5F1SA

Crystal structure of the teleost fish polymeric ig receptor (pigr) ectodomain
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
206
Chain Sequence
RVTTVGDLAVLEGRSVMIPCHYGPQYASYVKYWCRGSVKDLCTSLVRSDAPRKVVMFDDPVQQVFTVTMTELQKEDSGWYWCGVEVGGVWSADVTASLHINVIQGLSVVNSMVSGEEGTSVTVQCLYSQGYRQHEKRWCRSGDWSSCLVTDGEGRYEDQAVEIRDDLTKAFTVTLKGLARRDTGWYWCAAGQQQVAVYILVTPPSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords polymeric Immunoglobulin Receptor
publication title The structure and dynamics of secretory component and its interactions with polymeric immunoglobulins.
pubmed doi rcsb
source organism Oncorhynchus mykiss
total genus 55
structure length 206
sequence length 214
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f1sA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f1sA02
1MLBB 1Q9KB 4UINL 5JOPD 1BX2A 2NY2C 4WO4A 2ADIA 2C1PB 1HSAB 2IH1B 5F6HJ 4EDXA 1K4DB 3RWEB 4LLYB 5BZDB 4GW1B 3JV5A 5JORB 3ULSB 1N4XL 2WP3T 2VDML 4NKDA 1X44A 2OS7A 4I13B 4NKMA 1CGUA 3MBEB 3G5XB 2OM5A 1OAQH 4XNXL 1KFAL 1FVDA 1HNFA 1MIEL 4XPBL 3QDGD 4OQ1A 1KPRB 2X09A 3SBWC 4H20L 3S4SG 1U8NA 3RJDA 2VZOA 4DZBA 4K94L 2XT1B 5I17A 4OGZA 3FRPG 2EE6A 3U2SB 4MAUL 2EEBA 1IQWL 5GJSH 1A7NH 1C08B 3WIIL 2FZ3B 5J1AB 2R0WH 4WEUD 2NYYD 1S7VA 3HCVB 5F3HB 3WS3B 3WFCL 3CC5A 2QQNL 1C5DB 3U7YH 3GUTB 1S7SB 3GMOB 4GXUN 3B5GA 4HS8L 4YXKL 4NKOA 1IT9L 4WRLA 2WLYA 4XVJH 4RISL 4OZHE 1EXUB 1KPUA 1L7IL 4GXUM 1R3IH 3ZYIA 4L4VE 1SVZA 1RZ7H 2A6DB 3O6KL 2QHRH 5T5FL 2YUZA 3MCLL 4D0DB 4LHUA 1YMMB 2BOBB 3FCTB 4LP5A 3TV3L 2EDYA 3IDYB 3RGVC 3CZJA 4JPWH 3V0WH 4JM2A 1T7XA 1GOFA 1OGAE 4WI8A 2HLFC 3TZVC 4LNRB 5IEHA 1QACA 1Z2KA 8CGTA 4U1MA 3T1WA 3B5TA 4UV7H 1FO0A 1FRGL 4ODSH 1PKOA 4GRLB 2PYEE 3IETA 3VFPB 2EYSA 3MYZA 5DA4A 4WUUE 1CL7L 4WTZG 1GXEA 1OGAA 4RAHA 3U6RB 1KIPA 3QEQD 3TC9A 1JN6B 3S37L 4RFEA 1M71A 3AS3A 3K46A 4MLSA 1CQYA 1CD1B 4GLRI 3QEUB 5B39B 4I0PB 1UQSA 1Q9OA 3IDMA 2PYEA 3BN9C 5AG8A 3S36X 1R5WA 4ORGA 5CGMA 4WUUA 2FX9H 4PJXE 1MCKA 1YJDH 4R26L 4E41E 5JHDE 5D5MA 2AK1L 3BDYL 4JFPA 4WGVB 1BJ1J 1M7IB 1ZT7A 2AEQH 3PP4L 1S7TB 1T1YA 4LAQL 4XHQA 5CMAA 4HIEB 1N6VA 2YN3A 1P4IH 3PWVA 4P23C 4PJXA 4ZAKB 2D4DA 4E41A 3U9UA 5JHDA 2XZAH 4NCC2 4U6YB 5ID0A 3RY4A 5TE7H 4GW5A 3ARDD 1IGJA 2EZ0D 1BVKA 2NY3B 4O9HL 1Y6MR 1AO7D 1V3LA 4ERSH 5LWYL 4PRHB 3S36H 3WFDH 3QXVA 2CPCA 4U2YA 3FQNB 1MHHB 5J56B 4UDUB 1NGXB 4PPTA 2NZ9D 4XVSH 1KTDA 2F53B 3KG5A 5KSAC 3WXWL 2MOVA 1B0GA 5HHVL 5ESQB 2F58H 2E27L 2O5XL 3P4OA 4WWKA 5TDPA 1D5BA 2GAZB 3T0EE 1DVFC 3EJYC 3QHTC 2EE9A 2DKUA 3DBXA 3TBWA 3VRJB 3MBXL 4H1LH 1FL6B 3RHWK 1P6AB 3RWIB 1LEKA 1UJ3A 1G7JB 1HILA 3SDCB 4QHKJ 1Q9WB 2X4NA 1F5WA 3ZE2F 2OL3A 5E08H 5EC2B 4X6CA 1ZVSA 3T0EA 2NY0D 3HLAB 3P0VH 4I48A 1XIWD 1IGYA 4GBXD 1NFIB 2ZOLB 5FXCH 2MJWA 5L2JA 3QP3A 4GKSB 3V4VH 1H8NA 4IRJD 3FO9B 3KPRA 5IT2H 4LEXL 5JOPE 5MEQB 1T22A 5JW5A 2BRQA 4TOYH 3Q3GB 2MCG1 4XP1H 2XFXA 1SBBA 2A0LC 2X89A 43C9B 1G7PB 4DKFH 4DCQB 5LBSH 1FCGA 2OYPA 3P4NA 3TF7C 2K9UA 3GBNH 2AEPH 3QNZB 4WY7H 5GS0H 3QEHA 4UQ3B 1RUKL 5C0CE 2J5LC 1A6PA 1NCBH 4ZUSA 3ARFA 4GMSH 2DQDH 1L7TL 1YNTB 4LFHD 1K3IA 3MROA 1CS6A 1F58L 3QDGE 1TQBC 3U30B 2AI0L 2VSDA 2XN9D 4UU9B 2AGJL 2YC1B 4X7FC 5C0CA 4KKNA 3ZTJG 1CICD 5GGSY 3HPJB 2GJ6E 4D9LL 1YA5A 2HYMA 4GW4B 5I75B 3L7EA 5IB5A 3MLPA 1NAML 4KRPB 2WBJA 1F11B 4R8WL 2ZOKB 3C60D 3WIFA 2VZVA 3ZLQC 4RMUA 4BKLA 3WD5L 2GHWB 1XGUA 4NM8L 4WI7A 3AGVA 2GJ6A 5EUKA 2BOCA 1HYRC 5KVFH 4X9HA 3I75A 4G8FA 3TH3T 1KELL 2CLRA 5EA0L 1I85C 4L8CA 4QTHA 2DQHL 4RAUB 3O4OC 1Q94B 3F12B 5E9DB 4HK0B 4X8XA 4DGVH 3CZFB 3CNKA 2ICWB 4TUOA 4PP1D 3UZEA 3AU1A 1MJUH 2QSVA 1MFBH 4LFHG 1PY9A 3RWHB 4LCCA 4MA3A 3RWDA 4GAGL 4JHAL 1FFPB 5KG9B 4X6BA 5H2BB 4X7SL 4DVBA 1F6AB 4JRXE 3ZTNH 3O11A 5EWIL 2IPUK 4JZJA 4MQTB 2FD6H 2UYLA 2NXZC 4YGAB 3W5NA 4ODTL 2GJZB 4HLJA 3V4UH 1ND0A 2HTLC 1GAFL 3QEQE 3FJTA 2XTJE 4KMTH 5D70H 1BOYA 3OXRB 4JRXA 3U4BH 1E6JH 1P2CA 2OTUA 1XMWA 3K2UL 3TN0D 4N5UA 3SQOH 3FTGB 2J6EH 4XMKH 5I76B 4G7YL 4BQ8A 3TA3C 2Y07L 5ITFB 4HPOH 3U36A 3QEQA 1INDH 2B7DT 2J2ZA 1TZGH 4V2BA 2EDXA 4P4KD 4Y5XA 1P4LB 1OAYL 3V2AR 2HTKC 2YPKB 5D2LB 4AEFA 2AVGA 2XWTB 1FORH 5FDYA 1EFXD 5KSBB 2R0KH 1WSST 5MP6H 4TRPH 2F54A 4RZCB 4RQQA 3T09A 1JI2A 4XVUD 4MSWB 5K93A 1FZMA 2YD5A 5JIKA 1MY7A 1LO5A 3HRZB 3I2CL 3CFJB 4NN5B 1MLCB 3CAFA 1P4BH 2HVJA 1BHGA 5LQBH 4KXZH 4X7DC 3PQYB 1NGYB 2ILLA 4UIKH 3FB5A 2MKWA 3S96A 1L0QA 1MJJB 1WBZB 4MVBC 3S88L 3DUUB 1LGVA 2DLHA 3BEWB 5IV2B 3MUGA 1TZHB 2K1MA 4C83B 5DMIH 1KJ2L 1XCTB 4OCLC 1JGLL 2YUVA 3OKNB 4LLQA 4U1KA 5IFHL 5LGJA 4HFUL 4FQJL 1CWVA 1F2QA 2LQRA 1MRDH 1JGEB 1DL7H 4OCYH 3EOBA 2OTWA 1NFDB 3KYNA 4OKVA 1YPZB 1FL3B 2BSTA 3EYVB 4X6FA 1MEXL 5SX4H 3CDYA 3DYPA 4XHJC 1I9IL 3R1GL 1W2KT 3G5VB 4NQEB 4M7ZB 3ZKXC 1U8JA 1FZOB 1QSZA 1DN0B 2BVOA 4RMTA 4R6UA 1JYNA 3FQXB 1NMBH 4QHLA 3MCKB 1IM3A 4E42A 5A3ID 1U6AL 4U1LB 3VFOB 4UNUA 1KCVL 3S35L 1T6WA 1YEGL 3LN4A 4XAKD 1R0AL 1WWBX 1KV3A 1AXTH 1X5HA 5GSVB 3BH8A 5EO0B 5I8CB 4RNRB 4F37K 4WJ5B 3BYYA 3DNKA 3TNMB 3MLWL 2DI8A 3IFLL 1FFOB 2IQAA 3E6HA 2M8XA 4LRIC 3F65A 3JTSB 1B2WH 3RWFA 4P2RD 4X5WB 1M7XA 3RVVC 4KI5E 1G1YA 