1DLFH

High resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 5.25
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
EVKLEESGGGLVQPGGSMKLSCATSGFTFSDAWMDWVRQSPEKGLEWVAEIRNKANNHATYYAESVKGRFTISRDDSKRRVYLQMNTLRAEDTGIYYCTGIYYHYPWFAYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S)
publication title The pH-dependent structural variation of complementarity-determining region H3 in the crystal structures of the Fv fragment from an anti-dansyl monoclonal antibody.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 28
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 1998-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dlfH00
3PJSB 4ISVB 1HH9B 2J3SA 5CJOL 1P2CB 2F53E 2JJUA 1NC2D 4W4NA 3TCLA 3WDHA 1WISA 3U9PL 3MACL 1BFSA 1FFPA 5I76A 3RY4A 1AGEA 3HCVB 5GHWH 1FG9C 1TJHH 3H9SE 2WINA 1MCIA 3U46A 5HHXL 4S1DC 1T5XB 2YD5A 4NHUA 2DJ4A 4P2QB 3TPUB 2CRIA 1DANU 4F57L 2X7LA 3SOBL 2ESVB 4TPRH 4U1KB 2H3NB 4LSPL 3E6HA 5GS0L 2XQBL 4HBCH 5JIHA 1U8HA 4JO4L 4MD5B 3ZDYE 2MWCA 1ZLVK 3MFGB 2WIIA 1CXEA 1UWEL 1WCBB 1AE6H 2YZ8A 4JFZH 5GRYA 4WHYG 5D2LE 3LVEA 1FDLH 4FXLA 2NQCA 2R2BA 4IBLT 5F89A 3RJDA 3MRLB 1X6LA 3P9WB 3V6OC 2BVUA 1KCKA 1OT1A 3QNXB 2XXMB 3VFGH 1UB6A 3ARBC 4JZOA 4HCRA 4LPYA 4ZQKA 3KR3L 4ZAKD 1PG7W 3X13A 4LVOC 2FATH 4I0PC 3MSPA 1L4IA 2J88L 3BKJL 3MXVH 4RCAA 4U7KA 3V5HA 2A9NH 1JK8B 5D7KD 1LP9A 5E5UB 1RUAH 5D6CB 5ICZA 4NQVA 1Q94A 3OL2A 2CDFB 1BP3B 5BQ7B 3HRZB 1MF2L 5J6GA 3W9EA 1ZANH 5DMIL 3WN5B 3VMNA 4TULL 4YWGL 2ZP0T 4Y5XA 3SDXA 5K9QG 5CLTA 3CX5J 4TYUA 2O61B 3UYOD 4JFHD 1FL6B 4G8IA 4GUPB 2CUHA 4PRNB 4TNWF 1KC5L 5B8CC 3FFDA 1IKFH 4PTUB 4J6RL 3TNMA 3FCTB 3KPPB 1H5BB 1SBSH 3UO1L 1ORQA 2FO4A 5C0DA 3RWEB 3QRFM 1JTPA 4O5LH 4ELKB 4LHQB 1I1YA 2HT3D 5IVXB 2V7NB 4UNVA 1MJ8H 4JREC 3RPIB 1NAMA 3HUJE 1RURL 3CFJA 1LE9A 3U36A 2QHRL 4Z77B 2YUWA 2XOTA 3V4VL 4NN6C 3F7QA 1T2QH 4JKMA 3PWUB 1MWAB 5FYJH 4HAGA 2IAMB 4IEFB 4X7TA 1XGUB 1BFVL 5F9JA 4BFBD 1I7ZB 4OTXH 4P59L 3MYJB 4MGXA 5D7IE 4RFEA 9CGTA 5EBMA 1HNFA 4LHUG 3MRRA 4L29B 1I9EA 4OKDA 4OBRA 4HXAL 4OD1H 3TJEH 2EDXA 1OTUC 3WHXA 4HJ0C 1HH6B 1K4CB 4D0CB 2R15A 4QHUB 1S7XB 1A7PL 1DBAL 3OF6A 3I84A 4QHLB 1JPFB 1J05A 3JV5A 4KPHH 1T80A 4GS7C 1QLEH 4L1DA 1YN6A 4YIQB 4HJJL 1BQUA 1H3WM 3KNBA 3WNMA 1MI5D 1MFEL 1U42A 2EIZA 3RY6C 1NGWA 3P4OA 5FFLA 1CXKA 4FQCH 4GRLA 1QOKA 4XBGA 2AXFB 2DYPB 1OB1A 3LDBC 2C7UA 2E27H 3F6IA 1ZHBB 2PUQT 2CUIA 4WV1B 3BGFB 3QDJE 4HCRH 5GS0C 4R7NA 4XNMB 2VDNL 5FB8A 4KVNH 4P57A 5CJBA 4WHYH 4XMLH 5F8QC 1EDQA 4FQIH 4U1IB 3IDNB 1KIPA 2X4NB 4I77H 3ZL4H 1CD1A 1C5CH 2DN7A 5TFSH 3RTQA 2BNQE 2ED9A 2HJLA 5C86A 3RZWA 2HFFB 3DROB 3SGKC 2GTZA 3JWDH 4RGNC 1FQ9C 3D9AH 4N9GB 4KROD 3S7GA 3I9GH 5DVMA 4X6EA 3PV7A 1WTLA 4I9WE 5EA0L 1JMXA 4A6YL 1QBLL 3J7HA 3FB6A 1XGPA 4U1GB 4MA7H 2NW2A 2OSLA 1TZGH 5CHNB 5IMMB 1U2HA 2X1XR 2K7PA 4Q9QH 4U0RC 3GUTA 1ROWA 2R1WA 4YX2L 4U1LB 3MZGB 4KV5E 4CW1A 5SX4H 3MV7D 3IRZA 3KVQA 1MCJA 4X5LA 3GNML 3GHBL 2V2XB 1NBYA 4GG6B 3IFPA 5BZWA 4N8PA 5CINL 4ONHA 1NBQA 5FM5M 3UMTA 4JHAL 2PO6A 3RAJH 5L8LB 3W11C 1I9RL 4Z7NE 3B9VA 2OP4L 5IEHA 1R0AL 5DK0B 4U6XB 1X6NA 2JJVA 2UZIL 4M43H 3PHOB 2QSTA 2V7HA 2NY6B 5DURD 1F3DH 5LGJA 4LDEB 1S7VA 4R2GD 5FGCB 1JFQL 3GI9L 4XVTH 2HMIC 5IHZB 3QQNA 1KUMA 5DHVH 2A73B 3BZDA 3QCUH 5DRXA 4LASL 4WY7L 5H94B 3FRUA 3KJ4B 3ULUH 3C60A 1IT9L 1NCDL 5HHVH 2EYTA 3AU1B 2FD6H 3ET9F 2BOBB 3ROOA 5ALBL 1QSEB 4FFYL 4FZEL 3C6LA 4GBXB 2NW3A 5T3XL 5AD0A 3MCKA 4Q6IA 4JZJA 3SE3A 5KVGH 4KVCL 5AYUL 4UILL 1AGDB 4R96B 4JHWL 1BM3H 1IM3A 3OJMB 3ARXA 4OZFH 3TYGL 4UB0H 5EBWA 5HYQA 5IBUG 3GSUB 3BPNB 2X4OB 2YPKB 4TTDD 1NCBL 3VJ6A 4ZOBA 5CBAA 5DMYA 1OAKH 3RTQD 5IMOA 1WEJL 5T33H 4X6CA 2R29L 1KT2A 3FB8A 5DEGB 1GC1L 2O5ZL 5FCUH 2AGJH 4KXZH 3PE9A 4GW1B 3F5WA 1W72A 2VXUH 5CSZB 3LH2H 4WO4C 1FGNH 1IEAB 3FONA 4JY4A 5C2UB 5IBLC 3BDYH 1F4YH 3RWFB 2FBOJ 5CEZE 5MERA 3BYTA 3GMMA 1QR1B 5DQ9B 3D6GA 1T3FB 2N4IA 4G8GA 4HKBB 1VESA 5AAWA 5L2KD 5EO1B 4RDQF 4HZLB 5IESL 3EYVA 4WFED 1VFAB 3QA3B 2Y72A 4O58H 3HC3H 3PWJB 5ANMB 2VZUA 1ZHNA 3QNYB 3L7FB 1NDGA 4PJGB 1UKTA 4RWYH 4U1NB 1E4KA 4FZ8L 1U6AH 2GSIB 4P4KA 3SE9H 3BPLB 4PJAF 2OMNA 2ZNWA 1VHPA 1GGTA 4X7SL 1EZVY 4HIJB 2ZPKH 1CFNB 3CLFH 2H2SD 3DI2B 4MS8D 4P46B 4EQ2A 4LEOB 4XPTL 4EI5C 1FG2A 1ZS8A 4MYWB 2WIMA 5DWUH 3O2VL 3RZCB 4GJTB 1YNKL 1K8IA 4PJFE 2D7QA 4DZBA 4TN9A 5TDPB 2IALB 3C60D 1CZ8L 4N0FB 3BKMH 4ODHH 2OQJB 1J86A 4MVBC 3BKCH 3C6LD 1A6ZA 3X12B 4P3DB 5L6YH 5F97E 5FKPA 2ZOKB 4JG0H 1HHIB 1AD0A 5JW4M 3MZTA 1XF2A 1AGFB 3S37L 4D3CL 4F3FB 2F8OA 4JO3H 3B5GA 3TN0B 1Q0XH 2YMXL 1A7OH 2GFBA 3UBXA 4NJ9L 4ORGA 3QG7L 4QCIA 2X70B 1A9EA 3DV6A 3L3DA 3HNTH 1OAQL 3DO3A 3K8MA 2UVFA 2DQFB 1JPTH 5TE4H 2NLJA 4NDMA 2BC4B 3BQUC 1IKNA 5JA9A 2YPVH 1K8DB 3HI6H 4UV7H 1DCLA 5J0BA 4I48B 2VTFA 2XY2A 4NWTL 5E6YA 1U92A 5IG7A 3QG6B 4UQ3A 3ORJA 4F58H 3TC9A 5C0CA 1CFSB 4NO0A 1S9WB 3GK8H 1E27A 3G6JF 5GGQL 4U7SA 5HHPA 2NY2D 4G8GD 5CILH 3BO8B 5HHQB 1W72H 2GK0B 2F5BH 3MRPB 2PTTB 5HBBA 2KZ1B 3D0VA 4IRJA 4Y19B 1EK3A 3MLVH 3CLEH 1U91B 3H0TB 2DDQL 4V2BA 3NOIA 4IHOB 3VE0A 1Q38A 4NC0B 3MFFA 1D9KC 5KVEH 3WBDA 1A4KA 4CMHC 5J1AA 