMC 3ZKMC 1WBZA 3VWKC 1YPZA 1HHJB 2OMNA 4Y5VC 3BD3A 1RZFH 5EZIH 1X5FA 2K3TA 1AHWA 3DX8A 4YBQC 3OGCA 3TBVB 5K9JL 4MX7A 1BQLH 3ET9F 4JY4A 4WWKB 2DQDH 4MD5B 1EA9C 2IPTL 4MXQC 4MZ3A 2CLRB 1ADQL 3DARA 3H9SB 3EZ8A 1CDCA 1FO0H 2I60H 4XRCB 1L7IL 5DFTA 5C7XH 2UYLA 5DD6A 3WFHB 4EQ2A 4XC3L 4LCIL 3T1FB 25C8L 3NCJH 3UDWA 2HTKC 4PJCF 2NY7L 1I9JL 4FP8L 1YPZB 2F5BL 4L3EE 3OB0H 4ZO9A 3W5NA 1S9WA 2VAAB 1ZLWH 2FECI 2GJJA 2NQCA 1BAFH 3HN3A 2YC1A 3DX8B 5D2LA 4HG4J 1VADA 5MI0B 3N1FC 2WK2A 4MX7B 4NHCH 3WKMH 3QFJB 1DJSA 3KXFE 5GRWA 1HYSD 4DGIL 1CT8B 4Y5YC 4YXKL 4XHJD 2HMIC 5CD5C 2BY2A 5DJ8A 2UYLB 4XVSH 4U1KA 5DD6B 5I76A 2WUBH 4MXVE 2M1KA 3MA7A 1MHCA 2FDBP 5J13C 5GHWH 1T1ZB 3RTQC 1MWAH 2LU7A 4Z7UE 1K4CA 3RBSA 1QBAA 1S9WB 1SYVA 3I75A 3N1GC 1BFVH 5E7BA 3ULUD 3L3DA 1P1ZA 2YC1B 5D2LB 3W2DH 1VADB 3KYMB 5EOCJ 2Q8AH 4WUKH 4OLWH 5JA9A 4KVNH 4JM2C 4KFZC 3I6GA 4AJ0A 3OKEA 1UM6H 5C0BD 3QUKA 4E41A 1I3RA 1E4KC 4I0PB 5DJ8B 5I1EH 3O4OC 3S4SG 2EYTB 4U1KB 5I76B 1QFPA 4K94C 3UTSD 1MHCB 3BGAA 5SWSE 4G42A 2JELL 4OTXH 1JNHB 4YC2C 1QR1B 1HH6A 4G8GD 5TDNB 3OHXA 1JWMA 1K4CB 2GEEA 1SYVB 3I75B 3SCMD 5F1IA 1RZ7L 4P3CL 4D8PA 2VDRH 3L3DB 1P1ZB 3KJ6L 1PKQA 4HC1H 4LIQE 2YXFA 1BREA 4TQEL 2FX7H 5J4MA 1FC2D 5MHSD 1BD2A 3NFSL 3KPPA 4GRWE 2Y9RT 5LG1A 2DLTA 2F53D 1OTUD 3F8UB 3I6GB 4KY1L 2E27H 4L8CB 1FHGA 1JRHI 1EHLL 1NGYB 3QUKB 2F8VA 5D1ZC 5DF0A 3BYYA 3D39A 5I1CL 2R56H 1IAMA 1DVFC 1NFIB 1Y0LA 1RU9L 3DX9A 4JVWA 1SM3H 1JE6A 1NCAL 1NUGA 5GPRA 5GGVL 1HH6B 3S6CA 3QEUA 1JWMB 1RUKH 4R2GC 2F74A 3FB7A 3EDEA 2D7MA 2CRMA 4X6CE 4JPKH 3OG4B 5TFSL 5F1IB 4XP5H 5FYLL 3TA3A 4D8PB 1PKQB 3RUGF 3MJ8B 4QXGL 1D9KD 3UO1L 3GSNL 5I8CA 5AWNH 3SEPA 4IDJL 3G08A 1T89A 3MRMA 2G75B 1BD2B 1FORL 3FO1A 4NZUH 3KPPB 1IQDB 4QOKD 1PYWB 4W4NA 1NGZA 1HN1A 1H3VA 1RZKL 4JKLA 1MJJA 4JPVL 3QIBD 2FEEI 1U2CA 1FLRL 4Y4HC 3BQUC 1UGNA 3PE9A 5I66A 4I9WD 4R26L 3D39B 3CIQA 4FFVC 5D93C 1TTUA 4FZEH 3ULVF 4OLXH 3WFDH 1Y0LB 5E94A 3ZYJA 1X5ZA 1CLOL 3EYVA 3JV4A 1KIQB 4BFEA 1MCLA 4D0DA 1TQBB 4OCYL 3RAJH 2F74B 3FB7B 1CFVL 3FQXA 3LN9A 3TA3B 3VFNA 5BW7C 1RURL 3V79C 5FYJH 1ZLUK 5I8CB 1TPXC 1G7HA 4JPWH 1ZT4A 3X3GH 3FO1B 3MRMB 3GJFA 4PJ8C 5EBGA 1NGZB 4JGUA 3W9EA 4MLIA 2E9JA 1I7RA 2AJSL 2BNQA 5I66B 1AE6H 5IBLD 2AEWA 2WIMA 4HUWB 4QRPD 1KIRB 3U0WL 5E94B 3ZKQD 3CZJA 1E4XH 5E6IA 4O2CA 1FGNL 3JV4B 4CJ0A 5IM7A 3MGAA 4XP1L 3CDCA 2BRRH 5HPMA 3PWNA 1OD9A 4X4XA 3ARTA 3C8KA 3M1BA 2WLZA 4NYLA 3FQXB 4G6JH 2WBJC 