5F1SA

Crystal structure of the teleost fish polymeric ig receptor (pigr) ectodomain
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
206
Chain Sequence
RVTTVGDLAVLEGRSVMIPCHYGPQYASYVKYWCRGSVKDLCTSLVRSDAPRKVVMFDDPVQQVFTVTMTELQKEDSGWYWCGVEVGGVWSADVTASLHINVIQGLSVVNSMVSGEEGTSVTVQCLYSQGYRQHEKRWCRSGDWSSCLVTDGEGRYEDQAVEIRDDLTKAFTVTLKGLARRDTGWYWCAAGQQQVAVYILVTPPSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords polymeric Immunoglobulin Receptor
publication title The structure and dynamics of secretory component and its interactions with polymeric immunoglobulins.
pubmed doi rcsb
source organism Oncorhynchus mykiss
molecule tags Immune system
total genus 55
structure length 206
sequence length 214
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f1sA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f1sA02
4F3FB 3LH2H 4KMTL 2EYTB 4ZXBC 4GOSA 2BVPA 4NUGH 5I71B 1FSKC 1RUAL 5D72H 5I2IB 3V95A 1MAML 1LP9A 4P2YA 3DMMB 3VMNA 2F19L 4HKXA 4LCUB 5DQDL 3VFGH 2XZAL 5JHDA 4GAGL 1O5DT 2Q3ZA 5C0IB 1FCGA 3V7AE 3WL9B 3VFTB 2YRPA 1JTPA 1VEPA 4PP2A 4H1LB 4KMTH 5HHOD 3D69B 4TNVK 1T4KA 4XNUL 3T0EB 1OGAD 5CSBA 5EFIA 1F42A 3FO1B 3KPMB 2XACC 1RUAH 3DXAD 4YHYB 1MAMH 2A6DB 4LVNC 5D7LA 2F19H 5DQDH 2XZAH 5FGSA 5M7QA 2YD4A 4GAGH 1JF6A 5CP7A 5EUOA 3CFCL 1R5IB 5FOBB 5EU3A 3WIHA 2H32B 3QDMD 3MJ9A 4NQCD 4P46A 4JCMA 2KL6A 3HLAA 4PRPD 4XNUH 1XGUB 1A3QA 5KSUB 1A8JH 5I1AB 1DEEB 3IDMA 1CXLA 5D2NE 2JIXA 4FG6C 4IJ3B 2Z92A 3GJFK 3CFCH 4F7MB 3SJVA 4E0RA 4YUEL 4XXCA 1HHHA 2R2BA 3VU2A 4PJAB 4QHLB 3FTGA 4P99A 2IH3B 4R4FL 3HRPA 4HDIB 4I77H 4TUOB 4KZEL 1Z9MA 2RQ8A 1FYHB 3TBSA 2KBGA 2V7NA 2GI7A 4Z0BL 2GTZA 4I2XE 4WENB 3ZKMC 3I6LE 4L3CA 5HGDA 1TVHA 4L8DB 4PGBB 1HYSD 4AEEA 3KPSA 4YUEH 5I9QB 3VXRD 4C56E 4DN3L 1MY5A 2B39A 1GHFL 1U2HA 4HC1A 2B0SH 3WJJC 4R4FH 5KSVA 5BS0A 4KZEH 5DJ2B 1S78C 4XB8A 3B9KD 4Z0BH 3MBEC 5IHUL 3DYOA 4MXQC 5ACMA 5EZLA 3SKNB 3RVXD 3W5NA 1NSNH 1YMME 2V5RA 4DN3H 1GHFH 2VQ1A 3SO3B 3ALXA 4UNUA 5C3TA 1QBML 4W4OA 2Y7QB 1A7RL 5ICXA 1RZ8A 3BGFB 4Z7VF 1WICA 5IHUH 4A2LA 5A16B 5IW1A 1AI1L 4PTTB 1UYWL 2FDBP 4M48L 4G8EB 3VWJA 4N0FA 3MRMB 1JCKA 2CPCA 1C16B 1IGCL 3D18B 3FZUC 5E1AB 3EOBB 4NM8L 1RJCA 1NCAL 3OKNA 1N8ZB 4KJPD 1QBMH 1F58L 4PJXA 1A7RH 1AHWC 4A2MA 3HNTH 5DVOA 3V5DB 5C0DB 3NFNB 2NTSP 2EYRA 4OLUL 2NNAA 1UXWA 4U1MB 5C6WH 4M48H 5FEBA 2VXSL 3BHBB 2XNAB 2LTQC 1IGCH 2VDQL 4NM8H 1U8KB 1NCAH 4J3UA 3KGRA 1CGTA 4TSCL 3U0TA 1FIEA 1F58H 2EDJA 2K3TA 3UPCA 1Y0LB 4OLUH 4GAJL 1ZLUH 2ARJA 3MJ8B 2VC2L 1F2XK 4P4KD 3MLXL 3TO4A 1FL5B 1GH7A 3TESA 2VXSH 1S7WB 5DRNA 3C2SA 5FF6A 3BJLA 3FT4B 4LHQB 4WEMB 2QSCL 3BO8B 1E27B 3EDKA 2VDQH 5HI3C 5CIPB 4NQTA 1FFNB 4TSCH 5F88B 4R8WL 2JJTA 4GAJH 3P77B 4QRSA 2VC2H 3FB6A 1O7VA 3MLXH 3FHAA 5JPMB 3VFNA 2QSCH 2X4UA 1OP3H 3CSGA 4PBXA 3IDUA 1KXTB 4NPYA 4G80B 1FGVL 5CGYC 3SDDB 4WWKB 2CDGA 5IEHA 2YBRB 4N1CA 4R8WH 3QNYA 2A6IA 1LVEA 3EGSA 4LHJB 1FAKT 1EK3A 2ZOLB 4L4VB 1P7QD 4X5XA 1E0OB 4P2OC 3FOMB 3RRQA 3QQ9D 1YC7A 4M7ZC 1JBJA 4NQEA 4XAKE 1A4KA 4QRPD 1FGVH 1P9MC 2GITB 2GTWB 1KFAL 3EJZC 1E4KA 4GW5A 4JRXB 4DK3A 4EJ1C 4JFPB 4Y19A 4PLJC 3CDCA 1YNTB 4KRPC 1NGXB 1YPZA 4PUBL 5IROA 2JB6A 4ZNEE 4OCLC 3GBNL 3QG7L 1BM3L 1KJ2B 2JK5B 2YD8A 2BRRL 3ES6B 5DJCB 5EU5A 1RVFL 5DMJB 2YPKB 4A6YL 3I6KA 4RAVA 4XCCL 3HZKA 4F7EA 1BREA 4ODHL 1KFAH 3S3JA 3QUZC 4KXZH 3HUJF 3MYZA 2Q3AA 3BZFB 4HIXL 2BC4A 4PJ9B 4YZFF 5F9AC 4HS3A 5EBLA 4PUBH 2P24B 3GBNH 3QG7H 4ZDHA 1BM3H 2VB5A 3I3BA 4LRNL 2BRRH 2ADGA 3FFDA 3QISA 1RVFH 1MVUB 1I4FB 4A6YH 4XCCH 3VDCA 3FT2B 3CVHB 5E9DB 4XNYH 3S35L 4ODHH 3TO2A 1EUTA 3RZCA 5CGMA 4HIXH 3RGVB 3UBXB 4KJWD 2DF3A 1MCPL 4JM2D 5HD8C 2IH1B 2OQJA 5DMGD 2VXUL 4OI7A 4LRNH 2X4NB 4X83A 2VL5B 3KPRD 1HE7A 3S35H 1WBZA 5EO0B 3QHZL 1M7DB 3I75A 5DHVB 5EZOL 4F7TA 5LGKA 2PO6C 1MCPH 2FO4B 1A2YA 3WUWB 3AMKA 3QIUA 2C1OB 4OUOA 4PRIB 1DBAL 2VXUH 3B2UD 5GSRB 5CZXC 2PN5A 4PY7A 4Q9BA 4X6DE 1J8HD 3ARDA 4KGJA 3MX0A 3QHZH 5EZOH 1QSFA 3ARRA 2EDLA 5L2JB 3RWIB 2CUMA 4HJGB 1P7HL 4L9LB 4U1KA 1YJDL 4AIXA 2OLDA 4BQBA 4LCWD 1DBAH 3RWHB 4LVOC 2X4SA 2XG5A 3BQUD 2E6PA 3DSNA 3GSNB 1MCRA 3N1FC 5C9JA 3UTSB 1UM5L 3T1WA 5FHAL 4WU5B 3TNMB 3V6OE 1YJDH 4OZFA 2QQNL 4M7LL 4XC3H 1H8SA 3FONA 3QH3A 4GS7B 5DA0B 3HI1B 4G6ML 5JW5A 4MJ5A 1CK0L 4WV1B 3DUSA 4M1DH 3GMQA 1KF9B 4L3EB 1JGEA 1UM5H 5BVPL 2CRIA 5FHAH 1DQLL 3NABL 4J4PD 4LDOB 2QQNH 4M7LH 4WI2A 4PJ8B 5FYJD 1CK0H 3H9ZA 3GSOB 2DB8A 4DCQA 5C7XL 1J1OL 3ARSA 1A6AB 3EDJA 5L9DL 4WFHD 2VABB 3H9SB 5BVPH 1DQLH 3NABH 1AY1L 5GGRA 4JZJA 3JXAA 3HG1A 2C3VB 3ZYZA 5HI5C 2BNRD 4LVNB 1JNHB 2JLLA 2DLIA 3ULVF 3IGAA 4YDLC 4HFWA 4J3TA 4WFEE 5C7XH 1XGRB 3G9AB 4E42B 3DVIA 1J1OH 1R24A 2NY0D 3TZVD 1YQ2A 1GPOL 2QTEA 3MV11 1HQRA 1M7IB 4ZUSA 4WI7A 3RU8L 1AY1H 1CFVL 5E56A 1KPUA 4AQOA 2AEPL 3CUPB 2V7HB 2NXZD 4ETYA 1H9VA 2FZ3A 4F3FA 5F7FA 2EYTA 1ZGLB 2ERJB 4XC1L 1KXVC 3VRIB 3FB8B 4LSUL 2D9CA 2ADJA 1GPOH 5CSZA 1JWUB 4LLDB 5C9KA 3RU8H 1CFVH 4LAQL 2AEPH 3U4BL 1WWWX 4JEGB 4JDZA 1E4XL 1G7MA 2BXZA 4P5TA 2X44D 4XC1H 3BDBA 4X6BB 2KDGA 3NIDF 3GO1L 1EERB 4LSUH 4V1DD 3P30L 3ARGD 1S9WB 2VISB 1WCQA 1X44A 5JMOC 3DVGA 4JVUA 5IJVA 4LAQH 