1ODAA 1RUPH 3GI8L 1VPOL 4P4KD 2WSKA 4G8FB 4G9DA 1M7DB 3V6ZA 2G60H 1T83A 2VAJA 4N0YL 4O51A 4QF1A 5D7SH 1CVRA 4R0LA 1C5DA 3VRIB 1NFKA 1JGUL 4OGXL 3BXNA 3VXQB 2NTFB 3OXRB 2X9YA 4OGZA 4HPYH 4M7LT 1NKRA 2AERT 3QWRA 2P7TA 1CFTB 3F58L 5F1NB 5GJTH 3O9WA 3GMQB 3VXNB 4ODXA 5E8DH 3LV3A 1IC1A 4R97B 2EC9U 3PQYA 1XF4A 2PYFA 4IRSB 3LEVH 4W4OC 1BOYA 3AS0A 1MUJA 1T1YB 4NNXB 3E6FA 3VXMA 1G7IA 4LSUL 4MA3B 4TVPD 1QPPA 4QY8B 4NFCA 2XT1B 3V8CA 4WU5A 2Z91A 3RL2B 2MPAH 2BMKA 3MRQA 3ARWA 1PQZA 4LGSB 1HHHB 1MSPA 2ESVE 2D31A 5DT1H 4TOYH 2IQ9H 3AUVA 5HI3D 5K33A 4BELD 5HGHA 2OL3H 1RZKH 3DMMC 1JTOA 4HLZH 3WFCH 3DO7B 2GY5A 1BD2A 1T20B 3L5IA 3MNZA 2QQLH 1HILA 2NY1C 3BZ4B 3KPRB 5F7UA 4WEBH 2FX8L 1ZGLP 4BH8A 2X89A 4OB5H 2AEWA 3JTTB 1HYSC 2ZCKL 1FL5B 4HIIB 1DVFC 1GGBL 5I73C 5LWYH 5M95B 3G6DL 1HKLL 5C0CD 2VDQH 3IFOB 4NO0D 4ZD3L 1MVUA 1HSBB 4XCCH 3VFVB 2FR4B 2VITA 2VQ1A 4K8RL 5I1CH 1YMMD 2QV2A 4URTB 4QXGL 4YHPA 1RAMA 2WBKA 1E4XI 1T04A 5D1QB 3MLZH 3S3JA 3N1GC 5F7LB 4OZHB 4CVZA 4U1MA 4IRJD 1KBGL 3B2UD 1BQHA 3I85A 1P4LB 4KY1L 5JHDB 3B9KB 3N9GL 4XXDA 1KJMB 2OR9H 2HJFB 1MRFL 1D5XA 4XP6L 3ZYOA 1UWGL 5DJ8A 1X5ZA 1ETZA 3CPLA 2HT2D 5GGRY 5IQ7L 3V7AG 1CI5A 1JJUA 3O11A 2AJXL 5D2NC 2P5WA 4ZSOB 1E6JH 1QG3A 4GKZB 3RVXC 1DDHB 2LTQC 4QEGA 4NFBA 3WJLC 3QWRD 2R1YB 3BGAA 3O9WD 5IVXE 1JWUB 1BVKB 1DSFL 5ENWB 5MEPB 4LPVA 4PRBB 4KZEH 2R39A 1XCQA 1CLZH 2ZSWA 4MXVF 1EJOL 3PQYD 3TNNB 3QULB 4F33A 5EO9A 3GO1H 1INDL 4N1CA 1BIIB 3PHQA 1I7UB 2VWEE 3MLUL 5BVPH 3OXSA 3EO0A 3AROA 2VXSL 4AEIH 2H9GA 5HDQH 5EOCL 1DQDL 1HQRB 1P9MC 2ZCHL 3HG1B 5C0AA 5T1DH 3EFFB 2DB8A 1NCWL 3NIFF 4MQTB 4XNXH 4DAGH 2CPCA 4CJ0A 4IOSD 1YEKH 3EOAA 1AP2A 3FQXA 4JVPA 4CRPA 1WGOA 5TE6L 4TNVF 1BD2D 5GGTA 3O3DA 4XNUH 2A74A 2B2XH 3SDAC 4WI3A 1WCQA 5IK3B 1UYWH 2R9HC 2N56A 3O2DH 4G43B 4O2CB 2X1WL 3MLRH 4F7EB 4Z95L 4HPOH 1YY9D 2X89D 4ZTOH 4XNZB 1N7MH 4G6KL 2IADB 1G84A 4OT1L 2XICA 3U7WL 3L7EB 1Z3GH 2I60L 1A6VL 3C9NA 5LKNA 4NPYA 3PWPE 3B3IA 3PDDA 3NZ8B 4ETQA 2Z31A 3ZKMD 5A1AA 1OARL 2QHLA 2HLFC 5MI0C 3HMXA 4BKLB 2G75A 1E6OH 2AK4D 1FN4A 5FUOL 5CUSL 4XCNB 2R4RH 4CADA 1I8LA 3H7BB 3VWJC 4YXLL 2NY0B 2Q6WB 5FF6A 5FKAA 4ERSL 5CKGA 4ZODA 1WAAE 3QHZL 4AZ8A 3JV0A 4JRWA 5C09A 2F74B 3OX8B 4LPUA 2OJZH 5JZ7C 2I27N 4UU9B 1XFPA 4G7VL 3ROLB 7FABH 4YO0B 4PJCB 4HV8B 3VFPB 3R8QA 4LLMB 1LMKA 2B4CH 4U3HA 4XP4H 5B3JF 5IMLB 3PGFH 5HTSA 3T09A 3E3QE 3WKNA 3MLXH 5JR1H 2CGRL 2P5WD 4LLQB 1G7LA 1VFBA 4RMQA 1JGEB 4K8RC 4M3KB 2YA0A 1IFHH 1LWRA 1TZHA 2J2ZA 4GLRH 3LKNA 1JN6B 1NCUA 5F1SA 3QZWA 4X0KA 3RVVC 4MD0A 1S5IH 1IGFL 4GG8A 3T8XA 2A9MH 5IFHL 1IZKA 1L0XA 1GZQB 3OMZA 3LOWA 5IW1B 4X7CC 4I2XB 3ZT6A 1GOFA 4ZOEA 3Q6GL 3CGTA 5F44A 4HX1B 4G6MH 4GG6E 3SBWC 1HXYA 5I74C 3WKML 3U4BH 5ESAA 5KG9A 3F12A 4ZFOA 5C0AD 4HWBA 3OKEB 1G7MA 3D3VD 4L5FL 3BH8B 12E8H 4ZPVB 1MCFA 4XC1L 2IPUK 2VLKA 5FUZL 4LMQI 4JPIA 4FTVB 4NRYA 1FE8L 1QBAA 1A6TB 4NKMB 4XPAL 4OI9A 4IIQA 4UIMB 3ISWA 3L3KB 3HLAA 5L0QB 4NWUH 1C1EL 3G6JE 1WITA 2R8SH 1IGMH 1YEJL 4OLUH 1S8DA 4HC1L 1QSEE 3U0PA 3S37X 2FIRT 1CDJA 1TQBB 3C2AH 3S88H 3PGCA 4LLWB 1YY8A 3ARDA 3EUUA 3OKOA 4RA0C 2A38A 4LNRA 2DLFL 5EORL 5GGSY 3ZLQC 2Z31D 4MZ2A 4M6ML 1YEGH 3LB6C 4WWKC 4LLUA 1A6UH 1V7NL 1R5VA 1T1ZA 1ZWIA 3HE6C 5KZCB 3A6CH 4C4KO 3U1SL 3VFUB 1QEWA 4R26H 2P8PB 1YMHB 4APQB 5SWSE 1FGVL 3LMJL 3IFNH 3QQ9D 1LO4L 5FDYA 5DK2A 3WXWL 3FMGH 1L7TH 3MUY1 4ZFGL 1MHHA 3FO0L 4R90L 1PX4A 3NN8A 15C8L 3KYKL 2PN5A 4N5EC 3SPVA 1KIQB 1BGXL 4MMZC 4BZYA 2FECI 2Z92A 1ND0B 3BP7A 1ZTXL 3BZEA 3Q3GA 3MV01 1T0PB 2BNUB 2XTJB 3O3EB 1S78D 3BN9D 5HHOE 4YDIL 2WUBL 3PL6B 2CK2A 2CMRH 1UM5H 4EN3A 5DVOA 4PJGE 1P69B 3U0TB 4Y4KA 1GOGA 4YEEA 3MV8A 1CTOA 3UTQB 1P7QA 4IDJL 4X4YB 4E41D 5F3BB 2I9TA 2BSED 1XAUA 2CUMA 5D1XD 1DBBH 4L3AA 4P4RA 1MHEA 3W5NA 1LE5A 1HK6A 3LS5L 4ACPA 1I1AB 4YHLH 5C0FB 1DUZA 3GKWL 3QCTH 5IGXL 4JFOA 1NCCH 3ME0A 1U8LA 5CLWA 4LVHB 4PYGA 2DTSA 2HAZA 2NNAB 3HB3C 4RQQB 5C0RL 4ZMAT 1CF8L 4PLJC 4W81A 1QRNA 3RDTC 3U4AA 5M7QA 5J11C 3TF7C 4Y5VA 2OXHA 1FV1B 1MAMH 1K5NA 2NZIA 1FH5H 4UT9L 4DVRL 2VDKH 5E6IA 4HUVB 1K2DA 3GIZH 3DTXB 4M1GH 3C5JA 3CX2A 5TF1H 4FQ2H 3QEUA 1U8OB 4L4VA 4CNIA 3ARDD 2GKIA 2XPGA 3A6BL 3JV6B 5HYJB 2P24B 4V1DA 3LY6A 1BZ7A 1XR8B 2BY3A 5IF0B 4LHJB 4JDTH 3WLWC 5JO5B 4S1SH 4MA8L 4CJ1A 5HVGB 5BCAA 4CU8A 5D5MB 2EYSB 2VSCA 3DX7B 4KK5C 1RMFL 2VKWA 4HUXA 5B38G 2X4UB 4C59B 1A2YB 3MV9B 3TV3L 2OJEA 1DL7L 4PGEB 4FQXA 3MLYH 3BHBA 4IOIB 1DQML 4NGHH 3NCYP 5CEXB 2CIKA 4XT1C 5FYKL 4DEPB 3NACH 1FYHB 5HYFA 4P23A 1RIVL 5ID1B 1VGKB 2AABL 3IU4H 5AZ2H 1XZ0B 1FORL 1DQQB 2AP2A 2R2HB 3B8YA 5I1JH 3ZE1E 2XWJB 3MRMA 4XC3H 3S34L 2R56L 4LRIC 1NL0H 1QKZH 1FP5A 4LKCB 1Y0LA 4BSVA 4F37K 4PJIA 5CD5C 4EN3D 4FA8A 4Y4KD 1AGBB 1BZ9B 4JFEB 3FT2B 3CH1B 4OCYH 3UC0H 5LGKA 1P7QD 1B6UA 2GI7A 1BBDH 3QI9C 5SX4I 4L8SC 4V2CB 5K9QI 5GHWL 1TJHL 2EIEA 4N8VB 5EZLB 4ODVH 5GPRA 4Y4FA 1F11B 2AKRB 4MQ7A 5TH2B 1IGTB 3VFTB 4DVBA 1YEIL 1DP0A 3SGEH 5L7XH 5AYQA 4AG4H 3OSKA 3TO4D 1QRND 5K93A 3F7YB 1INQA 3CFEA 5J6HA 2GSGA 4H88H 1I4FB 1IEBB 1G0XA 5TJWK 4PJ5B 4PGZA 3OKNB 1J8HA 3QWQB 1GZPB 3QDHA 4CVXB 5I2IB 4YZFF 5FDWA 1I3VA 2R0WL 3I6GB 2DKUA 4L4VD 