2QDWA

Structure of cu(i) form of the m51a mutant of amicyanin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
104
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKKYETPELHVKVGDTVTWINREAAPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Amicyanin
publication title A single methionine residue dictates the kinetic mechanism of interprotein electron transfer from methylamine dehydrogenase to amicyanin.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 27
structure length 104
sequence length 105
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2qdwA00
4DP6X 2BWIA 2B08A 1AZRA 5AZUA 3OMAB 2ZXWB 4DPAX 2FT6A 4E9QA 1NZRA 3JTBA 2BWDA 4DP4X 1VLXA 1PZAA 2VM4A 4DP9X 2UXVA 1NPNA 3FYIB 1L9TA 1PAZA 4KO7A 5B7MA 1B3IA 2AZUA 3FS9A 3HB3B 3PAVA 1V54B 3EHBB 3ZBMA 3OM3B 1SDDA 3ZDWA 1AIZA 4A68A 7PAZA 1IC0A 3SBPA 2HX9A 1X9RA 3NP4A 1SFHA 2TSAA 5F7AA 3TASA 4YSCA 3ZX1A 4UAHA 1V10A 3OQRA 2H5UA 1OF0A 4GP4B 3S3DB 1RKRA 1ASOA 1AZCA 4HAKA 1ADWA 2YXVA 2Q5BA 1IBYA 2GIMA 3GYRA 4KOCA 3EF4A 1PLCA 1J9SA 2BW5A 3FU9A 1GY1A 2AFNA 1E30A 2P80A 2X87A 1JERA 5B7FA 2YAEA 2VSMB 2FWLB 4DP8X 1XB3A 2A3TA 2R7EB 1PZBA 1W6WA 2YAOA 4ZK8A 2MRYA 2HX7A 2HZHA 4E9XA 1FFTB 4Q89A 2PPCA 1URIA 2IDSA 3L45A 2E86A 2IWKA 1PZCA 2FQDA 2PP8A 1UATA 1SNRA 4BDVB 1WA2X 4E9YA 3PXLA 3QJRB 3NJHA 1KBVA 4YL4A 2XXFA 2YAFA 3FU7A 1T5KA 4DP7X 4A2DA 2FT8A 4E9SA 3CDZB 1BYOA 1ZV2A 2XWZA 5FC9A 3WG7B 2MTAA 4AKQA 5I5JA 5I28A 1J9RA 5ANHA 4GYBA 2P80D 1JZFA 1OE2A 1J9QA 2GB2A 2WO3B 3IBOA 2HX8A 1M9WA 1CYWA 1XB6A 2QDWA 4NAJA 2YAPA 1N68A 3PPSA 1J9TA 2Q9OA 1NDTA 2HRHA 2BP0A 2J56A 1AQ8A 2QPEB 5B7EA 3GDCA 3QQXA 1OOWA 4G7SB 1HAUA 1HFUA 3FSVA 1AR1B 3AZUA 1AACA 2XX0A 2PCFA 3N55A 4L0PB 1AZBA 3WKPA 4PCYA 2GHZA 1MZYA 4Q8BA 5D4IA 3X1BA 1KBWA 4CSPA 4JHVA 1TEGA 5TK2A 3QJQB 3IEAA 3PCYA 2RACA 1NIEA 1CYXA 3NJIA 3NJFA 2WO2B 5I6KA 4DP0X 4GXFA 1IBZA 3WI9A 1GYCA 3FSZA 1PF3A 4P5SA 3AG1B 2ZWNA 4HHGA 2ZONA 2YAMA 1L9OA 5I5IA 2VMJA 1OCCB 1WA0X 2CBPA 4NB7A 4JKNA 1NIFA 1OCRB 2BZCA 2QDVA 4AX3A 2UX7A 1J5CA 3FU8A 4A2FA 1JVLA 1GW0A 2XX1A 3T6VA 4YSOA 1A65A 4N4YB 4YSPA 3WIAA 2BP8A 2UXFA 2BO0A 1JZGA 3IN2A 1TU2A 2VW7A 1OCZB 5B1AB 3CVBA 3X1NA 1X9UA 1ETJA 1PNDA 3V9CA 1N70A 3FPXA 2DWSA 1EHKB 1KCBA 2GC7C 4A67A 4G7RB 1SJMA 2DWTA 3KW7A 4BWWA 3EH5B 5PCYA 5I6MA 3TBCA 4BWUA 1A4BA 2NRDA 4UF7C 1ZIBA 2EIJB 1AOZA 4KO5A 3MBWB 3HEIB 3AW5A 1XMEB 1OE3A 1NPJA 4E9TA 4YSEA 3UADA 1ET7A 2CAKA 3FT0A 2VW6A 5B1JC 2OV0A 3TBBA 3MX0B 2XU9A 3H4FA 2CUAA 5EHFA 4AI7A 2IH8A 1E67A 3N2JA 2BP0B 1NIBA 1BYPA 4PAZA 1FWXA 1NICA 1ASPA 3QJUB 3AG4B 2XV3A 1BEXA 1XB8A 3QJVB 4G71B 3S3CB 2B3IA 1AANA 2VN3A 4FA7B 4KOBA 3KW8A 5TK4A 4HALA 1EZLA 2JKWA 1E5YA 2W8CA 3CZUB 2I85A 2IH9A 4ENZA 3C75A 3UAAA 3T71A 3IN0A 4F2EA 1AG6A 2Y1AA 1PMYA 1NINA 2OJ1A 4N8UA 1E5ZA 2DYSB 1WS7A 3NYKA 4A2GA 2AZAA 2QPDB 5AFAA 4HCFA 1SF5A 7PCYA 4BWTA 1IUZA 3SBRA 4CSZA 1BAWA 1KCWA 1W6LA 3WNIA 1BQRA 2H3XC 1F56A 1OV8A 2YQBA 1RCYA 1ZIAA 9PCYA 1A4CA 1MG3C 1GS8A 1SFDA 2UX6A 1RZPA 3CG8A 3CVDA 4RH4A 3QPKA 1KGYE 4KNSA 1ILSA 1L9QA 3H56A 3NJKA 1BQKA 1JZJA 5I6OA 3GXUB 1KDJA 4YVNA 5PAZA 2PCYA 1DYZA 2XYBA 4EF3A 3IE9A 5I6LA 2DYRB 4KO9A 3WNJA 1SDDB 1PY0A 3NJGA 5B1JA 3DKHA 1JOIA 1A8ZA 3BVDB 1JXGA 1KDIA 5I6PA 2IAAC 3ASOB 3SQRA 1GY2A 5B1BB 2GBAA 3T6WA 2OCCB 2FQEA 1OCOB 2J57A 4DP5X 3OMIB 2GC4C 1NWPA 2IDUA 4KNTA 2H47C 4AZUA 2VSKB 2XUWA 5I6NA 3T9WA 2HRGA 1PCSA 1A3ZA 3NP3A 3NJJA 2LLNA 2UXGA 2VM3A 3EH3B 2GI0A 4YSDA 1FA4A 2WSDA 3OD3A 3FQ1A 4AKOA 2DY2A 3G5WA 3NJNA 4AKPA 4E9VA 3S8GB 2DV6A 1AAJA 3TU6A 4BDVA 1JZIA 4GY4A 4G7QB 1JVOA 1MG2C 4YSUA 2X88A 1GS7A 2FTAA 3NJLA 1CC3A 4DP1X 2CJ3A 4DPCX 3CDZA 3ABLB 3AY2A 5I5MA 1NIAA 3V9EA 2PPAA 3EH4B 2CALA 1AS8A 1BXAA 1L9RA 4YSQA 3UGEA 2YAHA 3PAZA 4E9RA 5B1KA 1R1CA 3NSDA 2W88A 5D4JA 1NIDA 3AG2B 3FU7B 1WA1X 1ILUA 3PLYA 4G72B 2TSBA 2HLEB 4YVUA 3ASNB 2AANA 3ERXA 4QKTA 4YSAA 3NSCA 3DTUB 2YAQA 4GP5B 4HZ1A 3SBQA 3T6XA 2IDQA 1YLBB 1JZEA 2N0MA 1ET8A 2I7SA 3AG3B 1I53A 3FQ2A 2J5WA 3FYEB 4YSRA 2XV2A 1ID2A 3H4HA 2BZ7A 4KNUA 2IDTA 1JXDA 4A2HA 4HHWA 4BXSV 2IDFA 4A66A 3ZIYA 4W1TA 1OE1A 3NSFA 1MDAA 4P5RA 2PLTA 1WS8A 8PAZA 1AG0A 4F2FA 1PLAA 3QJSB 2EIKB 1AZUA 1JXFA 3RYMA 2PPFA 4JHUA 2QT6A 4GP8B 2CCWA 4E9WA 3NJMA 4NERA 1HAWA 2XLLA 2ZOOA 5F7BA 4KO6A 1L9PA 3WKQA 2PPDA 1SF3A 4BXVA 1ASQA 1CURA 4UANA 2YARA 3BQVA 1ZDSA 2EINB 2JXMA 3DIVA 3U25A 2XVBA 3X1GA 4A2EA 3FSAA 1TKWA 1DZ0A 1JZHA 4HIPA 2EILB 3CVCA 5AKRA 1BXUA 1QHQA 1ET5A 3D12B 4X4KA 3S8FB 3TA4D 1M57B 4HCIA 3X1FA 2HXAA 3FQYA 2VW4A 2XV0A 1QLEB 2XXGA 4WTQA 6PCYA 1CUOA 1GS6X 1AS6A 1GR7A 2FQFA 4YSTA 3FPYA 2I7OA 3UAEA 1SHXA 3ABGA 5B3SB 6PAZA 2BP8B 1KYAA 1TEFA 4FAAB 2EIMB 3NT0A 3UACA 5E9NA 5D4HA 5A7EA 1BXVA 1W8EA 2UXTA 3NSYA 4HCGA 2JFCA 1L9SA 1ZPUA 1NTDA 1AS7A 1WAEA 2IWEA 2IWFA 2J55A 1ZDQA 4W9ZA 2PP7A 5IY5B 2FQGA 4K9JA 2PP9A 4M3HA 2PPEA 2AVFA 1IKOP 2FT7A 3S3BB 2GSMB 2R7EA 1PLBA 4TXVB 1M56B 3PAUA 3UABA 1A4AA 1QNIA 1BQ5A 1SHWA 3X1EA 3ABMB 3QJTB 2YXWA 4M4RB 4WKXA 3JT2A 4YSSA 1RZQA 4F7KA 1KV7A 1NWOA 1AZNA 4QLWA 4DP2X 3OMNB 4MFHA 1E65A 3FSWA 2BW4A 1MZZA 1PNCA 5I26A 5LDUA 2FJSA 2Y69B 1J5DA 3T6ZA 4BK5C 4DPBX 2BHFA 3ABKB 4G70B 3X2QB 1GSKA 2FNWA 1V55B