4RX4A 3NVQA 3VFNB 3NACL 2A1WH 4CADA 3ARGD 2Z31D 4XNZC 1G7HB 3OKDA 1ZT4B 1MY5A 5DR5H 1G9NL 2Y6SD 1N64H 2OR9L 2D4FA 1CLZL 4FQ2H 4K7PH 4PRIA 4KJQD 2BY1A 4KK9D 4Y1AA 1I7RB 2BNQB 2YKLL 1ORQA 5C0FA 3PG2A 1WBXA 4O5LL 4L8DB 5F9AC 3QCUL 3GHEH 2DF3A 2AK1L 5KVEL 4HXAH 1WIOA 2GTZB 5FYLD 2P5WE 5E6IB 4O2CB 1EV2E 2CIKB 3P4OA 2ESVD 43CAA 1WF5A 5IM7B 2OXGA 1OF2A 3PWNB 3C8KB 4IMKC 1N26A 3M1BB 4G9DB 4NYLB 3MFGB 5DJXA 1QSFE 4CADB 5SV3A 4OZ4A 4ODVH 2VAJA 1RIVL 3OKDB 1MRFH 4OFIA 3G6AA 3EDJA 4IHOA 3QDGA 5F3BA 4L4TD 4NP4L 1N5AA 4Y1AB 3O0RL 5IBTL 5TF1H 3STZA 3JXAA 1ORQB 5C0FB 1WBXB 3MJ9L 1EJOH 3QJHB 1OM3H 2NY1D 5FV2A 2BRQA 4RBPH 3UTTD 3OKOA 3HUJF 1VERA 3WEXA 3P4OB 4YHPA 2JK5B 4PB9H 4YX2H 1J8HB 2X41A 5DJXB 4MJIE 1KGCD 1U8JA 1R3KA 2A77L 3HE6C 5EN2B 3IDYB 2Q7YA 3QIWC 1MIEL 4TN9A 5EH1A 4IHOB 4XMLL 5GGVY 3QDGB 2E7HA 5EWIL 2QEJA 1MNUL 5F3BB 4BQBA 5H2BA 1N5AB 2J6EH 4ZNEE 3VXUD 2AJXH 3STZB 1OP9A 4JJ5B 4K2UL 4KMTH 3PL6B 4HUXB 3WNNA 4M6NH 1JYWA 4W70A 4LLAA 5D7JD 3V4VH 3ARBA 5CJQL 3OKOB 2Z8RA 3WEXB 4YHPB 2R9HD 4JRXE 4EEEA 4L3EA 2OK0L 5JUEH 3KPQA 1U8JB 1R3KB 2ZG2A 1IEBA 4LARL 3SDDC 4ZFZA 2Q7YB 4JN2B 3WL9A 3OKLA 4Q7DA 1CN4A 4LSUL 2E8ZA 2ZOLA 3TO4D 1VDGA 3BIAX 3KXFA 5C2BL 2XRAL 1AC0A 1NC4D 3MBEA 1ZGLB 5H2BB 5E00A 3O8XD 4XBEL 5DVOA 1TJGH 4TUKH 1X5JA 2EZ0D 3ULSB 5HHME 1A9BA 4KWUA 3WHXA 3ARBB 5I74C 3TBWB 5F9WB 5I75B 4LHQB 5IHUL 1N3NA 4Z7UA 4L3EB 5B39A 3KPQB 4X6EA 2AAVA 1IEBB 1OQXA 4ZFZB 2YA0A 3WL9B 2IGFH 2RCSH 3OKLB 1JGLL 2IBBA 2ZOLB 5EPMA 5KOMC 2JJTA 2DIBA 4N8CH 5ISZE 3MBEB 3BZEA 4LGPB 3U1SH 5DFVD 1AFVH 3QUZD 1LEGB 3BKJL 1CZ8L 3NFPA 1M05A 1SBBA 4B53A 1A9BB 4B41A 2NY4C 3WHXB 4JHBA 1F3RB 5SWSA 4CVXA 4BZ2L 4Z7NF 1U2HA 1CDIA 3KPNA 1N3NB 1B4JH 4Z7UB 4S1SL 4GMTL 4O2FA 2X1QA 4X6EB 1PY9A 4YHMH 5DK0A 3MRNB 1BECA 2VXUL 3BT2L 4XTRD 4DKFL 4G3YH 5EPMB 1LVEA 4JO4L 1KNOA 3GRWL 4JKMA 3H8NA 5F7YC 3BZEB 4R4FL 4OD1L 2HLAA 3EOYG 4HW6A 1GGIH 4KROD 4P2OA 4JO2H 1IE5A 4FQXA 2VR9A 3VD5A 3GKWL 4IRJC 1M05B 3GHBL 1DL7L 1LO3L 3U4BH 2QHRL 5FYKL 5SWSB 4CVXB 2X4UA 2H2SC 4UV4H 4EI6B 5H94A 3K3QA 1IGJB 1LMKA 3LKPB 1CFNB 1NUFA 1ZHBA 4QRRD 2WLYA 4NKMB 4X6CA 2R0KL 1CQKA 1E27A 5DK0B 3UX9B 4OLZH 5F1OB 3AGVA 3L5WA 2VDKL 5E8NB 2Q8BL 5CMAA 5FKAB 2QTEA 4XPHH 3SO5A 1PEZA 3L6FA 3LKNA 4NRXA 3TCXA 1YEDA 2HLAB 1HI6A 4OZFG 2IPUG 4PRHD 4P2OB 4KQ3L 5E6ZA 1F8TL 4FQXB 4FQJL 1CICC 2W9DH 5F44A 3OJ2C 4RFOH 5T1MA 5EO9A 2VO5A 3BRDA 2UVFA 4RZCA 4ZDHA 1KFAL 2X4UB 2B1HH 4RA0C 