2QDWA

Structure of cu(i) form of the m51a mutant of amicyanin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
104
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKKYETPELHVKVGDTVTWINREAAPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title A single methionine residue dictates the kinetic mechanism of interprotein electron transfer from methylamine dehydrogenase to amicyanin.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 27
structure length 104
sequence length 105
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2qdwA00
2N0MA 1OE1A 2DYRB 1IC0A 1GSKA 1CUOA 2VSKB 3NJLA 1ILSA 3NJFA 2HX8A 5I6MA 3S3BB 2FQDA 1AACA 3PLYA 3T71A 1AS6A 3QJUB 3X1GA 2VW7A 5I6NA 1GW0A 3ABMB 1BYOA 3T6VA 1W6WA 2J55A 3DTUB 3NYKA 2QPDB 4E9QA 3KW7A 2BP0A 4HHGA 4E9RA 2PPEA 2XLLA 4KNSA 5B7MA 2DV6A 3OQRA 2GHZA 2I85A 3HB3B 3T6WA 4DP8X 3H4HA 1KCBA 3SBPA 2QDVA 1BQKA 2DYSB 1ZDQA 2XX0A 3CDZB 3U25A 1JZIA 4WKXA 3QJQB 4WTQA 2HX9A 1AR1B 4YVUA 2GBAA 3ABKB 4PCYA 1OF0A 2EIKB 2AANA 3NJJA 1L9SA 2VM3A 1ET8A 1J9SA 1WAEA 4Q8BA 4W9ZA 1PY0A 5F7AA 4BXSV 1OE2A 4GYBA 1JZGA 1KYAA 2FQEA 3EH3B 2R7EA 2P80D 3IE9A 3TASA 3D12B 1A8ZA 2IWKA 2VW6A 3WNJA 2B3IA 4DP4X 3GXUB 3QQXA 4HCFA 3PCYA 4DP5X 4E9SA 1OCOB 1PZAA 1R1CA 2YQBA 2H47C 1JVOA 3NJGA 1F56A 2A3TA 4G72B 2YAEA 1SFDA 2DWTA 2IDUA 5AZUA 3X2QB 3X1BA 3BQVA 4BDVA 3T6XA 5B1JA 1M57B 1JZFA 3FS9A 1E67A 1JZEA 2YAPA 3NSDA 1PLCA 1W6LA 4KO9A 2LLNA 1CC3A 2X87A 2YAOA 1JZJA 2UXFA 5B1KA 1PLBA 2IWEA 1RZQA 3NSYA 4M3HA 1DYZA 3DKHA 4MFHA 3FYEB 1BXAA 1N68A 3TA4D 4E9VA 1UATA 2VSMB 4A2GA 2I7SA 1ADWA 5D4HA 3IEAA 1X9RA 3JT2A 2PPDA 1AG0A 4X4KA 1CYXA 1V54B 4P5RA 2BHFA 2J57A 3WKPA 2YAFA 4GP5B 3OD3A 1TKWA 1WA0X 4BWTA 1ILUA 2FNWA 2YARA 4AI7A 4E9WA 3X1EA 4A2EA 4KNTA 4ZK8A 1V55B 1NWPA 3AY2A 3EH5B 1ETJA 2HXAA 3WG7B 3NJNA 1BXUA 1QNIA 1JXFA 2PLTA 2XXFA 4FAAB 5D4JA 1OV8A 1TU2A 1J9TA 1FFTB 3UACA 1ZIAA 3IN0A 4AKQA 4BK5C 4YSAA 3UABA 8PAZA 1ZV2A 4EF3A 1E5ZA 3ZX1A 2HZHA 3TU6A 1PMYA 1A4AA 3FU7B 3PAUA 3NJIA 2BP8A 2UXTA 3FU7A 1AS8A 1GR7A 3S8GB 4KO5A 7PCYA 4AX3A 1JOIA 3ABLB 4CSZA 5PCYA 2BP0B 1YLBB 3C75A 1GS7A 1E65A 3CVCA 1NIEA 5AFAA 4BWWA 4G7RB 1TEFA 2Q5BA 3FSVA 1HFUA 2I7OA 4GP4B 1BXVA 1AAJA 4HCGA 2JXMA 4G7SB 2CBPA 2NRDA 2AZUA 1KCWA 5I5MA 3ZIYA 2IH8A 3RYMA 3X1FA 4NERA 2PP8A 3QJSB 1J5DA 1IBYA 1ET5A 2IDSA 2XV3A 3JTBA 2GIMA 4NB7A 3ERXA 4YL4A 5I28A 2Q9OA 2W8CA 1B3IA 1KDIA 2FTAA 3OMNB 4GY4A 1GYCA 1E30A 4UAHA 2QDWA 3SBQA 2PCFA 3EH4B 4HZ1A 2B08A 1ET7A 1SJMA 4N4YB 2VM4A 1FWXA 3PXLA 2R7EB 3SQRA 4HALA 1AG6A 3NT0A 1NIAA 1PZBA 4YSUA 1AANA 3PAZA 7PAZA 1PNCA 5I6PA 3FQYA 2DY2A 4L0PB 1WA2X 4YSTA 5B7EA 1NIFA 1AZUA 1GY2A 1M56B 1SHWA 2IH9A 1PNDA 3GYRA 3AZUA 3AG2B 2FWLB 4BDVB 5I26A 3S8FB 4G70B 2YAMA 1KGYE 5I5IA 1RCYA 1ASQA 1NIBA 4RH4A 5D4IA 4E9YA 1WA1X 1BQRA 1MG3C 4K9JA 1BEXA 1L9PA 1HAUA 2IAAC 3PAVA 3MBWB 1A4CA 2P80A 3AG1B 1QLEB 4GXFA 4Q89A 4YSOA 3WKQA 2FT7A 2W88A 1MDAA 2BZ7A 3NJMA 1XB8A 3UADA 3WIAA 1FA4A 4A68A 3FT0A 1SDDA 2GSMB 3TBBA 5B1BB 1NIDA 4DP9X 3T9WA 4N8UA 1A4BA 2CUAA 2AVFA 2X88A 2XV0A 4HHWA 3IN2A 4DPBX 4BXVA 1NINA 3EF4A 1EZLA 4DP0X 1KDJA 1N70A 3T6ZA 3UGEA 1ZIBA 3FPYA 4DP6X 2AFNA 3N2JA 1DZ0A 9PCYA 1E5YA 2YXWA 4CSPA 2XYBA 3EHBB 3NSCA 2IDTA 2HLEB 3IBOA 1X9UA 2BW5A 2CALA 3CVDA 4F7KA 2MRYA 4DP2X 4KO6A 3UAEA 5I6OA 2WSDA 3AG4B 1NPNA 2OCCB 2PPCA 3BVDB 3FU8A 1XMEB 4JHVA 4G71B 1J9QA 4KO7A 4QLWA 1NDTA 1PAZA 4KOBA 1PCSA 3AW5A 1GS8A 1AIZA 4FA7B 6PAZA 2UX6A 2XUWA 4YSDA 2IWFA 4F2EA 6PCYA 4YSQA 1L9RA 2PCYA 4AKPA 3ABGA 3ZDWA 2J5WA 2QPEB 1RKRA 3CVBA 1JERA 4BWUA 4JHUA 2BP8B 1MZYA 1PZCA 2HRHA 4HAKA 5F7BA 5E9NA 2UXVA 3QJTB 1J5CA 1WS7A 1QHQA 2FJSA 2VW4A 2ZWNA 1W8EA 1JZHA 1PLAA 4YSSA 2PPAA 2XU9A 3FQ1A 5B3SB 1WS8A 2OV0A 2XXGA 4A67A 1OE3A 3GDCA 5PAZA 2QT6A 1AZRA 1MG2C 1JVLA 3NSFA 1GS6X 3L45A 1A3ZA 2FQFA 1ZPUA 2UX7A 1SHXA 3H4FA 2CJ3A 1AZNA 2FQGA 1JXDA 1M9WA 3FYIB 5IY5B 2BW4A 2IDQA 1KV7A 2CCWA 4PAZA 3QPKA 1NZRA 2EIJB 1BAWA 2WO2B 5LDUA 5TK2A 1OCCB 5AKRA 3TBCA 2RACA 3X1NA 4DP1X 4A66A 1L9OA 2H3XC 2PPFA 3FQ2A 4JKNA 3CDZA 2E86A 2XV2A 3G5WA 5B1AB 3FSZA 1T5KA 1AS7A 1OCRB 1NTDA 4YVNA 1ASPA 2DWSA 5A7EA 3PPSA 4E9TA 1OCZB 2VMJA 1ZDSA 5I6KA 1SFHA 5B7FA 1URIA 4P5SA 1PF3A 3FPXA 4G7QB 4KNUA 1OOWA 1KBVA 2XWZA 1CURA 2EIMB 5ANHA 3V9EA 2TSBA 2YAQA 3FSWA 3MX0B 4ENZA 2JFCA 2GB2A 3HEIB 1L9TA 2MTAA 1XB3A 2ZONA 1EHKB 3V9CA 1ID2A 2PP7A 2Y1AA 1VLXA 1BYPA 5I5JA 2OJ1A 1SDDB 2AZAA 1HAWA 4YSPA 1A65A 3OM3B 3OMIB 4A2FA 1AZCA 4UF7C 1SF5A 4HCIA 4E9XA 2BZCA 4NAJA 2YAHA 1V10A 2UXGA 1AOZA 5B1JC 1NICA 1XB6A 3NP4A 3CZUB 4UANA 3ZBMA 2FT6A 1RZPA 3FU9A 4QKTA 1ASOA 5TK4A 1IUZA 1IKOP 2PP9A 1L9QA 3NJKA 4M4RB 2ZOOA 2ZXWB 3NJHA 1IBZA 2YXVA 2GI0A 2H5UA 3QJVB 3OMAB 3S3CB 2GC4C 2XX1A 3CG8A 4TXVB 1SNRA 2WO3B 1J9RA 4A2HA 1I53A 2BO0A 1SF3A 2XVBA 4HIPA 2Y69B 5EHFA 3AG3B 5FC9A 3SBRA 5I6LA 2EINB 3S3DB 3NP3A 4DPAX 3ASOB 4A2DA 4KOCA 2HX7A 1AQ8A 1MZZA 3FSAA 2J56A 2TSAA 2FT8A 4AKOA 4F2FA 3WNIA 4YSEA 4W1TA 2CAKA 1AZBA 4GP8B 3WI9A 1NPJA 4DP7X 2EILB 3N55A 1NWOA 4YSCA 2JKWA 2HRGA 4YSRA 1TEGA 3QJRB 3KW8A 3H56A 4AZUA 1KBWA 1JXGA 2BWDA 2VN3A 3ASNB 2IDFA 4DPCX 3UAAA 1BQ5A 2GC7C 1CYWA 1GY1A 3DIVA 2BWIA