1E4WH 3P0VL 3U4BH 1G0XA 2WANA 1BQSA 2BVQA 4QHMB 2CIKA 3CDYA 3LB6D 4JPKL 1E4XH 4MJ6A 5E4EB 2DIAA 1RUQL 2J4WL 5KSAD 1I9IL 2Z31B 4RDQG 5C0CB 2DI8A 3GO1H 1NANH 3P30H 2A83B 1BZ9A 4HUXA 1UVQA 5D1XD 4PREB 1JZ2A 5ILTL 4IDJL 3P0VH 2AEIT 3CFEA 1R3HA 4JPKH 3T08A 1QFHA 3C6SA 1RUQH 1WTGT 2J4WH 1I9IH 1KGCD 4LPVA 3BX7C 5CJOL 3WDJA 2VLJA 2R8SL 2IGFL 4WHCA 4YBHA 4PJBB 3SCMD 2IFGA 2G75B 3MJ7B 1U8HB 5ILTH 4X8XA 1JN6B 1AHWB 2R0LL 4IDJH 4I18A 4PBVC 4MJIE 4NN6B 4JPIB 4IS6A 2BSSA 5CEZL 2Y1VA 5CJOH 2LTQB 2R8SH 5DUBB 2IGFH 3D3VA 5DJ2A 2VWEE 3H6JA 5JZ7C 2MQ0A 2DKMA 3RWEA 3LCYA 4JGUA 2R0LH 1RZJL 2C26A 4JFHD 1TCMA 4V2BA 4WHTA 5ACZB 4HAFA 1T66C 3QI9C 5CEZH 4GBXC 1UKSA 4ZMAT 3MRNA 1UEMA 3MLUL 1EPFA 1EA9C 3RIAK 4YDIL 4MJ2A 5DJ6B 3RIFF 4NOFA 2P43B 5LAXB 3DV6B 4QOKD 3PP4L 2Q7NA 2E9IA 4OLEA 4ZAKA 1ITBB 1NKOA 5LCVL 1RZJH 1Q72L 5DTFA 3T1FB 1ZHNB 3FFCD 3O6ML 5LG1A 2I07A 3M1BA 5L2KB 5E1AA 3EOBA 1XCTA 3O0RL 4U0RC 5ESVB 3CZFB 3MLUH 1OTTC 2NLJB 2VN4A 4YDIH 5IEKA 5ESQB 1S7UB 2VKXA 5C0DA 3PP4H 5DJAA 4AM0B 4X9BA 5GS2D 4WGWB 5LCVH 1Q72H 3S37H 1MHCA 3AB0B 5EUKB 3O6MH 4DUXA 3LQZA 4HWNA 2EDHA 3O0RH 5HSFA 3JTSB 1QBBA 4GUPA 4OV6F 1CGWA 3SE9L 3P4NA 4P2OB 4O58L 4NOBA 5IUSA 3N1QC 1Z2KA 1T2QL 1Y0LA 2JJWA 5H37G 2FSEB 2EE6A 2X4QB 3KXFE 4O51B 2VXTL 4PJHE 5GGSY 2VTFA 5GS1C 2ZUXA 4KRPB 1YEIL 4M93C 1FFNA 4Y5VC 3SE9H 4O58H 1AQDA 3MNWB 4QXGL 1DQML 3DRTA 3HZMA 4S0TD 1T2QH 4M61B 2IBBA 5IM7B 4U2ZA 5JHDD 3V4UL 3QUZB 2XWBB 5SWZE 1RZ7L 1YY9D 2F74A 2VXTH 2QKIA 1P4LA 3TVMB 2NYYC 1NMCB 1YEIH 5DFTA 3PL6B 3CXDH 3NIDE 1P1ZB 1JE6A 4QXGH 2EDYA 1DQMH 1DN0A 4LHUB 3UC0L 1MCNA 2VN7A 4YJZL 3AXLB 3LKNA 1S8DB 1PD6A 5D7LD 3EOAB 1BJ1J 2YD7A 5DJDB 1U58B 3U4EB 4LEXL 1HDMA 3QG6B 3V4UH 4KKAC 3NGBC 4UTAL 3ILPB 1NCTA 1RZ7H 3F12B 1FFPB 4TPRL 1AD0B 3TBVB 4P46D 3T2NL 1SJEB 3BH9A 1Z3GL 43CAA 2MHAB 3D2UB 1FL6A 3UC0H 1OTSC 5D7IA 3I6GA 3IDXL 1SJHB 2JIXD 4WW2B 1WFUA 5D70L 4NO2B 4XH2B 4JFFA 4LEXH 5HDLA 4K7PY 3LN9A 1G9EA 4UTAH 1NEZA 1H5BB 1FZJB 3IDIB 1CD1B 4TPRH 3TPUA 3SJVD 3T4YA 1DVFC 3VD4A 5DJCA 2V2XB 2YPKA 4PJCB 3VG9C 2APTA 2Q76A 3T2NH 1Z3GH 2BNQB 5EZIL 5EO1A 2DM4A 1NKRA 3IDXH 2DQJL 3AUVA 1UKQA 5D70H 5DZOA 3VA6A 1MI5A 4LGRB 3JWOL 5IK3B 5TH2B 3ZL4L 3FAXA 1SBBA 3KPSD 1XF4A 5IVXF 1HH6A 3O3AB 5ERWB 3B9DA 2R0WL 3S8WA 3PNWB 1J12A 5BS0D 2UZYB 4M7LT 5EZIH 4LVOB 4NO0B 4ENEC 3A6OA 1UGNA 2DQJH 4YDJB 3T0WA 3MV7B 4UILL 1NDMB 3JWOH 3ZL4H 1FFOB 3UPAA 2XKUA 1U8JB 5FUCC 4I0PB 4NBXB 1TXKA 4RMUA 4EUPB 5AYUL 5CLWA 5I16B 4IIQC 2R0WH 4NRYB 5EO0A 3P73A 2H3NA 3VFVA 3GSRB 4KKCC 3KPLA 4UILH 3VWJD 1X5KA 1SQ2N 3MLYL 2C1OA 2EXWC 3WUWA 2GY5A 3ESVF 4X4XB 2ZUYA 5GRZA 1YEKL 5EU4A 5AYUH 5K9JL 5FGRA 4CVZB 1A1MB 3MO1B 1G1CA 5HHOE 2ESVB 1VDGA 1I7RA 3D85A 3MOAL 2FR4B 5J4MA 5IBUG 1OGAE 3DSFL 4FFWC 3JWDC 1MAKA 2FLRT 2W9DL 3DXAE 3MLYH 4ELKB 4I8DA 2IMNA 4ZO9A 1JWMA 3HE7A 1YEKH 1UWGL 1GSMA 3DVNB 4RQQA 5K9JH 1FNGA 4MS8D 4NQCE 2PCPA 3UEZA 4YDLB 3MOAH 4PRPE 1KN4L 5E94B 1S7QA 3UTSA 4DUVA 4P4RB 3DSFH 3TO4D 3BI9X 4G6AC 4LKXB 2W65A 4HEME 1JF1B 1G7JB 1UWGH 1VFUA 4AYFA 2H26A 1YZZA 3MXVL 5IR1A 5I1HL 1D5BA 1NFDB 4Y1AB 2HFGL 5KANG 1JGLL 3D39A 4L3EA 1AP2A 2MCPL 3IFOA 3QR2A 3IVKA 1KN4H 5EO9A 5DHYA 4IRJA 1U3YA 3SKMB 1EHNA 3LAFA 4PJFA 4GW1A 3ECBB 1VFAA 4BQCA 4PJ8A 1AD9B 1K8IB 2MNUA 1I8IB 3MXVH 3TBTA 1RPQA 1ACYH 3ROLB 5I1HH 4HAGA 2HFGH 3VXRE 1JGLH 3CZJA 3QCVL 2P8MB 2MCPH 1LO0L 2HKHL 3IDNB 4NN5C 4FABL 1IC1A 1V3MA 4X5WB 3H9SA 4OZFG 4I0KA 3DI3B 5DD6B 3AS1A 5A3IC 1CICC 3G6JF 1P5VA 1JNHA 3TJHC 3FQNB 3MJGX 1U3ZA 2ED8A 1NUFA 4RMSA 4JGMA 5SV3A 3O3DA 4ETQB 1NAML 5ADPL 4NQED 2AJVL 4UIKL 1TTFA 1VSCA 3MJ6A 3QCVH 3DETC 1LO0H 2HKHH 1VFMA 4FABH 5BCAA 1UH4A 4Y19D 1LK2B 3CSYA 4X5LA 1R3LB 2VR9A 4WTZA 3LDBC 5K9QG 2ICES 3N1MC 1JPTL 3N1GC 4HKBA 4EIGB 3V5HB 1CXFA 2V7HA 3CUPA 5EC1A 2VLKB 4JZNB 2E7HA 4Z7UB 3WIFA 3VW3L 3O4LE 4GMTL 1NAMH 2BOBA 5ADPH 2AJVH 4JFDA 4UIKH 4R4BA 2ENYA 5GGTA 3EAKA 3UBXI 3QDJA 3HMXL 5JIIA 1IILE 1OB1A 5I19L 3EYVA 1JPTH 1LO2H 3AM8C 2B2XL 5BV7L 1B4JL 1IGJA 5IHLB 4R96A 3VW3H 2KZ1B 4GMTH 3VFPA 3WN5A 2DQGL 4Y4FA 3RZCD 1ADQL 3VXTB 1Q38A 3HMXH 5DGQA 4YHZL 1KTDB 5CJ8A 5E2UL 4BFEA 5FM5O 5I19H 3X14B 5ICYB 2QHLA 3FRUB 1TVDA 4TUKL 5BV7H 1B4JH 1X4ZA 3IB4A 4M7KH 4P2QA 2H2SC 4U49A 3NZHL 1L0YA 3QI9B 4GBXB 1ZT4B 2DQGH 2W0FA 4ZODA 4Z5RA 1ADQH 3IU3B 3PWLB 4YHZH 3OB8A 5E2UH 1C5BL 1BIIA 3GFUA 3STBA 2G5RA 5GGVH 2NY2D 3QIUD 4OGYL 5JORA 4GKNB 5E8NB 2P5WB 4IOFC 4TUKH 2GSIB 4JFEA 3ZLQC 3NZHH 3ARDD 1YN7A 3DX8A 1QSFD 3QNXB 2ZG3A 2DM2A 2VE6B 3QEHA 4N90D 3SGJA 4PP1D 3C6LB 2WIIB 4XNQB 1C5BH 4FXKA 3JWNC 4OGYH 2AJZA 4JPIA 3H3PL 1LQSR 3QUKB 4R2GD 3S35X 1JWSA 5DJYB 1FP5A 4GO6B 1OSZB 1TETL 4QRPE 4X7FC 3MREB 4DN4L 5E8OA 1I8LA 1KJVA 4NN7C 1H3GA 3ARBB 43C9A 3H3PH 2GJ6B 3CDFA 1EXUB 3KHQA 5DEGA 3MRJB 3W11C 1M6OA 5GS1B 3BJ91 1DQQB 5K9OA 1N5AB 3UTPD 5AG9A 3DV6A 4Y5VB 1TETH 4F33B 1KCLA 4C83B 4DN4H 4OLWL 3OQ3B 1HHKB 2FX8L 2ITCA 3T1FA 3PG2A 5F7DB 5D5MB 5KG9A 3M17B 5DURD 5T1LB 1JNJA 3C5JB 5E5MA 3NA9H 5I1CL 2IF7A 4D0DB 4PJEF 1UJTA 4OD3L 1S7UA 4UI2A 4AM0A 2YPLB 1SEBA 4OLWH 1G9NC 2FX8H 2X1PA 3DBXB 5MP6L 1XZ0B 5IW6A 3T09A 3HG1D 2E9WA 5IKCB 5HHMB 1P84J 2IBZY 3RX7A 