2QDWA

Structure of cu(i) form of the m51a mutant of amicyanin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
104
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKKYETPELHVKVGDTVTWINREAAPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A single methionine residue dictates the kinetic mechanism of interprotein electron transfer from methylamine dehydrogenase to amicyanin.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 27
structure length 104
sequence length 105
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2qdwA00
4G7QB 3CDZA 4AKOA 3TASA 4DP0X 3PAVA 3EF4A 4A66A 2DY2A 3RYMA 1AQ8A 1IKOP 2HRHA 4DP9X 2IWEA 4YSRA 1GY1A 1OF0A 2XXGA 1AOZA 3GXUB 2YAOA 4JHVA 6PAZA 2PPCA 1SF5A 3AW5A 2BP8A 2TSBA 4G70B 2BW4A 1HAUA 1VLXA 1M57B 2BZCA 3WNJA 1HAWA 2I7OA 3QJQB 4NERA 3MX0B 3NJMA 1JXFA 4BXSV 1JVOA 2EIJB 4DP6X 2IDTA 2PPDA 4EF3A 4A2DA 3ASOB 2DWSA 4BWWA 3SQRA 2YXVA 2ZONA 1T5KA 3V9CA 1XB8A 3C75A 2EILB 1AR1B 2XV2A 4JKNA 2FT6A 3NYKA 4FA7B 2CUAA 1GYCA 1ET5A 2PCFA 5I6PA 3QJUB 3U25A 1NWOA 1M9WA 1PLAA 4E9VA 1AS7A 2IDQA 2XWZA 4E9WA 2PCYA 1E5ZA 4A2GA 2PP8A 1PCSA 1W6LA 3AY2A 1OCRB 2VW7A 4YSDA 4A2HA 4KO5A 2FT7A 1WA1X 2QPDB 2IWFA 1KDIA 2JFCA 5TK4A 1JZEA 3UACA 1KCWA 3FSWA 2CALA 3TBCA 3T6XA 3X2QB 1W6WA 3WNIA 1XB3A 1GR7A 1UATA 1SFHA 5B1BB 3FS9A 2GC4C 4E9RA 2H5UA 2YAEA 1ZIBA 2H3XC 1NIDA 2VW4A 6PCYA 1NIBA 4HALA 2J55A 3NP3A 1BXAA 3FYEB 1A4CA 1NINA 2EIKB 3KW7A 1AZNA 4HCIA 4KO6A 3H4HA 1J5CA 3DIVA 4DP5X 1A4AA 3SBRA 2ZOOA 3NSFA 2BP0A 3UABA 5I6MA 2MTAA 2QT6A 1TKWA 2Y1AA 1L9PA 4E9QA 5AFAA 2XV0A 3GYRA 5AKRA 3OM3B 2J5WA 4BXVA 1KDJA 2J57A 3WKPA 3T6ZA 2ZXWB 3NSDA 3QJVB 3ABKB 1TU2A 3CZUB 2CAKA 4NAJA 2BZ7A 3L45A 2DYSB 2YAPA 1KGYE 1A65A 1JZFA 1SFDA 3FSAA 1AZCA 2R7EB 1A4BA 2BHFA 3BQVA 3QJRB 2WSDA 3T6VA 5I5MA 1N68A 4UF7C 4WTQA 3S3CB 1JERA 4DP8X 4Q89A 3PXLA 1IBYA 4KO9A 2BWDA 1J9QA 1GW0A 3ZIYA 2WO3B 5D4JA 4AKQA 2B3IA 2XYBA 3S3DB 2CBPA 2P80D 1JZGA 1V55B 3ERXA 3PPSA 4E9YA 1L9RA 5I6NA 2FNWA 2DV6A 3ZBMA 2QDVA 3NJNA 1KYAA 2BP0B 4A2FA 1JOIA 1IBZA 3T6WA 5A7EA 1AIZA 4E9TA 1GS8A 4P5RA 4N8UA 1KBVA 3FQYA 1ZV2A 1DYZA 1QNIA 3QPKA 4HHGA 3NT0A 1JVLA 2PP9A 3ABMB 3AG1B 1BXVA 1A3ZA 1AANA 4KOBA 1V10A 1GS6X 1RCYA 2UX6A 1CYWA 1XMEB 2LLNA 3OMNB 4MFHA 4DP7X 1OCCB 4KOCA 1L9OA 3ASNB 5B1JA 1AZBA 1YLBB 2I7SA 2J56A 4PCYA 4HZ1A 1J9RA 1WS7A 2PPFA 3NJGA 4G71B 3SBQA 1OE2A 2VSKB 1TEFA 2AZAA 1GY2A 3FT0A 3FU7B 4GP8B 1PLCA 2FTAA 2IWKA 1BQ5A 2VN3A 4KNTA 5TK2A 3BVDB 3IEAA 1NICA 3QJSB 2GIMA 1F56A 2GBAA 1NTDA 2YQBA 1ILSA 1OCZB 1J9SA 3CVDA 1IUZA 1E5YA 3FPYA 5AZUA 3PLYA 1AZRA 1X9RA 4YSEA 1SDDB 2IH8A 2VM3A 4FAAB 4YSSA 2Y69B 4AX3A 4YVNA 4L0PB 3FU9A 7PAZA 4DPCX 3EHBB 3TA4D 1OOWA 1PZBA 2PPEA 2UXFA 3IN0A 3NJIA 1I53A 1X9UA 2EINB 5FC9A 2BO0A 1AACA 1ADWA 1NZRA 2YAHA 3H4FA 4HIPA 2PP7A 3FQ2A 1W8EA 2YXWA 4HAKA 1IC0A 2VM4A 4HCGA 5B1AB 5F7BA 4F2EA 3WI9A 1B3IA 4P5SA 1DZ0A 1EZLA 2Q5BA 3X1EA 1MZYA 2XU9A 2HZHA 1MZZA 1KCBA 1SJMA 1MG2C 1ZIAA 3PAUA 3AG4B 3FPXA 3N55A 2X87A 4GYBA 2IAAC 4BWUA 1PNDA 4YSAA 8PAZA 5B7EA 1E67A 2UXTA 4G7SB 4A2EA 1RKRA 2R7EA 3NJLA 1MG3C 3GDCA 4YSQA 3QJTB 1AS6A 4WKXA 4M4RB 4K9JA 4QKTA 2Q9OA 1SHXA 2YAFA 5PAZA 1ASQA 4BWTA 1J5DA 2XX1A 4ZK8A 1PF3A 2MRYA 5B3SB 1ASOA 2IDFA 4KO7A 5E9NA 2DWTA 1QLEB 3HB3B 1OE1A 1NPJA 3ZDWA 1ETJA 2EIMB 2AZUA 2HLEB 3NP4A 3OQRA 4M3HA 1ZDQA 3PAZA 5F7AA 3S3BB 2BW5A 1PLBA 5B1KA 1L9QA 1V54B 1JXDA 1CC3A 2GB2A 2YAQA 2N0MA 4KNSA 3DKHA 1SHWA 3G5WA 3NSCA 3FQ1A 3ZX1A 3NJHA 4NB7A 2OCCB 4E9SA 1WS8A 4JHUA 4RH4A 2GI0A 2FQEA 2H47C 3IN2A 4YSCA 2HXAA 2UXGA 3CVCA 3EH5B 4BDVB 4QLWA 1OV8A 2E86A 2HX7A 1ZPUA 3S8GB 4F2FA 1KBWA 2FQFA 2WO2B 1PY0A 2BWIA 1PAZA 2FT8A 3QQXA 4G72B 3WIAA 1ILUA 1FFTB 1PZCA 1AZUA 2OV0A 3AG3B 1L9SA 4YSUA 1WA2X 1BYOA 2XV3A 1JZHA 3UAAA 1GSKA 4CSZA 1CYXA 1ET7A 4YSTA 4DP4X 3TU6A 2CJ3A 2P80A 2PLTA 4ENZA 2VSMB 3DTUB 4BDVA 5LDUA 2GHZA 3T9WA 3X1FA 1OCOB 1M56B 4TXVB 7PCYA 2ZWNA 3FU7A 1L9TA 4GP5B 3H56A 3ABGA 2AANA 5B1JC 1ZDSA 2JXMA 1BXUA 1NDTA 4W9ZA 4YL4A 3NJKA 4PAZA 3KW8A 3SBPA 3ABLB 4F7KA 1AS8A 1AAJA 3CVBA 1EHKB 5I6OA 1JZIA 1ET8A 5I26A 1ID2A 3FU8A 2XLLA 1TEGA 2YAMA 2IDSA 2TSAA 3NJJA 1FWXA 2CCWA 1BEXA 1BAWA 1J9TA 2OJ1A 4E9XA 2QPEB 3S8FB 1BQRA 1HFUA 3WG7B 4N4YB 3FSVA 5B7MA 5EHFA 2QDWA 1GS7A 1CURA 2I85A 4DPBX 2VMJA 3CDZB 3TBBA 1NIFA 1A8ZA 5ANHA 2UXVA 3JT2A 1AG6A 1OE3A 4G7RB 4UAHA 1URIA 3OMAB 4AI7A 2AFNA 4KNUA 2GC7C 3PCYA 1WAEA 4HCFA 1JZJA 1R1CA 3FYIB 3X1NA 2PPAA 4YSPA 2GSMB 3FSZA 3IBOA 1CUOA 2AVFA 4X4KA 5D4IA 1PMYA 3IE9A 1QHQA 1SDDA 2B08A 2HX9A 1WA0X 2UX7A 3V9EA 4AKPA 2JKWA 3EH3B 4GXFA 4Q8BA 4GY4A 1MDAA 4YVUA 3EH4B 1E65A 4DP1X 1BYPA 2FQGA 3X1BA 1NIEA 2W8CA 2NRDA 2W88A 2HRGA 5I28A 3AZUA 1NPNA 2X88A 1E30A 4CSPA 1N70A 2XVBA 2HX8A 5D4HA 3WKQA 3X1GA 1RZQA 1NWPA 3D12B 1XB6A 4DPAX 4A68A 2RACA 2DYRB 1JXGA 3N2JA 5PCYA 2FJSA 2IDUA 3HEIB 9PCYA 5I5IA 1SNRA 5I6KA 1NIAA 5I6LA 1SF3A 1RZPA 2XXFA 4GP4B 3UAEA 4UANA 3NSYA 3MBWB 4A67A 1ASPA 1FA4A 1BQKA 2YARA 2IH9A 3CG8A 1AG0A 3OMIB 5B7FA 4AZUA 3UGEA 3UADA 2FWLB 3JTBA 4YSOA 2A3TA 4DP2X 4HHWA 2FQDA 2BP8B 2XUWA 2VW6A 2XX0A 1KV7A 3OD3A 4BK5C 3T71A 5I5JA 3AG2B 1PNCA 4W1TA 1PZAA 5IY5B 3NJFA