chains in the Genus database with same CATH superfamily
1U41A 4NOFA 4FADA 3CDGB 3QYNA 2ZPKH 2KDGA 1NM4A 2FWOB 4L9LB 2GSIA 4KHTL 3SPIA 4Z7WF 2BNQA 1XSKA 4K7FB 3JVGA 2I07A 4HH8A 3ABMB 1G7PA 2DQTH 4LCIL 1Z3GH 3TYFB 3TJEH 1CE6B 5LCVH 3LS4H 3HAEH 3NYKA 2QADD 4P49A 4BKLA 2NZIA 4HHGA 5C07E 3RWDA 2X6AA 4KU1A 4WW1B 5JMOC 5D5MF 2IFFH 3K6SB 5LNDA 4N2DA 1UXSA 1FE8L 4M1GH 4R90L 5I74B 4LU5L 5CP3A 3BVNA 1A7OH 1NC4B 3WTUA 1EXHA 3SDXA 3CQPA 2BMKA 5GS1C 3D39A 3K71B 1AQKL 4KZEH 2D31A 2DW5A 2IPTL 2JK5A 1WAPA 3MOAL 3MBED 2CD0A 4N5EC 2DD8H 1CTOA 1KCRL 4I2XB 3GHPA 2H0JA 5EWIH 1D7DA 5FYJE 1IJ9A 4Z5RA 1X4YA 4FHJA 2AQ2A 1JN6B 3I6KB 3HJEA 3HE7B 2DL2A 5IQ9A 3OKLB 2Z31D 2EZ0C 4NQCA 3DHJA 3EOTL 4OIFA 3K0WA 1WAEA 4UM9A 4OM0H 4AGMA 2FB4H 2APFA 4TTGA 3PWNB 1JZGA 4B3EA 4N9OB 4HIIA 3S4SB 2R23B 4FKHA 2OL3L 1WIUA 1XR9B 2DJMA 4HKBB 2FL5B 4S1QH 5IK3A 3IKKA 1SMAA 3QXAB 4OW6A 3ZUCA 4Z77B 3UTZA 1QSVA 5AW4B 2IGFL 4HCFA 4ZS7L 4KNQA 4AIOA 2VR5A 1GIGH 4OGYH 4B97A 1NDGB 1BIIA 2WPGA 3MV11 3U9UB 2VN4A 2NW3B 3OXSA 5EF2A 2XTLA 1FL5A 4UINL 4TSBL 1PD1A 1AGDA 4JO5A 1M57B 5EDSA 2X6CA 2I27N 5IJVB 1JZEA 3B6SA 4N9GB 2K3HA 2OZ4A 3KCPA 4F3FA 1D6VH 4KK9C 1KENH 3DJ9A 3ZO9A 3UC0H 1JYVA 3W56A 3X12A 1J8RA 1TMCB 2GJ6A 3HC0A 4JM4H 3SKNB 3UTOA 4XPHH 5HHME 2QTEA 3I3DA 3L3GB 5ITFA 5K9OA 3OB8A 4JY6B 3GB7B 2J8UB 3O2WL 3OLGA 2BIPA 3QRBA 5GHWH 3LZRA 4FE9A 2J4WH 4NQEE 5AOKA 3T4AB 2BHFA 1PD0A 3WKPA 3BIBX 3QO0B 2DQ6A 5DURD 3RGVD 4LCUA 4GMSH 4Q4EA 1QSFA 5E6IC 5T3XH 3X13A 5EU3B 5F89A 5D7KE 3AT0A 4PLKD 5C97A 1W8NA 4NJ9H 3CU1A 3IXAB 1B4LA 2WXHA 3L08A 3QA3A 1NMAH 4YQXH 3X1EA 4ZX3A 5IJKC 2P5EB 3GMOA 4X8CA 4PN6A 1BEYH 4G11A 1BD2B 2HT2C 3ISRA 3U0TB 2JKLA 4MS6A 4OBRA 5E00B 3NJNA 1F2QA 1LEGA 3SODB 3Q5TA 2NY0C 1JAEA 2A77H 3VFVA 1PFCA 2PCPA 4AGNA 3CLEL 4TRPH 3U48A 1ODAA 2OXHB 3SQOL 3V6FB 2YGQA 3P73A 3HI6L 3NH7L 4LSTL 2L7UA 1MFDL 5D7EA 3VU2A 1Z9MA 4AKQA 5I1IH 1OAKH 2H3NA 3VNZA 1S9VB 2ZG1A 2Y1YA 3BYTA 3CXDL 3VWJB 4X9GA 5LBSH 1KZYA 3C8HA 4HCRL 3B8YA 2E6QA 2M2DA 1N5YH 4JPIB 5JIKA 4KO5A 1FV1A 2NXYB 3IGAA 1O9ZA 4ODXA 4X6BA 2EYTA 2PTTB 2ZCHL 1NOAA 1E65A 4XP5H 5EO0B 3TA3C 3GSNA 2EYSA 4ATWA 3CSYA 2HFFA 1R3LA 3AS1A 2HT3C 4P46D 2F58L 3UJJL 5ILTH 5LGHL 1JGVL 5KSVB 1S9WA 3LV3A 3MLYH 4JFTA 1CFSA 4GRMA 3W11D 3ZMEA 5I8OH 1S9YA 2CU9A 4HCGA 2ZE0A 1FO0B 4KK8C 2Y2WA 5CJOH 1S46A 1EJ8A 4ZUTA 5FYKE 2KMWA 4XBPB 1ZLWK 4YHYC 3X1FA 4XCNA 4G8GA 3H42H 4HT1H 1EEYB 4BEIA 3GRWL 4DVBB 3BP5A 5FF6B 5HHOB 4Z3EA 1EJOH 3QJFB 2FTAA 2ESVB 4XMWA 4JPQA 4EZLA 5LCVA 4GFXA 4XB8A 3N1GC 4DF9A 4FZ8H 5EN2B 5JPNC 3HAEA 2EJ1A 2G9KA 3EH4B 3SSGA 5JQHC 1TZAA 2EIEA 4J4PC 2CGRH 3ATBA 4OLWL 1WZMA 3APNA 2AGJL 1AD0A 4HLZG 2FH6A 2R0WH 1QG3A 1JV2B 3D25A 3LOWA 4LLDB 5IWLA 3NT0A 2KC0A 2R9HD 3KJ4C 4LLYA 4Y1SA 5K9QG 1NDMB 3BZFA 3Q01A 3OJDB 3D85D 4BCXA 4JHAH 5CO1A 4PGJA 3RWCA 1RIHL 5C3TA 5JOPE 2AQQA 2V17L 3GEWB 1P4BL 2VYRE 4HHAA 5EU7E 2VGLM 3EJRA 2CR0A 1CZ8L 2W65A 3G6JA 2XY1A 2GTZA 4WHTB 2Z92B 4RH4A 1WA1X 4N0UA 3U1SL 1OF2A 3K2MC 1HAUA 5BRZD 4XPTH 3D06A 1F1GA 4NO0D 4ZXBC 1OSZA 1CDGA 1J10A 1H5BA 4GG6F 3PL6C 3BKCL 4W9KC 4Y2DB 2BZ7A 2D2OA 2VQTA 3MMEA 2ZWSA 4JFFD 4LEXL 2CLZA 3JYCA 3GXTA 1R5WB 2GSMB 4JDTH 2EDNA 3IBEA 3IDMB 4HPOL 3UTSA 1YEJL 2F7IA 3RB7A 1YUKB 3ARDB 5D1XA 1XL6A 35C8L 3V4VL 4ZQTA 2IIJA 2HN7B 3BDYH 2JI2A 3UJIH 5EZLA 4B95C 4RMVA 1O5PA 5AW7B 3A6BH 4PRIB 3B2DC 4YZWA 1Q9WA 1RJLB 4ANWA 3IKCA 3EHBB 5GGRY 2FECL 3VXSE 4FXGB 2GFBA 3FO9B 4JHWL 1W8OA 4NRYB 4CILA 2YRLA 4EZJA 1NC2D 1RUQL 4OUUA 3UFIA 4BHUI 1NCBH 4I8DA 2PN5A 3VG0L 1F00I 4LRIA 3VGDA 5I6OA 2PO6D 1ZLSH 1N2RA 4P8QA 3F7LA 1G84A 1DQKA 1FFQA 3BVDB 4ZUVB 5HGDB 3DETD 2X4TB 1DQMH 3MNZA 1K4DA 2Y7OA 5B4MD 1JGLH 1C1EL 3RWFA 4JDEA 2B4CL 3QNFA 4KRPC 2H2SC 1FZJA 1GS8A 4NM4L 5D7LD 1CE1L 1JZ4A 1YMMA 2ADJB 3D2UA 3ARTA 2NY5L 3V10A 2W1NA 1DBAL 5M7QA 3MA9H 12E8L 4MS8D 2BDNL 2IC2A 3NSJA 3PABA 4HPHA 1NH6A 2P8LB 2QGCA 3MJGX 4W6YB 4YOKA 4C56E 3V0WH 4ZFZB 4IU2A 3VW3L 1SVBA 1UB5B 3ZE0F 1J5CA 4PJGF 5HDBE 4BA8A 4FABL 1NUNB 2XJKA 3OGOE 5FPIA 2R15A 3ARGB 2V2WA 3DV4B 2KDYA 4HJGB 4N3TA 3EO1A 4K4KA 4UDTB 5D1ZC 1YY9D 2VE6B 4XI5D 4MNGB 4BFNA 1FO0H 3V5DB 3BGAA 3FN0H 3GS0A 4RAUB 3CDGA 1YVLA 1WEJL 3FFDB 4X6DF 2FWOA 4L9LA 3MFFB 3T0EC 5KVFL 1QQDB 2ZUYA 2MWCA 2EH8H 5FYLD 2VQ4A 2X3AA 3N44B 3T2OA 5L4MA 1QZNA 4QT5A 3J7HA 1NUFA 3TYFA 2P8PA 1CE6A 4ZOCA 4QHKJ 4YXHL 5LBSA 3S36X 1QI3A 2DWYA 1EEQA 2J88H 2F0CA 4ONOA 1UT2A 2AC0A 5TF1H 2Z8RA 4WW1A 5D2NE 3K6SA 5I1EH 1NLDL 3CMOH 4PJAE 2YPKB 4QXVA 4JMNA 2OMNA 3TBCA 1NC4A 4R4BB 1MW2A 2BH0A 3NK4A 4QXWA 1HNYA 1L9OA 3K71A 1HH6A 5JDSB 4PW3A 4XCFL 2YZ1A 2HA1A 3U4KA 1RUPL 1PX4A 4F9PC 1QUNB 2UV3A 4GBXC 4I2XA 1DBKL 4P57B 5B38A 5I6KA 3OVUB 3I6KA 2JJUA 1PF3A 3HE7A 3IFNH 4JFEE 4NAMA 3OKLA 4Z95H 4P4KA 3RY6C 1RZKH 3S96B 5EEXA 1E4WH 4N0RA 5HHVH 2GKIA 3PWNA 2JFCA 1IM9D 5AW1B 1LK3L 2DKUA 4O51B 1L4IA 2J3SA 2R23A 3QPQD 3S4SA 1XR9A 4HKBA 1DANT 2FL5A 3BVXA 1CXEA 2L8AA 3IMSA 3MDJA 1NMCC 3QXAA 2E7LC 4Z77A 4O4YL 5CUSH 5AOIA 1ZHNB 3L1EA 3MRPB 4RRPA 2NXZB 3DHPA 1SDDB 2D7PA 3F6JA 4OFDA 2AJ3B 2MPAL 3AT9A 2BIHA 1MI5B 4XRCB 4UF7C 