3NGBB 3A0OA 3WFDH 5I1CH 5DFWH 1Z0MA 4QXTA 5CWSA 1ACZA 4OD3H 2DWEA 1EHXA 3GJFA 1R3JA 3GIVA 2WAHA 4WJ5B 5EBWB 4PJIA 4R26L 5CJBA 5MP6H 2X4QA 3TFKC 2YS4A 3ZZ1A 3RI5F 1F13A 1I1FA 1U91B 2BY1A 4JKKA 2HAZA 4QGYA 5HYQB 1T1XB 1JRHL 4BQ8A 5TGBB 4G8IB 4KAQL 4XP5L 1J8HE 4R26H 2BVYA 4GW4A 2GK0B 4CNIA 4G43A 1G6RB 1EO7A 3ZSSA 1CFSA 3OKOA 4H25A 1CQYA 1JPFB 4P5TD 4D0CB 3BIKA 4QTHA 3O3BB 4LCWE 1P84K 3P4OB 5IB1B 2A6JA 2NY3B 1JRHH 4WHDA 1NGYB 1O0VA 1N3NB 4KAQH 2PKDA 4KJYA 4XP5H 5IHZB 5FM5M 4N8CL 1T7XA 1Z6JT 2VSDA 4AT6B 2HLAB 3ILPA 5AD0A 1FFPA 5GS0D 2EIDA 3ARUA 1SJEA 4HMDA 2APWA 4QLRA 3MUJA 3KS0J 3D2UA 3SDAB 3VMOA 4O2CB 3GMMB 2NR6C 1ONQA 4WW2A 3EDDA 4OV5A 4N8CH 4M1CD 2WBWB 1H5BA 2Q86A 2DLHA 2V2XA 4P2RE 5DDHB 3DPBA 1VGEL 2BNQA 5KSBB 4YLQT 2VLJD 1N6UA 5FYJE 2DOCA 2BVUA 1IAKA 1RJYB 3WLBB 3P4MB 4U1JA 5D1QC 3LMJL 1FZKA 1UWEH 4WFHE 1OOAA 2B1AH 2NW2B 4DFIA 1VGEH 5JXEC 2BNRE 1J5OL 4J2XA 3FQTB 3V6OC 3PNWA 2X10A 3D3VD 1FGNL 3GMNB 1BZ7A 2WWMC 5GXBB 4HK3N 4QYOB 4NT6A 1NEZG 4JQXC 3B9AA 1CE6A 3LMJH 1NDMA 3EIFA 1MCOL 1JZ3A 3KAAA 1A7NL 4XNMA 1D6EA 2X4PA 1L7IL 1J5OH 2BMKB 3L3KB 2DYPA 3VJ6B 4KK9D 4Q0XL 5SX5H 5CZVL 3LEVL 1Z9OA 3FQXB 2H6PB 4ZAKD 1MCOH 5JIPA 4JR9L 5E95B 3EO0A 1A7NH 1XCQB 1LP9F 2ICWJ 4UUJB 1GGCH 1L7IH 1SJXA 2RHEA 4CVZA 1CXEA 2ILLA 4MNHB 4Q0XH 2C4XA 4BJLA 2UUDH 2VIRB 3LEVH 5CZVH 2FWOA 3ROOB 3WE6A 3MRCB 1GGTA 4V1DE 4MNGA 2IAMC 4NN5B 4BUHA 2XYCA 5IJKC 4JR9H 2FJFB 5F9WC 1O7SA 5F89A 4ZPVB 1N59B 4EQ2A 5E2JA 3DVNA 5EOQL 2QADC 4L8SA 3KYAA 5D2NB 2GKIA 4DKEL 3GMLA 1P5UA 1LEKA 2OJZL 3SE8L 3WUWG 5FO8A 3IXTB 3O45A 3MRIB 4JZOB 4LKXA 5DRXB 3QO0B 2VERN 4KUCD 2YK1L 1K5NA 1YMHB 5EOQH 4UV7L 1KG0B 4KH2A 4YDVB 3RWFB 2CLZA 2ITDB 1N7ML 4I2XB 4DKEH 1OPGL 1KGCE 1G9MC 5EOCJ 4GG6A 2OJZH 4S1RL 3VXPA 3S37X 1K8DA 3SE8H 2OTUA 4XHJD 5F72S 1P6AB 3V5KA 4BQ6A 4KQ4L 4C56B 2HVKA 3TA3B 5I76B 1PX4A 3OPZL 1Q9LB 2YK1H 4UV7H 2GFBA 3ROLA 4OZ4B 1B2WL 4Y16A 1OPGH 1P4IL 1HNGA 2P8MA 3K8KA 3PWVB 4X5WA 4S1RH 5F7LB 1S9KC 1JHLL 2AXFA 1BMGA 1YMMB 5CEXB 4BZ2L 4KQ4H 5GRYA 3H42L 3OPZH 1VESA 1JIBA 2NZ9C 5INCB 4JFHE 2QLVB 2F5AL 3CDGA 1B2WH 1J0IA 3GIZL 1HHJA 1P4IH 1BQHB 1D7FA 2QHRL 2DBJA 4BYHA 1AE6H 5F70A 2AXGB 1EFQA 1GZPB 1K6QL 4NRZB 1JHLH 3OR7A 4JFFD 3STLA 4BZ2H 3BT2L 1KJ3L 4QOKE 3H42H 1QFWI 2UWEF 2CRMA 2V9RA 4LLVA 1YN6A 3FFCE 1BBDL 4K3HA 5F9OL 1JMXA 2F5AH 3GIZH 1NAKH 4HLZG 3WS3B 2QHRH 4MB3A 4MXWL 1WV7T 2NTFB 3VGFA 2HG5A 1K6QH 5I1IL 4N0CD 1MI5D 4FXGA 4KFZC 3BT2H 1KJ3H 2YXFA 4JG0L 2VWEC 4LU5L 4PJXF 1CFTA 5C08A 4QT5B 1RU9L 4UNVA 1QVOB 1Q0YL 1BBDH 5EWIL 4WTZG 3SGKC 4MXWH 3RGVD 1CL7I 3DX9A 3FO9B 4NFCA 5I1IH 3MRRB 3X14A 4JG0H 2AJXL 4LU5H 4NZJA 3FRUA 4Y5YC 3CFKB 2D0FA 3L95B 5KVMC 1Q0YH 4RGMB 4S10A 1DR9A 4M9PA 2XIDA 2PW1A 4K8RC 1CR9L 3W0WA 5EWIH 2DIJA 3K8MA 2BZDA 5JO5B 1X5XA 1R5WB 4Q6IA 5D1ZC 4Z9KB 3IU3A 3PWLA 2G5BB 1WVZA 2GIYA 4UT7L 5E00B 3OB0H 1G7PB 3O2VL 2NY5C 3QWOA 2AJXH 4HIIB 1LP9E 4PJGF 4PRID 1OM3L 1RIHL 2JCCA 5JHDE 4GRWF 4XVJL 2GSIA 4XT1C 3QBTB 3ULVC 5C0BB 4K7PL 2IBGA 2I60L 3QNXA 1ZT1A 3D85D 3VRLF 2VE6A 4LARL 4UT7H 1MCWM 2YWZA 3BH8B 3BKJL 4XNQA 4MDJB 2FBJL 3O2VH 3LD8C 4IRSA 3CNKA 5FK9B 5D7LE 1XFPA 2A0LC 1OM3H 1GRWA 1RIHH 5EPMB 1BJ8A 1JZ4A 3HE7D 4XVJH 5EUOE 1FC2D 3V7MA 5K93A 2N4IA 5T3ZD 3O3UN 1QQDB 4K7PH 3I85A 2I60H 3BVNB 3U1SL 1IC7L 4LARH 3VE0A 3UTSD 5ENWB 4G9FA 4KVNL 4O4YL 4JN2A 2FBJH 3CH1B 3JZ7A 4KJQD 1X5YA 1UEYA 4WO4C 5GZND 4Q2ZA 1LWRA 5I8KL 2A9ML 3T4AB 2IWGA 1SBSL 1UWXK 1INQB 2WM0A 1REIA 2CLRB 3SJVE 2EE3A 2Y6SC 3D39D 4L3ED 3U1SH 4FQXA 2YXMA 1IC7H 1HHIB 1D3CA 1FJ1B 4KVNH 4IRJD 4O4YH 2C3WA 5FUOL 3MLPA 3NVQA 5D5MA 4ZFZA 4YEFA 3QJHB 1IEAB 4HD9A 1S7RA 4PJ8D 5CJXC 5I8KH 2A9MH 2DMKA 1SBSH 4D0DA 4H0GA 2ZSWA 3KPSE 5IHBA 3C8HA 3SHSA 1M05B 4EI5B 3TCLB 4W4NA 3H9SD 5BS0E 1RHFA 4DEPC 5FUOH 4CMHC 3GDBA 3W9EB 3R8BB 4MD4B 1BFVL 2PXYA 4Z7WB 2FH6A 3TIDB 3F7VA 1ZGLP 1CU4H 4I0CC 5KVGL 3TIEB 1PZ5A 3K2UL 1Y6MR 5JHLL 3PABA 3RPIB 3F7RA 4LCCA 1BFOA 32C2A 4LBEB 4TUJA 3DGGB 1BFVH 4H1LH 4X6DB 5C0JB 5KVGH 4HUUB 5GRUL 1AFVL 4JFDD 1A22B 5KAQG 4HPYL 3K2UH 5JHLH 3MNZA 2OL3B 3QDJD 4F2MB 1D9KA 5B39A 1C8PA 1KB5L 2V5TA 4HX1A 4PLKC 3TYFB 3WFBL 4PJXE 1KV3A 4UINL 2KQNA 3ZT6A 4UTBL 1GIGL 3EYQD 4YHLL 2H32H 1Y18A 5AZEL 3QP3A 4R90L 1XEDA 3HE6B 5GRUH 5HHNB 1AFVH 1OW0C 3V4PL 4AENA 3AVEA 1R6VA 3P4OA 3QFDB 4TULL 4HPYH 5F7NC 4C58B 4Y4FD 3WS6C 3QUYC 3EJYC 1KB5H 5IHZA 3WFBH 2PTTA 4UINH 4IDLA 4QNPE 3PHSA 4UTBH 5DRWB 1GIGH 1RK1A 4UU9A 3ZDYF 1U95B 5MENA 1HQ4B 2K9UA 4MHHG 4YHLH 3C09C 3MYJB 3KLHD 1LMKA 5AZEH 4P2QD 5C0CD 1UB6B 4R90H 3OKLA 3V4PH 2F9BT 4TULH 2VQTA 4AEHL 2R2CA 5LGJA 2A2QT 3GMMA 2FECI 4EI6B 5DQJB 3TV3L 4NO5B 4BZYA 1L7TL 2XA3A 2CDFA 3TM6A 3WKNA 3LRGA 2BCKB 1MUJB 1PVHA 4GRWE 1XGPA 5DT1L 4P9HC 4JFED 5J9PB 5KSBA 2PETA 3T8XA 1UH2A 1ZANL 2V2TA 2XPGA 4AEHH 3VRLE 2GJZB 2WP3T 3NIFE 1RZIB 3V0WL 3TV3H 3BYYA 1DJSA 3CU7A 2LV4A 3LQAC 1ZLVK 1L7TH 2V9QA 4G9DA 1UCTA 2CUIA 2IAMB 4R0LC 1J18A 2YD9A 5ELIA 3BP6A 3VXNB 5L88L 5F9WB 4U3HA 1N2RB 1ZANH 3B43A 4Y88A 3GMOB 4YE4L 4NQEE 4PR5B 3V0WH 5H94B 2GAZB 5EZJB 2J88H 2QQLL 5DD5L 3CFBB 4Y19E 1YPZE 1GZQB 1AGEB 3TP4A 2DN7A 5L88H 1MVFA 4HH9A 3ESUF 2V6HA 