5LXVA

Crystal structure of ruminococcus flavefaciens scaffoldin c cohesin in complex with a dockerin from an uncharacterized cbm-containing protein
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
172
structure length
172
Chain Sequence
ETVQISASNAEAKAGDQFEVKVSLADVPSTGIQGIDFAVTYDNTVVTIDKITVGEIADTKAASSDQTASLLPTFDVSIQNSEGYSSVIWSTAVEDSSYWISKDGVLCTITGTVSSNAKPGAESPIKLEAVKRETYVGSGTDNSSISAGYSANDKAVKYTVKATNGKISVPSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Scaffoldin C
publication title Single Binding Mode Integration of Hemicellulose-degrading Enzymes via Adaptor Scaffoldins in Ruminococcus flavefaciens Cellulosome.
pubmed doi rcsb
source organism Ruminococcus flavefaciens fd-1
molecule tags Protein binding
total genus 41
structure length 172
sequence length 172
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lxvA01
1G1KA 3KCPA 4IU3A 5K39A 2O4EA 4U3SA 5LXVA 5G5DA 4UYPA 1OHZA 2B59A 4IU2A 4DH2A 2Y3NA 4WI0A 3F2LA 4FL4C 4UMSA 1TYJA 2VO8A 4N2OA 4UYQA 2ZF9A 3L8QA 1ZV9A 4FL4B 2CCLA 3KCPB 3FNKA 2OZNA 1AOHA 1ANUA 5AOZA 2JH2A 2VN5A 2BM3A 4WKZB 3BWZA 3UL4A 3GHPA 2XDHA 1QZNA 2VN6A 2W1NA
chains in the Genus database with same CATH superfamily
4XXWC 2Y9RT 3WLWC 3D0AA 3G5VA 5HHPA 3SKOA 3VXUD 4RA3A 5I28A 3ULSB 4IOSA 1N7ML 5IREA 4WWKA 3NJMA 5LQBL 4ETQB 5C0CB 4UYQA 4ODWB 2ZKMX 3BCFA 5JUEL 4FQ1H 2EH7H 1PZ5B 3TWYA 5GZOA 1E27B 5A3IC 2YJQA 1INQA 1IKNA 2RGSA 4ZX4A 4NBZB 5T3XH 2DICA 4UQCA 4P07A 3HE7A 4QRSA 1KTLB 1NOFA 2PWEA 2E7CA 4OCMC 4XRCB 2EIZB 3PHSA 3UPCA 4NPJA 2APBA 4HIXL 1G7HB 1ITBB 4XP9H 2AI0L 4Q9BA 4PVNA 4BFFA 5EBLA 4F37F 2XA8H 4X7SH 5AOJA 3BJLA 4B7LA 2MCPH 3QUML 3EG9B 3IDMB 2J8UA 1AIFB 5F96H 1YY8A 1FZJB 1XF3B 2CJTA 1GAFL 3QA3B 3RDJA 3B2UD 5DGRA 1HINH 3HIZA 3E9UA 1NCCL 3N85H 3T6WA 3WIIL 4BFOA 5A40E 4HZ1A 1X4YA 3W5NA 2X9YA 2EUXA 2VIRB 4L5FH 3EYUL 4F5CE 1NMCC 2Z8RA 2A77H 4HKJB 5BVPH 4DHLA 4DPRA 2EECA 2I26N 4Y19D 5JHDE 2R7EA 1TJHL 3FF7A 1INEL 5T1JA 4WWNA 1CGVA 4YDIL 4JG5A 3TA3D 3V5DB 4NLAA 4FE9A 4L18A 3R0MA 1DN2A 2LFEA 1IQDB 2W65A 5LWYH 3D2UD 4ZXBC 4NQSA 1T83C 4UQ3B 1NC4B 2BP5M 1UOLA 3H2WA 4NPYB 3TS8A 3AXLA 3AS1A 3CHOA 3HZKA 3GSOB 1OP3K 3OKEA 5BS0A 3OKDA 3TGXA 5DZVA 2ILLA 1AHKA 4PTUA 5DZPA 4Y4HB 3PJSB 3C60B 4UV7L 4TQHA 3WFDL 2Q86A 1JZEA 5K9JL 2JE8A 1QASA 3SJVE 4LVNC 1ZLWK 4LSSL 4LAJH 4M6OH 3MOAL 4WO4B 4JZJA 2DQFB 2G2PA 3FSZA 1HHIB 3DUSB 3FPXA 1NGXB 3NIGF 5H37A 2F5AL 3BN9C 3E7JA 1DUYB 3ARFB 4UBDD 2G9HA 1A0QL 1WWAX 4KKZA 3NJIA 1HSBB 5CBEA 2Z4QB 4M1DH 5H37G 3ZHFA 5J11B 1JGLH 4KK9C 4HEPA 2VKXA 3WXWL 4ZMAT 3FQTB 4ZPVA 1ZLVK 2F8IA 2YPLA 1P6WA 2GI7A 2CBPA 4OIBA 5AL0A 5EZOH 2C9XA 4AMWA 1M2VB 4OF5A 4HEPG 1EDQA 1BOYA 3T6ZA 4CBZA 3O3DB 3CN0A 2P5WA 1XH3A 1NLBL 2CDFA 2ZNXA 4WQOA 5LO7A 5F3HB 1WIUA 1A3ZA 4JB9H 1ZGLM 1XSJA 3OXSA 4UDTB 4XXDA 4HISA 4OFYD 4A39A 2BXYA 3QQ3A 3DIFA 1H8NA 3L7FA 4MBRA 5T8IA 4JFUA 3UTOA 2VR8A 5TTRA 3GO1H 2D7OA 4EBQL 3BGFB 1A7QL 2I07B 3RGVA 3KGRA 3HG2A 2DQHH 4FLHA 4ALAC 3KPRA 3FTUA 4P5TC 2P5ED 4L3EB 3CIAA 4P2QB 2XXCB 3FSWA 3UDWC 4ES8A 3VYOA 4WRLA 1RZJC 2ICWB 2WJ5A 4JY4A 1OTUC 5CCHE 3NFPB 3MZTA 1SMDA 3SCMC 3QUZC 2RIKA 1KUMA 1FGNH 3GKZA 2Y7OA 5ID0B 4A2DA 1L9SA 3B2XA 2OJZH 4G1MA 3LIUA 4MNGA 4GT0A 3VFMA 4BZ2L 2YD7A 4FMKA 4E0RA 1MJ7L 2I7SA 3WUWB 1KV3A 4FC3E 1KPUB 4ZW5A 2DH3A 4GS7C 4S0TD 1CI3M 5C6PB 1JNHA 3SY6A 3BO8B 2H2SC 3C9NB 1BSIA 5IB5B 4NKQB 1FORL 1ZK5A 4WUUD 3IDGB 4GXUM 2ALWA 1UM6L 3Q6GL 3TN0B 1MFEL 4X6FA 5F44A 1FQ9C 4LQ1A 4NN7C 3TL5A 3RG1C 4JRYE 2WC7A 5EORH 2OYPA 3KXFB 3W39A 1HHGA 2UZYB 4UT9H 2CGRL 3D0VB 3LKNA 3GQFA 4AV4A 5GXBB 4OI7A 3IGAB 2APSA 2UVFA 3C6SB 2YBRA 5AAMC 4HUVA 3L4WA 3UCQA 5IVOA 1UT1A 1AQDB 1DR9A 2R4SH 2VZOA 4UT6L 4G7VH 3MC0A 2ZCKL 4MJIA 3L6FB 5F1SA 1E90A 1A7OL 1RSFA 4Q2ZA 5FHBL 5KANI 5ETUA 3HEIB 4DZBB 2K3HA 4UILL 3Q8AA 2PCXA 3VI3B 3FZUC 1BQLH 5D5MF 3U36B 1SDYA 1A6TA 4W9KC 1K85A 3AU1A 1DVZA 4Z77A 1XH0A 3AQXA 2X2YA 3CH8A 2V3FA 4MAYA 2R1YB 4MB4A 5D1ZB 5D7IF 1N6QL 1CU4L 3IFOB 2JV6A 4G9FB 1IV8A 3RVXD 5GZOD 1LP9B 5IMLB 5ISZB 3MNVA 3SDXB 5KBMA 3HE7D 3A4AA 3V5KB 1OHZA 3GMOA 5HYJA 1I3RB 2QVTA 4FP8H 3O8XB 1OCOB 2YRPA 1I31A 2ZX8A 3PGDB 2JKJA 4QKTA 4NAQA 2IADA 2BJMH 1NIFA 32C2B 3LNIA 4QHMB 1DQTA 5C8JA 4OLWH 1R24B 4L4TA 3CHSA 1EO8L 1L3WA 1CVSC 4IRSA 1A02N 2JXMA 5AVYB 3ATFA 3MQIA 5TE4L 1S3RA 3C2AH 3EO9H 3EYSL 1JHKL 4E9RA 1QSVA 1KLUA 1CBVH 2KDGA 3TBWA 4XB3A 5I82A 3TBSB 4ENED 1A6WH 1RFDL 4HLEA 1IFHL 2XC8A 1BQHB 2FO4B 3FQWB 3GK8L 3NIFE 4HJJL 1JGVL 4UNVA 3CFDB 3MLXL 2LU5A 3RIFF 3EGDB 4BSVA 1UB6A 3NK3A 3P4LA 1IGCH 4B7IA 4DAGH 5I0XA 5CLTA 4QRRB 3TLRA 5CSZB 3UAJC 5LAXB 5F3BB 3H53A 3UC0L 3RFZC 1XXFC 1DQQB 2J1ZA 3DVNB 1IARB 4AEIL 5BS0D 1E9PB 4TM9A 5IVZB 1NGPH 3L17A 1G43A 2ZOUA 1BLNA 4N2MA 1E7UA 5AW9B 3LIZL 2YEZB 4NQCE 1YEDB 1VGEH 2C1OB 3UBHA 3CSYA 2FIKB 1AR1D 5B8CC 1FYTE 1IL1A 2Y2YA 5INDB 3C87A 5ILTL 4PIBA 4DVBB 4Z7QE 2H8PB 4RNRB 5HTSA 2NY4B 3NK4A 2F58L 4Y5YC 5JHLL 4Y5XC 4OY9A 1JNNH 2XTJD 1T0MB 1D5RA 3LSOB 1ZKAA 3BHBA 1I4FA 1OGAB 2G30A 2XQYK 5JIHA 2WBWB 4F8LA 4OB5L 4U0RC 1AHWB 5E2TL 4PYHA 2YPLD 4I1PA 1M1XB 1F4HA 4TNVK 3NCEB 5C07E 1HHKA 3HS9A 3OAZH 2P5WD 3UC2A 3MRNA 4WI3A 