3EGXB 2WJ5A 1HI6A 1HL4A 3VM5A 4L0YA 3FRUB 4R5XA 2NW3A 3VXMB 1T6VN 4OCRL 5L2KD 4WUUD 3AWFA 3CZUB 4RRPM 1UWGL 2ARWA 3MODH 3U9WA 4PEEA 3WO4B 4NKQB 5IJVA 1UASA 4TLSA 4N9GA 2FYYB 1IKOP 3E1F1 4JQVC 4L37B 3MXVH 1DVYA 4XVJL 3K6IA 5DR5H 1IQWH 2VUOA 4J3OH 5K69A 3BPNC 3A6OA 3S37L 4KRMB 1ND0B 4N86A 4QRSB 3IFLL 3SKNA 4GI8A 4YZFE 3CAFA 4ORZC 3VMOA 2EINB 3L3GA 3OAZH 2Y9RT 4JY6A 1GHFL 3GB7A 4TN9A 5AW6B 2Q76A 3ASOB 2H0EA 4JGNA 2RR3A 1ACZA 1DBBL 4LCCB 4PLOB 5IW6A 5T3ZE 4FL4C 3GSWB 5IV2B 4WUKH 1G9NC 4BK5A 1JYWA 4DSYA 3ATEA 5IVNA 1DDHB 2V5SA 4IS6B 1HKFA 4XNYH 4JRXD 4LRNL 4AH2B 3IXAA 1SGKA 3WFEH 2VR7A 2P5EA 1A5FL 3UG5A 5D72H 3UAAA 2VDNL 3NZ8B 1BD2A 3KBEA 5D2LB 5E00A 3SJVB 4BQ8A 1E50A 5GZOD 1ZLEA 3WFHA 2VTFA 4I87A 4WV1B 2VAAB 4ZD3L 3H3KA 5AW0B 2RGSA 5KSAC 5GGQH 5EU6B 2FYVA 2DBLH 2OXHA 3RTQC 4MXVE 3V6FA 5AB1A 5KANI 3D3VE 2K70A 4CC1A 2YD4A 1R75A 2VDPH 5JPMC 2H1LM 2P43B 4GAFB 1S9VA 4P23B 3VWJA 4FD0A 4ZNEA 1IJNA 4JCLA 2CJTA 4H44C 4JPIA 1I8AA 3SDAB 5EUKB 2E4TA 4E9QA 5KBKA 3DRQB 3Q8CA 1T83A 1XDTT 1OZTG 5ENWB 2Y6SC 3QXDB 3FL7A 5JHMA 4HUMB 1UA6L 3SE9L 4ANXA 1KCBA 4YDKL 1T20B 2XVKA 5KSVA 1J0IA 4NKMA 3THMH 5CSGA 3KWUA 3OF6D 1FO0A 3HLKA 4ZW6A 1QBMH 2W0KA 3DIDA 5C2BH 4XBPA 3BT2H 1OTSC 2KBGA 4OFYD 1NGXB 1Q9KB 3N40P 5DQDH 3RDTB 1T03H 3SKJH 4MHHI 4DVBA 1BQLH 2F5AL 5HHOA 5FF6A 4HU2A 3O3AB 2ED9A 2ESVA 3REWB 1CR9L 1KG0B 3ZTJG 5IBLD 3U9PL 5EF3A 1E4HA 1PY0A 2WIIA 4KX7A 2OMXA 2X0WA 5I5RA 4IGBC 3B7RL 3V8OA 2P80D 2XOTA 1JV2A 1Q1JH 5D8JL 3BW9B 5BV7B 3SDXF 2NY7L 4QXGL 2CDFB 3NOIA 5IFHL 1OAUH 1RP8A 1NL0H 1NDMA 2ICWI 3C87A 3OJDA 3MUGB 3FRPB 3VH8G 3ZKXC 3AM8C 3AQDA 4KROB 4OLUL 2DJSA 1QSED 4QY8B 2AV7B 1M71A 3ECQA 2Z31C 2X6UA 2ALAA 5HGBA 2FO8A 1KTRL 2E6JA 3U4EB 4KX9A 5IOKA 3OKOB 5FR3A 4WHTA 5FOJA 2Z92A 5D7SL 1G6RL 2CIKB 5CCJA 4UQCA 3ZSSA 1MFAL 4MA7L 2HVBA 4KQ4H 4Y2DA 2VIRB 3MLVL 2VR3A 4NBXB 2F7PA 4OGAD 1R5WA 4UV7L 1MXDA 4PRDB 4H2CA 3ZDYE 5AAPA 1X5ZA 3IDMA 2F5BL 5B21A 1W72B 5HI3C 2IO5A 2ZOLB 4IYKA 3MOQA 1DUYB 1NBCA 3P9MB 2IMNA 5IMKB 3ARDA 4TSAH 1L7IL 2VM9A 5LN8A 2HN7A 5T5FL 4W9JC 3NAAL 3FQ4A 1GZQB 1PG7H 1E43A 2W9LA 3GINA 3HI1B 1DN0A 5F70A 4BZYA 1J1OL 2B15A 3B2VL 4PRIA 3BVUA 3LH8A 1RJLA 3NIGB 3FTVA 4IKNA 4JKLA 2WAHA 1NAMB 1EO7A 4FXGA 1USZA 2WXRA 2HUEA 2MQ3A 4NRYA 2NSQA 5I15L 3BAEH 5HVHB 3IDNB 3W37A 4YEFA 4IRJB 3SCMC 2AJVL 4M93C 3BZ5A 3DOSB 4ZUVA 5HGDA 3SPVB 4F80A 2X4TA 2YGVA 4LT7A 1UC6A 3ILQC 2XT1B 2EKSB 3QIBB 1KFAH 5EOCJ 5LWYL 1M1XB 4GAJH 1AZZC 3KVPA 4FTVE 4PH8A 2ADJA 5KYUB 3RGVC 4KKCD 4DFIA 5KS9E 1OGTB 3LVTA 4HMDA 3QWQB 2ZZUT 4IMKC 1DJXA 4ZX4A 3D33A 2P8LA 2ZUXA 4ZFZA 2JKSA 1A14H 5IJBC 1BM3L 1M2VB 1IEBB 1UB5A 5C3IA 3K4AA 3B56A 2P48B 5DS8B 4QRBA 1U8KB 3TWCL 4AUUA 4GLRH 2FIKB 3ARGA 4MLSA 3DV4A 5GRWA 2GAZB 4BCZA 2C9SA 3NQKA 2BSEA 4UDTA 1LDSA 2AMUA 4JDVA 1F4YH 1UUSA 2VE6A 2DWDB 2X0VA 4ZAKD 3KHQA 4MNGA 4KQ3L 4A7GA 3V5DA 1E2ZA 4RAUA 3W9DB 3TBTB 3GGWB 3N9GH 2MSPA 2JKIS 3MFFA 5DZPA 1QQDA 2V33A 3CWGA 3RRQA 1OLLA 4HG4K 1UWXK 1TJHH 1FUNA 2QADB 1BMGA 2JB5L 3TEYA 1FYTE 4GY4A 2VMCA 3KPLB 5MERB 4U0QB 3GZPA 4B60A 5AW3B 3WTSA 2CO2A 2QKIB 4LLVB 4P46C 3CFIC 2BIQA 1I9JL 3W11C 2YPKA 3PV7A 4Q6IA 1ZWIB 4X8XA 2G3MA 5BV7H 4R4BA 4E68A 1MCSA 5ITBH 1IC5L 2OSLB 7FABL 5JDSA 4GO9A 3MBEB 3BRFA 5LNEA 3BDXA 1UWEH 3RVTD 4RCAA 4Z1PA 5F7NC 1QUNA 3D07A 2Q7AA 3LKSB 1YQVH 4P57A 2P47B 5KSBB 4U3HA 4UMGA 3MLWH 2FLMA 1J87A 5BZDB 3S96A 1YAIA 5IMMA 1DQDL 4HLJA 3K72A 1MG3C 3Q5OA 4K9JA 3FTYA 2B8OT 3PDOB 2R9HC 3CH1B 3VA6A 2A9BA 2PUQT 4TLUA 4O51A 2DN7A 1SXAA 3EZ8A 1KTBA 2ICWJ 3STZB 2FZ3B 2UVEA 1ZHNA 4AV0A 1IGFH 3RILA 1SDDA 1W72H 2AJ3A 4X0KB 3FBKA 4XRCA 1J5OH 3EGXA 4UIMB 4X80H 1TPXB 5AZ2L 3FRUA 4KI5C 4BXVA 5ANME 4CGTA 4AV4A 3ULUH 1AD9B 3ARQA 1KDJA 3G6JF 3KG5A 1BLNB 1TT6A 4JO4L 4OU3A 2GG1A 2IH1B 4MAYD 1NAMH 3LTVA 2XQBL 2FYYA 5FO7B 1E5YA 2R8SL 4OGQC 4FG0A 3VJ6A 2A74B 4L37A 5DUMH 2CALA 5I1AA 1YY8B 4TOYL 3FAXA 4FQXD 3PFUA 2DWEA 1ND0A 4QRSA 5AEAA 2XN9E 3AG4B 4XNZB 1P4LB 3SD5A 4P5MA 3FT1A 3LXBA 1CJYA 4BH8B 1XMEB 4XH2A 1J9QA 3KL3A 3QORD 3NGBC 2HLFD 1BF8A 1J5HA 1HHGB 1PAZA 4XMZA 1GCYA 3S34H 3S88L 5EORL 2ZKYA 4AG4L 5FYJD 4LCCA 5DURB 6PCYA 1NCUA 1MIMH 2Q10A 4DKDC 3BKMH 3CK0L 5CLYA 3GSWA 4PJCF 4B5ZA 1SYSB 3SOBH 3KHOA 4JZNB 2PO6C 4J3UA 2J72A 2LTQB 2D7OA 2XBDA 1Q9OB 3EYQD 4IS6A 3RL2B 3DETC 3GHEL 3N43F 2B1OA 2F7OA 5AVWB 5B4MC 3K8MA 4WHYG 2VW4A 1MRDL 5AB2A 3NZ8A 2HJFA 1O5DT 5D2LA 1KXVA 1HL9A 3QCTH 4MAUL 3MA7B 3SJVA 5FGRA 4X6CB 2PR4H 2VAAA 3LMJH 4OKDA 3QPXL 2OV0A 1OE3A 1CIUA 1A7BA 1YNKH 5EU6A 3LPGA 3P30L 3HB3D 1HWGB 1HCVA 4P3CL 4PRHD 3KM2A 4P23A 3A4FA 3ZYIA 3GM0A 4P2QE 3T8XB 1U91A 5F3HB 5AVUB 3L13A 4MRBA 4TSCH 2WQUA 2HFGL 5EUKA 5FS5A 4HH9B 4OZGF 3DRQA 2IBZY 1TXKA 4XI5C 4UTAH 3FNKA 3UTTD 1NM9A 2OCJA 1RY7B 3QS2A 2H7WA 2YUXA 2JLLA 4Z7QB 5HHMD 1BX2B 5GS2D 5GQBA 1T20A 3ULAB 3HBQA 5DUPL 2PPFA 3QWOB 4DAGL 2WTOA 2XV2A 4JPKH 5D71L 2YLKA 1J8HD 1MUJB 1GOGA 1FH5L 3V0IA 5F3BB 5IHZB 1WZLA 3H9SD 1TLKA 1NGXA 1Q9KA 4YVNA 3RDTA 4YLBA 4NO3B 4EVNA 2NY6C 2OR8A 1U3NA 1P1ZB 3O3AA 4FS0A 3RVWD 3T2NH 4P5SA 3ZRCC 5E4EB 4JRYE 3REWA 2J71A 4GH7B 4YE4H 5EUOE 1KG0A 4I85A 1KBVA 