2CUHA 1FZOB 3PWUB 1L9MA 4YE4H 3FQXA 4JKMA 4DOHE 4XP9L 1UQSB 1BVZA 1HYSC 4OLZL 1T0MB 2VR4A 2QQLH 3L1OL 5DD5H 5IFAL 1L0QA 5E6IB 4KGLA 5BXFB 2XG4A 3NCCB 2B4CC 4B50A 3HFML 3O2WL 4HZLA 1DBJH 2FB4L 3B9KC 4R4NC 5FA3B 2HJFB 1FBIL 1ZEAL 4NBZB 2VIRA 3F8UB 3NZ8A 4GT7A 1KCUL 3OMZA 3MRCA 3TYGL 3RVXC 3L3OB 4XP9H 5D2LA 1S7TB 3TBYA 2Q6WB 1U36A 1ZHLB 4OLZH 3BZ4B 3L1OH 5IFAH 2OTWB 3HFMH 3O2WH 4EN3B 3PF2A 4Y5XA 2FB4H 2BOCA 4TNWK 4GAYB 2JKXA 1FBIH 5GIRA 1ZEAH 2C1PA 3EKCA 1ZLSL 1KCUH 3TYGH 2QR0B 3IXTA 3OGOE 2CXKA 3DRQB 1T1ZB 2OX5A 4P57B 1NQBA 3X12A 4KJPC 2DLGA 3VFWB 3QXWA 4JO1H 4BKLB 4QXUL 3RHWF 1T20A 4UQ3B 5KN5A 4MJIB 1OARL 5BQ7A 4HCRL 5C92A 3RTQC 1QSFE 4CAGA 4N90E 4UB0L 1KJ2L 1Q9LA 4GXUN 1BEYL 1TJHL 4NKOB 1T04A 1UJ3A 5BJTA 5F3HA 5FKPA 2B8OT 1Q9KB 4OZ4A 4L8CB 3GSXB 4QXUH 3LHPL 3ILQC 4BSWB 1F97A 5GSVA 1W2KT 4ZTOL 1OARH 4HCRH 2P8PA 5GRJL 4JDVB 4UB0H 3KPNA 1KJ2H 4K94L 3JTTA 1BEYH 5H2BA 1TJHH 3LEXB 3M45A 3GBLA 5E7FA 2H8PB 1U8MA 2AV7B 3CVHL 4Y5YB 1KCVL 1P4BL 3WD5L 3D2UD 3LHPH 1KNOB 1BQLL 2AXGA 1QHPA 1GZPA 4ZTOH 3X13B 1ZWIB 4FQHA 4EEEA 3UTPE 3EZ8A 5GRJH 5D1ZB 5J13C 5TDOB 4K94H 3S36L 4F9PC 2YZ1A 1YEDA 1LHZA 1QZ1A 1QSVA 3CVHH 2BNQD 1KCVH 1IAMA 1P4BH 3WD5H 4RNRA 1AIFB 5FCUL 1B90A 1BQLH 3HR6A 5FIEA 4XRCA 1IEHA 1GOFA 1QVOA 4U1LA 4NQSA 3HG1E 1CF8L 3OKDA 1CG9B 2AK4A 1FVDA 5DHVH 3I3EA 5FCUH 5A2FA 2F58L 4YO0A 1ORSA 3KXFB 3BKCL 4GKSB 4JREC 1W0WA 4ZSOA 4PJHB 1HEZB 2HJKA 3R06A 3U6RB 2ZNWA 1NPUA 2ICWB 3KPPA 3KWWA 1OQXA 3L7FA 4EBQL 1ND0B 3FCTB 1MCQA 1OF2A 1CF8H 4LKCB 3QHFL 2DYPD 4WO4B 1ZT7B 3GSNL 4KUCF 3IAQA 2F58H 2G5BA 1QPPA 3BKCH 2GW5A 4QGTA 5E00A 5SWZB 5D6DA 1PDKA 2HFTA 3NMEA 5IFHL 4IM8A 4R7DA 3C9NA 5B8CA 4HPOH 4Y89A 4EBQH 5A2IH 3QHFH 4M8QB 1ES0B 1G7LA 4J1UB 3F7YB 3GSNH 5C0BA 4KJWC 4LMQI 5F3BA 3IDGB 1ZHKA 5TDNB 5DJ8A 1ORQB 5DMGC 5IFHH 3Q5TA 5DFVC 3DO3A 4F7CA 4XP6L 2NY1D 2APFA 4DEPB 4ONGL 4CMHB 2R15A 2UVEA 3PHOB 5E08L 3FN9A 2VLLA 3JVGA 1MLCB 1QQDA 3CXHJ 3MUGB 4QY8A 4U2YA 1W72A 2C3HA 1VFBA 5CHNA 3O3EB 1CQKA 2RJMA 4KI5F 3B2UC 1MRCL 1IGFL 3QEUB 4WUKL 4QF1A 2YEZB 3BPOB 4XP6H 4HS8L 2Z4QB 2KKQA 5CD3A 1HSAA 1CD0A 4ONGH 1YDPA 4PRAA 4JY6A 4ELMA 5SX4I 5E08H 2CLRA 1CI5A 5M94B 4NBYB 3ARXA 4XTRD 2MMXA 4NSKB 1KJMB 1BD2A 5DD0L 5J06A 3ARPA 3LEYL 1WBXB 1S7XB 1HHIA 1NGWA 2VLJE 5I17B 3P3YA 5IMMB 4HG4J 1I7UA 5K59E 1LE9B 3OJDA 5HGAA 1CIDA 4NDMA 2X4RB 4PGCB 1MRCH 1IGFH 5J11C 1C5DA 4WUKH 1IEAA 2Z8WC 1U3HB 3BQUC 4HS8H 1M71A 1IQDA 4B7IA 2C5DC 5DSCB 3R0NA 3L5XL 3LN5B 4QCIB 1UADC 4DQOL 3OJ2C 3T77B 5E1HB 4ZG1A 5KZCD 1Q1JH 4H88L 4Y16D 4HIJB 4GH7B 3UP1A 4UDUB 5DD0H 4YWGL 1M05A 4OM1L 4EI5A 3D3VE 2LVEA 3PP3H 1F02I 3CXHK 4MD4A 4HWBL 25C8L 5DJ0B 4P3DB 1P2CA 3H2WA 3QUYB 3VD3A 4Z7WA 4LLWB 3TIDA 4MX7A 1IAIL 3L5XH 1SJVA 2VJXA 5FKAA 4DQOH 4QRUA 3BPLC 4H88H 4U7KA 4YWGH 4J6RL 4OM1H 4J4PC 1CLYL 3CD4A 1XT5A 1J7VR 1X5GA 4ONHB 5ESAA 1OTUC 3UZVB 4FFVD 4HWBH 25C8H 3HS0B 4KI1A 2O5XL 4QWWD 4HG4K 4MD0A 2R4RH 1HOCA 2GJJA 3EO1A 1IAIH 2HJLA 3OKKB 5HHOB 1WITA 3NFSL 4JVWA 4Y2OA 3GSVB 3B9VA 3ZDXF 2ED9A 3SE4C 1OGAB 4JFOB 3GUTA 4J6RH 2YMXL 3PXHA 2WQRA 1CLYH 3IETB 3DXAB 3THML 3BGAA 4RA3A 2IMMA 5C08D 3UTQA 2O5XH 3OR6B 4YH6A 5MEOB 4TTGA 4NQXA 4CJ1A 4WW1A 4JFQA 2NY7L 2J6EL 4NQCB 3FKUS 2NY0C 3TZVC 3U7WL 3HE6A 5EBGA 1IZKA 1NCBL 4PRPB 3QFDA 5E99L 3IDJA 2X1WL 2YMXH 4R0LB 4LSDA 1V7NL 4GFTB 1Q94B 2KH2B 4M7JL 3THMH 5HGHA 2NXZC 1HN1A 1PKOA 5CBAB 1C12B 4BSJA 4AIZB 4Q9RL 4X99A 3U0PB 1CCZA 3S4SB 4HUNB 2NY7H 2J6EH 2P1YA 3U7WH 3W0WD 2XT1B 1NCBH 3WFZA 4ZXBA 2GCYA 1NCUA 5E99H 5B39G 3B6SB 1HH9B 2MKWA 4X80L 1V7NH 4JAMB 2CKBL 4EI6A 3MRGB 1JYVA 4M7JH 1TZIB 3A67L 4ALAL 3TN0B 4HLJA 4RWYL 4Q9RH 4UQ2A 1Q0XL 3QDAA 1WC7B 3VXRB 5J9PA 2Y9RT 3QIWA 3QUMB 2GJZA 4X80H 2CKBH 3C6LD 3LIZL 3LB6C 4L9DA 3P11L 4IRSD 4ALAH 4N0YH 1Q0XH 3OKEB 5C0GB 2CJUL 5ETUB 3GSUB 5D1XC 4NKQB 1T5XA 1FNEA 3GMOA 4NRXA 2VDML 5KBNC 2DM7A 4PR5A 5TE6L 3LIZH 1WZKA 4G9FD 4MAUL 5H94A 3P11H 2W38A 5D7IE 4XWOD 1FL3A 1U6AL 3HN3A 3O4LB 5T1KA 4JFFE 2CJUH 2ATPB 3SCMC 3OG6B 3V0AC 3J7HA 1XIWA 4X7TA 2BVTA 2IPTL 3VCLA 2Z91B 1D5MB 5ALBL 3PWUA 4C55A 2VDMH 1SYVB 4FQXD 3WEXA 4BUGA 5TE6H 4MAUH 3RA7L 4WDIA 3KLAB 3I02B 1T0MA 4N9GA 1U6AH 2JTDA 1BPVA 4GG8A 1HXMB 4I1NB 4XZUB 1MI5E 2VH5L 4NC1E 3UXFA 2OSLA 4K7PX 4MSWA 3QULB 5J6GB 3CLEL 2R23A 2IPTH 3NCJL 2P8LA 2EDOA 2DL9A 4PV8B 3RA7H 4P4KB 3BZ4A 4K55A 1MCDA 4HBCH 4KK6C 2AJ3B 4M3JA 1EUUA 2PXYD 4KDWA 5HHMD 4CMMA 5ITFB 2VH5H 1K3ZA 2N7AA 1S5IL 4EN3A 1ZVYA 3CLEH 1MLBB 1JGUL 3MRLB 2X9XA 3BEWB 5BZWA 1QFOA 4I4WA 5K33A 2EDQA 4YK4B 3D0LB 4O2EA 1T22A 2QR0A 3P9LB 4AMKL 2VXVL 5DD3L 5I8CB 5I1KL 4RBPK 4DKFL 4Z6AT 5FA4A 1A6TB 4NFBA 4YHPB 3VFWA 1G7HB 1FC1A 3B5TA 1S5IH 3ZDXE 1JGUH 1MWAL 4D94A 3ARWA 1KTLB 3FQUA 5EOCL 4MJIA 5A40E 1D9KD 12E8L 5C09A 4AMKH 2VXVH 4NM4L 5DD3H 5JMRA 1ZVHA 1UB5A 2XZCL 4LF3A 1TQBB 1MJUH 3LKOB 5I1KH 4W6YB 4NKIL 2VSCA 4DKFH 1E28A 2GSGA 4NKOA 4M6AA 1A9EB 1T21A 4W81A 1FZMB 1MWAH 1VADA 4QRPB 4OIBA 2CKBA 5EOCH 12E8H 1OAKH 5T3ZE 1A6UL 2XZCH 4LPUA 5MEND 4NKIH 4JREB 2DM3A 1UZ6F 4K3DH 5I74C 2H8PA 3QQ4B 3JV4B 1NFIA 5EA0L 1VCAA 1AGFB 2GUOB 2DJSA 4RAUA 4X8JB 1WWCA 1KBGL 1ZWIA 2AV1A 1A6UH 4YHKL 1DUYA 