2QDWA

Structure of cu(i) form of the m51a mutant of amicyanin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
104
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKKYETPELHVKVGDTVTWINREAAPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title A single methionine residue dictates the kinetic mechanism of interprotein electron transfer from methylamine dehydrogenase to amicyanin.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 27
structure length 104
sequence length 105
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2qdwA00
1GS8A 2PCFA 1TEGA 1WA2X 3ZX1A 4KO5A 2I7OA 2PPEA 2PP8A 3CG8A 1MZZA 1ASOA 1A4CA 4WTQA 2R7EA 5D4HA 1AZCA 3OQRA 3PAZA 3MX0B 5AZUA 1SNRA 2IH8A 1OE3A 2GC4C 1L9SA 1SFDA 1JZJA 1BQ5A 2BZCA 1GS7A 3UABA 4G7SB 5I6OA 3T9WA 1L9OA 3NJKA 4YSQA 2PP9A 3OMAB 3T6VA 3ZDWA 5B1KA 1L9QA 4ENZA 4DP8X 2H5UA 4DP6X 4AZUA 4FAAB 1OE2A 3CVBA 1TU2A 1N70A 2HRGA 3CDZB 2OCCB 1B3IA 2FQDA 1JXFA 3SBPA 2YAEA 3NSCA 4KO6A 2YQBA 3TBBA 2IDSA 1HAUA 4F7KA 4AX3A 2RACA 2VSMB 2XYBA 5E9NA 5B1JC 3T6XA 4E9XA 4E9YA 1A4AA 5I26A 2WO3B 2YXWA 2PPCA 2BZ7A 3TU6A 4YSEA 1BXUA 2YAHA 2BW4A 1L9PA 2TSBA 1SJMA 3C75A 2AVFA 1CUOA 1A8ZA 4HCIA 2HXAA 3EH3B 3X1GA 1KBVA 2VN3A 2JXMA 3BQVA 1NZRA 1QLEB 3JTBA 1IKOP 4JKNA 2W8CA 2PCYA 4TXVB 1SDDB 2XV3A 3NYKA 3FPXA 1CURA 3UAEA 1PY0A 2XWZA 3FSWA 3CVDA 1J9RA 1F56A 4X4KA 1AZUA 2BWDA 1NIAA 2ZOOA 3AY2A 3QJQB 1KDIA 3SBQA 4CSPA 2I7SA 2IAAC 2VMJA 4PCYA 3QJVB 2BW5A 2R7EB 2JFCA 2IDQA 3SQRA 1GS6X 2J5WA 3X1BA 2PPFA 1BEXA 2YAOA 4DPCX 2GSMB 3X1FA 3N55A 3UGEA 2PP7A 2B08A 4HALA 2QDWA 2GC7C 5I5MA 2YAQA 3NJGA 3FS9A 3WNJA 1W6WA 1PZAA 1A65A 1IUZA 2Q5BA 3FSZA 3NJHA 3V9EA 3X1EA 1NIFA 2ZWNA 4KNTA 2IDTA 1NPNA 3NP4A 2VW4A 5PAZA 3NJIA 1GYCA 4DP2X 1FFTB 4NB7A 2LLNA 2J56A 2XX0A 4GYBA 1MG3C 1GR7A 3FQ1A 2UXGA 3NT0A 3AG4B 4HHGA 1ZDSA 2QT6A 3HEIB 4A67A 5I28A 3FPYA 3TASA 4BWUA 1WA1X 4E9RA 1QNIA 2JKWA 4L0PB 3OM3B 3PPSA 1OE1A 4DPAX 3S8GB 2X88A 3WKPA 7PCYA 1HFUA 1JERA 1WS8A 3FU7A 1EHKB 5AFAA 1RZQA 1MDAA 1V55B 2DYRB 4F2FA 3HB3B 1PLCA 1MZYA 2BP8A 3X1NA 2BHFA 2XXGA 4A2HA 5I6MA 3NJNA 3QJRB 1ZV2A 3WKQA 8PAZA 2MTAA 2OJ1A 1J9QA 3ZBMA 2X87A 3FU8A 3ABKB 1ASPA 1A4BA 5I6PA 1BYOA 3DTUB 4P5SA 5ANHA 1CYWA 4A68A 5FC9A 1W6LA 3S3DB 1BQKA 1IBYA 3NSFA 4NAJA 1JXGA 2XVBA 1AOZA 3AG2B 3AW5A 3T6ZA 2FT8A 1ZDQA 2HZHA 4YSUA 4YSAA 1M57B 3FSAA 3V9CA 3IBOA 3ERXA 1ADWA 2QDVA 1GY1A 5TK4A 1NICA 6PCYA 2ZONA 3ASOB 1J5DA 4W1TA 4NERA 1XB6A 3NSDA 1IC0A 2XV2A 3WNIA 1BAWA 1TEFA 4BWTA 2CJ3A 4K9JA 3TA4D 2AZUA 2XU9A 1NPJA 3PAVA 4E9QA 3ABLB 2UX7A 3S3CB 5D4IA 2H3XC 1JOIA 1AS6A 5IY5B 2EIMB 4G72B 2W88A 3L45A 2WSDA 4GP8B 3TBCA 1AACA 4A2GA 1KV7A 1AG6A 3AG3B 3FQYA 4BXVA 1ET8A 3EH5B 4HCGA 3OMIB 1CYXA 5TK2A 1AZBA 4M3HA 3EH4B 3IN2A 3KW7A 4E9SA 2AANA 1OCCB 1M56B 1TKWA 1MG2C 1KGYE 5B1JA 9PCYA 5B1BB 1AAJA 1EZLA 1JZEA 3N2JA 2UXVA 4G7RB 3H4HA 5I6NA 1ZIAA 3QJSB 1ETJA 1ET5A 3MBWB 3IN0A 3NP3A 3FU7B 5PCYA 1AR1B 3FSVA 2XLLA 1SF5A 3H56A 1CC3A 4Q8BA 1DZ0A 4YSDA 1NIBA 2BP8B 2P80A 1A3ZA 2XV0A 1BXAA 2FQFA 1T5KA 2CUAA 1NINA 3UAAA 1FA4A 3GDCA 2YARA 3NJMA 1ZIBA 4GP4B 2EILB 1XMEB 2N0MA 2P80D 4GP5B 2J55A 4BWWA 3FQ2A 1E67A 2DWTA 4DP9X 3EHBB 2FTAA 4MFHA 3G5WA 3WI9A 3FT0A 2PLTA 1NWPA 1E5ZA 1WAEA 3FYIB 2QPEB 2YAPA 1AS7A 4AKPA 2XUWA 5I5IA 1XB8A 5I5JA 5A7EA 1KCBA 4G71B 2BP0A 3NSYA 3QPKA 4HHWA 4UANA 2FJSA 2IWKA 1NTDA 4KO9A 2GBAA 2BO0A 4JHVA 3NJLA 2DY2A 3QQXA 2GI0A 2XXFA 1QHQA 1RZPA 1HAWA 1PF3A 3NJFA 1JZIA 5B7MA 4DP4X 5LDUA 3NJJA 2FQEA 2XX1A 4FA7B 1NWOA 3IEAA 4KO7A 4BDVA 1R1CA 2DV6A 1E30A 1E65A 1OV8A 3X2QB 5I6KA 3ASNB 1GW0A 2QPDB 3BVDB 2IWEA 1PLBA 1WS7A 1UATA 3SBRA 4JHUA 4RH4A 2H47C 4YSCA 2CBPA 3WG7B 4BXSV 2AFNA 2YAFA 3D12B 1AANA 4PAZA 4A2FA 1N68A 3T6WA 4HAKA 3S3BB 2GIMA 4KNSA 3OMNB 2DWSA 4N8UA 4KOBA 1AG0A 1BQRA 3DKHA 2GB2A 1YLBB 4EF3A 2J57A 6PAZA 2BWIA 3OD3A 7PAZA 4A2EA 2HLEB 1FWXA 2EIKB 1X9UA 2UXTA 3CZUB 2IDUA 3U25A 4YL4A 4E9WA 1AQ8A 2I85A 4HZ1A 1PZCA 2YXVA 2CALA 4P5RA 2VM3A 1PNCA 1ASQA 5B7EA 3JT2A 2TSAA 5B7FA 1KDJA 1GY2A 1AZRA 4W9ZA 4KNUA 1RKRA 1JVLA 4DP7X 1ILSA 2BP0B 4YSOA 2Y69B 2VSKB 2VW7A 1PMYA 3UACA 4YSTA 2A3TA 4HCFA 1PNDA 1NIEA 4G7QB 2B3IA 4DP0X 1ET7A 1NIDA 1IBZA 1PZBA 1OCZB 1JVOA 4YSPA 1DYZA 1M9WA 1SHWA 2EINB 4G70B 4N4YB 5F7BA 5AKRA 1I53A 2CAKA 1BXVA 4YSRA 4M4RB 3GYRA 4BDVB 1ILUA 3UADA 5I6LA 2VM4A 4YSSA 1SHXA 1SF3A 1URIA 2FT6A 2EIJB 2DYSB 2CCWA 3ABMB 3QJUB 1KCWA 1WA0X 4AKQA 1X9RA 3AG1B 2FQGA 3KW8A 4GXFA 3RYMA 4DP5X 2WO2B 3GXUB 3QJTB 2FT7A 4A66A 3PXLA 3PLYA 3S8FB 1W8EA 1ZPUA 3DIVA 4HIPA 1E5YA 2UXFA 2IDFA 5B3SB 1PLAA 1OCRB 2HX9A 4KOCA 3T71A 2PPDA 1AIZA 2E86A 2ZXWB 3H4FA 3IE9A 1ID2A 1V10A 2Q9OA 2VW6A 2HX8A 4CSZA 2OV0A 4E9TA 1OCOB 2IWFA 1XB3A 4UF7C 1VLXA 1JXDA 1L9RA 2HX7A 2IH9A 1JZGA 3FYEB 5D4JA 4AKOA 1RCYA 3PAUA 4BK5C 1KBWA 1OF0A 3PCYA 1SFHA 4GY4A 4E9VA 1V54B 1KYAA 1AZNA 3CDZA 2PPAA 3EF4A 1NDTA 2FWLB 1L9TA 3AZUA 1J5CA 4QKTA 1J9SA 2UX6A 2Y1AA 1PAZA 1JZHA 3ZIYA 4YVNA 4A2DA 4ZK8A 4AI7A 1GSKA 4DP1X 4Q89A 2FNWA 3ABGA 3CVCA 2MRYA 2AZAA 4UAHA 2HRHA 3WIAA 4F2EA 1J9TA 4QLWA 2GHZA 4YVUA 1OOWA 5EHFA 5F7AA 2NRDA 3FU9A 1BYPA 2YAMA 4WKXA 1SDDA 1AS8A 5B1AB 4DPBX 1PCSA 1JZFA