chains in the Genus database with same CATH superfamily
4DZ8A 2XFGB 4L9LA 1VEMA 4L4VE 4GBXA 1AO7B 1AZRA 5J57B 2H2SC 3GDBA 4WW2C 4D9QE 4B53A 3QIWA 4PR5A 2WWKT 2Z64C 3MO1A 4NJAL 4UU9B 3UTQB 3HZKA 1DVUA 1B4TA 1CD1B 4PRIB 4UTBL 1XV8A 4O2FB 3PUUA 4KO7A 4W6XB 1MLBA 1GCFA 3FS9A 1J8HA 1RZJC 5CCKL 3ESUF 2FE0A 3DVNB 3H1ZA 5C9JB 5SWSB 4J2XA 4LO9A 3IDJA 1RZIA 4LRIA 4FHJA 1EHAA 4KTDH 3DTDA 5KJ4A 4Y4FD 1FO0A 3QRGH 5CILL 1U8HB 1NM4A 1RULL 3SCMB 6TAAA 4WFGD 5CJOH 2BSED 5KEZA 4MAYC 3TZVC 3IJ8A 2OK0L 4YJZL 3LKPA 1H3PH 1NFDF 5CU5A 4J3BA 4AW4A 1MFMA 2E76C 1FO0H 4JZNB 5IROD 2CO2A 3UTSD 1URZA 2NMSA 4ONHA 4Q6IC 4ABUA 3D33A 5LUMA 1D5IH 5DUPL 4QPEA 1N12A 3PWPB 2CKBL 3RA7H 4S1RH 4PJ9B 5A16A 3WFDH 2G75B 5J9PA 3QEHB 1MOEA 3VDCA 1FFRA 3GI8H 2IH3A 2CO6A 3CFDB 5B7FA 2VSMB 3HRZC 4IRSB 3ARFA 1G6RB 2A3TA 2Y24A 1ZT4A 2Y1ZA 2F58L 4MQXD 1EHLL 2Z7WA 4OAWB 4X8GA 5DJ0B 3RTQB 2DMGA 4OIAA 3KVQA 5AW0B 3UJIH 4GRLA 1TPXB 3U1SH 2BOLA 1BMGA 2WZPA 1HH6A 4NKMB 2EO7A 3WJJA 3U1PA 3ARYA 3GHBL 5T1LA 1F4XH 2XTJB 4MNQB 1THCA 3Q8CA 4KJQC 3FQRB 3L16A 4EVNB 2K0RA 2B5IB 4LLUB 5KG9B 5HD8D 3KYKH 4X4XA 4XBGA 5CD5D 4M7ZB 3RVVD 2JKNA 1CFVL 2G9HA 5CKGA 5GGTA 5IB2B 2OI9C 4YL4A 3X11B 3ZYOA 5I74C 4E9SA 4TUUA 3CDZB 1LMKA 2X2YA 3ATAA 3BP4B 3CLFL 4LLWA 4M6NH 5DO2D 1IVLA 5M95B 4QRPD 2RJMA 5GRYA 5GGTH 4Q58C 4BA8A 5I28A 1HHGB 3EO1B 4AK1A 5FIEA 4XP1H 3TS8A 1PX4A 3F01A 4PJAA 1N26A 3GJEB 1S7TA 3DJTA 4YZWA 5IESL 2JJTC 3P4OB 2ITDB 1XGUB 3MLTB 4G7SB 3UJJL 3B9EA 3T0EC 2V33A 1E5BA 2W9DL 5H35A 1GZPA 5H37A 3NGBB 4R4BB 5ALCL 3MV7E 2B39A 1FL3A 3VI3E 2A9MH 4MVBD 2Q7YB 3GBDA 2ITCA 1RJZB 1Y1DA 1UGNA 3ARDD 4UNIA 1LE9B 1BG1A 5DQDL 5H37H 4OCSL 2VH5H 3I50L 3MRCB 5CCJA 3QYCA 3L4ZA 5IW6B 2VN7A 4H8VA 3FMGL 4H8HA 5KVDH 1DP0A 2B0SL 4NWTH 2VIRA 4I0KA 2CCVA 2PYEB 3FQTA 4CC4C 1ROCA 4JPWH 2NY4C 2X4RA 1NIFA 1PQZB 2P24B 4L3ED 3UMNA 4N9GB 1J5CA 2EDLA 3FU8A 3NCWA 2YPKA 5JDSB 4JPIA 3ZKND 2OQJA 1SPDA 2D7QA 1ADQL 2UXFA 4LRNL 4WLCA 2LLLA 2A6DB 4AVKA 1JZGA 2N4IA 3BE1H 4WO4C 4KTGA 3ZZ1A 4JL1A 3CUPB 5JQ6L 3V9CA 5LGHL 1U3HB 3F5WB 5CUSL 2WYHA 2R1XB 3DX2A 3QNZB 1NA8A 1LO3H 3KW7A 2X6CA 5E2WL 4ZUUB 4JPVL 3FTGB 3OR7B 4M6AA 1KN2H 1E4XL 4PFEA 3E3QC 2H7WA 3GPEA 4LPWA 4UF7C 1GJUA 3CV5A 2GAZB 4P9HL 3LH9A 1YJDC 4J28A 4U3CA 1X4XA 3ZO0A 4PJ5A 3PIQA 1G4RA 3QI9D 4NQSB 2D3NA 2ORBL 4A7UA 1ET7A 2EE2A 4JW3A 1OPGL 2IANA 2WXQA 5B1JC 1S7WA 3TO4D 1E5CA 2AJUH 4JQIA 1X7QA 2BS9A 5HYJB 2MOVA 4Z7VB 2Z93B 1XIWD 3OF6D 1FE8L 5GIRA 4JM2C 3MJ8A 4MMYA 1I1YA 5F44A 4PSPA 4LGRB 1D3CA 3I6KA 4F7EA 5C6TH 1CICC 1G7JA 2OTUB 4NX0A 4XP4L 4JQIH 3CVIL 1AANA 2O30A 5GZOC 4XPAH 2JKWA 3M7OA 3GLDA 1P9MA 4XTRD 2CMRL 2Y1AA 4QRRB 1PMYA 1WCQA 4OZGB 5BVJA 4KK6D 5F0MB 3PF2A 1E5ZA 2AJYH 4UM8B 1WS7A 1J1OL 2QPDB 1HL4A 2XKSA 4AGQA 3N9GL 2ZWYA 1SF5A 3EF7A 1G5GA 4Y5VC 4JRXE 5SV4A 4WTWA 4OCXH 5JHDA 4KY2A 4WRLA 1P4IL 2I5YH 1MH5A 1XGPB 1C16A 1YEGL 5F3FA 2WBJC 2AGJL 1R0AH 4I18A 4Q9CA 4Z78A 1ZIAA 4IRZA 2ICEC 2YRLA 4Y2OB 5HYSB 3SGDI 1GS8A 4TSCH 1IKFH 5D2LF 2CG9X 4HFUL 1JAEA 2YFNA 5TGBA 5HHOB 2WTOA 4JM4H 3I84A 3PDOB 3O3AA 2C7FA 5BRZD 3NFPB 2YPVL 4IRZH 4HGWB 3D0VA 4I9WD 5G4OA 3HR6A 2DYRB 1J5HA 5MEPA 4ANUA 2UY7A 3DKHA 3OKNA 2WNKA 1K3ZA 1AHMA 2BJMH 1X6LA 4MSWA 3LRGA 4OB5L 5AENA 4XCEA 1A7PL 4PS4H 5DHVB 3U6RB 2HRPL 5HYEA 2G4EA 3O4LA 1U8PA 1JYWA 5EC2B 3L3HB 1BJ8A 5SWZD 5FGCB 5BUPA 1GZQA 5JO5B 4ZTOH 1NWPA 3MA9H 4DGYH 1VCAA 2ESVE 2WINB 4KKPA 3EGDA 4K5NA 3V6ZA 4OBSA 4XWGH 1T66C 3GNMH 3GXDA 3NJJA 3H9YA 2GI0A 2JCCE 3L1GA 2WSDA 3IDUA 3KAAA 4WTZG 2O5NA 3G9AB 5GSVA 3ZIMA 3AADB 3LCYA 1A02N 3F12B 2EDDA 4OFIA 4D8PA 2CQVA 4WWKC 3B34A 2OP4L 3FO1A 4LCYB 3VA6A 4TTDD 5C0IA 5LQBH 4P59H 5JLZB 4LGSB 4LNVA 3V7AG 1PLGH 3T4AC 2G60L 3LQMA 5CSZB 3GC3A 4CN4A 3OAYH 5FW7A 4GI8A 1C9SA 1EO5A 2A4CA 1UACL 1KB5L 1S8DA 1HKFA 4HQQL 2VMEA 2EACA 3VXNB 3P11H 5I19L 2ILLA 2XETA 3BFWA 3EHBC 4X5XB 3CFMA 4XXWC 1XGQB 5CLTA 3LH2H 3V55A 3U7YL 3IJHA 3VFMA 1S78D 4HMDA 1DBAL 2VDLL 1XAKA 3NIFF 3ARPA 2J8UF 5HJBA 5I1KH 3VWJA 3VAEA 5MENB 2YEZB 1HWGB 4GRWB 2WXKA 4GW5A 4LSRH 2XTLA 4ZDHB 3ERXA 2CNYA 3NG5A 1L7IL 5F97E 2G2PA 1ETZB 3GKWL 5DRWA 1DFXA 3D39B 4FXKB 5BV7H 5KSAA 4HZ1A 5FO7A 3A6OA 4MJIB 1OKEA 5E6IA 5ISZB 4I1NB 3EDJA 4G6JH 1OM9A 2VL4A 3FQ2A 5DEGA 5HDRA 4BKTC 2F19H 4KHTL 1GL4B 2N7SA 3RWDA 2X4OB 3E8VA 3K6SB 4P46D 3FO9A 1N0XL 5ANME 4AQEA 5C9KA 1DJIA 2R0KH 3DJSA 1UD4A 1ZTXL 1ZD6A 1WZAA 1QRNE 4J3TA 4ZS7L 3H54A 1QG3A 3EJZD 4G6ML 2OZNA 3MV8D 3QXWA 4X6FA 1PDKB 3D0AA 3LVTA 2MTPA 5IBLD 3VDAA 4Y4FC 4Q4EA 3TWCH 3CD4A 3BUQA 3L4VA 3Q5YA 4GPVA 3QG7L 4YDJB 4QXTB 4RAHA 1P5VA 4RGOL 4UT9A 1H8NA 3ZHDA 1YEHH 2JXMA 3HAEA 2F8IA 4FQ2H 4GUPB 4HJIA 5E1IA 5IROC 1XGYH 4ZX5A 4P5KB 3A47A 2X6VA 3EGXA 3F04A 4BFNA 3MRLA 3QDGA 4X4KA 3NACL 4EQ2A 4WK4B 4UT9H 2OFQA 1FVDB 3WIFB 4PVLA 3N0AA 3HAEH 2HMID 3BAWA 4O2CA 3ARRA 3FT9A 1NC2B 2WSKA 1SHXA 1KYAA 2VKWA 4XCNB 3OAUH 2FL5A 2DQUH 5I66B 5A7EA 2NQDA 5I1HH 2F53A 1UZ8A 3FCGA 4MQXC 3VQMA 4NRYB 5ECJE 2Y5TB 3HFMH 4Y19D 4EN3A 1G6VK 2F61A 3DRTB 1TEYA 3W57A 3L13A 4IMLA 2NNAB 3II2A 2NLJA 4FQHB 3PXHA 1QSZA 1IGCH 2HG5B 