3MX0A 3DXAE 2XIDA 4RWHA 4YWGH 4LDCA 5HYQB 1T6VN 3QIWA 4YSTA 1MCPH 2QR0A 4LU5H 4HJIA 4PJXA 4M7ZB 4YFDB 3U4BL 4CL7A 3W9EA 3WNNA 3W3BA 4LBEB 4ZXBA 1BJ1J 1T83A 3CBKB 3W11D 5D1QB 4QHLA 2AHIA 4AT6A 5KUMA 4BHUI 3KPRD 2X6UA 4JFPB 2W60B 4HS8L 4JPWH 5B3NA 1J48A 5T1LB 1UT2A 1IGTB 2KH2B 2EXWD 2X4SA 3MXWH 4YHKL 4KTEL 4HPYH 3O2VL 3IF1B 5HHME 5C0BA 1NAMA 2FX9H 4JGJA 2R0WL 3BXNB 3FH5A 4P9HH 5MI0B 1JZ8A 3LN5A 5CJOH 4PS8A 1TFHA 3QRGH 1CD8A 1Q9KB 4ORZC 1UWXH 5IW1B 5MEND 2DWDA 5AVRB 1T03H 4YK4B 4RFEA 5EIIB 3T1WA 1R3JA 2BIIA 3GBNL 4DCQB 2UUDH 3GRGA 5C09A 4Z8FH 2X2IA 5F9AC 4M29A 1RH8A 1CCZA 4BFNA 1W91A 1T0NA 5E1QA 1AXTH 1A1OB 3DHMA 2F53E 3G5XB 4ZJ9A 1L5GB 4ANXA 5J1AB 3MCG1 5KZCB 5D7JA 4FA8A 1XR9A 4PJIA 1HOCB 3O6ML 4OU3A 3E2HB 2QADC 4A7GA 4E5XA 2V7HA 2FYYA 3DI2B 2XKSA 1AKJB 3Q2CA 4FHJA 4AUUA 1LTXA 3F01A 3U83A 1A6ZB 1IRAY 2C7UA 3KGUA 2J1WA 4E5XG 4ZX6A 4I18A 3QUYC 4MJID 2GIYA 1PG7W 2NY3D 3EJYC 1TTAA 4LQFH 4J3VA 2VL4A 1ZLUH 3H6JA 1PAZA 1MJJB 5I1EL 2AJ3A 4EN3B 2QVFB 4GRLA 4I7ZC 4EEEA 1L9MA 4ZYKA 2RQ8A 3PDOA 5ID0A 1FG2A 4YL9A 4UOJA 4HUXA 3ABLB 5GISL 3D05A 3OR6A 4CVWA 1JYXA 1NBZB 3MA9H 5TQ0L 2OX5B 3MPCA 3V0WH 3JWNC 5DFVC 3U30B 3EJTA 3OKKB 3CX2A 4MAYD 4NKDB 5BNXD 1DQIA 4ZAKD 4WEBL 3SCMA 3QUZA 2M8XA 5F8RC 2DM7A 2VSMB 2BVEA 2W0LA 3RHWK 2WLMA 3SE8H 4WFGD 3I3BA 4M6NL 4LHUA 4BCZA 2AXFB 1XT5A 5HJ3B 3NACH 4GMTL 3VXRD 4QXVA 2QSCL 3V5HB 3DUUB 3HR5B 3Q2VA 1VFBA 1FL5A 3VXSD 4LHUG 5H94B 2HFFA 5BXFB 4GSDH 5HYEA 3NZ8B 3ZL2A 5JW5B 4L4TD 4PGCB 4QXUH 4XO9A 1ZHKA 2OSWA 3VG9B 1ETA1 4GEJA 2ESVB 1GC1H 4U4IA 2A7BA 5I0ZA 4OV5B 4C4BA 4YXHL 4HK0A 4RGMB 1ZMYA 3SIKA 1PG7L 4JFQA 5JXAL 4G6AD 3VU2A 4YO0A 2MHAB 3UPRB 3DOSB 2X2JA 1WAEA 4CMMA 3NCYS 4W9ZA 1A3RH 1VZHA 3RY4A 3QDHA 3IXAA 1H6TA 1T7WA 2FSEA 1CB4A 3FO1A 2O5NA 3WLWD 4JM2B 1Z66A 2R56H 4JFVA 5DJZB 3V2AR 5ABDE 2HKHH 3X2QB 5CBAB 3P73B 2YKLL 3ULVE 5I1CH 2V9UA 3ESNA 1MF2H 5FWQA 1DO6A 4RGNC 1G6VK 2RCSH 2JKLA 5KSAC 1K5NA 1L9RA 2CH8A 4N8VB 3PV6A 4PY8I 2P80A 2VDQB 4JFSA 5F97E 5A3ID 1AI1H 4RISL 3JSSA 5DD1L 4XCCL 3ULVL 2FYVA 2N7BA 2WZ0A 5I71B 5LDSA 3O6KL 3NJNA 1CDIA 5DR5L 3GB7A 3UJIH 2HVJB 1OF0A 3U4KA 2BSDA 4NWUL 1SJEA 2Y6TE 4DO4A 2ZICA 1QRNA 4NHCH 1TXKA 4JPIA 3LEVH 3AREB 3D7PA 1A4CA 3T8MA 5I9QB 5JZ7D 4OZHA 3L5XH 3QFDB 3LS5H 1XGZA 2UUDK 5DWUL 1UH4A 2VQ1B 2QKIC 3IU4L 4MXVE 5DVOA 3CFKB 1DJHA 2AABL 4XMLL 5F7EH 1YQVL 3CSFA 2IFFH 5F7MC 2VM4A 2L7EA 2BNUA 1ADQH 2P4AB 3V4PH 4Z7NF 2DL2A 3FN0L 1DANT 1QKZH 3K74B 2X2UA 4WUKH 4AL8C 2VLJE 5KS9B 4GBXB 2X40A 3B2VL 4PD4J 4PJIF 3RL1A 3FB7B 4A7GF 3T3MF 5HHOE 4A2GA 1JBJA 3MN8A 3VFVB 1RHFA 3BD4A 1QQDA 5J6SA 2NY0B 1WZ1L 1SRDA 1UD8A 3G9VA 1ZLUK 1ZEAL 3S36H 3L2MA 1ZT4A 5FLVA 4QI3A 1Z32X 1AMXA 1HEJC 3FFCA 2R2EB 2Y7QA 3HS0A 1DVUA 4ZXBD 2YD1A 4I9WE 4NWTH 4Y2DA 1NICA 1CLYH 3QXUA 4BFGA 5DMJB 3FNKA 1JPSH 2W88A 4XO3A 2FRGP 1Q9WA 1NEPA 2X9ZA 4JRFA 4LGPB 1XFPA 4XOBA 3AUWB 4ZODA 4PREA 2X6BA 1EAPA 4NZ8A 1SPDA 3EJSA 5J1SC 5C0BD 5AZEL 5E8EA 3ZZQA 2ZWNA 1QW8A 4AI7A 2EH7L 5J1TC 3SD5A 5ANMB 4WEUD 4JCLA 5A2BA 3EJUA 3IDXH 4WKXA 3D33A 3NEOA 1XF4B 1CFVL 2X1PA 1RZ7H 2C1PB 4WSJA 3BN9D 2XZAH 5EBGA 1MJ8H 4Y5XA 3O3UN 2XSKA 2J43A 4P2OB 2BP0A 3BDYL 4I13B 3MRFB 5C09D 5KYXA 4KK9D 1FO0H 1P4UA 1T7ZA 3J27A 4M8RA 2HVKA 1O5PA 4FCHA 2X9XA 3TU6A 3VMNA 5GGTL 2MCPL 3WHXA 2F18A 1QPXA 4LPXA 4KJYB 1XR8A 3O4LD 4WWOA 5D1XE 4HJTA 4WHCA 4YMPA 3BAXA 5KG9B 1TKWB 4HCGA 4I77H 1QLEL 4P5KA 2OL3A 3EGSB 5EIQA 3VFOA 4R7NB 2IGLA 2WWOA 1RMFL 2AKRA 4B9PA 1YJDH 1KXVA 4N2NA 3C5XA 1MDTA 3SGJC 3X1FA 5DTFA 3VFRB 3F83A 2D9CA 1TETH 3Q3GB 1G0YR 3QUXC 3RDTC 4GRLD 3EBAA 3G6JF 4W6YB 2OCJA 1TPXB 3T77A 3NSJA 3HN8A 4IU3A 4P5TD 2E6QA 4DK3A 3MLVL 5IMKA 3ES6B 2BVPA 5EZPA 3S3DB 1AGFA 4P2RB 5EUOF 2X4RB 1G6RL 3D4ZA 1OTUD 4LDOB 3TTSA 3WY1A 2DQEL 5C1MB 4MA1B 1JVOA 3ENEA 3SCMD 3QUZD 3MRPA 1BXUA 1OSZB 3HB3B 3WEMA 2B5IB 3IKKA 1WT5C 1EEQA 2DDQH 3E9TA 1U95B 1D7CA 1ZPLA 3II1A 2BW4A 2XY2A 3MRHA 4LHUD 3BKJH 4EUPH 2AEPL 3HFFA 4P9ML 5BCAA 3VRIB 4R8WH 2JK5A 2XRAH 5CO1A 2DQTL 4D8OA 5L2JB 2AGJH 4KV5F 3KEDA 4PJGA 3VGGA 1O9VA 2H2SD 4ES9A 1JZGA 2ZXDA 4PRDB 3VWKB 4PRIA 4QT5B 3L9RA 1MWAA 1C5CL 2FQFA 2WMPA 4PJ7A 1BGXL 3QJFB 1SXAA 3F05A 3HN3A 3OHMB 4M8QB 4S1DD 1JWSB 4I1NB 3R8QA 5A7BA 2FX8L 4XWOC 4K71B 1SOKA 1ZANL 3HVNA 1ED3A 1JV5B 4GAJH 3ZZLA 5HGBA 5GHWL 2YOCA 4UQDA 4KO5A 3P4MA 3ARVA 1WTGT 3LQAC 5EFIA 5LXGL 4IBUA 2BIHA 4FABL 1JMXA 3L1GA 1BYNA 1KULA 4GXVL 4LMQE 4OAWA 1U6AL 1WFIA 3H9SD 3K8LA 4M1CC 3VB8A 3QAZC 4JB9L 2ZUTA 2A74B 5C0DB 3MOBL 2WVVB 4KVPA 4N2DA 4A2MA 1NMBL 2OXGA 4GQQA 3GI8L 1M7XA 2WO2B 3FZUD 3D34A 6PAZA 4G82A 3GO1L 5DK3A 2HG0A 1BFOB 4G7QB 2J1KA 1Y1DA 2WXNA 3CVHL 1MCOH 3EF4A 3SGEI 3NABH 4DP5X 2AEOA 5GS0C 5I26A 2EKJA 1UXWB 1CT8A 5DK0B 1F4YL 3D0LA 3EYFA 3AY4A 3SKNB 1D6VL 3BP7B 3ISYA 3O3BA 3A6BL 3CJJA 4WIQA 2IBZY 3ROLA 1E6JH 2GTQA 2AQTA 1R3HA 2ZZUT 1QSFE 1E9OB 3FU9A 1PF3A 2GSGA 3L81A 2DLEA 1SLVA 4K9EL 1OGSA 2W91A 4O2EB 4WNQA 2WQVA 3L3GA 5DF0A 1KC5L 3V4UL 1EZSA 1GKEA 1I1RA 1FNHA 4AKPA 3DJTA 3RY6C 3MRRB 5TQ2H 4OZ4B 2B9AA 5ECGA 4M8VA 3CDZB 1RJZA 5CKAA 5A2JH 5EZLB 4QHUB 5EORL 4U1GB 3U4EA 1T1YA 4B3VA 1DJSA 4UT9L 3WSQH 5E8PA 4KDTA 4GKLA 4E42A 2VZ3A 