2Q76A 2X40A 5I16B 1DBJL 4RRPA 3M8OL 2HG5A 4V1DD 3AS3A 3H9HB 3I2CH 5EUOF 3CMOL 4ZS6C 4JFPA 2OTWB 2FATL 4YK4B 3ZE2F 2ARWA 4KJYA 1T22B 8FABB 1G1CA 1K4DA 4G5ZH 4ZO8A 3S35X 2J5LB 1KNOB 3KPRE 5F3HB 1Q9KB 4WTZG 2ADIA 4F8QA 1NMBH 1F4HA 3LSOB 5FO7B 4FQXD 4OCNC 4QWWC 2YA1A 3PUCA 4LAQL 2DIAA 4JAMA 2YK1L 4HG4J 4LSRL 1N0XH 5GIRB 3WL9A 2W60A 1OP3H 1MCDA 2C3GA 4X6DA 1E4JA 1FLTX 1FNGA 2R4SH 3FQRB 4PJ9A 3TEUA 4D9RD 3WNLA 3BW9B 1SBSL 2DS4A 1RIUH 5GRVK 5JLZA 1UB5A 1MHCA 3DIFB 5E8NA 1HHKA 1T89C 3WFDL 1JGLH 5I8CB 1R24B 2AQ2A 5E56A 4DKEL 5IJVB 3QB7C 1KGCE 4K3EL 5I1EL 3QIWC 3T08A 4UI2A 4NOBA 1WT5C 1FFOB 3WJJA 1AY1H 1KTLA 4H20L 4OF3A 1T21A 5B8CB 2OTUB 2CXGA 4PJ8A 1F58H 1AFVH 3NBNA 3I6LE 4ZSOE 3O8XC 4GT7A 5C6PB 4Q2ZB 2XN9A 5GSVA 5C08A 1GAFH 4Y4FD 5F9AC 3V5KB 2H8PA 1R3JB 1XT5A 5E8PB 3T0AA 1KB5H 2KQMA 3CDFA 2CDEA 2NR6D 5GGVL 2EH8L 1XGQA 1Y6NR 4PJDA 4NN6B 4S2SA 3TYFA 4NQDB 2IPTH 2Z9TA 4X9BA 2G9HA 3N0PB 2EZ0D 3RUGF 1J8HD 3GJFH 3QXWA 5ALCL 2FIKB 1FVEB 3HG1E 4XWOC 4ZO7A 1QLEL 1DN0B 4M6NH 1YEFH 1JUFB 2F53A 3ZO0A 2D03H 3HZMB 3VXPA 4W6WB 5E08L 3EOTL 5MEND 1KJ2H 2WWMD 4NN5B 3LKPB 3H9SA 4YGAB 5DXWA 4QXTB 2C3WA 2KH2B 4HT1H 5DSCA 6FABH 1KEGH 2XA3A 4HCRL 4OCSH 3VD5A 3B9DA 4TSAH 2XI9A 4NZTH 4HD9A 4EDXB 2AJSH 3MJ9A 4XMLL 3TCLB 3PDGA 3E2HB 4C55A 2CKBA 2CXKA 1AGEB 3ZL4L 1G9MC 4BK4A 3WCYA 4NO2A 1G7PA 3IDMA 3QFJD 2ARJQ 3RWJB 4XRCB 2P48B 4TSCH 2X7LB 3LDBB 3UPCA 3D9AL 4YPGB 3I9GL 3FO2B 1U3HB 1UGNA 3RGVD 4M48H 4E9LA 1FNFA 1YN7B 4XP9H 4LPXA 3TZVB 4MSWB 5H2BA 4BZ1H 4PJ9D 4LIQH 2XNAA 32C2B 1S5HB 4NNYB 5HDLA 2ZJSH 1Y6KR 3LD8B 4MA7L 1NEZG 4IMLA 3UTZB 4N90E 5IVOA 4DKFL 4W68A 5DD0L 2ERJC 4Y4HC 3F62A 5DS8B 4JZOB 4F9PC 3LKOB 4PJCE 1ZVSB 3UPRA 5CD3A 1EGJA 3LPWA 3PABB 2DLGA 1S7QA 3RIFK 4QYOB 4NCC2 1NAML 1OP3K 3V7MA 1B2WL 1EMTL 3DGCR 1I3RB 2OXGA 2VLRB 5EN2A 3C5ZB 5IFJB 2XN9D 2H6PB 5C08D 4OZGF 5E2WH 2DOCA 2W9DH 3DVGA 5HDBE 4M43L 4QRPA 4OF0A 4OGAD 2QKIA 5ITBH 5EOQH 4I2XE 3UJJH 3JTSA 3MUZ1 2BFVL 3WNNA 1CFQA 3QCUL 5FGSA 1RJLA 4MD4B 2YS4A 2HT3C 3O0RL 3P40A 4GXVL 4F2MB 1ONQA 4F7CA 2FD6L 1WLHA 2F53D 3EOBA 4NQSA 2I24N 5IT2L 1ORQB 5KVGL 2EEAA 4X8JA 4FTVE 3T1FB 3I6KB 5BV7L 5KSAB 3H9SD 1EX0A 2Z0BA 2AEPH 4LFHG 2FDBP 3IFLH 5D1ZA 5CIPA 2FL5B 3NCMA 4ENED 2J1KA 3AREA 3PWVA 5EOCJ 1N4XH 2DD8L 4XPFH 5D7IA 4UB0L 2VDPL 4MWFB 1GGIH 5T5FL 2BZDA 3HZVA 1QTYT 1IAOA 5IW3A 1ZLWH 1OAKL 4NC1E 4OZIF 3DXAE 3OG6B 2UUDH 3ABZA 4PJAB 3HNVH 3WFZA 3S97C 5ADOL 3FOMA 4X4ME 5FCUL 3L6FA 2AGJL 5KVFL 4LPWA 5DHVB 4OCRL 4PJ7B 4NM4H 4BH7B 3ULVE 3H9ZA 4OUUB 4M7JH 4DZ8A 3M07A 4LEXL 5ADPH 1Y6MR 3WEXA 3QQ3A 2EDDA 3CVHH 2D9CA 5J9PA 2OS7A 3Q1SL 1FPTH 3AFLA 4NBZB 1N8ZA 2P43B 3M17A 4LHUB 3NCCB 4O58L 3HC3L 4LARH 4LSVH 3OKDB 3ZHLA 4DUVA 1JNNH 1FIEA 1T0NA 4K7FB 3NMEA 1U95A 4OZFB 1EO8H 2VDML 3MRDA 4GRLB 4B5EA 4RWYL 5SWQA 3ALPA 1B4JH 1Q8MA 4JPVL 3SGDH 2BNQA 3SE9L 4U6HB 5D96C 4P2RB 1U8IA 3OKMA 4NKDA 1MLCB 3TBSA 1EH9A 1KACB 2JLLA 1RULH 2B8OT 4Y5XC 2ZPKL 4ODWB 3CLFL 2XTJE 4KROC 4HW6A 2HTKD 2MQ0A 1YJDH 4ZPTB 4OD2B 3WLBB 2ZUVA 3TWCH 3PXHA 35C8H 2ZUSA 1X5LA 2XY1A 4UV4H 1LO5B 2X1QA 3ES6B 4R4ND 4ZUTB 4Q0XL 4JRXE 3QWOB 4LCIH 1QQDA 2ED8A 3BKML 4ODHL 1U8QB 5JA8B 2MOVA 4NO3A 3RVUD 4HWEL 1U58A 5D7JA 3PHSA 4ORZC 2KL6A 1S7RA 3QPQD 3HRPA 4XNYH 4D9LL 3BP5B 5F7DA 3KYNA 4Z7UB 5D1ZD 1QFHA 3GSQB 3WFEL 3ARED 1CE6B 2I07B 3DURB 4NM8L 1UXWA 4WNQA 5DO2C 1B90A 1X4ZA 1LP9F 5CIPH 4YLQT 3O4OC 2IGFH 1VGEL 3T77B 5DR5L 4NRZB 4PTTB 4JDVA 1R5IB 1K6QH 4WIQA 4R2GC 2PO6B 4EKXA 5D7LE 4D2NA 2YWZA 1INEL 3TO2A 3RHWF 2H2PD 5HYJE 3QDGA 4PD4K 3S8WA 3VMPA 2DQUL 4F58L 3PV6B 2K1MA 5BV7C 4XPHL 1CLOH 5FOBA 3MCLH 5D5ME 1JMZA 1HSAA 2VDLH 3LEXA 2IC2A 4AT6A 5EU7C 3EOYG 1W72L 2X41A 2P47B 1YPZB 5ITFB 3HFMH 3THML 2F5BL 3MV9E 1FNHA 3QDJD 1A02N 3CLEL 2IQAB 2UUDK 2E9BA 2NW3B 4YBLB 5AD0B 3RI5K 5IUSA 5KVEL 1CBVL 4TUOB 4EUPG 2W9LA 4F15B 4OCXH 5C0IA 2BRRH 4RSVA 3WO4B 2HLAA 2BNQD 1HXMA 5SV3A 3RTQC 4LKXA 1OY3B 3BGMA 3V4PH 4N0CD 4PV8A 3MLWL 5BVJB 3W39B 1KCSL 3BWAA 4HPYL 1I3UA 1S7UB 4Y89A 1NSNL 1U8MB 1YYLL 1KN4H 4UIKL 1CFVL 4D8PA 4JCLA 2BSRB 4GLRI 4HK0B 1W0WB 2DWEB 1V5JA 2AXGA 3K2UL 1KSRA 4U0QB 3L3JB 2NY4D 5E95B 5INDB 5IBUB 5DJYA 1IGJB 5JXAL 1FYTB 1U93B 3GMMB 4EZMA 4MJ4A 4Y16B 43C9A 2EKSB 2O5YH 4PG2A 3MRNB 3IJHB 2RJMA 1CLYL 2VH5H 5HGBA 4KUZH 2IQ9L 2VO5A 4I3RL 2QQNL 3QCVL 2HTLD 1RI8A 5FYKE 4JQIH 1M7IA 3VFRB 1KTKE 5CAYB 4JDZB 2UYLB 4XBPA 3ZT5A 1EHLH 4W6XB 3D5OF 1R5WB 4PJ5E 2QQLL 1IZJA 1LILA 4Z7VF 2H2SC 4MS8C 4GW4B 4PP1D 5E03A 3QUMA 1QRKA 2WQ8A 3T0EB 4PBVC 4PJFA 2FHBA 4PGCA 3BYYA 4JM2A 4P3CL 4UINH 3DMMB 3QUZA 3C60C 1ZS8B 3VRJA 4BQBA 4DCQB 3C6LC 1IMHC 3QUKA 1XCTA 5I9QC 5ICXA 4Q6IC 3SE3C 4JZJC 5I18H 5F9OH 4DZBB 4K71C 4UQ2A 4AQ1B 3FAWA 3MLZL 3FQWA 4QRTB 4YAQB 2ZG3A 3QIBA 3PWLA 2XKSA 1S7WB 1L0YA 1MJUL 4MHHG 3UTPE 1I8IB 2OR9L 1RZIB 1T4KA 5I1DA 2OL3B 1MFNA 2A6JB 2QTEA 4OCMC 2A77L 2PW2A 5D71H 4I0CC 2I5YH 4XAWL 1QBMH 4ZUUA 3OJDB 4KRNA 3OGCB 4Q9CA 5LQBH 4M62L 4U3XA 4LPTA 4NBYB 3U79A 1MFBL 3UBXB 5KTEL 2G5BA 4QCIB 2UZXB 2VZTA 3CU7A 4K94H 2GAZA 4CN1A 3WE6A 5DI8B 4ZTPL 4KZEL 1G6RH 5CEZD 2NLJB 1BEYH 2UV3A 1AR1C 5ESQA 4QTHB 2QADB 3GO1L 3BSZH 