5DSCB 5AL8A 4HEPG 1ITCA 3BP5B 2PPEA 4BFEA 1DJXA 2DLIA 4OZIA 2R9HD 2O5XL 1FNEA 3B9KA 1J1PL 5IMOB 2KQNA 4UIKH 3SYQA 4UTCA 5EN3A 1T7ZA 3Q6FA 3RVXD 3S2AA 4NN6C 2QVMA 3MNMA 5CD5C 2AK1L 3RVVC 2ZX9A 5JHLA 2EH8L 5E4EC 3ABMB 1K4CB 1WAAA 4M4RB 4YH6A 4OM1H 2VQTA 3QRLA 3DRQA 1ZXKA 4X7SL 3K72A 4HJGB 4KFMA 3S36L 2DIAA 2DQTL 3FSWA 4PJCB 1VSCA 1TETL 5JHLH 5DO2C 1OSZA 5F8RC 5IWLC 1DVFA 5L9DL 1GC1C 2I07A 1MAMH 2VXTH 1R5IA 3ZL1A 1N7MH 3PREA 2N7AA 4FNSA 3VSQA 2BCKA 4PRNB 5AZ2L 3P54A 4FFZL 1KELH 1RVFH 4K5LA 2FH6A 5DMJB 1YEKH 4AYDC 3E2HC 2HWZH 3TT1H 2VDPL 4MHHG 5FOJA 1MIMH 3OMAB 4NP9A 5E6YA 4C56D 4AYMC 4NPJA 5ERWA 2IPKB 4HW6A 4NKDB 3HI6L 4ZT1A 1BQLL 4AQ1B 1BBDL 4OZFB 4MVBC 1B3IA 4L1TA 4S0TD 2WB1A 3ARDC 1V54B 3HB3B 4L4VA 4WDIA 4DOHE 5HI5D 3VMPA 2DM7A 4EZKA 3BP7B 1ZGLA 1WRFA 4BQ6A 1QX1A 3HG1E 4HOZA 3BAJA 4Z77B 3FTWA 3L8QA 1OTTD 1BZOA 3QIBA 1Q9WA 5I0YA 4QAWA 1E6OH 1JF1B 1T5WB 3CN1A 3DV6B 2B59A 1IJNA 2RMNA 2X89D 1G0DA 3PU7A 4UAHA 1FFOA 1A1OB 3UC0H 1X4ZA 1UM4L 4JFSA 2J73A 3BEWB 4NC2B 4RGNB 5FCUL 2ICWJ 3VRIA 4XAWH 1DEEB 3GINA 4Z8FH 4OCWH 3NH7H 1KPVB 3ELAT 5BO1H 1JPST 1SUHA 2WKGA 4K7PL 3TCXA 5JNYB 4YPJA 2EE3A 2WOYA 4FHKA 4ODVH 4HS3B 3ZKNC 3UDWA 3EF4A 1PLCA 4WUUB 1NDGA 2FX7L 2AQNA 3FH8A 1IM3D 2HVJB 3QSKB 4R97B 3ROLB 4FABL 2YQ2A 3WJLA 5D1XD 5C08D 5C0BD 1MFVA 3KPSB 4Y7OC 5B39B 3I9IA 5C07D 2V7NB 2BNUA 4P5MA 5DUPH 2L3BA 1JPSL 4KK5D 1Q8MA 3BHBB 5F0JB 3M17B 2B9AA 4P5TB 1EH9A 4ZTPL 5MERB 3VDBA 1CR9H 1U8QB 3VI4F 5FK9A 1PG7W 2QADB 4KKCD 2IWKA 2PP8A 1M6OA 3QI9C 3GGWB 4KXBA 1ES0B 5JXAL 3A24A 4YHZL 3TO4C 3D51A 5EU4A 3MQIA 4MMZB 2FT8A 2ZCHL 3U6XS 1XIWC 3WY4A 4DKEH 1IQDB 4PJ8A 4X4ME 3LD8C 5DI8B 1V3MA 1UKTA 4CDGC 1D5ZB 4HOWA 2XXMB 5J1TC 1UD3A 1CFVH 2Z8VC 3NPSB 2GB2A 3T3ME 1N6UA 4W9CC 5FGBC 2F8XC 1BQSA 5D7IE 1LO4H 3OB0H 3RWGB 4RFOH 4XTRC 3IXTB 5F6HI 4GO8A 4H13C 3SDYL 5B7EA 4O9HL 1KJMB 4KK6C 4TV3A 1F4AA 2ENQA 1AR1B 1UT2A 4TOYL 4L0PB 1LEKB 3N1GC 1HWHB 1GGTA 3B7TA 4CNIB 4KJYB 7FABL 3L3KB 4NCC2 3VGAB 4IBVA 1H6EA 2VWEC 1NGYA 2COQA 2WANA 1CFTA 3I6GB 4OF3A 4FA8A 2QFRA 1S7UB 3BT2L 3II1A 4H8WH 4QHNB 5D6DA 3SODB 3LDBC 3NJFA 4DP0X 1KYOJ 3RURA 1YYLH 1AHWC 4OUOA 3MV7A 1N5AA 2APVA 4WHCA 4FXGC 1PG7H 3VI3A 3RZCD 2VDML 5I1IH 5GSRB 4BQ8A 2Z8SA 1A1MB 5C0CB 4BZ1A 3GKZA 3RB7A 3KLAA 1S7SB 3VFNB 3CZSA 3EOBB 4Q0XH 1ZV5A 3VQ2C 3VW3H 3RWEA 5JHMA 3UYPA 3BUPA 1JHTA 3MRKA 3NTCH 4A2FA 4YMPA 4HP5A 4M9OA 2VDKL 4F7PB 4BZ1H 3FMGH 1PD0A 4RMQA 4Y1AB 2EDFA 4WJ5A 2YSTA 4J1UB 4NZ8A 4WW2B 5ENWA 3UYRL 5B8CA 1S9WB 4FEIA 2NCEA 4L4TE 1SXBA 1TKWB 1AVAA 1FHNA 2J43A 2B1OA 2UWEB 4NQVA 5KW9L 1TU2A 5MHSE 2A6KA 2NDGA 4GMSL 4NCC1 3FFCB 5D6CB 5FM5M 2G5UA 4KJPD 5LXVA 3P30L 4I2XE 4R3SB 2C4FT 4ODXB 4RGMC 3GRWA 3SDDA 3M88A 5GGSB 1I4FA 3CK0H 4DCQB 3D48R 1WZMA 2W0PA 2QR0A 4ISVA 3WMQA 4FX5A 4JFXB 1OW0A 5C92A 4LVOC 5EF1A 4MAYB 1LO0H 3GMQB 3TZVB 4N90D 3ATFA 4TTDC 2Y23A 3RWJB 3GRWH 4FD0A 1WBXA 3AUWB 3CPLB 4XNQB 2XPGB 3RI5K 3F6JA 3UADA 5KUMA 4JFYB 1TQUA 5E6SB 3BPLC 1P6WA 2OMXB 3MR9B 2Y4SA 1P5UC 2ZTBA 3QCUH 4OFQA 3WY1A 4Q6IB 5DRXA 1FN4B 5I8EB 1VPOL 1N6VA 3PGDB 4O2EB 4L0YA 1O6VA 5E5MA 3KR3H 4B6ZA 4HU8A 1S78C 4A04A 2YGOA 3I6LE 3KJ4B 4NQDB 5AVUB 1DJSA 1E5YA 2HKAA 3HRZB 4ENZA 4ZUVA 3C75A 4G43B 3CFTA 5IT2H 1FC2D 1CVSC 1OGTA 3KM1A 3BO8B 2X1PA 1MEXL 3BPOC 4YDMA 1D5MA 3C6EA 3TBTB 1QBML 3SJVB 3FAWA 3H9SB 4KQ4H 5FUCC 1F58H 5AFAA 4QRAA 1KXVC 3FO2A 1SLVA 4HSCX 4CVXA 4RWYL 4BWTA 2QQLH 4F7MB 2DS4A 2I9LA 1BECA 2BPBA 2XN0A 1FUNA 2WLIB 3SBRA 2CMRH 3MACL 4HBCL 3HE7D 1JN6B 3I75A 2WQXA 4K94L 5ITBH 3LKOB 3U1QA 1UUSA 1OV8A 1HKLH 1KCSH 4P46C 4TNWK 4LSVL 3NIGE 4RA3A 1H0DB 4QI3A 1G5AA 1KGYE 2AEIT 3MLYH 3EJZC 5E2UL 3QUZD 4JRXA 5EBWA 1V27A 1ML0A 2EEBA 2E7LA 5IBLC 3Q44A 3W2DL 1Z9NA 2WUCL 3LIZA 1G9ML 4FCHA 3GSUA 4PJHF 1G4MA 2HSIA 3FKUS 2P5PA 3RDTA 2XN2A 1J5IA 1D7DA 3VH8A 2K7PA 3LIZH 2E6QA 2GBAA 1JV2B 3T0EB 4B7IA 1DQKA 1AI1H 2V5YA 3VJ6B 4HUWA 2AJSL 2Q76B 3K81A 4U1HA 4E68A 3X13A 1CE1L 2VSKB 3T9WA 5ICZB 2VLJD 1IBDA 5KVFL 1DBML 1Y18A 4HU2A 1F97A 1H3WM 2JVUA 3X14B 1GGIH 2YSSB 4AJYV 2QV4A 1RLWA 1D6EB 4R5TA 3GWJA 1EA9C 4GW4B 1L0PA 2BSRB 2C3HA 5AALA 3DOSA 1WZKA 1G0XA 2AEPL 1XR8A 1MFCL 2ESVA 2H9GB 3DV4A 3CQFA 1EXUB 1G7QB 5JA9A 5EDSA 1R3HB 1Z9LA 4X9BA 1UT9A 5EIVA 5F2FA 5K93A 5JZ7D 3NSJA 3QZOA 2ZPKL 3JWOC 1F4YH 5DR5H 3CSBA 1HJCA 1IM9D 2IMNA 3UC2A 3K1DA 3WTTA 4TF4A 3RVXC 1QWNA 1SEBB 5A2JH 5D8JL 5KYXA 2V0AA 1AS8A 3VFPA 3VVWA 5BPPA 1J0JA 3KBPA 4E9RA 5K1NA 4G5ZL 4QJ4B 4WO4B 5CMAB 2VC2B 1ETB1 1G1KA 3P3RA 3H3PL 1A4JB 5HYIA 4OCYH 3CZKA 5E03A 3CFEA 2QKSA 1IGJB 3HZ3A 1F00I 4PGDA 5I19H 3KPQB 3PHQA 5HI3C 1GYUA 4G8GE 1B4LA 3LKNB 1UXMA 5TPWH 1UWXK 3G6AB 5CEZH 4YQXL 1UA7A 3SY0B 1JZEA 1LD9A 4B9FA 4PRHE 1E2ZA 2ZYHA 1JD7A 2YD7A 4ODSH 4YPGA 3TIEB 2CRYA 5ILTL 3SE3C 2CRIA 3ECBA 4P23D 2QKIC 1U2HA 2VN5A 4YGVA 5B22A 3WUWA 3VG9C 2IQAB 1CZ8H 4Z7WF 1WS8A 3MRFA 1RJLB 3QJSB 3IBEA 3VGDA 1QFWM 2QGEA 5HI5C 3C5JB 1MRFL 1FQ9C 3F7QA 3ZJAA 1TYRA 2ADJA 5I15H 4N8PA 5LWYL 5MP6L 4F9PC 3UX9B 1AD9A 1NCAL 2Q20A 3IDGB 5BS0D 1U3ZA 2LV4A 2IDCA 1OTTC 2PPDA 5ANMA 3POCA 4PH8A 4L37B 1MREL 4JR9L 1ZPLA 2ZSVB 5HHPA 1INEL 2F7OA 2ZWLT 