5LXVA

Crystal structure of ruminococcus flavefaciens scaffoldin c cohesin in complex with a dockerin from an uncharacterized cbm-containing protein
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
172
structure length
172
Chain Sequence
ETVQISASNAEAKAGDQFEVKVSLADVPSTGIQGIDFAVTYDNTVVTIDKITVGEIADTKAASSDQTASLLPTFDVSIQNSEGYSSVIWSTAVEDSSYWISKDGVLCTITGTVSSNAKPGAESPIKLEAVKRETYVGSGTDNSSISAGYSANDKAVKYTVKATNGKISVPSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Scaffoldin C
publication title Single Binding Mode Integration of Hemicellulose-degrading Enzymes via Adaptor Scaffoldins in Ruminococcus flavefaciens Cellulosome.
pubmed doi rcsb
source organism Ruminococcus flavefaciens fd-1
total genus 41
structure length 172
sequence length 172
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lxvA01
4IU2A 4FL4C 3GHPA 1TYJA 2Y3NA 4DH2A 1OHZA 1ZV9A 3KCPA 2O4EA 3BWZA 4UYQA 2W1NA 1AOHA 4IU3A 5LXVA 3L8QA 2ZF9A 4FL4B 4N2OA 4U3SA 4WKZB 1QZNA 2VO8A 2VN6A 5AOZA 4UMSA 3FNKA 3F2LA 2OZNA 2JH2A 3UL4A 4WI0A 2BM3A 2XDHA 1ANUA 3KCPB 5K39A 5G5DA 2B59A 2VN5A 2CCLA 1G1KA 4UYPA
chains in the Genus database with same CATH superfamily
2YMXL 3DROA 3BEWA 2FL5A 2UXFA 3BMVA 5L6YH 3NGBB 1V7NH 4N2FA 3ZYOA 4FNSA 4ZPVB 1OHZA 2FGZA 1KYUA 2NT0A 2YMOA 5BO0D 4HX1B 3HVDA 5F6IC 4AJVA 3WNLA 2JMRA 1KXQA 3QH3B 5FYKL 4D9RD 1H5BB 4UTBH 1MJ7H 3L3HB 2BIIA 4Y9GA 3C08L 4XN4A 1KY6A 3VU1A 1R1CA 1NIEA 2LLLA 3AC0A 4LSVH 3CHSA 4BK5A 2CA4A 2VR7A 3O3BB 4R2GB 2ARJQ 5IMKA 1PZ5A 1CT8A 4JQVA 3N5AA 4RRPG 5IQ7H 1P0SE 1ZA6A 3DV4A 3WUWB 5L0QB 3F6JA 1FCCA 5M7QA 2CLVB 4JQIH 1JPST 2BVQB 3VFRB 1FO0A 3RWGB 4NJAH 1HESA 5T3XH 4LU5H 3JWOC 2EDOA 3Q1EA 5C08A 2JKRM 3MLPA 4Y4KA 3JWNH 3WNIA 5C71A 1EQWA 1T1YA 4GIAA 5KVEL 1NJ9B 4P2QA 4E9YA 3INUL 3VGFA 1O6VA 1COBA 3EXJA 5LAXA 3A6BH 4QHMA 3ZKXC 1HNGA 1NEZA 1YC7A 3JWDL 1WK0A 2XWBA 3L3OC 4ZMXA 1HI6A 1U8QA 2A4EA 4U1IB 3ULUL 1BVKA 1HL4A 3MMEA 3DO4A 4Q8BA 4HOWA 4PTTB 1OB1A 4HHAA 1IQDB 1FGNH 3CFIC 3HC4L 4M8VA 1TIUA 3WTWA 1BF2A 1UB6B 2J1XA 2AAVA 1A14L 1U8MA 1XCQB 4Y2DA 3RVWC 4BSVA 4Y4FD 3DK2A 1MEXL 5IF0A 3KBFA 3DX2A 3IMUA 2K4AA 4E9TA 4HKXA 2K3HA 1O7SA 3W9DA 4XWGL 5J57B 1F42A 2CGZA 1OWWA 1TQBB 2WLIB 3L4TA 4Z7WB 4WTZG 5FYJE 4X83A 1A3RL 3OTTA 3FU6A 4NZRH 4CMMB 1VJSA 2G2RA 3EGSA 3MLRL 4ZW6A 3ZDXF 2EDBA 1OP4A 1R3HB 1GZHA 2ZOKB 3FRUB 1CICB 4AK2A 3PFQA 3TV8A 3WAJA 2BSTA 1SEQH 4D9LL 5TGBA 2Z4QA 1RPQA 3VRLE 1EV2E 1YEHH 4E41D 3GLAA 5FM5O 4EI5B 2Q87A 1SJEA 3IAPA 5J1AA 1AYOA 4I0PC 2TSBA 3OKLB 3DKHA 3FSAA 1I53A 1A9EA 3DVGB 3LEYH 2YD0A 4CC4A 5B4MD 4JDTH 4RFOL 2R0WH 4IS6A 3E80A 1J1OL 4P48A 1JI2A 4YHOH 1F6LL 2V5RA 5IWLA 1MNUL 1P6FA 4NGHH 4MXVF 1KN4L 1GC1H 1S5HB 3OF6D 3VJ6A 3FONB 3ES6B 4N28A 1ZY9A 3DURB 4KH9A 3WN5C 5I19L 3L9YA 4KAQH 2A9DA 1GAFH 5AW8B 4BZYA 1BEYL 2J8UF 4URTB 4YUEH 4Z3JA 1X7QB 1U30A 2OQJA 3PGDA 1XXFC 3QNXA 3WUZA 4DPRA 3CHQA 3ARTA 2HWZH 1HNFA 3ZDZF 1V7NL 2R9HD 1L0QA 3CXHK 5KOVC 3L6FB 2ZKXA 1ZV5A 1FE8H 3MRHB 2GFBB 3QJHA 4UYPA 4QRQA 1CFQB 3G5XA 4UTBL 3MXVH 2WB7A 2LAAA 1HHGA 5FO7B 2A73B 3L95B 1JUFA 2DBLL 4YE4H 5I0DA 2VLRB 5CHNA 4FI6A 4LSVL 2WSKA 4A38A 5E1GA 4KXBA 1A9BA 5IQ7L 1E7UA 4A2FA 5GJTH 4JQIL 4IOSA 5T3XL 4LU5L 4Y7MA 5EH1A 4MSWB 3LPPA 1Q0EA 3D2UB 4WW2F 1S9WA 1YN6A 4FEIA 2VCOA 3IDIB 3RX5A 3V8CA 3APDA 1OIOA 1H6TA 2FB4H 1SQ2N 1BFVH 3MRNA 1ZRUA 2E8YA 4LO9A 3ECUA 3PP3K 2ENJA 2CM5A 2VAAA 1R3KB 2ICCA 1S9KC 2ZD0A 1SYVA 2XNAA 1TMQA 1FGNL 4FJYA 5IBUG 1OSEA 3GD1C 1E43A 5JOFA 4J27A 5KYUB 3I6KB 4PRPA 1AZUA 2GIMA 1C7TA 5I66B 1DEEB 2WXOA 1NAKH 2DKMA 3JT2A 4ZSOB 2AEIT 1VCAA 3MV8E 1ZV9A 4MDJB 3GSQB 3JWDC 2AQSA 1WS7A 1XB6A 3BSGA 1I9IH 3ULUC 2FR4B 2VR5A 2Y1AA 1G5GA 4ONHB 1MLCB 2A4ZA 3JV4A 4JDEA 1ZHNA 3FUNA 4B97A 5J6HB 1SEQL 4I8DA 4RGND 3RZCA 4GW1B 3ZE0B 2B3IA 1YEHL 4X6FB 1OAYH 1T0OA 3O3AA 4YEEA 3OKYA 4EE2A 3LEYL 4YSUA 1BVNT 1SHSA 2V3FA 4JDTL 5HHOB 3EFDL 1K85A 4NBXB 1ZGLM 2GUOB 3GMMB 1KYOK 2R0WL 2ENSA 2MQGA 3C60D 5TDOA 4BSWA 3NOIA 2ADFH 3CLEH 3PNWB 3D2TA 5F0MB 3DRQB 4FEMA 3X3GH 4KHXH 4NGHL 1N0XH 2BP0A 4RBPH 5E2JA 5IBUB 1QNZH 2FECL 2JB5H 1GC1L 4Y4HC 1D5ZA 5DZOA 3ARDD 4MZRA 3X12A 2AGJH 3VG0H 1JWUB 4RSYA 5IQOA 4KAQL 3CZJA 1GAFL 4IHOA 4M6MH 2KYIA 4YUEL 5IVXE 4P46A 5KSBA 4YBLC 5BZDB 1QEWA 3GSXA 4PUBL 3HHRB 4E42B 3VI4E 3GKWH 5EU5B 3EJCA 4Y19B 2NUTA 5HY9B 2HWZL 3T09A 4MJJA 4PU2A 2VITB 5EDXA 2V2TB 2VLJB 4KY1H 1AIFB 1UFGA 1ZXKA 4TOYH 5E08H 4IKNA 2WB1A 2ZUWA 2H0EA 3UZVA 1FE8L 2RD0A 4M61A 2HAZA 1QTSA 2B0SL 4Z7AA 3MXVL 5FDWA 2AITA 2A83B 1F00I 3H9SB 5DC0A 4PJFB 1LE5A 3D18A 3QR1A 4L8SC 4YE4L 2HLEB 3QDME 3ARBB 2PWEA 5HYJE 2AJYH 3MYJB 3ABZA 3QISA 2BOBB 5CILH 3QFJB 1M6OA 3SY6A 1A7BA 5CUSH 2N1KA 1WWCA 1DZ0A 3HZYA 2VOTA 4X9GA 1S7WA 5DEGB 4UZUA 2E4FA 3CDZB 4PJ9A 3QRFM 2YMTA 3NFSH 4PS3A 5EZLB 5HPOA 3VXPB 2ZG1A 3KPSA 4FFWD 2IQ9H 4K3JH 2K4WA 5MP6H 4L1BA 3P73B 4B5EA 2VIRA 4TPRH 4OBSA 2X1OA 2FB4L 1CGXA 3WJLC 4J39A 1IE5A 2PYED 1RZPA 3O2VH 2WUCH 3EHBC 2UZYB 3AJ7A 3AXLB 2F08A 5T1LD 1T7YA 5EV7A 4QHNA 4LXFA 4U1GC 5EBLA 4YBQD 2CHWA 3S3SA 4DUXA 1ECZA 1WC7B 1PFOA 4P4KB 2TRHA 2KPNA 1CR9H 3KWTA 4NOFA 2W0LA 3CFDB 3LOWA 1UT2A 3BP4A 4PGJA 1NAKL 3EOYG 