4H5SA 5LGHL 3PNWB 2B39A 4N1HB 3UBXI 2QLVB 3OR6B 1P9MC 3MJ8B 2XN9E 1GJIA 1BAFH 5D7KD 2FB4L 3JTTB 4MDIA 2Z31B 3RWCA 2LU3A 1UM5L 1KCRL 4XP9H 3P30H 3N9GL 4AEIH 2R0ZH 4QNPE 4NC0B 5L9DL 3VFWB 5GS2D 5JIHA 1RIVL 1PX3A 1YY8A 3REVA 3UDWC 1WFOA 1U93B 3W5MA 2E7HA 2XKSA 1C1EH 2AJ3A 3IFPA 4WV1A 4X6EA 4X80L 1MF2L 1QSFD 4N9GB 5ESAA 4F7PB 1U8HB 2QSTA 5HYEA 5IKCA 3GI8H 1RFDL 1JHLL 2ZJSH 3HC0B 2HJFB 3V6OC 4NRYA 4K8RL 1YN7B 3HZYB 3LEXB 4JJHA 4MB3A 3S34L 2XY2A 3WFHB 4DKDC 4HWBL 4X0KB 3QUXB 2AJSL 1A5FL 1HNGA 5D5MF 3D85A 4PJ7E 5DHXB 1EPFA 4BM7A 1H3PH 5E8PA 4XXCA 5IQ7H 3K0WA 2AJYL 3PHOB 3F7PC 4KKLD 2Q87A 4NP4H 4L3ED 3O4LA 2VWEC 3ZT5A 1WVZA 1IFHL 3FN9A 1IM9A 2ZUVA 4R7DB 5DEFB 2M2DA 2ICES 3CFBB 4APQA 5HDLA 4I8DA 1IQDB 2H26A 1ZHLA 5FM4A 3VWKD 2DWEB 4N8PA 2WQRA 4FNLL 3MJ9L 2CJUH 1MREL 1LDPL 4M7KL 3ZHLA 1KF9B 2ZCHH 4PJBE 3DTXB 1IKNC 3P11L 2MHAB 3BKML 2VITB 2P43B 3LH2H 4UDTA 2AXJA 4FMFA 5CSGA 4M5YL 1FDLL 2EKJA 1MIML 5C86A 3AAZB 1IKFH 1FZKA 2Z92A 3ULUF 3O2DL 3PWUB 1A6ZB 2CDFB 1JFQL 4YAQB 4TVPD 5F9JB 1ZGLP 1R5VA 1C7SA 4OFVA 4HIHA 3BQUB 1GRWA 1UB6A 2ED8A 3MGTA 4LPTA 3OKMB 4LSSL 1J0IA 4HIIA 2I24N 5C70A 2A77H 4Z7UE 3PWJB 4CMHB 4JFXA 5HI4D 4X6CF 1EIBA 4HWNA 2F74A 3R8QA 2VISA 3VG9C 4GS7C 5TDNA 1GSMA 3MRBA 4U1SA 3B2VH 3BO8A 5F7EL 1W8OA 4GLRH 3RVTD 1IGIL 2IG2H 1H8OA 4MD4A 4OUUB 4XMPL 4OZFA 4LSTH 5J89A 3V0AC 1UG9A 2FX7H 5D7JA 2D0GA 3BKYH 3WFBH 2YWZA 5EUOF 2FJHB 2ADFL 2KUTA 1H5BA 1FNLA 1X7QA 3LKNB 2R29L 4PB9L 5E2UH 4XPFH 3MODH 4PGBA 1A22B 5TGBA 3MV01 1NLDL 2E3VA 2VL4A 2HKHH 3B9EA 4MCYA 5AEAA 3EOYG 3I9GH 4HX1B 1GGTA 2Z8WC 2J7LA 5JQ6H 3GIVA 2YBRA 4ZOEA 1AFVL 3WS6C 4M6NH 3V6FA 2G5BB 1QYGL 1KBGL 2NY6C 5HVHC 4C56D 1MFAL 1QVOA 4GMTL 2IH3B 4KKAC 5CSZB 5C07B 2CD0A 4JM4L 4NWTH 4S2SB 3A6BL 1A3LL 4FXKB 1MVUA 1NEZA 1KN2L 1SEQH 1KC5H 4FP8L 4GAJH 2V9TA 1FL5A 4OCRH 2X9YA 3OL2A 1NC2B 1X4XA 4NQTA 4BA8A 2CO7B 1PJ9A 2JIXD 3QUYD 4EN3A 5I1LA 1LK2B 2JF1A 2WP3O 2R2HA 4GXVH 4XAKE 5C0IB 2EECA 1KJVB 1MCCA 1S8DB 2DTML 4PJCA 1VEOA 4WU7B 1NAMA 3AXLB 3KPNA 4X99B 5B8CC 4P57A 2V17L 2PXYB 3E6FA 4JFHD 2HLAB 4JEGB 4LKCA 4JR9L 1HEZB 4NRZB 4OV6F 3RDTC 4N0FB 1OVZA 6CGTA 1JTOA 1BOGB 1UM6H 5E6ID 5F7UA 1CG9A 1MCOH 4NIKB 4P2RE 3CSYB 3KXFD 3HNVL 32C2A 2KZ1B 4M4RA 2H32H 1FG9C 3BWAB 2ATKA 1E28B 5D7KE 5GJTL 3GSQB 4R96A 1JHTB 3TO4C 2PW1A 4HT1H 1MFEL 1WBYB 4QTIL 3CJJA 4L5FL 1RJLA 5D2NC 5KOMC 1Z9LA 3HE7D 3CUPB 3V6BR 5T3XD 5F8QC 1U8MA 4UZGA 1U8IA 2DQJH 4AH2B 5E8DH 5GRVK 3HE6C 4NOFA 3VXOA 3O9WC 3VWJD 4ZD3L 4LPVA 1XZ0A 4OLYH 2HT3C 5C7XH 3EDDA 2EE3A 1R3KB 1HXMA 1QSFE 2NXYD 3BXNB 4JKMA 4IOFC 4QRPD 3OGOE 5DA0B 5BZWA 3KR3H 4YHKH 3LN9A 4IRSA 2BMKA 3QJHB 3HG1D 1S7UA 1VFOA 3GRWL 2PTTA 1YEIH 2FL5A 4KKCC 1HOCB 3WJLC 4KY1L 1TZIB 4KAQH 1JL8A 3ARBA 1TJHL 2GUOB 4JG0H 2MWCA 5H35B 1FHGA 5K33A 1A9EB 1LVEA 3ILPA 4NQCD 1KB9J 1NGWA 4L3EE 3WO4B 5JHLH 1S3KL 3DSFL 1XF4B 2J8UF 3L9RA 2WM0A 3G08A 1RUMH 3VG0L 2VLJB 4JCMA 1N5AA 1S7QA 4OZGE 4EVNA 1VGKB 1ZV5A 5IHBA 3UTPE 1QFUH 3T0AA 4ONGL 5LJYH 1FAIL 2JELL 2YMXH 1TCRB 1AKJA 3ULVD 2H9GA 2ITDB 1I3RB 2RCSH 4TPRL 3QT2A 1G7IA 1ETZA 2HAZA 4HKXB 2FEDD 4MQ7A 4PGEB 4JQXC 2Q86B 5HDQL 1JRHI 4OZGA 2JJSA 1P7HL 4IMKA 1ERNA 2NY2B 3DX6A 1SM3L 1A0QH 1CBVL 2V7NB 5DK2A 1VPOH 2NTFB 4LLUB 1RZJH 2BVQB 5FHAH 1ZHNB 5CEZL 3O6LL 1A7PL 4TVPE 2HRLA 5LXGH 4G80A 4UTBL 1DQQA 2VQUA 4OJFH 1RK1B 1QTYT 1CE1H 1KJ2A 2NQCA 4QRQA 4F9PC 5GRXG 5I1EH 4OT1H 3O3BB 4EBQH 3J7HA 4FHBD 5HYSG 3S5LG 5GIRA 4UT7H 5CIPB 5JZ7C 1JPTH 1Y0LA 3C6LC 4JZOB 1JZ6A 5GGTH 1QO3B 1T20A 3O6ML 3EYSH 3RU8L 3RBGA 2RGSA 3O2VL 5GISL 5CLWA 4XCEA 3T8XA 1AHWA 3QIWD 3QNYB 2XWJB 1WUNT 1RY7B 4PD4J 3QXUA 4Y5VC 5D72H 5GZNC 3VXSB 1YYLL 3BIKB 2XYCA 3BEVB 4X9FA 5EIIB 3QCUH 2DYPA 2IAMD 3QUMB 3RL2A 4MHHG 3ROLA 1EAPA 4FZEL 3UJIH 4FQCH 4ALAL 3MCG1 4E0RB 3QIUC 4OIIH 5I1KL 1HKLH 3VXRD 5JO5A 1KYOJ 5CLTA 2XG4A 3FOLB 4YHIA 5MEND 5D71H 3L5WA 1T1WA 3MV8E 4FQHA 3MLSL 3SDDC 3V5HB 3Q6FB 3TBTB 4K71B 5HYJA 3I6LD 3C9NB 4PJ5A 1CLOH 1OM3L 3IKCB 4K7FB 1BGXL 5HJ3B 1AGCA 4WO4C 2DMBA 1D9KA 5GSRA 3RGVB 2DICA 3VD3A 3G5ZA 2WNGA 3MRRB 4PJHB 4LKXB 1DLFH 5DJAB 1PSKL 4HBCH 3MV8A 3D69B 5CP3H 5A2FA 3MJ7B 4N5ED 2YPLA 4G8EA 2KKQA 3F6LA 4XNMB 3NCJL 3G6JA 1I1YA 4X9BA 1MI5E 3ARUA 5D1XB 2AXFA 1I7ZB 3MOQA 4R3SB 5F72S 2ICEA 2X1WL 2A9MH 5DUPL 3RNQB 1FNEB 5I18L 5CCKL 2WWKT 5FKAB 2BNRE 1ZLVH 4UUJB 5I1JL 2R4SL 5BOPA 4UB0L 2I9LA 5I9QB 3M17B 4MA7L 4ZG1A 1QD0A 3MV7D 2X4SA 1MI5A 4HJ0C 4NBZB 1RU9H 1INQB 2FJGB 4PRAB 2DIJA 4ELMB 3EYFA 5IM7A 3CMOL 1PEWA 1JYXA 3KXFE 2BNRA 3SN6N 4Y4KB 4HWBA 4ISVA 4JN2B 1AGFA 3RIAK 4HUXA 4K23L 5LAXA 4RSVA 2Z35B 2B1AH 2CLVA 1BEYL 3V9FA 4WTXA 5CGTA 2D2OA 3Q48A 4PJEE 3FONA 4PJ8D 3F7YB 3FAWA 4JPKH 3U0PA 3D9AL 3NZ8B 5L7XL 2EYRB 4FABH 2G75B 1DLHA 1WEJL 3C5ZA 3EJZC 5TE6L 1R3LA 3C8DA 2GI7A 1AO7B 5GGQH 1WV7T 1KCSH 2Y36L 1EDQA 1JTPA 1S78D 5KJRL 4JAMA 4JM2C 4PJEA 3ZKSD 1LO4H 3LEYL 2P7TB 2MCPH 3PIQB 4HH8A 4PJDB 5IVXB 3K3QA 3UPAA 4X9IA 3IU3A 4YHPA 3BSZH 5CHNB 4DQOL 5DJ6B 1UEYA 1U8LA 2VO5A 4P2OA 2JTDA 2GIYA 3MRMB 2CDEB 5KSAB 3D0LB 4Q9QH 1GIGH 1PLGH 4YQXH 5SWSD 2VLLA 4OLVL 1P1ZB 2Z4QB 4NQCE 4UILH 4MA8H 2IPKB 1EHNA 4AEHH 5EN2A 1G9EA 1I8LA 