4JEGB 2NY2C 1ITBB 4TQEH 2RIKA 4EUPH 5IB2A 1JPSH 3EKCA 3ECBB 1C16B 2V2WA 4K3HA 5C0JA 1KPVA 3BEVB 1FAIH 4Z0BH 3DX9A 4FP8H 1KG0B 3RGHA 2X4QA 1DEEA 4LCWB 3P77A 3KDMB 1OCWH 1E4KC 2R0LL 3SKOB 3MXWL 1WZ1L 1N26A 3BDXA 4P4KC 1UH3A 1AO7B 4PREA 2L4OA 4OF5A 4OQ1A 4MX7A 4ZG1A 2HN7A 4JQVA 3EJYD 4H0GA 4NQDE 2YRZA 4CMMA 1J1PH 2B2XL 3O6KH 4JKPH 1RY7B 4X4XB 2VXVH 3AB0C 1CD8A 1TVHA 1OTTD 5J1AB 5IBTH 1JHTA 4FQ1L 3PJSA 4ISVA 3SDDD 1GGYA 4HXBH 3MMEB 1HH9A 2AJUL 1P2CA 4ZNCD 4LSTL 4R0LB 3ARYA 5E7FA 1N7ML 4NBXB 3PP4H 3WIFB 1GOHA 4JM2D 4X6CF 5CZXD 2AV7B 3HCVA 2J4WH 2A2QT 3LV3B 4P2OD 4AIZB 1T5XA 4P2QA 3MNWB 3TPUA 2DI8A 5F9DC 5FYJE 1RHHB 5J12C 2ESVA 3E6FB 4WFFE 5IOPB 3OBAA 1O5DT 1E6OL 2H3NA 3GM8A 4U1KA 1ERNA 4OFDA 2X05A 1PSKH 3I3BA 4M93C 3QIBD 1MOEA 2C3XA 1UEMA 3WXVH 1DE4B 4MD5A 4Q7DA 4ZXBB 1PG7L 5HI3C 1WCBA 5BZDB 4MLSA 1KCRH 4EXKA 2OJZL 5DVLA 4OV5B 4NO5B 2D31B 3MRLA 1QFWL 4OJFH 1I9JL 5DRNB 3STLB 5DD5H 1P6AB 2VLLB 1IC5H 3VGDA 4QGTA 3PGFL 1C7TA 3QNXA 4M6AA 5JR1L 1IKNC 1BJ1H 1MFDL 2DQEL 5FXCH 5DJZB 4CL7A 4PRHA 4IRZH 2BSSB 3O6FB 1E4WH 1YZZA 4JY5H 5CCKH 5I1IL 1KCUH 5CJXA 1ES0B 2XQYK 3ZT7A 1S5IL 1JK8A 3B6SB 4WHTB 4BH8B 5D6CA 4KQ3H 1N3NB 4OLEA 3H7LA 5KJRL 2CDFA 5BQ7A 3CK0H 3HRZA 3KPQB 1H3PH 3MRGB 5TDNB 4G6ML 4IRJC 4PJHB 3WN5A 2VLRE 1IAIH 1NLDH 4UAOC 4JPKH 1S9YB 4PJEF 2O61A 1FL6A 2X4TB 3OB0H 4GUPA 5CP7B 3F8UB 4NJAH 4PRNA 2HT2C 4PTUA 4YNYB 3KS0J 4GAYA 2SEBA 3FCTA 3RL1B 3KPPA 1B0WA 1H5BA 3SDXE 3DPBA 3RWEA 3ZE0E 3SGEI 1IBGH 3MOBL 1A5FH 4ELKA 3P9LB 1M71B 5IVXA 4XH2B 2V7NA 4LL9A 5D93B 4Z8FH 4NWUL 3OAUH 3O9WC 3FJTA 3RPIA 1IGML 5GGTL 1IGIL 2CRMA 4JANB 4XBEL 2EO9A 3ESUF 2YD1A 1VADB 4Z77A 1Q9LB 4NOFA 2VR5A 2V6HA 3C2AL 3S88L 5KS9F 4WW2B 4LCYA 3PWUA 1PJ9A 1E28A 1MWAA 4NT6B 5CP3H 2IAMA 1LK3H 4JVUA 4I8DA 4UT7L 5E2JA 5F6HJ 1XGUA 3G9VA 4GFTB 5DJXA 1I7ZA 5B39G 2H26B 3MYJA 1J18A 2ESVD 1QFUH 3U30C 5KOMC 3OXSB 1TQCB 3DVIA 3KLAB 4L29A 4FQPA 4IJ3B 1A3RH 1YA5A 1HH6A 2VC2L 1DLFH 1K4CA 4D0CA 3HMXL 4R26L 4QHUA 2CLVB 5FGRA 1S7XA 5EU4B 4QHLA 1JPFA 3OZ9H 3TT1H 4PJ7E 4CVWA 4KDWA 1GGCH 3EOAB 2ZUQB 3FQXB 1M4KA 3QBTB 4RFOL 4YIQA 3ULUE 2Y7QB 3MJ8B 3T3MF 1YY9C 3QZWG 3R8BB 2BHUA 1L9NA 4RZCB 1MREL 1ACZA 1S7TB 4QO1A 2AXFA 3INUH 2DYPA 4MA1B 2Y07L 4JN1H 1ZHBA 4KRPB 4WV1A 2ATPB 3TVMB 4W6YB 4F7PB 4G9FB 1D6VH 4XNMA 1PD6A 1UM5L 3ZKMC 1EEQA 1OD7A 3UZQA 4U1IA 3IDNA 2X4NA 1BOGB 4K3GA 5EBLB 1P4BH 4JO1L 3G5ZB 1YECL 3BIBX 5GS0D 1WAAA 4U4BA 2HFFA 4P2RE 1BHGA 3KPLB 3DROA 1DBBL 1MIMH 3G08B 5H35B 1NUGA 4J7RA 4N9GA 3LKSB 1S9VB 2ZCLH 1Q72L 2X4SB 4HWBL 1YNTB 4MJIB 4NKQB 3QISA 3UYRH 1H0DB 2AI0H 1OSPH 2VYRE 3MJ6A 4XB7A 4N9OB 5IMMA 2DQJL 1MAML 4X7DC 3B2VL 2D9QB 3Q0HA 4K9EC 5D70L 1QACA 1RUML 1EO5A 2EDLA 3OKKB 3PGDB 1NUDA 4WI9A 1I9IH 4FQ2L 1RUKL 1ZVYA 4XCFL 5JPNB 1TZHB 2V2XA 4GG6A 5DUPL 4XMKL 2Z8WC 4Z7UE 2IAMD 4HUKB 5C9KA 3CXHK 3IDXL 1OGAB 3D2UB 4JDTL 3PG2A 4R7DB 4S1SL 2X4PB 2UY7A 1RZGB 4PGDB 5DK0A 4U6XA 1HQ4A 3PHOA 4YHIB 2ENSA 1H8OA 3H3KA 1IRAY 1BWWA 3WIHH 2VSDA 3D18B 3NABH 4M5ZL 3LS4H 4X9HA 5IHZA 4GRWF 1G7MB 4N1HB 3S3PA 4RMUA 3SE8L 2A73A 1J5OL 4KJWD 2R0KL 4ZYKB 5H94A 4HKJB 5E2VH 4J3WA 4GMTL 4GSDH 4GAGH 3AU1A 2BOBA 3HE7B 1QSEA 5FUCE 5GRJL 4GBXA 3WMSA 3NACL 4WI8A 3ZSSA 1MHPH 1Z0MA 5BMFL 2DYPD 2DQDL 1YPZE 1AGDA 4R96A 1SMOA 3CFCH 2P45B 3BKYL 4XC3L 3I02B 1S8DB 5ELIA 1QKZL 2WWKT 2Z31C 4AYFA 3GSUA 2WBWB 2X4OA 2YPKA 1YY8B 3L5WB 1I8LC 4TUJB 3GBLA 3QRGL 1BBDL 5EIVA 1GPOH 3KPMB 5DEGA 4GW1A 3QQ9C 3NZHH 5CSZA 3P3YA 5KAQG 1IEAA 1UA6L 2Y5TB 1QEWB 1QR1A 4RGOH 5DQ9A 4AG4L 1T3FA 4HKBA 1WUNT 5FM5O 1I1CA 5CZKA 4XMPH 5EO1A 5EU6B 1LO2L 4HZLA 5JDSB 1U3YA 1VFAA 1OGTB 1MRCH 1MJ7H 2NPLX 3QA3A 5IBLD 4HH9B 3PWJA 5ANMA 1DBMH 1EAPB 1S78C 5I75C 3BN9C 1FYTE 2EYRB 3ILQD 3QNYA 3L7FA 5AWNL 3Q6FB 3MRHB 4PJGA 3BP7B 4G8GE 4Z7OF 5F7EH 5F6HI 2UVEA 4FABH 2GSIA 3FO9B 3BIAX 2NY7H 4TVSa 4AJ0A 3D0LB 3KYMB 2IMMA 4HIJA 4IDLA 3HMWL 1EHNA 5A2LH 5D1XC 1H15B 1CFNA 4G7YL 2NMSA 4P46A 3TBTB 4LEOA 4QOKB 3T0BA 2NY6D 5LGHL 3KPSB 4NN7C 4K7PL 3CXDH 3CDYA 1AQKH 1F02I 3T0EE 3RZCA 3IKCB 3P0GB 1EJ6A 1DQJB 4IIQC 3EZJB 3NFPB 1Q9OB 5TDPA 3U48A 3FN3A 4JFOB 4MLIA 4N0FA 4XPGL 2OQJA 3L9RB 4OLVH 1QSED 2D7NA 4GBXD 5SX5H 1N0XL 3X12A 4P3DA 3GGWB 2ZOKA 1HHIA 1JGDB 1VACB 1PG7X 2YRPA 4OAWB 5IFAL 1AGFA 1CL7I 1N6VA 3JSSA 1FFNB 3ARDC 4F3FA 4NQUA 3CFIC 3MPCA 3RUGB 4BZ2L 3FN9A 3TN0A 1RVFH 4HDIB 3TJHD 3QEUB 2X70A 1AY1L 3QIUB 3W0WB 2DQFA 4YQXH 2Y36H 2BC4A 3KGRA 3O3BB 4OIIH 2MSPA 2EIBA 4I48A 4M5YH 3SGDI 3G5YB 4K3DH 2OR7A 4P9HH 3QG6A 4ZFZB 4EI6B 1FLRL 2C9AA 4M1DL 1CFSA 4OGYH 1U3JA 3BQUD 1S9WA 4Y2DB 3K7UA 3BO8A 5HHQA 2GK0A 5A3ID 2O5XH 1VEOA 2YPLB 2Z8VC 3MRPA 2PTTA 1L9MA 3QUXB 2L7UA 4Y19A 1PKQB 2MQCA 5HHOD 5C0CE 4LQFH 4RRPG 3H0TA 4MDJB 1KENH 4KQ4L 1LO3L 3SCMB 1AGCA 4YDLC 5B38B 2HH0L 4IHOA 1JI1A 1TMCB 1JYVA 5I1GH 4M6NL 4EN3C 3JVGA 4QHKJ 3AS2A 4Y4KC 3EHBD 4XVSH 1GXEA 5CJ8A 4G8FA 1M7DA 5KW9H 1BVZA 3VRIA 5E1HB 4HT1L 4KTDH 4RMTA 3RKDD 3T2QA 4M8QB 3VXQA 1U8JA 2NTFA 3OXRA 4HWUA 4TSAL 3SDCB 4NZTL 4P46D 2RGSA 5A16B 5TPWL 1CFTA 1W0VB 3GMQA 3VXNA 5I19L 2ITDB 3ZKQD 5GISH 5EWIH 3RZCD 4IRSA 4OQTH 3EYOB 1KB5B 5GS1B 1T1YA 4NNXA 1AXTL 4EOWH 