4L05A 4E41A 3D25A 3H56A 5JORA 1OTUC 4FFYA 2A0LC 3NSFA 4H8QA 3PV6B 2LU7A 1DBKH 4FTVE 1LEKA 4ZYKB 3NAAL 5HI4C 5HYJD 1I9IL 4OAWA 2WXQA 5G4OA 4ZTEA 2QEJA 1CI3M 4TNVK 3NRFA 2N4IA 3TF4A 1UZGA 4IDLA 1E8ZA 1PIGA 4OJCA 2P49B 4ZS6D 1E50A 1IC5L 2BY3A 5F1SA 4LDCA 5SWQA 4IBQA 4G8EB 3ABLB 1OAYL 2DQGH 4CSPA 3GSVA 3LKPB 4N5UA 4OIAA 4BKTC 4NOBA 2ZONA 3TBYA 4M5YH 1D5IL 3D0AA 1E9PA 3FO1B 3EG9B 4PRID 3LIUA 3WXWH 4L4JA 5AZEH 3VFOA 5DJ0B 1UYWH 1EPFA 5SWSE 1G9NH 2AKRB 3RE0A 3CLEL 1EFXA 3SDXA 2VC2B 5TDPA 1IBGH 3X3GL 4KHXL 1N0XL 1A1MB 3EJQA 1K6QL 2JB5L 3OGOE 3QQ4B 5IHBA 3L9BA 1JRHI 5E1IA 2AGJL 3NFPA 2JTDA 3VG0L 2VT0A 2WYHA 5CIPA 2WXNA 4M6ML 4U31A 4OI8A 1CU4L 3VI3F 3BGMB 3QORA 3DSNA 3Q3GB 3GKWL 4PJDA 4NAQA 4ZFOA 5DVKA 4BDVA 4LLVA 4EIUA 3I02B 4YHKH 4YX2H 2XXGA 4ODSH 2H3NB 3A3YB 4TOYL 4EBQH 3K0WA 4HZ1A 5E08L 4AQ8A 4GEIA 4J12A 3DYPA 5GGVH 3BLBA 1XF3B 3AW5A 1KJ2H 1UA3A 1GC1C 4TQHA 1IEAA 4LCYA 1CVRA 4YFLF 4HOXA 3U2SB 3FCSA 2NX5A 5FB8A 4FA8A 3T6QC 4MAYA 3WOVA 2AJYL 5I8EA 5CILL 4OCWL 2N0MA 3U46A 3SGKA 1WHPA 1CDJA 3EJRA 5CUSL 1S9YA 4FLSA 4DP9X 2VMEA 3ASOB 3DX8B 1D6VL 1A3LH 1PLBA 4GQQA 4N6RB 4HOMA 1AZBA 2AJ3A 3TBVA 2B5IC 5HJ3B 1S3KH 4M1DH 4U3SB 4F91B 4ANUA 4PWEA 1UOLA 1MCOH 4BBWA 3IRCA 5CD5C 4GG8B 4NDMA 4F9PC 5MP6L 4JRFA 3QDGA 4HJ0D 5ICUA 5JHDE 3J8F7 4TPRL 2GI7A 1X7SA 1O7VA 3P9MB 2HVJB 3O2VL 2A7BA 2WUCL 4LEBA 3FT3A 4GRWE 2R23B 1MCKA 2I69A 5AVSB 4G6JH 3D39D 4DGUA 2LTQC 2I5YH 4PGEB 1PBYA 1OGAE 4X5WA 5EC1A 3LNFA 3TX4A 3HIZA 4IOIA 4DFHA 4WEBH 4Z5RB 4IU3B 1CR9L 5E8EA 3GHEH 4LCWA 4G9FD 5DUBA 2DQHL 4IGBC 5J89A 1FYTB 2QKSA 3NJNA 4OCXH 1KELH 5ITFA 1OKEA 1VPOL 2P7TB 5B3JF 5T1KD 1QBAA 5H37A 3KW7A 5DUPH 3HTLX 1Q9KB 5C0CA 2YN3A 4MFHA 1DBKL 3PABB 1DSFH 3O4OC 3B7UX 3B3BA 2DPKA 3QUXC 2ZKWA 5F1IB 5A40E 2J2ZB 2Z91A 4PJ8B 1NCHA 3GZPA 3RB5A 1J0HA 1J18A 3BPCB 4PRHA 3HRZC 3KXFD 5GISH 4OCLC 3K8LA 3K6SB 1UD5A 2DQGL 3SY0B 4OTXH 3VA6A 1DQIA 2XTSA 1CDUA 3BN3B 3CSFA 2I7SA 3UBXG 2R2HB 3COOA 5KYYB 5IJKC 3U82B 4NHUB 4XBPB 5AZEL 1CXIA 1UYWL 4U2YA 1G9NL 5GJSH 4AH2A 3W9EB 2YLHA 1IBGL 1URIA 3RVVC 1U2HA 1ZVNA 4JUSA 2O72A 4IMKA 3HG1A 1ES0A 3BVVA 3DJSA 5IFJA 4RLDA 4YO0A 1R3JA 4GXVH 1P7QD 4ORZC 4LDOB 3MFFB 5IT2H 4UQDA 3P2DA 5JW4R 3VXQB 1PZBA 1WUZA 3SE6A 4NQVB 4MMZB 4BJLA 2G9HA 3IDGB 3BSZH 5GIRA 1AZNA 2Y2YA 4KK9C 2JI2A 3MRCA 4ACPA 4ENEC 1FNGA 4KKLC 1NCUA 2NSMA 5L4IA 4DKDC 5I8KH 2EACA 2YQGA 1B6DA 3TBTB 4YHKL 4YX2L 3SQOH 4ODSL 3UYRL 3U9WA 1ZEAH 1OGTA 1TVDA 1JGEB 1CYXA 3HN3A 4EBQL 5KS9F 4OF5A 1Q9LB 3OAYK 4NQTA 5GGVL 5JW4Q 1EAJA 3BT2H 5DEFA 4IRZH 1KJ2L 3FO9B 3QWOA 2VJ8A 3HUJE 1NGXB 3EJZC 4S11A 4KGLA 1QHQA 2FEDD 5DQ9A 3A24A 2G0KA 2B16A 2KBGA 3CSYB 4AQ1C 3OXSB 4UI2A 2YQ2A 4JRLA 1YHPA 2F53B 3UBXB 5CEXA 2YRBA 1QLEB 2DL2A 3ARYA 5AUMB 1RSYA 1VHPA 1A3LL 3B7RL 5KS9B 1ESOA 4QHKI 5BVPH 4M5ZH 3IBEA 1RD6A 1S3KL 4M1DL 5K69A 3F62A 3P1VA 1MCOL 4L9LB 4RA3A 4V2CB 2APTA 3NFNA 3QFDA 5EO0A 2YC1B 3W56A 1SGKA 1V3JA 3BEVA 4GAYA 4W6WB 4MHHG 3AS3A 1JDAA 3DOSA 5GGQH 3FQXA 1VKXA 1GYUA 2VDQH 3G6AB 2DEYX 1LQBC 4G6JL 4YHYB 1NMBH 2I5YL 1NEZG 3KDMA 1EWHA 1XIWA 1LP9A 2YD4A 2FWOB 3VXRB 3GHEL 2Z35B 2DQFB 2FVNA 3ARRA 3BEWB 1EZSA 4J28A 4WK4B 1FAIH 2P24A 1O9ZA 4KZEH 4YFEA 3P4MA 1J12A 2BK8A 2KH2B 2RBLA 3OQ3B 3RTQC 3ZKND 1KELL 3MROA 3FQRA 1S7XA 4JB9H 1XX9C 4QXTA 4LSQH 2C9XA 1F3JA 2Q3XA 4M5SA 3ROOA 4Z7UF 5DUPL 1XF5B 3VFPA 5GS1A 3VWJD 1XGZA 1M05B 1DSFL 1TQSA 1JERA 5IY5B 5T5FH 5KVFE 2V5MA 2ZAGA 3EDEA 1MF2H 1L0YA 5DS2A 1Z0NA 1C08A 2OP4H 3FOMA 3E6FA 3I85A 1CT8B 2CO6A 4C58B 4AYDC 5IMKB 5JO5B 2YSTA 1ZA6B 5GISL 1H8OA 5F3FA 3BKYH 1THCA 3K80A 1FO0B 3FTGB 2Z34A 4OTXL 4CN1A 1DJGA 2JQMA 5H94B 1SXCA 3FFCD 2KC0A 5D7HA 1QQDA 3AU1A 1URLA 4BELD 2SEBA 2X4UA 3NTCH 1S78D 3T8MA 5B8CC 3BW9A 2XFXA 4KTYA 3KCPA 4BQ6A 3NCYP 3GXFA 2V17L 3B1TA 5LAXB 1EX0A 4GSQA 5GJSL 3ECBA 1Q94B 1G6RA 3FO0H 3LN4A 4XVJH 2XWBB 4X4YA 2LVEA 1WIOA 4R7NB 1BVKB 1EO5A 3QIUC 4DZ8B 1ZT7B 3JTBA 1OB1B 4FG6D 4HHAB 4XP9H 1L5GB 2OYKA 3VYNA 2V0AA 4GXVL 5I16B 1JPSH 5AVTB 4AYMC 4G5ZH 5IT2L 1BMWA 1QRKA 1UOVA 4QT5A 3H7BA 1K4CA 4TVUA 2Y7MA 3BSZL 5BZZA 1YYLL 4Y2DB 1U8MB 5DZ9A 5HDBB 5I8KL 3BN9C 4DP7X 2HUHA 2UX7A 4IRJD 3KJ6H 1Y07A 4Y8AA 1ZEAL 3CNKA 4KKZA 3DX7A 2NY5H 3QR2A 4H20H 2Y7OA 5GZNC 3TTYA 1XGRA 2Z8RA 4LFHD 1YEGH 3KYNA 5IM7A 1OD7A 2AJSH 3M86A 4XR8C 4KDTC 4BKLB 3MLVH 1AKJB 4K94C 2XN9B 4U6TA 3SDAA 1N0LA 5ICXA 5TGBB 3HG3A 1HCVA 4QOKB 1R33A 1SN0A 4AMWA 2X4RA 1A6TA 3RFZC 1SJEB 5J1AB 1E5YA 4JO8A 3GXTA 3FAXA 1A9EB 4OCYH 2W0PA 4NFDA 1JPEA 4UM9B 4JRYE 5BVPL 4M5ZL 2CO7B 3TN0C 1RLWA 2AXGA 4MKTA 2FQGA 2A6KA 1KDJA 1E65A 2ALAA 3KBHE 5L2KD 3N1GC 1J8RA 2FATH 4IS6B 2OBGA 1FG2A 2BVEA 1E6OH 5I73C 1WEJL 4AZ8A 1MCBA 1BQKA 3ZKSD 5C92A 2YZ1A 1GIGH 3D85D 5GGQL 3ILPA 2VDQL 2VR9A 2EUVA 1NMBL 4WO4C 3QNXB 1U95A 2OQJB 2ZUUA 4KROD 5KUKA 1IL1A 1JDCA 2OJEA 4WJKB 5F7WC 3G5VA 4J4PD 2EYRA 2DMBA 4OLYH 4F80A 2O26U 3HJ0A 1KPVA 1S7UB 5ILTH 5IHZB 1QG3A 3AWGA 1F13A 4JB9L 1O7DC 1RJLB 3UBHA 3QJHB 5I75B 3ZY7A 2BSED 4FXKA 2RR3A 4HUUA 3IN2A 3G5XB 4Y9CA 5CLWA 2Y23A 2HLFD 5EBMA 1HHGB 25C8H 1XH3A 1NM4A 1JUFB 5T5FL 3U30C 5I71C 1MNNA 1O5PA 5CHNB 3LVEA 4JREB 4HIJA 3V0GA 1MF2L 1Y6NR 3CPLB 3QXDA 