5LXVA

Crystal structure of ruminococcus flavefaciens scaffoldin c cohesin in complex with a dockerin from an uncharacterized cbm-containing protein
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
172
structure length
172
Chain Sequence
b'ETVQISASNAEAKAGDQFEVKVSLADVPSTGIQGIDFAVTYDNTVVTIDKITVGEIADTKAASSDQTASLLPTFDVSIQNSEGYSSVIWSTAVEDSSYWISKDGVLCTITGTVSSNAKPGAESPIKLEAVKRETYVGSGTDNSSISAGYSANDKAVKYTVKATNGKISVPSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Scaffoldin C
molecule tags Protein binding
source organism Ruminococcus flavefaciens fd-1
publication title Single Binding Mode Integration of Hemicellulose-degrading Enzymes via Adaptor Scaffoldins in Ruminococcus flavefaciens Cellulosome.
pubmed doi rcsb
total genus 41
structure length 172
sequence length 172
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lxvA01
4WI0A 4N2OA 4U3SA 2BM3A 4WKZB 1QZNA 2B59A 2VO8A 2Y3NA 3GHPA 1TYJA 3FNKA 5AOZA 3F2LA 1G1KA 2O4EA 2VN6A 4FL4C 2ZF9A 4IU2A 4FL4B 3L8QA 5G5DA 4DH2A 3KCPB 3UL4A 5LXVA 1OHZA 3BWZA 2CCLA 2W1NA 2JH2A 4IU3A 2XDHA 2OZNA 3KCPA 4UYQA 4UYPA 5K39A 4UMSA 1ANUA 1ZV9A 1AOHA 2VN5A
chains in the Genus database with same CATH superfamily
4C47A 2ZOTA 4E2OA 2XWJA 1SMDA 5CEYA 3H42H 4OD1L 3U6XA 1VFUA 2DN7A 1F4YL 3S96B 3EYFA 1IEBA 4P5MA 1XZ0B 1DYZA 3GJEB 5KJ7E 1JZ5A 1DJGA 3QQNA 5J5EA 1KJ2A 1MY7A 4S1SL 1J7VR 3MJ9A 2EC9U 4AEHL 1UEYA 3VFOA 1GZQA 4NWUL 4NUMA 3PWUA 1W8OA 4K55A 2NNRA 4NBXB 4YHYC 2BC4A 1D7CA 5SWZB 3ZT6A 1NGPL 4WJKB 4TVPD 1WUNT 1M7DB 2X88A 5JR1H 4IBWA 5JHBA 1K8DB 1NIFA 1WAPA 4KKBC 4N85A 2R0WL 4OZIB 1MCCA 2A9NH 4DP7X 1MF2L 1NUNB 1Z0MA 1GZHA 2NW2A 4N0CC 2EYSA 4QXUL 3W5MA 1M1XA 1SDAB 1ZT4B 4OGXH 2ZUTA 5INDA 3NFSL 4CC1A 3PQYD 5EU7E 2IF7A 1KIUB 3FU0A 1UOLA 1MRFL 1FYHB 3P2TA 4WY7L 4Y2OA 3ABKB 4I0PD 4WFHD 2X1XR 4GJTB 1T4WA 3C60C 3H9SE 4MXWH 1AQ8A 2K1MA 5A2LH 3UZVB 1QKZL 2NXYB 1KCRH 2ITDA 1GSKA 3HC0A 