chains in the Genus database with same CATH superfamily
3OKYA 4D94A 2G2RB 2PCFA 2ZXAA 2J1YA 1ACYL 1R4XA 2BRRL 3VDBA 4XWOD 3CHRA 3F64A 3WENA 1AD0B 3EDKA 1K5NA 2BSEA 2DEYX 5A3ID 2FLBT 3O2DH 4XVSH 1IBDA 1E8ZA 4N8VB 5D4HA 4P5TB 3VXTB 4L05A 1F58H 1AY1H 1G7MA 1U3HC 2F74A 4JR9H 2BS9A 4LIQL 5CR1A 4PRAA 1FLTX 4Z1PA 3EJZC 1UD3A 1AKJB 2ZWLT 3A23A 3MJ9A 5J3HC 1VENA 2CCVA 3PHSA 1OP3H 4GRLA 4DKAA 1B2YA 3E7JA 5I9QB 3VNZA 4ZTOH 4XAWL 3ML8A 3OMAB 1SRDA 2WQ8A 3ZDWA 1PFOA 5DD3L 5B1KA 5MP6H 3RWEA 2NZ9C 3GNML 1KENL 4DP6X 3D0LA 4HHAB 4TN9A 4FAAB 4KKCD 1N70A 3RVWD 1G4RA 4AQ8C 2AJ3A 1MIEH 2WV3A 1B3IA 2JCCA 4UQ3A 3BWZA 4G42A 1JPTL 1NOAA 1XH3B 4MJ5A 5HHQA 2WGXA 1BA9A 2R39A 1VFMA 4DOHB 3NSCA 2R51A 4JFFA 4KMTH 2R29H 1YQ2A 2YOCA 4MRBA 3VXNB 3LZPA 4BE6A 4L8SA 4RZCA 5KZCD 1CJYA 5I26A 1U2HA 2OMWB 1NA8A 5E6YA 1ZT7B 1T89C 4MXQC 2JNZA 4LARH 4GAYA 2J44A 1NBYB 1I3RB 3PS6A 5C7XL 1KY7A 2MTPA 3VA2C 3WDJA 4EIBA 4G80A 4R83A 4BUGA 4PVBA 4ONGH 4YBQC 3G9AB 4TVSa 4FYTA 4XNXL 4XMWA 1I1AD 3GMRA 1M2VB 1QLEB 2E4FA 1IKOP 4DQAA 2E75C 4EKXA 4U6HB 4F58L 5HYJA 2Q86A 5JNYA 3MLRL 4PRPA 4KK6C 2VZVA 4PJXB 1MHCB 3MYJB 1IKFH 4CU6A 4AEFA 3BDBA 4Y0GA 1V05A 5FO8B 2ZCLH 2ZOLA 1XR9B 1HESA 5C0CA 1AP2B 4V1DA 5DEFA 1QBML 5F6HI 3MRPB 4L9LB 3K2UL 3VXMD 4KNQA 3KCWA 4LHJB 4GSUA 4XN4A 4D9LH 4E2OA 2OI9C 3HE6A 2QQLH 5IZ7A 3O3DB 1DLHA 4ZPTB 3RWDB 1EQWA 4K0OA 5ID0A 4X9IA 1UVQA 4U1IB 2GC7C 4WCYH 1S7UA 3H3BC 3IDGA 3MCYA 2AK4D 4N2NA 4HCRA 3WMSA 1R0AL 1PZAA 1R5WB 1ZHKB 3JTTB 1TUPA 1XF3A 4DZ8A 4F5CA 2FO4B 5F72S 2BIHA 3BPNB 5G4NA 2QV4A 3FOLA 5I1KH 2DB8A 4YJZL 1SVCP 4OCXH 1A3QA 1SOKA 5BMFH 5DJDB 2Y2YA 1U4EA 3TL5A 4BZ2L 3AUVA 1HCYA 3H7LA 3T2NL 1MG3C 2XN0A 5E6SB 3OPZL 4XPBH 4DGVL 4ESKA 4G5AA 3RI5F 1E28B 4FLOA 5DMIL 5C2BL 2C9UA 3CC5B 3BW9B 4OLUL 3ULSA 3MA9H 4H26A 1HQ4B 3LHPH 1K85A 1N2RA 2HG5B 3PV7A 1TQUA 3CPLA 4OV5B 2Q10A 3DURA 1NGWB 1MCFA 2P5WE 3CFCH 5F97E 1HXYB 1WFMA 4WHTA 3MRJB 4KI5C 3GBNL 2WJ5A 1EEZB 4YWGH 1ZV2A 1JMZA 5BRQA 3VI4B 1T0MB 3MRQA 4OZGF 4JFPA 5K39A 3BSZH 2BS8A 3P77A 3O6FB 1ORSB 3G6JB 3FBKA 5CSZA 4AK2A 4KDVA 1F18A 2VQ1A 2Q7AA 3MVSA 3HI6H 2IQ9H 4A68A 4ELMB 4OD2B 4EUPB 4YDJB 3PHOB 4J3SA 1UOLA 1YJDL 1JHLL 3R06A 4TPRH 5HDQH 4P2OA 5BV7L 1NCDL 1I1RA 3TBWB 3DX8A 5C71A 4OFYD 3F04A 3ME0A 2FHBA 4R7LA 2NCEA 1R9FA 1F1GA 2P52A 1Z9LA 4FEIA 5DEJA 4YE4H 2DQGL 1GY1A 5DEZA 4P2RE 5D7JC 4MCZB 3D2UB 4NQXA 4X7TB 3CLFH 4X9HA 5CJ8A 1PKQE 3D85D 1ITCA 3QR0A 3VFUA 4FQIL 3BZFB 1T5XB 1U8JA 1UCBH 3KDPB 5DQDH 4URKA 1KIPB 1UACL 3GQFA 3IDNA 1SHSA 4TLTA 3GTTA 4JDVB 1AS6A 4IKJA 3TNMB 5LCVH 1Z5YD 4PY7B 3L45A 1QW9A 2L7JA 4N0CD 5FB8A 4M5ZH 4U1NB 5F2FA 4PWEA 5CZVH 1HWGB 2MKWA 1BX2A 3HB3C 3OMIB 3ZRSA 3PJNA 1W0WA 1G0YR 1OCCB 3US1A 1B4TA 1MG2C 3T8XA 3G9VA 2GFBB 3MLVL 1NCHA 1J8HB 1P4IL 4KVNL 1CBVL 4FQPA 5FKPB 3UTZB 1ZANL 5L4MA 2LVEA 3MBWB 1ET5A 4UT9A 4O00A 1Q9OA 4UNIA 4ZMAT 3S2CA 5KSBF 1KYFA 4WHDA 2V7HB 3EYFA 2ODIA 1R46A 2FR4B 4XC1L 4R7VA 4RBPH 3RIFK 5BVPL 5KSUB 4Y5VB 4JRYA 3UAAA 3GDCA 2EXSA 2OL3L 3CVIL 1PGRB 1INDH 3MBEA 4KKBD 5GRXG 1ES0A 2BJMH 2EAEA 3GTNA 2WVSA 2ERJB 3HTLX 1IBFA 2NX5A 1ND0A 2VLJD 4IMKC 3MZGB 1H0DB 3GGWB 2V6HA 3K81A 3GXIA 1E5ZA 4FQ2L 1U3ZA 1NQBA 2V5MA 2VDPL 3RAJH 4EXKA 2H32B 4CNIA 4NLHA 2HJFB 4PS4L 3S48A 3Q13A 4R96B 4P06A 1KCBA 1KXQA 2IOIA 3VMOA 4CW1B 1DBML 3H9YA 4G71B 1INEH 3SQOH 3I6GB 2Y2WA 3BKYH 1KTCA 2C9RA 4PJHA 4QLRA 5DVOA 5A2LH 1I8UA 4KXCA 3KBEA 2R0LL 4IHOB 1NTDA 3HG0A 1ZSHA 4YDVB 1P5UC 3TIDA 4R4FL 4KX8A 5HI5C 2K9UA 4HS8H 2PTTB 4XXWC 5TE6L 5L88H 3TEXA 4NCC2 5EZJA 3HE7A 2Q2LA 4E41B 5ELIA 2BIMA 3QWQB 3S34H 3VFVB 1CDHA 2D7QA 3GMNA 2GJZA 4YR6B 1ZGLA 3GXTA 4IRJB 2JF1A 3IEAA 3SOTA 5EO0A 2DV6A 3ASWA 2RGSA 1BIHA 2PWFA 2EVHA 3G6DH 4K3DH 4LPTA 5I1AA 2A74B 3RIKA 3IK2A 2K4AA 1X5AA 5KSAC 1MFMA 1AR1C 2OBGA 4EI6A 1TXKA 1R5IB 4A7GF 4YSCA 4FCAA 3B9VA 4HULB 3TA3A 4FZEL 3TO2B 1UM5H 4CL7A 4Y19B 4ZDHA 5GRJH 1KC5L 3LEXA 4K8RC 4LEXL 4XMXA 1MCEA 3LZFL 4AJYV 4GXUN 2IPUG 1OAYH 2Y6SD 2YQ2A 4JB9H 1VPOL 1I7TB 4XXDB 4HF5L 2NSMA 4HIIB 2JLPA 4YDLC 5LBGA 3V5HA 4LSUH 4Y16B 3NTCH 2GB2A 1YLBB 2H6PB 5BO1L 3SZKC 2C4FU 1L0PA 3D3VE 4I1PA 4LT7A 4GEIA 4KUCD 3CVHL 3UAJC 5AG9A 3OD3A 3U4EB 1TCRB 3H7BB 5IM7A 2OYPA 3VFGH 4ORZC 3CSFA 3RPKA 5B8CB 1TVBA 2NY3B 1T0NA 3CZUB 5C0BA 1N3NA 2G5UA 3N1GC 2XZQL 4JY4A 4KROD 1J0IA 2X2HA 5IBTH 4AVHA 3QG6B 2YXVA 2VQ4A 5DRWB 2DKMA 3VX0A 3QIWC 1TT6A 4MDIB 5IROD 2QBWA 4G5ZL 4WWKD 5IHHA 2PN5A 4O51B 4JZJA 4C83A 3CZKA 4NO5A 3MKGA 2ED6A 2WCGA 4EDWL 2XZZA 4L8DA 4JFEE 3FKUS 5KBNC 4LHUB 2GSGA 4YSOA 4I3RL 4GXVH 3U36B 5LAXB 3ISRA 1YMHB 1JZ8A 4OI9A 4R4BB 4AQ8A 1Z9SB 1MI5B 4WNJA 3V4PB 1J1PL 2C1PA 1TENA 1TITA 3SQBA 5TDNB 1HVXA 2AJVH 2Z4QA 1ED3A 3VYNA 2KL6A 2OMBA 1W9XA 4K2UH 1I1FB 4U1GC 3SEPA 4F3FB 5HP5A 2VAJA 1EHLH 1JN6B 3VO0A 3H53A 5FYLE 1LK2A 3CFUA 1T89A 3IDMA 1TIUA 2B0SL 3E6FA 4YIQB 2EIJB 1JHTB 3I9AA 4QT5A 5D7HA 5EU6B 1SYVA 2HTLC 3FUNA 3FB6B 1P6AB 1KWGA 3QJOA 2NY7H 5KBPA 3M1OA 5CZXD 4GXFA 3PABB 5DHVA 2BWQA 4JQIH 4ZFOL 4MMXB 4NUMA 5GGVH 3TWCH 1Q38A 5HYQB 5IGXL 4Q6IB 1F11B 4L4JA 1I1YA 3SYCA 5IFHL 2AXHA 2O6FA 1YN6A 2VXSH 