chains in the Genus database with same CATH superfamily
4M7LH 3W39A 1FLRL 4PTUB 1G7PA 5FKPA 5JPNA 3I02A 3MJ6A 2DM7A 3M1CA 1C1EL 4WSKA 3RYMA 5SWSE 1REIA 1XCTB 5IB3B 2RAMA 3NJXA 4KROD 4YNYB 4AMKL 4BFBD 1HU8A 2OP4H 4LVEA 4UINH 2P5EB 3KPNA 4YHLL 3QPQC 4HIXH 2CK0L 4FN0A 5IIEB 1KIQB 5IB2A 4F37K 1R33A 3NEOA 5IR1B 4ONHB 1QBML 4KFZC 1H3PH 1ULVA 2AJVL 2ZX9A 2Q0ZX 2J8UB 4POUB 3SPJA 3SYPA 1HWGB 5HHMD 4LLYA 3KWTA 4N90E 3J2PA 3GRWL 4QHMA 5I1LA 2EDKA 4HHAA 3BRFA 6TAAA 3NIGF 3QJQB 2BSRB 4NUGH 4YJZL 2WQSA 4BXSV 3PYCA 2HPOA 4XAWL 5EEVA 4PRAA 4YOKA 3FHQA 1HE7A 2OI9B 1EXUB 1YJDC 4L0ZA 1S3KH 1TO4A 1PX8A 1KTLA 3ELAT 2RQ8A 3MXVH 2BMKB 1N12A 4JFUA 1BQHA 1OGPA 4KKAC 4JN2B 3ROOA 5BS0B 4H1LG 4ONHA 5L88L 2R8SL 2HT2C 3L54A 3EDKA 3NCWA 5DLML 4Q74A 4P3CL 4FQJH 5IB3A 1CR9L 5DO2D 1EJ6A 4LEOB 3U0PB 1VACA 3GSVB 4PJDF 2WTPA 5F9JA 4ZMVA 3DGGA 3SGEI 1BVNT 4R7DA 3UGUA 2PP8A 3CFUA 3O6LH 4MA3A 1V3JA 3IGUA 4PRHB 2AJ3B 4XMPL 5FIEA 4IKIA 3L3KA 3VH8A 4HFUL 3ZDZF 4XMTA 3MOBL 2XNAB 3NCBB 5BQ7B 4ABWA 4XNXH 1DJYA 1NEZA 5BS0E 1AKJB 3T0BA 2ZXGA 4H5SB 1U8NB 2KHAA 4B6ZA 4G80A 3WIIH 2YMTA 1OAYL 1M05A 2Z34A 4FABL 1II4E 1S3KL 1UOKA 3II2A 5DMGC 1WSST 1I1YA 2WLIA 1OARH 2EE9A 3TWCL 1N64L 3SDCB 3PF2A 3DETD 5E00A 4MS6A 3FS9A 5JOFB 1P2CB 4MVBC 4XX1G 2YAEA 1ZIBA 5GS1C 1J7VR 4WCYL 2DIAA 3QEHA 2IMMA 3N0AA 2AI0H 4XPAL 2AJ3A 3BWZA 4S1DD 1XXDC 4DP5X 1FH5H 3VXMB 3WCYA 1A4AA 2H2SC 3SBRA 1CF8H 2E7DA 3U0PA 3AXIA 4GQRA 3NSFA 3UABA 5CZRA 4K3HA 2AV7A 5ESVB 2VR4A 4XPHL 5F0JB 3EO1A 4M93C 2CHNA 4WEMB 2WYHA 1MXGA 3FTUA 2I9LA 2AKRA 1AIFA 1L7TH 2GTQA 3S5YA 4EI5D 1T7VA 2X38A 1IEAB 4FQHA 1MFBL 1X5MA 2XFXB 4U1JB 1IJNA 3QRLA 3HI5L 1NGPH 4OLZL 1JYNA 2CBQA 2G9KA 1N9PA 2EABA 4I9XA 2WN3A 4UOW1 2HRPH 3VXOA 4NZRL 1KCVL 2IV9A 3T6VA 4TPRH 5F7HA 2Z4QA 1JERA 3NRQA 4EI5A 2ZX5A 4HXBH 1NCUA 5E9DB 5BZXA 3VRJA 3W3BA 3CFCL 1AXSA 4L8CB 5JW5B 5E8NB 2P80D 3P4OB 1MCIA 5HI3D 1L9RA 3PWPB 3WDJA 2XTJC 4HP5A 3NJNA 4GMSL 2ED6A 1Q1PA 1YY8B 3FC8A 3GBNH 1NC2D 2HWZL 1HHKA 3BH9B 4K3DL 3NIFB 2XG4A 4MJ4A 4I77H 3CN4A 4P5TD 3TCTA 3BGMB 1CU4H 3TX4A 2BVPA 4YDVB 4ZDHA 1QNIA 1KENH 1I8UA 3CLFH 2ED7A 1C5DB 5A6IA 2B2XH 2P5ED 3LZLA 3JV6A 5HVGB 1XH3B 1QZ1A 5GGSB 1A7PL 4OCWL 5E7FA 4BRJA 4FADA 1UQSB 5KVGH 2J8OA 4FZ8L 3CJJA 4PJCE 4BKLA 3EJZC 3HC4H 4BSVB 2JE8A 3SYCA 1KGCD 1NAML 1SOQA 5F88A 3NIGE 1MI5A 5FR3A 4NZ8A 4LSTL 4PJ5A 3DPDA 4L1BA 1H6TA 2SEBA 5CLXA 1BGXL 4X80H 3NDZE 2CRZA 2WKOF 5JUEH 4JUTA 3I6LE 4J2XA 1TEFA 4L48A 3U9UA 1P4BL 5ACLA 4M6ML 1HOCB 5E2JA 2W9DL 4GRWB 5CJBA 3GXTA 4NQDE 4JMNA 4HKXA 3QR0A 5J3HD 4P4RA 1MCHA 3QHZH 3TBYA 2AK4E 2MTPA 4PRPE 1ZGLP 1BAGA 1R5IA 3VG9C 2AQ1A 1PG7L 1JZ5A 4YH6A 3UBXA 3AQDA 4FI7A 2WB1A 1XSJA 2C9VA 1DP0A 3RWGA 5DJ0B 4EZLA 2R0LL 3LKRB 4NXKA 3SKOA 5I73C 2IH8A 1G7JB 1Q94B 3RPIA 5CS7A 3U46B 5KVDE 5KVEL 2PXYD 4RWHA 3QXVA 4GO9A 4NNYB 5DRWB 4XC1H 2VDLH 1A9BB 2ATPA 1LO4L 3G08B 5C0BE 4XVTH 3BFWA 1I53A 1P84J 1S7XA 4AJVA 3QDMD 3NGBC 4FLSA 3FO0H 2ZPKH 5IMMA 4PU2A 3CFEB 1OW0C 1BFOB 4OZFB 3VXNA 4HIPA 4NO3B 3EJYD 4UQAA 3ARDD 2Q20A 3BEWA 4GRMA 2JCCA 4TVPH 4HQQL 5HGAA 4U0RC 1USZA 1AR1D 4A7SA 5EEYA 5GGVL 2WXLA 1YPZB 2BVOA 1WQVT 2IQAB 5KYXB 1OY3B 4M5ZL 2HZHA 1MZZA 3O6FC 3BQUC 2BIQA 3HB3D 1SJMA 5E08L 4ODXA 3S35H 4PJEE 3WNMA 1HYRC 5GHWH 3TESA 1MHCA 1WFUA 3H7LA 3MVSA 3Q3GA 4XCEB 2DTSA 4N28A 4WWOA 1HKLL 2NY4B 4M8UA 4Z95H 5DUMH 1KIUB 4Y4FC 3NCYP 3B9KA 3NCJH 4UQIM 1GGIL 4YE4H 2R7EA 4XVSH 4TULH 2WYIA 32C2A 3E1F1 4K7PL 1LNUB 4S10A 2JCCB 1BHGA 3AGWA 5LNDA 3I6GB 5K69A 2X4NB 1WZMA 5AYUL 2Z7YA 4BWTA 1CDUA 5FO8A 2FLMA 1IFHH 5DJXB 3LXCA 3VWKB 1MWAL 1WZLA 5JNYA 3MCKB 4GAGL 5JPMA 3WKNA 2BH0A 1IBGL 2ESVE 5C07E 2XWDA 2OTUA 2PYEE 4ICWA 3ZMEA 4FTVE 3WL9A 2O6EA 1S7VA 1DJGA 1OTSC 3HE7A 5D2LF 4P5TC 4P2RD 2BSBA 3WELA 5K39A 2VLJE 3Q1SH 4QRUA 4H0GA 4NM4L 1JWSB 3LNDA 1GZQB 1U8HB 4F3FB 4OR1A 4XX1E 6FABH 1U8JB 5F1KC 2R2HA 3IPEA 2A4CA 4WV1C 2NDGA 2BY1A 3MJWA 4YMPA 1DO6A 1JZ8A 3SDAB 1D5BA 3ZO0A 2WK2A 3ZGHA 2ICWA 3EJCA 5HDRA 3S88L 1JWMA 2I26N 3MROB 1YO4A 1ZOXA 3DUHA 4YEFA 4LASL 1RZFL 3C6LC 3LS4H 2Z35A 3VGAC 4LCYB 3NEEA 4EOWH 4Y9EA 3W38A 4JFPB 2A6DB 4P05A 1FO0H 3MUJA 5EBMA 1ND0A 4ZX3A 2EDMA 4JLRB 4ODWB 5H37A 4OD2A 4L4JA 4BZ1A 2XVGA 4TQEH 4N8CL 5T5NF 2LLLA 2XZAH 4KKPA 4XNQA 3H2QA 2JVUA 1BQLH 3NFPA 4ZRGA 5MERB 2MQ3A 2WGNB 2W07A 1GSKA 3WEAA 1RURL 3R1GL 3QS2A 1QEWA 4HUXB 1YMMD 1NSNH 3TV3H 4AYFA 3C8KB 2J1WA 5I8OL 3DTUB 3U7YL 5IROA 4E68A 3V52H 1RAMA 4DQAA 2N0KA 3V8CA 2FJGA 3U4EA 5FGBA 1KCSH 1L9TA 3HE6A 4JM2F 2XHNA 3M7FB 4MD5B 1OT2A 4Z0XA 2RALA 3ZKSD 3BRGC 3BPOB 2L3BA 4N0UE 4QRRE 2X4NA 1B90A 2Y7QB 4ZO8A 5H35B 1AS8A 3OLIA 1KWKA 1ET8A 3DLQR 3FU8A 2K7QA 1KACB 2IDSA 4WSJA 4WGWB 2VERN 3KL0A 4FZEH 4H2AA 2NSXA 1F6LL 2X4QA 1BAWA 3F64A 3OKLA 1IFHL 4XP9H 4G3YH 4N4YB 3FSVA 1MFEL 4V1DD 5D7IF 5AQ0A 4IIQB 2DJSA 4JANA 1DVTA 1TSHA 3VYOA 1R19A 4AUYA 3BZ4B 3QDAA 4MWFA 2AVGA 3K72B 4G9DB 4QRPE 1LO0L 1HEJC 3L08A 3ARBD 4ZT1A 4Y5XC 1RFDL 3HMWL 4KNUA 5LXGL 3B9VA 4K4KA 4JM2A 3WBDA 1AXIB 1Z2KA 5IKCB 2E7HA 3HZKA 3RVTC 4GKNB 5CSGA 2PPAA 4H20L 4O51A 2CLVB 3G5XB 1U58B 3DX9B 4O58H 4N2GA 3CZGA 