1JZ2A 1QRNA 1BD2B 3HZMA 4K8RD 2ZCLH 4LEXH 4CAGA 4RLDA 3WXWH 3TPUA 1HINL 2IMMA 3BSHA 1CLZH 3JSSA 1A6TB 4HLZG 4RGOH 1CUOA 2VC2L 4ZMYA 4MJ4A 1T89A 1FV1A 5I1GH 2R2HB 2QVIA 3R0MA 4WCYL 3RNKA 5A2KH 1O9VA 4DFIA 4X5LA 5EBMA 5CXPA 2ICEB 5D1XC 1OP5H 1U2CA 1EJ6A 4JJ5A 3TBWA 2QFPA 1HHHA 1P1VA 1BZEA 3QORA 4H1LB 5DJYA 4G3YL 5K9JH 5GRWA 1UH4A 4O51A 4FJYA 4B50A 2EDJA 4IKJA 3QXTA 4X0NA 1XGRB 4JO2L 4KK5C 4PJEB 4XCFL 1YJDL 1DJHA 1OO2A 3UTTB 4G6KH 4KKCC 5IEHB 5IMMA 1MW2A 5SWQB 2PO6A 1P53A 3TN0A 1Q4NX 3SDCD 3OKKA 4LIQE 1YYML 1HOEA 5DJDA 4C4UA 2V2XB 3BZEA 3GMMA 1JMXA 5E8OB 2W95A 5DDHA 1FJ1B 4AG4L 3ULVE 1RMFH 3HW7A 3GIVB 3IMWA 4KVNH 4YAQB 4PLOB 2WLLB 1IBHA 4TLKA 1Q94B 1I7TA 1OT1A 3OXRA 3ABZA 4IKNA 4O5LL 4Y5XB 3D4ZA 4YL9A 5E1QA 4DPBX 4S2SA 5D7SH 2CJUL 2WBWB 3MLZL 3Q43A 4Z3EA 4RDQG 4CU6A 1P7QD 3ZDZB 1X5LA 2YKKA 4YDZA 4FXTA 3LQAL 4KZEL 4LHUB 4TS6A 4LKXA 1AXSB 4WWKB 1MRCL 4OV5A 4XN8A 2OAAA 1NZRA 4U1SA 2EDQA 5AKVA 3T4AB 1GZHC 1JGLH 2VM4A 4O4YL 4AEFA 4W6YB 3MGAA 3N42B 4MMXA 3KS0J 4P2RD 3GMOA 4PJBF 5DCCA 2HG0A 5F7DA 1UT1A 2VDPH 5EIIA 3EHBB 1RUMH 1TJMA 5INCB 2AJZB 4K3JL 1MCCA 2W9EH 5E70A 3QBTB 4PJXB 2OR9H 3GSWA 4WU5A 4JBSA 5D1QD 4ATTA 4JL2A 3KEDA 3UBXB 5CZXC 3SDAC 1NJ9A 1WZ1H 3LNIA 5EPMB 4BINA 3RZCC 1MFBH 3OZ9H 4QDGA 2QQQA 1BF2A 1DJGA 2WLNA 3L9EA 2PABA 1A7NL 2VCOA 3QXVA 3J7HA 3S48A 1YUHA 3CZEA 1ZHKA 1QYGH 4MNGB 5DURB 1TYJA 3HG1A 5FUOH 1S5IH 3WFZA 3STZB 4FFTA 3RWHA 2ED7A 1N6QH 3VFWB 3ULUF 1FNGB 1DO6A 3QK0A 2P80A 4MCYA 1BBJB 5FYKH 5KS9F 1NUFA 1CMOA 5F9JA 3QHZH 2YD0A 3ZE2B 1I85C 2VQUA 3NA9L 1OT4A 2IEPA 2NY6D 3IFNH 4RWHA 5H37G 1K8IB 1KTLB 1OWRM 4FZEH 5CWSB 4OLYL 2A74C 1WK0A 3PP3H 4FYQA 1V5JA 1JNNL 4PWIA 2PUQT 3MRJB 4PY7A 4UOJA 3FF8A 1VACA 3U48A 2FYYB 2DJ4A 3OLGA 3H3BC 2FSDA 1WQVT 1T1YA 3IDXH 4N8VA 4GKSB 3VFVB 4U1KB 3ZMNA 2ZKWA 4B97A 2C1PA 5DVKA 3UTSB 2YAFA 1BVZA 4OFYA 1OQOA 4HIIB 1CDJA 4YXHH 1BYOA 5IV2B 3TV3H 4K9EC 2XWZA 4FQ1L 3WG7B 4D0CB 4TQEH 2XWDA 4NRZB 1T0PB 4PS7A 3G08B 3SPCA 3IBOA 1M9WA 5E9AA 1IEAB 1BM7A 3NFSH 1TZOA 2YAPA 1QO3B 1N68A 4AQ8A 4QRTB 5DEFA 3F85A 4WHDA 3Q2LA 5JYMA 3DROB 5LBGA 3CN2A 1HAUA 2A99A 1AZZC 3FSVA 4TVPD 4X4MA 4XPFL 4L3CA 2WQ8A 4TRPL 5GJSH 3FUMA 4PTUB 5TE7H 4FFWD 2VLRE 3IJEA 4LCWB 4OI7A 1OZUA 3VVVA 5DD6A 4RFEB 2P4AB 2HAZA 4ICWA 2GT9B 1ZSDB 3E7JA 3TEZA 2NSMA 5D7IA 3FO0L 4K5OA 1JIBA 1WVZA 2R56L 3DX4A 4GI6A 3AUVA 2XQYK 1DN0A 1WIOA 2Y22A 3HE7C 4NN6B 3X1BA 3R1GH 4RSVA 4QD2E 4XBMA 5E4EB 5KSUB 4I88A 5IJCC 1VJSA 3MROB 1QW9A 2Z0UA 4LBEB 2JQZA 4MCMA 4PWKA 2FX8H 5CN3A 5DC9B 3L5WA 3QUZC 3QXDA 3OKOA 4Q2ZB 4RQQA 1PJ9A 3ZE0B 1MWAB 2ZWNA 2XHNA 3EGSA 3KGSA 2X4UB 3L3OA 4QRPB 5C0FA 1FDLH 4YIQA 2VMJA 3HPLB 4P2QE 4HWEH 2G4GA 4IJTA 4AVHA 3Q1SL 1FLRH 5I1CH 4DKFH 1CGUA 3GSOB 3T3PB 4HIJB 3R8QA 1MVUB 2O4EA 4N4YB 1W72L 4EUPA 1RPQA 1U92A 2VXQA 2FBRA 1UM5H 1EK3A 3FCSA 3L4XA 1DVSA 3AXLB 4WW1B 4NUMA 3HHSB 3DX8B 5FYLE 4EUPH 2A1WL 2VDKH 1KXHA 3VX1A 4EIGB 2VXQH 2FO4B 4N2FA 5DEJA 2VN4A 5F7EL 2D7PA 3PDGA 1ZVSA 2ADFL 1AGDB 3C12A 3LXCA 1P69B 1U6AL 3JV4B 1KCUL 4LDEB 1G9NC 3F7VB 4DEWA 4XN7A 3D4YA 4B9KC 1JHKL 3RB5A 4JFED 1X5AA 4NC1C 4DUWA 1VGKA 4HT1L 2HKHL 5IVXF 3LQZA 1XF1A 3G5ZB 4E9TA 3NN8A 1AP2A 4Q7DA 4I2XA 3NIDF 4JAMA 5JZ7C 3GO1L 4Y5YC 3Q9PA 4QRSB 1KGJA 2OV0A 4DGUA 4OGXH 4KQ3H 2J12B 5I1EL 1G7LB 1B6DA 4KZDH 3SIKA 1IEBA 3A6CL 3F83A 3KLKA 5MEQA 4ECNA 4UWQB 2MIZA 3GSXB 3UPRB 1TMCB 2GITB 1BEXA 1NLDL 2OM5A 3FUJA 4L2LA 3PABA 4RX4A 5IVZB 1MWAL 3NCYP 4UM9A 3MOBH 1KGWA 2J72A 1D6VH 2GY5A 4KK8D 1IC5H 1AGFA 4N2IA 5D93C 3G9VA 4B41A 3Q48A 3CFCL 3APCA 3P3SA 1GGYA 4NPYB 1ZT1A 5AW5B 4HPYL 3UAJD 4N8CL 3BZ4B 4JVWA 1HHIB 4H8PA 4RRPG 5IKCB 1EZVX 4LMQI 1K5WA 4PJIF 4WV1C 5I1JH 1KMGA 2CDGA 3RJOA 3WKML 1MJUH 3ZHKA 1F4WL 1IC1A 3C5ZB 1OSYA 2EKSA 2OXHA 1UB6B 3TJEL 15C8H 3ZU8A 2P5ED 3QI9B 4EAEA 1MQKL 2EDHA 2EUVA 2X42A 2R2BB 5F9AC 1BX2B 1A6VH 3KE0A 1L5GA 2CIKA 4P23C 1GOGA 3TO4B 3BVVA 2UX6A 3IRPX 5T3ZD 1DL7H 3O2VH 2J6EA 4A39A 1XH0A 5LNEA 1BQKA 2UZXB 2VUOA 1R34A 1ZTMA 2ICWB 1FVEB 2MKWA 5CP7A 4BZ2L 3GZPA 4W9FC 5HHVL 3GEWB 3LD8B 3LIUA 2ED8A 2PCYA 2WLZA 3UP6A 3V6OC 4K94H 1AMXA 2CM6A 2ODHA 3GI9H 2JMRA 4PS8A 3IT8D 2J6EH 4LLAA 4LOVA 4LSVH 4TUOB 1EMTL 1ZA3A 2CK2A 4PLJD 5EUOE 3K71A 4KHXL 1M3JA 5KN5B 2O72A 1GY2A 5E99L 3BLPX 1DQIA 1KGXA 1CG9A 2BVOB 3L7FB 4K8RC 3MRMB 4HKJB 1I1RA 4UV7H 5EOCJ 2OCCB 4XC1H 4U3XA 1FFPB 2BNRE 1WEJL 3OPUA 4D9RE 1DCEA 3GMPB 2FO8A 4I3RL 4D7BA 3F7PC 4PB0H 3FQNB 5IBTL 1S2EA 4X7FC 3O6KL 1TTFA 2D2OA 2DLHA 1KBBA 2K70A 3G5WA 2LU7A 4PIRF 1AHWB 4N6QA 1NPUA 3M45A 4TUJA 3ZN6A 4U1LB 4UUJA 4M56A 1BJ1H 3RG1C 3MMEA 5ADOL 2K7QA 5BRZB 1V7NL 3AWFA 3IAPA 3K8MA 1EEUA 5IREA 1KJVA 3EJSA 4ORGB 2M8XA 4X80L 3FONB 5GGVY 1E7VA 1RI8A 2NYKA 2JLLA 4NO0B 4NQED 2BNQD 2ZXBA 3SDCC 2JV6A 3HIZA 5FO8A 1KIPB 3QUKA 2AAAA 5C0RL 5I30L 1N5YH 3IKKA 4FG2A 1AGEA 5SV3A 4IJ3C 1NGWB 5SWZB 1AJ7H 3T2NL 4JMXA 1A2YA 3IYLW 1JF6A 1OGAB 5ID0A 4HH8A 2X2UA 1KGCE 2CLVA 5SX5K 4JFHE 3O0RL 2XRAH 3B1TA 2P8PA 5I16B 4KUCF 3ZL4L 4CA4A 1ZHNA 4B9YA 4KTEH 4KV5E 3L4WA 3T6XA 5DLML 4Y2DA 3U46B 3MNVA 4TNFA 5FM5O 5JTWA 1JBJA 1NAKL 1X7TA 1SEQH 4F8TA 3ECUA 1R24B 2DD8L 1WCBA 