4K5LA 5E4AA 3SDAA 3MLYH 1GYCA 4L8CB 4U1KB 3ARTA 3AWGA 4U1IB 4ZFOB 2NDGA 3T0DA 4IHBA 2X7LA 3HOGA 2I9TB 4FXKC 1NANH 3UAJD 1FNAA 2AV1B 5SWQB 3WE6B 4QPEA 5D7KD 2P7TB 2ERJB 2DQJL 5C2UB 3Q1SH 2CM5A 3QARA 1AGEB 1BXVA 3BUPA 1CI5A 2W9EL 4GP5B 4YDKH 1IC4H 2C26A 4PWJA 4R5VA 4NO5B 2XJLA 1XD0A 2OXHB 4MGXA 4X4MA 1HH9A 5CUSH 1YN6A 1AZZC 1L0QA 2GJ6A 3B9EA 1M9WA 3X3GL 4FLOA 4HS3A 4KQ3H 2P9RA 3JYCA 2D03L 3MLSH 4BCYA 2Y23A 1OP4A 4FP8L 5E1AA 1YHPA 4WHTA 3SGDI 1MFCL 4U6YA 4XXCA 4H7VA 5CEZE 4JX0A 3RWJB 4LLWB 1IAOB 3C12A 4MXQD 2G0LA 1D2PA 4K07A 2IPKB 4HH8A 2QMKA 2BJML 4HUNB 4PJGF 5AFAA 2HFTA 2XN0A 1U8JB 3PWPB 5EF3A 4OLWL 3VWJA 5FF6B 3BPCA 3PNWA 1BEYL 4FGMA 4LMQI 4F15B 1W8OA 4OD3L 5CEZL 2V17H 3O6FA 3ARZA 4YBHA 5LBSA 3C2AL 3EO9L 5I8CB 1PX3A 1FJ1A 1RVFH 4GW4B 1TZ8A 3B8YA 4LSTL 3C5SB 2LQRA 1C8QA 3DX2A 3SQRA 2JH2A 1MREH 5MEOA 1RZKC 4PRPB 2VH5H 3VFWA 4L0YA 3BLBA 2NW2A 4KBPA 3UJJL 1OT4A 2HRGA 4LEEA 5AW8B 3WXVL 4UOW1 5DZ9A 3SQOL 4AVJA 2F8OA 4Z7OE 2C9VA 4TUJA 4G8EA 4YDZA 3RVWD 4PWIA 2QEJA 4L1DA 1RJLA 3NRFA 2WP3O 1LD9A 3FCSA 1QSEA 2AAVA 5DGQA 3ZTEA 4ACPA 1MCHA 3M45A 4J3OH 3S5ZA 3OJMB 4ZQTA 2G5BB 2YJLA 3GSVA 1OAQL 4YEFA 2CK0L 1UADC 4IKNA 1XB3A 4KVCH 2LABA 3MCKA 2JCCE 4CVXA 1UT9A 3WFHA 3IKCA 1FSKC 2ZWSA 3CHQA 3BUIA 4FQXC 3HMWH 3NAAH 1YN7B 5HXMA 4GT7A 3VSUA 4BDVB 1CZ8H 2MH4A 4YFEA 4YDNA 1QUNA 4FFTA 1WO2A 1Z9MA 5TE7H 3CZEA 1PLGL 4O5LH 3KWVA 3JTSA 4PJEE 3M8OL 5EWIH 3JV0A 1I1YA 2YPVA 3B9KB 1Q0YL 2CIIB 4JQVC 2QADD 4IKIA 4AUYA 4NCC1 5E99H 1UA6L 1ZLSH 4Z7WF 4QXTB 3QORC 2MPAH 4JL2A 5K9QG 4MLIA 5KVFE 4OGQC 3EJYD 2PCFA 1MCPL 4E41A 4LU5L 3RDTA 4MS8C 1F6FB 4O02A 2GY5A 2WNWA 4XX1E 4GQPH 3RP1A 3SPIA 1SXZA 3HAEH 3WY3A 3BGAA 3B3IB 2GTWA 2CKBL 5KVFL 4KU1A 2OQJB 4QUOA 4CADA 4OLXH 2N7SA 2CJ3A 4PJ6A 5DFVD 1FFRA 5FGBC 1MHCA 4N3TA 2Y5TB 2WTRA 3K4ZA 2VWEE 1NDMA 4JPWL 5F1IA 2NMSA 3MSPA 1CN4A 2DIBA 3UTPE 4WHYH 3GSXB 5FM8A 2X0UA 1FC1A 1I1CA 1BEXA 1WT5A 3V6OC 3PQYE 3QDGA 3DARA 4HKZB 1M7DB 1SHXA 3QFJE 4P9HL 5A6LA 1E28A 3HUJA 1R4XA 3NIDF 5CJOL 3QC5X 4WGKA 4JPVH 4HOWA 4G42A 3SYOA 2OMXA 1UJTA 3VXPA 3HBZA 2DYPA 1ND0B 5B3JF 4R3SA 5E0FA 1FP5A 1QYGL 4Z9KB 1WSST 1YEEH 2ID5A 2Q8AL 4J3XA 1U8QA 3MJGX 4Z8FL 1ID2A 4FX5A 4I48B 4MQXC 4FJZA 1CXFA 4G80A 4B9JA 3SDCB 1PFOA 2N4IA 1F18A 5CCJA 3WTXA 2IGTA 2QFPA 3P30H 1BBJA 2BOBA 3RBGA 1WEJH 3M7FB 3QNYB 3LQMA 4FFZH 3ZSSA 5D6CB 4ZMPA 3VXUE 1AD0B 5DLML 4FXGC 5FPIA 1IQWL 3TNMA 4JFHD 2V5YA 3EYVA 2FQGA 5DD6B 5DHEA 4RMSA 3KHOA 2OSLA 2R51A 5BRQA 2DH2A 3LEXA 5DK2B 3ZE2F 1U3YA 2VABA 1D5ZB 1M56B 1IVLA 1PS3A 4RGND 5EOCJ 2VMEA 4Y16C 5IFAH 2UX7A 5KSAD 1BIIA 3K80A 4NQXA 1OK0A 1H6EA 3AT8A 2J5LC 3Q9QA 4MMYA 3MA9L 4ODHH 5CJQL 5E6RB 3SQBA 4QRFA 5LAPA 1G7IB 1RUPH 4G6ML 4XP1H 1J5OL 2P26A 4KZ0A 1DFXA 5D7LB 3QJVB 2WLKA 1MIEL 4PB0H 1HHJA 3D25B 1ZTXH 4JKWA 4PLKC 1NKGA 5GJTH 4JE4B 1VEMA 1KCSH 5JLZB 1SBSL 2XKNA 1SEQL 1X7QB 5FYJU 1P7BA 2RBLA 5HGDA 4FF9A 3IN0A 4D0DB 1H6UA 4WFED 4TSBH 1GCYA 4IHOA 3PGFL 2DTML 4WTQA 4X7EC 4OVVA 4JFOB 4A68A 2DJ4A 2COQA 2JKXA 3K2UH 4UQ2B 5GRUH 2O5YL 2FWOA 1BZ9A 4LHQB 4HVBA 2FH8A 5JW4M 3RY5A 2WHVA 4Y19E 4JRLA 2EDDA 2BVQB 2GYSA 3O6FD 2AXGA 4M56A 3I9GL 5IGXH 1GCFA 3CSPA 3GSNL 4BIKA 2L7JA 4UCFA 2XN2A 4DPAX 1DBML 1AO7B 4AENB 4JY5H 1S7SA 2KQMA 3HG1B 5HYSG 1OW0C 1AP2B 2A9AA 3VAEA 2K6YA 2VE6A 3FTSA 2ZXCA 1VDGA 3L3JB 5T1KB 2OMWA 5EBMB 2OMYB 4ZO7A 4FXKA 2CR0A 2E59A 2D31B 1SFDA 4XHQA 3BZEB 3EJRA 2ADIA 3GNMH 2ZSVB 3GM8A 1NAKH 3OKOA 5DI8B 4LVHC 4ODXB 1CD1A 2O6PA 3CZGA 2Z92B 1KJ3L 1QSED 2RCSL 3S48A 4H20H 3L5IA 3WL9A 1FVCB 5I1KL 5H4ZA 1AS7A 1I1FB 4JDTL 1F90H 3U6XS 3KGSA 3MBWA 4RZKA 2Y1VA 1NC2A 4UZGA 1K6QL 3DYOA 1E2WA 4M7LH 1IC5H 2Y3NA 2PWGA 3OKMA 2OJEA 1CLZH 1GZHC 3S97C 4N9GA 3TVMB 4YHIA 2PTTA 1YPZE 1F2QA 4ZMLA 5MHSE 1BVKB 4EO5A 3LZOA 1NMAH 4FQQB 1BM3H 4OKVA 3NH7H 1VKXA 1ONQA 1X7TA 2FJGA 1FIEA 2Q6WA 1CL7L 4JVWA 1SJHB 4ZOEA 4X4XA 4ODSL 4YHZH 1QLFA 4LSPH 3QNXA 4V2BA 1RY7B 2JKSA 2V2WA 4JPKH 2FX7L 3PY9A 2WBXA 4AVIA 4AQAB 2H4EA 4DN3H 4OF7A 2QPFA 1DSFH 3EOAA 3H1ZA 1WBYA 4E41D 4FNLL 2X1WL 3RDTD 2P5EE 3QUXD 1KIRA 5E24E 5T1MA 3S36L 2IAAC 1QBAA 2X89A 1NCGA 4AVHA 4MQSB 4HGMA 2X6MA 2JIXB 4ZPTA 1ZHBB 4MA7H 1BD2B 4Z1PA 3QNZB 4C4KT 2DM4A 2A9NH 4KRPB 2AJXH 4NZJA 4XMPH 4XC3H 5HVHC 3KG5A 4WO4C 5C6TH 2CLRA 2ZX6A 2A6KA 1D5IL 1U93B 1CXIA 1JVLA 4G8GE 5D4JA 3MXVH 2YMTA 5HDOA 1CTMA 5KYUA 1NIAA 4KZDH 5C2BH 2VR4A 1NEZA 4MD0B 5IJVB 3QDGD 4BZYA 1CG9A 5J11C 1NLDL 3PAYA 4B5ZA 1I1AB 4NKIH 1IGYB 4ZO9A 1SVZA 3V7AG 4AQ8A 4FJYA 4WUUE 5CZVH 1YNTB 1NEZG 3PNRB 1WLHA 3VCLB 5J6GB 4Z3FA 2HLEB 1YEKH 1RZ7L 3D07A 2DYPD 4XMWA 1J10A 1XSIA 4WDIB 5BW7C 4E9WA 4YR6A 2CKNA 4JO3H 3KM2A 4XWOD 1NCIA 4Q89A 3PUCA 3OJVC 2CMRH 4OQTA 3LXAA 2CQVA 2VMDA 3QJQB 4HG4J 2KUTA 1XIWA 2YMXH 2W5PA 3JWOH 2KHAA 2R2HA 3FUFA 4DFHA 3BGFC 4M1CD 3P11L 3TASA 3FBQA 3P0VH 3QZBA 1JPST 4MX7B 4PJAA 4K94C 1TG8A 4AQEB 5DJ0B 3PV7A 2O30A 4FRWA 1YEGL 5AYUH 4NQUA 2GJRA 2HXAA 3UERA 1DJXA 1DL7L 3U0PB 4OM1L 3PFQA 1CE6B 3ARBA 3NA9L 3DVFA 4OLVH 4XE0A 1JZFA 4HPHA 2IGFH 3Q6FA 1VZIA 2L04A 3COOA 3I6LD 5DO8A 3DGGA 3FTWA 2Y5QA 5A16B 1JGDA 2GITA 4Y4KA 2JFCA 3V9FA 2CNZA 2APXA 2X87A 1MFBL 3BPLB 4M3HA 1ZS2A 4ETYA 