5H94B 1ZHBB 3U7YH 1BIIB 4X6CB 1TZHB 2LV4A 1XGRA 3RVUD 4NNYA 1E27B 5JOFB 4JZJB 4F7CA 3BYTA 4XXCA 3MYJA 1KCSL 5EOTA 3EOTH 5CMAB 1J1OL 4OCSH 3WFBH 3LH2H 1RUMH 3T8XA 4M5YL 3L6FB 3LKNB 1KTDA 5I2IA 3ARFB 4RAVA 1YEDB 4CW1A 1NGPL 3QDJD 2YD3A 3VFVB 5CFHA 3U7WH 5T1MB 5EO9B 3OJMB 3HI1A 4RZCB 4ZDHB 2DICA 1D6EA 5K9QI 1G0XA 1QO3A 5GIRA 4OF5A 4OJFH 3TT3H 2VDPH 2M26A 1SBSL 1FNAA 3VA2C 3VFUA 4OI9A 1XGRB 3NIFE 3NZ8A 3HC3L 4NNYB 4ZAKC 1ZMYA 3N85L 1IGYA 4JKPH 4KKAC 2HKFL 4GOSA 5DC4B 3MYJB 5EOTB 1V3JA 2PO6A 4WENB 4LPXA 3OF6D 2BVYA 5AAMA 5ADPH 3A0OA 3T8XB 1A7NH 1KTDB 3BDBA 3CFCH 4NZTH 3LD8C 4RAVB 1LEKA 4R90L 1EGJH 1ZLVH 1GIGH 5FYKD 5T33H 4GKZA 5EC1B 5GS1A 5K59F 4AH2A 4HWEL 3SDAA 3HI1B 1OD7A 3RGVC 3GMLA 2P5WA 1D6EB 3MV9B 3QXWA 4DK6A 1QO3B 2ZUWA 3NFNA 4HZAA 5D7IE 4K3HA 4LKXA 3ZE0F 1Q72L 5GS2D 2PXYA 1XIWA 3VJ6A 1QSFA 4B7IA 3NZ8B 3EIFA 2P46B 3LN5B 4P9HH 4JREB 2PO6B 4WU5A 1CIDA 3S36H 1DE4B 1RI8A 1OAZL 1MI5D 3KR3H 3O9WC 4TSCH 3B8YA 2W60A 3H9YA 1NCTA 1LEKB 2RHEA 5HVHC 2ZOKA 3ZE1F 1BQSA 4GKZB 1B0RB 1LO2L 5GS1B 2ZCLH 5KVDL 3NCCB 4YK4C 4PY7A 4N9OB 5DRZA 4AH2B 1C5CH 1C16A 1RD6A 4Y4KD 1OY3B 3A6BH 3GMLB 2OI9C 4FFYL 2P5WB 2CKBH 4S2SB 4OGXH 1NCDL 3QAZB 2VXTL 1U8PA 4ETYA 1VESA 4LKXB 1F4XL 2PXYB 1RZJC 2VDQH 4MJIA 1QSFB 3UAJD 1HHKA 2XIDA 3JTTA 2X2YA 4LOUD 3QUYC 2IBGA 4WU5B 5FDWB 1A3LL 2W60B 3P30H 4H88L 4LASH 4ZNEA 2EECA 4WHYH 3VRLF 2ZOKB 3LQAH 2BNRD 2VERN 2N4IA 4WRLA 2VN4A 4XNYH 5D6DC 4PY7B 4HPYL 5GZOC 4ZMAT 5DRZB 4YR6A 4YDJA 1C16B 3TIDA 3MLRL 4XVJH 5EOCH 3ZT7A 1IM3A 3C6LA 4JRXA 4POUB 3CX2A 2D7QA 3QT2A 3FFCE 1KXQE 3ZE2F 3PGFH 4Q6IC 1HHKB 4WTZA 4EUPG 1ZLWK 5DQDL 3G5YA 1XF3A 1IGTA 4Y2DC 4FMKA 4MQXD 4HK0B 4KKBD 5IV2B 1QLEH 5DC9B 3FJTA 4N1HB 1FL6A 2IAMD 3ZKMD 3VWKD 1MCNA 4AMKL 1YY8B 3FMGL 4YR6B 4YDJB 4K94L 5HHNA 3TIDB 3DO3A 3MLXL 1IM3B 4YBQD 3C6LB 2BFVH 4JRXB 1UQSA 1PKOA 2HT3C 4UIMB 5E0QA 3MV8E 2JB5L 2NW2A 2ZNWA 3AS1A 3KJ4C 4MXQD 4ODHL 5I19L 1HSBA 4LPVA 2R4RL 5JIHA 4OF8A 2IFFH 3G5YB 4CVZA 1XF3B 3EW3B 2AEIT 3DYMA 3JWOH 4R97C 1J0KA 1EHAA 5ISZA 1C5BH 2YPVH 5CEYA 2HTKD 1BPVA 4NT6B 2DLFL 3Q0HA 4BFBD 2MPAL 2DI8A 3CSPA 4XHQA 3IJYB 3FQUB 2V6HA 1NMAL 5HHNB 4BSWB 4HKJA 4JFHD 3TBSB 1WZLA 4ELMF 1L7TH 3KLDA 2Z0BA 1UQSB 4EI5C 5BV7H 5L88H 1MVFA 2NW2B 3PGCA 5CKGA 1U95A 1HXMB 3EYFB 3F5WA 4NQDD 2QL1A 4A6YL 1HSBB 5IP4A 1JN6A 1I85A 3G5ZB 1IKFL 5EU6B 1S5IH 3CDYA 4P2QD 4R4NC 4R7DA 4CVZB 2QQNH 5D72L 5E08H 5CD5D 5LGHH 2FGWL 5ISZB 5CEYB 5HYEA 