4P2QE 5FYLD 3H2PA 3DHJA 3GB7A 4ZUVB 5CGMA 1QUNB 3A3YB 2XZCH 1V10A 1EBPA 4JKPL 2DTMH 5I76B 3K6SB 3WJMB 1XB3A 5DUML 1I9RH 1VLXA 5HXMA 1EEYB 1G7QA 4RRPM 5E2VH 3C8KA 3D18B 2CWRA 4EQ3A 5HHNA 4QHMB 1MAMH 4X6CE 3W57A 4TM9A 3HZ3A 4R5VA 1XFPA 3QXAA 3HG1B 2P8PA 1D5IL 1P7KA 3TTSA 1O75A 5CEYB 4P3CL 4P2QD 1E6JL 3QGVA 4NO2B 5HGGS 3CHQA 3ETBF 5C6TL 1UT2A 5JO5B 5JDSB 2P9RA 1S8DA 1A6AA 1EFQA 5J6GB 1V27A 5LGHL 4KTEH 3DVNA 4M9OA 1S7QA 2PWHA 3HBZA 3CZEA 2B3RA 1SM3H 4Q56A 5EZIH 5BRZE 3WIAA 2VMFA 2R4SH 5AOZA 3JWOL 2ZOTA 5F9OH 4A7VA 3GSRB 5D7IB 5TQ0L 1II4E 3D0VA 4MVBC 2COQA 5EHFA 1FH5H 2OMXB 2LV4A 3OSKA 4M9PA 1DUZB 4C57C 4ZUSA 2FH6A 4JM2D 3VXOA 1DO6A 3L81A 5HYSG 1MIMH 2OSXA 2VMCA 3BPOC 1GOGA 2DLIA 2FL5B 1GSMA 1Q1JH 1BFOB 3GPEA 2RCSL 4GBXD 1HT6A 5BRZD 4BIKA 5IHZB 1Q9KB 4OD1L 3LKOB 2OSYA 3OB0H 4PGBB 2QSVA 3DGGA 1NAMH 2EXTA 2QQKH 5F89A 3PAZA 4Z8FL 4DWHA 3F5WA 4XVJH 2FEEI 3CXFA 1T04B 4S10A 4KV5E 3SBWC 2HFGL 2WBWB 3EHBD 3IJHB 4MZRA 4ADGA 2WNKA 3LS4H 3TBVA 4F7TA 4X8CA 2JE8A 4Y5YB 3QQ9C 4LAQH 2UWEF 3ZUCA 5EU5B 3VFWB 3WE6B 4E5XB 4PJAF 1I31A 4OJCA 2FJGA 4MAYA 2AJYL 5D4QA 5GRVL 1T20B 4OT1L 4S1DD 2X2JA 1TVDA 3DVGB 4BFEA 5DK3A 1IT9L 4AMWA 1PKOA 3K6FA 4MQXD 5GS1C 2DZEA 2NXZC 4FG4A 3C6SA 2VXUL 4I18C 3DRTA 4BA0A 2MCMA 3OKEA 4M3KB 3U46B 4L1SA 1BAGA 3QXDB 4JFSA 4N0UB 2AHIA 4OZGA 5DFTA 1RZJC 1VEOA 3IDUA 2EEBA 4O2CB 4JPKL 4MA7L 4NRXB 3UYPB 2NY4C 4XNMA 2PPCA 2QSCL 3HFMH 4TL4A 4FG2A 3IGAA 1J0ZA 2UZIH 1KYOK 4HJGB 2NUPA 4L37B 2DOCA 2DI7A 4WU5A 2VYRE 2EH8H 3T4YA 2CDFA 1E2VA 1A8ZA 4AXWB 3WSQL 3BDYH 4ZOBA 3D34A 5DHEA 1FQ9C 1XIWD 1YRKA 3ZTJG 4F91B 4OJEH 4HIQA 1UD6A 4PMFA 4ELKA 3WJJC 2W59A 3QAZB 1O9WA 3CQQA 3QNYA 1NUNB 1M3IA 2Y7QA 1HL5A 3TZVC 2PCFB 3IRPX 4X4KA 1QBLL 1U8LA 1JV2A 2Y3AA 3BRFA 2EXYD 4KZEL 3W56A 2A38A 3UPCA 4P59H 1K5NB 4HK3N 3SOBH 1SVZA 4MA1C 2J72A 4AL8L 1P2CA 1TETH 2YPVL 3JQOB 3KYKL 4P57A 2CJSA 5AZEH 2J5WA 4MNQD 4B5ZA 1G7MB 2ED8A 4LU5H 2F74B 3NRQA 4PRAB 2UZXA 3QEQE 3L9EA 1OAUH 3E38A 3QJFA 1NC4D 1UJ3A 5JUEL 2AC0A 2G9HA 4FE9A 2NDGA 5CIPH 1V3JA 2F5BH 5JHDE 2Q5BA 4OCWL 5FHBH 2Q7NA 3T3ME 5IFAH 1GKOA 2AI0H 3CFNA 5L6YL 1W2KT 3RX7A 1J9CT 3RWEB 4HIXL 2EUXA 5KSBA 4GS7C 3D0LB 4OJAA 2XWXA 2FX9H 4OIBA 1GR7A 3II2A 3SDCA 2GHWB 3NSXA 5FGRA 3ZO0A 2D2OA 3C5ZA 2AJ3B 4UQ3B 1F6FB 4G42B 4EZLA 2OAAA 4MJ5B 4A2LA 5HHQB 3HA0A 1PU0A 2P44B 1AXTH 5I28A 2ALWA 4BQ9A 1ZS2A 1BDYA 4NENA 4ZMQA 4L8SB 4RZCB 4OGXL 5JHDD 4ZX6A 3QDGD 4XE0A 4DHLA 1RIUL 5C0RH 5CGTA 4NRYA 3HMXH 4QXGH 3DSFL 5IHLB 3K6OA 2R4RH 4Z7OF 5C70A 3SE4C 4GAYB 2A1WL 4PHXA 3OBAA 3RNKA 4DFHA 4G80B 1UZ6F 4LSVL 3QUMA 3ZR5A 4M7ZB 4H8UA 5DC4B 3F62A 4DK6A 5F1NA 3ULUD 3RIAK 1N10A 3S37H 5I30L 1RURL 3GMRB 5CEZE 1E7UA 1RVFH 1TTCA 2QQNH 2ALAA 4ZX4A 2IG2H 2Q86B 5JNYB 2ICWA 4IOIA 4PRPB 2WTOA 3MLXL 4UIMA 3BPLC 3I3EA 1UM4H 2ZOLB 3UBGA 2P42B 1BZ7A 3AW5A 3NIFE 4HD9A 4V1DB 5DEFB 5DUJA 5C0CB 4CN6A 4ZNEA 3FN0L 3MLWL 2Z92B 3PNRB 4A63A 1OSPH 3BISA 3V52L 3OAZK 2ZONA 2CXKA 5F1SA 3HE6B 1JPGA 3IXTA 4W1TA 1CLVA 4A7GA 1DLHB 2HLFC 3VM5A 4CGTA 1RSFA 4C56A 2VWEE 2XV2A 4FNSA 5ID0B 1UVQB 1JF6A 1UUSA 4ZAKA 4BWTA 1LE9A 4O58L 1S7UB 4O4YH 2OCJA 3IDGB 4UDTA 5D5MA 3V4VL 1BVOA 3ABLB 3POCA 4R3SB 2VH5H 4X5RA 1YEWA 2JELH 5IY5B 1XF3B 3T0WA 4DZ8B 4BGDA 1ZLUK 4X8GA 1A7NH 2GJRA 3S3PA 3SGEI 3FOLB 4ATWA 4EVNA 1D9KD 5I24A 5E0QA 1KT2A 5CJQH 2D7PA 1KV7A 3BAKA 1CFBA 5GZND 3TJHC 2WZPA 3CZGA 2ZCKH 4UNUA 4HKZA 1FNGB 3RTQA 5JIDA 3X17A 5FEBA 1CXHA 3MHZA 4Y1AA 4AGQA 5KYUA 2OPCA 4XN7A 3NVQA 1FHGA 2EABA 5I1CH 3IMBA 3RWFA 1OSZB 4H26B 2G60H 1G5AA 2ZJSL 1N2RB 1D5BA 3JV6A 3CPLB 3QUXC 4OJYA 5I66A 3DURB 5L8KB 3J07A 2QV2A 2XLLA 1PPIA 3H56A 4PRIE 5ILTH 4S1QH 2R2EB 3C12A 3T0ED 2ZX9A 2V3FA 5I8KH 1G0XA 4WHTB 1A3ZA 2F1BA 2XV0A 3ZUNC 2HT3D 1QMUA 4E42A 3CIAA 2F1AA 1BD2D 1NCNA 2ZSVA 4GP4B 3LB6C 2ZKWA 3NZSA 2N0MA 3MRIA 3H1ZA 3RTLA 3QI9C 4JFPB 4KJWD 5K39B 4DP9X 2NYKA 4BZ1H 1U9KA 4P4KB 2YKKA 3IF1A 1A7OH 2OSLA 3P77B 5DURB 1Q94A 4PR5A 5CSZB 2VQ1B 4B9GA 3H85A 2R2BA 4HQQH 1H9VA 2EUZA 4MHHG 2XUWA 1DFBL 3PPEA 3R06B 1E4XI 1Q1PA 5AOKA 1K3IA 3MUZ1 1WISA 1TQBB 4P2OB 2BIOA 1NGZB 1C9SA 3DJRA 4IBLT 4PVLA 3S88H 4GUOA 3DX8B 3EJSA 3ME0B 1C5CH 4PP2A 1PYWA 1A4KA 3BKCL 3ARGD 4HU8A 1TNNA 2CMRL 1B3JA 2P5EE 1VIWA 1G0DA 5SWZE 1BFVH 3PU7A 4X6BA 4NQXB 4V2CB 1U3YA 1HAWA 1MLCA 4UTCA 4Y4KC 5LQBL 3VFUB 4FEMA 4NQSA 1U8JB 1U8IA 4MA8L 1K3ZA 2FQEA 2XX1A 2XA8H 3P4NA 4RAHA 2QVMA 3INUL 2BNQB 2R8SH 4UIKH 3AT9A 1OV8A 3QB7C 3NCJL 1NLBH 4XBEH 3CAFA 5DR5L 3PAYA 4L4VD 2DM4A 1ZTXL 5FB8B 4OQTH 1NGQL 3QEGH 3VRLF 2Z1KA 1BX2B 4FQXD 4WI6A 4JHWL 4FGMA 2WXPA 1W0WB 4LQFL 5E03A 3ZKQD 5AKVA 3T8XB 3JUZA 3QO0A 4LVNB 1YEEL 2NYZA 3MUJA 1ZKAA 4X7CC 3RILA 1FC2D 1IGMH 1Q9OB 1QFWI 2WOBA 3MO1A 4FTVA 4LRIA 3ZHFA 3LV3B 1SQMA 3D06A 1BM3H 4OUUA 3EYFB 3C2AH 4LSDA 1JK9A 4JRXE 5SWSE 3O2VH 3WFZA 3EYUH 4UQDA 4JRYB 4K3EL 2OQJA 1PAMA 3MBEB 2GJ6D 1ES0B 3BSHA 2CHWA 3SBWA 4HT1L 3B7RL 1GL4B 1ND0B 2NX5B 1MFCH 3HG2A 3DDGA 3JWDL 1GGYA 3JT2A 1QW8A 4DN4H 4I48B 2A9MH 4RWHA 1ZGLP 4UINH 2ICEC 4PJHB 1FL6A 2VW7A 1P6WA 4IKIA 1F6AA 3SKUD 2ZE0A 4HJJL 1THAA 4ZPVA 3TIDB 4QR7A 4ZMXA 4F57H 1CGWA 5C0IA 2AK1L 