1A22B 1W0VB 1GPOH 3KVPA 3RNKA 2ARJQ 4BBWA 3LX9A 3V95A 1U8KA 4PY7A 3EBHA 4UCFA 2XQBL 1ZY9A 1B88A 1FNSL 2FX8L 2UVFA 2YN5A 3QNYB 5J7CC 1PMYA 1A0QL 3VW3L 2J2ZB 3UBXG 5LKNA 3U46A 1BBJA 1MY7A 2X6UA 2NT1A 1RSYA 3LYRA 3PJLA 3SO3C 3HA0A 4PW4A 4OKVA 5DJZB 2IBZY 5HPOA 3SDAD 4LPCA 4A7TA 4TVSa 3OLDA 3ROLA 4U3HA 1BOGB 3OJ2C 5I28A 1TZHA 2CO6A 3RX8A 2XZAL 1G6RH 1GJUA 2COQA 1JV2A 3QEQA 4MGXA 4I9WD 3VXSB 1HI6B 3UJIL 5KANI 1S5HA 3TO2B 1I8AA 1NOLA 2PWFA 2X4OA 3SBWA 3FTSA 1KB5B 1PZDA 3PY9A 4XPBL 3BDYH 3GJFH 4C54A 5AUMA 4YO0A 1PBYA 2P7TB 2NY1D 4AYSA 2JJTC 2F53D 4ZUUA 5J89A 1M7IA 3QDME 4J3OF 5CJQH 2IFFL 5LBSH 3LDBC 4NQEB 5AAWC 3FT9A 4UQBA 1GZPA 3BPCB 4C4UA 4HUKB 4L8BB 3OKOB 2H1PL 3RVUD 5I0ZA 3ARGA 2CHXA 2KBGA 3EOYG 5HVFB 1KB9K 3FQNA 3LH9A 1AFVH 1ZVNA 4OAWB 4BUHA 3W82A 2WIIA 4YDIH 3GKZA 4KDTA 2JQAA 1QBAA 1HDMB 2AJUL 4U31A 5IQOA 2EDXA 1PZAA 1E9OA 3MNWA 4PB0L 5IJDC 3LH8A 2EXWD 1JHLH 4ENEC 3N41F 1YNTA 2ZCKH 1K6QH 3EF4A 4GAJH 4GLRH 1LWRA 3DO3A 3U1PA 1N18A 4KKCC 5D6DA 3DXAE 1L4IA 1Q0EA 1CGXA 5AWNL 3WIIL 1CTNA 4Y19B 3QCUL 1C7TA 4PSRA 2WSKA 3BESR 3WGUB 2JQZA 3VM5A 1JWUA 2PXYC 2TSBA 1KGCE 3B4NA 3COOA 3N06B 3NABH 4I7ZC 3RRQA 3NTCL 3VM7A 2CM6A 5IMOB 5D1QA 5IVXB 5KBNC 1KYDA 4G8FB 3RWFA 1W72L 2CO1A 2R2HB 2J73A 3BT2L 3QJHA 2OLDA 3GK8L 4BH8B 2WWMC 5BNXD 4UT9L 5I1AA 3GMQA 2AJUH 5I19L 4M48H 2K0RA 2GAZA 2H3NB 1OGAE 1MHCB 5HGDB 4PJ5B 1CXHA 5HVHC 4Q52A 4RETB 3C5ZB 5FOJA 3X3GL 4D9QE 3PGFH 4G5ZL 3F00A 4ZUSB 1OK0A 3BFQG 5I16A 2JJSC 2CUHA 3D0LB 1E5ZA 3QHFL 5DS8B 1WD9A 5EA0H 3GNML 5AALA 4YL9A 1W6LA 4OCLC 1OCRB 5I24A 3MKKA 3EJSA 1S7UA 3ASWA 4MDJB 2W0PA 1N5YH 2YA1A 3OF6D 3HCVA 2OX5A 4FKKA 3ZHFA 3Q6GH 2WZAA 3P9MA 2AQSA 2G4EA 4DVRH 2WXGA 4P5MB 2D7MA 2BCKB 2EE6A 4ZX6A 5ES4B 3RLSA 1AXTH 3HNSH 4M48L 1CD1B 4P59L 4H5SA 1LP9E 4FFYA 3ESMA 1NMBL 5IHHA 1BXAA 1Q0YL 4KO6A 3QUYA 2E9JA 1H15B 2ETWA 3FRUA 3H9SA 3OJDB 2GQHA 4TNFA 5FGBC 1B3JA 2DMKA 4HWEL 4TUJB 4LCUB 2DL2A 3U7WL 2CKBH 1CXKA 3EOAB 5BZWB 5I6MA 1WIPA 2MTAA 4LFHD 4DEPB 1T1ZA 5AKRA 1GHFL 1IKFL 2D0HA 2IAMB 3U4KA 3A24A 1NUDA 1WITA 2ZE0A 3Q5TA 3GJFK 4N26A 2NW3A 3U79A 2HVKB 3S9DB 5CJ8A 2BSTB 3O11A 5F7MC 1KGYE 1F13A 4NUJA 4D0CB 1A65A 2X2UA 1R5WB 1XGYH 1Z5LA 5ILTH 3HC3L 4U1LA 5KJ4A 4OFYA 3QWRA 1INEH 32C2B 5I5MA 4P2OC 3BAWA 3KD4A 4DP8X 2AJXL 3MFFB 3UO1L 5D1XC 5DHVB 4MDIB 3PXLA 3SPVB 3US1A 1F90H 3JBG7 4KO9A 1ZHLB 2X9WA 4M62L 5JR1L 4OLYH 3TOPA 1DUYB 3HAEB 3U4AA 3VVVA 1MFAL 1C08A 1JGIA 3S3DB 1FYHB 3QIBC 4XVSL 3QQ9C 3TBWA 3OR7B 2OMZA 5C0CD 3H2WA 4NQCD 5FYJU 4PB9L 4ODSH 4JY5H 3QP3A 5I0WA 1GXEA 5GRYA 1N67A 2XQYA 5GS3A 3TH4T 1DANT 4ZZKA 1I7TA 3WHE0 4JFEB 3WFZA 5HHXH 1UENA 2ZIDA 4HIQA 5SX5H 1ZV2A 2CDGA 4AQEA 1IC4H 2B9BA 2HRPL 3CFBA 4ZS6D 5GRZA 1I3UA 4O4YL 5CFHA 5M7QA 1GIGH 4XP6L 3IAPA 1OQXA 2TRHA 4F3FA 3E8UH 4GW4A 4DP7X 1G6RL 1NLDH 3BPNB 1IILE 1D9KC 4HUCA 4CVZA 2BOLA 4OCXH 4C56D 4ZO7A 1LDSA 1AZBA 3FUEA 3LNIA 3U1SH 1HHKB 4JFEA 4K5NA 3FB6A 2C9QA 4M7ZB 2FATL 3QORD 1SEBA 4MAZA 4YHOL 3BEVA 3GMPB 2FBOJ 4KDWA 1Z3GH 4WUKH 5F1SA 1LJMA 1A7OL 4BFRA 5BVPL 3GSXB 4WI2A 3IB4A 3CVDA 3VQMA 5ICZB 1W0VA 5JHBA 3F8UB 3CFMA 4NWUL 4U1IB 2Y7NA 1UXSB 4KJWD 3N1PC 2ZD0A 5HHME 2P48B 2VRAA 4AEEA 1MHPL 1ERNA 4X6BB 4EKJA 1J0HA 5C6WH 2YHGA 3EO9H 2M83A 1YMHB 1FNEA 1KCRL 4Y1AB 3TBSB 5I1DA 4L0PB 4WU7B 3AMLA 1I8LA 4X6DE 5BW7C 3C87A 3QQ3B 2DYPD 3NJIA 3K0WA 4Y4KC 5LBGA 3TV3L 1X5KA 4N2KA 4PJAE 3I9AA 4AVIA 2CUIA 3MXWL 4FDWA 4JO2H 4LCYA 1HL8A 3AITA 3VJ6B 2NYKA 5BQ7A 3DOSB 2V2TB 3H4FA 5K9OA 4HKZB 3OZLA 5F7LB 4OI8A 5BVJB 2V7HA 3UZQA 1L9NA 3QARA 3NCFB 4Q4EA 4WI7A 4D2NA 4G7VL 1B3IA 1H5BA 4LL9A 5E1HB 1KBPA 3QORC 4WHYG 1ZTMA 3MODH 4NS0A 3FTGA 5A6MA 4WU5A 3W9DA 1N6UA 3OPZL 1F4HA 4ZI8A 3CVHA 1AP2A 1X5IA 3D1MC 3HZ3A 5DMKB 5HSFA 3AG4B 2CKBB 3TYFB 4LASH 3T65B 5EF3A 1Q9KB 1O7DC 3HAEG 2CU9A 4YSAA 4PREB 4ZFGL 1CF1A 1ZSDA 3T8XB 2CLRA 2CHWA 4B7IA 1S8DA 4IJTA 1NBCA 5A40E 2IANB 4I4WA 1QACA 1TPXC 3IMBA 4QKTA 2NX5A 3CWGA 1M7UA 4WI0B 4CU6A 2Q86B 4YZFE 1WBZA 5EUOE 3B2VL 2XV6B 4ZK8A 2A74A 2RHEA 3H7BA 5B3SB 1O7SA 4WEBH 3SDDB 2IDFA 1USQA 3CFNA 4EO5A 3ZIMA 4YEEA 5DYFA 2YPLD 1RULL 1HC1A 4Y19A 5CLYA 4PJ9D 5B1CA 4WJG3 2DQTL 4JL2A 4BSWA 2VAJA 2ICWI 4X4XA 4P2OD 3RFZB 5F7AA 1I75A 3UC0H 3D30A 4RRPG 5C0JB 1CICB 2A7BA 4HOMA 4OZIE 4U1IA 1I7ZA 4DWHA 3TH3T 1P53A 4KUCF 2YAQA 1DE4B 1DN0B 1JCVA 5IWLC 3FQUB 4EI6A 3V2AR 5JA9A 1LXMA 2IF7A 2ZQKA 4JZOA 1D5IH 5I6XC 4FQQA 4Y0GA 1XH1A 3WMSA 4A7QA 2YRLA 3LB6C 4ZMOA 2O5ZH 1DBJL 1EGJL 3ORJA 3CHQA 4ABQA 3GHEL 1LE5A 4XNZC 2E86A 2YWYA 1ZLWK 4RAHA 4POZD 2X9XA 3O3AB 1CGWA 2Y07H 3FKUS 4UTBH 4F2FA 3FUJA 4NAMA 4AEIL 5INCB 4GI8A 1CFSB 4JJ5B 5BJTA 2HLFC 4J8RB 3EGDA 3T0XA 4L3CB 3KVDD 5DA0B 4YSUA 5LLIC 5FUZL 2X9YA 4WJ5B 1IGIH 2LVCA 3FO9B 5C09E 4QF1B 2YLKA 3JVFC 5DVNA 2A9CA 2QSCH 2GSIA 3SQOH 1OARL 4S1QH 3MR9A 5KSBE 4Y5XB 2D7NA 4Z77B 1L5GA 1ORQB 4LEXL 3UG3A 3X11A 3IJYA 5JQ6L 5MHSE 2MKWA 1JK8B 3LPFA 4GRLB 4RQQB 3TO4C 2D73A 2E4TA 3MYZA 4NX0A 4A55A 4G8GB 3V4UH 1SYSA 1IEHA 5MEQB 3NJKA 4ZUUB 2AEPH 4JRYA 5CN3A 5I1EH 4P04A 5D8JH 4HEMA 4F7KA 1OM3H 4KRMB 1O7DE 3KPSD 35C8H 4BFKA 3VFSB 1HHHA 5MP6L 4I18C 4RAVA 3WTYA 