3O2DA 1LP9E 3CU1A 4HWZA 4PGJA 1CDIA 1FFRA 5JMOC 1SY6L 1K5NA 4PIRF 5DJ2B 4ZXBD 4XWGH 2X4RA 3F58L 3VXPA 4LDOB 3IAPA 3GMLA 3RQ3A 1YC7A 1M4KA 1V7MH 1LE9B 5I2IB 1EEZA 1T0MA 2XACC 4LSUL 4KV5F 1KGCE 4JFDB 4PJFB 2VLRB 5C0NC 1A7OL 4P3DA 3ULVE 3KNBA 1LP9A 4C4KT 4ODXA 1MSPA 5DYOA 1IARB 1N2RA 4Y1AB 3HMWL 3OMZA 4MD5B 1F4WL 2UVEA 5HSFA 2EDHA 5I74C 2FRGP 3LMJH 4LHUG 4MMZC 4YBLB 3D18B 1QEWA 4JKKA 3L7FA 5L6YL 1NCWH 1BZ9A 3T04D 3QHFL 5IJKA 1EHLH 3VFGH 3BPCB 4LVNC 1A1OB 4NOBA 2WAHA 3O3EB 1LD9B 1F3DH 4EXPX 1H0DB 3QUZD 1F4YL 2R1YB 1T2QL 4RGOL 3WDHA 3IJSA 1P7QA 2J5LB 12E8H 5EB9A 1P84J 1CLZH 1T03L 4PR5A 3CFKB 4O4YL 2VXVH 2OXHA 5MHSD 1YYMH 1F3JB 1Q0XH 1TQBB 3OPZH 1CICB 2FHCA 4OSUH 3AROA 3HZMA 2Z8SA 1YEHL 5F7LB 4WWKC 2EIBA 2EDQA 3ULUD 3SKNA 2IGFH 1KB9K 3EHBD 5GRVL 5DRZB 3VXME 4R4BA 3U0TA 4YR6B 1UJ3C 4Z7WE 3LD8C 4PJCF 1JYWA 1OAQL 3KPLB 1MVFA 3VXRE 3ZKNC 5MENE 3IJHB 4W6XB 1ED3A 5A16B 3T0EC 2VXTH 5GQBA 5BXFB 5BVJA 3PDOB 4YDLC 2PYFB 3R0MA 4NM4H 1KIRB 2CKBH 4W4OA 1ES0B 3I6LE 3VXMA 5GJSL 2B2XL 3OX8B 3O4OB 4Z7WA 3ARQA 2R0WL 4U3CA 4X4XB 4QOKD 4YIQB 3MRGB 4JG1H 3VXRA 3VXNA 1XR9B 1W0VA 3U7YL 3EOTH 3DV4A 3N1QC 4O2EB 4CADB 5IMMA 4CRPA 2P48B 2YA2A 5FYJL 3LQAC 4LCYB 1GPOH 4F7TA 1FNSL 5BV7C 2BCKB 5KSVA 1R3IL 3QI9D 1RZ7L 3RUGF 4RX4D 4UNTA 2F8XC 2NXZB 3ARFC 1RZGA 1F90H 1GZQA 3I6KA 4O58H 3U46A 4KQ4L 2XPGB 3HC3H 2HVKB 5DQJB 5KSUB 2FWOB 1YEFH 1A6TA 4IDLA 3L3HA 4TYUA 4JPWL 5FAAA 3QDAA 3V0WL 5T1KB 3FFCD 1VERA 1YMHA 4JQVA 2PCPA 3MV7E 2VZSA 5FK9A 1VFAB 3BUYA 2W65B 2BY2A 3NN8A 1R24A 1BFOB 2NY5H 2UUDK 1T2XA 5C0FA 3TA3B 3MX0A 4UV7L 4ODSL 2X70B 2WBJC 1I7TA 3ZE0E 4G9DB 3T0WA 4PD4K 3GRWA 4FXGA 4JREC 2CIIA 1BFVH 4MJ5B 5E1AA 4RMQA 3RPIA 3OQ3B 2HJKA 2EDBA 2ESVA 4FN0A 5F7HA 2NYYC 1J05B 2GSGA 4G8GB 5DLML 1KYOK 3ECBB 5CSBA 2EICA 2NX5B 1RPQA 3H9YA 3QAZC 4NQXA 4HWEH 5EBLA 3FB7A 3SDXF 3MV9D 2CRMA 3Q1SH 2WMPA 3KVQA 3LSOA 5F1NB 1C8PA 2EYTB 2P5WE 4LCCC 3FFDA 3GMPB 5J3HD 1NC4A 2AEQL 1JWMA 2DQFA 2XQYK 2EO1A 4P3CL 1NAKH 4JZJC 3L3IB 1P4IL 4MGXA 1CZ8H 3VFUB 2P5WA 2XZAL 5B22A 4BK5A 5TE7L 4ODUB 3QSKB 1DJSA 3EBAA 1S7RA 3G6DH 2FO1A 3B9DA 5I1HH 2HFEB 1AD9B 4EUPG 5CUSL 3QIBB 1U8KB 4ERSL 3W0WB 3S36L 3WFDL 4Y5YB 1BQHB 2BDNH 2P8PB 4HS6B 1Z3GH 4JPIA 4P2QE 3VXUD 1R5IB 1IRAY 1NMCC 3QDJE 3JV6B 4KU1A 4NYLA 4XVSL 4CVZA 3UTSD 4AQOA 2XTJC 4BUGA 3ZKXB 2ZPKH 3C5JB 4ZPTB 4Y5XC 2C3VB 4K2UH 2IANE 5JA8B 3T3ME 4M1CC 4P2QA 1IGMH 3QDJA 3SKMA 4ZPVA 3WXVH 3JV0A 3FT4A 4WGWB 4O51A 4TNWF 5GGRA 4Z5RA 1JPFA 1G6RH 43CAB 4XPTH 3OKYA 3V7AE 2AK4E 5E08L 4HIJB 5AZEH 1I1FA 3KWWA 2IANA 3L6FA 4JDVA 3SHSA 2CK0H 3P0VL 3T77A 5I6XC 3QRFM 1YY9D 1CFSA 4OD3H 3HB3D 5E2VH 1HDMB 5IT2L 4D9QD 3DMMA 2Y23A 5CP7B 4BZ2L 4MJ6B 1NCDH 2AK4A 4GRWF 4XP1L 2XY1A 4DKFL 1AR1D 1FYTB 5LBSL 4WI2A 3UTTB 4I18A 4L29B 1JRHH 3BP7A 3GBNL 2AEPL 4LSDA 4H25B 4WY7L 5GS0L 1S5IH 1S9XA 3MRIB 3O8XD 1NCBL 2DLIA 4AL8H 4GMSL 5FYLH 4KGLA 3GSNL 1TFHA 4GO6B 4L9LC 1I8KB 1J8HE 3TEUA 4RFOL 1HHGA 5ANMA 5L0QC 1G7LA 2ATPB 1M05A 1JVKA 3HR5A 4PJ9A 2N7BA 4IJ3C 2BNQA 4K94C 4I5BA 4X6DF 2QSCH 1DCLA 2YXFA 2QQQA 4Y19B 5DMKA 4QHNA 3PABA 3RIFF 1XF1A 4DFHA 1J8HA 1P7KA 1UVQA 2EO9A 1I7UB 1O0VA 2R23B 1BZ7A 4RWYH 1ORQB 5AD0B 4DKEH 5KVFL 3FRUA 2C1OB 4IRJC 4CVUA 1FBIH 3H7LA 3U7AA 3OR7A 5FYJU 2OQJA 1JPGB 4G6MH 3WCYA 4KK5D 2UWEE 3X3FH 4DGVL 4NPYA 4PGZA 3VFTA 4F7MB 3F8UB 3MRHA 1P84K 2HWZH 2FATH 1MJUL 3OKEA 4DZ8A 2V5SA 4RA3A 3FFCE 4XZUA 3CVHB 3RX8A 4AIZB 3GHEH 1MOEA 3IS1X 3H6JA 3JZ7A 2XA8H 5HHNB 3ZTNL 2UWEA 4JFFB 4EI6A 5IOPA 1ZT1A 4KI5C 2GK0B 4FQXD 4NQSB 5HGAB 4CBPA 5D7IB 2FD6L 1MPAH 3WE6B 4EI5B 2DLFH 3ZT7A 1AXSB 4MXWL 3MLTA 4Y2DA 3ARED 1QOKA 5INCB 1Z5LA 4PGDB 1U58A 4WV1C 3WKMH 3HFMH 2F5AL 5CEYA 1XGPA 4KMTL 5D70L 5F8RC 3U4BL 1E6JL 4A2MA 5JW3H 3CLFH 3W2DH 3LKOB 1K9TA 3T65B 4XMKL 4IEFB 5IHUH 1SY6A 3TO2A 1ADQH 3VG9B 4OI7A 2MQCA 4GS7B 4LASL 4HPOL 1Z6JT 2RFXB 5C0JB 1JGVH 1JV5B 2OR8A 3VD9A 2I27N 1BM3H 1TZGL 4XXCC 3D39D 5FKPB 3SDAA 3ZL4H 2R2EA 1DE4B 5KS9A 1CK0H 2VKWA 1DQDL 4GG6F 2VIRB 3GMRB 1S5HB 5E5UB 3V95A 1FORL 2G60H 1GC1H 3MR9A 2IBGA 4PP1C 2R0KL 4APQC 5MP6L 4TRPL 2CMRH 4JLRA 5C0BB 4HH9B 5I73C 1F3DJ 3OKLA 4RBPH 4ZFFB 1SJHB 5D7LD 4URTB 1A7RH 2R39A 2YHGA 2Q7YB 1ZEAH 4YHNA 1P4BL 4M1GL 1CFVH 4L8DA 1F6LL 3GMQB 4UIKL 4L1HA 2NLJA 3PL6D 3VXUE 1PZ5B 2RB8A 2P5ED 5GZOC 3WIHH 2NY6B 3AY4A 5HVHB 1J10A 5D6CA 5DUBA 3MRKA 5T3ZH 4XNZC 1DN2A 4XCNB 4BH8A 5DMIL 3TN0C 4M61A 4D0CB 5C9KA 4UIMA 5IB2B 4JHZA 4Y2OA 5T33L 1MRDL 3T08A 5CD3A 4OCYL 2A9NH 5C09D 4P49A 2Y5TA 5J8OA 4NO2B 3L5HA 3CIQA 1ZA6B 1K8IB 2AABL 3DRQA 4R97C 4XVTL 1EX0A 2IALB 5FA4B 1N3NA 3NABL 5B8CB 5BRZD 4NFBA 5EBWA 4ZUVA 1N0XL 4U1JA 2VAJA 5INDA 5MERB 4A2LA 5JPMA 5E6IB 3LS5H 5C6PB 2V9QA 2AJUH 3RDTB 1OTTC 1O5DT 1E4JA 3LY6A 2E6PA 5D7JC 5C0EA 3TESA 1CGTA 1PEZA 5FYJE 2Q7NA 3SY0A 5EZOH 4YH6A 1H5BC 2AJZA 5CBAB 5DRWA 4LEOB 3OXSA 5HGBA 1AP2B 1HH9B 1HQRA 1AXTL 4OGXH 3TO4B 5EU4A 2DQUH 3PE9A 4NQDD 1OB1A 1U8PB 4ONHB 3QUKA 1TTFA 1KCKA 4HF5L 4OLEA 2GT9B 4PRID 4YDKH 3P77B 3ESUF 4MLIA 4U6XA 1B2WL 3HE6B 3O9WB 5FV2A 3RKDC 4DW2H 3OZ9H 1CN4A 3P4LA 3HG1B 2GEEA 2EH8H 1BAFL 4S0TD 4NCDA 2Y4SA 3SPVB 2I07A 2BSRB 3NFNB 2RAMA 3FO2A 