3SDCC 3U36A 5JOEA 3GI9H 1RZGA 1G0YR 4KDTA 5C9KA 4XZUA 3S37X 4NM4H 5GJTL 1F4AA 3GSWA 3QIUA 2UVEA 5E5UB 3VXSE 3T09A 2AI0H 3BZFB 3LKSB 2BXYA 2EDBA 2APVA 2MQ3A 2XICA 3DBXA 1U95B 4YWGL 3QUMB 2QSQA 1JN6B 5DVLA 3BESR 3C8DA 3O2DH 4IRZH 1QA9B 4R7DB 4IRSC 2ARWA 3BW9A 2WM0A 1CGYA 2QQQA 4HMCA 1HCVA 3U36B 4F9LA 1RZGB 1DQML 3OR6A 4OI7A 1PX3A 3R06B 2BCKB 3FZUC 4S1DC 5T1KA 5I1HH 3SGJC 3O6LH 5IMKA 4X7SL 1YEIH 2XPGA 1J88A 8CGTA 3KLHC 2HRPL 2OZ4H 3IVKB 2P45B 1R5WA 3HNSH 4ODSH 5ESAA 5FHBL 3ZTNH 1NCUA 4KKLD 2JB6A 5HGGS 4TUJA 4FFZH 4FOMA 5D1ZD 5DD1L 4N8VA 5FM4A 3WD5L 3MR9A 5MP6L 3BW9B 1DVFD 4PJHB 3EJZC 2YWYA 5TE4H 12E8L 4KUZH 1KV3A 3OR6B 1JF1A 3HCVB 5DJZA 1KN4H 4R2GD 3AY4A 1P7QD 5T1KB 2AXGA 4UT9H 1E4WH 3KPSD 5C0RH 6FABL 4PJ9C 2VXVH 2XPGB 5D7SH 4YO0B 1S7QA 4KRPB 4WEMB 2JJSA 1JGVL 4U4BA 1EEZA 1JZ3A 1R5WB 5ESAB 4U1NA 5DUML 2JB6B 4Y4HD 1P6FA 3BQUD 3L3KA 3TO2A 4N8VB 4U6XA 3WMSA 4FFVD 4Q2ZA 3MR9B 5HDQH 5I6XB 5LQBH 4HHAA 1T83A 1JF1B 2EH8H 4WWKC 4F37F 1GL4B 5C0BE 2AXGB 3ARDC 4PJ7B 1T7WA 3MSPA 4XP9L 1TNNA 1S7QB 5D7IA 5E4EC 2FB4L 1JGUH 4HK3J 4PJ8D 3GSOA 1FVEB 2X4PA 5A1AA 3B9AA 1AIFB 2J8HA 4Y4FA 3GMQA 3MLWL 1U58A 3SBWA 2VXSL 3TO2B 4JDTH 4YUEL 4Q2ZB 5I16A 5FUCC 4KI1A 5H35A 1MCWM 1AI1H 2WIIA 1FYTE 5MHSE 3I6KA 1AHWC 1D6VL 4HHAB 3TT1L 4JO1H 4ZXBA 5DRXA 2QSVA 1JNNL 3CU7A 4Z95L 2WBJD 4XNXL 3ARSA 5AUMA 4UINH 2X4SB 4OIAA 5D7IB 4OCWL 5J12B 3WKNA 4RBPK 4BSVA 1QFWI 4M48L 3GSOB 5IHZA 3TC9A 4LGSB 5EZIL 2X4PB 4O02L 2BMKA 2FWOA 3OBAA 1B6DA 3GMQB 3S5LG 5DMKA 1L6XA 3V0WH 4PP2B 3TV3H 1BQLL 5I16B 2DQDL 5H35B 4OZGF 4K3DH 3LEXA 1U3ZA 3ZL4L 1NCNA 3I6KB 3LCYA 1BP3B 5DMGC 3S4SA 3G04A 2XKNB 1R3IH 4NZJA 5DRXB 5F21B 2I60L 4U3HA 5C8JA 5C7XL 3QZWG 3DIFA 3HB3C 1AC6A 1HXYB 3MGTA 5EIIA 1NC2A 4I9WE 5CJBA 4XMKH 2B8OT 4HD9A 1CLYL 4CAGA 4BSVB 5A40E 1WWWX 3INUH 3DVGA 5IHZB 1JWUB 3D9AH 3IAPA 2BMKB 2FWOB 1BAFL 1TVDA 3CFJA 4QXTB 2ZG1A 1QPXA 2DOCA 5DMKB 1DQLH 2OL3A 3AMKA 3WKML 5GGUA 5DJ6A 4M43H 1SVZA 2E7BA 1GC1C 5HYQA 1I8IA 1LDPH 1SY6A 3S4SB 3OPZH 3G04B 4KPHH 4OD3L 3I6LD 2AQ1A 5C8JB 3DIFB 2MKWA 2WUBL 2C3GA 3MGTB 5EIIB 3EJYD 1NC2B 3HE6D 4QRPE 3QIWD 4FA8A 5GHWL 3CC5A 4FHBD 3MV8A 4P99A 3FFCB 3DVGB 5T1DH 2WAHA 4PG2A 4Z7WE 4G6ML 3T0VA 1BFVL 2ZSWA 3CFJB 1EEYA 3MCG1 3W2DL 5GGUB 2ZUTA 4KVNL 4ODUA 2BSED 4M03A 5HYQB 5E2UL 1T7ZA 2YZ1A 1UM6L 2Z8VC 4Z18A 2J4WH 3K74B 3PHQB 4X6DE 2QADD 3JV5A 3PUCA 4JFFB 3D3VB 5DUBA 5I1EL 1HH9A 2KQNA 2V17H 1T7YA 3QA3A 5CBAB 4U1JA 