3KVQA 4BZ2H 2OP4L 4DFIA 4BRJA 4C4KT 1BM7A 1A9BB 2YGNA 1CDYA 4AQAA 2CO4A 3BKYL 1MFAL 2ZZUT 2WJ7A 4H7VA 1RZFH 3K2KA 3WHXA 2OMXB 3SKOA 4OGXH 1G7JA 2FJGA 1S9WB 3PRZA 4CU8A 1KN2H 3NTCL 3RY6A 3V5KA 1YJDC 2E9BA 4QRFA 1TETH 2J88L 3MRNB 3FUEA 4WU5B 1WS8A 2YEVB 3L4ZA 2VAAB 3FO0L 2NY6D 4AM0Q 4XVJL 1CL7H 3AY4A 4G8IA 4AIEA 3IB4A 3T0EE 5DHVH 2Y1VA 4MASA 4XP9L 4ZW3A 1ACZA 2XNAB 2DIBA 1DUYB 1JPSL 4ZFQA 3ELQA 3BXNB 2KQMA 4G5ZL 5JOFB 5E6ID 1IIKA 2JI3A 2WN2A 1NC2D 1TFPA 4PRPB 2NNCA 2PO6C 3B6SB 5BOJA 3V52H 35C8H 2FO4A 4B3VA 3GZOA 3UJTL 3MA7A 3NN8A 1QYGH 3KJ6L 2EADA 1OTSC 3C8KB 3F6IA 4H20L 5EN2B 2P8LB 2VDNH 3QA3B 3VXSD 1EEQA 5L8JB 1YEGL 3HAEH 4ZO8A 3UCQA 2HYMA 2VL4A 4QNPE 2AJSL 32C2A 5DFVC 5FCSH 3MLVL 3GDBA 3G6JF 5E1AA 4QPEA 1X4YA 2ID5A 1OVZA 1JHTB 5K9OA 1KB3A 3L2MA 1T7XA 4C56A 3IGFA 4N0YH 3ULAB 5KW9H 4HBCL 2AXFA 2H1LM 1EJ8A 3PHAA 4FQHA 3BP7A 1WDAA 2VDRH 3FO2B 4OCYL 5B1AB 3DETC 3JV6B 5KSBF 1E5AA 3AAZA 4WSKA 2F8OA 4B9ZA 1UGKA 4KKQA 4M62H 4Y1AA 5D72H 2EP6A 1XO8A 2IAMC 1OOAA 2DF3A 2FATL 5BRPA 2XC8A 1S9XA 4K5OA 5EF3A 4EJ1C 4Z7QE 2BVOA 3T0ED 3ZKMC 2BP0B 4Z77A 1D5XB 1GIGL 3ARGC 1IVTA 3BH8A 4AUJA 5C9KA 1D5ZB 4Z0BL 1FSKB 1OP3H 1LLAA 1MW2A 3X12B 5IFAL 1DVYA 4A2MA 3GRWA 5LNEA 1T04B 1OB0A 1U0QA 2GHZA 4P46B 4PVNA 5ALCH 1QEWB 3GSXB 4U0RC 2XV6B 3WFBH 1RCYA 2NUTB 4WRLA 4KJPD 4KZCA 2WNWA 4OLYL 3D52A 3KDPB 2P8MA 5ILTL 3QEGH 4PG9A 3UZVB 4P2OA 1CGWA 5LGYA 1W6LA 3C9NA 4WWKD 2X89D 5DJCA 1TF4A 3B9KC 3INOA 1MI5D 2VLKA 5E6SB 1WAAA 5FDWB 1X6LA 1MFUA 25C8L 4RH4A 5AENA 1LE5B 3D18B 2OZ4H 3B2UD 4KOBA 3T2PA 5LGJB 4NQSA 3WLWC 5MENA 2Y6SD 3S35H 3DHPA 2QQNH 1B90A 2XV3A 2FIKA 4BZ2L 4YK4C 3ZT6A 15C8L 1UXMA 1S7WB 4PLJD 3AQYA 2D9QB 4PGDB 3WJMA 1FVCA 3DSFH 1BFSA 2CE6A 1RZFL 2IPKB 2YPLA 4LLDA 4MMXB 5AKVA 3ZO9A 4KDVA 1KCWA 3I9IA 2YARA 2Z92A 4PJ7F 4OGXL 1L7IH 3WDJA 4XPFH 1KN2L 2VIRB 1N19A 1TETL 4Y4FB 3UTQB 4CADA 4JFFE 1VEPA 1HOCB 1CL7L 1PEZA 2VW7A 2EIZA 4NBYB 4QHNB 2FX7H 2G5BB 5EBLB 3WNOA 4APXA 3KYOA 3IETA 1R0AH 4CVXA 4IJTA 5HYIA 4X6DE 2WYIA 5JXEA 2LT9A 2XCMC 4Z78A 1PX4A 3LRMA 1AHWC 1OTTD 5KG9B 1H9VA 1PAZA 4FFTA 1YEDA 1EA9C 2O6PA 4H25A 6FABH 3V52L 1R24B 35C8L 4Q97A 5F7NC 3FFOA 4E41B 1HYSD 1Y0LB 4U1NB 5EU3B 5JORB 3TURA 1QYGL 1AD9B 3WGUB 4F5CA 5HHXH 2GSMB 1LEKB 2WK2A 3ARFA 3DVNB 5EMYA 5A2JH 1MWAA 2VDNL 3MV9E 4OAWB 3L5JA 2X7LA 2YK1L 3HNSH 5IROD 1DQDH 3RVXD 4LARH 4Q89A 1ND0B 4LCCA 4RFEB 5L2KA 4JFVA 3Q0HA 4LEXH 2HMIC 2XPGB 1KPUA 4CGTA 1XT5A 5SWQB 3TZVA 2XT1B 4G7SB 4N0YL 1SHMA 4FNQA 4NP9A 5KW9L 4I1NB 4E9WA 3SCMC 5EOQL 1HS6A 1DQMH 4CBPA 4PY8I 2NY0D 2VDRL 4K07A 5HGDA 1XGPA 1V3KA 5D6DC 4PJDF 3O4LE 4JM2C 4P2RA 2XRAH 3VFOB 5D72L 3MLWH 4FLOA 3IJYB 3L3IA 2ATAA 1EFXB 4DW2H 3SDXB 3BDXA 5TDPB 3HS0C 3F83A 1HWWA 3ZTJH 3H4HA 1NTDA 2A9AA 1TCRA 1UT1A 2WQUA 3TPKA 5E2VH 3NFPB 5FYKE 4P9MH 1YRKA 4K8RL 5ADPH 2N59A 2NYYC 5FOBA 3QORB 2XFGB 5CXPA 3WFBL 3K6FA 3L7FA 4FQCH 4ZFOB 4FI7A 2CLRB 4LLVB 1S7RA 3TVMC 3QEGL 2F8VA 3BT0A 3C75A 5B21A 4F57L 3R1GH 2H9GB 3EJYD 4L3EE 1D7BA 3LRKA 2C3WA 4MNGE 5H37G 5DVNA 4LCYB 1AQMA 1M3JA 1F41A 2NX5B 2OZ4L 5KVEE 2CWRA 4PCSA 3LEXA 4BFOA 3J2PA 2EDFA 1T21A 1A4AA 3NZ8B 2QQNL 4LHQB 5E70A 5I8EB 3S35L 3VFWB 2C8NA 3LNEA 2P5EE 3MREA 1INQB 5L8KB 4NERA 1F6FB 4FHBD 3O6FA 3OLEA 1S9YB 1UWGH 4O58H 2WV3A 2Q0ZX 2LGNA 2IDTA 3ULUE 3UPRB 4JCLA 4TSCH 4G6AC 3TBVB 5J9PA 2X3CA 3O4LD 3ZL4H 4N8VA 1OL0A 2X1WL 4L2LA 5TJWK 4HUKB 4NDMB 1N10A 1L7IL 2IQAA 4XPFL 4I3RH 3GZQA 4DVRL 3FB7A 4RWYH 4C4UA 5JIMA 3OHMB 1LD9A 2RGSA 2VMCA 3A23A 4HIEA 4QRTA 3REWB 1OF0A 3ZE2B 1AANA 2FX9H 3DTUB 4G43B 2FX7L 3UTPE 2R69H 5EC1B 3O8XC 2OJZH 3BC9A 3HG5A 4FFVD 1KB5H 4IOIB 4PS7A 3VXSA 1RK1A 3F05A 1H3TA 5E8EB 3ZE1F 3L7EB 5DUBB 1UGNA 2AP2A 3KM1A 2ZUTA 5ITFB 1R3IH 4RGNB 4RDBA 6FABL 3RI5K 1J7VR 3EZJB 5BQDA 5HHXL 1BM3H 4MWFB 4JFPA 1G7QA 2ZWZA 3KGSA 4J6IA 1I82A 2F7QA 1S46A 2NT1A 3OPZH 3VRIB 4EZJA 1DQDL 4IIQC 2ADYA 3Q44A 3ZDXE 4LARL 5EZOH 4PRHB 3C60B 3LXCA 4XNDA 4NYLA 4QTHA 5J4MA 1DBBH 1DQTA 1CDHA 5KTEH 2BNUB 4JRXE 3VWKC 1CPUA 3ARDB 3QJSB 2AK4D 1NKRA 1DQML 4GW5B 3N0AA 1KLUA 5I8OH 2WUBH 3WN6A 1OCOB 4XGZA 1IAKA 3V95A 3TM6A 2XRAL 3MLWL 5KANG 3D12B 4F92B 4DW2L 4G8GE 3CVBA 4KO9A 3U9UA 1KTKE 4WNSA 1O75A 1J0YA 3HG1B 1ES0B 2APFA 1INEH 4YO0B 1R3JB 1UD4A 1Y1DA 1A4JB 5E2VL 1UXSB 5TFSL 1MN4A 4GXUN 3EBIA 2V9TA 3LH8A 5CZXC 2LLNA 4P9ML 1H0DA 3VXME 4C57C 3N41F 3O41B 4OW6A 5ADPL 4S1RH 1BD2A 2G9HB 2PLTA 1EVTC 4HSQA 3QPQD 5IHWA 2V8LA 3WD5L 1G1KA 2ZP8A 4Q9CA 5JPMA 4WDIA 1QRNE 4FQCL 2ZCHH 2WIMA 4J3OD 4N1EA 4MB4A 1U8JA 4PRDB 5IOPB 3U9PL 3LQZA 3R8QA 3P2BA 4ZBJA 1GYAA 1OGTB 2VKXA 3V4PA 1CFTB 5H35B 4EI0A 3R1GL 1P2CA 5B7EA 5D7EA 3T6VA 3IU3A 5DEFB 1R0AL 5T3XE 4KHTH 3FB6B 3BQUD 1KYAA 5TF1H 4X9HA 3UMTA 4PJIE 1MRDH 1QPPA 4NQQA 4G6FD 4K8RC 3FU8A 4P23A 4IKLA 2A5UA 1MVUA 2XIIA 3OKDA 4Z8FH 1MJJB 2PYEB 4A2EA 5I2IB 3CC5B 3G5WA 1OP5H 1D7DA 2J55A 5CEXB 1FFPA 1SDAB 2PXYC 1OSPH 2JJSC 1UWGL 4O58L 1CD1B 5EU6A 4KVCH 4YHNA 1LP9F 1ZSDA 4NRYA 5KBNC 3S2CA 4GQZA 3QO1B 3NFNB 5AOLA 5D7KE 1XGTA 1F2QA 4N9GA 1F86A 5F6HI 4PI2A 1PNDA 1AHKA 3BEVB 3CK0H 4GAYB 4RWYL 5E6RB 4F7MB 4W9IC 4EO5A 2QQKH 2ZUXA 5DXWA 5KOMC 1VKXB 4FMVA 2FX9L 3V5HA 