5LBSL 3D39E 3Q5OA 3U9PL 3BUYA 3WJLC 4LLQB 5ANMB 3DECA 4I3GA 4PJFE 4TNVF 4XCYA 3QT2A 4MWFA 5EA0H 1NMAL 1AIFA 3FAWA 5I1DA 5F9JB 1A4JB 1KBGH 2H1PL 3QJFA 2FIKA 3ULSB 1CL7L 1TNMA 3QUXA 4QTIL 4YHKH 5LBSH 2AABH 4JM2B 2VITA 4P46C 3U9PH 5IBLD 3H9SE 3ZE0F 1PEZA 3QXDA 3QNZA 4EUPH 1RFDH 3NPZB 1CG9A 1U8OB 3L3IB 5FM8A 4JHBA 1NMAH 2NXYD 3HAEA 5DMKB 2HN7B 1IGTA 4H0IA 4H8WC 1IAIM 5LVEA 2H1PH 3CX2A 2VZUA 4ZOEA 3MCLL 1CL7H 3RKDD 4QTIH 4O00A 4XXCC 3F7PC 4C57C 3U6RA 5LGHL 2ICWA 5C0FA 5ID1B 5D7JA 2OR7A 3H7BB 5L8JB 3UDWC 4PV9B 3VI4F 1ZVSA 4QRRA 1C7TA 5C0NC 1J8HB 1CDIA 2E8ZA 5IIEA 4XGZB 4BSVA 4JFDE 3MCLH 1F8TL 1EAJA 4IBLT 2V17L 3OZ9L 3QDJE 5LGHH 4DW2L 2BSRB 4LCWB 3RY5A 2QQQA 3HPJB 4Q7DA 1JNNL 4U6HB 5AZ2L 1ULVA 2NY6D 2BVOB 1G0DA 1JV5B 2B1HL 5MI0C 1EEYB 4ZO6A 1ORQA 5CEYB 1JK8A 3EYFB 2O93L 4HEPG 2A74B 2V17H 3OZ9H 4XCNB 4TSBL 5TDPA 1AGCB 4ORGB 4DW2H 2FYYA 5KVEH 1JGDB 4W4OC 3MRQA 1JNNH 1FG2B 5AZ2H 5DK2A 1GOHA 5JDSB 3V79C 4P2QE 5HYJA 5CD5D 2D7OA 8CGTA 3TC9A 5FUZL 3VWJC 3O3EA 5AWNL 2JB5L 2PO6A 3BPLB 4M5ZH 3S96B 2QL1A 4P2RB 1ZLUK 4TSBH 1S5HA 1WWAX 2Z4QA 4XHQA 5FGCE 4WW2F 1DQJA 3FL7A 4FQJL 1PLGL 4KKNA 2CLVB 3BGMB 1A9BA 4JFEE 3DURA 5FUZH 5AWNH 2JB5H 2MFNA 2X4RA 4YC2B 4CU6A 1JGVL 1UENA 2EC9T 1WCBB 4H26B 3PHQB 2BNRB 2BY3A 3MUHL 2FL5A 3LN5A 4MS8C 5HVHC 5T33L 4ZUTB 2AK1L 4FQJH 1HXYB 1PLGH 4HIJA 1OP3K 3OJMB 3CVIL 1J11A 3WO3B 2NY0B 3TO4C 3TZVB 4G8GA 3GRWA 2I9TB 2A9NL 4U4BA 1JGVH 4FFZL 1B0RA 3FO2A 4P3DA 2D03L 1C08B 2NXZB 1Q9OA 5DI8B 2X4TA 3VXSA 5T33H 4AIOA 2AK1H 4ZFOA 2JJTC 3EOTL 3DX6B 5I6XC 1RQ5A 3CVIH 2WLYA 3VI3E 4P23C 5BZDA 1K4DB 4XPTL 2CSPA 1LE5B 5FDWB 2A9NH 5BO1L 4FFZH 2D03H 4HT1L 2Q87A 3D0VB 3T0AA 3DHMA 1U8IA 3PUCA 5CLTA 5IWLA 1U8QB 3IDYB 4HGKC 5SWQA 1MRDL 3EOTH 1ZA6A 5MEPA 3TBWB 2E3VA 2YD6A 2EDFA 4HV8B 4UOW0 3ARGB 1HIML 4XPTH 3KNBA 4S2SB 3FT3A 1CFQA 4ZPTB 3BRFA 2ICWI 4NJ9L 2OZ4A 3SGEI 4LPTA 1P7KA 2VZTA 1A3RL 2HT4C 3IS0X 4HT1H 4LOUD 5IB2A 1QD0A 1H0DB 5KSAB 1AJ7L 3VFSA 1E4KC 4L4TA 2AK4D 1MRDH 1V3LA 4NO3B 2NQCA 3WHE0 4HGWA 3U9UB 5IROC 1HIMH 3SDCB 3HC0B 1BLNA 5IGXL 3W82A 3P9WB 1XR8B 1DE4A 2WV3A 4NJ9H 2R9HC 1A3RH 2D7QA 4AIZA 4PJIE 2VZVA 3CSPA 4LIQL 1G7QB 3VI4E 1AJ7H 1QSEA 1F3JA 1PKQA 2V2WB 1R3KA 1QHOA 2C7UB 2IBZX 3SCMB 1Z5LA 2LAAA 4XVSL 3MRGA 4AEFA 1I3VA 5IGXH 3DLQR 3U36B 2EEDA 3B2VL 4QRTB 5CILL 3TN0A 3VD9A 2FEEI 2AI0L 4GG6F 1JNLL 2APBA 4LIQH 4UT9L 2EDNA 4M9OA 3RZCC 5C0BD 1GYAA 2HT2D 4OUUA 1MY7A 4UDTA 5CKGA 3L3DA 3B2VH 5CILH 1H15B 2HYMA 2AI0H 1JNLH 5KVFL 1F4YH 4PB0L 4UT9H 3AC0A 1KLUB 1QFWM 1AC0A 2CIIA 2FGZA 5D7SL 2NY2C 4QOKB 4NHCL 1X7QB 2LU7A 4OI8A 3MRFB 3O4LA 1U93B 5KS9A 3D48R 3FFCB 3KYNB 5EB9A 1HILA 5KVFH 3ARDC 4PB0H 3SKOB 4DFHA 1V7ML 2QSVA 1N5YL 4OM0L 1NLDL 1INEL 2A73B 2ZPKL 4Z7UF 1BD2D 5IG7A 1SYVA 2BNQE 3ELAT 5D7SH 4NHCH 1RZGB 5JDJA 2EZ0D 3EHBD 3I02A 3I50L 1NDGB 4R2GC 4XZUA 1T6VN 3S5LA 3UAJD 5E8EB 4LVEA 1V7MH 5J6GA 3MROB 4OM0H 4ZUWB 1N5YH 1WWBX 5IESL 3IFPB 1NLDH 3WCYA 3DO7A 1INEH 2ZPKH 3DV4B 1K85A 4EI5D 4PRDB 1U8NB 4HUWA 1G6RL 2EECA 3I50H 3WDIA 3RFZC 5ITFA 4J8RA 3RWDA 2KZWA 3LKRB 5IESH 2BVPB 4JO4L 5TE7L 5I74B 5HGGS 1S9YB 5T1MB 1FLRL 2DJ4A 3OSKA 4HKXB 3VFUA 1BVLA 4P9ML 5I8CA 4ZS7L 1G6RH 4DVRL 5JHDB 5B21A 4Z0XA 5IMOB 3HHRB 2FATL 2WLZA 3TNNA 5T3XL 4PP2B 4EZMA 1T4KB 5EFIB 2JCCF 5TE7H 4JZJC 1FLRH 5D7LB 4PG9A 3MV8A 4P9MH 4WUUA 4ZS7H 4DVRH 2JJVA 5HHXL 2FATH 5CP7B 5EUOB 1RJLA 5EU3B 4MNGE 5T3XH 2R1XA 2HLFD 3HE6D 5I1EL 1QBAA 1WEJL 4RSVA 3SGDH 2A6KA 4ODWA 3AY4A 3IDMB 3KHOA 3BIBX 2D7MA 2JIXB 2Z92B 1KIQB 5HHXH 1QR1A 3JWDL 1RHHB 3SJVB 3NCMA 3AU1A 4E0RB 2F54A 1HHHB 2R2BB 2EYSA 5I1EH 4XPFL 3FTGB 1WEJH 4ZXBD 3F62A 1TCRA 4JDTL 1HKLL 1E6OL 3TBSB 2XFXA 1H3TA 2V7NB 1OY3B 4J3VA 2GTZB 2Q8BL 4Y4KA 4LPWA 4HJJL 4L3CB 5HGDB 5JXAL 2NX5A 4P5TC 1DUZB 2CMRL 3GJEA 4GG6E 5ANMA 2ZOKB 5E8DL 3JWDH 5BRZA 5I1LA 4G7YL 3KPSB 4MGXA 5HXMA 4YHYC 2FJHA 4XPFH 5D5MF 3H0TA 4JDTH 3SY0A 1A4JA 1HKLH 3QIWD 5GS0C 1FNFA 2Q8BH 4HJJH 5EZLB 3TCXA 2CMRH 3Q3GB 5BW7A 2W60A 2P5EB 5E8PB 3C60A 5E8DH 4G7YH 1DCLA 1NGZA 2VQ1B 2W9EL 1EGJL 1LO4L 5DMKA 4IJ3C 5DVNA 1HSBA 4EDXB 4M1CC 4LSPL 1I9JL 4YBQC 1RZ8B 1A21A 4MMZC 1OQOA 3RP1A 3RVUC 1I8KB 5IW1B 2A77L 1BWMA 5CMAA 4FOMA 4JJ5B 3VWJB 5T1KD 3TLRA 4N0FB 4OZHA 2XV6B 3BFOA 3HI6H 3GSWB 4YXKL 1ODAA 3QWRA 1XIWD 2O61A 2W9EH 4S1DD 1LO4H 4PJXB 4LSPH 4XGZA 1I75A 2EYRB 3U79A 2NNAB 7FABL 2A77H 1UXWB 4HH8A 3ZKMD 2A1WL 5I9QC 5CFHA 1FO0A 2BSRA 1J05A 3C5ZA 5D96B 3TH3T 4YXKH 3HAEG 4ODUB 5C08E 4HUMB 4MDIA 5C1MB 3U0TB 5HVHB 4XMKL 4LL9A 3K8LA 1S78D 4E5XA 1GC1H 4JHZA 3SBWC 7FABH 2A1WH 3TO4B 3A6CL 3NH7L 5DRNB 5FF6B 1ERNA 1AGCA 3S98A 4JFXB 2KPNA 4EN3D 3BGFC 2AJYL 3LV3A 3RIAF 3UTOA 4IIQA 5JDSA 2YA0A 4ZAKC 4XMKH 4N68A 5DC9B 4OF7A 3W0WE 4QRSB 3ULUF 5JLZA 3FB6B 4P2RA 3G5ZB 4OCXL 3A6CH 3NH7H 1EZVY 3VFNB 2X4UB 2EH8L 4DKDC 3FB5A 2AJYH 4NPYB 2JCCE 2CLVA 2HFFA 3RNQB 6FABL 4XNXL 1QRKA 2CDGB 5IEHB 4OD2B 1R0AL 5HPOA 4MJID 5C09D 5KSBF 3QNYB 2A6IB 1G6VK 3JUZA 4X9HA 4OCXH 1EBAA 2W0PA 4X5XB 5C0AA 3P4LA 4XXDA 1UT9A 4NQEB 1A4KB 4GMSL 5FO7B 5C70A 6FABH 1WLHA 5HHQA 4XNXH 3VXOA 1R0AH 4GW5B 2YUZA 4Y19B 3GM8A 1C7SA 1YPZB 5JQHC 2JB6B 2WSKA 1EV2E 3HPLA 4G9FE 