1XF4A 4IGBD 4HPOL 5AVTB 4JHWL 4P9ML 3T65A 4D0DB 3SD2A 5DMKA 3VXOB 3S4SA 4G8GA 4ETQA 4RNRA 5E00B 2ZJSH 3I3EA 3BPLB 2OJEA 4HUXA 1P5UB 1RD6A 4JNXA 4QWWD 5IB3B 2ZAGA 5AEAA 2MQCA 3QVAA 3OXSA 4PRHA 1QZ1A 3QA3B 2P8MB 2YUWA 1XSKA 4Y4KD 4CN1A 5D1ZB 4DVBB 5JW4Q 1GGUA 2XLLA 3DURB 3N43B 5F70A 5D1QC 5TQ2H 4NO5B 1SF3A 5BVPL 2BY3A 5CJQL 2NY0D 3PE9A 1NL0H 4LF3A 4Y16A 3X1GA 2OXGB 3FSAA 4NKOB 5MI0C 5C0EB 2JKSA 1BZDA 4CMMA 5IF0A 4APXA 2NNFA 3MLXL 1HIMH 2O5YL 4DQAA 5E56A 1FFQA 1DQML 4RESB 1KC5H 3H0TA 4S1QH 3QQ4B 4XP6H 2OSLB 3L2LA 4ONFL 5DXWA 3KWWA 3P4NB 3ZGIA 4B7LA 1B88A 2VLLA 4P46B 3DBXA 1LO2L 2AXGB 2F54B 3P4MA 5FX3A 2ZG2A 4FLRA 3LN4B 4RDQF 1TVBB 4M1GL 4JN2B 2GSIA 5EMYA 2NY6C 3FQ4A 4YBLB 1NTDA 5CNHA 1R5VA 3MV11 3ECQA 4JO1H 2XKNB 4RBPK 5IMKA 5KOVC 3MV8B 5LXGL 4W9ZA 1F8TH 3LXAA 1SXNA 4MWFA 3DPBA 3BW9B 3MX0A 1TQVA 4X6DB 4YK4C 5GGUB 4AENB 2XTJE 1J05B 4MJ5B 4MNQE 2EVHA 5DQ9B 4F7CB 5IIEA 3IJYB 2X3AA 1QACA 2UUDH 4MA1C 4GW1B 5I6XB 5IG7B 2DYPD 4OI8A 4JKMA 5EOQL 1ERNA 4HOMA 4NI3A 3O11B 3N41B 3ARWA 1NLBL 3KPLB 4YBQD 1SXAA 2X6UA 3DUUA 5D7JD 5ESVB 1B0WA 3EYSH 3ZTJH 1HHKB 5EU3A 1PZ5B 3G6DL 4OLUH 2CLZA 4RVBA 3U4KA 4NN7C 3BMVA 2APSA 3L7EB 4ZAKD 2Y69B 3ULAB 2ARJB 3CCHB 4N0FB 4ZPTB 1T4WA 4H0LC 2ZUUA 5I2IB 1AKPA 1HXYA 4I1PA 1CLYH 3BIKA 4G82A 4X42A 1WHOA 2BWIA 4FQPA 1TG8A 2AV1B 2WAQA 3GBNH 3MJ7A 3GIZL 4LIQH 4ZUWB 5ABAA 3UXFA 1CGYA 3F58H 2WHVA 4FFWC 4O5LH 1XTMA 3H8NA 2F0CA 2Z8RA 3APFA 3CNKA 3BWUF 5HHNA 2BDNL 3ULVH 1NMBL 4GEJA 4XVTL 4H20L 5C09D 4ZFOB 5B7MA 2FJGB 1VGEH 1H8OA 3CX5J 3NA4A 1ZK5A 4JFWA 4DGIH 1T0OA 4O58L 3VXUD 5GS0H 3U0TA 3BXNA 5ESQA 2C9VA 3VE0B 4Z7NF 1HESA 1QUNB 1YAZA 1RZ8B 1F11B 5LG6A 3MTRA 1HEZB 1PZ2A 5E9DD 3LZPA 3S3PA 4AQOA 3BWAA 2WZ0A 3IKCA 4W81A 4ZUTA 1BOGB 1FORL 4NGHL 3L5XL 4E42A 3QFDB 1SLWA 5EFIB 3S3DB 4MRBA 4FJ6A 1RU9H 2ZYSA 3KYNA 4R7VA 4QOKA 4U6XB 4WHTB 4ZW7A 3TVMA 1VKXB 4CVWA 1O75A 4XODA 1Q90A 2YXVA 3G5VA 1N64H 3GYRA 3S35H 4Y2LA 4B3VA 4C56B 1WWAX 3I2CL 5AB9A 4XP5L 3OKYA 1PS3A 3NDYE 3O41A 1UYWH 3HC3L 3MRQA 1DBJL 2CDFB 2GJ6D 1GHFL 2QKIB 2V9UA 2R7EB 1NOLA 5DA0B 3EH1A 4X98B 3LZLA 1JE6A 1T5XB 5HJDA 5K39B 4BSWA 3KLLA 5BXFA 3VD1A 5IFAH 1KPUA 2WQSA 5KJRL 4JPKL 3C9NA 1S7XA 2VZ3A 3DK0A 2PPCA 2VR9A 2R8SL 4BK8A 4GFXA 1S9YB 2IAMA 5D5MB 5K1VA 4OM0H 1ZSHA 4N3TA 4UOZA 4W9GC 3JWOL 3E38A 3KPRD 2XZCL 1Z3GL 3W39A 1ZE3C 2Z91B 3MJGX 3B9DA 3QPQD 5HYJE 1RAMA 2C3GA 4Z7VE 2ZUSA 4HIHA 1BVNP 2G0KA 4TUKL 2NOYA 3QIUA 2IXQA 2EDNA 5HHXL 1EIBA 4AV5A 5JR1H 2GUYA 3D2UA 1CBVL 3TA3D 2Y7OA 4ZXBA 4PY8I 3K5RA 3DMMD 3V2AR 5JORB 2YPLA 4NHUA 1X5MA 4KK8C 3PPSA 4OD1L 4QRRE 4HJ1A 4OD3H 3MBED 2YRBA 3PV6B 3MBXL 4LARH 4PG9B 3FOMB 2VJ8A 4LLMA 5DC4B 3UAJC 4Z7IA 3SSGA 3LEXA 1VFUA 2AABL 2BIHA 1U93B 1X6NA 4JDTH 2WCGA 2L0DA 2ZUYA 4TQ8A 3BZ5A 4GG8A 4HKBB 4Q52A 2VZ1A 5CZRA 3WNMA 5DVOA 1WHPA 3CX5K 4JG1L 3HA0A 1CF8L 2C34A 2K6YA 2OMUB 1JWSB 2FSEB 5TK2A 4GAJL 4PWEA 1W80A 3GMLA 4XPFH 1D5BB 4TRPH 4YUEL 5IFJA 4ZTEA 2VLRA 5EBLA 5HHOE 4NM4H 3QUMB 3O3DA 1KCVH 1IO4C 1H3XA 1YEJL 4HKZB 5J7CC 1IX2A 1G0YR 4PP2A 1IGIL 2EYRA 2YAMA 3TJEH 1L9OA 1EQWA 4IOSA 2OBGA 4DJMA 3N1QC 1FSKC 2EIZB 5JW3L 2I25N 2VERA 3QUXA 5KVMC 4Q97A 1SJHB 2N1KA 2E59A 4PLJC 3AS1A 1OP3H 4JY6A 1GGCL 5GZNA 4AT6B 1AKJD 2XX1A 2AJVL 2VXUL 3QFJD 4UZGA 4HS8H 4K7FA 4O02L 4OR1A 1TZAA 5AZEL 3WIAA 1KB3A 3RIAF 1INDL 3A67L 5FGCE 2UVFA 3FUEA 4ALAL 2DDQL 1W72A 4PHZA 4P2QA 2ROYA 5CZVL 3RY6A 2HFGH 2FZ3A 2Z4TA 3ZRSA 1VFBB 4AL8L 4HIXL 2F2HA 5JW4R 4NWUL 5E8EA 5E94A 3S35X 3KH4A 1W72H 4BWWA 2PTVA 1A6ZB 2XFXB 3TBCA 2EEFA 1NBZB 3DI2B 4HZLB 3AU1A 3P9MB 4P4KA 2G0LA 1C5BH 4KO5A 3RIKA 3D18A 4WJG3 4ELME 2GVYA 3RZCB 1HXKA 4QO1A 1BMZA 4XBEL 1A5FL 1NPJA 1U3YA 1JP5A 4BELD 2CDEB 2K4WA 2QSTA 4NRXA 1HQRA 1SOSA 5E23A 2H8PA 1IAII 4M61B 2HFFA 4WFFD 1QNZH 2ADFH 3CSTA 2MCMA 3L9RA 4M7JH 1AIFA 4QF1A 3IMUA 5DMGD 3N2JA 2BP0B 5FYLH 1JHKH 1OAKL 3ME0B 3D6GA 3NIFB 2J8UB 4JLRB 3SGKC 2ZF9A 4OKDA 5C8JA 5E8NA 3GJFK 1QSVA 4GT0A 2VN3A 1TZIA 5CJ5A 4ODTL 5MENE 1YEFL 4GRWE 3QUYB 4FS0A 3SOTA 4YEEA 3OPZL 4MX7B 5E1GA 3MRGA 3O2DL 1AC6A 5AVYB 2BS71 1QEWB 3T8XB 2A6IA 4N2BA 1JNHA 1C08B 3O8XA 5IK3B 3QXAB 3FQWB 2K8QA 3QUGA 3QHTC 1H3VA 4JHZA 5CBEB 4J3OG 1ED3B 2ZYRA 3DX3A 1E27B 1RIVL 3V5DA 4IGBC 5T1DH 2XN9D 3F62A 1EO8L 4HKXB 1F6FB 1KT2B 3BUBA 3LPOA 4QGYA 1I8KA 1J7VR 4G9FD 4AXWA 3RVWD 4OCRL 5JUEL 4OTXH 3V6FB 4KX7A 1B9KA 1ZWIA 1QKZH 4QWWC 1Y07A 4NAQA 3ARFD 5J06A 1MNUL 4YHLH 1K8DB 3VXRD 3WS6A 4QHPA 4NYLA 1YO4A 4Y4KC 3QQ3B 4BCYA 1IZJA 5AOIA 2XYBA 1BEYH 4HOXA 4AEHL 1UB5B 3Q06A 4GRLD 3SE4A 1TUPA 3MRRA 5TH2A 3HC4H 4FQJL 5GS1A 2WZPD 4R90H 1QSFE 4K5MA 5AYTA 1S7RA 5DQJA 1NCWH 4IRJD 2NY0C 1FYHB 1H3TA 2IAAC 1DVTA 4X6CE 5T1LD 1Z9SB 4E5XA 2GBVA 1S9VB 4P57B 2NY5H 4GAYB 1MI5B 2ZUQC 5HHVH 3CQPA 2DI9A 4K07A 3T09A 2FQEA 1FZKB 1ZMYA 1A47A 1OCOB 4CVZA 5E1HB 4BKLA 5E6ZA 3TEWA 1EMTH 3IGKA 2O61A 2G5RA 4QY8A 4CU7A 5EUOA 3H6JA 5I6NA 5KSVA 1AD0B 2Y7SA 3UBGA 3TO2B 1HCYA 1BM3H 1CDYA 4ADJA 4XMLH 5FO9A 2AQ3A 1NGZB 2E9BA 1L6ZA 2FJFB 2ZCZA 4LP5A 4JPSA 2GCYB 4JDVB 4NBXB 3K2MC 2AI0L 3GS0A 3C6LD 2IVFC 1JTPA 2JB5L 3I3BA 3JWNH 3QUZB 3TM6A 3CHPA 4JVPA 2AEQH 2DH3A 