2BCKB 3TO4C 4MA3A 5J13C 5FYJU 4Y5VC 3HI5H 4QY8A 1YC8A 2HT4D 3EDJA 4K55A 1Q1JH 4R3SB 1ZT7B 3RU8H 4YR6B 5E6IC 5K9JH 3PQYE 3W5MA 3GJFB 5C71A 4J3TA 3D39B 5E6ZA 4LIQL 1HHHA 4X8XA 1IC7H 2PYEB 3VXME 2X1PA 2OR8A 4YGVB 5I17B 4TRPH 1JYXA 2AJYH 2EDYA 3K80A 1AHWB 2RFXB 2BXYA 3TN0D 4ELMB 2Y5EA 1KJ2B 3DO7A 2N1KA 1T20A 2DBLH 2C3VB 5EIIB 1UXSB 4MNGB 2WM0A 5I8KL 3U2SB 1IGYB 1FNAA 3VWKB 3BZ4A 3KPRA 3U0WH 1KFAL 5SX5K 4JO2H 4G6AD 5EB9A 3JTTA 1NANH 2IBBA 3BZFB 1OAUL 2D0FA 1FL5A 4FQXC 4HIIA 2FJHB 3X3GL 1K4DB 4HQQL 5E99H 4RMSA 4ZAKB 3IFOA 2ZSVA 1HSBA 2ERJB 3P11H 3VFVA 1ADQA 1NCAH 2FR4A 3BJLA 1BJ1J 5EFIB 4U33A 3ZKSD 5FV2A 4N0RA 4P23C 4FXGB 4KI5C 2RHEA 4HK3N 5D1QA 4PLNC 1BAFH 4OZHA 2W38A 4HIHB 4Y19D 1LVEA 1P4LA 3L5XL 2DMCA 4XP1H 3T3PE 5JHDA 2CK0L 2AJVH 3QXDB 4PJHE 1KJMA 2HJFA 2D3VA 3H42H 1YC7A 4X80H 2ICCA 3GRWH 3TPKA 3EYSL 5E8NB 2R0ZL 4LLDB 3L95B 3IFLL 4ZSOA 1FBIL 3HZYB 4GKZA 1DDHA 1SJVA 2R1YA 1MLBB 4S0SD 1JWUA 1BVKA 5ENWA 4Y4FC 5MEPA 2FBJL 1GGIL 2BK8A 4PRBA 3ARTA 3TNNA 4Y8DC 3QULA 4IRSD 2E7MA 2PW1B 5DFTA 3GBML 1BIIA 2NR6C 4OIBA 1I7UA 3MJ9L 1QLRA 3UTOA 3OGOE 4DGIL 3HNVL 2VXQL 2CKBL 1IGCL 3SE4A 3DX6B 2EZ0C 4LLAA 1RZJC 3ARRA 4EIGB 2AAVA 3VDBA 5DD6B 3HG1A 1MIEH 5IB3B 2A6KB 2EKJA 2JE8A 3W82A 4M7JL 3EFFA 4XPBH 1B9ZA 1DQTA 3MODL 2JCCB 3TT3L 2J6EH 4BQ8A 3QXUA 2JELH 2WWMC 4MB3A 3MLSH 4LLVB 5BXFB 1HIMH 5SV4A 5FA3B 5FEBA 4Y1AB 1JPGB 3CVIL 5IK3A 4G43A 4O2CA 3KPRD 4PJIF 4F7EA 2IANA 1WFTA 1QYGL 4PGJA 3CSPA 2FX7L 1KULA 1MI5B 2IADA 1EGJL 1T0MB 1FO0B 5GRUL 5CMAB 1YEEH 3L7EA 3EFDL 1N59B 2Y4SA 4G9FE 3NH7H 3NZ8A 3RGVC 4BKLA 4PJ9C 4E0RB 3MNVA 3FQUB 1MQKH 4XCNA 1X5KA 1G9NH 2GT9B 3H7BA 1ADQH 1IQDB 2CH8A 4UV4L 3D85B 4E42B 5C2BL 2YD9A 2Q6WA 1MCBA 3B9KD 4ZO9A 3CVHB 1KGCD 2F74A 3OX8A 4QHKI 1AC6A 5K59F 2XNAB 3OR6B 2DIJA 4JRYB 2DI9A 2OLDA 2YRLA 4UU9A 4LSSL 1NUFA 1P1ZB 4YO0A 4HV8A 3V52H 3VFPA 4LLMA 3WJJC 3WO3B 5IMLA 2F8XC 4XNYL 4IMLB 4GOSA 1N5AA 1PZ5B 3I6LD 4MJIE 4RMWA 4LLQA 4PJ8C 3VI4F 5C09E 4JG1H 4DWHA 4YHYC 1GIGL 1OAYH 4HIXH 4HAFA 5EO0B 1F90H 2W0FB 2W92A 1Y18B 2X09A 2Z4QB 3NCBB 1CGTA 1JHLH 4I3SH 4U7MA 1GZQA 5BO1H 3BP4B 5IW1A 4OGAC 4I2XA 2VAAA 5EN2B 5IROC 3UROR 4LNVA 5LCVL 4HX1A 2VUOA 2F19H 3JWOL 4KC3B 1J1OL 4QRPB 3HG1D 2B39A 3VFNB 1OGAE 2W59A 3OKEA 3GMPB 3BH8A 3MCLL 4ZPVA 5C0EB 1KELL 2YUZA 3VDCA 2VDLL 4X6DF 5I71B 1A6WH 5E4EB 4FTVA 4MJ5B 3NGBB 4C56B 5KSVA 4PB0H 2OZ4H 2QQQA 4FQLH 1A6TA 4NKMA 3ZTNH 4ZO6A 5E2TL 5AG9A 1UG9A 2CIIB 2AQ3A 4D0DB 2VJXA 4NQSB 3L3KA 3VI3E 4DGYH 1S3KH 1XGTB 1JF5A 3GMNB 2VQUA 2VLKE 3W2DH 5E2UH 4X8JB 5C3TA 4XX1G 2BRRL 3ZHKA 5F1IB 2R2EB 3SQOL 5CIPB 2V5RA 5DD3H 1SJEB 1PEWA 3V4PL 4HSQA 4OUOA 4HS3B 4BQCA 3UDWA 4X4MA 4LLWA 4NIKB 2Q86B 2HFGL 1UACL 3X14B 1U8PB 3R1GL 1KN4L 5E9DB 4Z7VB 1BZQK 1OOAA 1WQVT 5A40E 5FHBL 1A7QL 5HD8D 5DZOA 2J8HA 5KSUB 3EZ8A 4S1QH 3C6SB 4N90D 1REIA 4MHHI 4PJDF 1B0RB 4IMKA 4PJXB 4J1UB 4KDTA 3SKJH 2P8PA 1YMHA 1C5BH 4APQA 3ARPA 2VNCA 2IG2H 4WWKD 4LQ1A 1QO3B 3T2NH 2Z8RA 1KIQA 2VH5L 5C0ND 1RFDH 2DAVA 1ND0A 4POZD 3OJVC 1N5YH 1WICA 3GEWB 4JQIL 3C09C 4HUWB 4RGMC 5L2KB 5EU6E 1LK2B 3FT3B 2BNUA 3O3EA 4OFPA 4CVUA 3HPLB 5JORB 4KTEH 4KKLD 3PL6A 4BQ9A 1OLLA 1A1MB 4LBEB 2FB4H 3ZDYF 3DSFH 5GZND 3BP6B 3UTQA 4M7LH 4X4YA 5F3BA 4R4NC 4U3CA 1RUQH 4BFEA 4NKIH 3S96B 4PG9B 5ILTL 1I1AA 5TE7L 5C0FA 1F3JB 2XRAL 3MBXH 3QAZC 3VD4A 3MA9L 4FTVD 3SDYH 3MV8E 3CX5K 5JOPE 3QPQC 2Q7YB 4OM0L 2NNAA 3T4YB 1EERB 4RQQA 1I8MB 2F58H 5D1ZC 3N1FC 5BJTB 5T1LB 3AREC 4LSQH 1BFTA 3MA7B 4X9IA 1FV1A 1SEQL 2R1XB 4UTAL 2D0HA 1BIHA 2CO6B 4YHKH 4HUVA 2D7OA 2NY5H 3ZYZA 3VG0H 2X6MA 3EBAA 3DTXA 3DXAD 3JWOC 1U8OA 4S1RL 1QRNE 2WP3T 3JV6A 5AG8A 5HYJA 3H9YA 2P24A 4MDIB 2H2PC 1XR8A 5IF0A 3ULVD 4K94L 4HWZA 3P4LA 1RIHH 5JO5A 2WBJD 2I9LB 2D4FA 5DEFB 4HFWB 4HMEA 5AUMA 1GH7A 4J3UA 1A7RL 5CGYC 2B20A 2EYSA 5T3ZH 4WEMB 3X3FH 3DX7A 2QR0B 5KZCD 1XGYH 2HWZH 5F96L 1RZ7L 3P0VH 1JRHI 2X4UA 3PIQB 1YQVL 3W0WE 1A2YA 4OLZH 2UWEB 4NHCH 1ZLUK 3MV9A 5CEZL 4APQD 4YDKL 4YHNB 5DHYB 3UJTL 4HJGB 5HI5C 4PGEA 5FOBB 1UCTA 4FP8L 3VXRB 3HUJF 3MBEB 5CEXA 3QPXL 1F4WL 1OCWL 5DFVD 4P5KB 4B53A 2DWDB 4P2CG 5ID1A 1AD9B 1JWSB 1VGKA 2VDRL 5F9WB 3I3DA 2MQ3A 1XZ0A 1DQQA 2R2HA 4N0CC 2YPLE 4M7ZB 4AY0A 2XTJD 3O6KL 2XWJA 4JKPL 2VXVL 1PKQE 3DUSB 5D7IF 3PL6D 4LKCA 4PJBB 2E5EA 1PVHA 4X99B 4KI5E 3SGJA 1AGBA 1G6RB 1BZ9A 4JFEA 3FT2A 3CH1A 4NQEB 4JRXD 4DKAA 2NY4C 1X4YA 5DUML 3QUML 1GJIA 1IJ9A 3RVTC 3GFUA 4N8VA 4EUPB 5EZLA 3BAEL 4AENB 1I1AD 4RBPH 3SY0B 1CE1L 5D7JC 2MHAB 4YHZL 4O02H 5J89A 1BF2A 1JYNA 1F11A 2AKRA 5E70A 5HPOA 4OLWL 3L3IB 5TH2A 3VFTA 4Z78B 5TF0A 1RK0B 3DI3B 2HRPH 5TQ0L 1OVZA 2B1HH 1T5WB 3F7YA 5FOJA 3V4UL 5LXGH 1KCRL 4J4PA 2HTLC 2YD7A 5GGRB 3FQTB 1I4FA 2QQKL 1IEBA 1I75A 4AEFA 1DN2A 1IC4H 4JFQB 3OKNA 4LVNB 1JI2A 4FHBD 1GZPA 5F1OB 3T0DA 2Z93B 4OJFL 2XTLA 4DN4L 4PJEB 4F9LA 1D5ZB 4CVXA 5I2IA 4PP1C 1IC5L 3GDBA 3I6GA 4MAYB 4NZUH 3D39E 5I16A 2PYEE 2F9BT 1TTGA 1Z9OA 5HYJD 3H9HA 5D6DA 2OTWA 3CFKB 5C07B 3QXTA 3LKQB 4EBQL 4ELME 5EDXA 8FABA 1T22A 1UEYA 2EDOA 1NMCB 3TGXA 1O0VA 4MNGE 3NA9L 5F7WC 1DANT 4AMKH 5FM8A 1QSZA 1KNOA 3NTCH 5I6XC 4YHMH 1PEZA 5F3HA 1Q9KA 4UNTA 3MV9D 