2J8UA 4F9LC 4NZDA 3U82B 3I6KB 4RAVB 3VGBA 4DOHB 4GMSH 3HZKB 1KLGA 4XHJC 4F7EB 4LLAA 5MEQA 2BC4B 2PTVA 1LO5A 4HS3B 5EBLB 3HA0A 4MZ2A 3H3BC 5DEFA 2H9GA 3CMOL 4M6ML 4ZDHB 5L8LB 4WWKC 3NCYP 2HH0L 2ADGB 3FFDB 5D5ME 1EGJA 1U8QA 4OFYA 4NQVA 3IXAB 5D6CA 3TBWA 4HV8A 5JW4N 3TO2B 5AAMA 2AP2A 3X17A 3G04A 3QUXD 2AEQL 3B5HA 5FM4A 4JKPL 4HK3J 1OAZL 3RBSA 5HI4C 5LJYH 5AG8A 5IBUB 1CICA 4M6MH 3CMOH 5D2LF 4KI5C 2XI9A 1S9VB 1J0HA 2HH0H 3S3SA 3LRHA 5HHME 4NO3A 1IBGL 1D6VL 4F7TB 3SDCA 3I75B 2WUCL 3C8KA 2AEQH 5FHBL 4JKPH 1A2YB 1KENL 3O2DL 5E7BA 2G9HA 1G9NL 2NY2B 3QIUB 4W70A 5D7JD 3REVA 1GAFL 4FQLL 3TGXA 4XMPL 3G5XA 4PY7B 4O5LL 4DVBA 4U1IA 4QRRD 4RMQA 1IBGH 4N0CC 3ARDB 1D6VH 4NC1C 5CUSL 3NIGF 2WUCH 3CFDA 4QRTA 5FHBH 3D87B 1KENH 2O5ZL 5DEZA 1OWRM 1G9NH 4U1KB 5JPNB 5J1SC 1GAFH 2DQUL 4FQLH 2V5MA 4XP4L 4XMPH 2DWDA 4D0BA 5C0EA 2BK8A 2X4SB 4K71C 2X42A 3RGVC 4O5LH 1NUGA 2IADA 5CUSH 4RAHA 3ZYIA 3MLTB 5C9JB 2P46B 2FX9L 3BZEA 2O5ZH 2CGRH 4U6YA 1X5LA 4OZFB 3FONB 1IL1A 2DQUH 3QH3B 4JJHA 3D5OF 5JW5B 3EFDL 3ZTJH 2ADFL 4MJ5B 5MENE 1FG9C 2PYEB 3DUSB 3GMQB 1QSZA 5DYOA 4IEFB 3DTXA 5HYJD 3H9YA 1NUDA 3N9GL 1JGEB 3W2DL 2BNUB 2PO6D 3MFFA 3FQRA 5ISZB 5MERB 1IEBA 1FFRA 2FX9H 3MRFA 4GKZA 2Y06L 3P0YL 4F8QA 3BW9A 5DURB 3EFDH 4MQ7A 2ADFH 1FAIL 4P0DA 5CZXD 5JOPD 4DCQB 1B9ZA 2A73A 3L7EA 4MVBC 1T2XA 4L9LC 5TQ2L 4MXVE 3N9GH 5KSBE 5E24E 3W2DH 4N0RA 4W6XB 1IGYA 1A1OA 1FYTA 1LEIA 5GGRB 3HE7C 2LVCA 4JZJB 5E2VL 3HG1B 2Y06H 5F1KC 1WIPA 3P0YH 3L6FA 3IGAB 4QRQA 3F5WB 5IVNA 1FAIH 4HFWB 3MROA 2EDBA 3M8OL 3DV4A 1R24B 2OL3L 8FABA 5TQ2H 4KJQC 2CO7B 3VH8A 3PGCA 4G8GD 4QHUA 1CE1L 4GS7C 3UPRB 4ZUSB 5GZNC 1UACH 1KPUB 1ZK9A 4ODSL 3W9DA 2ZUSA 4KU1A 1ITCA 2FZ3B 2ADIA 1KTKE 1F90L 3LKRA 3VXSD 3RWCA 3M8OH 4FHBD 4Z7QF 2AKRB 2OL3H 2ADJB 1S9YA 5T1MA 1CE1H 5CSZB 3WNOA 3FRPA 4PJ8C 3S5LG 5IMOA 4ODSH 2F8OA 4JDZB 1G7MB 4B41A 3HRZA 1F90H 4P5TB 3KPOA 2E9JA 1MJJA 3E3QC 4YNYB 3O2DA 2XWTB 2E7CA 3DVGB 3PJSB 4HKZA 5IJVB 4LGPB 2BVQB 5D2LE 3K1KC 2CIKB 4MJ6B 3GZKA 4L4TD 4I77L 3MRBA 1BZ9B 4HUXB 1UVQB 3H9HA 3NFPA 4TRPL 5CZKA 3H8NA 3QXAA 4F8TA 4HXBL 2YWYA 1KIQA 4Z78A 5AUMA 2Z8RA 2ERJC 4LMQE 1QFPA 1SMOA 3CFEB 1RHHA 1R3HB 1GGYA 1N26A 3L9RA 3WIIL 3C6SB 3X11A 1QSED 2B0SL 4BFIB 2ZG2A 2VLJB 1A64A 1W0VA 3PIQA 3NIGE 2B5IC 4TRPH 2CR6A 4OFPA 5E5UB 3KG5A 1SY6A 3EYQC 4HXBH 1YEFL 4NYLA 4BK4A 5KOVC 2YRZA 4ZFFA 1DUZA 3GNML 1MEXL 4I18B 4J3SA 3TN0D 2ZOKA 3IRPX 1D5ZA 4IS6B 1NSNL 1WK0A 2BSSB 2G60L 4X6FA 3WIIH 3WLWC 1I85C 4Y4FC 4K07A 3UTTA 3D3VB 3DIFB 1L9NA 1Q9WA 2X09A 1JL8A 5HVFB 3BP7A 3INUL 3IKCA 3RWEB 1YEFH 2VLMD 4FZ8L 5E4EC 3WXVL 3CGTA 1G9ML 2VDLL 2Z31C 3QFJA 3GNMH 1MEXH 3Q3GA 3ZHLA 2P5EA 3L3GB 5E8PA 4WHTB 4Z7VA 2QSTA 2G60H 3SE3A 3MRNB 1CBVL 3MFGB 3GEWB 1NBZA 4OFIA 4Z7WF 4X9GA 4EDXA 3KDMA 3HNTL 1NBQA 3INUH 1I8KA 5I8OL 1U8LA 4FZ8H 4YHOL 4ZAKB 3WXVH 1G9MH 2VDLH 1HZHL 5DTFB 4JJ5A 3O4LD 5EN2B 2J8OA 2I07B 3M1BB 3QDGA 5J12B 1XCTB 1D5XA 3GSWA 1B0GA 1CBVH 3SGJC 4HGMA 5IEKB 4X6DF 3FO0L 4JFYA 3KYOA 4NN6C 5DJAB 5I8OH 4YHOH 3ZKSD 1HZHH 2WW8A 1MHCB 1CFNA 3LQZB 5HTSA 4ODUA 4GUPB 3JV6B 1LGVA 2XN9A 2FGWL 3P4NB 2BHUA 1I8LC 3FO0H 3K4AA 2AK4E 2FHCA 1HWHB 4CVUA 4XVUD 1OT2A 1RULL 4N5UA 1KPRB 2VKWA 3QPXH 5EOTA 4ZSOE 4JFXA 4FQ1L 4TYUA 1T66D 3BP4A 5FYKD 4JY4A 3QDHA 5IQ9A 4Z7QE 2FGWH 1AQDB 4KROD 3RWGA 3DRTB 3HZMB 5A43C 3UYRL 4NUJA 3BKYL 1RULH 4RIRB 4UOJA 1MCIA 3G5ZA 4PTUA 4DAGL 2F74B 2QKIB 4FQ1H 1P4LB 2IPKA 2D7PA 2XZZA 4XWGL 5GGVY 1OTTD 3RNQA 1IMHC 1YUHA 1DN0B 4QHKI 1WZMA 4OD2A 4K8RL 3QEGL 2IPUK 3UYRH 3AB0C 3LKNB 4Q74A 2FD6H 3FB7B 3MV8D 3CU1A 3BKYH 5CJQL 5C0BE 3HC3L 5TE4L 1JYWA 4WUUD 1HDMB 5C2BL 3SDXA 4DAGH 1CGUA 5IJKA 2D4DA 2NY5L 1I3GL 1MNUL 1ZS8A 5ICZA 3O11A 1AGBA 2VLRA 4PGEA 4TVPD 4XWGH 3BH9B 1PG7L 5C07A 5FO7A 43CAB 3GHBL 1JTTA 1FL6B 4K8RH 5JNYA 3QEGH 5D7IB 3I6GB 1WFNA 3HKFA 1F3DH 3ULVL 4ONOA 3NCFB 4ZD3L 5CJQH 5TE4H 3HC3H 4IHOB 1HHGA 4JFFB 5C2BH 4Z18A 1NEZB 3ARZA 3HUJA 3TPUB 4FA8A 2NY5H 1I3GH 3T4YB 1MNUH 2F54D 2Q76B 1PG7H 5C6TL 4XNYL 2UYLA 3GHBH 5DRZA 5EO1B 3OXSA 4ELME 5I15L 4ZOAA 3ULVH 4ZD3H 3NACL 3TVMC 1BD2E 1NMCC 1YECL 4OKVB 1MI5B 4PGDA 4Y4KD 2NX5D 5T5NG 1A7OL 5ALCL 3PL6C 4UAOB 1NC2A 5BRZD 3O9WA 1XF4B 2BERA 2GHWB 1HH6B 1CD8A 5C6TH 3IXAA 2YN3A 4B0MM 3EBAA 4N8VA 4RGND 5I15H 4K71B 1MRFL 1T7VA 3NACH 1YECH 1FHGA 1A7OH 5ALCH 3SGEH 4KKAD 1YY8A 3C60D 1S9VA 4KQ3L 1RZFL 4FQIL 4X7SL 1I7TA 4Z7WE 1V3KA 4WW2C 2EH7L 3ZT5A 3P73B 2H3NB 3VFVB 5FYLD 1H5BC 3MLVL 1MRFH 2LU4A 3KPLB 5EG6C 1ZLWH 3U4AA 4NJAL 2FEEL 4KQ3H 2RGSA 2DKUA 5EU4B 1RZFH 3QWRD 4FQIH 1I3RA 2APVA 4X7SH 2I9LA 1XF2A 1EEUA 1S9XB 4I5BA 2EH7H 3Q6GL 1I7RB 3D85B 3MLVH 1UXSA 3EDEA 5SX5K 4NJAH 4OLYL 4XC3L 5JPNA 2APXA 3C5ZD 4YIQB 1J0JA 1JWMB 3HE7B 1OVZA 1EAPB 3QRFM 2VQUA 2NZIA 2IQAA 4RQQB 4M1DL 1FNGB 5FV2A 4XPAL 2CO6B 1U41A 2PCPB 3Q6GH 5D8JL 3MLTA 3LKPA 1S7QB 3E6HA 3BYTA 4YGAB 4I0PC 2UUDK 5HYEA 2W65B 3GK8L 4OLYH 5EC2A 1ZKAA 3X3GL 4YHIA 2R29L 2PYEA 2ZCLL 2GYSA 2H26B 5IR1B 1D5BB 5JOFA 4XPAH 3HZVA 3BXNA 2D3VA 3D39B 5D8JH 2ZZUT 1AP2B 3IFOB 4OKDA 2BNUA 2COQA 5ISZA 3IVKB 5EO9B 5MERA 5DHYB 4IRJB 1AR1C 1DANU 4P2RD 2ENSA 4PJFB 4GW1B 3GK8H 2X4OB 1F4HA 1VFAB 3VWKA 