4JGNA 4BGDA 3QUXD 4LSRL 2XQYK 2IH1A 2X12A 4MYWB 4ZTEA 5BRZE 5DTFB 2QGDA 1ZHNB 4JFYA 2B08A 3FNKA 4YSOA 3KBHE 1LWRA 4WTZA 3VE0B 1M1SA 2XTJC 3GSRB 5FA3A 3ARUA 4QXGH 4MD5B 3O45A 4UU9B 2NLJA 2UY7A 4JBSA 3BKMH 3HMXA 3QZOA 2VERA 4O2CA 5C0CD 1CGUA 4LLVB 2DLFL 1MNNA 1Z5HA 4ADJA 3HG5A 1RPUA 1DJIA 4XMXA 1GL4B 1EEYB 1DQLH 1U42A 3OC8A 4XN1A 5DHVH 5HHVL 4E41A 2GI7A 2YUVA 3JV0A 4PW4A 5DYFA 4OLZH 3TFKC 1VFOA 4EXPX 3OAUL 3FUMA 1J0HA 2RBLA 4TUUA 4X83A 4EBQL 2A3TA 2NY4B 2YD0A 4X8GA 1EX0A 3T0EC 4L48A 3KXFE 5AAPA 1HNYA 5IEKA 5GS0C 2VGLM 4M7JL 1S5HA 3UJTL 4HD9A 1DQML 4LLAA 2Z92A 3P4LA 3IDNB 5MERA 3SDCC 1I3RA 3MOAL 3P77B 1DLFL 3HS9A 5FGRA 1QBLH 5I18L 3POHA 1NKRA 3NIGE 5EZLA 1OAXH 5A7BA 4IOSA 1AGBB 1CVRA 2KUTA 4TLUA 5CFAA 2XV2A 3MLUH 4BEIA 5DVMA 3NH7L 5E7FA 2OP4H 5I5MA 1WCBA 5IW6A 1RUKH 5F9JA 1U8LA 4JKPH 3UIYA 3FQNB 4DFIA 3TWYA 1RERA 1E4KC 1BWWA 2XQBL 4H25A 2GTZA 4UILH 2XWTB 4PJIF 1OP9A 4UV7H 5FCSH 4AC4A 2G5BB 4MNHA 2VZ1A 1VGEL 2X4OA 1E4JA 2D0FA 4W9FC 1IBGL 3L3IA 3MUY1 4NO5B 3RGVD 4G7VH 1AD9B 3O3DB 2Z4QA 3DPBB 1U41A 2DJSA 3C75A 4PGJA 1DLHA 4DP2X 1B90A 1KT2B 1RQ5A 5EU6E 3S37H 4P2OD 3NIFB 1QX1A 4GXUN 2L0DA 4Z0XB 1KCKA 3NPSC 5LDUA 5EPMA 4BCYA 3BP7B 4IGBB 2OPCA 1XL6A 1GMIA 1NGWB 1LP9E 4F57H 4ZFFA 4NZDA 3F5WB 2ADGA 1NCDL 1KIRB 5CU9A 2QLYA 1B4JH 4Q9CA 1LO2H 1J8RA 4XN2A 3PQYA 1EHAA 3TV8A 1O6SA 4HWBA 4X8JA 1U3HB 1UKTA 5F8QC 5EN2B 3LZNA 4CKQA 3HNVL 3W5NA 3BP6B 3GRWA 4GO9A 4BK8A 1BQHB 1LILA 4N8UA 5C97A 2VZUA 1AZRA 1JXFA 4M93C 4NDMA 1UT2A 2PF6A 4YEFA 4DK5A 2DQIL 1LEKB 3UTTD 5JHDA 3PWPB 5CJ5A 5IGXH 3R0NA 3WUZA 4FQPA 1IL1A 2EDTA 4L4TD 3FDWA 5DT1H 2E74C 2UZIH 3V4PH 2B9AA 3BP5A 4E41D 1XR9B 1E65A 1XXDC 2J55A 3GK8H 4IBLT 4PB0H 5E8PB 4KMLB 5C0CA 5L2KB 3V6OC 2QFRA 1SVCP 4OF6A 4ALAC 2VL5A 2NXYD 2VO8A 3MV01 5FFGA 2MHAB 5T8IA 3L1FA 4MBOA 4M4RB 1QATA 4MZRA 3H0TA 4S1QL 1XF3A 1OP4A 3HZYA 2XWEA 5H2BA 5HYSB 3VU1A 1RZJC 1D9KA 1WZLA 2DLEA 3KR3H 5F1IA 1ORQB 