4HJSA 4MJIA 5KYWA 4A6YL 4EBQL 4NYLA 3HW7A 4Z7VF 3HE7B 2Y2TA 5EZJB 2G3MA 2GJZB 1MH5A 1KGJA 5IF0A 4IU2A 3TPUA 1ZGLB 2KLTA 5EO0B 4IIQC 4YHMH 1ZVHA 3LQMA 3N42F 3K3QA 5FO9A 5I1AB 1RAMA 3C6LA 4MLSA 3MFFA 1T2QL 4LCYA 4N86A 3ZZQA 4EI6B 5AVTB 5JDJA 2VDQB 4AQOA 2PWGA 4GH7B 5E5MA 5D2LE 3TA3B 2UWEA 4ZDHB 4ONFH 2UZYA 3QYNA 4I4WA 3HJEA 4N8CL 1PEZA 2E9BA 3TN0C 1UXSA 3CXDH 4PJAA 4QCIA 4UV4H 2HCZX 1ZLSH 4PSPA 3ZL4L 4X4MA 4PRHE 5IHBA 3LH8A 5AVRB 2CKBL 1WIPA 5H37G 1MY7A 3V7AG 5DMYA 2RHEA 5JYLA 4WUUB 4KZDL 2K6YA 2KBGA 2E59A 3V5HB 3DJZA 3RGVA 1V3LA 4QWWD 4P2AA 4PJBE 4AIEA 1XMWA 2XQBH 4YHYB 3NDYE 4M7LL 2PETA 5IM7B 2DN7A 2NY1D 4PV8A 1FYTA 2R69L 3F6IA 4N2IA 4HPOL 1LP9F 1ROCA 1TVBB 1T0NB 1MRCL 2CJUL 4OFDA 1N3NB 5C0BB 3S36X 5FCUL 2R2CA 2PKDA 4KUCF 2R56H 4H5SA 1CMOA 2B1HL 3CXHK 3RQ3A 4EI5A 1V8HA 3H2QA 3I9PA 2Y1AA 3Q48A 4XVOA 4OCRH 4K8RH 4JZJB 2HVBA 4C83B 1BM7A 1N0LA 1REIA 4L8DB 1DDHA 4JEGB 2MCG1 2GSGB 5C08D 2XTJE 1UEMA 2GY5A 2MRYA 4FHJA 2YK1L 4HXAL 1FZOA 3CFDA 4G7YH 4OJFH 2WBJC 4BYHA 5C3TA 1V3KA 1RP8A 4N2CA 2C1PB 3L2MA 4R9HA 1OOWA 1T0PB 3EOAA 4LO9A 4YZFE 5F7AA 5AAPA 1F13A 1ED3B 1EDHA 1N19A 4OF7A 3UPAA 2E27H 3C60D 1TNMA 1N5YH 4WKXA 2X89D 5AL0A 1LK2B 2FH8A 1M6OA 5HHOD 1JZ7A 2Q7YA 1LE5A 3IDMB 1BQHA 3E6FB 3F01A 4QT5B 1QTYT 3V0WH 1JDAA 5C6PB 1SYVB 2VN5A 2XTJD 4N6QA 1IAOA 4NBXB 1FV1A 4JFQA 4JFUA 2PP8A 3HZMA 4KZCA 5DHVB 3U79A 1ASOA 5G4MA 2CIKA 2WQVA 4GFXA 3UX9B 1EWHA 2FB4L 2E46A 2ATAA 4B9PA 1RULL 2RH0A 2TAAA 1M4KA 2F5AL 1RPQA 3WY3A 1L9SA 4CA4A 1I1YB 3QRBA 3SDDD 1ODUA 1YN6B 1YVLA 1HHKA 3D4CA 4JKWA 3O9WC 3GB7B 4B0MM 1G9NH 2EDRA 3LD8B 3T9WA 6FABL 3MLYH 2XPYA 4CC4A 5F44A 5HGDA 2AEWA 3SY6A 1H5BC 4EXPX 3Q6GH 4BELD 1NCCL 4QD2E 5EZOL 1L3WA 1XTMA 1G7QB 4RGMB 5IVXF 4KAQH 3C8KB 1U92A 1X7SA 1ZY9A 1I7RA 5HHNB 3ZRCC 4B27A 1ZA3A 1TF4A 5KJRH 3QXAB 2P8PB 5JIPA 1P7KB 2VXQH 1JZ2A 1ZTMA 3VD7A 2YAEA 1MNNA 5FOBA 1CLYH 4EZMA 2IGFL 3QC6X 3VWJD 3TYFA 1S7VA 3U7WL 1A6UH 1JP5A 1KTJA 1A6AB 1S8DB 3BAYA 1JSYA 1S7QB 1RUQH 4LSRH 2E8YA 2GW5A 1L9PA 3JZYA 2XWJA 1SJMA 3D52A 3BRDA 2EUVA 5F7LB 3GRGA 3APMA 1J5IA 3X1GA 3D0VB 2JXMA 3MMEA 4OLVL 4WU7B 3KPRE 4Q4EA 1EAPA 2BSDA 1MCHA 2WUCH 4NN5C 1FAIH 4ZUSB 5DHXB 2CBOA 4PS7A 4TQIA 3I6LD 4P46C 3QUXA 3VXOB 3N06B 4PJ5D 3B4NA 1R3LA 3D0AA 1JFQH 4YHZL 1N26A 1IBHA 2J1XA 2ZUSA 4RGNE 5TPWH 1F56A 3IGUA 3VXMA 3HNVH 1IGCL 2N01B 2WB7A 5MERA 1Y0LA 2AW2A 2PR9A 4JM2F 4K73A 3FUEA 1SLWA 1E43A 2JFCA 5FUOL 4Z95L 3SQRA 5F89B 3VB9A 3N6YA 2J6EA 2VDKL 3F5WB 3GMLA 4OZFG 5F71A 2FECL 2Y36H 4N85A 2IBBA 2GSMB 1YDPA 3F58L 2AK4A 4KK5C 4PJ9C 1U8HA 4LCUA 1D2OA 4XBGA 3TBVB 3WXVH 4F7TB 3QORD 1MCQA 3PFUA 3DVIA 5J12C 3H9ZA 2AEQL 3VXQA 4C47A 5IJKC 5TGBA 1O7DC 2FJGB 2VDRB 1HCZA 2XETA 4MAYB 2DBLL 1S3KL 1AGFA 2C3WA 1Q9WA 5GS2D 1QG3A 4F37K 2IBZY 3WFDH 4DKEL 4WFGE 4HDIA 1BP3B 3DRTB 2DWDA 5DS2A 3OKEB 3U7YL 2WIIA 4DKDC 4E9RA 1I8IA 2JJUA 4XE5B 3TFKC 2W95A 5EOQL 5I1JH 4OZGB 2FD6L 4B9FA 4J4PC 2L04A 3U0WL 5TFSH 7PCYA 3FU7A 4BD4A 5AVYB 4XNMB 4UOJA 4H88H 3A4DA 3V7MA 3ZZLA 4GG6F 3IGAB 8CGTA 2BNUB 2HVKA 2NUPB 4ZOEA 3HB3B 3KJ6H 4WU5B 2K70A 3T4YB 4LKXA 1GPOH 1RXLA 1GHFH 2CDFB 2Z7YA 2J88L 5TH2A 1J9QA 2ZNWA 1BQUA 4LOEA 4PJIE 1H3VA 3JYCA 3DTUB 2Q8AH 1MNUH 1CG9A 5DJYA 2R0WL 1W6LA 4OM0L 5FWQA 3QNYB 4OFYA 2Y7QB 5CCGE 5ISZA 1ONQA 4MJ6A 1U8LB 1JV2B 3ARED 1NBCA 3AG2B 3IYLW 3G08A 3SKOA 4ZNCD 2V9QA 2HZHA 1OW0C 1Q0YH 2WD0A 1RZJH 2C9VA 3PP3H 3W0WE 4OZFA 3S5YA 3D85A 4CKQA 1P2CB 4W70A 3ARVA 4P57B 4YDIH 1CVRA 4K3JH 4KTYA 3WFEH 4IMLA 1RK1A 3MUUA 3CZJA 4N0YH 1SXZA 3B5GA 4NERA 4PQXA 1DL7H 1V7ML 2UZXB 1P9MC 3QFJA 4GJTB 2MCPH 1UXWA 1NKGA 4HEMA 2FUTA 3QJFB 1P4LA 3DYOA 1UJ3B 3EGSA 2G9HB 4K7PL 2H3XC 2A83A 2ICEA 4XCCH 5F21B 3QUZD 4G72B 2FYVA 1KGWA 3LKNA 1SXBA 2WSDA 1Z5LA 3ZT7A 2QADB 5E2JA 4TSAH 5KSBB 4X80H 1GOFA 2VO5A 3SDCB 3IGKA 1USQA 2BOLA 1QFHA 3C5ZB 3ELAT 3IMVA 5EMYA 5AAWC 3ZE1F 3IN2A 4D8OA 2NY6C 4E9SA 1IIIA 2PXYD 5D96B 3BVTA 1VADA 5FUZL 2RAMA 1J12A 1PLGH 4NENB 3QDJD 4JBSA 3V0VA 1J0JA 1AR1B 2E7LA 4NRYB 3QCUL 3V0FA 4HEPG 3L9BA 4GKSA 5ACLA 2PR4L 2OTUA 1HYSD 3QIBC 2ZXBA 5EO1A 3RNKB 4HJUA 4DIXA 7FABH 4D3CH 4FQ1H 5J89A 2YA2A 2JVUA 1SXNA 1X44A 2VLJA 2YMXH 3QUMB 2P80D 1MFDL 3T3MF 3V6FA 2A4ZA 5D70L 5K1JA 5F1NB 4TVUA 4YPGA 4YDLB 1MWAH 1L9MA 2V8LA 4H8WL 1JNHA 4KK8C 3UEZA 1A25A 3GJFH 3T09A 4X6FB 4NPYA 2VXTL 2ICWB 4IOIB 3MRCA 2V5TA 4DGIH 4G7VH 4Z7VA 4H40A 2F18A 3ULUF 4JO1H 3EBHA 5I0VA 2XZAH 1BZ7B 4KVCH 3NSYA 3P9WB 4PJ8D 2AJSL 4C55A 1QRNB 1M71A 4KQ3L 4FMKA 2BO0A 5SWQA 2PMZA 1WAAE 4GQZA 1SLVA 1EEUA 5ESQA 1JPGB 3IXTB 1JRHI 5IVZA 4JFXA 5HHME 2JQAA 3HVDA 4YHOH 2C1OA 3STZA 4C56B 5FOJA 3OG6B 4XTRC 4ZAKB 1LE9B 2I9LA 5D5MB 2FEDC 1E6OH 1MJJA 3CE1A 5JW4Q 3BMVA 5I17A 4EVNB 3U4BH 2F68X 2D4FA 1KT2B 5L8JB 4NRZA 5K1VA 4UT6L 2NNRA 1NMCC 4PM1A 2CBPA 3WG7B 1D7DA 1P53A 5FKAA 3Q5OA 1ECYA 3WY4A 3RTQB 3V0DA 1OM3L 4IRSC 4PB0L 4U1GB 5KYUB 1IRAY 4K3GA 3LYRA 2BMKA 1LP9A 3CV5A 3MJ6A 5AYUH 1GGBH 3RWFB 5C7ZA 1F6LL 3VGHA 4XCNA 1OT2A 3MNWA 3DKHA 3UP1A 1F8TL 4KJQD 1D5BB 3ZE0E 5BUGA 3JV6B 5I66B 5BO0D 4JMNA 3HOGA 1EJ6A 3B7YA 4OGAC 4E42B 4RETB 4AQZA 2ZSVB 3MV01 3AQYA 1X9UA 3LPWA 5EBLA 