3FT2B 4NLHA 3MX0B 5KVEL 3RIKA 1KELL 5CWSB 5DJCA 1JRHH 1BJ1H 1NOLA 3BW9A 3D85B 3W0WD 2CDFA 1WSST 3ZTEA 2WANA 2AZAA 4PJDB 4ZFQA 5DS1A 3MUGA 3FRPA 3FO1B 4PV8B 3CN1A 4DUVA 3CFNA 4QY8A 5T5NG 3WSQH 4ENEC 2AV7A 1HE8A 2ID5A 5F3FA 3QFJA 3W39A 1TTBA 1T0OA 2WLIB 1E6JH 3OKOA 4FNLH 1RURH 4UT7L 4X7TB 4DGVH 4Z7OE 4OZIE 3QPQC 2CIKA 4NO0B 2A1WL 2P5WB 2VISA 5DGQA 3MVSA 2KQNA 1HILB 1KZQA 5IG7B 3DO3A 4DOHE 1GA2A 1M4KA 3TBWB 3CSTA 4JFFB 1XGUB 2E9GA 3AROA 4XTRD 4XVOA 3OHXC 2VIRA 1YPZB 3QT2A 3L9RA 3MPCA 1RZ7L 3V4UH 3KYKH 4PRDA 4WI9A 3E2HC 3GTNA 1QBBA 5EHFA 4N85A 5FC9A 1W72A 3DHMA 2ZOLA 3MJWA 1XX9C 5GRXG 1DUYA 3P9MA 2W60B 3CIAA 5IMKA 4K94C 3CVIL 4RAVB 4DPAX 3NTCL 2JTYA 5AUMB 1GZQA 1UG9A 2Y25A 2WWNA 3T0WA 1MIEH 5I0YA 1VADB 4F2FA 5L7XL 1NC2B 1UCBL 3S98A 3HC3L 1HJCA 1S7WB 1NAMA 3TT3L 3R1GL 1JS4A 1NCWH 1XAKA 4LNRB 2OJZH 4X5XB 1BBDH 2XVLA 1VESA 4MA3B 5ID1A 3QEHB 1KBWA 4LL4A 4NX0A 3V6OC 5CF3A 3VD5A 3WNIA 4IRJA 4GIPD 5IB3A 2WQSA 3DOSA 1DSYA 1EANA 5I8EA 1OP5H 4QTIL 1KY6A 1JPST 1UOLA 1WFJA 2F9BT 3QIBA 4WEUD 5TDPB 1M1XA 5JOPD 5KYUA 3GBEA 4DPRA 1OGTA 1W2KT 2YEVB 3MYZA 4HEME 2APSA 4L8SC 4I1PA 2DQIL 4Q52A 3ZHFA 1GYUA 2VW7A 3V0GA 3SGEH 4MZ3A 3AS2A 5BVPH 1BYOA 4WEEA 3ARWA 1FVCB 3BISA 3VFWA 2BIMA 5SX4I 5AD0A 1M2VA 1IEBA 3FTZA 3MR9B 3E1ZA 3WEOA 1S5IL 4HXAH 4X5QA 3TBVB 5GZOC 2K1MA 4Z7WE 5DWPA 3ZZQA 2FIKA 4GQRA 1GAFL 1KY7A 1X5GA 1EBPA 2WYTA 2WNXA 3ROLA 5I0XA 2E27L 1YNTB 2ZCKH 3VGGA 2DWDA 3U2SB 2YXFA 2WP3O 2Y5TB 4R7XA 4XHQA 4YHKH 3TBTA 3W9DA 4KJPD 5EF1A 2ZKMX 4W93A 5D5ME 3ETBF 3SD2A 1TCMA 4WEBL 1MRFL 3ECVA 3EBGA 5TQ0L 2VJ0A 2WHVA 4WDIB 3T08A 3FUMA 2GBAA 4JKPL 2HTKC 2IPKB 4KKBD 1OAXL 4ZOAA 4MA1B 3ROOB 5I73C 3VXSD 1JZ8A 4XXDB 3KPLA 5MERA 1ZE3H 4PGCB 4L23A 3F7RA 1UGNA 2QKIA 4Y19D 4DETA 4KY1H 4LLVA 4O2CB 3TFKD 3ALXA 3PJNA 3TZVD 1F6FB 4UTAA 2QVKA 3TX4A 4YHNA 1ZWIA 2YMXH 1R0AH 3V0DA 5ESQB 2YGNA 2BY3A 2OSLA 5L6YL 2NQ3A 2Y7SA 3BH9B 4TV3A 2EO1A 3LIZH 1E3ZA 3BLBA 1OCOB 5FM4A 4QGTA 3R8BB 2OZ4L 3MRKB 1T22A 1NBVL 4Q9QL 3LKSA 4M00A 3KXFD 4XVTL 5KSBA 3BQVA 5IBLC 4N68A 1AVAA 3FB7B 5BZDA 5ICXA 3QI9A 4BIKA 5B1JA 4P9MH 1VGKB 1IM9B 4YDIL 3STLB 5KVMC 1A9BB 4PQXA 3BD5A 3PDOA 1UYWH 1KTLB 3CH1A 3NIFF 1VF5C 3VAEA 2B1HH 4RFOL 5KYNA 3MNDA 3WD5L 3STZA 4TKWA 2FZ3A 1XZWA 3GFUA 5DRXB 2Q8BH 2B16A 3FYEB 4KGJA 1AGEA 1AO7E 4FYRA 1N68A 4X0KA 2Q87A 5ADOH 1SXBA 2CSPA 3HC2A 2I7SA 1DVUA 5L2KB 4Q97A 1CGWA 4J3SA 4X4YA 1KYUA 1AG0A 1FZKB 1NEPA 4TNGA 1MWAB 2V5MA 1AD9A 3GSVB 4FF9A 5E99H 2LAAA 4LEBA 1X5KA 4BSVB 5AVYB 1BLNA 1UZ8B 2GJRA 2IH1A 4F8PA 4HA1A 4O02B 5D7IB 2P44B 5FO7A 3TJPA 3CBJB 3JVFC 4NSKB 1E6OL 4OGAC 5IESH 4Q9RH 2ZOKB 2A74A 4GIOA 4CA4A 2E46A 3OD3A 1MW3A 1V7NL 4YK4B 5T1DL 4BWTA 1TCRB 1W15A 2BP5M 5F8RC 3D87B 3BIAX 1P4LA 4KNTA 4CU6A 2J73A 4KY2A 4BH8A 1IFHH 5E1AB 1YAZA 1AH1A 2GEEA 3TOPA 1UFGA 5D1QB 4HZLB 3P54A 1HHGA 4FCHA 1MJ7H 3G3LA 4NQVB 3HNVH 3U6RA 4JFED 1ZIAA 3UACA 5IMLB 3GSNL 3QSKB 4PYGA 3EJSA 2WLLB 4X4XB 4DKEH 3KDPB 3FUHA 4JZNA 3HN8A 5J1AA 1LK2B 1J05A 3PAUA 4ABQA 5F9JB 3AXLB 2VERN 1CLOH 3W57A 3MSPA 2VLRB 2ZUQB 3VYNA 2VLKE 2ZPKL 5E2VH 1N0LB 1F11B 4WY7H 4J3OF 2DI9A 3SPCA 1RK1A 3ZDXB 3MA7A 4X6CA 4KKCC 1N6QH 2DQTL 4GQ9H 1Z3GL 4E41D 3EJZD 5LCVL 3WJJA 3LS4L 2E0PA 4ORGB 1OO2A 4N0YH 2E7HA 2CJUH 4PBXA 3VD1A 3FB6A 4PBWD 2FSEB 2NPLX 4Y5YA 2IFFL 3T8XA 5EU4B 5KN5B 3NRQA 2PW2A 4AYID 2XV3A 4M1GL 5FUCE 4LMQE 4MAZA 2Z9TA 5E6ZA 1A7OL 5JHDB 4FQQB 1E30A 4HH9A 1TO4A 4KZEL 4YMPA 2YRZA 5IBTH 4GKZB 4IKKA 1CB4A 4FTDA 3DX8B 2MCG1 2EC9T 3BLKA 1WIOA 2DD8L 2OCFD 3QUXC 3ZKSD 1BX2A 1U3HD 3LNEA 4POUB 5EWIL 2H4EA 3QDGD 4HDIB 1AANA 4X9BA 3QWOA 4A7GF 1CXFA 1N12A 4OF0A 4UAOC 1UM6H 1AR1C 3FQYA 2DY2A 5I6PA 3SBWA 5IMOB 1MUJA 1SMDA 4LKXB 4OM0L 2XV6B 3C5SB 1KB5B 1X9LA 5F3BA 5IHZA 1X4ZA 2FB4L 4QKXB 3V4VH 4U0RB 4FA8A 1BOGB 1OTTC 1R3HB 3O6LH 1SUJA 3AZUA 3KPSD 4NO3A 1OQOA 1P1ZA 4S1QL 2ICEC 5EH1A 1A6WH 2R2BB 1MCLA 3VRLF 2NX5E 2MPVA 4HK3N 3MX0A 3C60C 1ZVSB 4GXFA 1DSWA 1GIGL 1UD4A 1F4AA 2YUVA 4OGYL 4PY7B 4Q58C 5CWSA 5J5EA 2X5PA 3RVTC 2KLSA 1OALA 2HYMA 1QYGH 4ZI8A 5K5YA 4PJDA 3KCWA 2OMUB 5B1BB 4PV8A 3LIZA 1D5RA 3D3VD 1BSIA 1B0GB 2AVFA 3AAZB 3B34A 4GG6E 4H8WC 4HX1B 1JCKA 1MWAH 1D6VL 3RI5K 4QWWC 1E2VA 4LEEA 1KENL 2WLIA 4U7MA 3K6FA 2G5UA 2IJ0C 4TUKH 4U6TA 4IJTA 3UC0L 5K9JH 4O02H 4FX5A 4HJ1A 4NO0A 4QRQB 4KZDH 2P5WA 2NY1D 3MC0A 3QUHA 4JM4L 1HILA 5IG7A 4WW2B 4OFPA 4HEPA 4XPHL 1U8CA 3TBWA 2WZAA 2YPLD 4B7LA 2YS4A 4JPSA 3Q2CA 4PWKA 5F0PB 1X9UA 3QNXB 1YPZA 3NG5A 2MRYA 5GHWL 3OKDB 3TL5A 3R0NA 3WHE1 2J4WL 4TTDD 1Z9SB 5EC2B 2CA4A 1CF8L 1HCFX 3MRHB 5CFHA 3KWVA 4BYHA 1TTRA 1P7QD 2H1XA 2W60A 4GMSL 4X99B 3LCYA 2JIXB 4NC0B 5T3XL 3QQ3A 3AW5A 2KZ1B 4MAYC 2ZICA 1IEAB 4NJ9L 4YSDA 4YSQA 1NMAL 4PRPD 4F7EB 4YQXL 5FHBH 1ETZB 1OAQH 4KXZH 2VDMB 5HGAB 4X83A 3WS3B 1BEYL 1S9XB 1NC2A 4FQXC 4XZUB 3LKRB 2PETA 5HVGB 4LNRA 4PR5B 2NQCA 2A77L 4X5XA 4DQAA 4Y7OC 2ZXQA 1EVUA 4MA3A 5CZXD 4TRPL 1OSYA 4PS3A 4DT2A 1WS7A 4PGZA 4HJTA 4AZ8B 4OJYA 3T65B 5GZNC 5I1IL 5AW8B 3JZ7A 4KTDH 1OAKL 1OHQA 4JN2B 3UZEC 3EDEA 1IVTA 1HTYA 5CAYB 1QMUA 2G75B 2A7BA 2PPAA 1JGDB 2JTDA 5LBSL 3EFOB 5TDPA 1V3MA 5KTEH 3ZE0E 4OJFH 