4WUKH 1GVIA 2AXJA 5DJ6B 4EDWH 5KS9B 3LSOA 1T7VA 5FO7A 5DA0B 2GJJA 1AKJB 3I75A 3HNSL 1FZMB 3MYZA 4POUB 3QEHB 1IAIL 3VW3H 2J8OA 3MJGX 1HHJB 4ONFH 1D5BA 1CG9B 1SM3L 4UQ2B 4KV5F 4YXKH 1BFOB 5GIRA 4MMXC 2FLBT 3FQRA 5E8OB 1C12B 5JUEH 2BY0A 2ZKHH 1X4XA 3BW9A 3NAAH 1MPAH 4LIQE 3DRTB 3DIFA 5I8CA 1GYAA 3WIIH 1R24A 3OAUL 5IJVA 1WFUA 4PRAB 2DLEA 1TJGH 2ENYA 4X98B 1ZEAH 1ZXQA 2LAAA 4RAUB 1FFOA 3FRPA 3U83A 5I0ZA 4WJ5B 1I7RB 4KWUA 5B8CA 5HYSG 3D1MC 4ODSH 2YXFA 3SJVB 1EZVX 3VG9C 5L2JA 3NIGE 3QIWD 1A3LL 5ESQB 4Q2ZA 1QFUL 3V5KA 4F80A 1A3QA 1V7MH 1R3JA 1EUTA 5E8PA 4DUXA 5HVHB 4LOUD 2QSVA 2YSSA 1KOAA 1A3RL 1ZHLB 2MNUA 4J4PD 2DICA 5E8EB 4NQDA 1UH2A 3EJYC 3NCYS 5E1AB 1T2XA 4PJ5D 2A83B 1MFAL 3P77B 3V0VB 3KLHD 1UQSB 2FIKA 1OTTC 5I1KH 1FVEA 1GGCL 2VKXA 5EUKA 4QHMB 1IQWH 1DN0A 3M1BB 4RBPK 2YR3A 1JUFA 1CVSC 1L0QA 2B1AH 4PJDE 3V6FB 3HZMA 4X9FA 4NSKB 2WK2A 1OAXL 3INUL 4JM2C 5CZXC 3QUZC 4QXTA 2A1WH 4R4FL 1OT2A 4P2OC 4GQ9L 4Y1AE 4WGWB 4EDXA 3LQZB 1GHFH 5JDJA 1MCSA 3FOLA 4OCLC 2L0DA 1NBVH 1D6EB 3QIBC 5KVDL 1WVZA 4Z18A 3IU3B 3UTPD 3VGAB 4J3VA 4R6UA 1HWGB 3RWJA 3W9DB 4XRCA 5GGUB 2ADGB 4L3EB 4Z5RB 4H8WL 3GSVB 4XVUD 4YPGA 4OFYD 4XP5H 3NCEB 3FO2A 1U3HA 25C8L 1YN7A 2KPNA 3TZVA 1HEZB 4MSWA 5ID0B 2AEQH 1NAKH 32C2A 5IM7B 1S5HA 4NNYA 5EZIL 3IT8D 4QRRB 5CGTA 2Q8AL 3UP1A 1CGSL 2V17H 3UTZA 2FCBA 3K1DA 3R0NA 2Z35B 3CSBA 1WBYB 4JFXB 4IS6B 2EH7H 2QBWA 2NXZB 3SKNB 4ODTH 2VERN 3LQAL 3V0WH 5DS8A 3OWEA 1R3KA 4JRYE 3RFZC 1OAZH 5GJSH 3UXFA 4HIEB 3LKOA 3ZTJG 4N1EA 1ZVSA 5GGSB 3NPZB 1A14H 3PABA 4PRHB 3WFBH 2ILLA 4PJFF 4QYOA 1UENA 3PXJA 1WWWX 2ITCB 1X5FA 4Y4HD 4JM2F 1I3RA 3PP3H 1HN1A 1UZ6E 2VLRA 3C5ZA 5IFJA 3VXSB 2H6PA 4Q97A 2D2OA 4XHJD 1XR9A 1MWAL 1N6UA 4H1LG 1SMAA 1RSFA 4RNRB 5DZLA 5DLML 5K9KB 3U6RB 4GMSL 4NQDD 4JQVC 1IM9B 5EIQA 1YEDB 1ZOXA 4RDQG 4XXCA 4MD4A 2XV6B 3IXTB 4QRPE 4GAGL 4F2MA 1I85A 4FNLH 1K9TA 3A6OA 3D3VB 3CAFA 4GAYB 4NRXB 2SEBB 1KN2H 1JNLH 1DBKH 1ZHKB 1MFCL 4C56E 3T1FA 3I6KA 4U2ZA 5KSAA 3JUYA 4I4WB 4GRMB 1N6QH 3MLTB 3LEYH 4DTGH 2FLRT 2FL5A 2ICES 5FYJD 4PP2B 4DGVL 1T03L 4WFFD 1AXSB 4MWFA 4OCWH 5DJDB 3GSWA 4LCYB 2IH3B 5E5MB 1E28B 1J0YA 4PRIB 4GW5B 3GZKA 1GPOL 5DJXB 3OPZL 4PJAA 3U9PH 3MACH 4DN3H 5E24E 1ZK9A 4HKZB 1NANI 2ZNXA 1U3HD 3CCHB 3IDGB 4PJ7A 3ARVA 5DHVA 4BH7A 5KSBB 3NZHL 4QXWA 4KJPD 3TZVD 5E9DE 3WFHB 4OUUA 3ALXA 3LHPL 2EDRA 3SOBH 4XCYB 4RGOL 4LSPH 3BPOB 4OI8A 2XQBH 2XZCL 4B0MM 5B39B 3OR7B 1UWEH 4PJXE 1VERA 3QJFB 4LHUA 5CJXC 3F7VB 2UY6A 3LKRB 3ZZ1A 1DBML 1RK1B 2GJ6B 3OKDA 4LLYB 3FFCB 3VMOA 4K7FA 4OZFA 1JZ5A 5LAXB 3MR9B 2Y06H 4XI5D 1FIGH 4H8WC 4FABL 3H6JA 1QSFB 1FNSL 4U6HA 5DF0A 4P2RA 4M6OL 2VLRD 3C5ZD 1MLCA 3WN5C 4WTWA 5I1LB 2BVPB 1TIUA 4ODWA 4EQ3A 1QP1A 3BKJH 3CC5B 1OP5H 1CDBA 1HZHH 5IV2B 3P4NB 1ZLSL 2EDFA 4ZPTA 4OD2A 5H37G 4GAJL 1G7JB 3WLBA 2X42A 2AV1A 1H5BC 3LQAC 1LO5A 2PETA 3ES6A 2FEEI 3DYMA 4ZUTA 3R06B 2HKFL 1KCVL 3QWOA 4E41B 2A0LD 3V0AC 2J12B 2GCYB 1U8QA 4TULH 4YWGH 5EZOL 5D1XB 5CEYB 4EI5A 1JF1B 2PXYB 2VMFA 2VWEC 3BVNB 1U2CA 1KB9K 4G3YL 4MNHB 5GGVY 5KSAD 4H1LH 3BP5A 4Z7UA 2OK0L 1LNUB 4PBWD 2PR4L 1RU9L 3GSQA 2IAMC 2IWGA 3UO1H 1LHZA 1CE6A 2I07A 3DURA 1WC7B 1ZKAA 4U6YB 1ACYL 4HFUH 5HHMB 1RURH 4ZOCA 1ZA3B 1KIUA 4OM1L 4C83B 3T77A 4YQXL 4ESKA 4NRZA 4PTTA 2QHRH 1R5IA 2VOTA 3V4VH 4K07A 5DO2D 1CXHA 3OAZH 2YKLL 1CD9B 1GSMA 4K3DL 3TM6A 5DC9B 1UM4H 4KJWC 1MCWM 1HQ4B 1BFVH 1Q0YH 3PV6A 4P59H 3ULUD 2E6JA 5LBSH 5DMGD 4I13B 3OF6D 1PY4A 4HXAH 1YPZA 3QDGE 5ITFA 2ZZUT 1LDSA 2UWEE 5IVZB 4WI4A 4WV1C 1QNZL 3BGFC 3QH3B 2IQAA 3TFKD 5IVXF 3T4AB 5F7MC 2IBZY 1FC2D 2EDBA 3UCRA 1NH6A 4GRLD 3VXRE 2BDNL 4TUOA 3G5VB 1MNUL 5DJAB 1LO0L 4XVSL 2C1OB 4HJJH 1JE6A 1MFEH 2NX5B 4P2RD 2BVQB 3K4ZA 1PZUB 4RAVB 5J3HD 3IVKB 1CCZA 5BVJA 3W39A 1S7UA 4Z7WB 1U8MA 3QUYB 5IQ9B 1NBZB 2VDNH 2BSRA 4HK0A 3E3QC 4IOFC 1W0WA 2DWEA 3K74B 3L3JA 3DARA 4U1GC 1P5UA 4NQEE 1J0IA 4KKCD 3H3PH 4KU1A 5INDA 3DWTA 1IGJA 4ZUSB 1Q1JL 2KUTA 1FYTA 1U93A 5K9JL 3BIKB 5HI4D 1SHMA 2RAMA 3ILQC 4Y16A 5AEAA 4RIRB 1IC7L 2EKSA 1CDGA 1OP5K 3MRNA 3IJHA 5EA0H 4A6YH 1QBLH 1G7HB 5H37H 1NGXA 3VFRA 3VFOB 4JDZA 2UYLA 2BOCB 4YC2B 1QZ1A 1R5WA 1B3JA 4GW4A 4NFDA 1CICB 4M9OA 2NY6C 2XZAH 3MRBB 4S11A 5EU5B 2PO6D 2EC9T 3T0EA 3GNMH 3GBNL 1NKOA 3OB8A 1CU4L 1WAAF 2XWBB 1OM3H 1R6VA 2DRUA 5CINH 2NYYD 4HGKC 5I30L 3DMMA 3KJ4C 4JHAH 4UT6L 1NUNB 5C07E 4DCQA 1NCAL 1I9RH 4GBXC 3B4NA 2OP4H 1R0AH 4HZAA 1AIFB 1TETL 2QLVB 4YAQA 3KJ6L 4QRTA 1JFQH 4EVNB 3EGSB 1X5YA 3O2WL 1S7WA 1YYML 5JQ6L 1I3GL 2AJVL 2VR4A 3NPSB 1I8IA 1RZIA 4WY7H 2OL3A 3OAZK 2A6JA 3TJHC 2W65B 1IT9H 3BPNC 4JLRB 5ALBH 4FFYH 2FWOB 1DJSA 5T3XH 2DMKA 4R8WL 5DDHB 3OJDA 3HAEG 3STBA 3OGCA 3WNPA 3RY5A 4GG6F 1C08B 1MH5B 4KVCH 3Q5TA 1NFDB 5AYUH 4UILH 4JHWH 2DQGL 3DYOA 4J3SA 1EXUB 1NCTA 5DI8A 3TYGH 3GMRB 4MCYB 4QTHA 1DQLL 4MXWL 3QSKB 1NCBH 4AH2B 5A3IC 5ACZB 4M03A 3SJVE 1RHFA 3ECBA 2V5SA 1C16A 2R29H 1UCBL 3WS3B 3P73B 1J12A 1AR1D 1FYTD 2O5ZH 3BEVA 4AL8L 1SYSB 2D7TH 4Y16D 4NKOB 1KG0A 1AJ7L 4KZDL 4XPBL 4LCWA 1WWCA 3KDMA 3SKOA 2X9XA 3KPOB 2J6EL 1QHOA 3EHBC 2J8UB 2EDTA 3BPLC 1AO7A 1P84J 1AGCB 1N64L 3MLSL 1JNJA 1ZGLB 4FFVD 3RKDC 1WTGT 4GXUN 4X4XA 