3MRIB 1EO8L 2D0FA 5IROA 4QHPA 2KQNA 4XBMA 1TZIA 3IF1B 1MPAH 3EO9L 3O9WA 3QEHA 2OSLB 3TOPA 1LO4H 1TYEB 1Q94B 5FA4A 3VGGA 2R2BB 1H5BA 2G75A 4GKZB 3GPSA 4D7PA 4DK3A 2JKXA 4PP2B 1PYWB 1A4KB 3AY4C 4FMFA 2WUBL 1NAKH 1SJHA 4IKKA 4Y2DD 3S35H 2DQUH 5AB9A 4QHUA 1CICC 4X6BB 3U83A 4OD3L 1VGEL 4XP1H 2ADFH 1MLCB 2H0PA 1IBZA 4NQSB 5HYEA 3NACH 1U8IB 5T5NF 5C09A 3HC4L 4POZC 3WNLA 4PJFE 3P4NB 5FYLL 4ECNA 2P48B 4L2YA 4M4RB 1MELA 3CBRA 1MXGA 4FFVD 4NZRH 1OLZA 1UQSB 3KWTA 5L9DH 4GW5A 5LGJA 3OJ2C 4ZG1A 1QSFB 4JDZA 3NIGE 2QVFB 4AKQA 4X6DE 1EO5A 3RX8A 3UO1H 4CVWA 5ID1A 3FTUA 4DGWC 3DGCR 2HFEB 1CS6A 2DM7A 4N20A 1LNUA 3ECBA 3OJMB 3R1GL 4XP9H 3V5KA 2UXFA 5IVXA 3B2VH 4R90H 3BO8A 3BPOB 4MDJA 3RY6A 1IKNC 1DJSA 3MO1B 4MBRA 4ODTL 3APCA 3BIKA 4FTVB 3QYMA 2ORBH 1RK7A 2HJLB 4P9ML 2YD6A 4OUUB 5SV4A 4CSZA 1TZHA 3JSSA 1OCOB 4DN3L 1JK9B 5ACMA 3WKNA 5D72L 2HMID 3MNMA 1PX8A 4YFLI 2V0AA 2YC1A 4MKTA 2OQJB 3TF7C 3EJTA 1YNKL 3N1FC 4IBQA 2W60A 4H4NA 5DTFA 3FF8A 4KU1A 5IESH 3I2CH 4PJ9A 4UM9D 2OX5A 3EF4A 2ENJA 1XGZA 1D3CA 2UY6A 3LRLA 5DF0A 1YPZE 3E8UL 2ZG2A 1SY6L 4FYRA 4Y9GA 2VZUA 1RZFH 2C3GA 3KL0A 3QWNA 4GRMA 1MHPH 4DO6A 5E5UB 4PJCE 5IJKA 2FNWA 4PP1C 5D8JH 4FG6D 1FL6B 1F5WA 2ZUUA 1F6AB 1MCNA 4ZPVB 3PE9A 2X41A 3ZXAC 4ATTA 1DBKH 3IFNH 2EADA 4QRPD 5AB0A 1LXMA 5D1ZC 5C0IB 4MMZA 4MJIB 5KYWB 4NYLB 3V95A 2WY3B 5TF1L 3RB5A 5J9PA 3JWOC 5IBUG 4JM2A 1MH5B 1KJVB 5IF0B 3F7VA 2VXVH 1MVUA 3LN5B 4IU2B 3D30A 2FO8A 4L3FA 3TPUB 4KY2A 1OGAB 2J73A 3EJYC 3VXSE 3QWRD 4BUHA 5FO9B 4IRZH 4GBXA 4DGYL 1JHKL 5CGYD 4HAGA 3C6LB 1GS8A 3DX1A 3PHQA 4JG1L 4L8BB 2EC9T 4LCYB 4RNRA 3VGEA 1TEGA 2F54E 4HWBH 2WWNA 3THML 2OS7A 2YGQA 3MNVB 5E5MB 2VRAA 1W72L 2EDYA 2B2XL 2UWEB 2UZYB 4I4WB 1RSYA 3ROOA 5J1TC 1UXSB 2HFTA 4PJAB 4QCIB 4TMPA 3OQRA 1SJEA 5HY9B 4L18A 4LDLB 3HIZA 1U33A 3TEZA 4HKXA 2CRYA 4U1JA 5SX4H 3PRZA 1BQ5A 2YKLL 5AOIA 3RGVB 2IV9A 3WKML 1A3LL 2H2PD 1G5GA 4TRPL 4YSQA 2F54D 3VNYA 3KYOA 3MKKA 4PV8B 4ENZA 1FYTB 4NQDB 3A4EA 1L7TL 2L7EA 5HHVH 4GG6A 1EJOH 2EYRA 3OVUB 3RGBA 1P9MA 2DIJA 2WNWA 2P8MA 2K6ZA 2ZF9A 3REWA 1S5IH 4H5SB 3QW9A 1GMIA 5CR8A 3Q9PA 4LESA 4XNUH 5E6ID 4EI5B 4KO6A 5AWNH 5DZNA 4LLMA 4KXAA 5IEHA 1R75A 4GUPA 4ZMWA 1H3UA 4UOW1 1HSAA 3OWEA 5E9NA 1N0LB 3RX5A 2F19H 1DDHB 5FCSH 3ZDZE 3A22A 3N40P 4BRVA 3LAFA 2JV6A 4KXDA 43C9A 1FZOB 3FMGL 3CFDB 5JW3L 4YN3A 3G7TA 3OKLA 2NNXA 2NNFA 5BS0D 3WO4C 4HWNA 3IJ8A 4OUOA 3GSNA 3EOAB 3TBSA 5MHSE 4QJ4B 1I75A 1NZRA 2EVFA 2LE9A 5TE7L 3BYTA 1N6QH 2YA1A 2JQMA 4LSSH 3GI9L 2XRAL 1Q72H 1M6OB 4LCIL 2Q7YB 1LE5B 3QG7L 3F00A 2VLKE 4OFQA 1BQHB 2J1KA 1TJHL 4Q9QL 3CVDA 5HYFA 1VEPA 2HN7A 1IAOB 4PCSA 1FV1B 1YEDA 4JFQB 5DFWH 1UEYA 3A4AA 5DD0H 3HZMB 5HHPB 4MNQA 5ALCH 5CF3A 3KNBA 4PTUA 2CIKB 4L1HA 2CGYA 1FO0H 2Y6TE 3RI5K 3KYMA 4LNVA 2WLNA 5HGAA 4AL8C 5MHSD 1NC4A 2W81C 4PJ7E 1CN4A 4J3XA 2CPUA 3UG5A 4TF4A 4YDNA 3VXUD 1HHKB 1MRDH 1NPUA 1NCJA 3BPLB 2VLKD 4OLYH 4QRTA 2ZOKA 1XGQA 3C5SA 1KZQA 1RUKL 2J8UF 3ECUA 3H9SD 1EAOA 5HGDB 1U30A 4Y5XA 2KUTA 3V8CA 5CP3H 4JNXA 4NBZB 1GYVA 2KLSA 3SE6A 2HT2C 3LEVL 2APBA 1PZ2A 1U92B 4HC1H 4M6MH 1I7RB 3O6KL 2XX0A 1ZA3B 2WJ7A 1YEIH 2X1XR 3NT0A 3NOIA 2X05A 4Z7OB 1CFTA 2A4CA 5ECJE 3TXAA 3VMNA 2CNYA 1S4IA 4QOKE 5E1QA 1KN4L 4F7PA 1DVFC 1ACYH 2A2QT 3FPYA 3EJUA 2BRRH 4XPGL 1IBBA 5KZCB 3QDGA 3BN9D 4ZO8A 3MTXA 1X5YA 3F3HA 2X88A 3QO1A 1YC8A 4M43L 4MCYA 2FJHA 1HU8A 1S7VB 3TYFB 4NFDA 3UOAB 4ABVA 3FU6A 1PX4A 4LIQH 5KBKA 5CLZA 4ZMYA 4JPWL 3X1NA 1PLCA 5LXGL 3GUTA 1PJWA 2XWJB 4M6AA 4A2HA 4IRSA 4OR1A 1G4MA 4PJDE 2OJ1A 1WZ1L 1NUFA 2CHZA 3A47A 4CSSA 5CEZL 2BIQA 4QOKD 2JXMB 3MMEB 4Q52A 3FUMA 4G6FD 4KKQA 3SE9L 1EAPB 1FSKB 3QNXA 4XPFL 1XR8A 5DD3H 3DIDA 2IPTL 3QUXB 3GNMH 5T3ZD 5FC9A 3FQTA 1KENH 2YGPA 1KTKE 1R3LB 4IIZA 4MAUL 4UZUA 1JXGA 5D1QE 3LSOA 3VXMB 4IBTA 3ZIMA 3OX8A 4U6YA 5MERB 5EUOE 4AJWA 1Y0LB 5EEZA 1WLHA 1FFPA 1WGVA 5TK4A 3TH2T 4P48A 4Z7QF 2CIIA 3ASOB 1HNYA 3GMLB 2VOTA 3MOAL 1B0IA 1NEZG 1MHHA 4R0LA 3ECQA 3WUWG 4CMHB 1U8HB 4JFOA 1TFPA 3IS1X 4LCUB 3EO0A 4K9JA 2AZUA 4XBGB 5C7XH 1NL0L 3O45A 4L48A 2HYMA 2KT6A 2Z93B 1X9QA 1OVZA 3AY4A 2Y3NA 4WRLA 5GZNA 4XNXH 3VXQB 5IW3A 3HCVA 3K2IA 2J6WA 5DWUL 3BCDA 4WIQA 5TGBB 2Z6FA 1AGFB 4P5MA 1Q9WB 5DVLA 3MLRH 1HIML 5F7FA 3UPRA 2DYPD 2BX5A 1J10A 2Y23A 1XGUA 2YMOA 3Q8AA 4HDIB 1P0SE 2DWDB 5T5FA 1NMAL 2F15A 4NKOA 5E6RB 3P4OA 4AQAA 2WIIB 5LBSA 1QBMH 1I8IB 2DQHL 3K2UH 1JGLL 5DYFA 1R19A 4G7RB 5B1BB 2W0LA 1ZJBA 3FB8A 5I6NA 3T0EA 1P7HL 1JMXA 1MIEL 1UWYA 3FU7B 5CM1A 5JZ7C 3HNTL 3FSVA 3B9KD 3BI9X 5K69A 5J4MA 1BD2A 4KMTL 2HVKB 2HAZA 3MJ8A 3FTGA 4MGXA 2C7UA 4DSYA 2RALA 1E3ZA 4LKXB 2B8OT 3TS8A 5F0JB 3U2SA 3G5ZA 5TH2B 4HUXA 4Z7NF 1HI6A 2J55A 1R0AH 3FNKA 4GMTL 5HDOA 3PNWA 1IKNA 4P5TD 1HHJA 2DQCL 3AT0A 3FYIB 3R8QA 1CG9B 5DJYB 3SY0A 5B3NA 4BZ2H 3T2NH 1CQKA 4DOHE 3OPZH 1AKJD 2R23A 3ARGA 1ONQB 4JREC 4MJ6B 4NN7C 4JO5A 5D1XD 3SKOB 3FXIC 4DGVH 3K2KA 3G08B 1HINL 4WWNA 2WTRA 3H0TB 2BC4A 5C2BH 1EO7A 4OZFB 3D85B 4OLUH 4PWGA 5I1GH 3F7KA 4NUPA 2IH3A 2FHCA 4IMLB 1RZPA 2D7NA 4JG5A 4KTDL 1E0OB 3IJSA 1G9MC 3QFJB 4KKAC 4PB9L 1UXWB 4HMEA 3PIQA 2O6CA 5I0XA 1NDGA 4G6AD 1P4LB 2Z7UA 3GZQA 