4I1PA 5EOTA 5LXGL 1WAAF 1YMME 4PJ8B 2FT6A 2QDVA 5CGYD 5D4QA 5H4ZA 4G6KL 4NLHA 3DRTA 1HWHB 4QMEA 2AAAA 2RMNA 2YD9A 3IXTB 1TKWB 3N40P 4HIHA 2Q5BA 1V8HA 2F8OA 3IJYB 3LEXB 3N40F 4JANA 4KX7A 2I9TB 1JWMA 1IFHL 4HSQA 2A73A 1WC7A 1WTLA 5T1LD 2WVSA 5AD0A 4KO6A 4N6RB 1UA3A 3VWKC 4ZOBA 1BV8A 2AANA 4HPYH 5CCJA 4D7BA 2ZAGA 5T1KB 2Z93B 2ITCB 5D7IF 4CNIA 1PLCA 1CB4A 2H0JA 4P2AA 4N28A 5KVDL 2YMXH 3QNYA 1UWXK 2A83A 1X5FA 2J8UF 3FH5A 1GGUA 4NWTL 1RY7B 1F5WA 3X14A 1MSPA 2DYSB 1K6QL 2R0LH 2WCPA 4PJIA 1UFUA 2ESVD 3X1NA 3MUGB 2AJXL 5TDOA 3B56A 2Q7YB 3K2IA 4R3SA 4JFFA 5EC2B 5GIRA 3QCVL 2W0LA 2K45A 4XCFH 3MLVL 4ZUUB 3WIIL 1U21A 1NDGA 3BZ5A 3WO4B 5I1DA 3SQBB 1BF2A 1CGTA 1JTOA 3G7TA 1DBKH 3LPWA 3MRDB 3O6FB 1NIDA 3P4NB 3QUXC 4JZOB 4UTBA 5IB5A 1MRDL 4OI7A 3R4DA 5MEPB 1TPXB 1JZGA 1WP6A 2UXGA 1MREL 4J3OF 3THML 5D93C 2E47A 3NOIA 4AZ8A 3BE1L 2Z8WC 5SWZE 5HHOB 2ARWA 4FQXA 4TOYH 5EU3A 4KJQD 1A7RL 4PGEA 1S9YB 1JE6A 2W38A 2E6PA 2NZIA 3WFBL 2HT3D 3OB0H 1OTSD 2VLKE 4U6TA 2FX9H 4DN3L 1UADC 2JKJA 1MJ7L 4HEPG 3WJLA 3ORJA 2ED6A 3EJSA 1IV8A 4R7DB 3GYRA 4OFQA 4WGVB 5A16B 1KULA 5CWSB 2CRIA 1KY7A 3V5HB 2V4LA 3VX0A 4Y2DC 1N59A 3QH3A 4NI6A 4R90L 4AL8C 1ZAGA 5DJAA 1F86A 1S9KC 2ZNXA 1PQZB 3QVAA 2G4EA 1J8HA 1E6OL 1KTBA 1RLWA 1NCCL 5KJ4A 4Z18A 5HI4C 2ICES 4Y19B 4L3AA 3V4VA 4KQ4H 4PVLA 3DTXB 5J13B 4AMKL 3CCHB 2AQTA 3DROA 3DTUB 4FFWC 4PRNB 3DV6A 5HPMA 2NXYC 3EDDA 2X4NB 5T5NF 5C6TH 2WIMA 3F6JA 1PJWA 2JKXA 4FI6A 4EDWH 1M71A 5E6ID 4IEFB 1FA4A 2XZQL 2EE2A 3A47A 4YHNA 2JIXA 1UACL 3BEWB 1TJGH 5FW7A 3G9VA 1G7PA 1U8NB 5B39A 4JPQA 4N5EC 2WWOA 4DP6X 4ELME 3BXNB 4H0GA 4BZ1H 3BYYA 4ZFGL 1RVFH 3DECA 3TN0A 1J5HA 1DBJH 3VXUD 4P5TB 4MSWB 2YGQA 2XWXA 4Y4FC 5F93C 4K5MA 2BHFA 5CU5A 5KYXB 3B2DC 1VDGA 1CICB 4WKZA 2EDOA 4GAGH 3UO8B 2EE6A 2IPTL 3DMMB 4NC0B 4MKTA 1A65A 1JGLH 2VQ1B 5BZZA 4Y4HA 4AYID 1BGXH 5J1AB 3PP4L 4TSAL 5EWIL 2BP5M 1YEDB 3GWJA 4WEMB 2X9XA 3TBVB 5GGVL 5F6HI 2GI0A 