4XP9L 3P30L 1LEGA 4AEIL 4LPWA 2R0ZL 3LPWA 5J12C 3RTQA 1A4KA 4I4WA 2VR9A 5E4IA 3BUTA 5FGCB 5FUOH 1I8IA 4LOUC 3O6FA 5BS0E 3E1F1 4AY0A 1PKQE 4WENB 4FFWD 3S5LB 3UPRA 3QQ4B 3E8UH 1C1EL 4Z18A 4F15B 3QG6A 2LU7A 2ICWJ 1RQ5A 3GB7A 5A3IC 4PRPD 4NO0D 3GI8L 2E5EA 3A6CH 1CR9H 1NBZA 2ZJSL 5B4MD 5F89B 2H8PB 1IL1B 5I1DB 4OFYA 5BS0A 1DQMH 1PKQA 2VN4A 3FN3A 1JCKA 1I9RH 5DEGB 4M3KB 4PRDB 2WV3A 2C4XA 1IMHC 4TTGA 4DTGL 1JF1B 5IQ7L 4QY8A 4JO2H 4O2CB 4KUZH 3OJDB 2HT2C 4NP4L 5F1OB 2IF7A 1CLCA 1YEJL 1ZLWH 4DOHB 3HZKA 4XTRD 3TBVA 4QYOA 4LBEA 3X14A 3ARGD 4J4PD 4NZDA 4F7CB 2GITB 1U3JA 3MTRA 3EDFA 1GHFH 5SWZD 1AQKH 1NEZG 2D0FA 1U8OA 2CJUL 2I60H 2XZCH 3B5HA 5HVWA 3LPFA 2X4UB 2ZCHL 4IRSC 1QPXA 1WC7A 3HI1A 1CXEA 3H9SA 1NKOA 1G7MB 3AREA 5H94A 3LH2L 4PJIB 3C6LB 4JFYB 3TH2T 3TT3H 2OJZH 3ARBC 1IAKB 5DF0A 2DOCA 4BZ1H 2XTLA 4MD0B 4BSVB 3KPPB 2IAMB 1XGQA 1B9ZA 3VH8A 1WFUA 4Y5VB 3UCRA 1OP5H 4LPUA 2Y06H 4P5TD 1M7DA 4QRRE 1MH5B 2MPAH 1HXYA 5BV7H 2A77L 1DBJL 5E5MA 3BW9A 2O61A 3QIUB 1G0DA 2XKUA 1UXWA 1G0YR 4LSRH 4KVCH 4WFFE 5M7QA 1NCAL 3AS0A 1NANI 4JB9H 1D6EB 3SDDB 2ZG2A 4BSWB 3B2VL 4QRRA 2IG2L 5J6GA 4KHXH 2JJSC 4IMKC 4LSTL 5K59E 4WO4B 1N26A 2FX7L 3RGHA 2ADIB 2J88H 3BKYL 5ALBH 4C4KO 5DR5L 5DUMH 4EDXB 5B38A 3MFFA 1NLBH 4NNXB 5AUMA 5D9SA 3WEXA 3B8SA 1RVFL 5E2UL 4XPFL 2A73B 3MJGX 4NKDB 4DN4H 2OTPA 4MQXD 1TXKA 3ZDYF 1MQKL 2HKHL 2Q6WA 3OHXA 3PL6A 4G9FD 1HI6A 3ZZ1A 4HFWA 3GNMH 4JE4B 4PB0H 5JQ6L 1FVDB 5JIIA 4HQQH 3UP1A 5LKNA 1PQZB 2Y6SD 4M6NL 1U8NB 1OTUC 5EU5B 1MY5A 4DZBB 4POYA 3GSNA 5ILTH 4S1SH 2B20A 5GPRA 1AHWC 2VXQH 4TUJA 3CDGA 1EJOH 4KI1A 1JWUA 2HH0H 4NWTL 1BFTA 1U36A 4GAJL 5CJ5A 1KC5L 4OCRL 4WW1A 3CC5B 4LU5H 3EJJX 3MRJA 3B43A 3RA7H 3FQRA 4GXVL 4R9HA 5EO9B 3T1FA 4Y4FD 5D8JH 4KK8C 5I15H 4NQDE 1KPUB 4O00A 4CNIA 3HI6H 2JK5B 5FO8A 3WBDA 4PLJD 3LIZH 1UM6L 4FZ8H 4LHUB 1I1AD 1D9KC 1VENA 4Q7DA 4YEFA 5H8DA 2VH5L 1SMOA 1LWRA 5JIPA 5IMKA 1CD9B 1CTOA 1U2CA 5IEHB 3VXQA 4HT1L 4FTVD 5HI3D 1FO0B 3B2UC 3QZWA 4HHAA 3L3KA 3IETB 4H88H 4HIXH 2DQCH 3T2OA 3WUZA 5HHMB 1A3RH 1KIPB 1TETL 1A4JB 2O26U 3FKUS 5E8DL 4R2GD 3ZDZF 4A6YH 1BF8A 5C0RH 1KJ3H 4OLYL 3Q2CA 4JFEE 4RFEB 5C7XL 5EFIA 4JN1H 1UGNA 1MCPL 3U82B 4YHKL 1WAAF 4YJZL 1T0NA 3IDMB 2PYEB 5ID1A 1R5WB 3KLSA 2PTUA 4WUUB 5IFJA 1ZMYA 4MAYA 1YEIL 1LQSR 4K8RC 2YRZA 4KAQL 5D5MB 4JFEA 5FYKD 4IBLT 5KS9F 4ZYKA 1ZT7B 1EMTL 2ZSVA 1QFWM 2P8MA 1T1YB 5CMAB 5JHLL 4NRXA 4ZO7A 3KPSA 2LVEA 3PWVB 4PJXB 2O5YH 1RUML 3WLWD 3DXAE 3BMVA 3KHOA 1PDKA 4E41B 3C5ZC 4WUKH 4K3DL 5ID0B 4LVNB 1QFUL 4GW5B 3B3IA 1MCNA 1IGJB 2YMXL 4XMLH 3EOAA 5HDBE 4HMEA 1NCNA 5SWZE 4I3GA 5IF0A 4KROC 3ZE1E 1NCCH 3MYJA 4Z78A 3HE7C 5EPMB 3DXAA 1MIEH 2KH2B 4H20H 1KTDB 2PO6A 4M48H 5F9OH 4NWUL 2HFGH 4MX7A 5T1MA 1B0GB 1RZJL 5FHAL 4WWKB 5TDPB 5JR1H 2K7QA 4Q6IA 4KQ3H 5LXGL 5I71C 3VA6A 3RFZC 1I8LC 3DBXB 4LCWE 2AP2A 3TBWB 3WFCH 1CE1L 1IVLA 4LIQE 5F1SA 4AT6A 1UJ3B 4EQ2A 5I1EL 4OT1L 1HILB 4EBQL 3SOBH 5F44A 5DRXA 1C16A 4UT7L 2OL3B 3GJFH 4X6CB 1ZVSB 2ZSWB 4C54A 5IMOA 4XB7A 5GGTL 4I48B 3EYSL 4LCWA 1BIIA 1IGYB 2MQ0A 4QOKB 5ACMA 3VGDA 3SDXE 3MRFA 2VUYA 1FIGL 5D72L 1BVLA 3CMGA 3KPRB 1CGXA 1CVRA 5JW5B 1KB5H 2Q1EA 3QCUL 1MWAH 3STLA 3OAZH 4RGND 2XFXB 5IJKC 3UJIL 4FQCL 1VFMA 2YKLH 3P4NB 1HKLL 1RJZB 3ARTA 3QI9B 4PY7B 1FRGH 4QF1A 4KKBD 3FO0H 3QEHB 3SDYL 2D9CA 4QXUH 2UZIH 4G9FE 1X5YA 5ERWA 1EEYA 3P9LA 3OWEA 2CH8A 4KJQD 5EBMA 2H2SC 2VDQH 3TJEH 1DLFL 2XZZA 3S8WA 2IPTH 5FOJA 4FXLA 1CI5A 1JGUH 1OPGH 4DGYL 3L7EB 3LHPL 5IB5B 5CWSA 4YFDB 3BDYH 2WBJB 1T7VA 1GZPA 3VD7A 2XV6B 4ELKA 1YDPA 3M45A 3WIFB 4JREB 1X4YA 4BKLB 1KENL 3GBML 5D2LF 1XGUB 5T1LA 3VGAC 3RY6A 5EUKB 3EYOA 4M6MH 1K2DA 5KSBF 3I75B 4G8FB 1FPTL 5DTFA 2CLRB 1CD0A 1OAZL 3B6SA 5ACZA 4H8WL 3MV9B 4QTHB 4W4OC 1FNHA 1KNOA 3QAZB 5IMLB 3H9ZA 3D2UD 1RU9L 3MRNA 5CBEB 5IJVB 2QADD 3ILQD 5F6HI 4TUOB 3I84A 5DJZB 3AU1B 3REWA 2AJXH 4PJAF 4MS8C 1QHOA 4P46A 4LCCB 3NACH 2AQ2A 2EE2A 3SGKA 4ZUWA 4OZ4A 5F6IC 2B1AL 1TVHA 4YLQT 4X6BB 5JXAH 3C8HA 5GRUH 3O11B 2XXMB 2C3HA 2X9XA 4JZJB 4JPKL 3GZKA 3QFJD 4FFVC 2UYLB 5DVKA 5HHVH 1AD0A 2E27H 3GSUB 4FABL 4PP2A 1BWWA 4N9OB 4YHOL 3D3VD 3GIZL 1ND0B 4JVPA 1U95B 1KCSL 1HINH 1RULH 1FJ1A 4QXGH 1QSED 4JANA 4LPYA 1NFDF 4JRXB 1P2CB 2OTUB 1Q9LB 4F7EA 1LO4L 5E24E 2ZUSA 4JQVC 2EIZA 5GS1A 1HWGB 1Z9OA 3S3PA 3LB6C 1S9VA 3LV3A 3BP4A 1TVBA 5IG7B 3SBWA 5LVEA 3NH7H 1NMCB 4PV9A 3QH3A 1T4KA 2DJUA 4OZFH 2X4PA 5ICXA 3U36B 1C5BH 2V2WA 5D1ZA 2XTJB 1T66D 4MNGE 4X6DE 1P53A 5FYKE 1PLGL 3GK8L 4FQQB 1Z9SA 4Y5XB 4UILL 1PY4A 4MA8L 3K4DA 4AEHL 1CIDA 5J6HB 1SBSH 3U9PH 4BYHA 2J8UB 1BLNA 5EIVA 4ENEC 4XWGL 2F54B 2VERN 4RQQB 4S1RH 5IEKA 5E7FA 1B4JL 1V7ML 2Q8BH 4BUHA 1FZMB 1LE5A 1X5XA 5D1QD 1LO5B 1DQJA 2NY1D 2HVJB 2I9TA 2YD1A 2VJXA 1W0WB 1J0YA 2WINA 4G42A 3FB5B 5I6XB 1IGTA 4P5MA 3S96B 4M5ZL 3TBYA 2G9HA 3DPBA 3HUJA 3MUGB 2HN7A 4D9LH 2Z91A 5DO2C 1EHLL 2Q20A 4CMMA 4M3JA 4U1KB 1EHXA 3DX8A 3EOBB 3WUWG 1R3HA 2OTWB 3L5JA 3KYNB 2B5IC 3MBED 4ODHL 1QPPA 3TYGH 5EU6A 2VXVL 1J1XH 1Q0XL 3TVMA 4OSUL 4I9WD 1FFQA 1K8DA 4R4NC 5L0QB 2W9EH 3PJSA 4U4BA 3PHQA 4IJ3B 3UEZA 4E42B 4XWOD 5FUCE 3MLXH 5C0GA 2NTSP 3BDBA 1MRCH 2IGFL 4MZ3A 3DUHA 4PJGE 4JHAH 