3SDDD 4U6TA 1KCVL 4NM8H 5HD8C 3LRGA 2JIXD 1HINH 3CC5B 4D0CB 4OTXL 3VFTA 3MV8B 3WYRA 4QTIL 4OLYL 4EJ1C 5FYLE 1RHHA 5JTWA 4NBYB 4YDLC 5EU7C 5BZWA 1BJ1H 4L4VE 2VDRL 1FNGA 4HC1L 2ZSWB 1EEYB 4HS8L 1B0GB 3EYUH 1T4KA 2FX7L 4BM7A 3K2UH 4APQA 1TQBC 5EO1A 4ZQKA 3LQZB 4ODUB 3TA3C 2R2HA 1BBDH 2E27L 4M93B 1UFUA 2XY1A 3S35L 5TDOA 4HLJA 2CJUL 1PY4A 3HNTH 1AKJD 1HH9B 3FOMA 3LOWA 3W39A 3EO1B 4UBDC 1G9MC 3QA3B 3V0VA 3VXSA 4PBXA 2WBKA 4FQCH 3DV4A 3FRUA 4OUUA 5GS0H 4ELKA 3VFTB 4MD4B 1TIUA 2VC2H 3VGEA 3BDYH 1I3GH 1RUKL 1RHHB 1EAJA 4MB4A 4JPKL 4Y19D 3I85A 4X9GA 4XP5L 3DVNA 1FNGB 2IBZY 3Q1SH 1T4KB 3BEWA 5AWNL 2EO1A 4KTDH 1F3DJ 5CJOH 3C08L 1AR1C 4ZQKB 2K7PA 3RGHA 1A14H 3MRGA 3GM8A 5TDOB 3R1GL 1UYWH 3S34H 7FABH 1JPSL 1Q0YH 3FOMB 3VXUE 3W39B 5D5MB 3OXSA 4OLXL 3WFDL 4YFLI 4JHWL 3VXSB 4OT1H 1DQQA 2Y07L 3DV4B 4A2LA 4LEXH 3OXRA 4ELKB 1FNLA 5SX4I 5CLWA 5GGTH 3IXAB 2IC2A 3IDIA 4GW4B 5DHYA 2VXQL 1ACYH 3DVNB 4M1CC 1TZIB 3DLQR 2E7CA 3J7HA 1ROWA 2XI9A 5E6IC 4AY0A 4F37K 3BEWB 3QI9C 1UACH 3NGBC 2BSSA 2FZ3A 3PWUA 4ESKA 2HLFC 5C6TH 1U8MA 4UT7H 3MRGB 3D85D 3HFMH 3QEGH 1AE6L 4P2CG 3OV6A 5D71H 4J4PA 1KCKA 4JQIL 2VISA 2VLKE 1E4XL 4WTXA 4UILH 3HZMB 3WHE0 3KPMA 1P5UA 2BRRL 2DMKA 4JM2F 4U7KA 1JV5A 2ZUYA 3IDIB 4G6JL 5DHYB 3ZDXE 1I9IH 4WGVB 1IC1A 5KN5A 3TBYA 3P0GB 3EBAA 3O2VL 4YDVA 4DZ8A 5DR5L 1E0OB 1N64L 2LTQC 4FQ2L 4K7PL 2FZ3B 4X5XB 4R6UA 1SJEA 1RZIB 3LZFH 4AEEA 4JPIA 5BZDA 5CIPH 1MCQA 5E5MA 5C0BA 3GHEL 2X4QA 4GQPH 3BP4A 2G9HA 4HXAL 2ED8A 4M9PA 4F33A 2VISB 4NWTH 1VEMA 2H3NB 4JR9H 1RZJL 2H9GA 2H32A 1C5DA 4DUVA 5B3JE 3KPMB 3PDOA 3C5JB 1D5BA 1CF8H 2D0HA 1HHIA 3RKPA 5KN5B 3TBYB 4NRYB 3A67L 4YDVB 2DTMH 2Z35B 4NFDA 4DZ8B 2JJWA 2Y36H 2ATPA 3SGDI 1WC7A 1FYTA 1YN7A 2ICWJ 3QRGH 5DWUH 4RFEA 4TSBH 2OTWB 1KTLA 3GDBA 2HP4A 3O3AA 3S96A 1SJEB 5BRZD 1DUZA 2UUDK 3LN4B 1D5IH 4JPIB 5BZDB 1OHQA 2ICWA 4PBWD 2N7AA 3MJGX 5DZOA 5E5MB 3U2SB 5C0BB 4HIXH 1EJOL 2G9HB 2GTWA 3G5VA 1YN6A 3ZYOA 4JY5H 4KKAD 5D6CA 3BKMH 5FF6A 2X7LA 2H9GB 2H32B 1C5DB 4HMEA 1AXTH 3NCBB 3UTSB 4AQOA 4PGJA 4PB9L 4YX2L 4ODWA 3VA6A 1MJUH 3EHBC 1D5BB 4G8GB 4QRRE 3ARBC 2FATH 5I75C 1VSCA 1QACA 1D5ZA 2ATPB 1A7OH 1D9KA 1UWXH 1A4JA 4WHCA 1WC7B 1FYTB 1YN7B 2AJVH 3RGVD 4RFEB 1KTLB 2J6EL 3O3AB 2AJXL 2F53B 5DJYA 3ZDZE 2ICWB 3QIBA 4KMTL 5HYJD 2D2OA 2EXYC 1S7WA 3PP3H 1P84K 1JVKA 4PRHE 3G5VB 5F9DC 1YN6B 1QEWA 3SPVA 3MUY1 3V4VL 3MBEC 1DQDH 4MA8H 2P5ED 5FF6B 2X7LB 1N59B 2D7OA 3TCLB 3MLZH 