4L2LA 3GBNH 2A6DA 2JTDA 3X2QB 1QD0A 2A83B 4L4VA 2ICEB 4KRPC 3LKNB 3OF6D 3P11L 1Z5LB 1MCKA 4FQXA 4PJXE 4KH2A 4JG0H 2AV1A 4WCYL 3REVA 1IBGH 2Z4TA 2GK2A 3W11D 1C1EL 2LFGA 5CNHA 4ZTEA 2AFNA 2IBGA 4XRCA 2WNXA 4PAZA 1B9ZA 1JHLH 1YJDH 5BV7H 1K72A 1EXUB 1WHOA 1ZV5A 4TNVF 1VADB 4HIHA 5MEOA 3T8VA 1HOEA 2DQGH 2JTYA 3V0VB 1TZOA 3DK0A 1O5PA 1KYUA 1KLGA 3IFLL 4GKSB 1CXKA 2RBLA 4FQIH 2OTUB 2EQDA 5EO1B 3TN0B 3CCHA 1G7JA 3FFCD 1UACH 3MROA 3KLHC 5JIHA 3V6FB 3EUUA 4PJGF 1CTOA 1YO4A 2G5RA 3T6QC 3O4LE 4TLUA 4YPGB 5JHAA 1S7RA 4JJ5A 1JNHB 4N6RA 4HG4K 4NPYB 3GSQB 3HFFA 3MRCB 2DF3A 2K8MA 4J3BA 2G0KA 3U6XS 2MFNA 3JWDC 4UDUA 4KNUA 4G9FD 3P54A 3PP4L 4UNVA 1KG0A 4F80A 2GTQA 4I5BA 1SUJA 3N42B 1M71B 4YSTA 3HI6L 3MLVH 1EUUA 3NK4A 3OWRA 1QI4A 1WHPA 4KVNH 2VZ3A 3WHE1 4AV0A 5SWQB 1CBVH 1TG8A 1ZANH 4WO4C 5ESQB 4F9PC 3HLAA 3FU5A 3WL9A 5IVZB 4JFXB 3STZB 2VDOL 4NQED 2C1OB 2N0KA 4O5LL 5HVFB 5MI0C 3J2PA 4FFWC 3LNFA 1QFWL 2EINB 4N4YB 1QPKA 4XC1H 3VI4E 1U91A 3GMQA 2CAKA 1HZHL 2I9LB 3JTSA 4NQVA 5BVPH 1L7IL 3S5ZA 4Y5VC 3CVIH 5I74B 1MJJB 1VF5C 5GJTL 3ETBJ 1SF3A 3CLFL 4MS6A 5HJDA 5I17B 5JHBA 3G6JE 4ELME 1SDAB 4JHZA 2XQYA 3IAGC 4NRZB 4ZFFA 1NANI 1TMCB 4RGOH 3FTWA 3IDIA 3JBG7 4FQ2H 2EDHA 5FKAB 4BHUI 4IYKA 2VDPH 4PS4H 4FI7A 2F53D 5CD3B 2BMKB 1LP9B 5FW6A 4QRBA 1OCRB 2HX9A 2Z8RA 2R0LH 5KOMC 3MNWB 2ADYA 3GJEA 4LSQL 3O6FD 4R4FH 3AS1A 4LE8A 3EH1A 1XDTT 3JWNE 5TE6H 5I73B 1E9QA 1YMMA 5IKCA 2CDEA 5DEGA 5AZ2L 4GAGH 4JGNA 1NGXB 3WOVA 2MPAL 3GSVA 3EZJB 3SKNA 2B16A 3N91A 3WAJA 4FP8L 5EBLB 2C3VA 1BZ9A 3GI8H 2Z1PA 1TZIB 1R34A 4KRLB 3O9WB 2E7BA 3QEHB 4HIEA 1JWSA 5FA4B 5DDHA 3W9EA 4N2HA 4FZEH 5C08A 1H5BB 2BJML 2G75B 4LEXH 1FE8H 3LZFH 4HKJA 1J8HE 1A6ZA 4NFCA 3MRRA 2IC2A 4L29A 2AZAA 2WQSA 3NCFB 4QMEA 3PP3K 1SJHB 3SCMC 1N5AA 4LL1A 4LXFA 4HF5H 3US9A 4QHUB 4QXUL 1IVTA 2W9DL 3HNSL 5BO1H 4FADA 2G4EA 3C60A 4WI4A 3F05A 2X89A 3CVHH 5HHOA 4Y4FD 5C09B 2NY5L 2YS4A 1S78C 4H1LH 2NPLX 5DRXA 4F7EA 2DQTH 4IBWA 2DIAA 4KKZA 4QTHB 4GW5B 2XZQH 2VITA 1U93A 3K74B 4JDZB 2WYHA 4KO5A 5D6DC 3V8OA 3WIHL 3E2HB 2W1NA 4OFPA 4NP4L 2OKMA 1PY4A 4G5ZH 4KHTH 5ID1B 2J8UA 4DT2A 2BK8A 3B9AA 4DTGL 1J0HA 5JHLL 1A4CA 3EJRA 1LNUB 3ECBB 2A0LC 3SDDA 4EDWH 3V5KB 3D8MA 4H8VA 4I3RH 3IKKA 2R9HC 3ALXA 3BO8B 1GZHC 4MDJB 2YBGA 3D33A 4KC3B 4G7SB 3ABZA 3U1QA 4E41E 3BIKB 2VDNL 3PWNA 3U82B 1N6UA 1J1PH 1TZHB 4AW4A 3J7HA 1BZEA 3CZSA 1OGSA 3DXAD 2EDOA 2Q3AA 4LSUL 3NTCL 4F7CA 2XIIA 3O6ML 1ECZA 2W60B 1QR4A 2K8QA 3RJQB 4N2EA 5DTFB 4Y1SA 5H4YA 4PJ9B 2B0SH 3NA4A 1T21A 2OX5B 3AM8A 5E99L 3ZDYF 2YBRA 5T3XE 4Y19E 2UY6B 3P3RA 5E00A 2EIBA 2P43B 1N67A 3ULVD 4MZ2A 1NOFA 3IM1A 4O02A 4GRMB 1FLRL 1HAUA 2YEZA 4E41D 5LB1A 5J12B 2EDLA 1BZ8A 3DX0A 4IRJD 4ABWA 5E56A 2DQ6A 5F3FA 5IGXH 4XO5A 1FFNA 1JK8A 5C9KA 2BP5M 5IFHH 4UTAL 2WZ6A 5AW1B 1RD6A 4MMZB 1EANA 2AVFA 1CUOA 3ZZSA 2OYMA 1RZ7L 2VZOA 1KBVA 3FW6A 3FTVA 4Q6YA 4XAKE 5J9PB 4JM2B 3FQUB 2J5LB 4PJ5A 5B4MD 5DUMH 1WFNA 3F7VB 3ILDA 2IGLA 1BGXL 2PCYA 4L1BA 1QFUL 3NYKA 3WGVB 2ADIA 4OVUA 2IV8A 2CUMA 1U8QA 4GBXB 1EERB 3B56A 3PHQB 4RNRB 2EDFA 5FM5M 1T1XA 2MPVA 5C6WH 5C1MB 3S98A 1XGYH 5DK0A 5HD8D 2BWDA 1D5IH 2R1YA 2CA4A 4ZD3L 1U42A 3SBQA 4PIRF 2R2HA 4AGOA 4P3CH 1SDYA 2OLDA 1WC7A 2ADJA 1FG9C 1E6JH 4PCKA 3QJVB 2ESVB 3ROOB 1TEYA 1J0YA 1ICTA 1SJEB 1UD8A 4KK9C 2X44D 2BHZA 5C6TH 4HKXB 2BFVL 4WI7A 2NY3D 3DGDA 3QORA 4M93C 4U1JB 1NEUA 2E6PA 1MI5E 5LGHH 2PP7A 4JHBA 4HALA 3SGKC 4H8PA 1HHGA 3VX1A 2OM5A 3M17A 2DQMA 2BSSA 2CRMA 2E3VA 5TQ0H 3X1EA 3KYOB 2WGNB 5KYYA 1IGYA 3BH4A 3FAWA 3GS7A 1T7ZA 1GYCA 1UKQA 1RZKL 4LHUD 4U49A 5EU6E 4GG6B 4GRWF 4GYBA 2EYRB 3DOHA 3QZWG 2UXGA 1UADC 3RIFF 3AG4B 2P8MB 3SB3A 2EO1A 3REWB 5IVOA 3HEIB 4YFLF 5J7CC 1I9RL 1MI5D 1PTZA 4A67A 1JZ3A 2RCSH 3BGFC 5E2VL 4LLMB 4ETYA 5IEHB 3NRPA 3VI3A 4GUPB 2XQ0A 3PPSA 4XMPL 5LUMA 4XCYA 1HSAB 3GEFA 4OD1H 5D7KD 1QZNA 1HFUA 1R6VA 5AFAA 4Z8FH 1AC0A 1RZQA 4NQCD 4JZOA 5ICXA 4GSRA 5TQ2L 5DUBA 1MZYA 1UCTA 2HFGH 5EU6D 5IBUB 3QDMD 3OKLB 1AYRA 4OAWA 2ZXGA 1YYML 2FE0A 4PBVC 1E4KC 2GUYA 1BF5A 2HA1A 3QNZA 1J18A 3GSNB 1ZWIA 3Q8FA 3TBSB 2BINA 3PHAA 3PQYE 1PG7X 4HH8A 1CR9L 2DJUA 5EZIL 4W68A 1TLMA 2AJYH 7CGTA 1CYWA 2WLKA 5FW7A 3HG1E 3AREA 2EXWC 4H25B 4OT1H 3S3DB 1CK0L 2WCPA 2HN7B 1IT9H 5DZLA 1YEDB 3ARFD 4L5FE 3NN8A 2Y07L 1RV6X 3EH2A 1RZGB 2VXUH 5DS1A 3V79C 4YSAA 3G04A 2OZ4A 1QPXA 3RB7A 3KNBB 4PTUB 4OVVA 2QDVA 4N5EC 1O7SA 2OYKA 5D2NE 1X5JA 3KYMB 4X98A 5FV1L 2Y7LA 1BFTA 5HGAB 4JPKH 4MA7H 1NC4B 4Z9KB 4FCHA 4K7PX 1TJGL 4CVXA 2QSCH 2EEFA 3BEWA 3S97C 5C0NC 2W80C 4HW6A 4IBYA 5D7IE 4YH6A 4ZS6C 4ADIA 3TT3L 5JXAL 4QRTB 2ZOKB 1IC1A 2BY3A 2QQKL 3OZLA 1XGQB 3C5SB 3V5DA 3NCYS 4XP5H 1FYHB 4MD5A 4Y5XB 1CLZL 4RDBA 3WSQH 4CN1A 4NZFA 5LGYA 2PABA 4FTDA 5IV2B 1VACA 3GLZA 4AG4L 2D3VA 2PXYA 1A64A 2KHAA 5F6HJ 1CFTB 1AZBA 3MBXL 4F7PB 2AANA 1UWFA 3QDJA 5EZPA 4KZEH 3KM2A 3QDGB 5J11B 4OF5A 4PJGA 3U30B 4EQ2A 3QO1B 1T3FA 3N2JA 4BUQA 3H4HA 4MCYB 5FFOA 2FJHB 1ETJA 4AL8H 5JW4M 1E42A 2YPVH 3KYKH 3B5TA 5DHYA 3RUGF 1GGIH 2FBOJ 4MMYA 1CXFA 4WK4B 5CJBA 3DDFA 2XJLA 4DVRL 5D9SA 3FT3A 2DKUA 3KLSA 2P80A 4L9DA 3GUTB 4IRSB 5CS7A 1XV8A 5JUEH 2O26U 1OTTC 