3IJ7A 1LP9E 5A40E 3L4CA 3C60B 4MAUH 1PSKH 2J1YA 3D85D 1JNLL 2BH0A 4G80B 5FYJE 2P7TB 3GF8A 5FM4A 4R2GD 4EI5A 1VFMA 2EE9A 1CJYA 5KVEL 3T2LA 2R23B 3KPNA 5KVGL 1ORQB 4OZIF 1SN2A 3CXHJ 3PAZA 4W9IC 1ZHLB 3E6HB 4YBQC 5D7JC 5AB2A 1PU0A 2H2PD 2IADA 3C8HA 5TE6L 2WIIA 2H32B 1BFVL 2GUOA 2HJFA 3LPWA 1WA1X 3QJHA 5FECB 4ZAKC 3OHXA 4MA3A 1WBZA 2EDXA 2VABA 5DEZA 3DTUB 4N20A 3QEUA 2BFVH 3SQOL 2KI6A 3HLAA 4QUOA 1YLBB 2J1WA 5DJCB 5I73C 4Z7OF 2J88L 1DFBL 3QZWA 3IDNB 4DWHA 9CGTA 4XNXL 4FYSA 5T3XD 5MEOA 3V5KB 1OTSD 2KLSA 4ODWA 1HQ4B 4WK0B 3L9YA 3FB7B 6CGTA 1YMMB 2X38A 5L88H 4NP4L 4EQ3A 5K1JA 2C9UA 2IDFA 4JDEB 4Y5YB 1LNUB 3VTAA 4WENB 1I7UB 3RX7A 2EE0A 2Y6SD 3P0YH 4LL9A 1GIGL 4L5FL 3TCLB 3RUGE 3UIZA 2QPUA 4WIQA 2KKQA 1C12A 1MFNA 4P4RA 3TH2T 4HCRA 1OAQL 3O4OC 2WMPB 1H6TA 4BM7A 4O2FA 1PW3A 4LSTL 4JRFA 4MCZB 3CLEL 2FB4H 1A6AB 4HCRH 4N2HA 1E40A 3O2WH 5DUBB 3WEXA 4M5ZL 3QAQA 3CVHB 4FTVD 5GGRY 4HIPA 1GXEA 4L8CA 4OIIH 4HWNA 3MLWL 1M57B 3ZDXE 1U8HA 4WV1B 2AJXL 4I0PB 5IBUB 3WDHA 1NGPL 4ZSOE 3EBGA 2WK2A 3QWOB 5LBSA 5EV7A 5IJVA 2GKIA 1G1CA 4JUTA 3ABGA 1W91A 4F15B 5HGAB 1RUAH 1T1XB 4P23B 3KPSE 1CD9B 5T5FL 1MUJA 2W81C 3GSVA 1I3VA 4XMKH 2EH7H 3WN6A 5LBSH 4KAQL 3D8MA 4OQTL 3HMXL 2M1KA 1AMYA 3GTNA 4JFZH 1JZ6A 4FNPA 4PW9A 2P43B 3Q5TA 3VD7A 4ONFH 4LOFA 3CC5A 4G83A 3C8DA 4XVJH 3SKJL 1FZMA 4MHHI 5F7MC 2VR7A 1CE6B 3QDJE 3B2XA 4I48A 4NQCB 5E2TH 4CUCA 5BS0B 3S3BB 1TQSA 4Z7QB 2A9NL 4FADA 5JW4M 4J8QA 1AR2A 1T0NB 1TTBA 3B7UX 3FCUB 3HS0C 3EBHA 4MAZA 3WFBH 2FEJA 1ACZA 2QPFA 2QHRL 2YXWA 3D52A 1AZNA 3B7YA 2PCXA 3MV9D 3PFUA 3SKOA 1E65A 1CF1A 3RX8A 4EVNA 3TA3C 4GG6E 4BK5C 2VO5A 3WV0A 3MRBB 3S5LA 4G7YH 1T1ZB 4G70B 1NFDA 3JVGA 1ACYL 3DMMC 1EDQA 1ZGLM 3CVHL 3L5JA 1BZ9A 4BUGA 1PFOA 1MJ8H 3MBEC 5EOTA 1ODAA 4V2CB 3T4YB 1IT9L 1UA3A 2JJSA 3KWXA 2KDGA 1BA9A 4L9DA 4APQD 3V4PA 4P06A 2XVGA 2Q8BH 1PZAA 2VAAB 2FWOB 2HTKD 2P48B 2D2CC 1FZOA 1MHCB 1NUDA 1YECL 3OKMA 3VI4E 1BQHB 4IIQA 1DSFL 3KVDD 3RVTC 2WGXA 2HJLB 5ALBL 3EG9B 3SDCB 3ZBMA 4LSUH 3V4PH 4UDTB 1WT5C 2VAJA 4A68A 3E8UL 4F3FB 2DWEA 3VMOA 1P4UA 2P5WB 4N8VG 2HX9A 5DMIH 2YWYA 2LTQC 1UJTA 12E8L 3AMKA 3HNSH 4H20H 3FCTB 4IBSA 5DJ8B 5IFHL 1A66A 4YDKH 1A9BB 1CK0H 1RJZA 2Z65C 3UZEA 4AYFA 3NAAL 4N2KA 3T77B 2CIIB 2YBGA 3KYOA 1HSBB 5BMFH 3MRCA 4HUMB 5L6YH 3VI3F 5IW6A 1P7QB 4V11A 4Y1AE 5H4YA 4WUKH 1NCOA 4Q6YA 1JK9B 1IBYA 3ARXA 5DD5L 2BVEA 2IOMA 4FTDA 4MD4B 3VO0A 5JOFA 1JYXA 1OLZA 4DAGL 4FP8H 1XFPA 1NCHA 1WFJA 4GKNB 2JJVA 3FU9A 2AFNA 2V7HA 4QRBA 4WI0B 4HULB 4TNGA 2VLKE 3VWJD 4N2LA 4P2RB 5ACZA 3VD3A 3UZVA 4XB3A 5DGRA 3U2SB 5GQBA 2F7RA 4W6WB 5D70H 1OPOA 1TLKA 2A6DA 3MJ6A 3WN5B 2DQGH 5C97A 2F74B 3OKEA 3EYOB 2CA4A 3CUPA 5E6ID 4KUZL 1U3HA 3F5WA 3ULSA 1OY3B 1IILE 2GFBA 4RZCB 3SZ6A 2XA8L 4OUUA 5IMLB 3FTGA 3FU5A 5K9QI 4DUXA 4AMWA 5KYYB 5DMGC 2XQBH 1BGXL 2OSXA 1V3LA 3MREB 5DD1L 4BSVB 3RX9A 4BCXA 5K9OB 4GSXA 3FW6A 1T20B 4NQDE 4U7KA 5C2BH 3AREB 4XOBA 1V3JA 3ZK0A 5HYJA 1BAFH 1JFQL 4N2DA 2GPZA 2OMWA 1I3GL 2ZKXA 5AKSA 2Z93A 4QNPE 2DQHH 3QRBA 4MA8H 2QPEB 3HN8A 4L8BA 3GDCA 1J0IA 1OOWA 1WISA 4AV0A 4ELKB 2FJHB 2MPVA 3H9SE 2XX0A 3DHMA 5CJXA 3TCTA 3FN0H 1DE4B 1I1AD 1QZNA 1MHPH 2IALB 3A6BL 2LAAA 5LKNA 1NDMA 1J12A 3L6FB 3OKDA 4P3DB 1IAKA 1KG0B 1XBDA 4MA1B 4Q8BA 4L23A 4WI4A 4FZ8H 5CFHA 1XH3B 3V0VA 1XF2B 3QR1A 4G1EB 4Q74A 4R4FH 4OLXH 4WEUD 3IAQA 4UM8A 3PXJA 3RVWC 1V05A 3FTUA 1CYXA 1HZHH 3O9WD 3X12B 4NKIL 2B1AL 1MRDH 4AIOA 3BKCL 1RK1A 2BCMA 1B0IA 1E50A 2FUQA 2F53D 2MJWA 2AXFA 1A6WH 4JG1H 4PJHB 4D94A 3TFKD 3FT1A 1CL7L 4LU5L 1MF2L 3H9HB 2EDRA 3PQYD 4PVBA 4GRLC 1WBYB 3ZYZA 5IGXH 2F15A 1HDMB 5L8LB 5KSBE 4LHJB 3CFBA 3KWTA 5ITFB 4G42A 1FGNH 5I0WA 4OW6A 4N25A 2E56A 4ADGA 4U1NB 4PRAA 4IRJC 5CFAA 4YXKL 5HPOA 1P4BL 2ZX8A 3DYPA 3O3BA 4L48A 5BQDA 3TNMA 5IJKC 2E3VA 4KK9D 5IP4A 4Q56A 3T0EE 5CLXA 4LEEA 1RJYA 5ECGA 3A23A 5C0JB 3S3SA 5IB1A 1CLOL 3DVFA 3F8UB 3FU0A 4XAKE 1RPKA 1MFEH 3VSVA 1TTRA 2KS0A 4J8RB 1ACXA 1ETJA 4R0LC 2ZWKA 3SE6A 3DIFA 3CSPA 3VM7A 4HGKC 2B14A 1I3RA 5DHEA 5BW7C 3SQBA 5EC2A 4Z95L 2FX9L 3MHZA 5JO5A 1PJWA 1IFHH 1NOFA 1BSIA 2DW5A 3C6LC 3K3QA 4J3OF 4U6YB 3V4VA 4J6RL 1Q9LB 4HIXH 2BIOA 2VDRH 3RGVB 2XBTA 3WNLA 4I77H 3FT0A 3L3DA 3SBWC 1MHHB 4K73A 5DK2A 5FUZH 5AYUH 3TBBA 1N10A 4P2OD 2VZUA 4R2GC 3V4VH 2WLMA 3PS6A 3HCVB 4GKZB 4E41D 3MCKB 4HDIA 4JG5A 4ANKA 5D2LA 4CN6A 5GGQL 4GRMB 4ELMA 5HPMB 2JCCF 4PGCA 4KMTH 4W9KC 2R0WH 5E0QA 1QD0A 5CSZA 2H2PC 3T1FB 3T0BA 1JI1A 4HALA 4LCUB 3V0WH 3L1EA 3WHXB 3CHRA 1P7KB 3WD5L 1U58A 4NO2B 4HHAA 3A4DA 3LN5A 1MXDA 2EVIA 4NQXA 4WHYH 4LSSL 5CHNB 5AW7B 5IQ7L 4GXUN 5I8CA 1BVKA 3I02B 4TVPL 5AW6B 1NSNH 1U36A 4ZMQA 2EUZA 3ZQWA 1OTSC 4ZDHA 3LX9A 3GXTA 1PFCA 1TITA 2Y5QA 3U30C 2BY2A 4PYGA 2H3XC 1X5ZA 1YAIA 2VZTA 1IL1B 4Z7WB 4TSBL 3JV6B 1Q1JL 1V3KA 4GRWH 5TE4L 3CXFA 2Y6SC 3AY4A 4PS3A 3U7WH 5E7FA 4HXAL 4KNSA 3V5HA 2A77L 32C2A 2W60A 4X99A 3FT3A 3IGUA 2Y3AA 2Y36H 3UEZA 2AV7A 3VGBA 2WXOA 2CLRA 3HBZA 3NCYS 3IFPA 4NDMB 1AO7D 1KZYA 1SJXA 4OI9A 4F93B 1BD2E 2I69A 2R0ZL 3GXMA 3LZOA 5TFSL 2VXVL 1L4IA 3MJ9L 8FABB 1YEWA 1NMAH 1YEIL 5F6IB 1QTSA 5AAPA 1RZ7H 1UH2A 2JKXA 4PRID 2X4QB 1B4JH 1IBFA 