1OZUA 1WCBA 4IYKA 5AZ2H 3KDMB 2R69L 5DUJA 1XIWB 2OJZL 3IRZA 4NCDA 1KB5L 2H2PC 3W2DL 4LHUA 3ZGIA 2CRZA 3EO0B 1ZS2A 3A21A 1U2YA 2BX5A 4XX5A 3TFKC 5E8NA 5HHPB 5F97E 4ZMZA 2I60H 2P24B 1DEDA 4X6CE 4Z7VA 3P4MB 4CN6A 3CDFA 3MROB 4HG4J 4WU7A 1R3IL 2YRZA 2YJLA 4QXTB 5ERWB 3ZX1A 4NQXA 1F3JB 1RLBA 3JYBA 4WHTA 2LFGA 5IQNA 5I5IA 3H42H 2GHWB 1BM3L 4P2AA 1T1XA 1EGJA 1WFTA 3WTUA 4PBVC 5JW5A 4N2EA 3B3IB 3OPZL 4PRIB 3EH2A 5CLZA 3PPEA 3UTTA 2I9LA 5FUCC 5KZCD 4NWUH 1DUZA 3GXPA 5EZOL 3UH8A 2JQAA 1C08B 3FOMB 3F7RA 4L3CA 1NSNH 5HHVL 2JXMB 4P04A 5DRNA 1ZPUA 3TS8A 1DBBL 5KTEL 2H6PA 2YGVA 3UFIA 1XVSA 5GRWA 1CBVH 1X5XA 1Z9NA 4M7ZC 2D0GA 3V0DA 4CBZA 2OMNA 4WLCA 3C5SB 4QYOB 3AU1B 2AEQL 3K8KA 1DQVA 2OI9B 3RJDA 2SEBB 2X4UB 1KC5H 5I0YA 3IBOA 3ZLQC 5I9QC 2FNWA 3KCPB 3MNWB 4JPKH 3TJHD 5AAMC 2IDQA 3ECBB 4HIPA 1G6RB 3LN4B 1RJZB 4X4YB 1FIGH 3OGCA 3FQTA 2ISDA 3RIKA 4O02A 1INEL 1Q9OA 2K7PA 1IB5A 2AAAA 2WLNA 3LRHA 3K3QA 4FQPA 2WHVA 4U1LB 3H7BB 1K4CB 4S1RL 5BV7B 1AXTH 4PWFA 1JVOA 2AQRA 3N85H 2NPLX 4ILDA 3QWNA 1F2XK 5D71H 2X6BA 3WY2A 2ZCHL 1MRFH 4PD4J 3EADA 5HD8C 1J9QA 5LCVH 2R4SH 4YFDB 2G9KA 5HDRA 4LIQH 5DS1A 4KK6D 1XGRB 2MOVA 1NCOA 4UINH 3CUPA 5IM7B 4KHTL 4NC1E 3C5ZA 2IOMA 5TF1L 3SO3B 4PLKC 1GPOH 1MRDL 5AB0A 3GBEA 3QDJA 1CXKA 1FZKB 5L8LB 3SDAB 5ICXB 3ZW3A 5E8PB 4Z8FL 2YHGA 4WV1A 3P3UA 2Y6TE 1G4MA 2FT8A 2X4RB 4MB1A 1OSPL 2XVKA 1KGIA 2E86A 5D7LE 1G0DA 2H45A 4KVCL 2VH5H 2HPOA 1OM3L 3TBWB 1X5MA 3WMPA 2AXGB 1A3ZA 2A6KB 5BRZD 4GG6F 1FG2B 1RV6X 5JXAH 3FUFA 5GGTA 4AZ8B 3KYMA 3CK0L 1RXLA 1RZQA 4FG2A 4WUUD 1TEGA 5LO7A 5T1KB 2QQKL 5GGRA 3ILPB 3MCYA 3C8HA 2Z31D 3O9WD 3FBKA 4TNEA 2EKSA 3EFFA 1JMZA 3MRJA 5DLMH 3SJVE 5G55A 1B9ZA 1WP6A 5AZ2L 1DDTA 1WIPA 1A1NA 3TH3T 3LB6C 2NW3A 3OBAA 2NY1B 2P52A 2OJEB 1T4WA 2I60L 4D3CH 1JNHB 4GKSB 1KPVB 4QMEA 1QSFE 5E6UB 1HFUA 4B9KC 1IO4C 3ULVH 1ZXQA 2EUZA 4DGIH 1A47A 3H42L 3L9RA 4GKLA 4IGBD 5T5NG 1RL1A 1XH3B 4EN2A 5D7JA 2YAMA 1JZJA 1WAEA 1X5FA 5GZOC 3H2WA 3L2NA 1EXHA 1CDGA 1A6VH 3QGVA 2QADC 4NWUL 3QXDB 1URZA 4PJHF 4RCAA 1NSNL 4UDTA 5CGBA 4HWBA 3DMMC 4R96A 5CSGA 1GGTA 4AQAB 2XACC 4GPVA 5ADOH 1CBVL 4MJID 3RDTD 5C0BA 8PAZA 1ZHLB 1P7QB 2XTLA 3HG4A 5D1XC 5F3HA 3ATFA 1XHHA 3QZOA 3HHSA 3MLUH 1PAMA 2FJGB 4NO0D 2NTSP 1KC5L 5J1TC 1HN1A 3V5KB 2CK0H 4K7PX 1RFDH 1TENA 2EABA 2MQCA 4HK3N 4JPKL 3TCTA 3SKMA 2BHUA 4YSDA 4UIMA 5EO9A 3ZPDA 1EK3A 5CLYA 3R7RA 5IBLD 1FIGL 1XXDC 1HQRA 2XJLA 3RP1A 2Q6WA 2AQ3A 2NLJB 1MAMH 1U6AL 3C2AL 4DP6X 2NXZD 5K39A 5I6PA 1U92B 2P45B 1QFHA 4Z7OF 2EVGA 3K46A 3IVKA 2CNYA 2FX8H 1PFCA 2W91A 1H5BC 3L13A 3RVVD 5ISZD 4XX1E 1N5AB 3N85L 1A7NH 3ATAA 5D71L 1QAWA 1MQKH 2AZAA 4PWKA 3VI3E 3MA7B 3GM8A 3NN8B 3QXVA 2M8XA 4FHKA 3SEPA 2VSMB 3CXHJ 2R4SL 4OZIA 3NA9H 4DESA 5DD5H 3IPEA 4HWZB 1T80A 1AQDA 1YMMA 2WWMC 4KRPD 32C2B 3QO0B 3RURA 1T5XA 1GPOL 5DDHB 5I1JH 3EJSA 5E1AB 3SKNA 3SSGA 3VFUA 3DI2B 2HH0H 2JCCA 4C59B 2R0KH 3TH2T 4C56B 1NL0H 2XSKA 1T22A 3NG5A 3OC8A 3N1PC 3FU7B 4YXKL 4QGYA 2AXFB 1H3VA 3GMLB 3R18A 1HHIA 1NBZB 5KSAD 4HISA 3QXAA 1EXUA 3BP7B 5DK2B 4U0QB 5HPMA 4NKIH 2QV2A 3BZEB 1KV7A 2LR4A 3AAZB 2V5YA 1P6WA 4ZFZB 3B43A 4LE8A 4Y1TA 4Y1AB 1S7QA 3SGDI 3EYUH 4OGZA 1QO3A 5IOKA 1S9XB 1QFPA 4YIQA 5JXAL 4KNSA 1YEKH 2BVOB 4HC1H 3LVTA 3TA3A 3KEHA 3BH8B 4NHCL 3VWJB 5DLML 1WH0A 4YHPB 5C3IA 1NOFA 2VLMD 1KJMA 2ZOWA 1UZ6F 1ZLUK 1NWOA 1NPNA 4GP4B 4ABUA 4XN9A 5BCAA 2HTKC 2P8PA 1TYEB 4D3CL 1KTLB 3REVA 4R8WH 5C0GA 2VC2H 5FV2A 4PG9B 1HAWA 4L5FH 3LH9A 2DQUH 4P2OB 3V7MA 2W9EH 1LVEA 3ULVL 2R7EA 3C9NB 5DJCB 4XVUC 1E40A 4K23H 5E2UH 1N4XH 4W9KC 4DGIL 2VLKB 2VXUH 1DO6A 2AANA 1T89C 2WM0A 3V9FA 3FFCB 4KQ0A 3SDCD 3W11C 5GRVL 1GYCA 4HMDA 4P3WA 4WI9A 2VQUA 4NQSB 1PQZA 5MENB 3X11B 1A6VL 3WXVH 4XP6H 1V8HA 4LBEB 1F90H 4HULB 3WLBB 4D0DB 3KLHD 1UCTA 1UQSA 2XU9A 4MJHA 4KXAA 3FKUS 3FSOA 5ADOL 3WJMB 1FVCB 3BVXA 3MGAA 4G6KH 4JKPL 3KWUA 3UC0H 5B7FA 4KXCA 5H8DA 4JPSA 1UENA 2IH1B 4LLDB 1CDCA 2K6YA 1BA9A 3MLUL 2ZXEB 5DA0B 5C7XH 1AVAA 3F7PC 2WKOA 1UEMA 1NIDA 1P6AB 4D2NA 2CK0L 3DIDA 1RFDL 2FJHA 4YNYB 4FFZH 4ZMYA 3QULB 4NQED 3MGOA 1DVXA 1AIZA 1KYOJ 3D1MC 1NPUA 2HX7A 1MCNA 5KSUA 3T08A 2QKIA 4XMPH 2XWCA 1NC4D 4LCUA 1MAML 2WXJA 3WS3A 2V9RA 5K9QG 1MVYA 5G5DB 2AQTA 3KYOB 3D0VA 2C9AA 3IJ7A 4CVXB 1J1XL 3D3VE 3K5SA 5FA4A 3ARQA 1XWVA 4KX7A 4Z78B 4ZFFA 2OV0A 1DBMH 1AR1D 4XCFH 1YEDB 2I25N 1SYSA 4H25B 1MQKL 5I1AA 2P26A 1WA0X 1PZDA 3S36H 1QA9B 1YY9D 3BFQG 3NA9L 3IJEA 5DD5L 1T66D 3QBTB 1BZ8A 1Z32X 3VVWA 1M4KA 3QJQB 5I6OA 4HD9A 4LF3B 2X7LB 3DNKA 1FWXA 1KLFA 3RI5F 1E4XL 4L8CA 5L2KB 4LCCB 1NFIA 5I1JL 3D9AH 2TAAA 2HH0L 1N6UA 2PCPB 3TZVB 2R0KL 1O7DE 5E99H 4URKA 3D85B 1TVBA 1QW9A 2FT7A 2HFFB 3QIWC 3WG7B 3SDDC 1IEBA 3IFOA 5CAYB 1XL6A 3HPJA 4HT1H 1SMOA 1XGPB 2DB8A 4K9EC 3KW8A 5HGDB 4F7EA 2VABA 2Q8BH 4P2RB 5AYTA 3I74A 3EYUL 2IF7A 3L3IB 4N8VG 5AL0A 4W9GC 1FZOB 4I48B 4MQTB 3UAJD 1I75A 3WTYA 3ESMA 1BZEA 1KTBA 4K55A 5IQ9B 4HC1L 5KEZA 1UOWA 1VFBB 3L4CA 3C6LA 5E1HB 5GPRA 2RJMA 3GB7A 4A7VA 3HZMA 2VR4A 3QUKA 1KMGA 3K6OA 5BO1H 2F61A 3NP3A 1U42A 4XXWC 4O2CA 2QBWA 1W15A 2BVPA 1ITBB 2QLVB 3GUFA 3MBXH 1NGYB 5FOBB 2COVD 2NRDA 2KLRA 1GJIA 1MVFA 2DJMA 3L7FB 4XN2A 3TEXA 2P44B 