4YDJA 2A99A 5GS0D 1GGCL 2R39A 4PLOB 4QRQB 4ZUTB 1CL7I 2N1TE 2PKDA 4XPGH 3NBNA 2H32H 3PWLB 3ULUF 4D0BA 5T3ZH 4KROC 2CHDA 3RU8L 5I18H 4RBPK 4NKMB 2J8UE 5ICXA 1A9EA 2NY5H 3T4AB 1R1CA 4PWEA 4U1NA 2PN5A 1XWVA 2NUPA 3ZGIA 5L4JA 1KXQA 4WVRA 1NGZA 2FEDC 3JXAA 2XRAL 2MFNA 1IKFH 4X0KB 1C12A 2AGJL 4IEFB 5IB4B 3U9UB 3BE1H 4WW2B 1E5YA 1JPEA 1B4JH 1OT1A 3OGCA 2J6EH 4OZFA 5GGSB 2BM3A 2BHUA 2E75C 4JG0H 1WP6A 2GIXA 2VLMD 3LZRA 4YL4A 2F19H 4OZFG 3ABZA 3EHBC 3QXTA 1EGJA 1LO5A 5F88B 3FQUB 1S9VA 4FXGA 3IMUA 2KKQA 3BD5A 4ZUWA 1WK0A 3S98A 1PY9A 5K59F 1CDCA 3MR9A 4BRJA 3QUKB 1DDHB 2VJ8A 5GRXG 2JVUA 3SOTA 5BS0E 2HZHA 4HULB 3ZU8A 4Y9BA 4OGYH 1UVQA 1D5MA 2LE9A 4Y16A 2BP3A 5GJSH 1JGEB 1Q94B 2BNQB 2GAZA 2D7QA 3QEQA 4Y1AA 1M42A 5CLYA 4D9QD 4KNTA 2OZ4H 3KPPB 5D70H 4GKSA 2WWKT 4X6CB 5DS1A 4BWUA 2I24N 1NC2D 1URLA 3NABL 3R06B 3NCJH 2DD8L 1B3JA 1KJVB 5DRNA 4M8UA 1QAWA 1FGVH 3CDYA 5KBKA 3BAEH 3RTLA 1S7UB 3UTTA 1J8KA 1KCRL 3D18B 5BV7L 3KH4A 3W1ZA 1QLRB 3VFUA 2J2ZB 5E1IA 1S46A 1EVUA 2EDNA 3VXMA 3K81A 2CXGA 2P5WE 1OCWL 1QD0A 5EU4A 2VLKB 3DMMA 4OFDA 3VA2C 5C0NC 4AXWA 4R2GB 2XWTB 3N0PB 4D0CA 2YAMA 1P1ZB 2C4XA 3FQXA 4PBWD 2I60H 2V2XB 2YSSB 4JDEB 4AJWA 5IVXB 4YSUA 1NKOA 4LRNH 1JGUH 4U1HB 5DEGB 1DLHB 3CFMA 4F2MA 1U3JA 1J1XL 2UY7B 3S5LA 3WSQL 2WUCL 3LNDA 3FUMA 3KPRE 2Q3AA 4J1UB 4ETQA 1CR9H 5C0CA 1HZKA 4ODWA 5AVWB 2WSDA 1OAXH 5IIEB 4MD4B 1MFUA 1NH6A 3GC3A 3GI9H 5AVVB 1PZ5A 1E27A 5B38B 3LH2H 1WAAA 2VLRB 4AW4A 3FONB 1J5DA 4UU9B 1ACYL 5LG1A 5CJ5A 1UWYA 2DAVA 1KTLA 2QELA 4M4RA 5AD0A 1OARH 2DW5A 4P06A 4XRCA 3AMKA 4MNGE 2EIZA 4P4RB 3V52H 1P4IL 1G7HA 2OA9A 5KYNA 1OM3L 4P23B 2XQBH 1N67A 3EG9A 3IDMA 1AIFA 4JVUA 3KZ8A 5JXEA 1FZJA 3QA3A 4JAMB 2NY2B 3VU1A 1AHWC 4GPVA 4I0KA 1SXCA 3FOLB 5HVGB 4QTIL 5DWPA 4FQXD 3B7TA 4RDBA 1C9SA 5E5LA 3MLSL 2VIRA 3NJVA 4N28A 2L7QA 5DEZA 3KPSB 1G0DA 3I6GB 2BERA 1XGYH 4HKJA 4PBVC 15C8H 3RLSA 4PIRF 3DI3B 2ZUXA 1QI5A 2PR4H 4M7ZC 1O7DC 4MJIE 3ZDZF 1IBGH 3V5DA 4O4YH 3NSXA 3KE0A 3H42H 2RHEA 3QORD 4UQ3A 3AS2A 1NC4A 4KX9A 4NPYA 2UV3A 4KKPA 1EWHA 4MS8D 3ARDC 3GSOA 4HZAA 1G9HA 3TM6A 2UX6A 4HYTB 1CICC 1S7XB 3TZVB 5DJXB 1NZRA 1P5UB 3VDCA 2PPCA 3ZT5A 2DQUH 4Y4HA 3PJSA 3WGVB 2Y22A 3C60A 1NM4A 2IG2H 3IGFA 5GRYA 2VDLH 3BLPX 4NP4H 2Y06H 3AB0C 4Y4KD 1I85C 2ZX5A 3FKUS 3II2A 3G5YA 4WCYH 4GIOA 1G4RA 3B3BA 3O4OC 2DQFA 4WO4A 4ZT1A 5HYJE 1HHIA 3GEWB 3DUSA 3WN6A 1NGXA 2CALA 2EC9U 3DO7B 2V5RA 3FCUB 4YK4C 5F3FA 2CGYA 1DUYA 3BSZH 3ARFA 4MCNA 4PJ8B 4FFYA 3I84A 3WKML 1QSZA 1HSBA 2WM0A 2XTLA 2Z4QA 2YS4A 3UTZB 4XNYL 1DVFB 2ZCHH 3FQTA 4L4TE 5JHBA 2OKMA 2BIOA 2UWEB 2EC8A 2E9WA 2BHYA 2Q3XA 3QRBA 5I6NA 5D6DC 1E2ZA 1M2VA 4FZEH 4WV1B 5CINH 3SDYH 5IEKB 1N3NA 3O3DA 4LFHD 5IOKA 1AANA 4HQQH 4HKXB 4MQXD 2VUOA 2WLLB 5A2IH 5MEQB 2O5XH 4N0UB 4UDTA 1QRKA 1HL4A 1MCJA 2VSCA 3TJEL 1T5KA 4OCWL 4WJ5B 4C56B 3ZHKA 1ASOA 3C6LC 1E4WL 3NPSB 4AM0B 3U6RB 4PUBH 1ZGLB 1OTSC 1AD9B 1M3JA 2I07A 1PD6A 3OAYK 3CX5K 5E99L 3GMQB 3MGOB 4D8PB 3RI5K 4AJVA 4ZS7H 4L3EA 4P2QA 1G9EA 2LHAA 4F3FB 5CILH 3X14B 4MZ3A 3U30C 1G7JB 2CR6A 3MUY1 4U49A 1ADWA 3KPLA 1BBDH 3NFPA 4ZMNA 2BNRE 5TF0A 3TNNB 4GUQA 2A83B 3ZN6A 1GS8A 3AT0A 4Y16D 2DWSA 3VD1A 1U2HA 1PEWA 1J87A 2WN2A 1SMAA 4KMLB 1AFVH 4XBEH 3QEQD 5LB1A 3WG7B 3W9DB 1E43A 4N5UA 1T22B 4N2OA 3P3YA 4QXGH 3WUWA 1Q8MA 3QDJB 4S1SH 3MRLB 3IDNB 5ELIA 1TZGL 4MAUL 1RZQA 3BO8A 3C9NA 4FHKA 4EIGB 3WUWG 5IB5A 4PLKD 1A21A 4UI2A 4M03A 4BFEA 5JQ6H 3IDGA 3MV9B 2J4WL 3P9MB 2FEJA 3TN0A 3UTTD 5LG6A 5F9OL 4OGAC 3ZMRA 4RGMC 3UOAB 1UJ3B 4GO8A 3KXFA 3UAEA 3VGDA 3SBQA 3VXMD 5DQJB 4FI6A 3D0VA 2E9JA 1THCA 3TBCA 1TQTA 5ENWB 2WLNA 3IGAA 4M6MH 2ZXEB 2WCSA 4MRBA 3MREB 3AWFA 4IIQB 5DHVA 1AQDA 3VD4A 4PJXE 3EH4B 4W9FC 3G5WA 1NL0L 1LE5B 2MQ0A 1W15A 3L6FA 1KYUA 4WGWB 4G3YH 2HG5B 3VH8A 5HVWA 2FGWL 2FBRA 1UYWL 3ZRCC 2PYFB 5C7XL 2FHCA 4DZBA 3UROR 2IPTL 1CGSH 3VI3A 3BVVA 3U36A 1JF1B 4CVZB 1T6WA 3VI4B 4P3WA 2ZSWB 5F9JB 5C0CD 3O9WC 4X9BA 5LGHL 4Z7UB 1FDLL 4NC2B 2R1YA 4OLZH 1HTYA 4XCEA 5T5FA 3IFOA 5A2CA 4G9FA 1TVDA 1AAJA 3RZCC 3K72B 2VRAA 3ZXAC 1LP9A 2AJZB 5IMLA 4HBQA 5ISZA 1RURL 5C0BE 5AB1A 2ZE0A 3C5ZC 3WS6A 3AVEA 3V5KA 3D39A 4DGYL 4LEXL 2HX9A 5IFAL 1M4KA 1UD5A 4AMXA 3O8XA 5CHNA 3I3DA 3S37H 4DVRH 3D08A 3ZKNC 3PGDA 4KXZH 3GBEA 3IAQA 2VUYA 3AREC 4XP5H 32C2A 3KCPA 4QHMA 1NAML 5I9QC 2J20A 2EUZA 3AZUA 5DEFB 1AH1A 5C09E 1J9QA 5DD3L 1R24A 4LCCB 1W8NA 4URTB 1YMMB 5EULV 2PO6C 3WBDA 1ZTXL 1U41A 2YAQA 1I8IA 1EHNA 3F65A 4TVPE 2HMID 1D5BB 5I30L 4PJIE 3WU1A 1NWOA 2YK1H 5ADPH 1HL9A 3T3ME 3UYRH 1H3UA 5H2BB 1J1OL 3QCVH 2FO4A 3FQWA 2NY6B 2GB2A 5IJBC 2KZKA 3CFDA 3I6SA 4MNQB 1BFVL 3GBLA 2ITDB 2Y6SC 3EGDA 3K2UL 4TVPL 5GRUL 1BQHG 5FYKU 3QHFL 1Z5HA 4K3DL 2MKLC 3AQZA 3DJ9A 3L2NA 3WKQA 4QRRA 5IGXL 5LAXA 5F3BA 2VO8A 4JO5A 3WNMA 5I23A 2DF3A 3DVNA 1EFXA 2AEIT 3PHQB 1H5BB 2Z0UA 4W9CC 1E9PA 5E4OA 4NZTL 5IVZA 3FT0A 2QLYA 3S36X 4E9QA 4XGZB 4FMVA 4V1DB 2YEZA 1JRHH 1U8IB 1YEDA 2WQSA 2DQDH 2C1OA 5IW6B 3LS4H 4R97B 3WAKA 5CMAB 2ZAGA 5C08B 5INDA 3GNML 3VFTB 1X6NA 2B2XL 4FQPA 4WO4D 4YFLF 5E2VH 4DVBA 2H8PA 3PRZA 1RZJL 2RD0A 4RNRA 4TULH 5L4FA 2ARWA 5C0AB 4WFFD 3ARFD 3AXHA 3H3PL 1UZ8B 1TYJA 4LSVL 2VDPH 2WANA 