5I8OH 1KUMA 1G9NH 3QZBA 1QVOB 2Y7QA 1OAXL 3ZL4H 2VZVA 4W9IC 5E9AA 3ARED 3EYOA 3STZB 3QRGL 1OT4A 4N90D 3G3LA 3WAJA 1I1RA 4QNPE 1CURA 4YAQA 4Z0XB 3CH1B 4LESA 1KGJA 1S7XB 4JDTL 4G1EA 4OIBA 2HTLC 1T0MB 1JTTA 5GRJL 1SMAA 2FJGB 4W68A 1KLFB 4RCAA 4XE5B 1URIA 1OVZA 3L5HA 1I9EA 4AGOA 4JNXA 1DDHB 2ZJSH 4KQ4H 3OAYK 4MXVE 3N5AA 4OZHF 4MZ3A 3CX5J 2V7NB 1XGPB 1DQDH 1U6AH 2VCOA 4NQCA 3UG4A 1BD2B 5FCUL 4XWGL 1M42A 5DYOB 3WJLA 4XPFH 1KT2B 2IGFL 4PHXA 3S0PA 1YAZA 4PRHE 1EFQA 1BDYA 5IQ9A 4IHOB 4KVCH 4RRPA 2BCKA 3VXUD 3O2WH 4ETQB 3CHPA 5FK9A 5KYWB 1OGAA 1BF5A 3ZY7A 3I6SA 3MLSL 4PWIA 4DN4H 2X88A 4H25A 3C8KA 1X3DA 4MNQD 1CQYA 3N42B 3C9NA 4NQCE 4XO4A 5E6YA 2CM5A 2NY2C 3SDAA 4BUQA 1G7HB 3BPNC 1ZWIB 5IBLC 1KENL 1HEZA 2HT4D 3E0GA 4Y2DB 3SDYL 4Y4KA 3QI9C 4N9GB 1FUNA 2YD9A 2VDML 4OU3A 2ROXA 3HEIB 4QXWA 3H8NA 3O81A 4BZYA 5I5IA 3U2SA 1IBFA 3P1VA 3OZKA 3WHXA 1NCOA 4O2CB 3E2HC 1X5JA 2HVKA 4XPFL 1C5BL 1OGAB 1IGCH 4AQOA 1Y1UA 3K6DA 3BLBA 4IBYA 4E41D 2EZ0C 1N59A 4BZ1L 2F53A 3NH7H 2GK2A 1HHGB 3OMIB 4ZG1A 4JDVA 1ZHBA 1OAKL 2NZ9D 3L1FA 1JMXA 4F7EB 2JJVA 2BP8B 1HXYB 2IH3A 3T71A 5I5JA 3KWXA 4KZEH 2O4EA 5IVXE 3SIKA 1SHSA 3O3UN 4Z76A 3FRPG 5FLUA 2BXYA 5E9DA 2R2EA 5CCHE 4DGWC 2P24B 3EYVB 4E41A 4UBDD 3TASA 1OM9A 4PS4H 4DP0X 1G9EA 1AQ8A 3QDJD 3RWDB 2YEVB 5LO7A 3DX1A 2YSTA 3L5JA 4JLRA 3O2DH 4APQB 4JG9A 3AMKA 3P3YA 4OCRH 5EIVA 1HYSC 2Y2WA 1KELH 3AT9A 3LN9A 1MPAL 3FB5A 1YNTB 4XCYA 2X0UA 5GS0L 1T5XB 3P0GB 2VLRA 4QO1A 3W5MA 1QSEB 2OXHB 4XC1L 4YHLH 3UTPE 3SKMA 1HAWA 3OGOE 4J3OC 2X2YA 3POHA 4HUXA 2WXFA 1P5VA 2YMXL 4LPVA 4M1GL 3R7RA 3KEHA 1NCCH 3V0AC 3C8DA 5LAXB 2YPLB 2I24N 2ADYA 3M45A 4MNQB 4A2DA 2V9QA 3BD5A 3EYUL 1S9VA 3QXTA 3R18A 1DL7H 2ZCLH 3MKGA 3MRQB 1GGYA 4XNUH 4AUJA 4P3DA 4LVNB 3CD4A 3Q0HA 3WFBH 1ZEAH 3U6XA 4X5LA 2O5ZL 3KGSA 5GPRA 1FNGB 3TN0A 3Q6FA 4JDEB 3QJZA 5C0GA 1VDGA 5I0YA 2WBKA 5KYUB 4A7UA 5JUEL 2HLAB 2IO5A 3MV7B 3OXRA 4GUQA 1EUTA 1AS7A 1KB5A 4FQLH 2MOQA 5J11C 4G8GE 1NCNA 2WNGA 2UZIL 2XIBA 2CNYA 3O2DA 4HV8B 3HS0A 1O6TA 3H3PL 5E5UB 1OTUD 2FT7A 3EAKA 3H42L 3D50A 5K9QG 4XAWH 5D9SA 1AMXA 1SPDA 4FCHA 1TVHA 3FSWA 3CDGB 5CEXA 1BBJB 1FYTD 5JLZB 2C9AA 4TLUA 3BAIA 4AW7A 4AQAA 1PY4A 1GR7A 3HNSL 1RUKL 4XGZB 2H5UA 3EGSB 3MNZB 4Y4HA 4JFEE 3V5HA 4KBPA 4QKXB 1BXXA 1A47A 1FZOA 3DIVA 2NNRA 3CXHJ 3SGKC 1O0VA 2DWDA 2PCXA 2YRPA 1G1OA 2G2PA 2G5BA 2FUQA 2ZOOA 3GRWH 3GZKA 2MMXA 4FQQB 1KTCA 2BNUB 3SE8L 3VX1A 2AABH 1RZFH 4P46C 4TTDD 5I6XB 3BVUA 5AB2A 4AQ1A 1WIOA 4Z7NF 4S1DC 3H3PH 4BZ2A 3BGMA 5L2KD 2EUWA 1KDJA 2WOYA 1DQLL 4ZMLA 1SM3L 4XNZB 1DSFL 3CZUB 5EUKA 5TF1L 4TSAH 3VB9A 3WY3A 3HFFA 1DVUA 1WCQA 4F9LC 2AK4D 15C8L 3VXQA 2HLFD 3ATAA 3NIDB 2Z6FA 3FUNA 3GLAA 4JHAH 1FNEB 3GSNL 3BAEL 1AZCA 4XCNA 4PR5A 1TF4A 1UZ8A 3NK4A 1O7VA 2BHFA 4NXSA 3UYOD 2NW3B 1UB5A 2B5IC 3NCMA 2C4FU 1J88A 4LLVA 5DVPA 2WBJA 1KOAA 3S3CB 5E8PB 1KLUB 2ENSA 2QHLA 5DMGD 2HG5A 1DJZA 4WI0A 4X6CB 3CBKB 2D9QB 3LZRA 4IRSC 4F58L 2V2TA 3CZJA 3WJJA 3BSGA 1UFUA 1G7LA 1T21A 4X6DA 1XEUA 2PTUA 1IBZA 4HIHB 4QHUB 3LIZA 2XG5B 3F7PC 5I5RA 2CIKB 4P23D 4E9TA 4OUUB 4HMDA 4M6OL 4WGKA 1HHJB 3ARYA 4G8EB 4XCNB 4FXKC 2BOBB 5DQ9B 1DYZA 1AD0A 1J9CT 5DZNA 3LSOA 4YHYB 3WUWA 4RISL 1BXVA 2WCSA 4IGBA 1AE6L 1TCMA 4JZJA 2R9HC 4N3UA 2B59B 4HBCL 4QTIH 3RB7A 1F3JB 4KZDH 4JO2L 2ISDA 4PRHD 1MCKA 4I13B 1NPUA 4N0FB 4N8VG 4PJ7A 5KVDH 5BZDA 3FH5A 3MCLL 4OCNC 3VUAA 3D9AL 3GSRB 5DURD 4BK5A 4KK6D 2I7SA 2J56A 4HZ1A 4G8IA 4X4ME 4X6FB 3IKKA 2ATKB 5JHLA 4JFPA 3BAYA 4KHXH 2ED9A 1KN4L 4HS6B 1CFQA 1OE2A 2H0FA 4R7LA 1R3HA 2XN9A 5EZOH 4EUPB 3O4OB 1URZA 3LDBB 1GCYA 4PJAB 2NY5L 4M93B 3BQUB 2LU4A 3ZHKA 4HUUB 3PL6C 4KNTA 3K2MC 1XR8B 3QORB 3UTQB 1NICA 1Z3GL 1PIFA 3QJSB 3P3RA 4NPJA 4CILA 4LAJH 1RIHL 3LEYL 3WNOA 2O5YH 3ULVL 3T2LA 3ETBJ 1A6AA 4OLVH 3IAGC 1NMAH 2WBXA 1B4LA 1MPAH 2BVYA 2VM3A 4ZTPL 4APQC 2A1WH 3FONA 4JCLA 3KWWB 3LKSA 3DPBB 1R3LA 3SGDI 4NO0D 3HE6B 4DAGL 4W6WB 3TA4D 4R4ND 3ZZSA 5DRNB 3VWKC 3CFDB 3O41A 1PEZA 4NUQA 5FKAB 4JW3A 5CD3B 5LNGA 1R17A 1TMCB 3IJSB 5T3XL 2YAHA 2F15A 3DHUA 3ELQA 1SJXA 2DLFH 3TBWB 4M5YL 2WTOA 1ACXA 1BAFL 1TJIL 2JCCE 2YXWA 2NY3C 3BOVA 4QHPA 4IM8A 5C0AA 5FYLH 3NJVA 3ZTCC 4TTGA 2FYYB 2UZXB 2ED8A 1J5OH 1ZCRA 4ADIA 5EU3B 2VR6A 3VG0L 2DKUA 4R4BA 3G5YA 4LQFH 1P2CA 2FHFA 4B9PA 4OLVL 3K2UL 2G2NA 3LSOB 3FPXA 4E5XA 1TQSA 1YEEH 2K1MA 4OSUL 2KZBA 3O11B 1S9WB 2EDJA 2D7QA 2FH8A 2YOAA 3AT8A 2R23A 5D93C 1P7QD 4MJIE 4A2EA 1RKRA 5D5MA 3AXHA 5DI8A 4GQPH 1X5FA 3P2TA 4TNWF 2Y07L 4RISH 4UTBL 5GRVL 4DZ8B 5LXGH 4RGNE 2VSDA 4A63A 1UT1A 3IDJA 4MQTB 5I0DA 2FX7L 3NVQA 2KPNA 1Q72H 3L3KB 2OL3H 2Y6TE 4LHJB 5EU3A 2F8XC 4Z18A 4AENA 3RWDA 3FDWA 4EIGB 5HHOE 4IRSD 1QKZH 1OE1A 1G7IB 3ZDWA 4DQOL 4NKIL 2EIMB 1IGJA 2K6WA 1QBLL 1WBXB 2X70A 4QAWA 4G6FB 1QSEE 5IM7B 3W9DB 4N1EA 3OKNB 5FHAH 3RWCA 1F3DJ 1F8TH 1KPVA 2BY0A 2DIEA 3FCUB 4NT6B 5TQ2H 4LCCB 4Y19D 3UYPA 5ADOH 4TOYH 3PHSA 3KZ8A 5JHDA 3JZ7A 4UTAA 1CXFA 1QFUL 4NLHA 5A1AA 3D39E 1QSFB 3NABL 1IGIL 3ZTEA 3ZZLA 2FEDC 1XGRA 3R8BB 2WYTA 5E2TH 4G6KL 3PE9A 5TDPA 4NQDA 1ML0A 2FD6L 5IB5B 3EH5B 3BKJH 3SSGA 4IEFB 4OZGA 4MQSB 5AW5B 3KHQA 3OG4B 1U8LB 2IAMC 2OMYA 2GT9B 