1BFSA 4PJGE 1N5YL 4WWNA 1OM9A 4PJHB 3D09A 2HT4D 3ESUF 3SPJA 5GRVL 3RURA 4ZTEA 3WY3A 3IF1B 4XP5L 4DO6A 2ZG3A 1JXDA 3I84A 1KIRA 5ISZD 4TNFA 1M9WA 2VQ1B 1FVCA 2R59A 5ILTL 3MR9A 2ZUWA 5A2FA 4AENB 5I8OL 3MLYL 3TBVA 4G6FB 5J3HD 2KKQA 5CJOL 4ZAKB 3ZIMA 5C7XH 4D8PB 3KWWB 5EBWB 4P5TD 1YNTA 4PVLA 5D2LF 3H42L 2O5XH 3PWPB 4HT1L 3U2SA 4DP1X 2DM7A 2BHUA 2Y5TA 1TQCC 3EYFA 4FXTA 4MJ4A 1EJOL 2VR8A 3FQ2A 1R5VB 2P52A 4HD9A 3EH2A 4FZ8L 4JO2H 1W0WB 3HFFA 3LRGA 5EA0H 4L29B 3LNGA 3CN0A 3ELAT 1OCRB 2CGRL 4WDIA 3TH4T 5JIQA 5JIPA 5A7EA 5F1IB 5LGYA 1N18A 2IPKA 4GRLD 5I8KH 1IAOA 2R0WL 3ROOA 1SFHA 5B7FA 3BWAB 4FMFA 3MLXH 4PGCA 4O2CA 2Y07H 1DEDA 1INQB 1Y18B 1CURA 1KYOJ 2ZP0T 4JHAL 3QEQB 2GB2A 4PGBA 1O7DE 1XB3A 2RHEA 3MLSH 2K7QA 2L0DA 2X4UB 4PS8A 5ESQA 3T3MB 3VYOA 1FIEA 2H2PD 2AEQH 5DQJB 4F33A 2EE6A 9CGTA 1B90A 1PVHA 4RESB 2A9MH 1I9IH 5BS0D 2J2ZA 3DUHA 4UZGA 1G43A 3ETSA 4Z3JA 2XHNA 2R2EB 5MI0C 1EXUA 2DM3A 3FB7A 2AERT 2EXWD 4AJVA 2G9HB 1RJYB 1VGKA 3STLA 1OZUA 5C09B 2VOTA 1A9BA 1MCQA 2XZZA 3K2IA 3MRNB 4JDTL 4PWHA 4XC3H 2ROXA 3FU9A 4QKTA 3TEXA 3ZTJH 2QVFB 3HN3A 1PX8A 4M4RB 5ECJE 3H2PA 4XX5A 2YA1A 1TFPA 1HSBB 2XIBA 4RMTA 2E9IA 5DRXA 3BDYL 3UJIL 1SNRA 2F19H 3S35H 3A6BL 2WNKA 4XP1H 5E9AA 3GJFK 1UD8A 4M3JA 3TC9A 1N3NB 1OD7A 4K9EH 1FZKA 2WNGA 1MWAA 3DXAE 3I74A 1BG9A 3GSVA 4KOCA 3TIDB 5LNGA 5C07B 1BIHA 1NCBL 2VDMH 4BSVA 4XTRC 1UZ8A 1ZLSL 1QSZA 5CU9A 4O02A 5D7IA 4K3HA 5HHXH 1KCVH 2ED6A 4MMZB 1DQML 4H88H 4NSKA 3TO4D 2ZOKA 1JGLL 1NPJA 3WE6B 5EEVA 1I1AA 1NWOA 1E9QB 1T4WA 5KZCD 3BMWA 3QJRB 1OWRM 2X12A 3ALPA 2BWDA 1EUTA 3NFNB 3QORB 3CMGA 2BFVH 1BQSA 1JIBA 2E7DA 3C6LC 3MA9L 1FIGH 1HHJA 4QLRA 1R24B 2CKBH 4BBWA 1IB5A 3EUUA 3QZWG 5E1AA 1FP5A 2JJTA 5D1QA 1ZSDB 3ARFB 3V0WL 4KUCF 2X28A 2WB1A 4NQVA 4C57C 4NNYB 1NANH 3CDFA 3PF2A 3F8UB 5IUCA 1ZT7B 3CPLB 4AEIH 5IMLA 5JHBA 2WLLA 1AS6A 1VHPA 4X4XA 3ULUF 2ATAA 3LXCA 1GW0A 1LK2A 5F9JA 3ABZA 3AXLA 4X6EB 3T6VA 3DTUB 1FO0L 5J0BA 2VLRA 3FN0L 3N40F 4D9QE 1SXZA 1N0LA 2Y23A 1F11A 1JP5A 5HD8C 3BGFB 2EH8L 1MCEA 3OG6B 4O2FB 3T6WA 3HB3B 1C9SA 2COVD 4ORGA 3IXTB 1ECYA 1LMIA 4UNUA 2XX0A 2J88L 1KPVB 1NBYB 4G5AA 5TF1L 3U25A 2FSEA 3C5ZB 3RL1B 1JWSB 2FX7H 4ONFH 1E4KA 4V1DE 4C58B 3WN5B 5EU4A 3II1A 3TBSB 1WO2A 5I1EL 4Y9FA 5KN5A 3CMOL 3O2VH 4H8PA 1LTXA 3OX8A 2ITFA 3QUZD 4WI8A 2WMPB 4QR7A 1QHOA 4G8EB 5JHDA 4FQQA 2P4AB 1EO8H 4WWKD 4NHUB 1SEBB 4GKZA 4FQ2H 3V0JA 2YUWA 3DX8A 5HHMB 2X1XR 2BNQE 3KS0J 4KJPC 4XCEB 3DX2A 3ES6B 4DCQB 2BK8A 3N6YA 1TTGA 4K5NA 4NQEB 3WNJA 4HDIA 5CGYC 4U7KA 3EG9B 2JV6A 3QQXA 3IFNL 4Z95L 1F8TH 1RZKL 1FNFA 3WAKA 5HBBA 5IMOA 3QYCA 4KKBC 1INEH 4LKXA 3C5SA 1E4WL 4HGKC 4OJDH 5HHVL 3QUGA 1HE7A 2Q1EA 4H2AA 3UBXI 1R3HA 1W0VB 4OIIL 2XTJE 4Z8FH 1WFMA 2R2BA 5CUSL 3O4LB 1U2YA 1KPRA 2V7HB 2Q7NA 2NTFB 1E4XH 1TR7A 4RQQB 1ZVSA 1PSKH 3VMPA 1EHXA 3FQUA 4FMVA 2QELA 1S3KH 2BY1A 1HNFA 4K8RC 4AW7A 1IAIH 4HAGA 1B4TA 4ABVA 3P0YH 3MODL 2ED8A 3VFNB 4E9VA 4R83A 2E8ZA 4NZDA 1HCYA 4DVRH 3WO3B 3AAZA 1CDCA 4JRFA 4HX1A 2WXQA 3HZ3A 4P2QD 1AE6H 1I8IB 3MXVL 3NFSH 1IQWL 1I8UA 3GXDA 1CYXA 1DTUA 3NABH 4WWPA 3SHSA 2J57A 4AW4A 4CC4C 4LGRB 4WW2A 2DMHA 2LLGA 3H54A 1MNNA 1QTYT 2L4OA 5C0BD 4ZZKA 2QGEA 3GO1H 4Y2OB 1WA0X 4OZ4B 2WZ6A 2CRZA 3OKDA 1D2PA 4Z3HA 1Z9SA 5EC2A 1I1CA 1QBLH 2RALA 3MRHA 4PGEA 1BV8A 3AY2A 4XO9A 3U1QA 2AJYH 1PYWB 1WTGT 4AQ1B 1KGXA 3QG7H 4X99A 2JIXA 4WUKL 2B2XH 4JM2C 3D0LB 2ZUVA 4XNYL 1IEAA 3TPUB 4BINA 2DQMA 3WFEL 2GJ6E 4WJKB 3CFBB 4I18B 1JWMB 5D72L 5HGAA 8PAZA 4NCC1 3U0PB 4F20A 4YR6B 4XZUA 3P9LB 3LKRA 3FU7B 3V8CA 1XF4B 4PR5A 5E8OA 4YHYB 5CS7A 3PWUB 2EECA 5BUPA 2DBLL 1JPSH 3ABLB 4EN3D 1I8MB 1IFRA 1CTMA 2BP0B 4I3RH 4NQXB 3T65A 4ATTA 1H3GA 4AZ8A 4F92B 1NIEA 5E2TH 4PFEA 2VDPL 4WEMB 4JN2A 2DF3A 2G75A 4P9HC 1JGDA 2B1AH 2CKBA 4PB0H 2AHIA 3EFOA 1SXCA 1E9OB 2JLPA 1J0JA 2CKNA 4HIEB 4ALAH 1BXVA 2YQGA 3M7OA 4MJJA 4OI8A 2JCWA 5JR1H 3ML9A 1T7YA 4ZMPA 3IF1A 2R2HA 3ECWA 4ZMAT 3FFOA 3ZRFC 2G3NA 4YBLC 1PY9A 2VQ1A 5D6DA 3TTSA 4U2YA 3M8OH 4AENA 5HY9B 1EDQA 2FGZA 5F71A 3THML 5A40E 5GS2H 3V6BR 3F7YA 1K4CB 1QBML 4HZ1A 5C2BL 1KPUB 3BT2L 4J3VA 2OMZB 3T2PA 1CVRA 4WHYH 3KWWA 5EBWA 5ACMA 4D8PA 5FO9B 3PWPA 5FUOH 4TULH 5DQDL 1T03L 4I9WE 3SKJL 2UUDK 1XEDA 1BQLL 3O2DH 4HALA 1NIAA 3FK3A 3WIFA 1R5VA 1K5WA 4GJTB 1W0WA 3VTTA 2V2XB 3VFRB 3UH8A 2N59A 2X2YA 1WAAE 2DTSA 5F1IA 2EUVA 2ZJSH 3EYVB 2GW5A 1Q1PA 1Q1JL 3TZVB 1HESA 4BUQA 2YAMA 2DLTA 4KMQA 4Y1AE 1GJUA 1LM8V 1CXHA 1OAUL 1NL0L 1BQRA 1Y18A 1INQA 3OB0H 3ASWA 4S1DD 4X8JB 2Z7ZA 3FCGA 3QEQA 4U1LB 5TD4A 4G8GE 2BPBA 2F15A 2D4FA 2X4UA 4Z7QF 3RG1C 5DD3H 1MDAA 2QPFA 4OD1H 1IQDA 4WU5B 5L0QB 5DQJA 3T77B 5LVEA 3RWEB 3MNWA 1ZLUH 4F9LC 2X9XA 1U58B 1Y6NR 2A6KB 2KZKA 2NY4D 4TLKA 2OYLA 4A7VA 4BFEA 1KGCE 2Y2TA 5DMIH 4C56B 3VFSB 1D2OA 4QRAA 4Z9KB 1MFEH 2R2EA 3SO3C 3C8DA 4A6YH 4KQ4L 4M9PA 3QZPA 5HDBB 2G9HA 2WNWA 1RJYA 3AUVA 5C09A 2UYLB 3MRNA 1I9EA 1DVFD 1RLBA 4RZCB 4RMSA 5HYQA 4QYOB 5E8NB 1OHZA 1KJ3H 2BW5A 4MDJB 3DROB 5FYKH 4RFEB 4TSAL 3G6JE 1X5XA 5BPPA 2C7UB 1PG7L 1VFBB 3OV6A 1I9RH 3FONA 1UA7A 3BZEB 2V4LA 1QRNE 4KO7A 5IHUH 4RBPK 2I24N 4IIQC 4NWUH 3NCYS 4ICXA 5HPMB 2J7LA 