2E8ZA 4ZO6A 1HCFX 2DD8L 2WUBH 4X7SH 3QB7C 1A3QA 1U8QA 3BH8B 3MREA 1Y6KR 1RUAL 1MCBA 4J3WA 2VXTL 1QRNA 1I1CA 1IEBA 4NM4L 2IQAB 3E6HB 2BVPA 2CKBL 3LEVL 4PJGA 7CGTA 5D4QA 3RWFB 1GAFH 1IAOB 5GS2H 2EDNA 3DMMC 4H5SB 4JG1L 5MEPA 3NA9H 1YMMD 1NANH 4J6RL 1M1SA 2GFBA 3EOTL 3QUZC 4MDIB 3RWCB 4Y4HA 3UAJC 4GUPA 4I18C 2XI9A 2H32A 4FQXB 2ZNXA 4QT5A 5DS8A 1GPOL 1DSFL 3D6GA 1BWMA 5EO1B 4UOW1 2PW2B 3GSXA 1YY8B 3L1OH 5FCSH 3REVB 4O58L 4GRLD 3I85A 1HHHA 3HC3L 2AJ3B 4WV1B 3IFPB 1YEFL 4X6EB 3WHXB 4PGCB 5ESAB 5DGQA 1U3HA 4BSJA 1CQKA 4J2XA 3BPOC 5IKCB 2A38A 2AKRA 4TTDD 4PJ9C 2X9WA 3W11D 4NRYB 3DX7A 5I1AA 3G9AB 4I0PD 4X8JB 3ESVF 5JOFA 2NY5L 1EEQA 4KUCF 3D39B 1IGCH 1LILA 5E6ZA 4NN6C 1XH3A 3SE9L 1FV1A 1EHAA 2EDDA 1UKQA 3RWJA 3QQ3A 5DFWH 1UYWH 2YZ1A 4IIQB 4CU6A 1BFVL 3O4LB 3JXAA 4WW2F 3S88H 4X4ZA 5F3BB 1VKXA 1VESA 1IM9B 1TNMA 3W9DA 2LVCA 2YK1L 4OCNC 4ZFGL 5FCUH 5ICZA 1NUNB 5D7LB 3PWPE 4ZAKD 4DWHA 2H26B 4HWEL 1YC8A 4UBDD 4D9RD 2FJFA 1ZHLB 5H37G 3Q1SL 1MUJA 3VE0A 4ZFZA 4FS0A 2BY0A 1J5OH 2E7MA 4TVPH 3HA0A 3KLHD 1KT2B 2NY3D 3QXAA 2NNAA 1OY3B 3NIDE 4PRHD 3CVIH 1PVHA 3OV6A 3R1GH 5AYUH 3PWPA 4UDTB 1BQSA 1NAKL 1A1MA 1CZ8L 3PGFH 1FZKB 4Y2DC 2F53D 4XNZB 4TSAH 4ZNCD 2AQ3A 3VRLE 1V3MA 3G5YA 4HZAA 1ZKAA 1NBYA 1R5VB 3MNZB 5HI5D 5HPOA 4HIHB 3G6DL 5I1HL 1UB6B 3MGTB 4HIIB 5BOZG 4J23A 4OF5A 2BDNL 1Z3GL 3ALWA 4JFXB 1UB5A 1HHJA 3SDCD 2VISB 1ZSDA 5TDNB 3MRBB 1OLZA 3AS1A 4U1SB 1G9MH 3BO8B 2ZPKL 2R56H 3H9HA 1WCBB 3SDAC 2FNBA 4MD4B 4CVXB 4XGZA 4YDJA 5GGTA 5GRJH 3QEGH 1RAMA 2KL6A 4GRMA 3CK0L 5JA9A 5D7JB 3BDXA 5IGXH 1IGML 1Q1JH 2D7PA 2XIDA 1QLFA 1CT8B 3WXVL 1ZLWK 3U48A 2AERT 1R3JA 1UM5H 4ZFOL 4PGBB 5TGBB 4JFZH 4LF3A 4U1NA 5C08A 4XPTL 3IF1A 4PRIB 1IC5H 5AZEL 5A2KH 2D7QA 4N8CH 2CK0L 2GY5A 4JHWL 1UT9A 1FQ9C 1IC4H 1JNLH 1WGOA 4OD3L 5E2VL 2P1YA 2C1PA 1J1PH 2YBRB 3GIVB 3V6FB 5BZDA 2JCCE 3AY4C 4GW1A 4I3SH 1NCDL 3R4DA 1ZLSH 1RFDH 2CSPA 5DJ0A 3MACH 2BRRL 1QVOB 9CGTA 5IVZA 4FG6C 1D7FA 3TIDA 2R2CA 1MVUB 3INUH 5CP3A 1NEZB 5C9JA 1FL5B 5ICYA 5I1LB 2JCCA 4EN3B 5KBNC 1MHPH 2R2HB 4AL8L 1OP5K 5FYLL 1H3TA 1EFQA 3KPMA 1X5LA 3QPQC 4PJCB 5EOTA 1NAMB 4Z95H 3E2HC 4P57B 1BQLL 3U2SA 3E6FB 3DGCR 4TNVK 1A7QH 4LKCB 1C08A 1YNLH 5J1AA 3M07A 4XI5C 1Q8MA 1JUFA 1OAKH 5F3HA 4P2YA 2QSCL 4DVRH 2X2YA 1CG9B 4YXHH 5E9DD 3GUTA 3T3PE 2H1PH 4RAVA 2H6PA 1YMME 5HPMA 5FO9B 2ATKB 4U7MA 1NL0H 4R96B 3QG7L 3FO1A 4PY8I 4RWYL 1QKZH 1RZFH 1FDLH 1RJLB 3F6IA 5C6TH 4ZUUA 4DKEL 3DV6A 4X7CC 1BVZA 3OG6B 1FBIL 3RUGB 1U8MB 1U8IB 3ZDYE 4G6ML 3X3FL 3VXOB 4JJ5A 1V7NH 1XZ0B 2ED7A 1CXHA 1I75A 3NVQA 4OGAD 4IRZH 3ARSA 4LNRA 5BZWB 1H3VA 4N90D 1T21A 3U1SH 4K9EH 2BMKB 5DHVH 3CFEB 3GHEL 3ZDXF 2XA8L 2FL5B 2UY7A 1VHPA 5DWUH 4ACPA 1MCFA 3RTQC 1SQ2N 1A2YA 3ARBB 1MPAL 3WKNA 2DLFL 3U6RA 3ILPB 4XMPH 3O6FC 1KCUL 1JN6A 1NGWB 2CGRH 3UBXA 3ULVH 3QEUA 3HFML 3WKML 4X4ME 3F5WA 3L9RB 1MJ8H 3G08B 4R4FH 2R29H 1N5AB 2XWBA 3DYOA 4EVNB 5C0AE 5JW3L 3W2DL 4LHQB 5DJDB 5DJCA 5T5NF 5DQDL 4I1NB 1T0PB 3U83A 4HK3N 3FZUC 1AKJB 4ZS7L 1M7IA 2H9GB 3WFEH 3ETBF 1JGVL 1G7IB 1S7TA 4PLKD 4MQ7B 3ZL4L 4LRIA 4MJ2A 1MAKA 5C0AA 4PRHE 3PQYD 5HGDB 1KBGH 3VFVA 2XXCB 4OLZH 3QFDB 5DK2B 1GC1L 5KVDH 4HGWA 4WHTB 3A6BH 2CMRL 3RVUD 2VDKH 1HHIA 5IB1A 3HPLA 4G80B 2H2PD 4BH7A 2B8OT 3ARVA 5FA3A 5F70A 1KJ2B 1A7RL 1ZEAL 1RZ8A 3BKCH 3WJJA 1CFVL 1VFUA 1XEDA 2VRAA 5SX5H 4UDUA 1NGXA 3TWCH 2WSKA 5GIRB 3AREC 3DARA 4DK3A 4N0CD 3WIHL 1T20B 4M43H 5T3ZL 2GAZA 4NQED 3T8XB 1AHWB 4O02H 3BIBX 4ELMF 2GY7B 4N0UA 5D96C 1CU4H 3GMNA 1FL6A 2DYPB 1G7JA 3RL2B 1JJUA 3ROLB 1EAPB 4HCRH 1D5MA 5E99H 2YUXA 2J4WH 1PD6A 5JO5B 4QTIH 5CINH 4YHIB 2Z0BA 3DVGB 4MNHA 4J1UA 4XP5H 4B5EA 5JXEA 3L5WB 4FQHB 4OUOA 2ZOLA 3VFNB 3LS5L 1ZT4B 5HYJB 4NBXB 2AJUL 4PJ5B 2IBBA 3VGFA 3IFNH 4POZD 1SJVA 1D9KB 1JGDA 5GSRB 2CKBA 43C9A 5EZOL 1G7PA 3G5ZB 1HKFA 5IVXF 4FTVB 4NJ9H 3MV8B 4XNUL 4GRWB 5HVFB 2IFFH 4OGXL 2YPLB 4G8EB 2DQUL 2Z31D 4C58B 1DUZB 3G6JB 1AGDB 1I1YB 3PL6C 1TJHH 2EDKA 2AXFB 3WNMA 2ICEB 1A8JH 5GS0C 4MWFA 3T0XA 1VACA 5E6YA 3VH8G 2IJ0C 1BD2E 4UU9A 3VG0H 2YC1A 5K9QI 1QR1A 2I9LB 2OI9B 35C8H 2EH8L 1YNKH 3GJFK 5CZXD 2X4SB 1I7RA 4GW4A 1JZ4A 3BGFC 3OKDA 4ONGH 4YEEA 2DLGA 4H1LG 3EYFB 1WZ1H 4XT1C 2ZOKA 1VSCA 5E9DE 2BNRB 4TPRH 5ISZA 3QUXD 1BD2A 1W72H 1BJ1H 1RK0B 4NT6A 1WWAX 4ISVB 5FUOL 1AGFB 4GQPH 1YUHB 5LAXB 2GYSA 1KULA 3E8UL 3KDMB 3U4AA 3HR6A 2OK0H 2K7PA 3FONB 3U0PB 4RAUA 4ZTPH 3F12A 5E9DA 3FAXA 1KOAA 3A6CL 1CR9L 3SO3C 1DLHB 3C5ZB 3X3GH 1R3LB 4UTBH 4WHYG 5HHQA 1FNFA 2DM7A 1HWHB 2CDGA 4JAMB 4PJEB 3AFLA 3WL9B 4KMQA 5TQ0L 3RI5K 3E3QE 1F6AA 2RHEA 3MPCA 4JO2L 1FVCB 4YHPB 1UENA 3PWNA 4KUZL 5JTWA 1U8LB 4P2OB 1K3ZA 3QA3A 4Z7VA 1CFBA 5JUEL 2Z8RA 1MCIA 5GISH 4G7VH 1TNNA 2VLLB 4CVWA 5JPNB 4Q74A 4U1HA 3C5SA 3HS0B 2BY3A 5EZJA 3QJFA 5I71B 1A64A 1GHFL 4WFGD 4QRTB 5EN2B 3PUCA 1AQKL 4ODVL 4YPGA 4EDWL 4M93C 5DMGD 2I60L 2XZCL 5LGKA 1K5NB 3BQUD 5HHOD 1JMZA 5D2LE 3R0NA 3I3BA 4NHUA 3F7QA 3VXPB 5KSBE 5K9KA 3GMLB 4LCUA 4MAYC 1I8MA 1EEZB 1T0MB 2OCFD 5E7BA 5FO7A 3TT3L 2OJZL 4P3DB 3KNBB 5C0DB 2NZIA 4WI4A 1LP9B 4ODXB 4WI5A 4MZ2A 1JHKH 5DYOB 4BZ1L 1N2RB 4KUCD 5SWQA 1F2XK 1CDGA 1T7ZA 4J3UA 3THML 3UZVB 4GFTB 1NH6A 