4MLSA 1JGVL 4B0MB 4YHKL 1A9EB 5J1TC 1WFTA 1B0RA 1JF1A 4JPIA 1IC5H 3RBSA 1NAKH 3G5VB 4MCMA 2J25A 3IDMA 5HHPB 4LBEB 2Y6SC 1IGYB 3W2DL 1TVBA 5J6HA 4IMLA 2H9GB 2YXMA 1XGTB 4GSXA 3VE0B 4YDLB 4IRSB 1AY1H 3OBAA 2CJ3A 4KZ0A 1ADQL 2YPKA 3DETC 3QT2A 4P2CG 1ZSDB 3T8XA 4Y4HD 2D4FA 4M9PA 3LZFL 3WE6B 1YEKH 4IOIB 4WFHD 2HFTA 3W0WD 2Z91A 1UXWA 2YEZA 2LVEA 1DLFL 1CFNB 4PJGE 1SBBA 1E9QA 3NSJA 1HHJA 2BNRB 5DVKA 1U3HA 3KW8A 4MA8H 1SHMA 1F6FB 3F3HA 2NX5E 3BWAA 1AHWB 3T3MB 2AJZA 2CK2A 1DCEA 5DMIL 2A9ML 1YA5A 5E6RB 2H4EA 4AQ1B 5I18H 4R84A 4GFTB 2O61A 2Z8SA 3VFVB 3PXHA 1SMOA 3A22A 2IANE 4RBPH 1B2WH 4P3WA 2FL5A 3TPKA 5J6HB 4BH7A 3FT2A 3KEDA 4HGMA 3RP1A 1TUPA 1IBGH 3C09C 3H9SD 4PLKD 5J13B 4GRLD 2I85A 2WVVB 4FL4B 1WEJL 4NC1C 4U1HA 1Y6KR 5H37G 1UEMA 4OZIA 5H8DA 1F4YL 1ZA3A 3PHOB 4NDMA 2PETA 5E5MB 3PCYA 4LSUL 4A7VA 2VR8A 4M4RA 1KBGH 4BGDA 1WAEA 3RWIA 3TS8A 1QWUA 1OSYA 4OZHB 4YO0B 5TDPB 4I2XA 1JRHI 1QLEH 4K8RD 4PVLA 4RDBA 1YPZA 5HDLA 3JYCA 1AJ7H 5JO5B 3MREB 3WFEL 1PYWB 1PD6A 2YXFA 3T4YB 3UEZA 3CGTA 2R83A 3C6SA 1WZKA 4CW1B 1ANUA 4FQ2L 2YUWA 3L3GB 1M3JA 4QHNB 4UBDC 1YMMB 4ILDA 3OKKB 3CZFA 3APNA 4FTVA 1MDAA 1A2YA 1F8TL 3VSQA 4F15C 4F7MB 4QGTA 4XVJL 5FW6A 3FFOA 5K39B 1R3JA 4NRYA 2FQGA 2VUYA 5E5RB 1N8ZA 3AZUA 3B1UA 4MMZC 2ZUTA 4LF3B 2P45B 2D2OA 1ACCA 3CAFA 1XCXA 3D12B 4QHLA 4BSJA 1CFVL 1XB6A 4BRVA 5J6GB 1BJMA 3K5RA 4NRXA 4XP5L 2P8PB 4NO2B 5JOPE 2MSPA 4CKVX 2EDQA 2LU3A 3PWLA 3VDCA 3DROA 9PCYA 1SNRA 2J88H 5DK2B 5EUOF 3EGXA 3GGWA 3KAAA 3HN3A 3UAEA 1PFOA 2L0DA 5GSVA 2QSVA 2Z92A 2EKJA 2I9TA 2IH9A 1SXSA 4JFOB 3UGEA 1HQRA 1M2OA 3JTBA 3MGOA 1IFRA 4JM4H 5AVXB 1OB1B 4JO3H 1KV7A 2NY2D 3CXHK 3ARGD 2HVJB 3RZWA 3O3DB 2KKQA 4W1TA 1CZ8L 4HXAL 4QOKA 4LHQB 3E80A 4XZ4A 4AEHL 1MJ8H 1N3NB 3FMGH 4NO0A 3D25B 2VDKL 4NHCH 1INQA 3MBEC 3KYKL 4MBRA 1FZOB 4BCYA 43C9B 2X3BA 5LGHH 2Y23A 1MFEH 4LOUC 4W9LC 5AVTB 1BJ1J 2GITB 5DUPL 3KYAA 1PIGA 2XXGA 1V7ML 4PWJA 5DHDA 1C5CH 3GBML 3IFNH 2OJEB 4PJIA 5ICYA 5HHXL 3GMQB 1W72B 2FEJA 1SEBB 1RUAL 1AKJA 1KPVB 4CKQA 1DANU 5KEZA 5IK3A 5F1NB 4TRPH 2YKLL 4OD1L 4AYFB 3CZKA 1V8HA 2X09A 1RUMH 1JNHA 4MA3B 4PV1C 1LP9F 3VXSD 4Z7QE 1CT8A 5HDQH 3ASOB 4U2ZA 2DQGL 2D7OA 4S2SA 1M4KA 3GSOB 1UB5B 2Z4QB 1CIDA 1KLGA 5I8KH 2E0PA 1GA2A 4PQXA 4XNUL 1BZ7A 3U9WA 1GYCA 2Q8AL 4UOZA 3MACL 1JI1A 3ARWA 2HT4C 4LU5L 2A38A 1MI5E 4C56E 2IDQA 4E9WA 2OX5B 2WLKA 2YMXH 1S7QA 3DO4A 5CBAA 4G82A 2DKSA 1I8IB 2JKLA 3QZWB 1JGDA 5IBUB 4JS7A 2B5IB 4C8XA 4RFEB 5FGCE 5HY9A 2GKIA 2VZUA 4KO5A 3W2DH 1WA1X 1P4IL 2LAAA 3PQYD 5TE6H 4FP8H 2NDFA 4XMKL 4N2AA 1WWBX 4YS4A 4NN5C 1BZ8A 5FUCE 1H3UA 3EW3B 3OF6A 1I7UB 3HOGA 3SCMD 1UGNA 4PRID 4L5FE 1IAIH 4WWNA 5C09A 1K8IA 4KTEL 3DVNB 1RZ7L 5BMFL 2H41A 4GKZB 4JVWA 4YHNA 3QJFA 1TLMA 4U1MA 5LAPA 2EIKB 1NINA 5FKPB 5KAQG 1TNMA 1AHWC 1VAHA 1SXAA 2NR6A 2V33A 4KAQH 2AGJH 4R4FL 1AXTL 2OQJB 4B7LA 2EADA 3QNFA 4PS7A 4HOWA 2H7WA 4MB4A 1RL1A 3ILPB 3V4PL 5AB0A 4FNQA 4F20A 1VCAA 2AJSH 4AY0A 4PJ9A 3N3EA 1ZVSA 1MCPL 1TTGA 2BP0A 1G5GA 5ETUA 2N7AA 3UGXA 3BP6B 3P77B 1S46A 4WSGA 5C0CE 1XCWA 2ZCKL 2O61B 5HDBB 3AS0A 1FRGH 1MEXL 1LTXA 2MPAH 2P5WA 1NFDF 5F3HB 4DZBA 1Z9SA 3NSDA 2XWBA 5EOTA 5HYSB 1UCBL 1U2YA 4NAJA 2ZNWA 4OV5B 3F7YB 2DYSB 5JW4R 4MXQC 1SJHA 1MWAA 5JIMA 4M7LT 3P3UA 2OA9A 1T4WA 1GHFH 1JZFA 4HGKC 3RFRA 4B3VA 1PL3A 3F7QA 3FT3A 4UT6A 3UZEA 5TE4H 4N8VA 4XB7A 1VERA 3P4NB 3U36B 2E7CA 3QJRB 1HCVA 1KXVA 2OULB 2PYEB 1WVZA 2VZSA 3SKNB 2K4AA 1MCOL 2BWDA 3VNZA 4MJ2A 1JN6B 4EDXA 5KN5B 4S1RL 2X89A 2ID5A 5JQIB 1HN1A 1KYOK 5A3ID 1MVFA 4MMXC 4NN7C 1E5AA 2YZ1A 1BG9A 2CR3A 3RPKA 3VGBA 2OMNA 1V05A 4A2FA 4L8BA 4XP1L 1BMWA 2XPGB 4MMYB 3CSBA 4MHHI 4XO3A 2H6PA 5IQ7L 4PFEA 3F58L 1G6RA 4B96A 1KJ2A 1MREL 4BFIA 3RFZA 4DVBA 4ODXB 4F8QA 2ADJB 3TT1H 1OALA 2BK8A 4HPYH 4L4VA 2NOYA 4X9YA 2EIZB 3K6FA 2VLKA 1TVHB 1AGFB 3OMNB 1ETB1 4PJBF 5D1ZC 4FHBD 2EXYC 3N04A 3TO2A 3T09A 2GBUA 2J8UE 1ZVYA 2VITB 1SN0A 3K2IA 1E4XH 3L9YA 4R3SB 4PV8A 3MXWH 4L4VD 2LU7A 2K6YA 3WTUA 3VJ6A 3ALPA 4EDWH 3R19A 2F8OA 1P7KA 3I3EA 1BV8A 5F6HJ 5KSVB 3ZE0E 4FNSA 4LU5H 4MXWH 3S4SG 1K5NA 3C60D 5FOBB 3G04A 2QVIA 4PJ7F 3VWJB 1A9BA 2ATPB 4GW1B 2Y06H 1T2XA 4JFVA 4KJQC 1Z5YD 5D7LD 1A6WH 3ZGIA 3VGDA 3DUUB 4PJFA 3BVDB 3OR6A 1CFMA 1YMHA 3CU7A 2D3NA 4JFDB 3ZXAC 5F0PB 1KJ2B 1F18A 1CFQB 3BISA 1RUQH 4YC2B 2ZG1A 3S2CA 3C60A 3FOMB 3CHRA 3UO1H 4CW1A 1I1AC 4X6FA 4KX7A 4QRPA 4JFDD 3N91A 3ZE0F 2NY5C 4AX3A 1JGUL 4XMXA 3RAJH 4J39A 4RVBA 1KC5H 3VXTA 1I9JL 5BUAA 1MCWW 2Q87A 1N7ML 1TQBB 2A73B 4I87A 5C70A 3US0A 4ANWA 3NZHH 4D8PA 1FFPB 3QGVA 3VSUA 4X99B 4ATWA 1CVRA 3FQRB 3P4MB 1GGBL 4JFDA 3HUJE 2DF3A 4G6AD 4NIYE 1BPVA 3T0EB 2ZUVA 5GRUH 1I3RA 2BJML 3GSWA 2F7IA 3PHQB 3FU6A 3E8UL 2P7TA 2XBDA 3NIGB 4I77L 1KTDA 4F2EA 1O5DT 3WY2A 3QEQD 4P5SA 2F5AH 2Q5BA 1YSOA 4HT1L 5ISZB 1LEKB 5F0LB 4U3SA 3HS8A 4O02L 2X87A 3NZSA 3LQAL 4HWBL 4BWUA 4GJTB 3IJSA 3CDYA 3NFSL 2DLTA 4GIAA 1JK9A 3U4EB 1T66D 3F58H 5B7EA 1R9FA 2PW1B 2XWTB 1FIGL 4G3YL 4JGJA 4Y16A 3QI9A 1MG3C 1WUZA 3GDCA 4MCZB 2VDQH 3VRIB 1ZT4A 4QJ5B 4YBQD 3X14A 4Z7WF 4K9JA 3NACH 3ZMRA 1BOYA 1GZHA 4W9KC 5M94B 1D5RA 2QADC 5DHXB 1J1XL 1JS4A 5MEPB 