1N3NA 3L3DB 2NY1C 2N01B 1JNLH 3BP6B 3TIDA 2WVTA 5C07A 4IOFD 3BAEL 3ZDZE 2AJSH 2IWFA 1JPGB 5D2NB 3FAWA 4LAJH 4LXFA 4EIGB 4ETYA 4AMXA 4PJAB 1ZHBB 3B9KB 3QFDB 1RIUH 2BP8B 5D1XE 1KFAL 1K8IA 4GAJL 1UJ3C 3KH3A 2C3GA 2VO8A 1YPZF 1SOSA 2DDQH 5F7KC 2GY5A 3U2JA 4Q9CA 4PJCE 2ZWNA 1AP2B 4AYGA 1R24A 4OCXH 1BHGA 2P7TB 4MSWB 3NA4A 4M03A 3WNKA 1UOKA 1ZSDA 3ARFA 3LJ3A 5IOPB 4QIRA 1A14L 3QNYA 5GGVY 4JFEB 4A67A 1EO5A 4NNYA 4JMXA 5PAZA 1DVXA 4ONHB 2XPGB 3CPLA 3CLWA 3UEZA 4G7VH 5ECGA 1DO5A 1SHXA 3B2MA 3W9EB 1X3DA 5MEND 5B3JF 1F4YL 2FBJH 4X6EA 4KITB 3LDBC 1XGTA 1YMME 3FCTB 1TIUA 1YDPB 4W9GC 1J8KA 4W4OA 1N7MH 1X7QB 3GKWH 3WFDH 3N9GL 4ZFGH 4MLIA 4N8VB 2YPVH 1BMZA 5JHAA 1BF5A 2J21A 1TJHL 2XQYA 3TVMC 3N41F 1JF5A 4ABWA 3AXIA 2CRMA 4WI0B 1M7DB 3UYPA 3EUDA 1D7CA 4OZGE 3KH4A 1S7UB 1KPVA 1NBYA 3DMMD 4IRSD 1NMCB 3C5ZA 3RL1A 1JWSA 3S5LB 3QUKA 3BWSA 4DGYH 5SX5H 3TBSA 4F15B 2DWSA 1CBJA 3H2QA 5A43C 2WMPA 5E9DA 5BV7L 4G8EA 4K7PY 4DO4A 4HUVB 4N90E 5ITBL 3SYPA 4N2EA 4NHUA 1AHKA 1SEBA 3LH9A 2WXGA 1QW8A 3ZR6A 4RGNC 1UWEL 1U3HB 3KYOA 3ILEA 2ADIB 3CZFB 3ES6A 3V7AE 4DCQA 2P9RA 1YNTF 1YQVL 4N2OA 5H2BB 1QFOA 1R46A 3ARBD 4NQEA 3RWGB 3UAFA 3MLWL 3EG9A 1UD5A 3O2DA 3S3SA 3G5ZB 4IK7A 4FKEA 3VD0A 2FUTA 5EIIB 3FT4B 1A22B 1PEWA 4F8LA 1JPEA 4RA0C 1WCBB 4G6MH 3O8XD 2IOOA 4HS8H 4L1HA 2P26A 1W0VA 3LRLA 1ZA6B 1HJBC 3GLEA 3IPFA 2X1QA 3QISA 1SJXA 3DC0A 1WRFA 1IGFL 3O4LA 4R4FH 1HQ4B 3L3OC 4BA0A 1W72L 2V7HA 2Q7YB 3ZT6A 3L5HA 3AACA 2NTFA 3BEWB 1GC1H 1ASOA 1J5OL 4RQQA 3QIWD 1IUZA 4N1EA 3NJKA 3TV8A 4BELD 2YBRB 2ADYA 2AQNA 4P2RE 4GS7C 1OGPA 1IBZA 3SB3A 3ZYOA 4ZFFB 2OLDA 3IRCA 2V37A 2XX1A 3D3VB 3ZW3A 3ULUL 2OAAA 5I9QC 3VFNA 4FNPA 4Z23A 5IEHB 5FAAA 2Y69B 1SOXA 1NAML 2EXWC 5CHNB 2WN3A 4AIXA 3MHZA 2IADB 4YGVB 1KCLA 2IAMC 3ILPA 1I8IA 5DUML 4D94A 1BZ7B 2BY2A 4A6YA 3CU7A 1AQ8A 1BW8A 4F7TB 3VDBA 2XWBA 5DHDA 1MLBB 4A7QA 4ODBD 4JRWA 1J8SA 4Y2OA 1IGCH 1CG9B 1QA9B 4OZ4A 1P69B 3S34L 2YD5A 1B9KA 2DM2A 2UY7A 3LN4B 4MDRA 1MIML 1XF3B 3BKML 1PYWA 2BZDA 4AQ1A 3SOBL 1ZAGA 4OQTH 3D48R 2ZOTA 2YQ2A 3TA3A 1PG7W 3TEUA 5BOJA 1OE1A 2YKKA 4WF7A 4JFPB 1JGUH 5MEPB 3TPUA 3G6DH 5A7BA 4ZS6D 1IE4A 3QXVA 3RIAK 1V8HA 5I1LB 3FTWA 4PLNC 3CFBA 4I18A 1HEZB 3K7UA 2W94A 3QCTL 3U0WH 3R18A 1RH8A 3JV6B 2QQLH 1N0XH 1XF4A 2OP4H 4NKOB 3LMJL 4QRPA 3UZVB 3F2LA 1CGTA 7CGTA 2CBTA 3MZGB 3PWUA 1KLGB 1GJWA 1YNKL 2A4EA 5GSRB 4B27A 1I8MA 4NQXA 2BP0A 2EC8A 4S0HA 5GGUB 2DLGA 3IPBA 3RZCB 5AVQB 4P59H 4IEFB 3KWXA 4PMEA 2D7QA 2L7EA 3E3QE 4KNSA 1N6UA 4G1EB 2ZOWA 4KK6C 1E9OA 4YWGH 1BZQK 2JI3A 1MCDA 2ZSVB 1BQUA 4TSCL 3OWRA 5CBAB 2WW8A 2DYSB 2RQ8A 3AFLA 5LJYH 3LRKA 4YHOH 2LT9A 3A67H 4NZTH 4UTAL 2WP3T 1TSRA 2ALWA 2NDFA 4LP8A 1IARB 4UOW0 2FCBA 1Q72H 1GL4B 2MHAA 4HK0B 4WWOA 4CBPA 5JA9A 4GXUM 2VLJD 5HY9A 4ODVH 3ZDYB 2YWZA 3AU0A 1K4CA 5AAMA 1KPUA 4JPKL 5F7AA 2OMZA 3II2A 5HJGA 4JUTA 1GYWA 3E6FB 5FO9A 4CW1B 4ZNEE 1PZUB 2YPVA 3EH3B 1AHWC 3ARED 4C4KO 3BHBB 1W80A 4F8TA 2E74C 5T3ZH 4HUXB 3T2NL 2N4IA 2BLFA 1AKJD 2ERJC 4YE4L 3SQBB 1PZAA 4NFBA 5CEZE 3QUZC 3VFRA 4GRLB 4B9CA 3EJUA 2VUYA 4WWKC 3X2QB 2OL3B 3EYVA 2ZUTA 3X1BA 3DX3A 1BA9A 3OAYH 3ZL1A 1JRHL 3TZVA 3HNTH 1M6OB 3D05A 1Z3RA 4BKTC 1X5AA 4X8JA 4NN5C 3Q6FB 3BAKA 2J5LC 2OW7A 3WSQL 2X6VA 5DFAA 1CU4H 1ZSHA 4FTVB 1LWRA 4OFQA 1JZJA 2ATPB 2H45A 3LQAH 1I8LA 5JMRA 1FC1A 1RZIB 5KS9B 3LEXB 3T77A 1BOYA 1E6JL 4FNLL 1U58A 5E2JA 2A6KA 4DGVL 1G9HA 3NIFE 4OCSH 5IT2H 5LLIC 1A4JB 4BJLA 4C56A 3VFSA 5HYSG 1PKOA 4FNRA 4GG8A 5DVNA 2DIJA 2VXQH 1NCDH 2HP4A 1LDPH 4HQQH 1H8NA 3KPQB 4S0TD 4LDCA 3TV3H 5HI4D 3AS3A 4GINA 1NFDF 5DXWA 3FHQA 3V4UL 3KYKL 2UYLA 3F83A 3PHQB 3S35X 1H19A 4P48A 4QYOA 1TZIB 3Q1EA 3F58H 2X6MA 3MRGB 5E8NA 3SDCB 5CCKH 1KTKE 4MNQD 3DROA 4RFEA 1HDMB 2NSXA 2C7UA 3F7QA 3WY2A 1VFBA 5C8JB 3BZEA 1NWPA 1MIEL 5I1HH 4JPVH 1ROWA 3GXFA 3KPPB 1JL8A 1FYTB 5HPMA 2PLTA 3IDYB 2Y0SA 5I66A 1ODUA 1NCWL 3LVEA 2OJZL 3BP6A 1BBDL 2EDBA 3BVWA 2XWXA 1JPGA 5D2NA 3TO4B 4NN6B 4QRRE 4PJAA 3BVTA 3QAZC 1AMXA 2BSSA 2NLJB 3B9KA 2B4CC 3ESPA 3QFDA 4WW2F 2BP8A 2Y3AA 4KBPA 1N59B 1MCWW 1NKOA 4ANKA 3JQOB 2UY6B 2WQ8A 3IJ7A 1RLWA 1AP2A 3CVCA 4I88A 4JK0D 3OKNA 1UFUA 1C12B 3I9AA 4KKAD 4MSWA 3ULVF 4J8RB 3GNMH 1IZJA 5BVPL 2A9DA 4MX7B 4YLCA 3Q06A 2FK9A 3G6AB 4JFEA 4OQTA 4M4PA 5J89A 1GGUA 5CMAA 4NO2B 1JI1A 1Q0YH 1CICC 1JDAA 4HXAL 4ONHA 2XPGA 4AMKH 2F7QA 5LAXB 3T8VA 1D5BB 2IH8A 1IEHA 3RYMA 1NJ9B 2CUHA 4PV1C 1XH2A 3W9EA 4ZW3A 2ZCKL 4EN3C 4NB7A 5MHSE 1FZMB 2Q9OA 3FCTA 1Y1DA 4LB8A 1YDPA 4YHKL 1J7VR 5BZXA 4APXA 1X7QA 3T04D 1X5LA 3IDJB 4N8VA 3SYCA 3AU1B 1JGIA 4H0LC 5AALA 1ITBB 3KNBA 5ANMB 1FFPB 4V11A 4R7LA 4WI0A 1M7DA 1EX0A 1VEMA 4CJ1A 3F12B 3HR6A 2EAEA 3K0YA 3PAZA 1S7UA 1URLA 3DXAD 1XSOA 2EDWA 4KY1L 5M95B 3IAQA 3S5LA 1GY2A 1M56B 1X7SA 4K71C 2AITA 2YMXL 1HVXA 4F2ME 1JZ6A 4PJEF 2LVEA 3AG2B 4JHZA 1A21A 4MNGE 4LDLB 2FWLB 4M1CD 5I26A 3S8FB 4G70B 2XN9B 5JA8B 4M43H 2BINA 5EIVA 4QHMB 1D5MB 3UIZA 4AL8H 3LIZL 4Y4FD 4WJG3 2XQ0A 4KDTC 3QQNA 1RK0B 3D18B 2ZX7A 4QI3A 2ADIA 3BJLA 3CZFA 3T09A 5H2BA 1FL6B 1JYXA 1SN0A 4FI6A 3VRLE 3G5ZA 1AI1H 3JUZA 4U7SA 4XHJD 3CV5A 3FH5A 4P9ML 4PJ6A 5EIIA 3ZYJA 4XE5B 1NIDA 