3QYNA 2D3VA 1T0MA 1DCLA 3CUPB 5JDSB 3LSOA 1JXJA 2CM6A 1F90L 1DBBH 1OGAA 2WXMA 3BKYH 4WTZG 1XH1A 5IBTL 4LSQH 1AHWA 1V54B 3P9LB 4IBYA 2HVBA 1B3IA 2QSQA 1M1XA 4M7LL 5J89A 5K9OB 3F5WB 4OI9A 1QBBA 1S3KL 3FPYA 2XY1A 5D2NB 4NZRL 5L2KB 4NO2B 4NO3B 2E6JA 5FCSH 3HBQA 5TDNB 5HYQA 3WFCL 4A37A 2VERA 3RKDC 3LMJL 1BM3L 2I9LB 3MUUA 4Y5VB 3W2DL 3DIDA 3M07A 2R0ZL 3G6JE 5EIVA 2BCKB 2XX0A 1KJ2B 3QH3B 4LBEA 4DNLA 4B0MM 5HPMB 4OCRH 2OI9B 1NFAA 2AC0A 5L7XH 5KJRH 4JPKL 4OF6A 5EUOE 1CF8L 4JGMA 4L3ED 4JFPA 1OAJA 4P2QD 1CDJA 5DU7A 1OWRM 3FC8A 2Y7LA 3L48A 3L5JA 1CICA 5T1LA 4NQDA 1L4IA 2NNCA 1RZGB 3DX6A 4UB0H 1JDDA 1ZT1B 4PLNC 3FSOA 1U3HB 1EK3A 5EA0L 1YUHB 3FTZA 3IF1A 5C9KA 3HB3C 2VXVH 1HZHL 1I85A 2IH8A 3V4PB 5D71L 1PZUB 1Q9KA 3D69B 4PV9B 2A9NL 3SDXF 5IW1A 5I1JL 4XC3L 3ULUH 3PDDA 2I25N 1KB9K 5LUMA 5EIIA 4JQIH 1QRNE 4DCQA 4O58H 4KROD 1JN6B 1JDAA 3A22A 1XF2B 5EIIG 1RZFL 4Y2NA 3Q5TA 2H1PH 4RX4A 4HMDA 4BK4A 1SLWA 2EABA 3GSWA 3QZNA 3OR7B 1VCAA 1L5GA 1A1OA 3G5XA 4K71C 3VE0B 4DOHE 4KKCC 4OD1H 4HZLB 5J1AA 3KXFD 2FEDD 1CDYA 1PY4A 2ODHA 3NJFA 3BT2L 3CNKA 3NJLA 1AKJA 3FCGA 5HDRA 3RVVC 3X13B 4BKTC 1IE5A 4BQ9A 5IMMB 1A6ZA 4U3SB 3MJ7A 2GUYA 3EFDL 3CN1A 2A74C 4UIKH 4YVNA 2B1AH 1M9SA 1UM5H 5EEXA 4EN3A 5KAQG 3QXWA 1TQBB 1WS7A 2ZKHL 3FFCE 3NIGB 4B9KC 5E08L 1DQDH 3ZE0B 3CFCH 5E8DL 2BH0A 4KRMB 2GTZB 3V8CA 1LE9B 4WI7A 1JV2B 4XC1H 1KIPB 1NBZA 1AZBA 2AV7B 3ZDXF 2YD4A 2OX5A 4JO1H 4OTXH 3MLWL 5E9DB 2GJJA 3OKKA 4NKDA 5DVLA 1A4KB 3BVNB 4G9FD 3IJ7A 1FO0B 1JPGB 1MIMH 2YHGA 3L5WA 4EDWL 4UINH 4NN6B 2LT9A 2J88H 4POYA 5ISZD 3BWUC 2M2DA 3D39D 5KTEL 2AW2A 3D3VB 3RWCB 2AXFA 1P4BH 4OUOA 4PJBB 5HJ3A 2EIDA 5KN5B 5C3IA 3V5HA 4G5AA 3HR5A 4UQ9A 5SWZB 5H94A 3SPVB 5DQ9B 5BXFA 1E3FA 1G9MH 4L9LC 3NZ8A 4Q74A 5JW5A 4XPGL 2DQ6A 2G0KA 2PPFA 4TTDC 2ADGB 5T3ZL 2ESVA 3U9WA 3ROOA 4OV5A 1I82A 1ESOA 3PWNB 1UUNA 3MCLH 4P46B 3PCYA 2C9AA 2NY5L 3CK0L 1FNLA 3TURA 2F1AA 2MHAA 3UPRA 3IMWA 1J5CA 3FT1A 2OCCB 5EU3B 1UWEL 1OAYH 4MB3A 4WW1B 1IKFL 3QCUH 3HVDA 4PS4H 3ZZSA 3KYKH 3OC8A 4MXWH 1H6FA 3BE1L 1L6PA 4FDWA 4EN2A 2R0KH 5F6IB 4JM2A 1MHPL 1MJUL 4X0NA 5DJZA 5KYYB 2FWSA 4OCNC 2GFBB 5CBAA 4QRRD 3GRWH 2F19L 2VDMB 2W0KA 4POUB 3B5HA 3MCYA 3L45A 3ZKXB 3CPLB 4EUPB 1EFXD 1J9CT 3AAZA 1B88A 1JZ2A 3INOA 1HXYB 1YEHL 4N8VA 4XMKH 2R29A 3PU7A 4G70B 1CYWA 1U8CB 2EDRA 2ZG3A 1LO0H 4BH8B 3ARSA 4PRHD 4D9LL 1JZ3A 3BAYA 5HHVH 5I6LA 1FA4A 2VDOL 3EOTL 2QPSA 3T2PA 2ZP9A 2EADA 1TYRA 4WENB 3S34L 5GGQH 2HVJA 1IILE 25C8L 3K4DA 2FT6A 5E8OB 3DRTB 4AYSA 4D2NA 2GABA 1X4XA 4DTGL 3AREA 4N8UA 3QFDA 3MU3A 4PJGE 3RX9A 3I3EA 4XPFL 1U30A 3CFKA 1II4E 2YR3A 4PRIE 5F7AA 3TO4B 4TLKA 3ZKMC 3DPDA 2XDHA 4PJ7E 3KCWA 2ZUWA 4KXBA 1GGTA 5D5MB 4M3KB 3HE6B 5FA4B 2CE6A 3H8NA 4LLDB 5I74B 2AZAA 1IGJB 4QOKA 4XVJL 4ZFQA 2AQ1A 1UWGH 5KS9A 5LGKA 4E68A 1NDGA 4GBXA 2WKOF 2G2RB 4KK6C 3F7PC 1FNSL 1W2KT 1XXDC 3ZR6A 4F7EB 3KLAB 2VMCA 4QDGA 3CXDH 1JK9B 3VFVA 4IIZA 2J72A 3HNSH 5KAQF 1K8IB 1VFAB 2DI9A 2SODB 2R2EA 5BO1L 1NCBL 3OJ2C 2VCOA 4XMUA 4TLTA 1JGUL 4RIRB 3L54A 5ICYB 3BUQA 3FUIA 2D7MA 3SOBL 2VLLB 1RERA 1CICD 3LKRB 5T1LD 4NQDD 3ZBMA 5E8NB 1LEIB 4YSQA 1G9NL 2X4UB 1ZDSA 5KWYC 3OXRB 3VQ2C 4XNZC 4UANA 3NCCB 2DQCL 2JJWA 3ILPB 1MCEA 3FFDB 3LH2L 5MP6H 5ANMA 1QOKA 4GAGL 1LO4H 1X5KA 1XF4A 3JVFC 1EHAA 2C1PA 4E2OA 4F7CB 3IM1A 4BV1A 4OI8A 5L4IA 1MW0A 2ZCLL 3DTUB 3MRFA 4PHZA 2IDSA 4ZTOH 4ODTH 3B9AA 4DKAA 1FF5A 1LK3H 5GRJL 2LAAA 8FABB 2AMGA 4HXBH 3SBWC 2JJUA 5KZCD 2F8XC 1U42A 4LASH 2BZ7A 5KG9A 3CHXA 1INDH 1JG9A 3GSRB 4MJHA 5EDXA 3U6XA 1SYSB 3PWUB 2ZXWB 3M1BB 3RTQC 5AB0A 5FGSA 5FW7A 4OSUL 5ECJE 1WITA 1RU9L 4RAVB 2M1KA 2AJVH 3KVPA 3ZUNC 3VFRA 4JFHE 2ZWYA 1V3MA 1NA8A 3C6LD 1E4KA 3QUMA 3JBG7 4QHNB 4RH4A 1OTSD 4FYRA 3X11B 1KN4L 4G7YL 1IBGL 3H42L 4QRPB 1SVCP 1WBZB 3ES6A 2AZUA 4J2XA 4NAMA 4P2RA 3OPUA 3PWVB 2X4RA 3UX9B 5FYJH 5JNYB 1K4DB 3BEWB 5D93C 2F7RA 1VJSA 2UXFA 2DMHA 3QI9C 2A1WL 1KB5H 5HJGA 1KTRL 2N7AA 3L4CA 2BSRB 2WPGA 1DDTA 1OSZA 4CSSA 4ENZA 4GFXA 3NUKA 3ATBA 2HT4C 2IG2L 4X4ME 1U95A 3NIDE 4ZMVA 2GJ6E 3SE9L 3GKWL 3SBPA 2A4CA 4R84A 4UQIM 3V4LA 4WCYL 4TUKH 1CFTA 4XB7A 3VRIA 3BI9X 4M62L 4OW6A 3F7YB 2DLFH 2E7HA 2YD9A 3IEAA 4H5SA 5B3JE 5L2JA 2VM9A 1FH2A 4R4FL 3WELA 2AXHA 3CLFH 3VWKA 1Z5LA 3LRSB 4FCAA 4FL4B 4PRDA 3TYGH 3QJXA 2FUTA 1BVLB 4QT5A 3HG5A 4WFEE 3ZO0A 1B9ZA 2ESVD 4M8QA 4CKQA 1JWSA 3M1CA 1PAMA 4OGAD 2JI1A 1YZZA 4TKWA 4YH6A 1JV5A 3FSAA 4G6KH 1CDUA 1OSPL 1U0QA 2VXTH 4B60A 1DZ0A 3OKNB 1P7KA 3UCRA 4ZTEA 5KS9F 1HAUA 2H6PA 3RX5A 2JQAA 2HP4A 2D7TL 2JB5L 3QIBC 4WY7H 2QJDA 4FTVB 3L4ZA 1SN5A 5C0FB 1M6OA 3GUFA 5DUPH 2A74A 3HC4L 4QRBA 5C0DA 4JM2D 1VAHA 2NY7H 3S88H 4TMPA 3ZE2E 4F33B 4NRZB 2C3GA 4YHOL 5FUZL 4DQOH 2GC7C 2WZPD 4NRXB 5LBSL 5SWSB 3VYPA 3HHMA 2VDNH 1JCVA 1RIVH 3O11B 5JDJA 1J1PH 3B2MA 3O9WD 4Y2LA 1BFOA 5AZ2H 2YPKB 3N1MC 3SGKC 3EKCA 3LY6A 4G9DB 2N0KA 4AW7A 1CD0A 1QSEE 3GEFA 3RZCD 5CILL 5I1LB 5HSFA 2YWZA 5DK0A 4UT7H 1XHHA 4DP9X 3C5ZD 1P84K 3SKNA 2CHWA 1MRDH 3BP7A 3MLTB 1EHXA 5IW3A 3MJ6A 1R3IL 3KJ6L 5E6IB 1JF6A 2CCLA 2EH8H 4R90H 5DYOB 3ZKND 2AJUH 1E9OA 2CBMA 2Y07H 3DJRA 3E8UH 4ELMB 1OB0A 3O0RH 5T1DH 1R17A 2ATKA 3ARED 4O2EA 4EZJA 3FUKA 3RAJH 