4AXWB 1J5DA 2DEYX 1CDBA 4WO4A 3GXPA 2CO7A 5F96H 5C0RH 4YFLF 1LHZA 4GBXD 1I7ZB 1T1XB 1NPJA 3MNDA 4EIZC 5DZAA 3IDJB 2AZUA 3C5SB 4F1ZA 1W8OA 2CH8A 3MRGA 3WXVL 5JZ7D 3UTQA 3AFLA 1JGEA 3FJTA 2Y7MA 4CJ0A 1OLLA 2VXTL 5E00B 3N85H 1AD0B 1Z9PA 2VJ8A 4I0KA 5C2BH 5I17A 1I3GL 1JL8A 4JFSA 1MFBH 1AC6A 1AZVA 4L4TD 2XZZA 3ARSA 1X5GA 1E4KC 1JXDA 2XETA 3FW6A 1CMOA 1HKFA 2ZG2A 3NPZB 5I71C 1MEXH 2GJ6A 3UTTA 5DRXA 2HAZA 5DFVC 1PQZB 2NCMA 1GAFL 1MY5A 1T1XA 1JAEA 3VDAA 4ONFH 5KG9A 4U6YB 5D7SL 3MCYA 5IQMA 1MCPH 1E5BA 2AK4B 5TDNA 3EGDB 2JLLA 3ARFA 4AIXA 4WO4B 2OYPA 2EEBA 3HE7B 2RH0A 3BP5B 3MODL 1XHHA 5DJCA 1T7WA 2DPKA 2WCGA 1KBWA 1NCWH 3LB6D 5K9KA 2J44A 3FB7B 2JKXA 4N0CC 5LG1A 5IFJA 2J88L 4YPJA 4MA8L 4XN4A 3EXLA 2DQCL 4YX2L 4XOBA 3TNNA 3QRGH 3N41B 5L4IA 1IC7H 1MCFA 3B7YA 4LLWA 4Y4FB 4YAQB 2OTPA 5KS9B 2UZIH 2X10A 2XJLA 4TNVK 3I9GH 2VSMB 4ZX5A 3BZFA 2HMIC 4OZIF 1AFVL 3LPWA 2JELL 5FF6B 5HVWA 1Z32X 5J57B 2FR4B 3LIUA 2NYYC 1QA9A 2ZWZA 3STBA 4AW4A 3V0WH 4LLDB 1DJXA 1RU9L 3EYQD 3V6OE 1Z6JT 3PV6B 1XGQA 2Q1EA 3B3IA 4PY8I 4W9ZA 5CIPH 2E8YA 4B27A 5E6IB 1ZRUA 1ZGLM 1SVZA 2EDLA 1UYWH 5F8QC 4FNRA 3ULSB 3SE8H 3VGGA 4UQ9A 2GIYA 5JXAH 3ECBA 5KSAB 5C1MB 2A6JA 4HC1H 3R8QA 5C0EB 1UJ3B 1J05B 4KXZH 4K71C 4KUZL 3H9HA 5EC1B 2AV7B 4J6RH 5ESVA 3CPLB 5T1MA 5GZNC 1E3XA 5I2IA 4X0NA 5IQ9B 2CCWA 3MRGB 2NPLX 1AZZC 2CGYA 1BQRA 1WT5C 3NTCH 4K5LA 5DT1H 4EN2A 1BIIB 4PJGF 3VFPA 1U8QB 2YKLH 4OD1H 4AG4L 4FQ2H 3J27A 2AMUA 4ODVH 2VMJA 5IHUL 4ANVA 4F57L 2HJKA 4NQSB 2RMNA 2Z7UA 1U3HB 5DWUL 2YLHA 3FULA 4AUUA 3LRSA 5DEGA 5A2AA 5J06A 4L9DA 4JO1L 5I1KH 3KPNB 1Q90A 1NCDL 1U91B 3GI8H 3OKMA 4GBXB 3MLXL 3LH2H 4KQ3H 4WWPA 3VRJB 3WDHA 5FB8B 5JDSB 3UPCA 2MIZA 2R4SH 3O8XA 3ATBA 2NZ9C 2YBRA 3HRPA 4YDIL 2PYFB 1FGVL 3DHPA 4EIBA 5IJBC 4TVPL 1ZTXL 4G8FA 1TITA 2NXZD 2X4UB 4IRJB 2B08A 2YGNA 2W81C 5GJTL 1J87A 4JFQB 3QCTH 2BERA 3NFPB 4B53A 4RGOH 3EH4B 1KC5L 1MIML 3MUZ1 5L6YL 1WGOA 4H0IA 1T4KB 1FL5A 1NIEA 1HXKA 2E6QA 5FA3A 2BFVH 1OOAA 3UAJD 4JPWH 4OZHA 4NCDA 1V7MH 5IG7B 1NANH 2HB0A 4FMVA 4LT7A 3R0MA 3FQRA 3QG6B 4UV7H 5BRPA 3L3OC 3K8MA 4WW2B 4N2OA 3QUZD 1ZA6B 3BKYH 3L9EA 4KMTL 2E75C 3QFGA 1ITCA 1XGRB 1JXGA 2D7TL 4NKOA 4TQ8A 3KVQA 1EFXA 2FK9A 4LHUD 3AB0C 3P2BA 1Q72L 2WVSA 2Q6WA 1H6FA 2VT0A 3VI4F 5E4AA 2HH0H 1NIAA 2V8MA 4P2QB 3RDTA 3S36H 5AZEH 2A9NH 2E27H 3O2VH 2Y5QA 5KS9F 4NT6A 2EE0A 1U8OB 1BQKA 2O5YL 4PJEA 2XBZA 3N43B 1FCCA 4FJ6A 3MRIA 3UTPD 4NQQA 4DP2X 2J8HA 5HJGA 2XUWA 2ENJA 2VAAA 2V2XB 3J7HA 2ZCHL 1KJ2L 1XF2B 2OP4L 4UINL 1K8IB 1LK2B 2GAZB 2CDEB 2AHIA 4AKOA 2VL5A 4CAGA 2XTSA 4AEHH 2JCCF 1OAKH 3BUYB 1CE1L 3BYTA 2HJKB 3KE0A 1KPRA 3A5VA 1WAPA 4R83A 4XBGA 5D7LE 4BH8A 5DSCA 1KPUA 1EZVY 3BZDA 4PW9A 2IWEA 2C3VA 4B9IA 3O45A 4EBQL 4LOVA 4OFKA 1P5VB 1E50A 3ILQC 3Q43A 5CZVH 1AGDA 1W0WB 3NCEB 1XSOA 3QDGD 6PAZA 1I7RB 4R0LB 5JPMC 1IVLA 2H1LM 1QYGH 2AV1A 5DD1H 1J8KA 2BZCA 3WN6A 1LM8V 2ADJA 1EHLH 3H3KA 2Q7YA 3NFNB 1Y0LB 3MX0B 5GISH 4I3GA 1MWAB 4U33A 5LNEA 1IGTA 1RZJL 4DP6X 4IHBA 1TCRA 3F7KA 4H88H 4MRCA 3MNVB 1KB3A 2BY3A 3EF7A 4NZDA 3QDMB 4BWWA 3FH8A 1XCQA 4M02A 3OTTA 2BNQB 2EILB 2JB6B 3PDDA 1GMIA 1ADQH 3QEQB 3VXSA 4FA7B 4QEGA 3O4LE 2CUAA 4DF9A 5EF0A 3EADA 5D7IB 4H0HB 4M61A 2VLME 2FVNA 2WKOA 3QI9B 3U25A 3VRIA 3CHOA 3D05A 1T6BX 4PRNB 1PY9A 2F61A 1XGUA 3B5HA 1XSKA 1GSMA 2XN1A 4JZNA 5TE7H 1DBBH 5GZOC 2EDWA 1KCLA 1FGVH 5TGBB 3V4PH 2ERJC 4HG4K 1UOLA 1QEWB 3DX3A 2GUOA 1MW2A 4IU2B 5D71L 3SPIA 4A39A 2NNFA 4ZQTA 1JNLL 4GEJA 4GW4B 3BDBA 4BA8A 1TYEB 2XICA 2E9GA 1CT8B 1QZNA 3IXAB 3TJEH 4PR5B 1QG3A 1MCJA 2R1YA 3GFUA 4OGXH 4OGYH 3S35X 4HC1L 2CR6A 3TLRA 1JPGA 1RK0A 4HCIA 2AQPA 3EJJX 1P7HL 3SCMA 4RMRA 3V0FA 4BQ8A 3LN5A 1V27A 5FFGA 5CCGE 4UTAH 3UBHA 2NNAA 5FHAL 3CFJB 5MENA 3OJVC 3IF1B 5BRZB 4WVRA 4KRPC 3LRMA 1FFRA 5FGRA 2C5DC 4PWEA 5CKGA 3WKPA 2ZXWB 5BUGA 2Q8BH 4JY4A 5GS0D 4IU2A 3RL1B 4NENA 3WUWB 2ZXDA 2KH2B 2H2PD 2YAPA 3LNHA 4M1CC 4NZJA 2JB5H 5INCA 1KYUA 3GK8H 1EDQA 2E7LC 1EEUA 3HBZA 1UWXK 2EYTB 2Q76A 4XB3A 4WEBL 1SXBA 2BCMA 5D7JB 4PGJA 5DWPA 2VZTA 1AQMA 5FO9A 1RK0B 2JKTM 4OUOA 2EE3A 1HL4A 3N1MC 4WIQA 1C9SA 4NZTH 4M03A 1F4WL 2IAMA 4N2CA 2N59A 3TJHD 3UAFA 3FCSA 2DH2A 2KLTA 4JM2C 4E2OA 4PJ9B 2QDVA 4PLNC 2EE2A 4EI5B 3BYYA 1IBBA 1D6VH 4BJLA 1VGEL 5J12C 4R2GD 4UT7L 1I8MA 2GEEA 1IQDB 3QBTB 3EYSL 4KY1H 2W59A 2HA1A 3BLKA 3BX7C 2OJZH 1FNAA 2FLBT 3NT0A 2OR9L 3T3PE 3ABMB 3N6YA 3WNPA 5C0FB 4O5LL 3RG1C 5LGJA 3X17A 1ZJAA 1W0YT 5C0EA 3NZ8B 4H26A 4D0DA 1I3VA 2WIMA 4Z7UF 1OGTB 1K9TA 1CYWA 1EAQA 4RMWA 1X7QA 1DTUA 4KOCA 5JXED 4XVUD 2I07A 5ABAA 5F89A 4ODTH 2DW5A 1F42A 3QUZC 5AVUB 3V0DA 1FL6B 1SQMA 5CZKA 1E43A 1XVSA 1RZ8A 4U4IA 4DFHA 2K3TA 4PN6A 2DLFL 3K72A 4G9DA 4YBLB 5CR1A 2VC2L 1YDPA 5CM1A 3L8QA 5LWYL 5KUKA 1J8HD 3FU7B 4YDKL 3A3YB 5IBTH 4OD2B 4TSAL 2FTAA 5IWLA 5JIQA 2IWKA 4ZUTA 4AYDC 2OTUB 2BX5A 2KERA 4P07A 1VGKB 3ULUH 2FB4H 2B16A 4X5XA 5AVYB 2XVLA 4HK0B 1J9SA 4X2UA 5F72S 3V6FB 4X83A 3FRPA 4GW1A 5D9SB 2KLRA 2R2EB 1F3DH 4IRJA 1BM7A 1BZOA 2Y1ZA 3RGBA 5BO1L 1QNZH 2YD2A 1EEZB 1RIHH 3ARVA 5IW3A 4FFVD 1DQLH 2PO6C 2BNRD 1J1OL 3BGAA 5KG9B 1HCZA 4F7TB 5CMAA 2EINB 4U1MB 3QG7H 1C1EH 