3CUPA 4J7RA 2P42B 3FMGH 4PJ9B 4S11A 4N8UA 1UYWL 5CEYB 3MRBB 3RPIB 3B9EA 2DAVA 5AENA 4P0DA 4HHWA 1WCBA 2B1HL 4F5CA 5D93C 3P0GB 4KTYA 2YD6A 1TQTA 4LVOC 2X4QB 4G9FB 4WHCA 2Q8BL 1QAWA 4QDGA 3R8QA 2NUPB 1HQ4A 3CC1A 4U6XB 2Q7YA 5ADOL 5KG9B 4OR1A 3BEWA 2YXWA 2YBRA 5I0DA 3CZNA 1O9VA 2HFTA 2NY4C 4ZFFA 2ADFH 2YMOA 1UEYA 3GWJA 5E99L 2MCPH 4HGMA 3GSUB 5IEHA 4P2QB 5F2FA 4W6WB 4JHVA 3WJLA 1OPOA 5CHNA 2IADA 4YGVA 1NKRA 4N0CD 2K8QA 2J43A 3WIIH 4Q9RL 4N28A 2Z8WC 5D7JD 4AK2A 1BZ7A 2VXQA 3CFJB 4MDIB 1FNAA 4DQOH 2VZUA 2XDHA 4K5PA 4F7TA 3TEZA 2EDFA 5KSAA 5EIQA 2B0SH 3N06B 3DARA 2CLVB 4HIHB 3RTQA 1S9KC 1MLBA 2HVKB 1IFHL 4HFWB 2Z64C 2BNQD 3O41B 4UT9H 1S78C 1CG9A 4HGWB 2QSTA 1MJ7L 3BQUC 3UYOD 4LZKA 1QHQA 1U3ZA 3HNVL 3LN4A 2R1WA 5F44A 1XF3A 3QDJE 4RMBA 1TZGH 4UIKH 2EH7H 2VZ3A 2HG5B 4DKEL 4IOFC 1OVZA 1R34A 4LPTA 1CLOL 4JRYB 3O9WB 4PIBA 4JFPA 2CUMA 3KEDA 5EUOB 5FECB 5MEPA 1MG2C 4QHPA 2JXMB 3ALWA 3B7UX 2GHWB 3JBG7 3NSFA 4L3EA 2XYCA 4WY7L 2WGXA 1KTDB 2PABA 4KXBA 4Y89A 2FHBA 2UZXB 1GSMA 4MVBD 4XN4A 3JV6A 1N6QL 3V52H 4NKOA 3UZVA 4ZUSA 2BSBA 1DJHA 4GQ9L 5H8DA 4B9KC 1KLGA 5GSRA 4N0YL 1CO1A 1T4KA 4R7VA 1FYHB 4MQ7A 2CJUL 1X44A 2WUBH 2Q6WA 1NZRA 3RZCA 5IP4A 4IEFA 2FH8A 4NQCD 1MFMA 4UM9D 5BRPA 4G1EA 5FFLA 4X9YA 3L54A 1VSCA 1J0KA 1H6EA 3QUMB 3MNVB 2ETWA 2XA3A 4OZIB 2ZSVA 5HTSA 4Z7OB 5CBAA 5CN3A 1DVZA 2WBXA 3QCUH 1FVDA 3L1OH 2APVA 2MMXA 2O6CA 4OD2B 3EDDA 5IBTL 4DOHB 5C0AE 1ASPA 2VSDA 5GGRA 3PPSA 4HK0A 4UQ9A 5CJ5A 2QMJA 2LU5A 2F18A 1ZLDA 4PUBH 5F9DC 4LPWA 2OYPA 5JW4Q 3CSPA 4APQB 3BLPX 1HT6A 1U8PB 2XWZA 1UM6L 2EIMB 3V9EA 4M6NH 3FSWA 3SEPA 2BVOA 2Q3AA 3GQFA 3E6FA 4AM0B 1GTFA 5FGCE 4F58H 4NUGH 3WFBH 1NGQH 3BHBA 2EUZA 3BOVA 3O6LL 4JFQB 2GQHA 4HUXA 1BYPA 3K2UH 4NRZA 5I5JA 4R2GD 1A6WL 3P2BA 4WI2A 3SQBA 4YSPA 3OMIB 4GRLA 5DDHB 1FNSH 3U30C 4D3CH 1AZCA 2FJHB 3IFOA 2GJ6D 4ZDHA 5AW5B 3V2AR 3VG9B 5FK9B 1XB6A 1M6OA 1H8LA 1QYGL 2MNWA 3D2TA 2VKWA 5ESVB 4I3GA 5FW7A 4B50A 1A6ZB 4M5TA 2YKLH 2VWEC 3Q6FA 4XN8A 1P84J 2G4EA 4FTVA 2ATPA 2CHNA 1MWAL 3JSSA 3NJHA 1VKXA 2DS4A 4HAFA 1XSJA 1RZIA 5KS9A 3LEXA 4YAQB 2ZYRA 1ACXA 4TUKL 3HI5H 2WO3B 2WXKA 4KV5E 4O02L 4YH6A 5K9JL 4RGOL 4YC2B 3O8XC 4KZDL 1A4JA 1OT2A 4DGUA 3JUYA 4JFXA 3SCMA 3FZUD 5JW4M 1S8DB 3KPQA 1IM3B 4BQBA 1DVFB 4QXTB 3TTYA 3DSNB 3CQQA 4R3SA 4Z7WB 4EUPB 4DTGH 3LZLA 1UT9A 3ZKMD 4Z7NF 3MV01 2P1YA 3JWNE 4RISH 3QR0A 3HAEG 4YHZH 3Q2WA 1TZIA 4L8SB 3MRGA 4BFBD 4CADB 3SDCA 1IGIH 1NCTA 2V5YA 3QFJE 5TGBB 1TO5A 1HDMA 1MFNA 2VDKB 3O6FC 3DVIA 5D5MB 1SDAB 4FFZH 3PWVA 4LPXA 4PJFE 4MXWH 3TIEA 5C8JA 3LNIA 5FHBL 1OAQL 3EXLA 1U36A 5GRVK 3KLSA 1NCIA 2MEJB 3KPPA 4PHXA 1CYWA 1FYTA 2WZ5A 4PREB 5LN4A 2R0ZH 2HMID 5GPRA 5E2UH 2GPZA 4Y9EA 1Y1UA 1MH5B 3EAKA 4LARH 3LX9A 3QXUA 1AACA 1DL7H 3BUQA 4D9RE 1B0RB 4KTDL 2JMRA 4ZUWB 3CHOA 2NLJA 1D9KC 2A2QT 5GXBB 3WLBA 5JYLA 5E5LA 4X5LA 4G8GD 1N59A 5J11C 5KTEL 4FLSA 2NQDA 4OJFL 4UT9A 4UUJB 2F53E 4B96A 2UY6A 1WWWX 4DN4L 1UWFA 1XIWC 5AWNH 4OZFB 4BQ9A 1C12A 1AFVH 3OQRA 4ZS6C 4C55A 5IR1B 4MX7A 3OZLA 3H4HA 4PG2C 3SBPA 3G6AA 3ZHDA 2J6WA 1LLAA 2YIHA 4XBMA 5FXCH 4W9EC 3MUUA 2AXGB 3WS6C 4WFED 5LAXA 5C08E 1EUUA 4WKXA 3EOAB 3EFFB 3D52A 1NJ9A 1EA9C 4KJQD 4PVNA 5C7XL 4YVUA 3M88A 3QO1A 2WXJA 2O5XL 4OCYH 1YEGH 1T2JA 2AXFB 4GMTH 3FCBA 1QTPA 1AO7B 3HMXA 1E27B 1MW1A 5DZAA 3IDJA 4G42B 4JO2L 2FLBT 5DLMH 1OSEA 2Y1VA 5EA0L 3AU1A 1AQMA 4KTEH 5D96C 5ANMA 5DEJA 1BFOB 4IQHA 1X6LA 2Z93B 3DMMB 4IRSB 3F12A 5I8KL 5ICZB 3NDYE 3MLXL 1HHIB 3QR2A 2YQBA 2H47C 3IJHB 2Y07L 5J12B 2WJ7A 2QZQA 2M83A 1PDKA 2I32A 2ICWB 1TJGH 4UZSA 2EXYD 1QATA 2YAEA 3MLSL 2CHXA 5EOTB 1KB9K 3UTSD 4ADJA 5DD0H 5EPMB 2XN9A 4HUUB 4Y5VB 1X7TA 5D1XD 5F88B 2AEQL 4PWJA 4QHMA 1D5MA 2O61B 3B2UD 4L2YA 3AREC 3LNDA 2A9ML 3SGDI 1I9IL 1SBSH 5F9AC 2YAPA 4FQ1H 2JI1A 1RK0A 3ARBB 3D18A 4Z7AA 3MACH 3ZE2F 2NDGA 1JMZA 1RJCA 4LLMB 1FL6A 5AW9B 4P5KB 5FO2A 5B1KA 4R7NB 2G5RA 3F84A 3LKPB 1F2XK 3TCXA 4HBCH 3IETB 1G6RB 5FO8A 1G87A 4PJ9A 4XC3L 5CEYA 4K3GA 4PLJD 4Y16C 3RPIA 4A1RA 5D4HA 2C9VA 2K0RA 4EUPH 3L5XH 3RWIA 2VLKB 2ISDA 4G9FA 5EOCH 2O93L 3RP1A 5FV2A 3QIWB 3QUYB 1YMMD 2NUPA 2F19L 3D2UD 3S35L 4U6XA 5KG9A 2GJJA 1TG8A 4XP1L 5T1KB 1FRGH 2VDKH 3A6CH 1OB1B 4K55A 2WCPA 5FKAB 3BUPA 4K9EL 1ILUA 4FN0A 4M8UA 1U9KA 5T3XD 2Z65C 4GSQA 4JGJA 1R3JB 5KYXB 2VDML 5FA4B 2HH0H 3SE4A 2DWXA 4JY5H 2VR4A 3GSUA 3HN5A 5EO1B 4XPAH 5HHXL 1X5JA 5HI4C 1KCVL 5CM1A 4LLWB 4H88L 4ZSOB 4NGHH 2CBMA 5AKTA 4MDIA 4HJSA 3NCJH 4OLVH 3ULSB 4N90D 5B38G 2AKRB 2FDBP 3KMDA 3UABA 3MLUH 2BFVL 1ZV2A 2CLVA 1YC7A 4HIHA 1FIGL 3BZ4B 5C6TH 2CKBL 2E4FA 4HFWA 3HMWH 3O41A 3Q7JA 4FZEH 4AY0A 1TTCA 4HWNA 3H9YA 4MD4B 1MCPH 4A7SA 1ZHLB 2XBZA 3S4SG 4WU7B 3EF7A 5ACLA 1QR4A 4OZFH 2K6YA 4CSZA 4YPJA 4AEIL 2XZCH 4FFZA 2ITDB 5KWYC 2XWDA 4PJ7B 2HG5A 4RRPG 3ZPDA 1REIA 4XMPH 4JHBA 4JRYA 3O9WA 3B4NA 2AQSA 5EUOA 5FECA 1AAJA 1YYMH 3AWEA 3S3JA 2JXMA 2NX5B 3K1DA 5CLTA 1K8DB 4HP5A 3WN6A 3O4OB 1KTDA 2Z91B 4OAWB 4Y88A 4PJAF 1ET5A 3JTSA 4L2LA 1UKSA 3TPKA 2C9UA 3ESVF 4UAHA 3E0GA 4H1LG 2CO3A 3HE7D 4WNJA 4P4KD 4WZ9A 4GG6B 2XC8A 2FX7L 3GJEB 4ONFL 1WBZB 2C1PA 3BYYA 1T5WB 3DX7A 3F5WA 3PXLA 2F08A 