4R8WL 1S7RB 2NW2A 5DJ6A 2OAAA 4HJJL 4WK2B 4YXHH 2VC2L 3LKRA 2Y5EA 4L5FL 3ILEA 2W9EL 5E7BA 1M53A 1IKFL 1WTGT 5E2UL 4K23L 4XPTH 3GBDA 1N4XL 3KZ8A 1YN7A 4Z7UE 2VXUL 3ILQD 3PWJA 4NQCD 1HSBA 1L0PA 2VO5A 4TXVB 1X5ZA 3VCLA 4PSPA 4FXTA 3LEXB 1FDLH 1HZHH 2HRPH 3P3SA 3STZA 1WZLA 3WXVL 5JHMA 4TYUA 1AO7A 4KH2A 1N6QH 4FYRA 1F90L 3GBLA 3QC5X 3MREB 5A6LA 5AW3B 1PDKA 5I5MA 5TH2A 3O6FB 3SE4A 2NY6B 3SE3A 2Y9RT 4KOCA 4G6KL 1VRSA 5J9PB 3BVWA 4N90E 1BZ9B 3ULVC 4OFIA 3P9LA 4OZGE 4U1KA 5DC9B 5C7XL 1NC2B 1ZVSB 2EXSA 4ZDHA 3FB7B 1WTLA 3PGFH 4TSBH 3QI9A 3FPYA 4FFZL 4LLWA 1PIFA 4KJWC 1LD9B 4QRTB 4HIEB 4XMZA 1C7SA 5CFHA 1QLEH 4XMPL 3N9GH 2E6PA 3Q8EA 3QZWA 3VXSB 1RK1B 4D7PA 1KB9K 3AREA 4DHLA 4ZXBD 5IREA 4ICXA 3T9WA 2YOAA 2I85A 1DBML 1P7KA 1JMXA 4PI0A 4XCFL 4JFEA 2C1PA 1HHHA 4U49A 5ANHA 4UT6A 1FVEA 1QZNA 4P57A 3ARBC 3S36L 1OEZW 4MS8C 4N0UE 1G9MH 3CH8A 2ZYSA 5ANME 1KZQA 5KSAA 3MUJA 4JFPB 1G7QB 5F7FA 1MZYA 4KZ0A 1KCVH 4R84A 4KKAC 3MV7E 2OMWA 3QXTA 4LAQH 4XH2A 1DTUA 5EEYA 2OSXA 2XZAH 4Q0XH 4NYLB 3LYRA 4D0BB 4QTHB 3PV7A 4NKMA 2D7TH 1HHKB 5E99L 1MOEA 3IF1B 5HHME 4WI3A 4OCMC 2D31A 4N90D 3GS4A 4K71B 4UIKH 4XPHH 2DV6A 3FT9A 3RWHA 3QJUB 1M3IA 2XIBA 1KY7A 4TMPA 2W9LA 2XTJC 2Q8BL 4XGZB 1IAKB 4FADA 5BVJA 1KV3A 1FL3A 5F7KC 3MO1A 2Z8VC 5BQ7B 3FTWA 4TQEH 4WFEE 1PTZA 3MZGB 5EIIA 2JIXD 1FO0H 4WWKB 3GBMH 3NJMA 1MI5B 4XMKH 5DCCA 3B9EA 5BO1L 1J10A 3V8OA 7PAZA 3MBXL 2WBJA 5FECA 4QTFA 1FORH 5CJXA 3VQLA 4WDIB 3US1A 2EILB 1U8JB 2DIAA 2NXYB 4LHUG 3DJ9A 3AWFA 2BSDA 3LQZB 5IMOB 4YXHL 4HJ1A 3MV8A 2ZAIA 3V4PB 3UBGA 1U3JA 3DLQR 2DQMA 2OYLA 1MCHA 4XPTL 3VFSA 2DM4A 3MV7D 3IU3B 4PJ5D 5BS0D 2UXGA 1IM9D 1JE6A 3U7AA 2AQ2A 2Q7YB 3MBED 3RYMA 3WNMA 5DWUH 2EVHA 1FDLL 1HZHL 2HRPL 3D4YA 5TTRA 2YN5A 1HNYA 1MVUB 3W0WE 1OCCB 1N6QL 4L23A 4IBTA 2KHAA 3EBHA 1XSOA 3OAZK 4LPWA 4LRIA 1QBLH 1FFPB 2X3AA 4MTMA 5FDYA 5L7XH 5DUMH 3LZPA 4GH7B 1ZSDB 4NRYB 4YDVA 4B0MB 2ROYA 1CE6B 3ATEA 3OHXA 2OL3B 3LHPL 4JZNA 3DUSA 3D48R 3T0AA 1BSIA 5DC2A 5C0AD 3IXAB 3CVCA 4WQOA 2CBOA 3PP3H 4N9GB 1BDYA 3V0IA 4MVBC 4TSBL 4FKHA 4AW4A 4UNIA 3JTTA 1MCLA 1CLOH 2K6ZA 2ZNWA 4FCAA 4P4RB 1HU8A 3ZHLA 1A5FH 3N9GL 5SWZE 5AVUB 2DS4A 4LDEB 5IVXA 1GW0A 1RIUH 1JZDC 3NUKA 4LHUB 5CEYA 5H4YA 3QZMA 4MZIA 3FSVA 4YE0A 4G71B 4LVOC 5EPMA 3VI4A 1I85C 5E8NB 4PIRF 2C3VA 4Z7VB 2AZUA 2DYPD 3MRMA 1DBJH 3QEQE 3CQFA 1E4KA 3B2PA 1NIAA 4DIXA 4NQXB 1IBHA 5EO1B 4WHTB 3BHBB 5EBWB 5BUPA 4NZ8A 1T1XB 1DANT 4U6XB 1AXSA 2G3NA 3MZTA 3ZQ9A 1JWMA 4Y88A 3IT8D 1KCVL 2VJXA 1AZVA 3QDMA 4XZUA 2EECA 3UTTB 2I9LB 3UXFA 1DUZB 3HE6A 2ZXWB 4FC3E 4L3CB 1HH9B 4L4VE 1HEJC 3CDCA 1MCRA 2XZAL 2Y3AA 4H0IA 4Q0XL 1TVHA 3CDYA 2D7TL 3VFGH 4D9QE 5D1QD 1RERA 3IDXH 1CGTA 4LKCB 2G5UA 2FLBT 1QBML 2NY3D 2CRYA 4XPHL 1UD8A 4YDNA 2ITDA 1CZ8H 2G4GA 2W9DH 5C07D 1CFSB 3KWXA 4AV5A 4NIYE 4OGQC 3PWPD 3IPFA 4TQEL 2X4QA 4JX0A 3FQTB 5FGBA 2ENYA 1JAEA 5EEVA 1M7XA 2Q7AA 1NFKA 2CKBA 1Q9OB 4GP8B 4JO4L 3VFVB 3GBML 2WBWB 1XCWA 2OTUB 2WWKT 3K71A 3CX2A 4YSQA 1UM4L 4KXZI 4NT6A 3ZZQA 4A7SA 1Z3RA 1FORL 3X1FA 1J86A 3HB3C 4L4TE 1I9EA 4MJ6A 2MKLC 4PJ8C 4LLUB 1LJMA 3EOBA 2WP3T 2J72A 3L5HA 2AK1H 3CC1A 4TSAL 4FTVA 4J3UA 2EH8H 2MHAA 5GGSA 3QNYB 1F0LA 3CUPB 3C5ZB 2PPFA 1ET5A 4JL1A 1YEIH 2D7MA 3QDJB 4M9OA 4XP4H 4WFHE 1YDPB 43CAA 2P5WD 1OP9A 1U3HD 3P2TA 4LT7A 4YZWA 2UZXA 3QYCA 4QRPE 5C09D 1QBLL 4G6MH 4J23A 4DQOH 3BZ4A 1A6ZA 4N24A 5DUML 4MD4A 5CWSA 3NCFB 3H9ZA 2EC9U 3K1KC 4K5PA 4MD5B 4QAMB 3TCLA 1WPCA 3IYLW 4IW4C 5I17A 4M03A 5SWSA 4I3GA 4M1CD 1BXUA 1NH6A 2X1PA 3RKDD 4C8XA 1ONQA 1MFMA 3KYMB 4MMZC 2KZWA 2ZOUA 3VXNA 4B41A 5GGRB 1CLOL 2JKSA 3U6RA 5FFLA 1A5FL 2J71A 2Y36H 3EFFB 1RZKC 4ZZKA 4LLYB 1D7CA 3ML8A 1RIUL 1VGKB 4HIHA 4TNGA 1LK2B 2RTTA 1N8ZB 1U91B 1DBJL 2DQIH 3BIAX 4UBDC 1ROCA 2MCG1 2YAEA 4TQ8A 4GRLD 4D0CA 5FV1L 3SOBH 3V6BR 1F4YL 3L9RB 2AK4B 1ZTMA 5KWYC 1T4KA 4MX7B 4BFGA 3HE7A 3CFCH 1KZYA 4QEGA 1NBYA 5ABDE 1JS4A 1LO3H 4PG2A 4MB5A 4UDTB 3QW9A 2BNRE 4MD0A 4R96B 1U93A 2IWEA 2ZXAA 3ZBMA 1IM3A 1WFIA 4J8RA 3VFGL 3WIHH 2F6AA 2VO8A 2YWYA 3IDXL 2EEAA 1BBDL 4HHWA 4JFOA 2XV2A 5F3HB 1UKTA 3FCTA 3QYMA 3MLTB 1ZA3A 3ZXAC 3VNYA 4CA4A 3RGVA 1IGJA 1S7TA 2W9DL 5E94A 5K5YA 4KI5F 5JHDA 2ZTBA 3GMRA 2XA8H 4JAMA 2E76C 1WICA 3SKMB 4KV5F 5DYOA 3I9GH 4PJBE 4ETQA 1NA8A 1HQRB 4EXKA 5ENWA 2Q6WB 3N43F 3CVDA 4HJUA 4YDLB 1OGAA 5K39B 1I7ZA 2OMZA 3F7QA 1IIIA 3CDGB 3DXAE 2Y2TA 3POHA 1H8LA 5TE6L 3EF4A 3PWVA 3IVKB 1HWHB 1CF1A 1IC1A 2HT4D 2PTVA 1F6AA 3F01A 5DJ8A 1BW8A 2JCCF 3MLZH 3ZO0A 3CHOA 2X6AA 4W9ZA 1KBVA 3NZSA 4GRMA 4RDQF 1TR7A 2AK1L 4F2FA 4OZIB 3UTSD 2O6DA 4I7ZC 1DO5A 3MNVA 1J5IA 1LWRA 2EH8L 2F0CA 3SQRA 2X70A 3O2WH 4L8DA 4F7CA 4YHLH 2BNQE 3FOLA 3G04A 3V5DA 1AQDB 1YMMB 2J1ZA 2YO3A 4F20A 4WI2A 2BNRD 3SKNB 1CVSC 1T3FA 1F8TH 4XP4L 1QSEE 1KIPA 2PW2B 3K5RA 4YDJA 2Z7UA 2ZG2A 4WFGD 1UOKA 5B39A 4I2XA 5MERA 1WBXA 1XB3A 1HHIB 3O3DA 3QXAB 4G6ML 4JE4B 4DQOL 1KTDA 4TNWK 5HPMB 1BQHB 2EDNA 3U0PA 4BQBA 4TTDD 2AERT 4M7JH 5FUCE 2C7FA 1CFVH 1YYMH 3BWZA 1QO3B 5DVMA 2OYMA 4YIQB 3QEHB 4IK6A 3S35X 3EYQC 4F7TA 2WLHA 3UPCA 3BZDA 1UWYA 3CTTA 3FFDA 3TA3B 1E67A 5FW6A 4AC4A 1T1WA 2VDPB 4ZMPA 1RVFH 4P99A 2Y36L 2WLMA 3AGVA 4QRRD 