3QVAA 4GG8B 4OZGF 5CP3A 2FWSA 4ALAL 2C34A 4CVUA 3KH4A 4YE0A 1PG7W 2DQ6A 3VA6A 3O3AA 5JHLH 4Q9CA 2NUTB 1W8EA 3KWVA 1ZTXE 3LPPA 4HAKA 4PG2C 4TVPE 4XVTL 4Y5VB 4ZFOA 2ATAA 3RWGB 4IK7A 1WK0A 3KHOA 4QRQB 4X99A 5J4MA 5IVXF 5F97E 4MNQA 2CQVA 5L0QC 3LEYH 5KVDL 2JKSA 5KVEE 3U6XS 3HG0A 3FU0A 4J3TA 1HOEA 3VXNB 1LLAA 2LABA 3JT0A 5IB4B 2YD4A 3CC1A 3D69A 3O6FD 1NAMH 2ZUXA 5E03A 5L7XL 1QW9A 3FUFA 5SWZD 4Y4KD 4H8HA 3HE7C 3VYNA 3RVVD 1QNZL 1FJ1B 1QI3A 5DC2A 3ULVC 3FQNB 1IV8A 4JY6B 4G7SB 4NKDB 3AXLA 2V17H 4N6RB 2P46B 1A6ZA 4G6JH 4HJ0C 3T08A 5FM8A 2VLLB 3L6FB 5C9KA 1J11A 2Q9OA 1SHXA 2HJLA 3HBGA 5KAQF 1WBXA 2X70B 1OF2B 5BRZD 2BVOB 4PG9B 1S2EA 1TEYA 1XTMA 1J1XH 2XX1A 4LIQH 4OF3A 4TL5A 4S0SD 2I60H 5DRZB 5LBVA 5CP7B 3K91A 2DI9A 1UM5L 3II3A 2WXRA 43CAA 4KQ3L 5KTEH 5KJ7E 3KBPA 3CFKB 5CUSL 1HNGA 4PJ8D 2HLEB 3HLKA 1NBVL 2JF1A 1BM3L 1KN2L 2QGEA 1RPKA 1FQ9C 2KZWA 1MVYA 3O0RL 4LSQH 3VNYA 5I15L 4ZXBC 2DJMA 4Z9KB 2O6DA 5JPNC 1RU9H 1QFHA 2GB2A 3GRWA 1E9PA 1BREA 1D6EB 2WUBL 1T89A 2AEPL 4KU1A 5FO8B 3NJHA 5KVGE 4GUOA 2AEOA 2IOIA 3JV0A 4E9SA 3F84A 2QSTA 2W5PA 1Z9NA 2AJYL 4XPAH 4WFGE 5GGTH 4D8PB 3HZKB 4U3CA 1N3NA 4M7ZC 3QW9A 3RL2A 1DBJH 1EGJH 2AK1H 4H8WL 1OV8A 3BVTA 4TL4A 5E95B 2CO7B 4OIFA 2Y7LA 1H19A 5K9OB 4P8QA 2ENPA 4IGBB 2DQDH 4UNVA 4DUXA 5GS0C 3KM2A 4D0CA 4JFOA 4N2FA 4EXKA 3Q6GL 2Q3ZA 3BPLB 4OJFL 3VI3A 3HS9A 1Y6MR 4AVKA 1L9SA 4HWUA 1HT6A 5KBLA 4JG0L 3DYPA 4JRWA 4GBXC 3L7FA 5JW3L 3DO7B 3L3HA 4DK5A 1NEPA 4CSZA 5K9KB 4E5XB 4KRPD 2YGOA 1ET7A 3HJEA 4ONFL 1WGVA 3TZVB 2PLTA 2EVGA 2E9IA 2KDGA 2V5MA 3LN4A 1NUFA 2ZXCA 2HJFB 2DBLH 4U1GC 5E5LA 5F3FA 2P42B 1MFCL 1BVLA 2UY7A 1DQMH 1CR9H 5J12B 3DX0A 4D7BA 2HT3D 5HI3C 5I1HH 2DQIH 1BZ9B 1NFDE 1U9KA 3L95A 4YLQT 5DJ2A 5BPPA 4GG6B 4PAZA 4EDWL 1TZIB 4WF7A 1XBDA 5LB1A 5ICYB 3GBDA 1TJXA 4OF0A 5D7LB 3PNRB 4PMFA 1TIUA 1YN6B 5DJAB 3B7UX 5ID0B 1TEGA 1A8JH 1RZ7H 5E51A 4AV4A 2Y3AA 2F53B 2D03L 4KC3B 2J6EL 4PJ8C 3L3GA 5KZCD 3KJ4B 3KL5A 5JMOC 2ZAGA 2IBBA 4Q9RL 3FONB 4POYA 2QPEB 4PBVC 5KOVC 4HF5L 3AB0B 2EO9A 4BA0A 4NSKA 5EU6B 4D9QD 3NIDF 1V3LA 3ARDB 3ZQWA 5A16A 2HUHA 4WW2C 5G4NA 2ZKWA 4ZFOL 1XX9C 2V2WA 3BVWA 4FKEA 3PAYA 4UDUA 2GJ6B 2V5SA 4PJXB 1DEDA 4AI7A 3II1A 4TUKH 1IVTA 3HZMA 1KY6A 2UV3A 3U9PH 4J4PD 2J5LB 3AY4A 3SBWC 4QPEA 3NA4A 1FSKC 2Y5TB 3G6DL 2R0WH 4WNSA 1KJ2H 2XIIA 2CR0A 2XYCA 3OR7A 1S7SA 4PTTB 1T21B 2B15A 3FSZA 1QHQA 1YYML 4GRWH 1I1AB 3RKDC 1JFQL 1ZD6A 3DECA 4LP8A 2A9NL 4CSTA 3NA9L 2VR3A 1TJHL 4G42B 1A02N 1P5UB 1E30A 4TLSA 3HAEH 4JRXA 3QXAA 2AQNA 2XVBA 2OL3A 5C0GB 3FQ4A 2F7QA 4ICXA 2ILLA 1XCTA 4MZ2A 5HGGS 3B6SB 2FSEA 5EO1A 1EHLL 2AJSL 1CGVA 3GINA 3V4UL 2DB8A 3RWHB 3GMMA 4O00A 1DDTA 1NCCL 5DJ2B 5F93C 4GG6A 3C5ZD 1NAMA 3HLAB 1YMME 4WK2B 4XMLL 2XXFA 1KXHA 1C8QA 3NZUA 4PIBA 5AB9A 1ASPA 1X5YA 3GMRA 3Q9QA 4I8DA 1X4YA 3K4DA 1JI2A 4NO0B 2JQMA 3MUY1 1XR8A 2A3TA 2GSGB 3GHEH 3HG3A 3QORA 4KKCD 3TEYA 4XCYB 2JV6A 2LFEA 5D2NA 3TA3C 4HJUA 2P5EA 5IJKC 1T4KA 2VXUL 2J72A 4JN2A 1T6VN 5C7XH 3FT4B 2RIKA 2WVVA 1KYOJ 2ZXQA 3KBHE 5T5FL 2DYPB 3F5WB 1K4CA 4Z6AT 1MIEL 2YD5A 2X4OB 1S7TB 4PWHA 1OF0A 2I5YH 1HDMA 1LQSR 4X6DF 4R3SA 3LHAA 4S11A 4CMHC 5EOCJ 2PTVA 4PUBH 2VDNL 3M8OH 4MJ5A 2XG4B 2YMOA 2BP8A 4XBGB 4RGNC 4PGDB 3ARRA 4OBSA 5ACZA 3RZCB 4YWGH 3ULUC 4JN1L 3ZKNC 3WEMA 1E9PB 1VCBC 1OP9A 2VABB 4TQHA 3EJRA 1OWWA 1MCLA 2VAAB 3APFA 5D7JD 1MAKA 2JH2A 5FV2A 2DI7A 4IOIA 1BIIA 2MCPH 3DGGB 3T0DA 4LMQI 4ZAKD 2H3KA 3WDIA 3TV8A 1GYVA 4AWJC 1ZS8A 2WXNA 2QQKH 2ZTBA 4S1QL 5IEKB 4YXKL 1CGTA 3X13B 3KXFD 4G8GD 1Q38A 1GCFA 3HTLX 5GSRB 2VQ4A 3TFKD 3B9KD 2AJXH 3WTSA 2AQRA 2PWDA 2F9BT 2XWZA 4RA0C 3ROOB 4NKOB 3W9EA 4E9VA 5BS0A 2MPVA 5EU6E 4ZAKA 4I2XB 1ZXKA 4GINA 3EO1B 3AY2A 3REWB 2MPAL 3ZKXB 4LAQL 2KT6A 4NRZA 3ZDZB 4HOZA 3UYRL 1A3RH 3QCVL 3NFNA 3DJZA 3DSNB 2Q7YB 1JDAA 4ZPTB 3Q06A 5F7WC 4ZSOB 4NCC1 4KNQA 1DVZA 2CALA 3KPRE 3QZLA 1OANA 4WW1B 4Y2OB 2M26A 1UQSA 5E6ID 1RV6X 1SJEA 3RAJL 3D09A 2VE6A 4IU3B 1N5YL 4I0CC 2J21A 4WEEA 1ITBB 3KBFA 1ZVSB 3U7WH 3MJ8B 4EEEA 1FLRH 3NIFE 1TTBA 4HS8H 4HJGB 3MBEB 3UMNA 3O6ML 3BUYA 2P8LB 4JZNB 4F80A 3O8XB 4U6TA 3MRLA 3FTXA 5FDYA 3NEXA 3ARZA 1D5ZA 2QQNL 5IOPB 3GB7B 3JVGA 4UV4H 4APQA 2X2HA 4DN4L 5CGYC 1UUNA 2WZ5A 3IJHA 4EMZA 1MW1A 3JSSA 4LPUA 4JPVL 4L18A 2HKAA 2X40A 3ESNA 4QTFA 3QRFM 2EEAA 3ML8A 4LL1A 2NY6B 2XKSA 4HIIB 5DURB 5D1ZB 5ENWB 2CMRL 5I19H 3OZ9H 4LPTA 3L45A 2K7PA 3FFDA 4S1SH 4XCFL 1VZIA 2JK5A 4KTDH 4N5EC 1NGPL 4OLZH 4JFYA 2ZOWA 3RKPA 5F9WB 3HE7D 3K74B 5T33L 4NQDD 4YX2H 4N0RA 3JV4A 4P2RA 3VFWB 2R7EB 4X6EA 2VDNB 5EF2A 2BVTA 1BQHB 3ZTDC 3ZDZE 5JQ6H 1N68A 4JFHD 5I17B 1IMHC 1AO7B 1IEAA 2R1XA 2RJMA 4Q89A 1H3TA 3F04A 3Q2CA 1ODUA 4FYQA 4YHZH 2BP3A 2WZ0A 5CN1A 4Y5XA 3L16A 5CO1A 1G5AA 1IAKA 1SVCP 5EO9A 3RL1A 2VH5H 1T2QL 5C6PB 2F7RA 3LQAC 2OFQA 1QSFE 4QRQA 3S34H 5B3NA 1R5WA 5DFWH 4TMPA 2WIIB 5HY9B 4HJTA 1EA9C 3PU7A 2PO6D 4HHGA 3QPXH 1LK2A 4PB9H 1FNSH 2FX8H 2WQWA 4JAMA 2WW8A 1PJ9A 4PWFA 5FO9B 4HYTB 1GS6X 4HU2A 5AVZB 5LCVA 3I02B 3BH9A 4JRXE 1BWMA 1Z66A 2VXVH 4M7KH 4JFDE 3QEUB 1I4FA 3HUJF 3CMOH 3DI2B 1GGCL 2DWXA 3FO2B 3Q2LA 4DH2A 3K71A 1IX2A 4U6XA 1R24B 4FQ1L 3FRUB 