3O9WD 4ODWB 5JUEL 2FL5A 1F4HA 5GZNC 4PR5A 5DGRA 4QWWC 3REVA 4C59B 3SQOH 1OAUH 5TJWK 3T3PF 3BPNC 5J06A 1D5ZB 4JCMA 2ICCA 1D9KB 4TNVF 1A4JB 1L9MA 5JXAH 4RA3A 4QOKB 1VEOA 3QB7C 4NBXB 2V5RA 3CVHA 5DJYB 1JNLH 4QGTA 4TUKL 1DANU 4UIKH 3QIBB 3F58H 3HMXH 3QP3A 4XGZA 2JJTC 5C1MB 4LHUA 3QNYA 3QDJE 4HWBH 4DK3A 1QEWB 3SGKA 1OAQH 3LV3B 1A7RH 4QRPA 5FOBA 2NXYD 4FQ1H 1QBMH 4EZMA 1JPST 1U8IA 3MPCA 4Z7WA 3TWCL 2FBJH 4Y8AA 4PR5B 1FH5H 3GMPB 3REVB 1FSKB 3SKMB 5ESQB 5GRYA 3DETD 4TVPH 1U41A 5LCVH 2IGFL 3KNBB 1A7PH 5EIQA 4X9FA 5GZOD 1FL5A 4FQHA 4OLVH 3ARGA 1CXEA 1MCPH 2Z31A 3CFKA 4N8CL 4UNTA 1D5MA 3JWNC 1F4WH 2ICWI 4X6DA 3BH9A 1JUFA 1YZZA 3EYOA 4ODXA 5HHVL 5AYUH 1RIUH 4XGZB 5FYKE 2XTLA 3QNYB 2KZWA 2GSGA 1NMCC 4EIGB 3E8UH 4QRPB 5FOBB 1EVTC 4Z77B 5LBSL 4K7PY 4P2OC 3WFZA 1TLKA 4FQXC 4Z7WB 3H3BC 3GSNA 2A38A 4L4VA 4YHML 4ZO7A 3K7UA 1OP3H 1MOEA 1IZJA 3UTQB 3TFKC 2HFFA 2G2RA 3U82B 4G3YL 5EORH 4FQHB 2R8SL 3ARGB 1BF2A 2Z31B 5GRJH 4AL8H 5D7LD 3CFKB 3F6LA 4NNPH 1D5MB 4OZFB 5INCA 2V2TA 3VW3H 1MI5E 5ICYA 3S88H 4X6DB 1JUFB 5IB4B 5IK3A 2HT3D 4JO2L 4ODXB 1HILA 1BZ9B 1WWCA 1QUNA 1CTNA 4D3CH 2Z93A 1GCFA 5F1KC 5DLMH 4UV4L 2XXMB 4D9QE 4POYA 1KPUA 1OCWH 3GSNB 1J5OH 1JHTA 4MDIA 5TH2B 2G60H 4LNRB 2EICA 3MROA 4XPHL 4KU1A 3CX5J 1TMCB 3S3PA 1NBQA 3DI2B 4LCCB 3W9DA 4OM1H 5INCB 1EERB 2W59A 3P2TA 5ICYB 1CGTA 4XXCC 1RJYA 2IH3A 1HILB 3VXUA 4Q9QL 4WW2A 5IEHA 2W9DL 2BNRE 4RFOL 2Z93B 5CP7A 3H7BA 4P23D 4RDQF 4R4ND 1EFXD 2B1HL 4N0UB 2NY1B 5DJDA 3U7YL 5F72S 3UTTB 2BK8A 5F88A 1KPUB 4HSQA 4N5UA 3G6DL 2XN9D 1JHTB 4CDGC 4NN5C 4MDIB 3EOTL 4K07A 1A3RH 4LPYA 3MROB 4OCSL 4WEUD 3JVGA 4DEPB 3LH2L 4PRAA 1RUML 2E6QA 3W9DB 1LHZA 1G6RH 1UKSA 3TO4A 4JREC 2PO6C 1H0DB 3IDMA 4MAUH 4QLRA 1RJYB 2IH3B 1NAKL 3VXUB 5I18H 1QFHA 5IEHB 5IMLA 2FJFA 1VFOA 3U7WL 4ZODA 3H7BB 2VLKA 1WAAF 4JQXA 5DJDB 5C3TA 4D9RD 4IRSD 4OJFL 4G7YH 5GS1C 1ZT1A 4Q58C 3TT3L 2C5DC 2VDPL 5F70A 4YBHA 3T0AA 1OLZA 1V3LA 1YYMH 3OX8A 3SDAC 4DN3H 4ONGH 2Y5TA 1X44A 2YBRA 4JKPL 5A2JH 3PWJA 3HAEA 4BJLA 1XZ0A 4HWZA 2PXYC 4NOFA 1XIWC 3AU1A 3O3UN 4S1DD 3IB4A 1HZHL 5F89B 3WIIH 1IGFL 4PRAB 5ADPL 5JW4Q 5IQ9A 1A7NL 3CFCL 3TO4B 1JP5A 3MJ9A 1GIGL 4HQQH 1EAPA 1XGPA 5EUKB 3KLHD 3IDMB 3OKYA 3DHJA 4NQCE 1MHPH 2FJFB 3B6SB 3QUZA 3MOAH 1EVUA 4ORGA 2VLKB 3KYNA 1GAFH 4X83A 3T4YB 1LP9F 4LPWA 1ZT1B 3ESUF 3IETB 1JHKH 3EJZD 3OX8B 1JYVA 3DURA 2HKHH 2Y5TB 5E1HB 3KYKH 2YBRB 5I73B 1JI1A 5B4MD 4P9HL 4NQDE 3PWJB 1XZ0B 4HWZB 