3O2VL 3MNVA 3QUMA 2XJLA 4OZIA 1U6AH 1AG6A 1ZJAA 3LPFA 7PAZA 3IMWA 1EO8L 2BJMH 1KJVB 2YSTA 3FCSB 4OD2A 2GBTA 4FQ2L 5F7YC 5F9WB 1DJWA 5A6MA 1X5HA 5DUJA 4G5ZH 1JHKH 3U6XS 1X5MA 2IH9A 1JD9A 1J1PH 3E9TA 1HHHB 1KGYE 5AOZA 4OCLC 4QTHA 4APQA 1U8PA 3LKOB 3S97C 5HYJE 2BXYA 1F8TL 2VITB 1CFNB 1I7ZA 4YHMH 3P3SA 4DUXA 1INEL 2CRYA 2WVVB 3WKMH 2NUTB 1A64A 1PZ5B 3ZL2A 3OPUA 1AKJB 5BQ7B 4EBQH 4JFQA 4FXLA 5IHBA 3UYRH 3L95A 4Z8FL 2G60H 4P2AA 4RGMB 3D8MA 5GRYA 5KBNC 3OHXA 5DDHA 4DP9X 2FJHA 1E4XL 2BSTB 5TFSH 2DQDH 1PSKL 2EE2A 3PWJB 4DPBX 5FK9A 1D5IH 1S3KL 3OAZK 1S7XB 1IAIL 3MV8E 2XCMC 4GO8A 4G83A 3P0YL 5ESVA 1A6ZA 4DVRL 3UOAB 3DWTA 3PWLB 4Y4HC 1ACYH 3TP4A 4OKVB 1ACCA 3O3UN 4LP5A 3ZE0B 4PJGB 1CD8A 2XVGA 1AE6L 4YAQA 4HEMA 5DRZB 3NFSL 1FGVL 1QFWM 4KO6A 1NPNA 2ZUSA 5CD5C 3NABL 3HRZC 2APTA 4XVUD 3DGDA 2KI6A 1WT5A 5E95B 2X09A 3J07A 4FFWC 1ZK9A 1BD2D 4QLWA 2Q0ZX 1BZDA 1S8DA 3BPLC 1IM3A 3EJQA 3W5MA 3HUJB 4DZBB 4QXTA 4NDMB 2XA8H 3DSNA 2EDQA 4EUPA 3IMBA 2Z3FA 1H3XA 3FU5A 1O7SA 4XT1C 1SJHB 1QBLL 4XXCC 1QUPA 4CDGC 2AJYL 3QDHA 4L8SA 4TNWK 3QG7L 4CADA 1M9SA 3FT9A 5TGBA 2B2XL 3VWJD 2HRHA 4J3TA 4EKXA 4MQSB 2F1AA 1MJJB 3VXUE 4DKAA 4N0CC 1DVSA 1K6QH 5FHAH 2ZNXA 3MLPA 3IMUA 3ARXA 3QWRD 3FQ1A 4MYWB 4NNPH 5I75B 1EPFA 4PREA 4FEMA 4WNSA 1HOEA 1PZDA 5IVZA 5HYSB 1N10A 4KZ0A 1JPSL 1MH5A 3DX4A 3JVGC 3P77B 4I3RL 2ED7A 2FQFA 3Q0HA 1B0RA 1LEKB 4ZPTA 5E2TL 3UBXG 2CJ3A 2N1TE 1R9FA 2VJXA 2AEWA 4I1NB 2B1AL 4PB0L 5K93A 1XXDC 2W95A 4CU7A 4JQXA 4UUJA 4ALAL 2GABA 1OEZW 5HHOD 3TM6A 4ICWA 1ULVA 2ZYHA 5JR1L 1WH0A 2ZQKA 4OZFA 1HIMH 2QVIA 4AVJA 3TBYB 4MJHA 5B3JE 25C8H 2XPZA 3CFCH 2EADA 3APDA 4MJIB 5IR1A 1NOFA 1IBGH 1TETH 2AXGA 4LO9A 4MVBC 2AW2A 1BQHB 4JY4A 3LXUX 1KUMA 3EFFA 2WZPA 4DIXA 3ZUNC 1SBBA 2BS71 3BWUF 4UZUA 5F97E 5IB2B 4OCWH 3FU3A 5FUOL 3HCVB 4TULL 3CIQA 3O2DL 1DSFH 2AXFA 2ODHA 1TUPA 1AO7A 4TF4A 4G7QB 5DO2D 2UZPA 4AJ0A 2YR3A 3VFUB 2LU3A 4LSQH 4J3OG 4BK8A 4GSRA 2ZONA 4GOSA 1BFOA 1JXJA 4MXQD 2ZJSL 4E9LA 3WIHH 4J27A 4CVZB 5ICZA 2PP7A 1FNGB 4WO4C 5IQOA 4Y2DD 3UZQA 1U8NA 1HHIA 4FEIA 2OJ1A 1ETA1 5KJ4A 1SQMA 3IJHA 3D4YA 3EIFA 5ABDE 5KOVC 2ICWA 2WQRA 3VXPB 3RHWF 5C0ND 3CDYA 5EOTA 4PP1D 4L1TA 1CYGA 5DD3L 4CMMB 1YEDB 2OBGA 1PU0A 3DGCR 4OD1L 4FGMA 3ARDD 2DMCA 5EPMA 5F88A 1OP3H 3WJMA 1IL1B 3V0EA 4UANA 5CILH 4S0SD 1RZPA 2EEFA 5DMIL 3ARBA 2BIOA 2O30A 4WIQA 4R2GC 3O11B 4XX1G 5DZ9A 1MFEL 4G80B 2GJZB 4NJAH 1S7RB 4LLMA 3PNWB 3EHBD 4P5KA 4Q0XL 4R7NA 4A6YL 2IFGA 5GISH 3LKPA 3IETA 3MXWH 2BO0A 4HIJB 4XP9H 4J3OD 1E9PB 2QHRH 3B5GA 3E38A 5C0GB 1HSAB 3WMSA 2N3JA 2QLVB 1NGYB 4FYQA 5F72S 5K39B 2R29H 1M53A 3NZUA 3P3YA 1SOKA 1KJ3L 1CFTB 5IFAH 2VLKA 5FYKL 2HJKA 3C6SB 1L6XA 3QIWA 3QUYA 3VD7A 4L48A 1I9RL 5FFOA 4AKOA 2Y1ZA 4EOWH 2WM0A 4YDLB 2ZCZA 2CAKA 3AT8A 3O6KH 4GP8B 5T1KA 3WI9A 4CNIB 3GMPB 5IHUL 4RMRA 1AQHA 5GS0D 3BKJH 4NWUL 5FKAA 2JKWA 5D7HA 2J8OA 2VXTH 1N8ZA 1NMBH 1JNLL 4AZUA 4M7ZB 2LW3A 5IQMA 1R3JA 1ZS8B 5KYXA 2AJSL 2COQA 2VRKA 4M8QB 1CDYA 3FZUC 5FA4A 4ZNCD 4DPCX 4V1DB 5EO1A 3BJ91 5SWQB 3ARGD 4RDQF 4MMXB 4LLWA 1XH3B 5C0CE 4ZSOA 4FYSA 2BSED 1RIUL 3ZKMC 4IOSA 3VXNB 1VACA 1VENA 5AAWA 5AVRB 4JCWA 1TTFA 5CXPA 1J86A 3GPEA 3ULSA 2DDQL 2AKRA 2BNQB 4KXDA 1S6NA 4OI9A 3ZOAA 3BZ4A 4PJIE 3Q8AA 4OCXL 1QR1A 2EACA 3FJTA 4MZIA 4Y9BA 4MD4A 5L8LB 3OZKA 3OKKB 2O6PA 3BAJA 4WU7A 5HXMA 1C5CH 1PW3A 1FSKB 1R33A 4X7FC 4BH7B 3L1FA 1KULA 3SGJA 1MFBH 1HWHB 1O6SB 2ITDA 4FQHB 1ZVNA 2DKSA 4G7VL 1PAMA 4PJ7A 5J56B 5JUEH 1AGCB 4WI6A 4Q6YA 1DJSA 2XTJB 1QX1A 2FBJL 1MCIA 2YUZA 1CDIA 4KJYA 1T1XB 4M48H 3QUXA 1GGBH 2NX5A 2ENJA 1ZDQA 3G04B 2DLIA 1N7ML 3GKWL 1K8DA 3WFDL 1HXYB 5BCAA 4ZFGL 3SOTA 3CX5K 2YPVL 2D3VA 1JZDC 1RP9A 2Z91A 4OAWA 5KW9H 1EJFA 3D1MC 3NJJA 3QIUB 1HS6A 4ZODA 4YBQD 3MRIB 2KYIA 1HXKA 1OE2A 3GJEA 1WBZA 1T5WA 4DGYL 5FFGA 5GRUH 4GRWH 2VW6A 4LESA 3GXUB 1WISA 3MCYA 1I8KB 3VTAA 4C4KT 1KJVA 3FCSA 2CO7B 2HTLD 1KT2B 1F4WH 2NXZD 2V9RA 1F56A 1JE6A 3INOA 2OI9B 3UX9B 4P99A 4PCTA 3F7PC 1FL5B 3LRMA 3UPCA 1AGDB 1HINH 4NWTH 3MRLB 1CLYH 2K78A 5MP6H 4JFZH 5T8IA 3LY6A 5JLZB 2VITA 3WNOA 5I8CB 1CFNA 4YDZA 2WVVA 2FEEI 1H5BC 4LVHC 3UGUA 5JIMA 3KCPB 2NUTA 2ARJB 2LLNA 3QDJD 4B9FA 4F3FB 4K23H 5BQ7A 5ABZA 4G6ML 4GKSA 4HS8L 5CSBA 3KBFA 1GCFA 1RZQA 4M3HA 4TVPE 1RZ8A 2O5NA 3IGUA 3WIHA 5J13C 3RB5A 4R4FL 2G0KA 3LEVH 4LPVA 6CGTA 3F65A 3HPJA 2ZXAA 1GC1L 2BSTA 5D1XC 4QO1B 4XWOD 3L5IA 2XY2A 3PWJA 3B2UC 3IEAA 4OI7A 1EBAA 3QR1A 1U8OB 3MJ9H 1S7XA 3HG1A 3N0PB 2A38A 3HZYB 4KI5F 3U1PA 1DDTA 1XH1A 2YAFA 1OAYH 3X13B 2BFGA 2HWZH 4LK4A 2E9WA 4PJGA 1DFBH 3BAXA 1NFDE 2B5IB 5F1SA 4LRIC 1DJIA 4KQ0A 2CLRB 5DRZA 4AYMC 2JVUA 4PJBE 3GMOB 3WMPA 4KDWA 3TGXA 2W5PA 4AEFA 3CFKB 3G9VA 1IC1A 5D1ZI 2PCPB 1GRWA 3LPPA 4MCYB 5GZNA 4X5RA 1BGXH 3AGVA 1XCTA 1IGCL 1ZV5A 3HUJA 4DZBA 2R29A 2CHWA 4NDMA 1A7QH 3VRIB 1AXTH 3MO1B 5JNYB 1LL1A 5EU6D 2OYKA 3UXFA 1SJHA 3C09C 4B9ZA 1ES0B 2EDTA 4KKNA 1MRCH 1BJ8A 3ESOA 4OQTL 3NRFA 5SX4H 5DJ8B 4R97C 1VGEH 1JGUL 1OB0A 3G6DL 1MJJA 1JOIA 4N8CH 4ETQB 2EYSB 1MHCB 3ZQ9A 4GLRI 5AFAA 1T7WA 3HW7A 1TEFA 3U0WL 3MV7E 2YOCA 2QQLL 3LV3B 1N0XL 3GTVA 2OP4L 4GRMB 2X1PA 1SDYA 4FULA 5C0JB 4Y1AB