4PS8A 5BW7C 1KJMB 4PJAF 3NIFE 1F97A 2GTWA 1NBVL 1PG7W 2Y7LA 5F9AC 2A77L 1AC6A 4Y16A 4U6HA 3RPBA 4ZNEE 3ZR6A 1LGVA 3ZDWA 1JV2A 1EEZB 2P8PB 4JMNA 4NM8H 3REVB 3UP6A 1WG3A 1QMUA 4NQDD 2DQIL 5C0GB 4K9JA 1R9FA 5D93B 4FYQA 1CK0H 2IGFH 5BPPA 2FWUA 2X41A 3A67H 3BWUC 2AI0L 4JPWH 1U8CA 4LOFA 3SOBL 3TP4A 4G83A 3PJSA 4DGVH 2NYKA 3HUJA 4C55A 3BH9A 5EUKA 4RMBA 2NY2D 3L4WA 1BOGA 3D0LA 3CFCL 1PQZB 1T0PB 3DDFA 4HAFA 1ZGLA 4JO3H 1LO3L 5I1CH 1CYGA 4R5TA 2CJUL 3ROLB 3AUVA 3FN9A 1UQSB 3WIHL 3KPLA 3AM8C 4OQ1A 3Q05A 2YPVA 1QP1A 4M8UA 3ZYIA 2YEZA 1K72A 4YVUA 3VTTA 2I9TA 4Q6IA 1KGYE 2VN7A 2BP8B 3GSOA 3P0VH 3GGWA 4YDMA 4PP2A 1HZLA 4BEIA 2XA8L 4GAJH 3IJ9A 1UZ8B 1A7PH 1DLHA 3GS0A 1D5MA 4H13C 2PCYA 4J3VA 3I9GL 3MUUA 4NM4H 4TUOA 1U58A 2FJUB 1IJ9A 3RWDB 1K2DA 3T3PE 5KSUB 3OSVA 2FECI 2QKIB 4LCUB 1ZS8B 4X9FA 3MQIA 3D0VB 5B3NA 1RK0A 4JQXC 1X5IA 3GIVA 1AGCA 4RA0C 4YWGH 5I75C 3CZLA 4DEPC 5FA4B 1VENA 1H6UA 3QXUA 1I8KA 4DVBA 3NJGA 1XBDA 3BWAB 2R15A 2CRIA 3PY9A 5J56B 2C4FT 4JREC 4F9LA 3KAAA 4GS7B 4PJXA 1BJMA 4KK5D 2V2WA 4OJYA 4MKMA 3EH5B 4PV8A 2K0RA 2GBAA 1I3GH 2Q3AA 2YXFA 2ZX6A 3O2WL 4N20A 5GSRA 4YHLL 1Z1WA 4OD3H 1SBSH 4LOUC 1BJ1J 5T3ZH 4PVLA 1D9KA 1YMHA 5TQ2H 4D7BA 4A6YA 1F8TL 1TZHA 3CSGA 2X12A 1EJFA 3PAVA 4JJ5A 1AP2A 1F4AA 3CZGA 1C12A 3PAYA 4KI5C 4KMTH 5DJDA 3TA4D 5H37H 3GMQA 4J3SA 2B39A 2LVCA 4OCNC 2WZ0A 3QSKB 1YVLA 2Z31B 3O9WB 4X8GA 4YR6A 1IEBB 3IFOB 3HPJB 4Z7NE 4F7EB 2OTWA 2VABB 4QR7A 1JF1A 1CFVL 1WAPA 1YYML 5ESQA 4NC0B 2FEJA 4FRWA 5D1ZC 1ZIAA 3MRGA 4LOEA 2XN2A 5KYWA 2BSRA 2ESVE 1PZ3A 5D1XE 1YYCA 2V5TA 3K72A 3GB7B 4KUCF 3QRBA 4EZLA 3QQDA 1RVFL 3HZMB 1G7PA 3LPFA 4M5TA 4RMWA 1J9TA 5CR1A 2BVPB 3QUMA 4R7XA 1TQCB 6TAAA 3NJKA 3VRLF 3QZWG 4WNJA 1Q8MA 4NM8L 4PY7A 3RGHA 2NW2B 5DJ6B 4AVKA 1CK0L 2IGFL 3LKRB 3U2JA 3A67L 4JPWL 3ZHNA 3HW7A 4JG9A 2HT2C 3GM0A 1UXLA 3RDTB 2BC4A 1YN7B 3THML 3PWJB 3VSQA 5C9JA 5FXCH 1HSBB 4MXWH 4XBEH 4AIOA 3HHMA 1WQVT 5FR3A 2D3VA 1ROWA 4NO0B 1HH6A 4LNRA 4YL9A 5CN3A 4JKKA 5JIDA 4ELKA 3RUGB 4NP4H 4A2LA 3P02A 1AO7B 3UADA 5I6XB 4S0TD 4JO3L 5I1CL 1DJYA 1ZT4B 3FB8A 3GMOB 4HKJA 1PDKB 2VZSA 5GHWH 3SBWA 4EUPB 3PDGA 2Y1YA 1QTYT 2EO7A 1I9RH 2QQLH 2F1AA 2MEJB 2NXZB 3IKKA 6PCYA 4JRYA 2C3XA 1J8HE 4X4ME 2HX9A 5SX4H 2BIHA 1TZIB 3M7FB 4HFUH 5ISZB 4JDZB 4LPTA 3IFNH 1WCQA 1MJ8H 4ZDHB 5B38A 2Z7WA 4GAJL 2IGLA 2OMVA 2ESVD 1A7PL 2YAFA 4LLWB 4B53A 1VERA 1KBGH 1IV8A 4KK8D 4NM4L 1J1PH 4FN0A 2QJDA 2ZKMX 1R5VA 1KT2B 1A7RH 5C0EA 4XCNA 3CVHA 5EIIG 4YWGL 3T4AB 3KL5A 3AREB 2CGRH 4HLEA 4YDKH 4JFEB 3UC2A 1BYPA 1R47A 1YLBB 3Q5TA 4XB8A 1DVFA 1E28B 3ZDYF 1MCQA 4JFZL 4NKOA 1OHQA 4A63A 1KYDA 4X99A 5EEWA 4EOWH 1GZQA 3QQ3A 5DZPA 5KSAB 1I3GL 3KM2A 2MRYA 5C0JA 4ZNCD 1J5CA 4Z7WE 2Y5TB 4WI5A 1SBSL 2LAGB 5T3ZL 3RIAK 4NZUH 2PUQT 5AD0A 1P7BA 4XBGB 4XH2B 4MMXC 4R2GD 5TQ2L 1FNSH 2XIDA 3WKYA 3U7WL 2HKFH 1J0IA 2XG4A 1B0GB 3WE6A 4KMTL 4HWUA 5J8OA 2GCYB 3H0TB 4MA7H 4B5ZA 4Y4FC 2W07A 5CMAB 4JMXA 1RU9H 2C1OB 1FFNA 4G9DA 3NH7H 3RWHB 2DQDH 4X5PA 1WYJA 5BVJB 3FUJA 2XY2A 3STLA 4AJYV 2R29A 5GS0H 1NIFA 3MO1B 1HXMB 1OQOA 4GG6E 4BUHA 4IOFD 4LQFH 3UG3A 4FQXA 2GK2A 2X9WA 3TWCH 1I8LA 4AG4H 2R2EA 4JJOA 4Z9KB 2BP5M 4M4PA 2YFOA 4FDWA 3TBSB 2H8PA 3SDCB 3WJJC 3M17B 4IIZA 3L5WB 2WBJB 5T1DH 3ZTNL 1P5VA 3DO3A 1GOGA 4NSKB 2NUPA 4I9XA 2WIIB 4QXGH 4QLWA 3OJVC 4R97B 5B4MC 4B9GA 4F37F 1KENL 5KBLA 1G6RH 4TQPA 3MV8B 3KPQB 1YECL 1LEGA 2ZYIA 3G6DH 5LDSA 3N44B 8FABA 2VZUA 4TQIA 4UQ3B 2UWEB 4JFQA 5DSCA 5TQ0L 1CICD 4FNTA 4BWTA 1HCFX 5BV7H 3OG6B 1U36A 3U1PA 2VLRE 4UTAA 5C0RH 3FT4A 4NQEB 4WW1A 3G5YA 4WJ5A 5E9NA 5GHWL 1J5OH 4EI5D 4PJHE 1AOHA 3B56A 1MELA 1I9RL 4JVUA 2R9HC 2QQLL 4J1UA 3BIKB 3A22A 4MQ7A 3K2UH 3VQMA 3OHXB 1HILA 4KNTA 3N40P 5EUOF 3VI4F 4JZNB 4XPGH 1M2VA 4PV9B 3EF7A 3LPWA 2F74A 4HFUL 4KVNH 5AW1B 1AR1B 1ZK9A 1MFDH 3IFNL 4WWOA 1MJ8L 2YUXA 2Q1EA 4FI8A 5D4QA 5C6WH 2P80D 5CD3A 1JDDA 4QI3A 1J1PL 3BLPX 1A7RL 5MEQA 4TN9A 4WSGA 1SXNA 2DM3A 1TJHH 1HHJA 2VYRE 3LX9A 1NKOA 3LQAH 5IVXB 2BIQA 4HV8A 2CH8A 4JFTA 2IC2A 3JTSA 5IB1B 2CGRL 4ATWA 1V3LA 2J44A 4CL7A 3L3OA 4LPCA 1JV5B 2BHYA 3OKNA 4HHGA 4PJGF 3F84A 4M3JA 2B14A 5HJBA 3RNQB 1B3IA 1PX8A 4N5ED 2X6VA 2VL5B 1NPJA 2ERJB 2VE6B 3ATBA 3QCUH 1PY9A 2AV1A 3MC0A 3PXHA 4GAGH 4OFPA 4ZSOE 4EOWL 2X4SA 3OKKA 3SGKC 5EDSA 3FBQA 3WSQH 1AXSB 4LZKA 1ED3B 5LLIC 1JWMB 3EO1A 5AW2B 3VD7A 3EFOA 3QDMB 4XZUB 4NZUL 2OJ1A 5EFIB 3KPRA 4LPUA 1FNSL 1YSOA 4JY4A 2HKFL 3CHRA 2OULB 2W60A 3QR0A 1TVHB 4HKBA 4NXKA 3CN3A 2F7PA 1IFRA 4MA7L 3OX8A 2E9IA 2HJLB 1RU9L 5D9SA 1AS6A 4ZUVA 4AE1A 2O6CA 3NH7L 2ZYRA 2ITDB 3D2UD 1JCKA 2DQDL 4XNZC 2V9UA 5EORH 4POZD 5CN2A 1XTMA 5GS0L 5HHOE 2EEFA 3C2SA 4OM1H 5M94B 2XX1A 2ZP0T 4JFFA 5E2TL 4LQFL 4I0PA 3AS0A 4HF5H 5AOMA 1AQ8A 3TWCL 4AG4L 1GGYA 2CKBB 4RGNC 3MBWB 3ULVE 2GABA 2ITCA 3HLKA 4X4XB 1ZLEA 3K71B 4NT6B 4X6DA 3UL4A 2GTZB 5T1DL 4BFBD 3P9WB 1FZJA 4GKOA 3BWSA 2EVIA 2GBTA 3OQRA 3V6ZA 2CLZB 2DWEA 3AMKA 4QXGL 5DJZA 3WNNA 3S8WA 4QF1A 4Y19E 1I8MA 3EOBB 1BJ1H 3KBPA 1G6RL 4G42A 3WN5A 2DWTA 1GRWA 3C60C 4O51B 4XNXH 3IGLA 3G6DL 1I7UA 3EOTH 3ESPA 5HTSA 2MHAB 1K5NA 3MV9A 5GGSB 1EAOA 2XJKA 4AWJC 1CGVA 3RNKB 3ARDC 2XG5A 5BV7L 3RWIA 1T5KA 2BHFA 