4F80A 2XWTA 1IEHA 4W6YB 3QXWA 4RGNB 1N5YH 3GO1H 2Y06L 3IDJA 3LDBB 1QEWB 1WZKA 4XP4L 4AEEA 2R9HD 3ET9F 1IAII 4RZCA 1BZ9B 3P4MB 2AV1A 4N8VG 3SJVA 3HRZA 1JNNH 3NCJH 4LSRL 4KVCL 2WWMD 3DETC 4G8IA 2ADJA 1CCZA 1WZMA 4ZFOA 2EDFA 2RIKA 3IJSB 1P7QB 3EO0B 5IWLA 3Q0HA 4NFDA 5DUPH 2EXYD 1WBZA 4PR5B 1JIBA 5FUZL 5CCKH 1G9NH 3DUUA 3J8F7 3K1KC 4KHXL 4L4TA 3ULUH 2XNAB 1YPZE 3O41A 3TJHC 2NR6D 2PO6C 5ALBL 4F2MB 5DUML 4XXDA 4D0BB 4KPHH 1UA6L 2QTEA 2N7AA 4FQ2H 1QFOA 4Q6IC 4Q9BA 4DN4L 3CMOH 4M6AA 4L3CB 4U1IA 5C07D 3EFDH 4OM0L 1QLRA 3T0VA 3OKKA 3SKNB 1UZ8A 4OLXL 1YPZA 1EAJA 2BC4A 4KMLB 4R4BB 3GNML 1NC2D 5A43C 1BEYH 2OMBA 4PB0L 1UEMA 3FQUB 3NZHH 4HQQL 4Y0GA 4M02A 3MOAH 4NO5B 4YNYA 3MZGB 4OV5A 3QCTH 1ED3B 4NZRL 5BVJB 5IESH 3C2AH 2APFA 4S1SL 3RL1A 1QQDB 3MXVL 2VXQL 5F1IA 3VXMB 1EJOL 1I3VA 4U1LA 2X7LB 3GSOB 1ZA3B 3VXNB 3LEYH 3VFSA 1W0VB 4LU5L 3DVIA 3DV4B 4GSDH 4JQXA 3RA7L 5IMMB 2X05A 4DUXA 4ZS6D 5D8JL 4WJ5A 3DOSA 2E9BA 4F7TB 1SYSA 1AR2A 5I15L 5DD0L 3CDFA 5IW6B 5KSVB 3D3VB 1DDHA 3G9VA 3HI6L 3MLUH 3JTSA 1GZQB 2EDEA 3LIZL 1T04A 2PKDA 4FZ8L 4JQIL 3SCMA 2GJJA 1A6TB 2EDTA 3L3HB 4P5KA 5IW3A 4LLDA 2VMFA 1BBJA 4EUPH 3CH1A 1X6LA 3QQNA 3QULB 1YMHB 2PCPB 3MJ6A 3BUYB 1QBBA 3MNVA 3NN8B 1R24B 2VZ1A 4LSUH 5C0FB 1CGVA 3DO3A 3UYPA 1I7TB 3NIFF 4H88L 4HIXL 4FXGB 1U93A 2DQCL 3HMWH 1FLRH 2ZZUT 4NZUH 2CIIB 2XKNA 4KJPD 5E1AB 1RZIA 1NBVH 1PW3A 4A6YL 3RPIB 2FIKB 1KJ3L 2GTWB 2ESVB 4JN1L 3MA7A 4Z7NF 2Y7QA 4X5XA 2VLJD 3K4ZA 1XGRA 3FB7B 4LLMA 1F4YH 1T2QH 3DUSA 1KIQA 5DI8B 2QEJA 4P46C 3FFDB 1NPUA 4WFHD 4YHLH 4QKXB 3TNNA 3VI3E 3OKOA 2YD9A 4AJ0A 3CFBA 4TVSa 3AB0C 2NY2D 4RIRA 2O5YL 1IQDA 4D94A 1YEHH 4OZIA 5CILL 4WUKL 1CVSC 5F7DA 3SE4A 2CLZB 3TPKA 5DXWA 5FV1L 4XMLL 2VTFA 3HHRB 4WFGE 3R06A 1J0ZA 4XRCA 4AK1A 4Q9CA 2QKIB 2WZPD 2BNUA 3IAQA 3ZHDA 1NCCL 5GGSA 3DIFA 5GS1C 2VITA 2C4FT 4TSBH 5T3ZE 4JPIB 1UFUA 1T5XB 5B3JF 3A0OA 4YGVB 3U7WH 1NEUA 3AAZA 4NYLB 3FOMA 5D1ZC 4M48L 4CVZB 3PWUA 2CDFA 5F9OL 5MI0C 2B2XH 5F9JA 2HFGL 3WIHA 5JR1L 2FYYB 3UPCA 4KQ3L 3JWOH 5HVGB 3LN5A 5F88A 4F57H 3OKMA 2P4AB 3NIGF 4P2QB 1FVEA 3BZ4A 1V3JA 3VXSD 2OP4H 3SKMB 4ZPVB 3PXHA 3FT4B 4O51B 5FYJH 5GGRB 3EO9H 5DD6B 4Z5RB 4UAOC 1QR4A 1ZHBA 1FNSH 3E0GA 3SOBL 1XR8A 3MUHL 2YN5A 1BPVA 1I1FB 3VFRA 2IANB 3HI5H 3GGWB 4P4RA 3P0GB 1DEEA 4KQ4H 2VR5A 3T77B 4HKBA 4D8PB 5ETUA 4FFYH 1CFSB 1ZAGA 1RSFA 3DMMB 1KB5L 4OZHA 2AK4B 3X11A 2WUCH 1MWAL 3RZCA 3IJYA 4L4VA 4N0YH 3RGVD 3PF2A 1N8ZA 1IAMA 2YKLL 4QEGA 5DSCA 4I18B 1DANT 2ZUQC 1F4XH 3LS4H 5D7IF 1FNGA 3JVGA 1XGTA 3FO0L 1S9XB 2JB6A 3VDAA 4QXUL 2UZIL 2O5ZH 4V1DE 5D1XD 1B6UA 1JWSA 5ACLA 2X4QA 4XPHL 2APTA 1FIEA 2VDQL 3TJEL 1OLLA 3TVMC 5DLMH 4K7PY 1HHGB 3BPOB 5ANMB 2BHUA 3HR5B 4PJ9B 2IPTL 3PGDA 1QSVA 2BNQB 3QDMD 1G7HA 4I5BB 4KJWC 3B9KA 3CXDH 4V1DA 1JGUL 1OPGL 5T5NG 1WICA 3BN9D 5DMKB 5ENWB 3IU4H 5D6DC 3PABB 4NGHH 1J8HB 1F13A 3QO1A 4Y4KD 3AXLA 2DJSA 4X99A 1UVQB 1A6AA 3BGMA 4P3CH 1BZ7B 2PXYA 1EZVY 4M6ML 5ESVB 4NRZA 3O81A 2YEZA 3FRUB 5FUCC 4OAWA 1EGJH 2NW3A 5B21A 4ZSOB 4G6FD 1J7VR 4HULB 3MGOA 3OR7B 2OQJB 1FYHB 1QZ1A 4M9OA 4NPYB 4F3FB 3MRHB 1X5FA 5CUSH 2AJXL 2IWGA 3OKEB 4DZ8B 1JHTA 3NACL 3NFPA 4XZUB 3ZYZA 2F8OA 4Y4HC 1D5XA 1WBYA 4O2FA 1KXTB 4JKPH 1FGNL 5JXAL 4Z76A 5GRUL 3CUPA 4OCWH 4Z7VF 1SJXA 2DLTA 2FH6A 4EI6B 4Y16A 3ZO0A 5IOPB 4NDMA 5HD8C 5L8JB 4AH2A 4Y2DB 3MLTB 2PN5A 2IADA 5KSAD 1X5JA 1Z5LB 5CEYB 1HINL 1RULL 4QXGL 3RAJL 2DLEA 3QNXB 1U3HC 5FM5M 3EJYD 3QJHA 1AJ7H 2BXYA 1MCJA 3O3DA 2WBKA 5HY9A 1UWEH 2VDNH 3VMPA 1UXSA 1HOCA 2VLJE 3X17A 1BMGA 3BHBA 5CZKA 3UYRH 3NH7L 4KTYA 1TZIA 3TO2B 2CUIA 4HGMA 4HUUA 1LO2H 5H35A 3DJ9A 2VN7A 1C5BL 4HUVA 3NCBB 4JFDD 2VLRD 1TJGL 3SDAB 5KS9B 2R2EB 3S4SA 2YD7A 4BZ2H 1FNAA 4Y1AD 1SBSL 3SKJH 3U9PL 3ZKMC 3K4AA 3Q5OA 1U9KA 4DN3H 4S1RL 2A0LD 2Q8BL 2ITDA 3WHE1 3OKLB 2A6KA 1BBDH 1ZS8B 4JGJA 2VLMD 1K6QH 5BMFH 3V0VA 3MOBH 4YHNB 3BWUC 3GSNH 4GT7A 4L8DB 3MA9H 2NLJB 3GKWH 1J88A 4LK4A 2V7NA 5DJYB 2Y72A 1E27B 4NUGH 4CJ1A 1XAUA 4OLUH 3BZFB 4RFOH 3JUYA 1ZHNA 3MRKB 1ITBB 1EO5A 1B90A 5I0ZA 1RK1A 5KN5A 4CDHA 1C5CH 4UIMB 5DRNA 3PDDA 1QNZH 1RZJC 3QDGA 5DGRA 1A14L 5CD3B 3IXAA 3VXSE 2Y5TB 4Z7OF 1B88A 4WI9A 1OCWH 4OGYH 2SEBB 3DRQB 3QCVH 3TYGL 1N3NB 4G6AC 1AH1A 1OQXA 1CFQB 1J1XL 3TIEA 1OP9A 5EBWB 4ZUVB 4LLVA 2QJDA 4WTZA 4LVHC 4U1JB 2JE8A 1NMAL 5INDB 5JPMB 3A67L 3H3KA 5DDHB 2W9EL 1YN6B 3NCEB 5EIIA 5J11C 4NKQB 3QPXH 1MHCA 5C0EB 4BFBD 3MLXL 4JY6B 2L7JA 1NUDA 1MRCL 2R4RH 1JK8B 3CPLA 2AJZB 5DRWB 3L5XH 3OXSB 3JV4A 5HGBB 1U42A 1HQRB 1S9YA 4U31A 2WUBL 4PJHE 5EU4B 2YD8A 1OB1B 3QUKB 1A9BA 1OGTA 4F33A 3K2MC 4MXWH 4S1DC 4DEPC 1IAIH 3FQTA 2JB5H 3RX5A 2NXZD 4U6XB 2F5AH 2GW5A 3MMEA 4MXVF 4MA1B 3MRRA 4PJHA 5DJAA 3CLEH 5SX5K 5IBLD 3NA9L 3RP1A 3MJ7A 2HTLD 1CDUA 3EFFA 3IXTA 2P42B 2R1WA 4NNYB 2EH7H 5T1KD 3MRCB 3P73A 4Z77A 3FO2B 4PJIF 1HQ4A 3DGGA 2MMXA 1LEGB 3V7MA 4LASH 1I7ZA 2ZCLH 3S6CA 5A2IH 3RTQB 2PF6A 2Q3AA 3TA3D 1A4KB 2YA0A 4I4WB 1DUYA 3L1OL 2GSIA 1I8IB 4EJ1C 1DQDH 1KLUA 3O6FB 3QXTA 1YQVH 4G43B 4M62H 3UPRB 4K3JH 4LP4A 4Q97A 1UWGH 5DURB 2A6JB 3Q6GH 3QG6B 4X83A 2HTKD 3GB7B 3QWOB 3DURA 2HMIC 4A6YA 1INQA 1NBZB 2FJGA 4G8GD 3K1DA 3GJEA 3VU2A 4H8WC 