5ID1A 4QXTA 1QSFA 5HYFA 1HZLA 4JFDE 4GO6B 5SWSD 4FNRA 5TDOA 3WIHL 2ADGA 4I9XA 1CGSL 1Q0XH 4NXSA 4X6CA 4DEPC 1RURH 4GUPA 2P5EB 3NDZE 1KLUA 1ONQB 3BQUB 3DSNA 4D3CL 5G55A 3ARBC 1KGUA 2I24N 3W0WE 1KCLA 4K2UL 3MFFB 1FPTL 1X9LA 4A6YL 3BT0A 4L29A 5HHME 3CZLA 1ESOA 2NCMA 3TU6A 3EXJA 1DLHB 3V0IA 1JZIA 3S4SG 4I3SH 1A4KA 5EU5A 4PJEE 1NC2A 1WF5A 4N6RB 1XL4A 3CHSA 3UTTE 4XCNA 1OALA 3PWUB 4H88H 4YWGH 4DPCX 3QJFA 5I66A 3FUKA 3AAZB 3BKJH 2Y5TA 5A2IH 3PWPD 3GJFB 4KVCH 4GIOA 4PJ9D 1T3FB 1TJHH 1EZVY 2JB5H 4LPYA 1WFUA 4UT7H 1L9RA 4YSQA 2ROXA 4IBQA 5L4IA 1SDAB 4YHPB 4D0BA 3HZYB 5TD4A 4XPTL 4TULL 4IRSD 4X6BA 3VWKA 1LP9A 4TLUA 4YDLC 3VFGL 4ZQKB 4F57L 3RTQD 3PLYA 3MV7D 1U8OA 1OB1A 4U3SB 3T6QC 3Q8AA 3K6NA 5L8KB 2VMFA 5L8JB 2XJLA 4GP5B 3FN9A 3ZDZE 5LAXB 3I6SA 5FYJH 1G1OA 5I17B 1MELA 3AG3B 1H3GA 1I53A 5B38B 3HZVA 5CJ8A 5T5NG 1M7IB 4JFPA 3GXNA 5L2JB 1EFQA 4PG2C 1G7PA 1MCDA 2LU5A 3BUIA 4FLHA 5EDXA 4APQC 3VFSB 4PRNA 2V3FA 4OSUL 4DGWC 2I60H 5IQ9B 5INDB 2HTKC 4JG9A 5DD0L 3ZR6A 2GTZA 2PLTA 3IJSB 2G3MA 1PLAA 2BNQB 4JFQB 1AZUA 1CO1A 1CU4H 1XZ0A 2QPSA 3O6LH 2LGNA 3RAJH 2J44A 3ZTJG 3AT0A 1YQVL 5F0PB 3UZQB 1YN7B 3ALPA 4BFFA 1MCOL 4BQBA 2K4AA 2R29L 4U6HA 3CSYB 3ZTNL 2VDQH 3WFHB 4OZFA 4AQ1A 3WKYA 2V2WB 4LT7A 1CURA 4UANA 3P77B 1LWJA 3BZDA 1DUZA 5T1KA 3RUGA 3WLBB 1N9PA 4UMGA 5DJZA 1JZHA 4KRMB 1N4XH 2VDOH 1P0SE 1RSYA 2K9UA 3R06A 4OZFH 3RVUD 1OAQH 1X5XA 1PYWA 2EZ0D 1B0GA 1QLEB 3VU1A 4AYSA 2ZOLB 1I1FA 2AVGA 4QXGL 1JF1A 3K2KA 4LSTH 1EFXA 4IGBB 5KS9B 2CD0A 3TBSA 4ESKA 2Y06L 5EO9B 1A1OA 1PIGA 2HLAB 4PJDB 3MLPA 3D50A 5B3SB 4RISH 5HYQB 4TM9A 4TQPA 4FAAB 2HKFL 4X8JB 3BGAA 1DEEA 4GH7B 3ZE2E 1GAFL 3VWJC 5TTRA 3IU3A 4MB3A 3BYYA 2HN7A 2PYED 4HS3A 1IEHA 3TYGH 4ZSOA 1ZDQA 4W70A 4Y4KB 3VTMA 1ZKAA 4AZ8A 2PP9A 1ZANL 1QFUL 1OAXL 1IB5A 3ZYIA 4KKAD 2AXJA 4WFGE 1ZA6B 2HLFD 2C3VB 2J2ZB 2BSTB 4K71B 5T5FH 2ZP9A 2J21A 5J6HB 2J1KA 3LS4L 1T1WA 4HK0B 2NY0B 2E9WA 3ALWA 3HBQA 1DANT 1R3IH 4J4PD 1JV5B 3STLA 4ZMVA 3OAYK 3B83A 3UTSE 2ZUQB 3BHBA 2EADA 3M17A 4P5TA 5MERA 1RZQA 4MLSA 3QNYA 4M93C 4RETB 3G6JB 1IGMH 3J07A 4OLZL 5FDYA 3QDJA 1I7RA 4NIKB 1QLRA 1PNCA 4HGMA 5G4NA 2PW2A 2X05A 4ZS6D 3B2MA 4JZJB 3Q3GA 4MZRA 1GSKA 4AGMA 3HE6D 3LH8A 1U8CA 3O6MH 1F3JB 3KVPA 5E5LA 1MKFA 3MC0A 4ZFFB 1IQDA 2GTQA 3KCWA 3MNZB 3RY5A 3ULUL 3NRQA 4J12A 4GG6A 3JWDH 5F1IB 1I1AC 2Q2LA 4IKIA 5K9KA 2GIXA 2CA3A 3FYIB 3BAXA 2IGFH 3RWGA 4UDUA 2X4NB 1EJ8A 1QHPA 5A3ID 3V0JA 3U83A 4YR6A 3T3MF 1WFOA 1UOLA 1ZY9A 3O9WC 1SYSB 3S96B 1IVTA 3TNNA 5D7IF 3PUCA 1IC0A 4HEME 2F1EA 1NC4B 3DI3B 2AMGA 3D30A 1X9RA 4GI9A 4JCWA 3ZE0E 3VI4A 1D7CA 4QRPE 3ARVA 5GHWH 3TFKC 3WFCH 5LCVL 3ZX1A 4YHYC 1HH9B 4Z5RB 4JRYD 5JPNB 1XF3B 4QHNA 2J5LC 2W07B 1EGJL 2IV9A 2J25A 5KTEL 4YE4L 4YZFE 2NZ1A 1RKRA 3T3PE 3E6FB 2XIIA 4L8SC 4M00A 2B4CH 4LPCA 3JYBA 4MTMA 1QQDB 5ETUB 5JIHA 1ZLVH 4L4JA 2GIMA 4KK9C 3ZE1E 5D71H 1ZEAL 1J9SA 1J5OL 3VXSE 4H4NA 1E30A 4KKRA 3VFNA 1JERA 4KXDA 2WXRA 2YXFA 1A14L 1EJFA 2OCFD 4S11A 3WE1A 1NAMA 3BPCA 4ZQTA 1BQUA 2JB6B 1H5BC 5CEZD 1FVCA 2AKRA 2HX7A 1E8ZA 4J1UA 4TYUA 2XICA 4WW2A 1IBGL 3DDFA 1J1XH 3VXUB 3N1MC 1NFIB 4JFFD 1TZGH 4GKOA 4AIXA 3WJMA 1NAMH 3L45A 2GBTA 4I5BB 5FXCH 2VLKA 2WTRB 5E9DB 1Y6MR 1I82A 5AQ0A 1PGRB 3VRJA 4ZO8A 1YY9D 4OJFL 4OVVA 4L3EE 4K3HA 5E95B 4P2OC 3LNGA 3SPIA 4MD0B 1KTBA 4OKVA 5I0XA 1RZJH 3Q2VA 2A4EA 2E6PA 3GMQA 4L1BA 2CXGA 3TZVA 4A55A 25C8L 2KBGA 2ZCKH 5DC0A 3TIDB 4X50A 1KIRA 4UINL 5JPMA 3L95B 4R8WL 4XNQA 1IC7L 3TXAA 1FRGH 3U82B 1E6JH 3PGFL 4GYBA 2EO1A 5LNGA 4NQQA 43CAB 5EO0A 2JH2A 4E9LA 4M7LH 4OLWL 4R96B 2Q9OA 3QAZC 3N0PB 2XCMC 3MXWL 2Z4QA 1T80A 4S1SH 3QQXA 2XWTA 1EERB 4PJIB 1XT5A 4F7TA 2VDNB 3M46A 1HEJC 2X40A 5ABDE 3Q2NA 5EUKA 3K6OA 1M71B 5FLUA 4HUUB 3HRZA 3J8F7 5AB0A 1TCMA 4PMEA 4Q9QH 5H2BB 2WD0A 4L2YA 1C1EL 2OSWA 3KPRB 4HC1L 4H26A 4KPHH 3PWVA 4X7CC 1DBKL 3D08A 5KYUA 3H9SA 3OJVC 5HJ3A 2BVQB 1K2DA 3SGEI 2MPAH 4XPGH 5KYWB 3U0WH 3VYNA 4F7MA 2RFXB 4BSJA 1SYVB 3TA3B 4YNYB 3CN4A 2NSQA 3JT0A 4K4KA 3D39D 5CEYB 5I5IA 3IPBA 3O45B 4MJID 1CDCA 4JKNA 4OIBA 3EYUL 5ISZD 1BCIA 1FLTX 4YDIL 2XBDA 2VB5A 3N6YA 3GHEH 1HWWA 3MBEB 1IAIH 1F5WA 3JZYA 1UD6A 4PB9L 2NTFB 4YSOA 4LESA 2G2RA 2NNRA 3NIGF 1NBYB 1U95A 4P8QA 3E1ZA 4RMSA 5KSBA 3Q05A 1A7RL 2R69A 1ODUA 2VWEE 2VISB 4QTHB 1UWEH 3KLSA 5DHYB 2W80C 2WNGA 3MLVH 3BCDA 3DPDA 3S37H 3GS7A 3TFBA 1HILA 3T0EA 2VDNL 2R69H 1P4LB 4YN3A 2BOBB 2D7NA 3KXFB 4AMKH 5JHBA 1UCBH 2QSCL 1AOZA 4MBOA 5E8DL 2NT0A 3IDIB 4EMZA 5BRZE 3ENEA 1R5WA 4X7TA 4I9WE 4U1JB 4Z23A 4M6MH 1T7YA 1EAOA 1OSPH 3U36A 2XIBA 1KJ3H 2FEDD 1AY1L 4GW4A 3WTYA 3H4FA 4JJOA 1MVYA 4WTZA 2CUAA 1H8LA 1O7SA 2WKLA 4PJ9C 1BF5A 5L4JA 1AKJB 1BYPA 3QFJB 1N2RB 3QCVL 1G7QA 5IW1B 4NZTL 1HJBC 2XV3A 4LPXA 4CC4A 3GSQA 5SWZE 3RHWF 3S5ZA 4IRSC 2B3IA 5EEUA 1JXJA 4B96A 2J1XA 4E5XG 3FRPG 4EO5A 3RTQC 3VFUA 2FBOJ 4KI1A 2I85A 5BCAA 3QPXL 1J0KA 2JELL 2IPUK 1SEBA 3M8OL 3RL1B 3L08A 5CF3A 1GOFA 4QRUB 1GTNA 3RGHA 2ICCA 1U0QA 1LQSR 4U1MB 4WO4A 2G9KA 3OB0K 4YO0A 3CFJB 4FG6D 1OWWA 3FULA 3MA7B 5FYKD 4DZ8B 4L9LB 2KZWA 4GBXB 8CGTA 3BVNA 4IBUA 2E27H 4M6OL 3L3JA 2HT3D 3B3BA 4Y1TA 5AVRB 3DO7A 4M43L 1GJWA 