3K4AA 5AZEL 4P46C 1GC1C 2C1PB 3B5HA 1YQ2A 5DQJB 5HJ3B 1FNLA 3MMEA 3T0ED 4FXKB 4HLJA 2VR9A 3ZMRA 3RZCC 4FZ8H 3ARFB 1U8JB 1RJYB 5IHUL 5L9DL 3WIFA 5MENB 2GY7B 2BJMH 4AEHL 2AV7A 1G0DA 2UZYB 3IDUA 1P7KB 2HT4C 4AIZA 3WHE1 3MNWA 4JN2B 1A6AB 5BW7A 1UFUA 1RHHA 4XPTH 3HI1B 3JWNC 5IOPA 2AEIT 4N5UA 2OYPA 1G9NL 1ADQL 3O2VH 4K2UL 4MCZB 4XZUB 3RBGA 1DE4A 1X5JA 2EDKA 1YNKH 4Z6AT 4ZXBA 5BZDA 4P2QE 2JF1A 3QFJB 2MCG1 3TN0C 4KMLB 4KMQA 3GSNA 1CZ8H 4L3EE 4OV5A 4YE4H 4NO5A 3C5SB 5E5RB 5DRNA 3KXFB 1HINL 3STLA 4PJGF 2VLLA 3NFNB 3O2DA 3IF1A 4YXHH 5C8JB 2APBA 5F21B 4G6AC 5DJCB 3S9DB 1OAYL 5DJZA 4QRRE 1FZJB 3D87B 3S5LG 2BSSA 3O6FA 1KPUB 3BISA 1ES0A 1NPUA 2YMXH 4JHBA 3VXTB 3B6SA 4WHTA 2QADD 2WQRA 4NJ9H 2NY3B 2WAHA 1N3NA 1NC4B 3GSXB 1OAQH 3LN9A 3KPQA 4PRHE 3MRGA 5TDNA 2WUCH 2ZSVB 2EIDA 3HAEH 4PJHA 5C1MB 3UYPA 4NWTH 1VENA 3RNQB 1A0QH 3VXSE 5F6IB 4OBSA 2H1PL 1S9YA 4LCWD 1W0YT 2DQTH 3JVGC 2Y6SD 2X4TA 4NYLB 2JJTC 5CP7A 4K3JH 4PB0L 2OZ4L 4YPJA 5JIPA 4YEFA 4YNYA 5HHNB 3RL1A 4JFYB 3AVEA 3SBWA 1AI1H 1KB9J 1I1FB 3JV4B 5HDOA 3P9LA 1S3KL 1M71A 1UM6H 2I25N 4XH2A 4DQOH 1OL0A 4B7LA 5E2UL 2VLJB 4LF3B 5JW3L 3TA3B 4PLOB 1A64A 4R97C 2BRQA 4JANA 4IRSC 4LRNL 5DRWB 1VADA 1T6VN 1Q9LA 3GI8H 5BS0B 3RIAK 1CGXA 1KLGB 3UJIL 1TNNA 4WW2A 2Q7NA 1NEUA 3G04B 3TBVB 4N0YH 4NT6A 4M9PA 2W91A 1JGUH 4OGXH 2H26A 3U7YL 1JV5B 3VXMD 4XTRD 4QXUH 1CDIA 1QLRB 3MGOB 3IKKA 3KLAA 4HS8H 4TUKL 1EVTC 4LCCB 2E6QA 4ZXBD 4PRIE 3ZE1F 4LSUH 2JK5B 3FAXA 2CLVA 4NUJA 5D2LB 4UDTB 5D72L 5EU4A 3PDOB 3IJSB 5ISZB 2DQCL 1QVOB 1WK0A 5KSBE 1S9XB 2E8ZA 1XIWB 1CTNA 2Y7QA 3GSNH 3MJ8A 1RFDL 4UBDD 4RZCA 4S10A 1M05B 2N7AA 1S7TA 1CDUA 1G9EA 3O6FD 3E8UL 4FRWA 3MREB 2IANB 5I1HH 2ATPA 1FAKT 1J1XL 3TVMA 4F7PA 4G9FA 2GTWA 1EEYB 3EO9L 4ONOA 2GJ6E 5EC2B 3FFCE 3S35L 3VU2A 3MRKB 3FTGB 2FB4L 4MAUL 3EO1B 1BOGA 5EBLA 2BVTA 2X10A 3SKUD 4JKWA 1MCLA 3G5ZA 1FFQA 1QSFE 2ZOLB 3I50L 3B9KC 3KPLA 5MHSE 3G08A 2XA8L 3G6DH 3FT4B 5I8EB 1HKLH 5H35A 5MEOB 4ZD3H 4GAFB 1CN4A 3VGGA 3LKSA 1ZSDB 3MNVB 1S9VA 5J7CC 4K8RH 2CJUL 2X4SA 4HG4K 1YNTA 4MJIA 4TNVK 5H8DA 1JZ8A 1C8PA 5I66A 1KTDB 1MELA 3ARGB 2WZPD 1H0DA 5F70A 1OPGL 1SJHB 4B7IA 1KBGH 4N68A 4X4ZA 4KY1H 3RWDB 4UTBL 3N9GH 1MRFH 3HUJB 4KK9C 4XP6H 1N5AB 1UWGH 3VG0L 3OKKA 3PGDA 4OLXH 5E94B 3D48R 4PIRF 4N8CL 4F8TA 4JGJA 5JPNA 5IQ7H 1JHKL 2ZUWA 3LZFL 4D9QE 4GKNB 1VFOA 3RDTA 1NGYB 1H8SA 1OGAA 3D2UA 3ZHDA 4OZ4B 2VISB 4R7DA 3DV4B 5BRZB 2X4PA 1A21A 1RZGA 1DSFH 2VAAB 1CGVA 4PGDA 5C0GB 1G0YR 4DW2L 1JNHB 3NFSH 4YHIA 1EJOH 5HHME 3IDYB 3P30L 4P5TB 3ULVL 2NCMA 3MOAL 1INDH 5B22A 4OLZL 3D18A 4NHCL 4OZHF 3MLUH 3WUWG 3Q2CA 2VXSH 5EOCH 1DQDH 4ZYKA 2V2TB 4HKJA 3LRHA 1D5MB 2ZCHH 4QHNB 5KSVB 1M1SA 3HE7A 5HPMB 5FGCE 1UH4A 1NCWH 3G9AB 4JB9L 3D69B 3MX0A 4XNZC 2Y9RT 4PR5B 3VD7A 4KRPD 3L5JA 1Q9WB 2YEZB 3I02A 3TVMD 3VH8G 1T7YA 3QDJB 2IF7A 2EXYD 1A1NB 4G9FD 1HKFA 1GCFA 1RQ5A 4U6VL 2EEBA 2LVCA 5HD8C 3VRLE 3L5WA 4TUJA 4Z95H 4ONGH 5C6WH 2NX5E 2P8LB 4MNQB 4AIXA 4G6KH 1E4XL 1CR9L 4OT1H 3KPMA 4FG6D 2OM5A 5FV1L 2W9EL 4WUUB 4G8EB 4O02L 2V9RA 3T0XA 1UJ3B 4WDIB 4MJID 1XF3B 2Y5TA 3GHEH 1HDMB 5C09D 1NGQL 2FJGB 5DGRA 2B1HL 5CUSH 5C0NC 4WI2A 2IFGA 2KZWA 3ZDXE 4POZC 5JMRA 1NGPL 5EU6A 5JDSA 4MB4A 3STZB 4ERSH 3QHZH 1OGTA 3WSQL 1IC4L 3BD4A 3IYLW 3H2WA 4HH9A 1EAPA 4BQ6A 5J57B 5GZOD 2DBJA 2EYRA 4G7VH 4KKLC 1PLGL 3Q6FA 4NZUL 5GS2H 3MRHA 1UC6A 1P4IL 3LRSB 5GZNC 3FO9A 2CGRH 5J1TC 4NUGH 5CJQH 5HYEA 3FN0L 2CQVA 3D0LA 1OGAD 3D2UD 3KYMA 5ANME 4BA8A 2XG5A 2F5AH 3IB4A 2OTPA 3SEPA 4JCMA 3FQNB 1H15A 3TBTA 4QOKA 1IGFH 3OTTA 5IFHH 2NZ9D 3KPSA 2G2RA 4YHML 5SWZB 1U8KB 1TVBB 5DD1L 3IKCA 1HHGB 1DQJA 3Q6GH 1KCLA 5EPMB 1KTRL 5IKCB 3NFPA 1Q9OA 2BERA 2VLKD 3V2AR 3WKMH 2QSCL 3VW3L 1T1WB 3DRQB 5L0QC 3L9RA 4BJLA 4YXKL 3HE7D 4F7TB 4L9LB 4H5SB 4K23L 4PJCF 3GGWA 1C7SA 4QKXB 4XC1H 3SHSA 1J0ZA 5ETUA 4NC1C 1KIRB 4X6FB 3MJ7A 1JGDA 5FUZH 1VACA 2FYYB 1TQBC 4LDLB 3CMGA 4OAWA 3UDWC 3V79C 2JIXB 3AAZB 1FFNA 3S4SG 4ALAL 3IDIB 5KVMC 4XPAH 2ADJB 4XVJL 2DKMA 3ULVC 3RUGA 1BLNA 4HDIA 5HDBF 2WBJC 1JGVL 1ZV5A 3N85H 1C1EH 1ZA6A 4B41A 3VFMB 4NZJA 1YEJH 3QNZA 2GJZB 4HC1H 4XCEB 3QIUA 3W0WA 4YUEH 1PAMA 1IAMA 4IMKC 4HUNB 4HWZB 3O3BA 4KDTC 1LEIB 4APQC 5AUMB 1NFDE 3G5YA 3DVNB 1SVZA 4ZFZA 4EI6A 2DLFH 5EORH 4KHTL 5F88B 4M6MH 5DFVC 4Y2DA 1X5AA 1V7NH 4NQTA 3AS1A 3TLRA 4I18B 5JIKA 5EU6D 2YPLA 1T1XB 5I8OL 3QUXA 1PKQA 2XTJC 2A6DB 4MXQD 5FYLL 1FGVH 4KH2A 4MDJA 3SCMA 5I1KL 4CU6A 5B38A 3PL6C 2B0SL 2FGWL 4FN0A 1LO4H 3WXWH 5A43C 4ZFGH 3FO0H 4R90H 3N1MC 4OLYL 1BGXH 1KV3A 2J8UE 3NA4A 4JKLA 4Y19E 4ZNEE 4WI5A 3HR6A 1ZTXH 4Y5YB 4LPCA 43CAB 3T2OA 5J1SC 1R3IL 1BQLH 4M8QA 1MCEA 3SDCA 3ULVF 4OFKA 1I1AC 1VKXB 4QOKD 4QRQB 3MV8D 4HHAB 5A16A 5DMKB 4YDIH 5JOPD 1W0VA 2DLIA 2WUBH 4FFZH 3OG4B 2ITDA 3SDDB 4LVHC 5C7XH 3GMOB 2XKNB 3WD5H 3EYOA 1KB5A 5GS1A 5TGBB 2BCKA 3RWHB 3DBXB 4TPRL 4CUCA 3MLPA 1B88A 4R3SA 1ZT7A 3LS5H 4P2OB 4YR6A 2ZUTA 4HBCL 3GJFA 2AEQL 3D39A 1NAKL 2PYEA 3ARUA 1AE6L 1I1RA 4JFZL 4YGVA 5I17A 3FO1B 3N50A 5HGAB 5C0RH 1FDLL 2ICEB 5E6ID 1BPVA 1AHWA 2RFXA 3FRPG 5CFHA 4ELMA 1KJ2A 2E6PA 2C3VA 3RWGB 3QDMB 5EIIA 1UXSA 4MNGA 3VFGL 3U2SA 5HVFB 1IGYA 4UT9H 