2NX5D 4Y4KA 3MRLA 4M1DH 5BS0B 5FB8A 1OQOA 5IB4B 1IGCL 2PR4L 4JN2A 1AO7E 4N1CA 4M1GH 4PJAB 3DHJA 2MTPA 4QY8B 1UYWL 3AS2A 5DZOA 4PJDE 3ARDA 3TBVB 4QYOB 2V5MA 3EDKA 4MVBD 1FN4A 3X14B 4BZYA 5J1SC 5FCUL 1AO7A 4XB8A 5TF1H 3CVHL 4PREA 3PP3K 3K7UA 2APBA 2WIIB 1GOGA 1N6UA 4PY8J 4WNQA 5IROA 5T33H 4PJDA 3SGEI 1J5OL 5CHNA 4TVPL 4YBQC 2AABH 1UKSA 4XVTH 1WC7B 3VJ6A 3QIBD 3FB6A 3NABH 2KPNA 3PXJA 3H9SB 4L9LA 3W0WD 4LIQH 3CVIL 4DAGH 1NFKA 5AYUL 4GRLC 5H94B 4HV8B 1N0XH 2UUDH 4QRUA 1T3FA 1I9EA 5TJWK 3PGFL 4WI6A 3PV7A 2YRPA 5FGRA 4PJFE 2VLRE 2Y9RT 4AM0A 4TSAL 4XH2A 1I4FB 3VH8B 1LNUA 4PUBH 1M7DB 5E8EA 5EZIH 5D96B 3T4AB 5IBUG 3VW3H 3BPLC 1RZKH 1HXYB 1XIWA 5E5MB 3CFDA 2EDLA 4GBXA 4H1LB 1UXWB 4IRJA 4HF5H 1G9ML 2VLME 2QR0A 4QRRB 2R56L 3GJFA 4P9ML 2DBJA 4CW1A 5J6GB 4RRPG 5GRJL 3QEGL 4IOIB 4JM2F 1RIUH 3RWGA 5IGXL 1JP5A 4PRBB 4QWWC 3RVVD 5B38B 3MFFB 3K8LA 1Q1JL 1A1OA 1D5IH 5AUMB 5D9SB 3WEXB 1KB5A 1BQHG 1FZJA 5C2UB 1ZANH 1MWAA 2KBGA 2R1YA 4JFZL 1URLA 5CJ8A 1FYTD 3UTTD 2IFGA 2DQTH 1IC5L 3IRZA 4H26B 3TCXA 2Q6WB 2APVA 2X4TA 4HMCA 4N8CL 4WIQA 2N4IA 1HI6B 5TH2A 3WJJC 4HKJA 2XN9A 4HFWB 1VEMA 4RFNC 1IEAB 1IC4L 1JNLL 5AG9A 1CICA 1J1PL 3UBXG 3M8OH 1T80A 3RBSA 4I3SL 5C71A 1ZLSL 3MACL 3QHZH 3BGFB 4TUJB 3W81A 1JWUB 1HYSC 3C60A 3RVWC 2YS4A 2Q8AL 5F9DC 1WIOA 5GS3A 2VL5A 3INUL 3WNOA 3DECA 4YZFF 4WW1B 3BH9A 4Y19D 4DTGH 4HUKB 5F93C 3MRJB 1MHPL 3FQRB 4WCYL 5DFTA 1JF6A 1BF2A 1YEJH 3SGDI 4Z95L 3OF6D 2BVYA 4PJXF 5F71A 2OSLA 2PYFA 5JXEC 3T0DA 4EIGB 3VGBA 3BESR 1EERB 3ORJA 4CNIB 1ES0A 4H0GA 1A7QL 3QWQB 4PJ7A 2D4FA 1YNLL 5FO8B 4NZTH 1HHKA 1OAKL 4XC3H 4DVRL 3P2TA 4YXHL 5HTSA 3DSNA 5T3XL 1CE6A 4YFLF 1XF2A 2H1PL 3MZTA 5B3NA 3RY5A 5IMKB 4LCYA 1NL0L 2IBZY 4N8VB 3VXQB 2ZUWA 2BCKA 2XQBH 1QKZL 1RZFL 1BECA 5C6TL 3QZWB 3OJVC 4HHAB 4OFPA 5IK3A 2XPGA 1QP1A 4JFFD 5KSUA 4PJBA 3TN0A 1PYWB 3PWLA 3U30C 1DTUA 1OSPH 4EI5D 4HJGA 1V7NL 3L3OB 4R90H 5FYKH 4AMKH 5TF0A 1F4HA 3TYFA 5HHOB 1CDCA 5EFIB 5JW4R 1N64H 4M93B 2AXGA 1TPXC 4IRZL 4NFCA 2ZUYA 3WDJA 1DBJH 2C3WA 5I19H 3A6OA 1T0NB 3U1SL 4K9EL 4WHCA 4Q6YA 5ID1B 3TPUB 4JRYD 4P4KA 1NCAH 2FO4A 2AJVH 4MAYB 2X70A 4KRPC 3KPOA 4G9DA 5DWUL 5BW7A 1OD7A 2CK2A 2NY5C 4MJ5A 1EFXA 2ZSVB 3STZA 5CEXA 2P8MB 1FLTX 4Z7UA 2CGRL 5EIQA 4WW2B 3ULVL 4NRXB 3HAEH 5DR5H 4OF7A 1EVUA 3KPSB 1MJ8L 4R4FL 2HA1A 2OZ4H 4LLWA 4U0QB 1RVFH 3IDXH 1HSBB 3B3IB 1MQKH 2EYTA 3BKJH 5C0BD 3EOAB 3GMPA 1TDQA 5IF0B 1S7WA 5F7KC 3WFEL 2Z93B 4LCIH 3MYJB 4Z78B 2FEEL 3DXAB 2P8LA 3KLAA 3W0WE 3IAGC 4EZMA 2FHBA 4OLZL 3BZEA 2PO6B 2VLKD 4WFED 4ZODA 5KVDL 2NY6D 3EYQC 3TBSA 4ODUA 4MCZA 2VDKL 2HFEA 2ICWI 3E3QC 4KKAD 1CDBA 3RNKA 5ALCH 1VADA 3NIFE 1U8KA 1NDGA 4HS3B 5IB3B 1AGEA 2DM3A 4Y5YA 1SYVA 2P8PA 3BKCL 4LRNL 5BQ7A 2EEAA 1OT1A 4HUMB 4P59L 3TWCL 1LDSA 5IMOB 4Z0XA 4ZPTA 4LCWB 3V5DB 3QO0A 4M43L 4DUVA 1NJ9A 2W0KA 2RJMA 3MRFB 3O3AA 4O02L 1X4ZA 1AGBA 4MNQD 2JKXA 1I3UA 4ZQKA 4JDZA 3RDTD 1I1RA 5DK0B 1CU4L 2VH5H 3H3PH 3B8YA 3STLB 5DVNA 4WU5A 3OGCA 4HCRL 5E99L 5IW1A 2J4WL 5IHZA 5CINL 3L3DA 4QF1B 3H0TA 4P2RA 4XP5L 3TO4D 4RCAA 2FECI 5CJQL 2ZP0T 5IWLC 1KJMA 1EBAA 5ERWB 2Q76B 1EEYB 2WQ8A 3EAKA 3P9LB 1TETH 3N85H 5CP7A 1F02I 4OBRA 2DMKA 5EBMB 3IFNL 5FDWA 1ZLUK 3HE6D 3O9WD 1MCPH 4M03A 3EO1A 2V2TB 2HT3D 4JZNB 4NJ9L 1PG7L 1LK3H 1Q38A 4IOFD 4X4YA 1QA9A 3KJ6H 2IFFL 1FAKT 1HIMH 3NGBC 3TM6A 2X4OA 5E5RB 5CWSB 4KKCD 1QSFA 4PBWD 4N0CC 1GZPB 4RGMB 1EMTH 4I0KA 1WK0A 3L95A 4ELKB 1YDPB 1I8KA 5KZCB 4M7ZC 5T1LB 2CRYA 1K2DB 1W0YT 2ATPA 5DTFB 3B6SB 5ACZB 4LMQI 35C8L 4Z0BH 1D5ZA 1YNKL 4K3DH 1KNOB 3MRPA 3MRDA 3MRNB 2FGWL 4MDJA 5E8NA 3ARPA 4L3EA 1WZ1L 1MQ8A 3REWB 4OTXH 1F6FB 1W72L 4P46B 2R23A 3I02B 1KG0A 4DJMA 5CGYC 4ZUWB 1GGYA 4OZ4B 5AD0A 1TVHB 3K80A 2C1OA 5EG6C 3CFCH 4OD1H 2OK0L 4IHOA 3VWKA 2YPVH 2IC2A 4NWUH 4ZTPL 3GSRB 1AD0B 4XNYH 4JFFE 4PP2B 2DQEL 2FCBA 3X3GL 3ARZA 4QCIA 1K4CA 2BJMH 1F3RB 4I2XE 3SCMC 2E6JA 1DQTA 1B0RB 1FJ1B 2W9DH 4JANB 3CVHA 3DX9A 3VDBA 3FQWA 1TTGA 1WT5A 4NC1E 4F7EB 3HKFA 5FECA 1TTUA 4OQTL 2EIZB 5GS1B 1DBAH 2ZUXA 1S9VB 3BP4B 1TVBB 2FLBT 2GK0A 4PV9B 1T4KB 1Z9MA 5EZLA 3SKOA 4I2XA 1AXSA 2X4PB 5C6WH 2ZCKH 5ICXB 5D1ZB 5JZ7D 3C6LD 4G7VL 4HAGA 4PGDA 3QWRD 1TQCC 2ENSA 1FIGH 4ZTOH 5EORH 4WVRA 2C4FU 3FB8A 2P24A 4J8RA 5GZND 3LKOA 1BLNB 1KPVA 4PG9A 3T65A 2HFTA 5TQ2H 1XF3A 2DQGH 4OI8A 4XCYA 2L4OA 2VAAA 3DRTA 4UAOB 5IEKB 4BFIB 2RFXA 1LE5B 3SDYH 2CR6A 3QIUD 2JJTA 1IBGH 1DQJB 5L2KD 4TN9A 2I9TB 3DI2B 3SDDD 4FQLL 4QLRA 1JHKL 3GMRA 2J1KA 2WINB 4G42B 1MJ7H 4P5MB 2VQ1A 3TBYB 3VGEA 2G9HB 1N5YL 2L0DA 3GO1L 4QO1A 4KK9C 3S9DB 3HUJB 2BVTA 4WO4D 4C56E 4WFEE 3MV11 3TZVB 4L1DA 3X13A 2HN7B 2R69L 3SE4C 5AWNH 4CMMB 4DGYH 1GC1C 1NGQL 3LHPH 4M8QA 4CKVX 1JNNL 4KI5F 1CLYH 2ZUQB 2NY7H 1S7XB 1IC7H 3DX8B 5C2BH 1R3HB 3GMQA 1KENH 4C56A 4OCXH 3GBMH 1G9NL 2PTVA 4NUJA 3ULUL 5EU6B 1D6VL 5IR1A 1FPTH 2EXWC 3TCLA 1OAZH 1DANU 4H8WH 3TVMB 1AXIB 3QDMB 4JFHE 1ONQB 4KPHL 3ZE2E 3SGEH 1RV6X 3GI9H 2D7TL 4CAGA 4FQ2L 3PJSB 2JIXA 3QUYA 3PHQB 4YHMH 5M94B 4AYFA 4HJ0D 4XAWH 3EFDL 5C0GB 2OXGA 3MNWA 2IALA 5FA4A 2NY4C 5J1TC 1KACB 3NZHL 1WIPA 1U8QB 3MOAL 3QCTL 3MREB 4G6FB 4P23B 5E6IA 1RJCA 4PJ7F 5IESL 3KXFA 3BD4A 3V5KA 4CDGC 