1OAKH 4YHML 2QQKH 4PJHB 2XZQH 2PO6D 2BWQA 3GSUB 2E7LC 2G3NA 1L7TL 5IB1B 3MRRA 1FVDB 4ZMWA 1KEGH 4OZ4A 4FYSA 3E0GA 4QOKD 4C83B 5GPRA 2DMCA 3CDZA 3HAEB 4NQED 1SN2A 1OGPA 4QHUA 2BZDA 4ILDA 1NDTA 3V4VH 4OZIA 3EJJX 4G7RB 2IQ9H 2MCMA 3BUBA 3KR3H 3RB7A 3H7BB 2BCMA 4L8CA 1A4BA 2Y6SD 3EJZC 3GTVA 4U1KA 4U1IA 1WIPA 4E41E 2L4OA 1FZKB 3U2JA 3NESA 5TDOB 1W0YT 4PGDA 4G3YL 1PSKH 2I9TA 1KBBA 3EDJA 3WE6A 4QGYA 1U21A 2P7TA 4KUCF 4QEGA 2VDRL 2ZXGA 2LTQB 3Q8EA 3DA0A 4LSUH 5ALBL 3ZHLA 1IBHA 4P4KC 4ATTA 2I27N 4NO5A 1SY6H 2OXHA 2TAAA 5EUKB 3MYJA 1UXMA 4M7JH 3TBTB 3RWDB 2NXYB 3CN4A 3M88A 3QJUB 2X3CA 3MRDB 3QDGE 1J9RA 4A6YH 1DJGA 1GR7A 1QUPA 3CU7A 3HUJE 2J56A 3AY2A 1XB8A 1CQKA 4H8PA 3RWJA 2FZ3B 4LLWA 1IAOA 2YRZA 5KVGH 5L8KB 2YD3A 4LRIC 1NCTA 3PWJB 4QWWC 2IPKA 2PYEB 3T3PE 4XZUA 2HA1A 1HAWA 1E5AA 1FYTB 1U8JA 3BZ5A 3PWPA 4IOFC 2DPKA 1EUUA 4CW1B 5FF6A 4KJPC 4D9RD 3U82B 1JOIA 1E7VA 5DJ8B 3ULVC 4LP8A 3BWZA 2WLIB 3OKLB 1E4JA 1DBJH 5DFWH 4JO4L 3RKDD 1TTBA 3ZL1A 2X4PB 1GH7A 4DFIA 4GW4A 2YK1L 5HYIA 3MUZ1 4DGWC 3UYRL 2Z91A 1A65A 4AM0Q 3PHAA 4LPTA 1IGIH 2WIIA 4BK5C 4Q4IA 3O2DA 1F13A 3VG0L 1UM4H 3NGBC 1E8XA 4NN5C 1V10A 5DJDB 2BFVH 2WGXA 5LBVA 3IBEA 4P2RD 3WLBB 2GEQA 1HHHB 4CU7A 1VSCA 3I6LE 4JCWA 1NBYA 4M9OA 2YGOA 4PS7A 2G5UA 4UUJB 1MAML 5DYFA 4Z7NB 2YUXA 1CYXA 3KLQA 1ITCA 4OM0L 3HB3D 3LH8A 4MS6A 4TN9A 2JKTM 2G5BA 1BVZA 1NBCA 1A7PL 4JHAH 1JSYA 4GAFB 4K7FB 4PRBA 3N6YA 5GS1C 2VRQA 3GBMH 2HRHA 3LS4L 3CLEH 1FFTB 5BRZB 1A1MB 1Q1JL 4XBPB 1URIA 5D4IA 5GS0L 1GSMA 3QWOB 4PCSA 3F3HA 3CFTA 4BDVA 4AC4A 3P2TA 2J12B 2QPUA 4YN3A 2WCGA 4KKCD 2FQEA 5DVMA 5H35B 3SBWA 5CS7A 1KGWA 2EXYC 2W94A 2CIIA 3B9KA 3FT3B 3K2KA 4XVTH 3WKYA 1U9KA 3SYQA 3VTAA 3EFFB 3K2MC 4QXTA 1UFGA 2XIIA 3EF7A 5DJ6A 5I8OH 4X6DA 1PD0A 5DC2A 4AZ8B 5C0EB 4A38A 4G6FB 1A14H 4MCYB 1FNGB 1RUQH 3EBHA 3S7GA 5ACMA 3V0JA 4CU6A 1CURA 2HFEB 3SJVD 4L8DB 2I85A 3R7QA 5IQ7H 1MRFH 4HXAL 4BKLB 2O61B 3QC6X 1H15B 4XX5A 2H41A 2YGPA 5IFJB 3B3IA 1VB9A 2YXWA 2NCMA 4N2AA 4LIQH 5I6XC 3ZTNL 3ZY7A 5G4NA 3HNVH 3HZYB 3B7YA 3DHPA 3BPOC 1ORQB 1EJFA 2Y5TA 1PU0A 2MOQA 4I5BB 5AOLA 1OAUH 3QZWG 3K6SB 3FHAA 3NTCL 2ZWZA 4LKXB 4D9QE 3BP4B 3C8KB 2GW5A 3GSXA 4N85A 4UB0L 1F58H 2WYHA 4Y1TA 4TPRL 3TBYB 1O7SA 3HC3L 2JJTA 3P9WB 4HKZA 5D1XC 1GGYA 3WNOA 4KI5C 1SOSA 5CWSB 5CZXC 3KM1A 3ZE1B 2NTFB 5I19H 3ULUL 1JZIA 4RSYA 3GMMB 3K7UA 2Z93B 3BP6B 4ATWA 3B7UX 1FI8C 4TTDD 5HDBE 1QHPA 5B1BB 4FQCH 4BEIA 5F70A 1RUML 4I48A 4DPCX 4A2EA 1IM3B 3SDCA 4ALAH 1GW6A 4HGWB 3I74A 2AQ3A 5CN1A 4YIQB 1Q38A 3I50H 2JI3A 1OO2A 2WOBA 2Z0BA 1OQOA 3IMVA 3KNBB 2CUHA 1F02I 4GKNB 5D6CA 1IB5A 4X9HA 2YAHA 1AD0A 5K59E 5FOBB 2CJUH 1D9KB 4XHJC 2FBJL 3D5OF 5DD6A 1M05A 1A8JH 5GGSY 1E5CA 1G7LB 3OPZH 4IYKA 2WLYA 5BZZA 3HHSB 3U7YH 1W6WA 1PNDA 1UM5L 2R69H 3D8MA 5FGCB 1D5ZA 3AGWA 2BIMA 2O6CA 3BWAA 4ZNCD 3SGKA 3LRMA 4LLVB 4LPVA 4OF3A 1RZKL 2HRPL 4HIPA 4XC1L 3APCA 1P6AB 1TR7A 1HDMB 1NSNH 1E67A 4M9PA 3DPBB 4IKKA 4X8JB 2Y5EA 1P7QB 1DLFH 3QCTH 5D7LA 1XAKA 2F53A 5TDPB 1N0XH 1RSYA 5J6HB 3V7AE 1MIML 3D25A 1A9BB 1WVZA 4UINL 5GS2D 7CGTA 4Q8BA 3QZMA 4EIUA 3VXOA 4K7PH 1HL8A 3TWCH 5JLZA 1A4JB 3WN5B 1X7QA 4U6VL 2D3LA 1MNUH 4YX2H 4FG2A 4D0DA 4NJ9H 3OJDB 3ZKMD 1B9KA 2VMJA 4H13C 1ETZA 4F7KA 5JW3H 2E7LA 2B59B 1GY2A 2BFGA 4JFOA 4R2GC 1AIZA 2QLVB 1IT9L 2M26A 3TBBA 2R8SL 3UGXA 2Z35B 3BSGA 2BVQA 3SZKC 3DJSA 1YY9C 4KKAC 3KDMA 4O00A 3MCLL 4ZMQA 3S9DB 2XHNA 3U1SL 2IJ0C 3CVIL 1AO7A 2AK1L 3FS9A 4AENA 4IBWA 2YRBA 4XPBL 2HTLC 3HG1A 2BHZA 4OCYL 2QPDB 4UWQB 1OAYL 3UTQB 2VR3A 4ADIA 4K9EC 4PJAE 1AP2A 2RMNA 2GK2A 3S3BB 5CGMA 1KN2H 3HN5A 3KYOB 3L3JA 5FDWB 5T1KA 2K6WA 1ILSA 4DKFL 2H0EA 2OMYA 5EBMA 5K39B 1A6AB 4DT2A 2H32B 4NGHL 4B9FA 4NUPA 2D31A 4I89A 3BZEA 4GRWB 2ZSVA 4KPHH 5B39B 3VRJA 1A5FL 4ODXA 4XR8C 1G7MB 1R19A 5DI8A 5FC9A 3T4YB 1A3QA 5G5DA 3NDZE 2Z92A 3FO9B 3T71A 3TYFA 4L4VB 1MRCL 2EE3A 4H25B 5LGYA 2IAMC 4GOSA 4I3SH 4XMKL 3BVXA 3IJHB 2VISB 1KNOB 1I1FA 2FB4L 2R2CA 4ZUVB 2ZONA 3CFBA 1DEDA 3GXPA 1HCYA 4MJ6B 1KGCE 3DX4A 5I1HL 1LO0L 3VD3A 1KWGA 4DEPB 1RZIB 5HHVL 5I8KH 2VDKL 1F8TH 1E5BA 4HHGA 1XBRA 4C55A 4MYPA 1CFNB 3LDBC 4E9YA 2CBTA 1HU8A 1BVKA 1KXQE 4XNUL 4BK8A 1XGTB 3RPIA 4DP8X 3CXHK 3F7LA 3S2CA 1YYCA 1EIBA 1YNLL 4EF3A 1QWUA 4JKKA 5KVEH 1SJHA 1XEUA 4HV8B 2H3XC 3JYBA 3GS0A 4IMKC 4L23A 2YQGA 2XI9A 4P8QA 4A04A 2IO5A 1O5DT 5L6YH 4JHWH 2GHWB 3ISRA 5FX3A 3RPKA 1LO2L 2FHBA 3RTQD 3PXHA 1UWGL 4ONFH 4AQAA 1MFMA 1I9IL 4HDIB 4WKZB 3U9PH 1GMIA 1PLBA 3QBTB 4HJSA 4XN7A 1ZJBA 2GIMA 5EMYA 4S1RH 3P40A 3SB3A 2EEXA 1DJZA 5TF1H 4YSSA 1KJMB 2RACA 3FT9A 4JFZL 3KLDA 2JIXA 1ZHBA 5AWNL 3PP3H 2FE0A 1BD2A 2EE6A 4HWEL 4H1LH 3MA7B 3QNZA 4NHUB 3HMXH 4RMBA 1BP3B 2CXKA 3QEQE 2R9HC 3QI9D 4Y1AE 1MW2A 4CC4A 4Q97A 3UIZA 1U93A 1E4XH 1VZGA 4YXKL 5EPMA 4LLMB 4GUOA 5C97A 3ZYZA 2HT4D 4MD0A 5DS2A 5IJVA 5C07D 2XZZA 4RMRA 1DVFC 5L9DH 1IGYA 1JJUA 1ZJAA 4Y8AA 1J11A 1U8PB 1PQZB 1IAIH 1YNTA 4UAOB 3VCLA 5J6GA 3UTTE 3MBXH 1F4WL 5HHOA 3NP3A 3ARGB 2ETWA 4WI4A 1XDTT 3VXME 1X5XA 1KELH 4WDIA 4ICWA 1SM3H 3TA4D 4FG6D 3SDCD 4ZTOL 5LNGA 3NJJA 4F8TA 1OLLA 4GG6F 2KMWA 2WQUA 5CD3B 3JV6B 3N1PC 1E8WA 4HXBL 2W9DL 4IGBB 4N4YB 4OFPA 4WZ9A 5IQOA 4W1TA 