3SJVE 4OCWH 4D2NA 2PO6C 1NBQA 3IMWA 3QNXB 4ETQA 3ZOAA 5GIRA 1XR8B 4BKTC 5L6YH 5IJCC 3AMLA 4H8WC 2EH8L 5C07A 2MSPA 3G6AA 4HIXH 3FQTB 2WZAA 5KVGE 4AKPA 1G6RA 1A7BA 4PJ8A 3DHUA 2X38A 1QQDA 3LSOB 5I5JA 2V9UA 4G2AA 3OX8B 4N0UE 4U6YB 3ZTJH 5C3IA 2BP0A 2DI9A 1AH1A 4JRWA 4HHWA 2VR6A 2NXYD 1NFDF 1FFPB 5BRPA 3QQ3A 2CIIB 5F8QC 4OGXH 3OV6A 4ABUA 1NEPA 3B8YA 3GMPA 2WXGA 4Z3EA 1MHHB 1RIUH 4R0LB 3DSFH 4JFOB 3SOBL 3EXJA 3EO0B 3UXFA 2A1WH 3DUUA 2WLJA 1OALA 3CK0L 3O45B 1HHHA 1RZIA 4HBCH 3LH9A 4LSVH 4X7SH 5IWLA 4XR8C 3F7QA 4ZJ9A 5I30H 1KJ2L 3HCVB 3QUYC 4W9GC 1KBKA 2WCSA 4FJ6A 4P5MB 2WOYA 3CFEA 4LDCA 3UC0L 4BXSV 3UPRB 5CINL 1XL4A 2F5BL 3MLXH 5IB4A 1XGUB 4A2FA 3TVMD 2YHGA 5EUOF 5F1IA 1UG9A 4AYID 4QAMB 4TV3A 4NKOB 3P4OB 4AQAB 3MV7D 4XNZB 4M7KL 3EDFA 3FN0H 2YSTA 3FK3A 3MLWH 4RX4D 4XOCA 2V33A 5AB1A 3FB8B 4WWKC 1BQRA 3T0EB 1V5JA 3MRNA 3V52H 4JX0A 1X4YA 4B3VA 3FZUD 4JRLA 3PWUA 1AXTL 3L9RA 3K1DA 5E9DA 1VEMA 4ANVA 1BD2B 4BCYA 3MJ8B 3G3LA 3FTGB 2C7UB 1C7SA 4U7SA 4U3CA 1FNLA 1CL7I 1XAKA 4LLAA 4O58H 2EZ0D 3U2SB 3V4VH 3G5ZB 4G9DA 4HUXB 4I0PC 5DRNA 2VC2H 2CK0L 4QXGL 2R4RL 1F41A 2EKSA 3PNWB 2WKOF 4TQPA 1H8LA 4LIQE 5CSGA 1HHJB 4PLJD 4OBRA 2K45A 3L3GB 4UQ9A 1A6TA 1S9VA 3GDBA 2JCCE 3SY0B 1P6FA 5GQBA 2HH0L 3K80A 1K6QL 4GSDL 3TH3T 1B6UA 2BNRD 3EFDL 1RKRA 4FHKA 4JFFE 1JVLA 1JPSL 2R23B 3ARGB 4Y2DA 3S37L 1YY9D 3MXWL 2IADA 3N44F 2BC4B 2DLEA 4NLAA 4WTZA 1AKPA 1NIEA 4RMTA 3N43B 5GS0D 1OTUC 2IH3B 2ZJSH 3QAQA 5C0EA 3O6LL 2B20A 3U9UA 1UWXH 3FRPB 4F9LA 3PIQB 1M9WA 5EF3A 1ESOA 1NDGB 2H2SD 1WZMA 4LL9A 3GS0A 3V0JA 2A6DB 4ZQKA 4Z77A 4L4VB 1MW1A 3D05A 4FFYL 3NG5A 5HYJE 4PRPE 1AHWC 4FQXB 5A6IA 5I2IA 2AV1B 2OJEB 3IAQA 4OIAA 5TD4A 3REVB 3KW8A 2VDLB 4FL4B 1HE7A 2AQ3A 5C0CE 4XRCB 4YX2L 4V1DE 1G9HA 2FT7A 2FWUA 1DFBH 2WQAA 3UCRA 1TQCB 1W8EA 5GGSY 3TGXA 4K94L 3MODL 3U7AA 1RH8A 4DVBA 2XWTB 5DJ6A 2IMMA 3ZKXC 3BKCH 4A55A 2FLMA 4HIHB 2ZCKL 1ID2A 2CMRH 5AL8A 4ZI8A 3QRLA 2VW6A 1M05A 5J06A 1VKXA 1KLGB 3DX3A 5LQBH 1DCEA 3AXLA 3R4RA 5I1CL 4UQIM 2HX7A 4MA8H 4Q9RL 1JZGA 3CCHB 1G7JB 3MROB 4UM9A 4F5CE 5C0CD 2VLMD 2D73A 3AS3A 5IB3A 4HK3J 3INUH 4WW2C 3ARYA 3I85A 2J8OA 3NCJH 2ZSWA 3VGBA 3CDZA 4HUWA 1CLCA 1S7RB 4JJ5B 3PL6C 4N6RB 3N5AA 3VQLA 3SGKA 2JK5B 4H2AA 3UYOD 5HDRA 1ZTXH 3HE6D 1PAZA 4UDUB 2WLHA 1EHNA 4JHWH 3KPLA 1VDGA 1UOKA 1KG0B 2KLRA 3GZKA 4LQFH 4I5BB 4QRPA 2E9GA 1EV2E 4V11A 1T66C 2XVLA 1MW0A 1YEEH 4HUNB 3HMWL 4TLKA 3CFJA 2V2WA 3CMOH 3HLAB 1IAIL 4YHPA 1A6WL 4H0IA 3S88L 5MEQA 3JVGC 4F2MA 3SO3B 4HUVA 4OIFA 4UAOC 3QWRA 3UJIL 1U91B 3BEVA 3GMQB 3OLDA 3ESOA 4NQVB 3P40A 4K3EH 1PFCA 1UURA 2XKNA 4FFZA 1SOQA 4QAWA 1U8KA 4ORGB 2XVKA 1XGRA 4HT1H 3QE5A 4X5XA 4ZFFB 4M8UA 3ZU8A 4UBDC 3C6EA 1NFAA 1J1OL 2CGZA 2XWRA 1LGVA 4XNBA 3IDIB 3JWDH 3BAEL 3KYNA 1U8MA 2E5EA 1CWVA 3UBXI 5KYXA 3NMEA 4XMLL 3APDA 3PWVA 1OQXA 5DFVD 4BE5A 1MFUA 2IH8A 4MQXC 4AY0A 2APTA 3F8UB 1BIIA 5KVDE 1EGJL 5I23A 1PD1A 4NGHL 3QEGL 1AJ7L 4PVNA 2OR8A 4HJJH 4P4KD 2IFFL 2YLKA 3GJEB 4ZSOA 1OAZL 2AK1H 1F4HA 3L3OA 1CF1A 4A6YH 2NY1B 4EBQH 1E9QB 1YMMB 5KTEL 3QXTA 2CDEB 5DEGB 1XX9C 2OW6A 1BXXA 3T6VA 3UJTL 1JGIA 3RZWA 3GSVB 3F65A 4N2KA 1BWMA 5D7LB 2C3VB 4YHIA 1BZ9B 1ETB1 1EZUA 3UTTD 5E6IA 5FDWA 1BM3L 1A2YA 2FQDA 3IS0X 3O3BA 4OZ4A 1T2QH 4HIEB 1JWSB 1DANT 3RGHA 4NNYB 5DDHB 2YQBA 3RIAF 2VDMB 3W9EB 3MC0A 1OTSD 5CEXA 5C08B 2FCBA 2XYBA 3AS2A 2FX8L 4N8CH 3ARDD 4HKJB 3OXSA 1YEHL 2BNQD 1A6ZB 4NWTL 1B0GA 3ZL4H 3MRRB 4ZFGL 4L29B 5HVHB 3QPXL 4MTMA 5JPMC 2CKBH 4KH9A 5KG9A 4KZDH 1N5AB 2YQGA 2NR6C 3OHXA 4W6XB 2ZP0T 5BS0A 3OC8A 4R2GC 2JB6A 4MBOA 2YD7A 5FK9A 3IT8D 4GQQA 2B4CL 4RVBA 2O5NA 2B1OA 3C60B 3IU4L 1N6VA 1OGPA 4JRYE 2BIIA 5HHOB 3C09C 3I75A 2X6VA 4ZBJA 2GEEA 4QXVA 1F3DJ 3MAWA 5DRXB 4F7EB 1URLA 3SDXA 2AXJA 1EZSA 2R69H 3AS0A 3HS9A 3K0WA 4HPOH 4N90E 1CURA 2NX5E 2D4DA 2CJUH 3FC8A 2XWZA 1ADQL 2VITB 1U93B 5FCUH 3S0PA 4WWPA 1IC7L 3II3A 5HI4C 2B1HH 3T04D 4WWID 1KXQE 2J8UB 4NNXA 5ESVB 4YHML 2VMJA 1NGYA 3DECA 4OCYL 4DETA 2PO6A 3HAEH 4PJHE 3SDDB 3VXUA 4BFGA 3LPPA 3X1BA 3TO4D 1IZJA 4JRYD 2NY2D 1KJMA 4B60A 4TTDC 4U1HA 1RJYA 2YK1H 3H9SA 4HXAH 2QVIA 1HDMA 3NJGA 4N90D 1BVKA 3GINA 2YD9A 3RVUD 2H0JA 4XVTL 3PWNB 4UV4L 1ZLSL 4LCCC 1IUZA 2WMPA 1NDMA 1NIFA 4KNTA 4X9YA 5H37H 4U2ZA 3U0PA 2YD3A 5GGTA 1JUFA 3RUGA 4MAZA 4F7CB 5JXEC 2WN3A 4FOMA 4LPCA 4IK6A 3FQ1A 3LDBB 1BF8A 1T21B 2XQBL 4HHGA 2WAHA 3O8XC 2QT6A 2VRKA 2YJQA 3C9NA 2YBRB 3EF7A 4XN9A 5E00B 5FWRA 4AMXA 3DC0A 4O02B 1JJUA 2ZAIA 2YEZB 3OM3B 1OE1A 5DO2D 2G9KA 4AEIL 4JL1A 3V0HA 3VFRA 1S9KC 2FB4H 2V2TB 4GQ9L 1RULH 1MAKA 2ZP9A 1U8PA 2DM2A 5FF6A 1FFNB 2F5AH 1JK8B 2QVTA 3ULVF 2BHFA 1KB5L 3QIUD 4J8RA 4Q6KA 4I7ZC 4APQD 6FABH 2ARJA 3FQXA 3FB5A 4WEUD 3BX7C 4PJ5B 5HTSA 1IGFL 1UASA 3D07A 1NFDA 1TJIH 1FCGA 2CQVA 1NCCH 5EZOH 5C0BE 4Z7QB 4LZKA 1Z9MA 3TH4T 2ADIB 1DBJL 3GRWL 4KKNA 4U1KB 1XSOA 4ZW5A 5DFAA 1U8QB 1ZHNA 1OO2A 1IBYA 2NNAA 4WUUD 5KBDA 3WIFA 5I1EH 1T1XB 1AOZA 2NTSP 2QMKA 2QQQA 3FU3A 4OZHF 5DK0B 2E27L 5IQMA 2R1YB 2R2HB 2EIEA 2BVEA 2WP3O 3V9CA 2GT9A 2ADJB 4FQLH 5F0LB 1GKEA 1MKFA 2IOOA 3L1OL 3NUKA 2IGFH 3GMOA 4G83A 1U3JA 3U7WH 3WY1A 3VG0L 2Y22A 4WFHE 