3C2AL 1QRNB 2ZKHH 5T3XE 1IEBB 1MFNA 4YHOH 3GIZH 3GMMA 4GKZA 4PJGB 3LVEA 1AIFB 3VD4A 3EJZD 5IQ9B 4HUNB 4UI2A 4QRPE 1WBXA 4LHUD 3RZCC 1HH9A 3ARWA 3HE7A 4GSDL 4JM2D 4CGTA 3HG1E 4GUPB 2YZ8A 4LHJB 2H32B 3WSQH 4QT5B 4MJIB 1WQVT 2XRAH 3JVGC 2RBLA 3K8KA 3VWJA 3ARRA 4XBGA 3N1GC 3P77A 3GK8H 3GSXB 2V6HA 4PJBF 1FG2B 2DDQH 3MLUL 4QRPA 3IGAB 2GCYB 1HHHB 1DVFB 2YD3A 1UH4A 5FGCE 3HG1A 2BSSB 1SVCP 5HHMD 1OGAD 3QBTB 3EKCA 4RMSA 3VI4F 3OTTA 1U3HB 3DO7A 3NA4A 1V5JA 2AKRB 3DX7B 4YBHA 5IVOA 3B9KC 1B4JH 5JOFB 4JRWA 4NQCA 2PYED 2UZXB 4WUUD 2X44D 4LDLB 5DHVA 1JZ7A 1XH3B 3KJ4C 3CDCA 5HYSA 3IRPX 1FV1B 5I1GH 5DD5H 3RWJB 3QQ3B 5C0ND 3VD5A 1FLRL 1OF2A 4NZUL 4M5ZH 4MQSB 2PXYC 1NBVL 3VFMA 3R8BB 1VKXB 2DI9A 4MYWB 3W9DB 3ROOA 1EO8H 4Q58C 1F8TH 3BT2H 3BAEL 4E41D 5JHDD 3SGDH 3EGSA 1MUJB 4GG8A 3IKKA 3X12A 1UC6A 4LSPH 1JF1A 5E0QA 2ITCA 5CD5C 2RR3A 3EYUH 1J9CT 4ODHH 3QXAB 4YHLL 3DLQR 2AQ1A 1BIHA 3PWPB 1GGBH 4Y89A 2ZWLT 4OD2B 4Y16C 3IDUA 2A83A 1A1MB 3GSVB 4KK6C 2HKFH 4OF3A 5I1CL 2R1XA 1CF8L 3G5YB 3U4EA 1NBYB 4WWKD 4RWHA 3IS0X 4OF8A 4HBQA 2DD8H 1BQUA 5HHPA 4TSBL 2Q3ZA 4JFYA 1LEIA 1UB5B 3QIWA 1HHJB 1RUAH 1KUMA 3U7WL 5IVNA 1ZSDB 1IZKA 4KC3B 4LVHB 2IAMA 3LEVH 3T0ED 3WO4C 4POUB 2N1KA 4GRMB 3JWOL 5J11B 2X6MA 4EQ3A 4F57L 2G5RA 4J6RH 5MENA 4AENA 3KPRD 5IBTH 1QLFB 2OP4L 1R3JB 2HG5A 3EO9L 2X89D 1DSFH 4LF3B 4U1NB 5C08B 1D6EA 2D7OA 3IF1B 4BSWA 4CN4A 4HCRA 5AYQA 3HI5L 2WLZA 4DEPB 4PV8A 3LKQA 4FFYL 3ARFD 4NNXA 1MAMH 4IMLB 5DJ0B 1X3DA 2WUCL 2A73A 2ERJC 4IDJH 2EC9T 4N0YL 5IVZB 3TIDB 1CDHA 4YHZH 5C0CD 1FH5H 2EDJA 3ES6A 2F19H 1F4XL 3LS4L 5C9JB 3F7VB 5ICYB 2JCCB 3SE9H 2VKXA 4F8QA 2R2BB 2O5ZL 2WBJD 1PQZA 3KPMB 5JW4N 3MV7A 4JFQB 5EU5A 4JO1H 5EOTB 4YUEH 1U41A 2YK1H 1KLGA 3PV6A 4ZFGH 4ODWB 2GJ6D 4YX2H 2VB5A 5JW4M 2KZWA 4KRNA 1FE8H 1JUFB 4YK4C 1VGEL 3CXDL 5EU7E 3G6AB 5IBUB 3IU4L 5EO9A 4RAVB 4PJ8A 2H6PB 4NGHL 5HPMB 4OZGF 1MFCH 3AM8A 2FR4A 5DD3H 3FO1B 1W72A 4Q2ZA 2QQLH 4JCLA 2JK5A 5LCVH 4ZUUB 4K71C 2M26A 3DV6B 1EGJL 4RMWA 5SWSE 2DWDA 3P0YL 4PG2A 1MCLA 2MKLC 4JJ5B 5GRYA 2BXZA 5HHME 1T21B 4JRXD 4E5XA 5F7NC 1M6OA 1JZ2A 4KHTH 5SWSA 2D31B 1ULVA 4JKPL 3TLRA 5D1XC 4PYGA 5FGSA 2PUQT 4OCWL 4OQTA 1A2YB 2Y25A 4TNWK 1A4JA 2W0PA 4U7SA 1RJYA 2XTJD 4K7PX 4W6WB 5D5ME 3CK0H 1ITCA 3JWDC 4ZXBA 5L88H 4NSKA 4YZFE 2ORBH 3UBXB 1ZWIB 4IS6B 5I9QC 4HLZG 4KJYA 4QXTA 2P44B 3F5WB 4U3HA 3BPLB 1YECH 4M1CD 1AJ7L 2XWBB 3VRIA 2VE6A 5DJCB 1UWEL 2VDNL 1WLHA 4Y4KC 3UYRL 2F54D 1LO2L 3KS0J 3HNTH 4JHWH 2H45A 2W60A 1OAXH 1EZVX 3V4PH 3BVNA 3C8KB 5C0AB 4NQVA 5CZVH 1OARH 5MHSE 1DBKH 4ODBD 3FMGH 3VFVB 3WN5A 2ARJB 3ARDC 2BRRH 3SKJL 2EZ0C 3QUZA 2X1OA 3N1PC 3GHBH 4K7PH 3AVEA 4DN3L 4HGWB 2D3VA 1KTLA 4FQPA 1HHIB 5IB1B 3G6JF 3HPLB 5IROC 4XC1L 4BH7B 3ULUE 4ETYA 1BBDL 2VDOH 3LRSA 5FA3B 1T89A 4GOSA 5FF6A 2NZ9C 1K6QL 2CIKA 5EPMA 5BMFL 1MHEA 4NO3B 3MOBL 1RZ8B 3DROB 1U2HA 3MA9L 4RFNB 3LZFH 2E9IA 3GKWL 1FC2D 1BQLH 4NUGL 2CKNA 4OLUL 3RIFK 1GL4B 3DVFA 1U91A 1TITA 2DMCA 4X6CE 3WFZA 1A6VH 5E94A 3MLVH 5E70A 4QOKE 4N0UB 4F58H 2CRZA 1A1NB 1C5CL 1QNZL 3GMNB 5FHBL 5FIEA 4PTUA 3KPRE 4UTAH 2NY0C 1G7QA 3EDEA 3QG7H 1XIWC 1AC0A 1D5MB 3VCLA 1OCWL 4GBXC 5EUOE 4OGYL 3TT1L 2ZSWA 3QCVL 5J57B 1OWRM 2VXSH 3L3JA 4MNHB 4J1UB 2YOCA 4QOKA 3RHWF 1NQBA 4YDVB 1CGSH 3IDGA 1SJEA 3ARYA 4YBLC 1KEMH 4WHYH 5EUOA 5DEZA 3QPXL 2NMSA 1JGDB 4PJEF 4S0SD 1EVTC 2CKBB 2R4RL 4OFIA 2FSEA 4G6KH 3L5XL 3KYKH 1RJZA 3U0WH 2X41A 3QI9A 1J87A 4PY7A 4RX4A 1S9WA 5CKGA 3LKSA 4UT9H 4QHUA 5DQ9A 4OF6A 1XGYH 1F97A 2DM4A 2R8SH 1KCUH 1IAIL 4ZDHA 2JB5L 4KI5D 3FFCA 2Z9TA 4MWFB 1MNUH 1CICC 1VACB 5TFSH 4Y8DC 1P6FA 2VZTA 1RD6A 3IFOA 1QR1B 5E2WL 3CLEL 2IMNA 4JRYB 5E00A 1TPXB 4ESKA 1TMCB 1I7RB 1AE6H 2EH7L 5DQDH 3OKDB 3C60C 1YEKH 4EUPA 1INEL 3MV9E 4ZS7H 2ZCLL 1LP9F 5ISZB 1BD2B 3H7BA 4NT6B 3D85D 1YQVL 3DI3B 4M62L 3HMXH 2LU4A 4K3JL 1TCMA 5MEOB 1UWGL 4HG4J 5DHYA 3C09C 1WTGT 3Q6GL 3O4LD 4X98A 1UADC 1GYAA 3MV9A 1XFPA 1IM9D 3S7GA 3ULVF 5IMLA 3MXWH 5I66A 5CBEA 1UCTA 5IJVA 4S10A 5CJXA 5DJZA 4APQD 5HHQB 4M1DL 1MCDA 1A7BA 2BVUA 2VC2H 3V6ZA 5HYFA 2CDGB 1OWWA 4ETQB 4HPYH 1QBML 1OP3K 3QQ9D 4AZ8A 4FQ1L 2VLKB 3PWNB 1CXLA 4LQFL 1ZGLA 3QA3B 3GSUA 4Z7VB 5BJTA 4ZOCA 3UTSE 1ZK9A 2QV2A 1TLKA 2UY6A 4YPJA 5GZOD 1KSRA 4XBPB 1U95A 5IBLC 5TF1L 4U1HB 3OB0K 2A6IA 3BMWA 3C5SB 5EZJB 3QJFB 3KPQB 1Q9LA 1SEBA 3VXUA 4JY4A 1QBAA 1IGFH 4YPGB 4P0DA 4GAYA 3GM8A 5E8OA 1EEUA 5E4EC 5TPWH 3UTSA 5IG7A 3I6GA 1T1ZA 2J8UE 4NHUB 4HJJH 5K9KB 4LCUB 4P4KC 2F5BH 4LIQL 4DAGL 5EU3A 4J3TA 1I8MB 2F54E 3DVNA 5BW7C 5DJ8A 5FO7B 4MNQB 4FQQA 1LO0H 1TJIH 2B4CL 4Z7WF 2EIDA 5SWQB 5DC9B 5J6HA 1OTTD 2J8UA 4D9QE 4PUBL 4XVUC 5K9JH 3IDJB 2YWYA 4YC2C 5EZIL 1MFDH 3VW3L 5D7JD 3QXDA 1RZKL 4XNUH 1H3WM 4Y88A 2AV1B 1DP0A 2VDRL 4CL7A 3SJVB 3GBLA 1GH7A 5D2NB 4G8IB 4TUKH 3HN3A 2ADJB 4ZFOB 2QL1A 3VXTA 1W0WA 1G6RB 1Q0YH 5M95B 4D3CH 3GSWA 4L4TB 5I8EA 4HW6A 4L8BA 1RIUL 3O41B 3UX9B 8FABA 5EOQH 1HCVA 4XXDB 3RKDD 1D5IL 1RI8A 3CGTA 3O8XA 1A6UH 1ZANL 5C3LD 2X40A 3NGBB 4U1IB 1QLRB 3OAUH 3OKKB 3QIBC 4KTEH 2DQTL 1UZ8B 4LGRB 4ZO9A 2C26A 4PRNB 5JDJA 3IDNA 4Y5YC 2WBWB 2BC4B 2VNCA 4RDQF 1JNHB 4X7EC 4EN3D 4OZFG 3IVKB 3KLDA 4LOUD 4M7LH