5T33H 1IEAB 3NPSC 4HS6A 3SO3B 1FUNA 1INDL 4MX7A 1JD7A 5HHMD 4AQEA 3BKCL 2OYLA 4M43L 4NO0D 1AYOA 3GF8A 5C0CE 1DVSA 5LJYH 3U0PA 3PPSA 1U8HB 1K8DB 2J7LA 2R1XA 3GLEA 1WAAE 1WZAA 2CBQA 4GP4B 4XOAA 1IFGA 5A16A 3Q7JA 1SLUA 2ARJA 1HQ4B 2Z31B 2QQNH 3GMRB 4CMHC 2YXVA 3DDGA 2A4ZA 2CU9A 3HLAB 4PJ9B 1YAZA 4QRQA 1MCIA 2PW1B 4ZUTA 5I66B 2F53D 1OQXA 3PWLA 2VXUL 3CMOH 3QISA 4K55A 1WA0X 4HIEB 5GGRB 3MJ9H 4NKMA 4Z7WB 3KBFA 4PG9B 5FYKH 3T4AA 3VM7A 5IJKC 1SJVA 1OP5K 4JJ5B 3G7TA 2DKMA 1SDDA 3AADB 4Q9QH 4FULA 4KRNA 2DLFL 4X0KA 2QSTA 2ZUQC 4I0PB 4IEFA 4Y9EA 2E4FA 5IB4A 3U9UA 1UXSB 1J18A 4WW2A 5IHZB 1YEFL 3A6CL 3B6SB 5F9DC 1KZYA 5I1DA 3JTTB 5GGSA 4DKEL 4IIQC 4U2ZA 4JM4H 1UC6A 4O9HL 2HPTA 2QZQA 3JWNH 1S7QB 5J7CC 1ZSDB 5F7FA 2PLTA 3WTVA 2VDLB 1AO7D 2W8CA 5F88A 1WFJA 2VXTL 3HG1D 4P9HC 1JFHA 4XPHL 3FQUA 5D8JH 3WJMB 5EHFA 3SPJA 2XVKA 4FNUA 5IEHA 1SEBB 3MKKA 5T1KD 4KKNA 1NCDL 3QUKA 1DDHA 2CRYA 1A22B 4H0HB 4NC1E 3U0WH 1GOHA 1LDSA 1NFDA 3JWDL 5EO1B 3NEEA 4JKNA 1T7XA 5F0JB 4UYPA 4LCWB 5BZDB 5ACLA 5D9SB 2NX5B 3QWRD 1Q94A 2BNQA 1AQHA 2IC2A 1IC7H 2PP8A 4PBXA 1WFMA 5AKVA 5HJBA 4P4KD 2H0JA 1M1SA 4PVLA 5AZ2L 6CGTA 2DLTA 1AGDB 1KFGA 4X6CA 5JR1H 4YPJA 4WFFE 3ZDYB 4NT6B 2QGEA 1BPLB 3FRPG 1B6UA 3R06A 3DBSA 4OIIL 1KJVA 4GG8B 3O3AB 1J9TA 4LCCC 3K4AA 1MRDL 3QEGL 4TOYH 3VFPB 4HF5L 4D94A 3SDDC 1S7UA 5E2UH 3VX0A 5AZUA 3DSFL 4NUJB 3S37X 1QLRA 3L3DB 2J2ZA 2Y07L 3WFEL 5B4MC 3KLHC 1YNTF 4QWWD 1MCSA 4FFYL 2X9WA 1AE6H 2IV9A 3RAJL 3FL7A 4IOFD 2QQKL 2VLKA 1IIIA 4DP4X 2D4DA 4RETB 1HWWA 2J8HA 4ORGB 4P04A 5I15H 4X80H 3IFNH 1J0JA 2O26U 4KJPD 2XWTA 4JRWA 2IDQA 2NY6C 1JI1A 1P1ZA 3WJLA 3ULVD 2V2XA 1TJIL 2YSSA 4JDEA 5IVXA 4UV4H 1CWVA 4U1HA 5DEGA 1EVTC 4KKBC 4CGTA 4QJ3B 1XL6A 2H3KA 4LARL 1NUGA 4N1HB 3MBEC 5I6KA 2UY7A 4IDJL 3C8HA 5E00B 1ZS8B 5F71A 2IQ9L 3REWA 3RJOA 4KQ4L 3ZOAA 3GRBA 2GBVA 3CFEB 3L4TA 4L3EE 2BSTB 4P2QE 4XMZA 3T09A 3BP5B 5IIEA 5D96B 4HK3N 4MD4A 4AVKA 5JYLA 2XZCH 4S1QL 2C5DC 5B38A 2JIXD 2VLRA 3FONA 4XNBA 3WUZA 2YLHA 4J3UA 1PSKL 4K94L 4UU9A 4R97C 2Q5BA 4F58H 1Y18B 4LT7A 3QDMB 5DD5H 4LE8A 3QAQA 5AAWA 2YFNA 4M61B 3QQDB 4GQ9H 5I8EB 3V6ZB 4P4RA 4UT9A 2ZOWA 4K3EH 4X6BB 2CA4A 2H26B 3OX8B 5KJ4A 1SJXA 1JPFB 1XX9C 3G6DH 2IBZX 1DBAH 3K6OA 4P23A 4H88H 5CN3A 2WB7A 2EVJA 2WINB 2LFGA 2VLJD 3D87B 2X1QA 1E9QB 3H4FA 4JAMA 1N5YL 3U0TB 1NUNB 3VXNB 1RJCA 3FOLA 3GTTA 2NXZC 2G3XA 1JWUB 3QSKB 3IETB 5HHOD 3VRLE 3V6ZA 5EU6B 3KXFE 2NNFA 3RGHA 4LKCB 1SDAB 2FO8A 3TBVB 3KPSA 3ZYJA 3I6GA 4ANVA 2YQBA 2D4FA 4ADGA 4I9WD 1FC2D 4KK5C 3SE4A 4R96B 5EO9B 1SGKA 4WW2F 1KTJA 2EXYD 3MRKB 3ZVVA 1OEZW 5BQ7A 1OOWA 3FF8A 4L8SB 1QFWH 2D0HA 4UMGA 4J3WA 1S2EA 1GIGH 2BSED 1DVTA 4F27A 1BZDA 1RP9A 2OI9C 3DV4B 2PETA 1FFOB 2QHLA 2Y1ZA 4TQEL 1F6LL 3VI3E 4DKDC 4FQLH 2MQ3A 1HNGA 5T5NF 1J88A 1FNEB 1RIHL 3N42B 2VW6A 1S7XA 5DLLA 3TZVA 4YUEL 5DJXA 1P5UA 3T6VA 3MACH 3UTSB 1Q72H 4GNKB 4G9FE 3HC0B 3M1OA 4HWUA 2AJYL 1LP9E 5ISZE 1F0LA 1A3LL 2X41A 4YS4A 4KI1A 2FEEL 2WQRA 1CLVA 1DSYA 1UURA 1ZE3H 5FXCH 2LU3A 5T5FL 3DO7A 4K3JL 1K3ZA 1TMQA 4PJ8A 1EJOL 5DXWA 1J8HB 1JPTH 4OJFL 1MFAL 4EI5B 3BSHA 4UQEA 4X6CF 1TJXA 5D1XD 3UTZA 4KI5D 3AT9A 1DVFA 1IAKB 3A47A 2QTVA 3EOBB 2G4GA 5CZXD 1YYLL 2UWEA 2ITEA 1ECZA 2NTSP 4DGVH 1TZAA 4NIYE 1RULH 4WV1A 4CN6A 1RIUH 3LQZB 3F04A 5B7EA 4DERA 4PW3A 3U25A 4ZFZA 3N06B 4HKXA 5CZRA 1J0KA 5BQDA 1CGUA 3MJWA 1BVNP 1FVEB 5MEQA 4L3CB 3BVWA 2X09A 3V95A 1RZ8B 4DO5A 1P4LB 4N0UA 3F58H 2B9BA 3NT0A 4WJ5A 4Q6IC 1JD9A 1B4TA 1U2CA 4C56A 1MLBB 5KVDH 1YEJH 3N41F 4NM4H 3U6RA 1KBGL 3N9GL 4XVTL 1ZGLA 1E6OH 5IVXF 1AD9A 4QRRE 2OS7A 3GMQA 3MGOA 4D8PA 5AW0B 3LEYL 3HZVB 4XHJD 4KTGA 3ZKQD 5TPWL 2ZPKH 1S9KC 4PWFA 4HX1B 1FPTH 1PJWA 2WVSA 1LNUB 4F3FA 5I8OL 1IMHC 3MV8A 4YFLI 1G7JA 2VDPB 5EEZA 1T66C 2DQGL 3TNNA 4C47A 2A83A 1FBIL 3Q06A 2OTWB 3N43F 1MXDA 3OZLA 4HHAB 4JHBA 3WFBH 7FABL 4MJJA 2YD0A 2FD6L 1V3LA 2E7MA 5CIPH 5KSBF 3W9DA 3QJTB 1U8LB 4YC2C 1T22A 4TNVF 2WUBH 4XAKD 3VO0A 2UYLA 3MLZL 2B0SH 3IDNA 3DTDA 2GSMB 3MRLA 3CN3A 3LQAH 5A6MA 2FWLB 1XCTB 3MV9A 1OGAE 1KMGA 3P9MA 4Q6YA 1RKRA 3IAPA 5IJKA 3ZW3A 4CILA 3BCDA 1NIDA 1UJ3A 3G9AB 3V0GA 1FFQA 3QG7H 8CGTA 1KV7A 5ENWA 5ITBH 2YLKA 4WWKC 1MN4A 2VLKD 4YHYB 2K1MA 4R2GD 4YHPB 3HS8A 3MREA 4MTMA 4IIQA 5L8JB 3T2OA 1DFBL 3F6LA 4MDJB 5TH2B 1TMCB 1LE5A 3MV7B 4LLUB 4M02A 2X0WA 4KKAD 1YY9D 4QJ4B 3OHXC 4AMKH 1CFBA 2W92A 1O7DE 3ARYA 3F7VA 4P3CH 2XFGB 2O1AA 4UM9D 1DE4B 4DZ8A 4J28A 4ZFFB 5ID1B 3BZ4B 2PYFA 2EICA 2HTLD 1BJMA 2H3NB 2FEEI 2ICEB 5D4QA 5I5JA 4F57L 3BKMH 1NCWH 1JF1A 2AFNA 3VI4A 4LPCA 4CVZA 1AOZA 3IDJB 4JLRB 1QBLH 2ZSWA 5DHMC 5BMFL 2IOIA 2ORBH 2GJPA 1I9RL 4OLEA 1UA3A 1QABA 1IM9D 1HI6B 1IGMH 3S35H 4NQDE 1QSFD 3UACA 3K72A 2IXQB 2ZOTA 3LPGA 2AJZA 1MCLA 2NRDA 2BHFA 3ZQXA 3LV3B 4N20A 3X3FH 4L2LA 5JIKA 1EEUA 4MNHB 1NCJA 1D7DA 5HHNB 2JELL 5DURB 2P24A 4UIMB 3WNIA 1BAGA 3PGCB 3FU5A 5LCVH 4GI9A 1GJWA 5DEFA 1S7WB 2AJSH 2H5UA 2A6JB 4AV5A 4XOEA 3QCTL 4HJEA 3EDKA 3I2CH 4LCCA 3TO4C 1KCVL 1YMMA 3BWSA 2UZXB 4PRNA 5C0GB 1MELA 3WY4A 5J5EA 3CVDA 3GMLA 5I74C 2H7WA 2CA3A 3KPSD 4RAHA 4LDEB 4Y0GA 1FL3B 5F93C 1CGTA 4BXSV 5FDYA 3B43A 1UHVA 5FLUA 3MODL 3ZJAA 2C3WA 4NDMB 5IFHH 4MNQA 