2F8OA 3VTAA 3B3IA 1U3HD 4RMWA 3QORB 4MJ4A 2VWEC 1TTAA 1CTMA 3WNIA 3WFCL 1MFNA 3EJZD 2Q87A 3EAKA 4AM0Q 5F9AC 4N1HB 1HHGB 3MV8D 4EJ1C 3M17B 5J3HD 1HEZA 2M83A 1CFMA 2BSSB 4Z76A 1JOIA 5E4AA 4KY1L 5I1IL 4M48L 4PLOB 1DQLL 3HRZA 5KYYB 1IGYB 2DYPA 35C8H 4PYGA 2NZ9D 2NY0C 3SGDI 3FQYA 1ET8A 4GEJA 5GZOC 4JGJA 1TVHA 4YHZH 4FXTA 5A1AA 5GGRB 2F6AA 1O0VA 2Z31C 3VI3B 4Z7NB 1ZVSA 1AAJA 1NCIA 4ISVB 4XCYB 5L2JB 1C5BH 2JSFA 1WFTA 5KJRL 4RFEA 2WKOA 5FUOH 4Z95H 3U9WA 3H2WA 3EW3B 2VDKH 2ZNXA 4QHNA 3WNMA 4MXQD 4JZOB 3AU0A 1A9EA 1HQRB 5DUBB 5FPIA 3N3EA 1RIVL 1A6UL 1XMEB 1S5HA 3LKRB 1OXYA 1E67A 1UWGL 1ZWIB 3HC3L 4YBQD 3FOMA 3VH8G 2FWSA 1JNJA 2AEQH 2DD8L 4Y9BA 1HL8A 3IJ9A 5GGVY 3S4SG 5IEKA 5D1XA 3AREB 1F3JA 4KK6D 4A39A 4D7BA 3QUKA 1WFJA 3ZVVA 4DKEH 3Q3GA 3KDMA 3NN8B 3W39A 4QO1A 4MQSB 4UANA 1FAIL 1DQJA 3G04B 3U7YH 4WW2A 1A9VA 5KBLA 3NCXA 1N64L 4JFHD 4Q74A 3B9DA 2FD6H 4KBPA 2IAMC 4OGZA 5TPWL 4X98B 3U0WH 3DETC 4CVXB 3OJDA 3VFOA 4N0FA 5B7MA 2DJSA 2EDJA 3BEWB 3ZGIA 3FQNB 3P9MA 3QZMA 1KTBA 5AB2A 4JUSA 4HX1A 1QLEL 4LVOC 3HG4A 3HJ0A 1R1CA 3OF6A 1HNFA 2MOQA 3V5DB 5I6KA 4HLEA 2J88H 4MD5B 3EO1A 4UI2A 3L4WA 4OZFH 3BVDB 3AC0A 3EBGA 3CFTA 3BDXA 3BOVA 1IEAB 4E0RA 3P2TA 1UATA 3SBRA 1CGSH 3RVTC 1H3PL 3WXVL 2AAAA 1H3XA 2PXYB 4IBVA 4KI5E 2R0WH 4BCZA 3PG2A 3UGUA 3BE1L 4Y9FA 2LR4A 4RA3A 4DKFL 3QDJB 3NABL 1M2VA 3IDXL 1B0WA 4KNSA 3OMNB 1YN7B 2B39A 1LK3L 1SHMA 1F1DA 2X53A 1JGDA 4PJGB 1WT5A 3VDCA 5AUMA 1T3FB 3WFDL 3V4UL 2X1WL 5DHYB 4GAAA 3IWUA 2YN5A 2KERA 4MMYB 4CRPA 2RD0A 3FFCA 4EUPG 3M1CA 1V7MH 3HS0C 5D9SB 3FT3B 3VMPA 3P3SA 4LMQI 1X5MA 4KI5D 3VH8A 4U33A 5AVWB 1MCBA 5TFSL 3W81A 4RWYL 4K7PH 1PD6A 4YL4A 3ARRA 1AQ8A 4MLIA 4ZUUA 3TP4A 1XEUA 3S4SA 4ZPTA 1PZCA 4GMSL 4G8GD 4KX9A 5GIRB 1F97A 3QZPA 5DD1L 3FT2A 1F42A 2LU4A 4ZO6A 1OQOA 3AUWB 4G9FA 5C07B 4DH2A 1PNCA 3G6AB 4I3GA 1GHFL 3Q8EA 1G6RB 1VFBA 4PJ8B 4W9ZA 1D5MA 4UTBA 1QQDB 1IJNA 2AEIT 3LZNA 4XBPA 3ECVA 4DP7X 2BP0B 3FN9A 4OZGE 2Y69B 4NWUL 2VKXA 4I2XA 1KNOA 1MNUL 3AJ7A 2WXLA 4P8QA 5DJDA 5FUZH 1WWAX 1SN5A 4NQEA 5J6SA 1GRWA 3EYQC 3QQ3B 3WJLA 5D7JD 1DLFL 3GMPB 2QFPA 2QSQA 4OF8A 1PZBA 3QCUH 3CN4A 3P1VA 4J28A 5E9AA 3EGXA 2PR4H 1Y6NR 1J0KA 1XL6A 2APWA 3QHZH 3DUUB 5I1HL 1HQ4A 3SYQA 3W5MA 1HHHB 1RZIB 4DO4A 4OZIB 3EGDB 1L0QA 4FNLL 5JPMA 3MOQA 1MFDH 4TVPE 4MD0A 5D70H 3SCMB 4OU3A 2QVKA 2CO4A 4LMQE 4FN0A 5EN3A 3AB0C 5IHUL 4KDTA 1KGCD 1TZGL 1DE4A 2M26A 2VXTH 1DJGA 1E8YA 2F53A 3GXUB 4F33A 5IB2A 5IB4B 1T0MA 3HB3D 1FVCA 1J8SA 1EIBA 1N8OE 3IMTA 5F1IB 3TX4A 1N0XH 1D6EA 4TSAL 2AJSH 4TQEL 1F00I 4D0DA 1JZ5A 4KQ3H 4JN1L 4XODA 4EUPA 3MRNB 1E5BA 2VQUA 4U0RC 2E9WA 2ZX5A 4N68A 4TVPD 1UM6L 2Q9OA 2OV0A 3L9RB 3PWUB 1RI8A 5E9DB 3ARQA 1YNTF 2ICWI 3CN3A 2IH9A 2QKIA 5DUPL 4ZMOA 4PSRA 5JOFA 5DJ0A 1KXHA 3RE0A 2ZIDA 2ATPA 4U4BA 4B9ZA 1OF0A 3LEYL 4IOFC 2R59A 3PCYA 3FHAA 4G9DB 5DRNB 4E9VA 4JK0D 3P02A 1MHEA 1QACA 3M7OA 5KSBE 2EKSB 2VUYA 3WY2A 4DEWA 4Y4HC 5DZ9A 5GRVK 4GSQA 4UT6H 3MN8A 7FABL 1A6TB 1S9VB 2JJSA 2OP4L 2RQ8A 2VL5A 3L5JA 5EEUA 3D5OF 3TURA 1GSKA 3RVVC 4Y2DB 2O5ZL 4ACTA 4M1GL 1GZQA 2C8NA 1OM3H 4PB0H 2IADB 3C5JA 4JY5L 3QH3B 1LDPL 4G7VL 1AFVL 3RJDA 1TSRA 3O8XA 4Y7OC 4OV6F 1F8TH 4Y4FA 1I8KA 3RU8L 5HI5D 5C0EB 3U9UB 4P2YA 2XQYK 3SDCD 2EC8A 4EN3C 5I1DA 1TKWB 1E50A 2VN6A 1HXMB 4ZQKB 4DFIA 4GQPH 4Z77B 1DSYA 2GITB 1CF8H 4LPWA 2UUDK 1EO8H 1E5AA 2BERA 2BM3A 5I2IB 5TDOA 2OMTB 5I15L 3EO9H 5KSAD 3GRBA 1AR1D 1WWBX 3MLPA 1MN4A 4MXWL 3TT1L 1I8LC 4K8RD 4ZNEE 4M1DL 1QFWM 4XO8A 4DVBB 1MFEL 2GC4C 4XPTL 5DJ6B 2D31A 5SV3A 2V2XA 2WUBH 2WVUA 2VJ8A 2VO8A 4PGDA 5D7SL 3AWEA 3ZDYB 5EWIL 5I6OA 4C56E 3RBGA 3LS5L 4RFOL 5GPRA 1OCWL 1KOAA 1M05B 1VKXB 3DXAA 1VGEH 4OD3H 3AXLB 5DJZA 3UAJD 3VRJA 5DXWA 3HC4H 4FNRA 1L9QA 2WWOA 4UU9A 5FYLH 4LHUG 4UM9B 3DV6A 2ZZUT 4YXLL 5IB3B 3NJVA 1JGVL 4JCMA 1QRND 3NESA 2ZSWB 3CDZB 5T3XL 2P49B 4HUWB 3EG9A 3WEXA 4L1TA 3WGUB 5KSVA 2EUWA 1DQKA 3O2DA 3QIWD 1D2PA 1TTUA 3TBBA 4IRJA 3LQZB 4Y1AE 4WSKA 4UOZA 3IPFA 3UC2A 3KPLB 5ABDE 4QRPB 3R1GH 1H6TA 4K9EL 4YHLL 5CXPA 3VG9C 4F27A 1BXUA 4KKPA 2DDQH 5ALBL 5DVKA 1O9ZA 3KR3L 3EYSL 2CBQA 3CFJB 2V2WB 4YHPB 4OZHA 2LTQB 2CH8A 4ODTH 4QTIL 3BGFB 5FYKE 1XBDA 4P9MH 2H9GB 5EV7A 3BVVA 4J3OG 4F2MB 4DN3H 5MEQB 3WTUA 4HUVB 2VZTA 5D72H 3RTQD 3BEVB 2ZWSA 1TQSA 3B2MA 4PBXA 3A6CL 1QHOA 1YNKH 2YN3A 2XKNB 3QFDA 4ANXA 1VA9A 4BA8A 4OKDA 4HS3A 4RGNC 2W92A 5EEXA 1JI1A 1A6VL 1XGRB 2HTLD 1KGXA 2R29A 1YEGL 4X5XB 3U4EA 1BZOA 5L8LB 3QJQB 5LXVA 5DRZA 3E8UH 2IAAC 1SY6H 3KYNB 1U8MB 2GBUA 2I9TA 1Q8MA 5JIKA 3RRQA 1UENA 3TBYA 2P8LA 5KYXB 5FYKD 5L4IA 3PWVB 1QSEE 4YS4A 4MZIA 4H0HB 3EOYG 3IE4A 4JAMA 3V4PL 4ZW6A 1BIIB 2WNGA 5GGSA 4Q0XL 3UGEA 1KWKA 3CFKA 1KELL 3UEQA 3BUTA 3WDIA 4ZSOB 1MJ8L 3WEMA 3O3EA 4KJPC 1PCXA 3L3OB 5INCA 3WN6A 3B2PA 4FLQA 3VVWA 3FSZA 5TF1H 4R90L 4LHUA 1I9JH 2FLRT 3LVTA 1JPST 4GINA 32C2A 4YHIB 2BZDA 2HKFL 5E6IB 1RZKC 4RISL 4DGYH 1JHKH 4LDEB 5DHDA 5DGQA 4AQ1C 5TDNA 3O3BB 4JG1H 4OZ4B 2KDGA 3PDOA 3THMH 1UOVA 1F3DH 1QNIA 4CDHA 4X50A 1W72H 5CEXB 2B2XH 4NQCA 5AW9B 5AVZB 4YIQA 3OXSB 1OHQA 3EOTL 2Y7SA 4AUJA 1B0GB 5D55A 3QDMA 2WBKA 5KG9B 5CBEA 3GSUA 4FTVE 3OHXB 2YKLH