2D2OA 3HZYA 3N06B 3X3GH 4LDEB 4CGTA 2R29H 1JHTA 2ZCLH 3V4VL 4MNQE 3TBTB 3VXMA 1OT1A 2W92A 4F37K 2MKLC 4G6FD 2NY1C 1CXIA 3F6IA 2YUVA 3R0MA 4L8SC 5D9SA 4A6YA 5HYFA 1FRGH 3F5WA 2EDTA 3O3DB 4YHML 3V4VH 3KR3L 4P9HL 4CW1A 5K9KA 3UPRA 3CSYB 2VUYA 4HIEA 2JF1A 4HKBB 2ORBL 1NFKA 4NC0B 1ZA3A 4PJHF 5EC1B 4XTRC 3LQAL 4PRBA 3WIFB 4LLYA 4YHMH 5HJ3A 1T0NA 2BOBB 4ISVA 5CP3H 3KR3H 4JFDB 4P9HH 2AKRA 4R4BB 4LSRL 3EOYG 4MD5A 4YBLC 3QDJB 2ZCHL 2X1QA 5DK0A 5IVZA 5HGBA 1E4WL 4WHYG 3ALWA 1OB1B 3EYVB 2B5IB 2ORBH 4E41A 3KPTA 2DQTL 3LQAH 1IGJB 3LPGA 2VNCA 5MHSD 4R96B 5DJZB 1AKJB 5BOZG 3VFPB 3WN5B 3KYMB 1DP0A 1I1AA 3Q0HA 4OFYD 1FVEA 4XBGA 4JANA 3VH8G 4LSRH 4WCYL 4OLXL 2EIBA 4Y4FB 2MJWA 2ZCHH 4YNYA 2XWTA 3PJSA 5ID0A 1UH3A 4YXLL 2Y36L 1QNZL 1BF2A 1ZHBB 4XPHL 4HF5L 1CICD 5JIKA 2P48B 2DQTH 3MCKA 5IFJB 4WU7A 1Z9LA 4PG2A 3UO1L 2LABA 4P2QB 1JMZA 2B4CL 3LRSA 2XOTA 2QEJA 4PFEA 3E1F1 4WCYH 2W0FB 3FRPG 4OLXH 3SDCD 5KANI 4MA3A 4Z5RB 4FFVC 2H41A 4QWWC 1PW3A 3G9VA 4HBQA 3N85L 5FGCB 3KPQA 1QNZH 2Y36H 3AFLA 4YXLH 3RKPA 1BIIB 4XPHH 4L8BA 4HF5H 5JORB 2YD2A 3UO1H 4JFEB 4BFIA 2B4CH 4DGYL 3FN0L 1KUMA 3N0PB 1HK6A 1VPOL 1YN7B 2X1XR 3DX8B 3QEHB 3N85H 1WFTA 4FMFA 1DZBA 4FXKB 5C09E 2AJZB 5TFSL 4X6EA 3OB0K 5J1AB 4DGYH 4OGAD 1JWSB 5J6HA 3FN0H 5HPMA 1TITA 3UZQA 4U3XA 3DIFA 1VPOH 1KC5L 3O8XA 3G6DL 1G7IA 1RJZB 5E8OB 1KJVB 5K9QI 3L3GA 1A6WL 4XCFL 2ZUTA 3IJSA 5TFSH 43C9B 4OQTL 3RL1A 4KHTL 4Q6IC 4KXZI 2HTLC 2H2SD 4LNRA 5DEGB 4P3WA 3RY6A 1M6OB 4ODBD 1BGXL 4AH2A 5K9OB 2IFFH 1BZQK 4OT1L 1KC5H 1X5IA 4YGVA 3G6DH 4NKMB 3MV9A 2ITCB 3S37L 4XCFH 1A6WH 5EN2A 5KG9B 4OQTH 2MOVA 1ETZA 1UZ8A 3O6FA 1Y6NR 1OAQL 1UKTA 4KHTH 1AH1A 5E5MB 4BFBD 1W8OA 3QO1B 3C6LC 1BGXH 3VMPA 4OT1H 3EJJX 5IMLA 4HKJA 1EH9A 1FYTD 1SEBB 3V6FA 2R1WA 3EW3B 1QRNA 5IW6B 2W59A 1FIGL 2OI9C 4C54A 1OAQH 2EKSA 1NC4A 3JV6A 2DTML 4QXTB 5CWSB 5GGUA 2DWEB 1KT2A 1OLZA 1K4CA 3GJFB 1R3JB 3GIVB 4JHAL 2XICA 4XWOC 4JKWA 3ARBC 3RVVD 4PJIB 1KPRA 3P9MA 5KVDL 3RVTD 1CDBA 1I7ZB 4NWTL 5BV7B 1FIGH 3STZA 4HXAL 1I1FB 3TEUA 4UBDC 5B38A 2CR3A 1I3UA 3CXDL 2DTMH 3W81A 2W0LA 4M5YL 1DQDL 2BXYA 2EDDA 4JHAH 4Z8FH 4QRRE 4GW4B 4RIRA 3NCYS 3KJ6L 2Y07L 4CNIB 4G43B 5HHPB 5KVDH 4NWTH 2ICEA 1CFSB 3CH8A 3OKOB 2HP4A 4HXAH 4H25B 4TTDC 3BIKB 4QTHB 4M5YH 3X3FL 1II4E 4DZ8A 1DQDH 4RWHA 5I1JL 1NLBL 2A6JB 2ZP0T 4NFDA 1QFUL 3LN4A 2FJGA 2HA1A 3MZTA 3FB7A 1PQZA 4KJYB 1MFDL 4OFVA 4XP1L 4WFGD 3KJ6H 2Y07H 3MGOA 5AD0B 2X41A 4GRLB 4WIQA 1DANT 2C4FU 2F8VA 3WUZA 5EORL 3V2AR 1U8PA 5IB4A 4NCC1 3X3FH 4APQA 3DARA 2OJEA 5I1JH 1NLBH 1IKNA 1AGDA 1QFUH 1ONQB 1EEZA 4IHOA 1MFDH 4OV5B 4XP1H 2X70A 4X6CA 5HYJE 1BP3B 2WBKA 2F53A 2CKNA 3AREB 3C8DA 3CCHA 2Q86B 2Q7YA 3BMWA 1OP5H 5EORH 5DD1L 4XBEL 1IAKB 4OZGA 5IVXA 5JOPE 3PE9A 4OKVA 4U1JB 1FN4B 3RTQA 1FZKB 1QEWA 1IC5L 1ZSDA 1QO3A 5GGRY 4WNQA 2NY3C 5F6HJ 2D4FA 1A0QL 3UTTD 1R5VA 5I8EB 5DD1H 1QLEL 5E03A 2ZNXA 4XBEH 1BZ7B 2V5SA 4NT6B 1CE6B 3QFJD 3UMTA 4KMLB 4G8GE 2P5ED 2WINB 3FHQA 1IC5H 2HWZL 1MJ8L 4XNMB 1D6EB 3ULUC 3SDAC 2X4PB 3ARYA 1GOGA 1A0QH 2CXGA 2NW3A 2UY6A 2DYPB 1QLEH 3VXQA 4JB9L 3VXSE 4WTWA 1JP5A 3OAZK 5DS8A 3K1DA 4XBPB 3EO0B 1H8NA 2HWZH 1MJ8H 3QDGD 1X5ZA 1BOGA 1RZKC 4N8VG 1S9XA 2RBLA 4JB9H 1AR2A 2FWOB 3WE6B 4KY1L 5IBLC 1SEQL 3UJJL 1E4XI 2VAAA 4MNGB 2OR8A 2ZUVA 4LRIA 4HUVA 2NY1B 3DOSA 1XF5A 3QEQA 4YIQA 4MB4A 5F89B 2NXYC 1EAPA 5B3JE 2XN9D 4L8SB 3BN9D 3GMLB 3KLSA 1I1YA 4L4TE 4NHUA 1LEKB 4KY1H 2OBGA 1WISA 1SEQH 5FO8B 3UJJH 1IM3A 4PJ5A 5DXWA 3VRJA 3O45B 3ARVA 2Z93B 2NY4D 5FYJH 1K5NB 4ONFL 1TQCB 2CLZB 1ACYL 3GMPA 3VXUA 2GK2A 1QSEE 2DIBA 1J87A 1PKQE 4GG6B 3VXPB 1K8DB 2OTUB 4YBLB 3V5KB 2HVKB 2X4OA 2YC1A 1PBYA 1X5AA 4GRMB 4ONFH 3V6BR 2GFBB 3G6JA 4KZDL 3ORJA 3MR9A 3F7QA 5KZCB 4Y16B 2IG2L 3MGTB 2ZSVA 4JO2L 2AXFB 4LP4A 3MODL 1CVSC 1KIRA 4Y5XC 1RIUL 5D2NC 2VZ1A 2VLME 2DD8L 4QXWA 5F96L 4X98A 2VLRD 4JM2F 1MELA 5E6YA 5CD5C 5FYJU 4TNWF 5C07D 4KZDH 3BPNC 3CDGB 4L1HA 1HHJB 1GC1C 4P3CL 4CRPA 4FTVA 2IG2H 2XKNA 1QOKA 4ZS6D 1GGUA 4JO2H 3OR7B 3STLB 3MODH 2WWKO 1LO2L 3H7LA 1CDGA 1RIUH 2YOCA 2DD8H 4LLVB 1JUFA 5F96H 4F15C 1YN6B 1LK3L 5KS9E 6CGTA 3MMEA 4RFEA 4P3CH 4MYWB 3TA3C 1MCCA 3RVWD 2HG5B 2HRPL 5IW3A 1UJ3C 5T5FH 3AMLA 3DYMA 4FXGB 1XF1A 5C08B 1CFTB 1MFAL 4D2NA 1NC2D 3O9WD 2BVEA 5DJZA 4M7KL 5SWSA 1AKJA 5C2UB 1LK3H 4MA8L 5J57B 3KYMA 1QKZL 3ARFA 3G5YB 3PDOA 1XGTA 2DS4A 4R3SB 4QHNA 3DX9B 1XR9A 2HRPH 1ZHBA 4Y8AA 1VFOA 1OAUL 3VFOA 5GGVL 3TWCH 3PDDA 1MFAH 4N1EA 1PG7X 5IFJA 2GT9A 2JELL 3IS1X 5J89A 4MA8H 1F4AA 5F7MC 3CFJA 3VD7A 1QKZH 2PW1B 3W0WB 3QXUA 4AG4H 3Q6FB 5FYKE 3FQWA 3OXRB 4EOWL 4Q6IB 3OHXA 1DBBL 2ZCKL 4M1GL 3QWOB 1OAUH 4OGXL 2E6QA 3BD4A 4XI5D 4MA1B 2X05A 2BSTA 2XXMB 1YNLL 2I25N 2JCCB 4LEOB 4R7NA 4RA0C 2JELH 4Y2DA 4F57L 2B7DT 2D7TH 3MNVA 4YHNA 4EOWH 1ZT1B 1S7VA 2VZ3A 1DBBH 2VL4A 4LOUC 2R1YA 2ZCKH 4JRYA 4M1GH 1YEEL 3E6FA 4IRSB 4OGXH 5DC0A 3MV8E 2AERT 4YPGB 4WUUE 1YNLH 5J1AA 4F57H 3F65A 2V9TA 2OI9B 2VAJA 1WGOA 5T5NF 1OSPL 4TVPE 3EYOB 5IP4A 3VE0B 1EMTL 1NJ9A 1RJZA 4G9FB 4JO3L 4Y4HA 4JN2B 4RGMC 4YDKL 1YEEH 2XY1A 1EBPA 1FV1A 4Q2ZB 3ET9F 2HFEA 2PYED 2WK2A 2EKJA 1V5JA 3NA9L 3ARTA 4LSVL 1CFBA 3BEVB 5D6DC 2F54E 1OSPH 