3AB0B 4ZS6C 3S36L 2DAVA 3QQ4A 4TSCL 2GJ6E 3K8MA 4NN6B 4PJ9D 5IQ9B 3PNWA 1Z6JT 5FKPA 4J3WA 1FJ1A 5KSAD 1F58H 4AIZA 1EAPB 1XGPB 4QYOA 4KK8D 4KGJA 2ZJSH 2ZCLL 3O81A 4C4KT 2YA1A 3QUZB 3MREA 3TN0A 1C5CL 3IRPX 4ORGB 1I9EA 3VFOB 3DWTA 3FQNA 2AS5M 1YEHH 3KYNB 3RPIA 4OGXL 2NY5C 3MRFA 5IVXF 1MQKL 4OQ1A 2FEEL 5C0GB 4TNVK 1JYNA 1FIGH 4EUPB 2VDQL 8FABB 3L3GA 3S8WA 1VENA 1YJDC 3QR2A 5TE6H 3DUSA 3OQ3B 3DURB 4QRRA 1BWMA 2WWMC 3QNXA 2DQCL 5DK3A 3C6LC 2BVPA 1NMBL 1I3UA 3L3OB 1XF5B 3MLVH 4WWKD 2FGZA 3QQ4B 3ARDD 3THMH 3P30L 3PNWB 5FKPB 4LASL 1BBJB 4Z7VE 3B2VH 1FJ1B 1G7LB 1MCBA 4JKKA 4QYOB 1WGOA 3CDFA 1FG9C 2JCCF 4XNYL 4DKEH 4PRHA 1LILA 2BVOA 4KROB 4P3WA 2RGSA 3TN0B 5EOCL 4RWYH 3FHQA 1HQ4A 3MRFB 1F11B 1X5GA 3NPZB 4K23H 2EE9A 3P73A 5C9JB 5D2NB 1HEZB 3T65A 3DUSB 3GMOB 3PGFL 4QRRB 1VFAB 2RQ8A 3QNXB 4EBQH 4MB5A 3TZVC 3TPKA 1IAOA 2W9LA 1QHPA 4OM0H 3I3BA 3KS0J 4HAFA 1DLHB 1K8DA 1MCWW 3QDJA 4PRHB 5GGQH 2BVOB 1HQ4B 4IBLT 1KJMA 4X7TA 5EBMA 3CH8A 3M17B 1QQDA 5GJSL 3P73B 2Z91A 3GGWA 3ULVE 4KXZI 4NC2B 3ZDYE 3GRWA 1UB5A 3GBLA 3JWOL 4OGYH 4P5TA 1T7VA 3UPCA 1IAOB 1WSST 2IANE 3HB3D 3Q2CA 1C5BL 3HHRB 5CCKH 2YPVL 1V7ML 5DSCA 3OF6A 1I85C 4P46A 4GRLD 1KB9J 4JY6B 4I18B 1K8DB 4WI9A 1WK0A 5E8PA 1G9ML 1AXSA 4PGCA 3QDJB 1MRDH 1F3DH 1YNTA 1S5HA 1KJMB 2ADIA 4P9MH 4X7TB 2IBZX 4U49A 1IBGH 1H8NA 4KDTC 4LRIA 1WWAX 4CU7A 5A2IH 3MXWH 1YEKL 2C7UB 1QQDB 4JVPA 4XPGH 4KTYA 1FE8L 1ZAGA 2Z91B 5KOVC 3GGWB 4WGWB 3V52H 3QIUC 3DHMA 1R0AH 4H1LH 1S5IL 1ZGLM 4UQ2A 2QQNL 1GZQA 4LF3A 5C86A 1UB5B 3O11A 2ED7A 2BVQB 5LGHL 1T5WA 2NZ9C 1YY9C 3OAYK 4J8RA 5DSCB 1MI5A 3EO0A 2X6MA 4P46B 2NXZC 3VRIA 4QO1A 2DD8H 4E41D 3D2UD 1H3TA 3BH8A 4MNHB 4P59L 1AXSB 4LSVH 3DYOA 1T3FA 1IC7L 5E5RB 3BPLC 2ADIB 1YNTB 1S5HB 4KKCD 4LLQB 3ZLQC 4F9LC 1AO7E 4ZPVA 2FH6A 2B2XL 3E6FA 2MQCA 3QCTL 4X8JA 4NO2A 1IAIM 3KGRA 5J6HA 4IRZL 2VDNL 4PLJC 4PYHA 4CU8A 3AUVA 1GZQB 2ARJB 3O11B 3QJFA 4ZS7H 2XKUA 1T5WB 1IC4H 3H3KA 3TPUA 1A4KA 4J8RB 1S9YA 1MI5B 3BAEH 3MV7D 4HZLB 3EO0B 3DO7A 4OD2A 4H25A 3VRIB 5JQ6L 4KZDH 1BEYH 1KYOK 3P0VH 2BNRA 3D39D 2J8UB 1KBGL 2ADJA 2MNUA 4OLUH 2B1AH 1NH6A 4BSJA 4G6AD 5HBBA 1YEIL 1WFOA 4X9IA 4QKXB 2D03L 4M1GL 4Y4KB 4ZPVB 3O6ML 5BVPL 4LLDA 3NA9H 2UZXB 3TM6A 3E6FB 3AY4C 1CE6A 1LD9A 4ODSL 3ZTNL 3K1KC 1A6VH 4B5EA 1J0IA 1J0YA 5J6HB 2H45A 1T0NB 4FFZL 2JJSC 3QJFB 3HUJE 1W0VB 1HE7A 4UBDD 2W0FA 3TPUB 1A4KB 1S9YB 2NPLX 4QHNA 5TE4L 1Q9KA 1FVCA 4OD2B 3PWVA 2MMXA 3IXTA 4H25B 