3QIWB 4PR5B 5I76B 3MO1B 2MH4A 3G6AA 1RZPA 3V4UL 4Z3JA 3QPKA 2FLMA 2KUTA 1E28B 4G7VL 4MQ7A 3H56A 4OGYL 3BRDA 1S7QA 3OLEA 3EJTA 1CFNA 1AZVA 4FGMA 3IDJB 5HSFA 1RZIB 3HNTL 2QLVB 1AFVH 5F9OL 5B1JA 1JOIA 4H7VA 1FO0B 2D3LA 5DJAB 2KZKA 2ZIDA 1OW0C 4C4KO 1I9IL 3BP6A 1RJLA 5B1BB 5EORL 4JM2A 2JKIS 3LKSA 4ZMOA 3CH1A 3ZT6A 1E7UA 2CJTA 3EJQA 1AE6L 3LKPB 4P9HC 5K5YA 5DD3L 1CICA 3T6WA 5LBVA 5FUCE 4LASL 4CU8A 4PHXA 2J57A 2KYIA 1SRDA 3IDGA 5FWRA 2EZ0C 3V0DA 5GZOA 3LRMA 4ONHB 2H47C 4L37A 3SE8L 4ANVA 2DTML 5E0FA 1JCVA 5FGSA 2VQ4A 5C7XL 3QNXA 5DRNA 1EDYA 4AITA 3EH3B 4XOEA 5A16B 3WIHA 4XN4A 1F1GA 2BSDA 2V17L 3QZWG 4FEMA 3MLRL 4LLDA 5D9SA 2ZWZA 5J9PB 1HI6A 2IH3B 1T2QH 4Y5VA 3ARFB 2OSYA 1A6TA 4A6YA 3MV8E 5T5NF 4JFDA 3F6IA 3WIHH 1DQDH 4X6DE 3TF7C 3QISA 2WBJA 1RERA 1XCQA 4RGND 4GRLB 2OMVA 4KKAC 3S37X 3FJTA 2HLFC 2ICEA 3DXAA 3W0WA 2FR4A 1HH6B 3BN9D 4A6YH 2Q6WA 4FDWA 4A7TA 2CHWA 4CSTA 1X5IA 2PPAA 5T1LB 4KTDL 3N44F 4J4PC 3SY6A 3US1A 2CBTA 4WUUD 1XGRA 3QRGL 3UGEA 4X4XB 4XBGB 4PJ6A 1HL9A 5CJOL 4R26H 3EJJX 3OGCB 4NZFA 3JV0A 3AG2B 4HEPA 1H3PL 3NABH 3B2PA 1UHVA 2TSBA 3UIYA 2XBZA 4R0LB 5FGRA 1FO0L 4ZS6C 4LLWB 3OAWA 2E7LC 3HE6C 1D5IL 4DFHA 2QADD 4Y19E 2D9QB 3RA7L 3VFGH 4PVMA 5G5DB 4S1RL 4YAQA 3WFDL 3DHJA 4PJAB 1ID2A 1SY6A 2BIIA 1FCGA 1Q94A 4PP1D 3F65A 3GI8L 4KI5D 5IQOA 4TLTA 2H6PA 1KYUA 4PUBH 3BAKA 4IBLT 2CO4A 5H35B 1GZPB 4EI0A 1UZ6E 4R2GB 4JANA 2FDBP 1SY6H 1FL3B 1XHHA 1HOCA 3U1SL 1LWHA 2ITCB 1ULVA 4JHUA 2VOTA 2OL3A 3T4AA 4FULA 1GYAA 1F4XL 2ZOOA 3BAEH 1KBGH 4BXVA 3ML8A 2XI9A 1KY6A 1I9JH 1RZFL 2R39A 1AR1D 3OZKA 2OL3H 3S98A 1XSJA 4XXWA 2VIRB 1FL5A 2X4SA 1EHXA 3S34H 4TL4A 3FQUA 1DQJA 5D55A 4O00A 4JX0A 3TA4D 2X4RB 4JKKA 3RRQA 3STBA 4M8UA 4ZJ9A 4M6NL 5C0AD 1MJJA 1VEOA 5GGTL 2APTA 4C56E 2YPKB 1EJOH 2Y7QA 4JPIB 1GS6X 2X2HA 5EBGA 4C59B 3OQ3B 4GIPD 4XP1L 1KTRL 4X9GA 5I1AA 4ODUA 2UXTA 4J6IA 5DK0A 3MCLH 4ZW8A 5L2KD 1A9EA 2GK0A 1YNTA 1AS7A 1ZVHA 2E7HA 4MGXA 3MRNA 1AYRA 5I8KL 2FQGA 4R7DA 3KPOA 1YNLH 5D5ME 2A9ML 1M2OA 4Z7NE 1ZV9A 2W94A 4N1HB 5EZLA 4W4NA 4NZUL 1YY9C 4PJBA 2VH5L 1UVQB 4PJ5B 4FHBD 3PIQB 4F24A 3K1KC 4DGVL 1KB9J 2CUMA 4Y4FA 4Y4HD 1O5PA 1FFNA 2IANB 1OD7A 4YFEA 5CM1A 4BFIA 2VQ1A 2ATPA 5KVDL 3FFCD 4OU3A 4NWTL 5CN2A 1X7QB 2FEEI 4R9HA 4M03A 4BFRA 1BP3B 3T08A 4JPWL 2FYYA 5GIRB 3MJ8B 4DEPB 4MMYB 1I1YB 1WH0A 3I6KB 2EABA 4U1KA 5IROA 3VFVA 4CKQA 4F7EB 3W9EB 1G7JB 5D1XE 3EBIA 5C08E 5C0BE 3TOPA 3S9DB 2XN1A 4PJ7B 4XCCH 4XO8A 5DC2A 3AJ7A 5C07E 4DP6X 4PWGA 3FH7A 5EZIH 5IV2A 4PIBA 1ZS8A 2HH0H 3BE1L 4Z3FA 4OLVH 4Z0BH 5BVJB 3JTBA 5HDWA 1LE5A 2V9TA 3FB5A 3C08H 3B2DC 3G08A 1CFSB 4EZMA 3BLBA 5EULV 4HXBH 4LQFH 3F7RA 1LO3L 3JVFC 3ETBJ 3PAVA 5JHDB 2DMCA 4I4WA 1SXZA 2VITA 4OQ1A 4WU7A 2I27N 1MH5B 4ZPVA 1KN2L 1C16B 3RKPA 4UQBA 2F5BH 2BXZA 4KXAA 1JG9A 4I18B 4Z78B 3MTXA 4EDWL 2IF7A 4YDLB 1S4IA 2GT9A 1AXTH 1SHMA 3MV9B 2V8LA 4AYID 4MLIA 5TGBB 2X6AA 4JY5H 1MHEA 3WL9A 4M48H 2ZNXA 1V10A 4KX9A 5KBPA 3O3AB 2AJUL 1WTGT 3SJVD 2NTSP 4PVNA 2UV3A 2UY6A 3MRPA 1CFQA 2D03H 1KV3A 3SYPA 5MEPB 2XACC 3DUHA 4QHUA 5IZ7A 3SOBH 3GQFA 4HEMA 5IHHA 4Q2ZA 1E8YA 3LNEA 4F1ZA 4MSWB 5C6TL 1NEZA 1VCBC 3MOAH 4JQIL 4XCEB 3R7RA 2NY3B 1D9KD 4KBPA 4XC3H 4XPAL 3LS5L 1IGYA 3H42H 4TQHA 1P6FA 3O4LB 1U8PB 3NRFA 4MJJA 4UQIM 1BVNT 1G87A 5FHBH 1GZQB 2BRRH 1E4KC 3NCJH 1OL0A 4ZK8A 1GC1H 2AJYL 5DVMA 4QYOB 1MVUA 1HXMA 3EGDB 2A5UA 3N40P 1MPAH 3V6ZB 5HPMA 1S7VA 3HPJA 3LB6D 4XX5A 1OP5K 4XPHH 3VXSA 1BYNA 2R1YA 4OCXL 4QTIH 2I5YL 2E6JA 4X5WA 4D8PB 2J4WH 3ARDA 1R0AL 2FO4A 4H25A 5HJGA 1HN1A 1SBBA 1KBVA 1L6XA 4TSCL 1MCPH 3O3EA 2FEDC 3FU7A 3MYJA 4H5SA 4JM4L 5TJWK 1YEEH 1S8DB 5F7NC 4IRZL 1FHGA 2YZ1A 4Y9EA 5AVSB 1DQLH 5FC9A 5HYSG 1RZGA 2FCBA 2GG1A 3G5ZA 1J9RA 3QZBA 4AH2A 1QPKA 1T03H 4DW2H 1HT6A 3DLQR 4ACTA 3MUGB 1JZFA 4QRSA 2BJML 3DTXA 3IJHB 5I8OH 3ISRA 4L3EA 1G7LA 2XNAA 1OGSA 3VFMB 2CBOA 3N40F 5GPRA 2MCAA 2BK8A 5BV7B 4PS4L 4XCYA 3VWJB 4FL4B 2HCZX 2OYLA 1RFDH 3KBFA 3UPRA 4Y16D 3KCPA 4ZTOL 2G5BA 5CINH 4ZMLA 3MA9L 2YUXA 1KEGH 5DRWB 4FJZA 1KXTA 5KSAB 4K55A 5FO7B 4FG6C 4XWGL 4N90E 3GNML 5TDPA 4ZRGA 5E6IB 3TX4A 5DEGB 5HGBA 5DVPA 2Z35A 3V8CA 4WF7A 4CSPA 4JHVA 2AJ3A 3MUUA 4NFDA 2HT3C 4NPYA 4WSJA 1G7IA 2PR4H 3RWDB 1QFWI 3GMRA 5KVEE 2A6JA 5I6KA 1JFHA 5LGJA 4K3EH 4AQEB 3WI9A 2WPGA 4UV4H 5LQBL 4GB9A 1AYOA 4P59L 5C3IA 1PLGL 4UB0H 4HHGA 4GSRA 2FHCA 5HDLA 1JWUB 4LLYA 4PTTA 4Q6KA 4X6FB 5IVXA 3TO4A 3IDMA 1PD6A 3P11L 5LO7A 2FECL 4XB8A 1TJGH 1O0VA 3BH8A 1ZS2A 2NYYD 3C8KB 1XIWA 3OF6A 1P5VB 5DYOA 3LH2L 3D2TA 4P99A 4WHYG 3VXTB 4YSPA 4UYQA 2F8VA 3HAEB 4CADA 4MNHB 4M5TA 4AQZA 5I1KL 4M5SA 2BO0A 3O81A 1YHPA 1I1AB 1HEHC 3EGXB 4LSRL 4LNRB 5FGBA 3MRLB 3UCRA 3W1ZA 5AAMC 3X1NA 3FPXA 1Q9KA 4CSSA 4N26A 2ZXQA 3RWCA 3ZKXC 4A67A 3L7FA 5DT1H 3MRMA 5BV7L 4O2CB 2DMKA 5ADPH 2OTPA 1MCIA 2QQKH 1K9TA 4G6JL 1AQKH 1ZT7A 5EUOF 2X70B 2FD6L 2FL5B 1M4KA 2F19L 6FABH 3VD9A 1NBVH 2QVTA 2Z7UA 2F53B 1S9KC 4Y8AA 2KPWA 3CZFA 4F8OA 1KPRA 3ULVD 4EN3B 3FQNA 5J1SC 2VUKA 4YHYB 3ESMA 3PP3K 4RGNC 4IMLB 2R0KL 2NLJB 2DLFH 1PKQE 4DN3H 1N59A 4UT6A 1AHWA 1JGUL 4XE5B 4C83A 3ES6A 4V1DD 3EO9L 3B9KB 1FNEB 4FXGA 2MQ3A 4PRBA 3Q6FB