4FQXB 4NKMA 2HVJB 4ODVL 1BX2A 5B8CC 5ISZD 1EMTH 4JO3H 4PJEA 4YDKH 4HS6A 4ZFZB 2E7BA 3VWKD 1VGKA 1S7RB 4L5FL 1NAMA 2NX5E 2HT2C 4FQ2L 3WFDL 4CL7A 4LSVH 5ANME 1T83A 3QO1A 4U1SA 3VXMD 1EFXA 2I24N 2ZSWB 5BRZE 3CC5B 4DWHA 3ULVD 3VD5A 4ODVH 1X4YA 3QA3B 2JE8A 2DQHL 4RGNE 2A0LD 2PXYB 3CPLA 4L5FH 3F7VB 3CJJA 4FQ2H 2EDEA 4U6TA 3T0VA 1J86A 1PZ5B 5BVJA 3HMXA 3PABB 1LNUA 4LCCB 1BFOB 32C2B 1MCSA 4ZUUB 2DQHH 5FYLE 4TUJB 1I7ZA 2EDRA 3WIHL 4JN1L 1GCFA 3MJ9L 3PP3K 4OZHE 4HIHA 1ADQA 3MNZB 4ZQKA 2R4SH 5B39B 1D9KB 4HX1B 4H8WL 4IMKA 3PGFL 5DF0A 3UAJC 1SM3L 5HHPA 4ZTPL 3WIHH 4E41D 3A6BL 4HK0A 4JN1H 1OCWL 3MJ9H 1Y18B 1WZ1L 1JI1A 4EI5C 2A38A 1I1AD 4AENB 1VEMA 3IJYA 3LKSA 4JM4L 3U46A 1ZAGA 2DLTA 4BK5A 4M3KB 5IMKB 4U3CA 4H8WH 3PGFH 2PTTB 3AAZA 4X7EC 1SM3H 4ZTPH 4UU9B 1QYGL 1RK1B 3A6BH 4GRLA 5EBMA 5B38G 1N64L 5MENB 1OCWH 1WZ1H 1QG3A 4HC1L 1F6LL 1ZV5A 1EVTC 1WIOA 2OXGA 5T3XE 1PGRB 2YSSA 3NAAL 3OKLB 4JM4H 3SKJL 3GI8H 4P2CG 5LGJB 4YR6A 3PWJA 2VXQL 1G84A 2YPVL 1JJUA 3C5SB 1QYGH 2CDFB 1UWEL 3AREA 1N64H 3OWEA 2J5LB 3QCTL 4OZIA 3B83A 2B1AL 2LAGB 1XGPB 4HC1H 4KK8C 4HZAA 3O4OB 3NAAH 3T8XB 2DQCL 3TT3L 3SKJH 2V2TB 2XPGB 5INDA 5F93C 1WBYA 4M8VA 1PAMA 2VXQH 2YPVH 2ATKA 5JA9A 1FN4A 2EIEA 2Z35A 2HLFC 3HE6C 1DDHA 3QCTH 1TZGH 2Y25A 4LCYB 3HCVA 4G42B 4G9DB 4BFGA 1FVCB 3ME0A 5C0AE 2BDNL 3BP6B 4ZYKB 5I8EA 1LO3L 1A02N 1EZVX 1WT5C 1AXSA 2DQCH 3TT3H 2NXYB 1DEDA 3O8XD 4OFDA 4S1SL 2DRUA 4AJ0A 4LPCA 4KVCL 2OXHA 2WINA 1XH3A 1GGCL 4Z7OE 1J1XL 4K3EL 2HT3D 2BDNH 1F00I 1LO3H 2D31B 2N7BA 2WBJB 2X1OA 2J8UE 4HH9B 1QLRA 3RDTA 4S1SH 3Q48A 3MV9D 3CK0L 4KVCH 4NQUA 4RDQF 1VA9A 4XBPA 4Q9CA 3BD5A 3CIQA 1X5JA 1ZXQA 3O6FD 3S88L 3WJLA 5CSGA 1IM9A 1J1XH 3QIWC 4K3EH 4PRHA 4D8PA 4HZLB 2NY6B 5F1IA 5DO2C 4W68A 5MHSE 3DX7B 5CGTA 3NZ8B 3NN8A 4JLRA 5D2LB 3PWPB 1IAOA 3TBYB 3CK0H 4DJMA 1QRND 1CYGA 1T89A 4MHHI 3S88H 3G08A 1ZOXA 1NC4D 4POYA 4PYGA 5EUOF 4Y5XB 3DGCR 2BOCB 3ALPA 4DKAA 3VGDA 4RMWA 5GIRB 2C1PB 1KB5B 5F1OB 3BPNB 4GRWH 2Z93A 1XIWC 4S1DC 3X12B 4MQSB 1RUPL 1IC4L 3UDWA 3VGEA 1A6VL 4DTGL 4F15B 3MUZ1 1T20B 4HSQA 5KN5B 3RQ3A 2P42B 5E6IC 1BBJA 4KMQA 5BQ7B 2I26N 5I75C 2X89A 3GB7A 5H35A 3QZWA 2UVFA 4GRMA 2R69L 4F7PB 4NNYA 3BP5A 1T04B 1UJ3B 5BJTB 1RUPH 5F3HB 1IC4H 5FKPB 5HYSA 1A6VH 2XQYK 4C4KO 4R4ND 4DTGH 1AE6L 5GSVB 3MGTA 1MIML 2P8PB 1RD6A 4EN3C 2R69H 4PBWD 3KPNB 3JTTB 5H2BB 1ED3A 3VFRA 1AO7A 1PSKL 1U8MB 5L0QB 4APQD 3BWUC 1LD9A 2LFGA 2UWEA 3WFHB 1NAKL 4GQPH 4EKXA 2EIZA 1MIMH 4FQHB 3UX9B 4Q97A 2F53D 5CEZD 3K3QA 1A7QL 1XGQA 1PSKH 1YEDB 5TJWK 4RNRB 3SOBL 1IKFL 1GXEA 2E7LA 1AI1H 1KB9J 1UYWH 1TMCB 4LP5A 5F7WC 1U92A 4XRCB 4EQ3A 3RTQD 1FYTE 4J12A 1EVUA 1A7QH 3MRHA 4U1LB 4NQSB 5HY9B 3OKDB 5CBEA 4H20L 2GY7B 3BRGC 1FVDB 2AK4B 3SOBH 1IKFH 3G5YA 1JPGB 2YKLL 4YO0B 3ILQD 4R3SA 1ORSB 4E9LA 3BAEL 1W0WB 4ZSOB 1MSPA 2MWCA 1FCCA 2HJKB 3R06B 4QNPF 3BIAX 3MSPA 4X4YA 2BHZA 3KPPB 3KWWB 3L7FB 1MCWW 1OF2B 4H20H 4PJGA 3Q6FA 2F5BL 3UTZB 3OXRA 1KEGL 4MAYB 1MH5B 2YKLH 1F11A 4P59L 5E70A 4NQDA 5B4MC 4P23A 1EIBA 3BAEH 1IT9L 4R7DB 1KB9K 3C9NB 5E2TL 5B8CB 4KK5C 4LEOA 5H8DA 3GKWL 2Y5TA 4I13B 1JRHI 2FO1A 1BF8A 3ZHDA 4MCYA 1G7LB 2XTJB 5BMFL 3IAGC 3QUXC 1CVRA 2DJUA 2F5BH 4CVXA 2CDEB 5F3BB 1KEGH 4P59H 1ZHKB 3E0GA 3T65A 4N0UA 5DJ8B 3NIFF 1IT9H 2EC8A 3RWJB 5E2TH 1HI6A 4OZFH 2P7TA 3FMGL 4F7CB 4YPGA 3DNKA 3QEQD 1T3FA 3UROR 1XGYL 4CDHA 4WFGE 3GKWH 4JRWA 4CADA 3SDXF 3QB7C 5BMFH 2VLLB 2FRGP 3IRZA 1X5HA 5FGBA 4QY8B 3DROA 3EYOA 4LQ1A 1W72B 5CHNB 1VFBB 1VERA 4CVWA 5D7JC 1MQKL 1NCNA 2GEEA 3L3HA 4PJ5D 1NBYA 3SPVA 3FMGH 3PWNB 3U2SA 4QF1B 3B3IB 3S34L 3AROA 1XGYH 3OAYH 4ZNCD 4CUCA 5CD3B 1HSAB 4PRAB 1YDPB 3U0WL 1YPZF 4JY6B 4ELMB 1KPVA 3BEVA 4J3OC 3VXUD 4XNZC 3QIBA 3MACL 1BD2B 2BSED 2FIRT 2HVJA 1NGWB 3LPFA 1I7UB 1RIVL 3OJDB 1MQKH 5HGAB 3D25A 4NDMB 2AQ2A 1C5DB 3VDAA 3S34H 4PJ7A 1M71B 1IQDB 1I1RA 2Z0BA 1KIPB 3U0WH 1CU4L 4BH7A 4FMKA 2G2RA 3CC5A 3L5HA 5LQBL 3TT1L 3MACH 2W9LA 3UTTE 1VKXA 2XXCB 1F6AB 3QA3A 5EIIA 1RIVH 1T80A 3CSBA 3VGHA 5A1AA 2PF6A 3MXWL 3WO4C 4W6WB 3MLZL 4PS4L 5DFVD 1P2CB 4MX7B 1OGTA 3QFJE 4OSUL 5JUEL 2P5EE 2Z8SA 5FKAB 3PQYA 4Z7VE 4QRUB 5LQBH 3TT1H 5GGSA 3IFNL 4JQVA 4FTVD 5D93B 3BPOC 4TVSa 3HB3D 5F97E 4ZUUA 3MXWH 5ESAB 5GS0L 3MLZH 4PS4H 4RGOL 4MD0B 1DLHA 1HOCB 3EO1B 4OSUH 5JUEH 1S7SA 2HJLB 4NKDA 4C4KT 3IF1A 3QDGE 2FX7L 3IFNH 3GUTB 4NGHL 1U3HC 5DQ9B 4TOYL 4CN4A 5TF0A 3RNKB 2UY7A 5GS0H 1CLOL 4Y0GA 3UTQB 4RGOH 4NQXB 4ODTL 4WW1B 1MQ8A 4JFQB 5SWSD 1AKJD 1QACA 1OD7A 4LLMA 3RX8A 3ARFD 1QLFB 2FX7H 3IDJB 5IMKA 2XN9E 4NGHH 4WTXA 4TOYH 1TZHA 5HGHB 1CLOH 3MRKA 2OCFD 2MTPA 3WHXA 1UC6A 4ODTH 4X99B 4WI9A 3NA4A 4G6KL 1MFNA 1CT8A 1PZUB 5C0RL 3DVFA 1Z0NA 3T04D 4ZXBB 4U1NB 2GCYB 1BFSA 4POZD 1EEQA 4MA7L 1FSKB 2KUTA 1RURL 4HWEL 3SN6N 1A6ZB 4XB7A 3C5SA 1OTUD 4G6MH 5IWLC 4UQ2B 4MNQB 4G6KH 1QA9A 4PJDA 4Y2DD 3U30C 5C0RH 3T2PA 3PV6B 4RX4A 5FECA 3QIWB 1H3PL 4MA7H 1KIUA 1RURH 1RUML 4HWEH 1TDQA 4JCLA 3RJDA 4JRYD 4NNXA 3QYCA 2J88L 2ID5A 4UZGA 4LCYA 3GMRB 4G42A 5HVGB 4X0KA 4PYHA 1FVCA 1T5WA 3GGWB 3SDXE 4HWZA 4ZYKA 5FV1L 4WI3A 5L9DH 1T5XB 2VLRE 1FNEB 4NRXB 1H3PH 2X7LA 5C07E 1RUMH 3MLRL 1LEGB 2IANA 4Y4HD 2M1KA 4FQQA