4UV4H 3VRJA 4PJFE 5E9DD 2YPKB 3DVFA 2YRPA 3KWWA 5C0RL 2X6CA 1NAMA 2UZXB 1J5OL 3QFJE 1LEIB 5FFGA 2Z0UA 1ZD6A 1SF3A 1A6ZB 2JE8A 1A22B 4U7MA 2ZIDA 1SNRA 4MD4B 5CWSB 4NKDA 2N1TE 1P4LA 1D6EA 3TCLB 4XPGL 2F1BA 5TE7H 4ES8A 5I17B 5CBEB 4I89A 1N70A 1VZHA 4HU2A 5SWSB 4ZQKB 1A1OA 4KVNL 4A67A 5JDSB 3RDJA 1MFDL 4HIXH 1ONQB 1XH0A 4GUPA 4P2CG 4TNWF 3T04D 3V4VL 4HA1A 2B1HH 4JHZA 5INDA 1YNTA 2HN7A 2EEDA 3U6RB 3FMGH 4WWNA 3I84A 3KR3H 4TL4A 3GWJA 5AFAA 1OF2B 4LSDA 2RMNA 4YPGA 5J11B 3LKSA 4QXUL 5LG1A 2BSSA 3H9HA 1PL3A 3HZ3A 3ARZA 4IBWA 5AG9A 4ZFGH 1K4DB 4Y19D 3NSJA 1MLBB 2GB2A 4UQ2A 3L81A 5IW3A 5GGUA 5JTWA 2VLJD 3PHQA 2B2XH 4WIQA 1AKPA 1FLTX 2W95A 3SHSA 1AE6H 4N6QA 4A55A 4AV4A 4CN4A 4D0CB 4DEWA 3QCUL 4GAGL 4L3EA 5CJ5A 3GYRA 3ISWA 4RIRA 3WSQL 4MNGA 1QOKA 3AITA 3BJLA 1T4KB 2APSA 4D8PA 2CPUA 3H9SD 3CBJB 5H4ZA 3HE7B 3D05A 2WXMA 4YBQC 1WJ3A 3CZKA 2EDQA 4Y89A 4PCKA 3SPCA 3SYCA 5ECJE 2BOCA 4GRWF 1W2KT 2P5EA 2J73A 1KGCE 3H55A 4PSRA 2XKNA 1U93B 3I3DA 4G3YL 4J8RB 1L9SA 4S10A 4FNLH 2W94A 1L6PA 2JIXB 1FNAA 1NANH 1XSIA 1GOFA 4V33A 3BZFA 5B39G 2IBBA 1ZA3B 2NNAA 4H1LB 4OZHF 4W70A 1PKQB 4WUKH 1H3GA 3RGVB 1UADC 1G1CA 1IGJB 1V27A 1X9QA 4N22A 5E4EC 3S4SB 5E94B 4ELME 3QNZA 1W72B 5EORL 3GMRB 4P5KB 4PS4H 3OJDA 4MA3A 4H0LC 4OM1L 2HPTA 1IGMH 5I1DB 1QD0A 3QFGA 4GRWB 1FFOA 5JOPD 3FQWA 4NUQA 4XCEA 5ENWB 4H40A 5F7HA 3RWEB 5FWRA 4ZS6C 4HMEA 2OMZB 4P4KD 3DRTA 5CO1A 1CN4A 1H3XA 4IRSD 1SOXA 3MLYH 2MNUA 5ETUA 3PWVB 4M56A 3P4NA 5D2LF 1F6AB 5DJ8B 5B3SB 1QABA 1P7HL 4CW1A 4JPQA 5J1SC 1DVQA 1I1AD 3GJFA 1WA2X 4Y4HA 2MQ3A 5I76A 2DICA 2VAJA 4XNXL 5E4IA 2BIMA 3EOTL 3VXUD 1XR8B 2X70B 3GMPA 3NDYE 4L8DB 2J1WA 3FOLB 5IK3B 1QLFA 3V5DB 2CIKA 1C5DA 2IALB 5FIEA 2AJZA 4J8QA 4R83A 2RCSL 3DBSA 4GT7A 4UV4L 3VX0A 4NO3B 2OI9C 4LSSH 4YDJB 2P80A 4JRXA 5B39B 4I2XB 5MERB 3BGFC 3GBNL 4W1TA 3M1OA 3O3DB 1C16A 5EOTA 5JUEH 1KTDB 3F2LA 4L8SA 4WI0A 2A9NH 3KPNA 3SPHA 2UUDK 3IMTA 5TE7L 5E4OA 1FVDA 3NIDB 4PJCB 4EKXA 3F65A 1K8DA 2DYPB 1A25A 2APBA 5HGBA 4HIXL 4G8GA 4F7TB 3OXRA 5BV7C 2Q9OA 3FFDB 5DLLA 4AVIA 5C0DB 1OW0A 3PQYD 1CIDA 2WGXA 2HKAA 3FMGL 3HUJF 4R4FL 5DD3H 3VXMA 4NPJA 1CTNA 4UTBA 2GTWB 3WJLA 1U3ZA 4U3HA 4Y16B 1QRNA 3TIDB 5IIEA 4GQRA 1SVBA 2HP4A 2KZ1B 4HXBH 5A7EA 1WBYA 2WTPA 4MCNA 4XAKD 4F8LA 4Y1SA 1FYTE 2ROXA 4OCRH 2DMHA 3QCTH 1LILA 4P06A 4HJ0C 1MFEH 4FAAB 1U8CB 1AE6L 4JQIA 4XHJD 4JN2A 3T2QA 4ZTOL 1PNCA 2DI8A 3PJSB 2NY3B 1ZKAA 4UZSA 4XC3H 1MHCA 1ZDSA 5GRUH 3BH9B 4PJIA 1ZLVK 2D0FA 1BIHA 2PCFA 1BOGB 3D0LB 1WVZA 1X4ZA 2NR6D 2UVEA 2EVJA 3WTTA 3FZUD 3NRPA 1ZGLB 4XNUL 1MCDA 2NZIA 1W0VA 1XEDA 3WIIH 4GFXA 2QHRH 4IDJH 3GJFK 3S36X 4NZJA 1FL5A 2PR4H 2YEZB 4OLUH 5KBKA 1KBKA 4WUKL 3LKQA 3LS5H 1G7LA 4AKPA 3ARSA 2I9TB 1L3WA 1UWXK 4Q6IB 4KKCD 3SGEH 1SOSA 3CCHA 3GSOB 4LBAA 5TD4A 3GGWB 4ANKA 4PP2B 1DDHB 1D5MB 1IGML 4F33B 3ZZ1A 4TUOB 3BD5A 4ONGL 1K2DB 2AF2A 3VA2C 3UYPB 1NMAH 5D7IB 1U8NA 4RMTA 1XV8A 3NPSB 4H0HB 3ARXA 4OUUA 4OM0H 4XRCB 1ANUA 3VTMA 1RK0B 1AGCB 1GY1A 1VB9A 1FBIH 3MLYL 2V7NA 4PYHA 1NFAA 3DX6A 4ZPTB 4X7EC 4X6CA 3RA7H 4AEIL 3BUPA 1I8KB 5DMYA 2NNFA 5CKGA 1U3HB 2CM6A 3CG8A 5F7AA 3VXUB 4PJXB 4PV8B 2FT6A 2V2WB 4QLRA 4MGXA 3DX9A 5E2WH 5FGCB 5DD1H 1YMHB 1XSJA 5HDOA 2UXVA 1CI5A 1BG9A 3MDJA 4QCIA 5A2IH 5BJTA 5F89A 4JJ5B 4LSSL 7PCYA 1AP2B 4NJ9L 5I0VA 1C12B 5DJDB 1CDBA 4GO9A 3IPBA 1G7HA 2UYLA 4ODXA 3LKOB 4RX4A 3AT8A 3NCXA 2F53E 5JUEL 4ZMAT 3K81A 4F8PA 1OOWA 4GO8A 2A9NL 2NZ9D 1JF1B 3ZGHA 4PRAA 2VSCA 4QKTA 1FL6B 2VMDA 2HVKB 5F1KC 2AMUA 5AW0B 2C9SA 5AVZB 2BCKA 2LHAA 2FEDC 5KYWB 2BSRB 3QS3A 4GQ9L 1CL7I 5JMOC 4GRLB 5B38G 3K72B 4K3GA 3LSOA 3QQDB 4LGRB 5DD3L 4G80A 4N8PA 4HGWA 2CDGA 1G7PB 4K4KA 4F9PA 3EDDA 4G7QB 3MV01 3MR9A 5F7UA 4OGAD 5CR8A 3PL6D 4PY7B 1M1XA 3D07A 2AJVH 4QHUA 4HXBL 1A6PA 4OCRL 2PETA 1AMYA 1MFEL 4GW4A 3Q13A 3LXBA 4KRMB 4MB3A 3WNPA 2JKNA 2IH9A 3TESA 1JTPA 5C9JB 1ASOA 5GRUL 4XO9A 4GBXD 4DP1X 1HH6B 3H3PL 4WNQA 1K8IA 1TYJA 2APWA 2Q76A 3ZOAA 3FB8B 4HKJB 3WIIL 3LZQA 2R8SH 1MY7A 3IRPX 4K7PY 4QY8A 4BFFA 5J7CC 3LV3B 1GKEA 3V4PH 5I6LA 4R26L 5D7LA 3ZKNC 3QUXA 1CBJA 2FJFB 4JJHA 4TF4A 4JRYB 1BLIA 2PR4L 4B9JA 5ESVA 4AEFA 3VDBA 2YSSA 4OLUL 4OFVA 2XVLA 5DEZA 3GI8H 3OKEA 3LS5L 3DIFA 3NEXA 3HRZA 1WT5C 3SQOL 3VWJC 3ETBJ 2X4NA 1HE7A 1CLYH 1YEWA 2H3XC 4LGPB 4B9FA 3Q5OA 1T03H 3SD2A 3V7AE 5J5EA 2G75A 1Z5LA 2BOLA 2QZ5A 3V0HA 4X6EA 5CN1A 4KITB 2A9BA 1NMAL 4DH2A 3SJVA 5C0EB 5IJKA 3QAZB 4PFEA 2DWYA 3GFUA 3CVHB 2OL3H 2BRQA 2MTAA 3QXWA 4DZBA 1U4EA 2AXWA 1FBIL 4NNXA 4PCTA 3VXRD 5HXMA 2G3XA 4HFWA 4TM9A 5FYLE 1CLCA 1UASA 3GJEB 2LU5A 4H26A 3RA7L 5I74B 3TJEL 1USZA 3DWTA 1CTOA 1S78C 2BXZA 4HJTA 4NKOB 1CFNB 2TRYA 5HDBE 5IHLB 1CS6A 3Q2NA 5HVGB 3QZLA 3IM1A 5DD6B 5C0JB 3CN1A 3HN5A 5E2WL 1H3UA 1OAZH 2EYSA 2I24N 4DUVA 5IKCA 4FG6C 1QZ1A 4N2IA 5AD0B 2DWDB 5E51A 4JFHE 1F5WA 4X5RA 3JUYA 2IFFL 4BFIA 4P9HH 3ESNA 1KF9B 3FUHA 5AYQA 1JGLH 2XG4B 2XN9E 3O6LH 3WE6B 4JVWA 4AT6A 3Q01A 1PX3A 4QOKE 2W07B 2ZCLH 1UM6H 3N91A 1KTCA 1EGJH 5C08D 4QRRB 4Y4KD 5IJVA 4IRJC 5FO2A 1DN0A 1S5IL 2FGWH 4RWHA 2EDJA 4P2QD 3STLB 2QSQA 1TTGA 2VZOA 2D4FA 4NQDB 1U8HB 2SODB 3SQBA 1KOAA 3UEQA 1KFGA 5LN8A 4GI6A 2HB0A 2BW4A 2FBRA 