4KK6D 4DVRH 3VWKA 3QIUD 3W0WD 3KXFE 3G5XB 1FRGH 2ZUXA 3AMLA 2IPKB 3QR2A 3DHJA 3RKPA 1FSKC 3MXVL 2V9TA 4KRMB 3BZFA 2A9NL 1ZE3C 2FJHA 4U1HB 1RUAL 1VA9A 4ZAKA 4ZUWB 1XEDA 2JB6B 3CUPB 3K3QA 4Y2DD 5EFIA 3ARBB 4DEPC 4XWGH 1ZT1B 5F71A 4FXGA 1ZANL 4QT5B 1RMFH 3HPJB 3I75B 2YPLD 2DLHA 5KN5B 4HIHA 4RMVA 3QUXD 4LVOB 3TV3H 2GIYA 1D5BB 4I0PB 5DUBB 1BX2B 1DL7H 2FECL 1J88A 3SCMD 3QXDA 3EYFB 4TSBH 4P23D 1DQMH 4KI5D 1WIOA 4KFZC 4WTZA 1IKFL 3SGJC 4OZHE 5FYKH 4HGWB 1JNLL 2VE6B 4LLDA 4O5LL 4WI6A 1RIVH 3L95A 5JHDE 2AABH 1ITCA 1MJ8L 3LEYL 5KOVC 3SDCD 3ILPB 3HZYA 3MRIB 3S34H 2R56H 1MLBA 3BRFA 1G1YA 5FO8B 3ZSTA 5D5MF 2VLJE 2X5PA 1T2QL 2M1KA 5JXEA 2XKUA 4LOUC 3VXUB 2PW1A 5L2JB 5FYJL 2JB5H 1F45A 2FZ3B 1R3HB 5E00A 1U41A 5BS0E 1V05A 4OTXL 4C58B 4J4PC 5DYOB 2VN4A 4DN3L 4M8VA 3DX6A 2PCPB 3VFWB 4JREB 5DD6A 2D7MA 2YSSB 3KLHC 1M7XA 5IB3A 3LIZH 1IE5A 4F9LC 2A6KA 3D39D 4OD1L 3TJEL 5HYSB 2PYED 4R9HA 3UTSB 3HC4H 2JCCA 4K7PY 3HC0B 1WIUA 1YEIH 1MAKA 5D6DC 2DL9A 1W8OA 2LFGA 1QLFB 4KMTH 4KPHL 4L1HA 4LLVA 4YK4C 5BXFA 3I3EA 5FA3A 5EUKB 4Y1AA 1JPGA 1G9MH 3F65A 3VWKD 4UZGA 5ISZE 4FQQB 2J5LC 3O41B 4FQCL 2EDQA 2R0WH 2Y06L 1JBJA 1FIGL 4BSWB 2CLRB 2E27L 4P49A 1DBJH 1MI5A 3M8OH 1IL1B 3SO3C 1WBZB 2LABA 2Y25A 3CMOH 4KVNL 1T0MA 2FJFB 1FO0A 4FQIL 4GS7B 5CMAA 3FOLB 2IANE 4XVUC 2XZQH 4I77L 3QDAA 1HZHL 1N59A 1C5CL 5TFSL 3Q48A 3EYUH 3GIVB 1CXIA 4E0RA 3FQUA 1D3CA 2GT9A 4JM4H 5IEKB 1IQDA 4YBQD 4E42A 1OQOA 3D85A 3JWDL 2FO1A 2BX5A 5LVEA 2LU4A 1G7QB 2VZVA 3CVHA 4LAQH 1FNEB 4XAKE 1MCCA 3OR6A 4JRYA 5T5NG 2YK1H 1P1ZA 4LSRH 3GM0A 5CKAA 2JTDA 2NXYD 3ESVF 1TZGL 5IB4B 3X11B 1PZ5A 2EECA 4Q9QL 4JQXA 4AM0A 5CJ5A 2EE9A 3BD3A 5EO0A 4RGNB 2W0FA 2Z4QA 1R3KB 1Y18A 3WFDH 1CK0H 4XHJC 4DKEH 4HFUL 5JXED 4BFIB 4PJ8D 2X44D 4ZFFB 4K3EH 5I1EH 1NEZA 3BP4A 5C6TH 3MV7A 3IAPA 3RAJL 3KPNB 5DGQA 3KS0H 4H20H 5E4IA 1RZFH 3L5HA 1PW3A 1XR9B 4U0RB 3L3HB 4Q58C 1UM4L 1Q0YL 5HGDB 3VFNA 1I7TA 5FGBA 2PF6A 3GMPA 5BRZE 2CRZA 5L88H 5C0EA 4FMKA 4XVTL 5FA4B 5LBSL 3EJJX 1TZIB 3P4MB 3OAYH 3RWCB 3QQ4B 4MJ5A 4C56A 4YH6A 3SO5A 3UX9B 5GGVH 2EH8H 4NN5C 5JTWA 3ULUL 4OZFG 3ULSB 5B21A 5B3NA 5HHVL 4H1LB 2CIIA 4PFEA 1EFQA 2DLTA 4Y1AD 4D0DA 2VN7A 4Z76B 1XGTA 3GMNA 5ALCH 3E2HC 1FJ1B 3CDGB 2YHGA 4NC2B 5F1IA 1PFCA 2R2EA 5FO9B 1BM3L 3TBYB 1CD0A 4H26A 1SJEA 5E08H 3EOTH 4LCUB 4HS3A 3L1OH 1J11A 2Q86A 3KLSA 3QEGH 2CRYA 1OSZA 3X14A 1U8PA 2EDNA 3GJFK 1YNLH 3GSWB 1U3HC 3PWPB 4ODBD 4M61B 5E9DA 4Z7VA 4KJPC 5JW5B 3TZVC 5T33L 1FO0H 1UKQA 5KSUA 4P2YA 1FZKB 1X5XA 3LD8C 4NQXB 3C6SA 3D85D 5JW4N 1B0RA 5T3ZE 1QFWM 3H3PL 4PJXA 4J1UA 5EZJB 4MNQE 2VXUL 1JYWA 1IILE 1TDQA 2EEDA 3LH2L 1FGNL 3UZVB 3BDYL 4JRYD 1F4YL 1CL7H 4XX1E 3RWIB 3O6LH 3L3GB 4WUUE 1QO3A 5T1KB 2XWTB 2EO1A 4GKSB 1TPXC 4XI5C 3TCXA 4YDJB 4WW1B 1X3DA 2CD0A 4NNPH 3C5ZC 4HUWA 5L2KA 5DJ0B 4PY7B 4DKFH 1LK2A 3FT3A 2LE9A 4WO4B 3HPLA 4JFDB 1V3MA 5JORA 1U6AL 5DD0H 2BP3A 4OKVB 3JWDC 3AC0A 2XZAL 4GO6B 1A1MA 3EJZC 5F72S 4LBEA 4Z7QE 1PDKA 3UTTB 3ZDZE 3VGBA 1SEBB 3BP6A 1NAMH 4KK8D 1B2WH 1OM3L 1EMTH 7CGTA 5GRZA 2IJ0C 4XXCC 4QRPD 2EDEA 2A0LC 1OF2B 3K8KA 4JHZA 1I85C 3S96A 5GS3A 4PG9A 5DWUL 3FL7A 1F3JA 2H41A 4L3CB 2AV1B 4C56D 1A9BB 2Q7YA 1RJZB 3T4YA 3CFBB 5KSAC 5SWZE 1I8MA 3KHOA 5BJTA 2GHWB 5EULV 5T1LA 2BFVH 3BKCL 1B6DA 4A6YB 5L6YL 3MA7A 4EI5B 3BN3B 4JG0L 2R1XA 2BXZA 3G6JB 3O0RH 4GXVH 3B9AA 1J0KA 1JWMB 4POYA 3GKZA 1HI6B 3NCJH 5IT2H 3MGTB 1IAKB 4JO3L 3V5DB 1Q0XL 5BV7H 1A7OL 3OAYK 4MDIA 3C8HA 3IDJB 3HNTL 5E9DD 5C9JB 2DD8H 2I9LA 5CBEB 1JPTL 4HFWA 5DEFA 5TE4L 2VDPH 3ULUC 4LFHD 3DETD 2YPVL 3HI6L 4UV7L 5T5FH 5DMGC 4FMFA 2QR0A 1KEMH 3PIQA 2UWEA 3SDXF 3ZE0F 2APVA 5ABDE 4YHNA 3KYAA 5SWSB 5DHYA 4HJGA 3IS1X 5CGYD 5ADOH 3TFKC 3GK8L 2D7TL 5KVFH 4RFNC 2HFEB 4I5BB 5CILL 4OCRH 3VXRA 3MBEA 4GRLC 1KLFA 2W0PA 4P5KA 1ZLWK 1KJVB 3BQUB 4LEXH 3EAKA 2DWDA 5HI5D 3MLVL 4J3XA 1AD9A 1JWSA 5IR1B 4WENB 5T5NF 1EEZB 1KYOJ 3Q1SH 5J3HC 5FCSH 1FVCB 5HHOB 3DUSA 4JR9H 1RUPL 1Z5LB 5IIEB 4PJBA 4FQHB 4X99A 2C26A 2G60L 1FHGA 3T0VA 5D7SL 2VDMH 2OX5A 2EDHA 1G6RA 3QO0B 3RHWK 4NQEA 4JPVH 4UOW1 1WJ3A 2BJML 4RISH 4HULB 5C92A 4KKCC 3UZEA 5GJTL 5E8DL 4EUPA 4AENA 1UKSA 1EAJA 1UADC 4PJ7F 1D9KB 3DUUB 3C08H 1F2QA 3SY0A 1CGYA 1DR9A 3LEVL 4CMHB 2MHAA 5HI4C 3GMLB 4JFEE 3ULUF 4C4KT 3L3IA 3FB7B 2D4DA 4Z78A 3RVTD 1RK0A 3WUZA 4HLZG 5T1LD 3WHE0 1T5WA 4U1JB 2MPAL 5D7JD 4Z0XB 4Q0XH 5GGRA 1DEDA 1W2KT 2W0LA 3FQTA 1DUYB 5IB5B 2YN5A 4YE4L 4JFQA 5DT1L 4TOYL 2Z93A 3B83A 3CDCA 4PJEA 5INCB 3UBXG 4HWEH 1D5ZA 2C5DC 4MAYA 5FYLE 4JJ5B 4YXHL 2OL3L 1RZKL 5IMKA 1NGXB 2PO6C 3CIQA 4D9LH 3WFCL 3IAQA 3WFEH 3M45A 3O4LB 2NYYC 2APFA 3CFKA 5C07A 2CLZB 3LKQA 4NM8H 4O2FB 4WEBL 2R69H 5FUCC 3QDME 3QEQB 2E3VA 4L4TB 2K3TA 1SYVB 4OB5L 3EIFA 3QDGD 2IH1B 2EDWA 1VGEH 4LAJH 5DR5H 5LWYL 3MCG1 5DJ6A 2VDQL 5KS9A 2WUCL 4XCCL 4Z9KB 1AKJA 1INEH 3S36H 5I1CL 1FZMA 3VXRD 4YBLC 1A0QL 3QEHA 1RD6A 3MBED 1HHJA 2NY1B 2DQUH 3QP3A 4LMQE 3V6OE 1CG9A 2DQTL 1UWXH 1BFOA 4F15C 4XPHH 3WO4C 1WWAX 4K3JL 1YMMA 5MP6H 5E8OA 3HS0A 1C12A 1QFOA 4Z7UF 2GITB 1DVFB 5I73B 1H3GA 2IPUG 3THMH 4UDUB 3DRTA 1AI1L 1UM6L 4DQOL 3BJ91 5EOTB 3QJHB 4PRAA 2F54B 4X98A 1CBVH 5FIEA</