4J2XA 3S37H 2DM2A 4DWHA 1GGYA 5DQ9A 1LK2B 3SE3A 1MFCH 2BNRB 2R1XA 1E6OL 2HJLA 2ADJB 2D7TH 1TTFA 4RISH 4UT9L 1E4WL 2BJML 1I4FB 3I6LE 4Y5VA 2VXVL 5D7SL 4YE4H 4Z0BH 3VI3F 4OQTL 1T83C 2AXFA 5GQBA 4LLDB 1MCRA 1AR1D 1CE6B 3S5LA 2V9TA 2AJUH 1S7XB 4MQ7A 1IGIH 4JRYD 2O5XH 3B4NA 2W0FB 5HDQL 2G5RA 5FO7A 4JFXA 5LQBL 1GH7A 4QHNB 5D7KD 1FVCB 4Y4FC 4KMLB 3PWVB 3IXTB 2BP3A 3SBWC 1JK8B 4NQCA 3UJJL 5DQ9B 2HFEA 2R1XB 2N56A 4PJIF 2EDYA 2IAMB 4Z6AT 4M1CD 1NCCH 4NUGL 4Y5VB 1PSKH 5SV4A 2AXFB 1PG7H 1TVHA 3QI9D 1JGUL 4S10A 4ZXBC 4ORZC 4MCYA 3HR6A 2EE6A 3S5LB 4BUHA 1FFPA 4DVBA 5IW6A 4Z8FH 2HLFD 4NQDA 2HVKA 4XP6H 4LLUA 4JFYA 4PJBF 2GJ6A 4HGWA 4DW2H 1JCKA 2B0SH 5H37H 4U1IA 1AI1L 2W9EH 4PRID 5DT1L 5DHVB 4M7KH 2LVCA 4R9HA 4R4BA 4UTAH 3QZWB 4LAQL 3ARVA 3WJJA 1VFBB 5AZEH 5DFWH 5JNYA 5KTEH 4FXLA 4U6YA 4MCYB 4XPBH 3IGAB 5FA3A 1FFPB 4DVBB 5IW6B 4NQDB 2PYFA 5F7LB 4B7LA 4Y19E 1U8NB 3V0WL 4Z7NE 5LXGH 4P2QB 2GJ6B 1ES0B 4HGWB 2V7NA 4OV5A 1UWXK 3E0GA 4K3DL 4Z7VA 3LB6C 2BHUA 3GMNA 5MEPA 4GS7C 1R3IL 1DN2A 3HA0A 5EBWB 1MAJA 5FXCH 1TNMA 3NABH 3ELAT 4W6YB 3CFBA 4XCEA 3PP3K 4XMKL 5DJ2A 4RAUA 1R24A 4Z5RA 1IFHH 1JFQH 4X80H 1N0LA 1U8KB 3NBNA 3INUL 3ZKNC 4AQ1B 2WV3A 4U6YB 2DLHA 3HI6H 3D9AL 2EEAA 4QNPF 5HHOD 1K6QH 1MCSA 3HKFA 2CPCA 2F19H 3H42H 1FNSH 3MFFA 3P4NA 4OF7A 3CPLA 1DQLL 3UP1A 2BC4A 2V7NB 3M8OH 1EO8H 4PG2C 1DDHB 3ILPA 1IARB 4OV5B 4Z7VB 1CK0L 1DTUA 4WHYG 4CMHB 1EUTA 4AENA 4PUBL 1LNUA 5MEND 5CILH 5MEPB 4K7PX 3SDYH 1A6WH 2ADGA 3BGFC 4MA3A 5EUOF 4XCEB 3CFBB 3ARBD 1P7QA 5DJ2B 4RAUB 1R24B 4M93C 3JV0A 2YD5A 3CVIH 4M6MH 4A6YA 4HKBB 4K8RC 5C70A 3MRKB 2GT9B 4L3ED 5T1DL 2Q86B 4GW1A 1RMFL 3KG5A 4WHTA 5I8EA 3L7FB 3WUZA 2EDKA 4MMZC 4RGOH 3BIBX 3P4NB 3MFFB 3TP4A 1S78C 3CPLB 3QRFM 5DDHB 1ZHNA 2IANA 2BC4B 3KXFD 2X40A 3R0NA 3ILPB 2DJ4A 5D1ZB 1OGTA 2MCPL 4YLQT 4AENB 1DVFB 5E24E 2J4WL 3WO3B 1LNUB 2DBJA 4JJHA 2B20A 3AAZA 3BP5A 4APQC 1OP5H 1LE9A 2DQEH 5GZND 2HG5A 3NH7H 2V17L 3S3JA 1WBYA 5L2JA 4R2GB 1FAIH 1P7QB 5EU4A 1IAIH 1VGEH 4A6YB 1YPZF 4I3RH 1MEXH 2OP4L 4GW1B 5E4IA 3MLYH 1CXHA 4MNQE 4YPJA 4LQFH 2VQTA 1EMTH 3DOSA 3PXHA 1YECH 5KS9E 1Z0MA 1OP3K 4H8WC 2EKJA 1G1YA 1C12A 4HUUA 2GIYA 4Y4HB 1ZHNB 2IANB 3K2UL 5JHDD 1UZ6F 2FLBT 5D93B 1YMHA 1BBDL 3E1F1 3SKNA 5C0DB 4KKNA 2M2DA 3BP5B 3WDJA 2QSTA 3HNTL 4RMSA 3BJLA 1MSPA 1LE9B 1I7TB 1WBYB 2V5YA 4PRDA 5EU4B 1AO7A 4FQCL 4NJAH 1BFOA 2WBJA 5F7MC 2VC2L 1RV6X 3BDYL 4OZHB 1I3GL 4E5XA 3P4MA 5FYJE 4YHYB 4PJ8B