4GB9A 4DKEH 1DL7H 4TRPH 3KHQA 3NCBB 3P3YA 5EOCJ 2H8PB 3LZOA 5DD0H 2CU9A 1EJ6A 1P5VB 2QPDB 2VDLB 2ZSWA 3A6OA 3IJHA 4UU9A 1AQHA 4Y2DD 5ACZA 4B9CA 4H8PA 3BUDA 3VI3A 1KB9J 1OK0A 1MKFA 4OFYA 2AJVL 4PWGA 1TQVA 3MRLA 4UWQB 4HH8A 4AGPA 1ZVYA 3JBG7 3M8OH 3MLXH 1LEGB 4HUXB 2IAAC 1FI8C 8FABB 4Q2ZA 3B2DC 4JFQB 5DSCB 2PTTB 2X9YA 3QIBD 4P07A 3RTQA 1PYWA 2GIYA 4Z7QF 1QFUH 4GUQA 3NQKA 4FNPA 3FUMA 3FT4B 3MRPA 3QG6A 2WWOA 3G5YB 4FF9A 4KROC 4WJ5B 4WW1B 5MI0C 2R8SL 4LCIL 4E2OA 4J4PC 5DRWB 3V4PL 1OAKL 1L9OA 4J1UB 5KVMC 1M7IB 1HILB 1GJUA 5F72S 4GFTB 1PKOA 1RUQH 4LSRH 1M2VB 1UVQA 1Z3GH 4XO8A 2ZWKA 1WGOA 4WI8A 2F74B 4JGUA 4P2YA 3QYNA 4QHPA 4IEFA 2HLFC 3EGXA 3GSRB 1CLYL 4KI5E 1T03L 4FZEH 1Q4NX 4YOKA 4F3FA 5CD3B 3NSDA 3WY3A 3MGTA 1JPTH 5LAPA 2MPVA 4KU1A 2OS7A 5DS8B 4X0NA 5DTFB 5MEQB 3VD1A 2XX0A 1Y18A 2C9RA 1HHJB 1CD0A 4RBPK 3SE8L 2GC7C 4HV8B 2OL3L 3VFNB 5B8CA 3JTSB 3UAFA 1OAUL 4CKVX 5AW4B 3O45A 4A66A 4PW3A 4EDXB 4IMLA 4KMLB 4PRPE 4E5XA 3OKNB 3QIUA 2OCFD 4YPJA 2AV1B 4I4WA 2ATPA 5T1MA 1Q72H 2CR3A 2NY6C 3LRLA 5HVWA 3EO1B 3VDCA 1OAZL 4A1RA 5I6MA 5LGHH 4DOHE 5L9DH 1MHPH 2YD6A 3V6OC 4W4OC 5EULV 2ZG3A 3KPRB 2HRLA 5KYNA 1EBAA 4JY4B 1DJWA 2L4OA 2Z4TA 4P9HL 5E6IC 4HKBB 1JGLL 1C5CH 3O6LL 1JK9A 1JK8B 1IAIL 3KG5A 1MHHB 4NBZB 4LOUD 5GZNA 5LWYH 4IOSD 2PWHA 2ZCLL 3OX8B 4BZ1L 3X13A 1SEBB 1UM6L 5D9SB 4X6DF 1EGJL 2JCWA 3U7YH 4KDTA 1BPVA 2FH8A 4MJ2A 1HXYB 4PGBA 2FGWL 1CDIA 4ZX4A 4FOMA 4M3KB 1ETZA 1MCFA 4H8HA 1GXEA 1EAPA 1EEYB 4XNMB 4XBMA 3LMJH 3HKZA 2EE0A 4JFFB 5DK0A 4HWBH 5HGHA 3TNMA 4AE0A 3RFZA 2ICWA 1UJ3C 4I0PB 5B1KA 1AFVH 3IJSA 4O5LH 1UTDA 4B96A 5DQDH 3X1NA 2EO1A 2BY1A 3TN0A 5K59E 4DKEL 1ZLUH 2FHBA 1DL7L 2ITCB 3HS9A 3H54A 4TRPL 5JHAA 2NNRA 4D9RE 3D3VA 4X6DB 5DMGD 4Y5YC 5DD0L 1FFTB 2D3LA 2XYCA 3EUUA 4PJAE 5I15L 3VGDA 3V6ZB 3B8YA 4HLJA 2DWEB 5CINH 5DJZB 5JNYA 1BLNA 4QF1B 1XGQA 1XF2A 4X5XA 3WN5B 2CJTA 2XZQL 1SM3H 1M7DA 2IAND 3M8OL 3MLXL 1AZCA 2VERA 1I7UB 4WO4A 4ETYA 1YEFH 2VLLA 3MV9B 4UM8A 2JKWA 2C26A 2YWZA 2EIEA 3RPIA 4IBVA 2XG5B 1MPAH 1BAWA 3KBEA 3RWIB 5E5RB 3VRJB 5HJGA 3RZCD 3KWWB 3HC0A 1ZV2A 3S88L 4L1SA 5AZUA 4KJPC 1LNUA 1NBQA 4M43H 2YRLA 1YC8A 4HLZG 2IG2L 1AY1H 1JYNA 2GEQA 4N0RA 1P4LB 1WD8A 1D6EB 4WF7A 1RUQL 3L3GB 4LSRL 4HEMA 4MMYA 4PBXA 3FU9A 4LESA 4WWKC 3U2IA 1A4BA 5DZVA 2HFTA 2VN5A 3FCGA 2YXVA 1A1OB 2VXTH 3U48A 3NCEB 4UNTA 3QHZH 4GUPB 4LVHB 3CFTA 3QZBA 4FZEL 3B2UC 3ZZLA 1YNTB 2HN7B 1KTRL 2Y6SC 3Q2CA 1JPTL 4MQXD 1L7TH 1VSCA 3WFEL 4X5LA 1KJVB 2JKJA 4DP8X 3OMAB 4WGVB 3H9HB 4P46D 4GSDH 2EIJB 3DTXA 4PLJC 4Q9QH 4WSJA 3JVFC 4BGDA 2BM3A 3DPDA 4LSTH 3LRSA 3PHQB 1F4WL 4U6VH 3MI6A 4F2MA 4X7DC 2M83A 1U8IA 3ULUF 5KUMA 3LIZH 3SKJH 1G4RA 3U1SH 4YEFA 2BFVH 3S5LA 2VDPH 4Z7UA 2V8MA 4XCCL 4E41E 5GRYA 4RIRB 5FYJU 4XAWH 3K6IA 3FH7A 4D8PB 1AC0A 3ZZSA 5AVXB 1Q38A 5LGHL 1JZ2A 4UOW1 5CCKL 1HKFA 5L9DL 1QEXA 1U8PA 2BOCB 2ILLA 1X5YA 1OCWH 1KJ3H 2JJVA 2R56L 1FG9C 1LQSR 2CO2A 3HI6H 4PW9A 3V4UH 1JPFB 1C5CL 1DQQB 4N2KA 1N68A 5L2JB 1OTTC 2WVUA 5LWYL 1GSKA 3EJPA 4PJ9D 1FGVH 5DR5H 1HYSC 2Y24A 2FSEA 2NNAB 3KPSD 4OZGA 5F7LB 4KKBD 5D96B 4XN1A 3L08A 4UYQA 3V9CA 3BSZA 4OFDA 5F0LB 1GS8A 3LXAA 4L37B 4NAMA 4ZD3H 4J3OF 3ISYA 3LMJL 4IHBA 3KYKH 5D6CB 5IROC 1FFOB 3KGTA 3RVXC 3WKMH 1JN6A 3L1OH 1AGDA 4XCEB 1AFVL 3SDXE 1UUSA 4P9HC 5D2NA 4O5LL 5DQDL 2WW8A 4HBQA 2UV3A 2DQEH 2CR6A 2IAMA 3HFMH 4W9FC 3P4NB 3IAQA 2BWDA 4NFBA 3RL2A 3RVUD 1XFPA 3QIBA 2JJWA 2NY0C 1X6NA 1IKNC 3GJFB 4RAUA 4G82A 3PS6A 3ARGA 4MA1C 2HG5B 5CINL 4JRWA 4U1HA 5GSVA 1PF3A 1IGTA 3N1FC 5ANMA 2H5UA 4TLSA 1YEFL 4YBLB 1QLFB 1C5DB 3WTVA 4QJ4B 3ZDXB 2QGEA 3TH4T 3GC3A 2AJZB 5TPWH 2B8OT 1NUGA 1Q0YH 1THAA 4DN4H 5TK4A 3U6XS 1QTPA 4AX3A 3H3KA 1WWBX 5C0ND 3B9KA 3LN5B 2HT3C 2CDFB 2UY6A 4M43L 1C16B 3GLDA 2W38A 2RFXB 3AG4B 4G8FB 2KUTA 1AY1L 4NCC1 3A4FA 2LW3A 1H8NA 4L8SB 5KN5B 3T5WA 3HMXL 4YAQA 1REIA 3KPNB 5F3BB 3EJYC 4MAUH 3NPZB 1NFDE 1LE9B 3HBZA 3DV6A 1BZ7A 3D4CA 3L3DB 3S96B 5L6YL 2DYRB 5HGBB 1EFXD 3QHZL 4G8GB 3OXRB 5C8JA 5F1NB 1G9EA 5D8JH 4WKZA 5AB2A 1AGFA 1L7TL 5E56A 2QT6A 3BPNB 3ZE2E 2AFNA 4GP5B 3VXMB 2ZXGA 4PJIF 4QWWD 1MJ7L 4XE0A 1E3XA 3UAEA 4Q9QL 1UUNA 2J8UB 2VR6A 3QORD 5F21B 3EGDB 5T5FA 3WE1A 4M6AA 4F7PA 2QTEA 5T3ZE 3GT6A 5IIEB 4LSTL 1AGEB 1W91A 1CFMA 3VB8A 3ZDZB 3OAUH 1CB4A 4U6VL 2H1PH 1DN2A 5EEUA 2ZP9A 2B77A 1B4TA 3LIZL 2AEPH 2EDDA 4RGNE 4GUOA 2BFVL 4NJAL 3ZDYE 2VDPL 3SODB 2ZOLA 3VQ2C 4XPAH 3STBA 2QVKA 4E9SA 5CM1A 1AHWA 3EOAB 2X4OA 5D5MF 2NX5D 4MAYD 3W0WA 1LMIA 2OXHA 5IMMA 3BUBA 4XN8A 5IHHA 4FFVC 3RY5A 5I0XA 3VW3H 1OCWL 3T1FA 1KCBA 3A6BL 1KJ3L 1SJVA 4KZEL 3HI6L 1U33A 5C2UB 1ZLDA 5E5MA 3U36A 2A74B 1QI5A 2NNXA 4EI6A 1FGVL 5FYJH 5AVWB 1S8DA 1FL5B 4HWEH 1BPLB 3L48A 2VZTA 5DR5L 2GVYA 3E8UH 2DQCH 1G7LB 1YQVH 4X6CF 5BOPA 5FK9A 4DAGH 2GT9A 1TZ8A 3QDGD 4R4ND 4WW2B 1TTAA 4Z3GA 1PCXA 5HVHC 4ZD3L 1N59A 1E30A 2OSLA 2EXWC 2WYTA 3KYKL 3PWNA 4HEPA 4HPYH 4NIKB 5IQLA 3WKML 3SCMA 3F12A 4EUPH 5EEXA 4GUCA 2DQJH 3L1OL 2IANA 1U8NB 5SWZA 1GHFH 5D6DA 3KMDA 1BX2A 4NZRL 4JM2A 8CGTA 3DGGA 5T3ZD 2DQEL 3HFML 2QGDA 2V7NB 5F0JB 4K7PH 4LCWD 3DX6B 4JFXA 2PW1A 2QGBA 3P4OA 4X6CB 4WI6A 3WMQA 4KWUA 1I7TB 3HS0A 1IGYB 3QEQA 2FZ3B