2ITDA 2EE9A 3A6OA 3L7EB 3GJFH 1WICA 1UUSA 2KPNA 4TSCH 4HOMA 1FFNB 3P3RA 3FUHA 2ZUVA 4X7TB 5EN2B 1JERA 2Y0SA 2FL5B 3DJZA 3KD4A 2WTOA 5EU5B 3RHWF 4W9LC 5ABZA 3OB0H 5CP7B 5BV7C 3PHQA 1H5BA 3B9DA 4Y9CA 2J44A 4G1EB 2IQAB 2WV3A 4OVUA 1KN2L 2VKWA 4XGZA 4V1DA 3E1F1 1N4XH 1B0GB 1HWGB 3QJRB 4MKTA 3VGBA 2FO1A 1U8IA 3FB6B 5IW6A 3UEZA 2Z8SA 3F64A 4N87A 4ZRGA 3ETBJ 5AW1B 3CVBA 2WQAA 5CMAA 1OHQA 5C08A 2R9HD 4ZDHB 5C92A 4UNTA 2JB6B 3QPKA 4LLYB 3G5ZB 5C0AA 3UYPB 5LN8A 2PWDA 4UNIA 2NNAA 3AXIA 3I85A 3HNTL 1UZ8A 1ML0A 5CZKA 1PZAA 2B14A 1BAFL 5JDSA 1EMTL 2BRRL 1DVFD 5IROA 5GRZA 3AGVA 1Y6NR 3P9LA 1M57B 2A9MH 2VJXA 4I0CC 4PRAB 2ESVE 2QHRL 4RWYH 1Z3GH 1L9NA 1OPGH 5DD0L 1GZQA 5K9OA 3F5WA 1A6UL 3HRZC 3K6FA 4XWGL 3GIZL 1FE8L 3RGVC 1DQMH 3MJ8A 3SPHA 4NO3A 5TDNA 3ZZ1A 2ZAIA 2MNJB 1BQ5A 4MWFB 3R4RA 4YZWA 5TGBB 4ZSOA 4HIJB 2I9LA 4KKQA 1JZHA 4XH2B 5JTWA 4DGIL 4Y5VA 4WUUB 1ORSA 2K45A 4YE4H 4YDLC 4C56D 4KITB 2BCKA 1BECA 1YNKH 3QH3A 1DYZA 2EO1A 5HPMA 4UM8A 1GHFH 3GXUB 3OAUL 4Z3TA 3NJXA 4Y2OB 1TENA 1ZPUA 4ERSH 3TPUB 5E1HB 3K0WA 3LZQA 1QBMH 1I8KB 3MV8D 3NFSH 3TT3H 4C8XA 1RZGA 4K2UL 3IFLH 3FCTB 1ZT1A 1QWHA 4GY4A 2F7QA 4Z7UF 1YUHA 5C71A 2OR7A 4XCYA 4DP0X 3WO4C 2VXQH 2E86A 4GRMB 5HHPB 3LOWA 1OV8A 4EOWL 3LXCA 2FDBP 1ADQA 3MRQB 3V4PA 3VW3H 4UTAH 1X5LA 2LOEA 3D69A 3FUDA 4PV9A 5D72L 1Q4NX 4XBGB 3UPAA 1IGFH 3OLEA 2VDQL 4JREB 3KPMB 4PCTA 1M3IA 2QSVA 4TF4A 1J0ZA 3PIQB 3WMQA 4N0RA 3SSGA 3ZDZB 1JN6A 1XF2A 1GTFA 1HKLH 3KL3A 5FFLA 5ADOH 4DW2L 4KJQC 1USZA 2B1HH 2NY3C 2WXGA 3MNZB 1EZVY 4QRSB 4W6WB 4F80A 3U7WH 5IB2A 3OR7A 3QQ4B 5DVKA 3VE0A 2JQZA 4KY1H 4HZLA 4WK0B 4IOIB 1A4AA 2QQLL 2B08A 1N5AB 3RWFB 4Z18A 5DUML 1P1VA 5IM7B 3KPOB 4J4PC 1OAZH 5KS9E 1OP3H 3X13A 4YXLH 2BDNH 2ZNWA 4HPOL 5IMMA 5I0DA 4U3SA 1PD1A 5I76B 3VNYA 3K6IA 4AEEA 3T8XB 1LO3H 1SJMA 4JN1L 3QG6B 3I02B 2YD5A 1NIBA 5L0QC 2MIZA 1Y6KR 1KLGB 3SKJL 1LE9A 2GTZA 2C9QA 1JV2A 1KIPA 3D1MC 3OB0K 4TRPL 2AV7A 1AKPA 4S10A 2HB0A 3HPLB 5E9DA 1SHSA 3QFJD 3LPFA 1A4KA 1EZLA 3BVNA 2YO3A 3BQVA 1FO0A 1JPGA 3L4XA 4KVNL 1SHWA 1EHLH 3F62A 3B5GA 3GBDA 3IRZA 4IRSC 2ZX7A 4NQSB 1M71B 2Z1PA 5ANME 2GY7B 2X3AA 3D3VA 1S7VB 4K23H 4PJBA 5E6IC 4XNAA 5D7EA 3RWCA 4BXVA 5KN5A 3AG3B 3J8F7 5SWZA 3SPVA 4F2EA 5DQ9A 3QZPA 3UP1A 4N0CD 4YLQT 3RJDA 1B2WH 4GMSH 1O6VA 2ICWJ 4WI2A 2ADGA 4MZRA 5A7EA 1AR1B 1MXGA 1YMMD 3ISWA 3SDDD 4GB9A 5B4MD 2Y69B 3PWNA 3INUL 5AUMB 4G8FB 4P46A 3KLHD 4XPTH 4D9RE 4F92B 2HLFC 2H45A 2R83A 4XPAL 3QK0A 3WKNA 2WLJA 5G4MA 3RIKA 3O2WL 3I9IA 4A7UA 5EU3A 2KZBA 3KBHE 1N64L 2P8MB 1U8OB 5DJ2B 2XTJB 4UTBH 4LLQB 2ZJSH 4WW1A 2ADFH 1NKRA 3IMRA 2VC2B 4P49A 2NY6D 1FZMB 2YD6A 5FUOH 3S2AA 4MNQD 1DEEA 3BIAX 3OHXA 2YPLB 1PX8A 4CSPA 1KB5B 4KKBD 3GZKA 4JM4L 4YBLB 5KYYA 4FQJH 1QA9B 2GFBA 1U8MB 2VQ4A 3MBED 2I5YH 4U33A 4NM8H 3BUYB 1R9FA 3WMPA 1V3JA 2Y1YA 3FYEB 4EUPA 1CDBA 4P2RE 2XOTA 2HFGH 1HXYA 3OXSB 5JZ7C 5HDQH 4V1DD 3MLRH 4EUPG 2NW3A 4GW5B 5CJ8A 1U8CA 3U0WL 4NJAH 1TNMA 1C1EL 1V27A 4M5YH 1H3PH 4ZZFA 4MD5B 2YXMA 4BZ1H 5DT1H 3QEHA 1F4XH 5E8OA 3DRTA 3T2NL 1I7TB 5C0AD 4FA6A 3TC9A 4XZ4A 1KB3A 3QIWC 2WCPA 4KNUA 5JR1L 4JVPA 3VSTA 1NQBA 2VZVA 4J2QA 3D9AH 5K1JA 2AQ2A 2CJSA 2BY1A 3Q8FA 1DO5A 3TO4A 3F7QA 1WCBA 2APWA 2F15A 4X2UA 5HI5C 2NXZD 5D5MA 1HXKA 4Q9RL 3JZYA 5FA4A 4HP5A 2X05A 2BMKB 4XODA 5B1JA 1IGJA 2C3HA 2XVBA 3VFMB 5MENB 3UGUA 5E2UL 3WTTA 4PP1C 5CU9A 3S4SG 1FH5H 4OR1A 2VDNB 5K5YA 5D7IA 4KMTH 5KBLA 3C09B 4Y88A 2ZWLT 3UJTH 4KK5D 5F9WC 1AE6L 4F7EA 3KLAA 4OGXH 4XCNB 2A3TA 4J3BA 1JK9A 2P1YA 1NPUA 2VW4A 4NUQA 1H3GA 1GVIA 3R0NA 3UABA 5AB9A 1K8IA 4K15A 4PS3A 1VFAA 4DGUA 3U4AA 4ZD3H 3W39B 4PY7B 1ET7A 3T0VA 2FJFB 1PYWB 2Q1EA 1GPOH 2BS8A 3ASNB 3VQ1C 4J8RB 5ICYA 2HUEA 3QGVA 2CLVB 3ZE0F 1MVUB 4YLCA 3IJSB 5KW9H 4XAWL 2VLLA 4DEWA 3LKRA 3X1EA 3C5JB 1LEIA 3FO2B 5E8NA 5HJDA 3T04D 3LN9A 2X4UA 4MJIB 5DMIL 4JR9L 1V7MH 4WSKA 1QR1A 1MZYA 3OXRA 4GQZA 4V33A 1F86A 4MB1A 2CWRA 3ILPA 3FFDA 1MAJA 5MHSD 4EDXB 4JFDB 3U7AA 1A6TB 1RI8A 5D7JC 1U58B 3LRHA 4FG4A 4TNGA 5E95B 1S4IA 1XQ4A 4F7CA 4PJBF 1OM9A 3GHEH 5KANG 1Y07A 2N59A 2PUQT 4GKOA 3V4VB 2WBJC 4K3EL 4ZAKB 1PX4A 3MRMB 1FAKT 1XF1A 5IZ7A 4I18C 2XVGA 3B8SA 3RGBA 3VFSB 3ZQWA 8FABA 4GRLC 4AH2B 3HRZA 2K8QA 3T08A 1T2QH 2VR9A 1X5ZA 3BZFB 3VXRB 3RURA 2O4EA 4XN5A 5IEHB 1XGQB 3GSRA 3FQNA 3VXSB 1F11A 1FRGH 1G5AA 3A5VA 1U33A 3PWUA 3M1BA 5DA0B 3VTMA 5C8JB 4OZIE 3QPXL 3UFIA 2CPCA 4KAQL 3E8VA 4RAVA 1V5JA 5EEYA 2V9TA 2WQ8A 4QHKJ 4BQ6A 4HC1H 4HIQA 3F85A 3FBKA 3X11A 1OSEA 4L8BB 3RWGB 1GL4B 1LYQA 4KTDL 4QRPA 1WBZA 1VADB 3I9AA 4A6YB 5A1AA 3HBPA 4G8GD 4XP6L 5DJYA 1ZA6B 3PWVA 5EEVA 5E9DD 5JNYA 1NCAH 5AKRA 1K4DA 2IPUG 1YEIL 3P54A 4FNPA 4ZFOL 3N04A 5E03A 1T66D 3BRFA 5FYLH 7PAZA 3L3IB 4HWBH 1X9UA 2BSRA 4IJ3B 4S1DC 1SYVA 4CGUB 2G60H 3B2DC 2AQRA 4X4YB 1KPVB 2OK0L 3OZ9H 4IRZH 2MJWA 3C08L 1AJ7H 1R3KB 3F7YA 5B1CA 4WI8A 1PDKA 1BLNB 2EDBA 3WNPA 1KPRB 2P52A 2ZOLB 3I6KB 3LRSA 4WFHE 1BVLA 1NWPA 1RQ5A 2MKWA 3IRCA 2CRZA 3V10A 3PWPE 3DX1A 2HH0L 5CCKL 1WWWX 4P46D 5J06A 4RMWA 4AYID 1CYGA 1XZWA 2EO9A 5L88H 4IOSD 4WWKD 1S9YB 1QNZH 1OCZB 1UCBH 3DOIA 3FQRB 3OKNA 4J4PA 4MQ7B 1PLAA 5FKAB 1QO3A 5MERB 5KVDE 1KFAH 2NR6C 1UB5B 3P77B