5ESQB 4WHYH 1OTSD 5E2UL 4AT6A 2ICWJ 1ROWA 2ZYHA 3UBXB 3KLSA 5EULV 5EO9B 1DL7L 4P2QD 5J0BA 2GY7B 1S9KC 4L3ED 1TKWB 1XZ0A 2GG1A 4AIOA 1NL0L 4B9JA 3MC0A 2NZ1A 4KX9A 5F1IB 1ZKAA 1OCZB 3B9DA 3KG5A 1RZGB 1OTTD 1CDGA 1DQKA 4UV4L 3TBTA 5MHSD 5ALBH 4MQ7B 1Q9OA 1RZJH 5GJTH 4BFFA 3GRGA 4YSSA 3HNTH 4AV5A 4G6AC 3IXAA 5HJBA 3FU9A 4OZFA 2CRYA 1QA9B 1N2RA 5FYLE 4PB0H 4Z78B 1X9UA 1SLXA 2VDMB 4IRJD 3ARXA 1EZUA 3PFUA 4G5AA 4R2GC 1NH6A 2VIRA 4ZD3H 5B8CB 3RL2B 1ZANL 3IPBA 4PYGA 4ZXBB 1TJGH 2BO0A 1AACA 2EYRA 5IEHA 1XZWA 1M53A 4NN7B 4FG0A 4NNYA 4JM2D 5DRWA 5EBMB 4BFGA 3VU2A 4E36A 3QXWA 1PZ5A 2CJUL 3DK0A 4OVVA 4HIHA 4QHUA 2A5UA 2QQKL 2QKIA 1NBZA 3WI9A 3EDFA 3B5GA 3S98A 1GL4B 4HUVA 2QVFB 2ESVD 4JQVA 3UAJA 2XU9A 3BD3A 1LDPL 1WG3A 3EJUA 3L5IA 3S96B 3IDNB 1DN2A 1IQWL 3VFPB 3PAUA 1R3KB 3Q9PA 5KTEL 3UJTH 1K72A 3RUGE 1G7IA 1QFWH 4RWYL 4IKNA 2Q2EB 3DI3B 4X6CE 4YXKH 4DN3L 3B2VH 3NQIA 4C4KO 4XOAA 7FABL 5KYUA 4F8PA 1ZLUK 2E27L 3O2VL 3QJTB 4PW3A 4RMVA 1PQZA 2EIDA 4G6ML 2FYVA 1OZTG 3QI9D 1CE1H 5DEJA 5CBEB 4S0TD 1UB6B 2EYRB 4FQXA 1KN4H 4IBQA 4LLQB 2GTZB 3ARBC 5E1AB 4LGPB 4Z3HA 4FS0A 1U8LA 2E74C 4HA1A 3TVMC 3PREA 1RD6A 4ODBD 4JY4B 5AW4B 3QUXA 1X5HA 4Z1PA 3FTVA 3HB3B 3RX5A 1NFDA 3S8WA 3RUGB 1VFAB 1MFMA 2X4UA 4FA6A 4P9MH 2I27N 4K8RC 3QDJA 4FXKB 3RVXC 3TBYB 4ZX4A 3TEWA 3VFVA 1SJEB 1UH4A 5MERA 1K4DA 1A3QA 3PAZA 2BW5A 5B1KA 5CFAA 3MFFA 1GZPB 2HKHL 3WUZA 1HILA 1LP9B 4AQZA 1U93B 2BINA 3NZ8A 4H26B 1CC3A 4MD0B 3RQ3A 3QIBD 5LQBL 5D6DC 4MMZB 3FQ1A 4BSWB 2WJ5A 2KC0A 2OZ4H 1ZJBA 1VEPA 4H2CA 4EUPH 1URLA 1KLGB 4EZJA 1X5AA 3TYGL 5H4ZA 4NO5A 4HZLB 1JZ6A 4AEIH 4QYOA 4EOWL 4KX8A 4UAOB 1GYUA 3IVKB 4KZDL 5GRJH 5T3XH 1OSZA 4HWEH 2PR4L 5K9JH 1D5BB 4JZOB 4NO3A 5I1GH 2C3VB 2WLJA 3ARUA 4TNGA 4MASA 3ZT6A 4XPGL 2BWIA 4PS8A 1JV5B 4Z7AA 1D9KD 3FU3A 5E24E 4N2EA 1E4WL 2F1BA 2PCPB 2JTDA 2ZKXA 4LP4A 1NCBL 3HHSA 4Z7QF 3RIAK 4I18A 4HH8A 2ITDA 1VFBB 2J1XA 2WTRB 3UAAA 4GKOA 2Q7AA 1I9IL 3CQPA 4XN9A 1B4TA 3TU6A 4HX1A 1AY1L 3B3IB 3VU1A 1P1ZB 3BUBA 3GHBL 1K8DB 1MRDH 1Z5HA 3X1FA 3P2DA 5B39B 1M56B 4NKDA 5BV7C 3G6DH 2OMUB 1HCFX 2ZWNA 2WBJC 3FU7A 3QPXL 1UM4L 3HI6L 1YEKL 4GKSB 4JM2B 3UJJH 3FN9A 3KPOA 4RNRA 1E5UI 2AANA 5B1JC 2JXMA 4DNLA 4F8TA 5AYUH 1EJFA 4YL4A 1JFQH 2VXVL 5I1GL 2H6OA 3PQYE 3TJEL 3QUYD 1ACYH 2VGLM 3VD2A 4MNGA 1G87A 1SM3H 3APMA 3I6KB 3UPAA 3VRLF 3CMOL 4JANB 5ID1A 5I16B 1RZKC 4DQOH 2I9TB 4HCRL 4XPBH 4LNVA 5KBKA 4QY8B 2IBGA 1L6XA 1KIPA 2QLVB 4CC4A 3TIEA 5HJ3A 3VI3E 5KYXA 4JX0A 1DVXA 1RUPH 4PRPA 1E40A 5HGBA 2K45A 2J1KA 2XZCH 3FO9A 5B7MA 2C4XA 3DHMA 4LZKA 4N0UA 4QRRA 4Z76B 4PTUA 4K0OA 1QBMH 4N85A 4U6XB 2WSPA 4AITA 1JHLL 3LNEA 1MHHA 4NKQB 3CFEA 3JT2A 5T3ZL 1AG6A 2FZ3B 1YEGL 4YHML 4A37A 1G7MA 1T7ZA 4QHKI 1P4IH 1OXYA 3QIUC 4CA4A 3FN0H 4PP2A 3IRPX 3RX7A 4G1EB 4P48A 1P6FA 1M1XB 1WC7A 3NCJL 5IUCA 3HZYB 4XNDA 2Q3AA 4P9HC 4OF5A 4P23B 5DJXA 3EYOB 3N1FC 4V2CB 3NESA 5ALCH 3ENEA 1TZGL 2IAND 5K1JA 3T77B 2XC8A 3DJSA 1RK1A 1WA0X 1JTPA 4Y2OA 3MDJA 3KDMB 5IROD 3NCYS 4LP5A 3PP4H 1HL5A 1QKZL 4Z78A 5E4EB 1BFSA 5FAAA 4RMUA 4PD4J 1NGYB 5ELIA 4IJ3C 1N70A 3MGOB 4UT6H 3RZCC 1RZQA 3MRBA 1CFBA 5C92A 4TLTA 1R47A 2ZX8A 4YNYA 4A7GA 4FC3E 1FI8C 4R0LC 3S3JA 2ZX7A 3VYPA 1H0DA 1NBYB 3BN9D 4ODHL 1CTMA 2VLMD 5I6KA 4ZTEA 2AJVH 5D1XE 2XNAA 1B0IA 3OLEA 1FAIH 2O5XL 2X1XR 2YZ8A 3A23A 5DVMA 4HIIA 1G7QA 5ENWA 5AVVB 5BRZE 3RDTD 1AHWA 2D3VA 2YARA 3B43A 1NSNL 4YSOA 3EFDH 4HHWA 1CDIA 3MPCA 2P5WE 5AZEL 2CDGB 2Q8AH 4JQXA 1CBVH 5CJOH 4I2XE 4TOYL 2AW2A 4G7QB 3CH1A 4UI2A 4YPGB 1ROCA 4JFXA 1CLZL 1VPOH 4Y1SA 3K3QA 3V0GA 5AOKA 3OGCA 3BKYL 5JW4Q 4MAUH 3DPBA 3D2UD 4IRZH 4X6DB 1E6OL 1N0LB 5EV7A 4PVBA 4WCYH 2VN7A 2P52A 4IDJL 3GXUB 2B1HL 2VIRB 2HH0L 4PVMA 3NCCB 3IJEB 5B8CC 2DYPA 2EXWC 5G5DB 5ITBL 1NOAA 2BRRH 4EI5C 2DLGA 2EDFA 4NZUL 2OYMA 3GSWB 2ZCLL 1KV3A 3NJMA 4N22A 3P9LA 1IL1A 1IE5A 4CC0A 2ROYA 3IDIB 1HWWA 2QLYA 2VXQA 3C2SA 5T5FH 1JGDB 1H9VA 2J7LA 3GWJA 5HYQB 4EF3A 1ORQA 1L5GB 3V6OC 4RFOL 1HQ4B 4RX4D 5FK9B 1BWWA 1TQCB 4GMSH 1TZGH 4IIQA 4G6JL 5SWSD 5KBPA 2FJFB 4LLUA 2ZKYA 3TFBA 5LN8A 5HYJD 3PWNA 3W1ZA 3HVDA 1ORSB 3VD4A 1OPGL 3BVNA 2DAVA 4CBPA 1OP3H 4QHMB 1M9WA 2FIKB 1CGSH 3O2DL 2CUMA 4IBWA 5IB1B 3PWVA 9CGTA 3ESOA 5GS2H 4FFWC 1OWRM 4CJ1A 1LGVA 3O6FA 3SDCA 3BZ5A 2L7JA 3GO1H 2NY7L 1NFAA 2KS0A 3SY0A 2B77A 3WFHB 2CJTA 1T0MA 3TBCA 2YPKB 4HJJH 5F7EH 1GGBH 1E7UA 3D87B 4LOEA 2C8NA 3PWPD 1K4DB 1BD2D 5DLLA 1UATA 4UB0H 4X9GA 5AKSA 2Z93B 4B9FA 6PCYA 1DR9A 3WENA 4KTDL 3WHE1 4LL4A 3P02A 4JRLA 2WUBH 3WE1A 1JGUH 5A3IC 3B83A 4WW1A 3TT3H 5C8JA 4J1UB 4DW2L 4Y5VA 4ZFOB 3N43F 4XOCA 3VSVA 4XGZA 2ZOLA 2YC1A 4GI9A 1IGFL 2BSED 4OGZA 3BUPA 2GTWA 3MUGA 2ZOKB 2A0LD 5GRVK 2GEQA 4IBUA 1IQDA 5C86A 4YQXL 2E76C 1G1CA 1KCVH 1MN4A 3DYMA 2ICEC 3MBWA 2W9DH 2W9EH 3VSTA 2VQUA 5EUOB 1VIWA 4K2UL 4P46B 2X6BA 5I82A 2DWDB 3TFKC 1AGCB 1MFCH 2W0LA 3IETA 2OMWA 3EKCA 4LSRL 4I0PC 5D5MF 5FM5M 4XHJD 2AC0A 5JDSA 5FB8A 2YD7A 4JDEA 5DO2C 4O2CA 2VISA 5D2LE 1V55B 2XACC 3ERXA 4E9YA 3ZYOA 5IESL 1K5NB 4K3GA 5FOBA 4QIRA 5TD4A 1ZK5A 2B2XL 1QSED 3ZSSA 5CWSA 5FHBH 1T2QH 2CGZA 3GJEB 4UQEA 1J8HE 3VFTB 3MJ7B 4LRIC 4QTHB 5ITFA 3DUS