3RVTC 3MQIA 2WYHA 1RHHB 5LN8A 3V0VB 1QEXA 1USZA 2X4NA 3Q05A 5HPMB 2V2XB 1KPVA 1XEDA 2WPGA 25C8H 5FK9B 1U8HB 3CCHA 3FU6A 5CLXA 5K9QI 2H8PB 2NY7L 1F97A 1OE3A 4H8PA 4EQ3A 4KX8A 4DUWA 4PSRA 3PIQB 3QHFL 4X50A 5CZVH 4MQTB 4Z3HA 4JFXB 2TSBA 1H3GA 1HAWA 2ZYRA 1AIFA 4R7DA 3J07A 3BP4B 5TK2A 1QSFA 2XN1A 3HS0A 5A16A 5EEXA 4IIQC 5JHLA 2WHVA 4IBZA 5I8KL 4KK8D 2XWDA 5MI0B 4WWKC 2H3NB 1G7JB 4Y5YB 1QBBA 2EEFA 3P73B 3F83A 3VA2C 4O00A 3ABGA 2NY3D 1OOAA 5HHNA 3PAYA 1XR8A 3VI3B 1YG9A 3WNNA 2V5MA 1KDJA 2WTOA 1T20B 4L5FH 4B0MM 3AXHA 2YD1A 4E0RB 4MDIA 3KVQA 2WTRB 3F7YB 3NG5A 4AIOA 1G9ML 3HA0A 5CILL 5GRYA 4BWWA 5FYKH 4UNVA 3TIDB 4NC1E 1OTUC 1T20A 2BWDA 4JDTH 2PCFA 3ML9A 4PJIB 3KW7A 1Z5LA 1X9UA 3KYKL 2LU4A 5E08H 3W11C 3B8SA 2PTVA 4ZMPA 4WK2B 4QRRA 5IBLC 5CINH 3QSKB 5TGBB 4JE0A 3W1ZA 4Z7NE 2G3MA 5A43C 3BP4A 2BNQE 4N0RA 1KXHA 3FO1A 5TDNA 4JFXA 4A2GA 15C8H 3PIQA 2N1TE 5IB4A 3LPPA 1KJVA 4XMLH 5KOVC 2G2PA 3HG1D 3IJYA 2Y2WA 4PJHA 2Q10A 1F45A 1NAMH 4AVIA 2IIJA 1BFVL 4TQEL 4ZTPH 1S7TB 2NT1A 4PJ8A 5K9OB 3IMVA 4EI5C 2VDRL 2XZQH 3MC0A 3DJ9A 2CR0A 5CUSL 3DX8A 3Q7JA 4QTIH 3NJKA 3T65B 4MD4B 4B97A 3MLWH 2WP3T 4YX2H 3GI9L 3OSVA 2W95A 1J88A 2VDPH 4QT5A 4UAOB 3UC0H 5E7BA 5JUEH 1XF5A 3CVHL 2I07A 5E9AA 4LHUD 3RTQB 3ZTEA 3LKQA 2AJSL 2WVUA 3KPSD 3MV8E 1IC4H 3ZQ9A 4YPJA 1A7OH 3NCCB 3MUHL 4G6ML 1ZGLA 1GKOA 1WFUA 4L3EA 5TFSL 1ZHLB 3QAQA 4UMGA 3MKKA 4UT7H 4ZMXA 3FHQA 3ZKMD 4HWBL 3MSPA 3HPLB 1R24A 3HI1B 3JWDH 4WI2A 2J6EA 2K0RA 5F0PB 3DV4B 3SOBH 3V6OE 1JWSA 3DX2A 4OM0H 1TVBB 4I77L 3LRSB 4GIAA 4YXLH 3UL4A 3E6HA 3D33A 2DDQH 2UZXA 4UZSA 4OJDH 4W9EC 3SOBL 4AC2A 2D2CC 5A2CA 3MLRL 5GGVH 1MEXL 3B9KB 3T77B 1NQBA 2YPKA 2K8QA 3S8WA 3K7UA 3N91A 2EDYA 1PY4A 5EN2A 4YR6A 3HZVB 4QPEA 1O6TA 1HCFX 3MO1A 3LPGA 2QQQA 1DN2A 1KY6A 4L4JA 1YPZA 3GMPB 2VR5A 4RWHA 3W2DH 1UVQA 4PY8J 3KM2A 4TL4A 2XN9E 4ANKA 4UTAH 5KSBB 5TF0A 1D6VL 1SF3A 2Y36H 2EE3A 3AXLA 5BUPA 3BESR 1KEMH 3QPXH 2FGWH 4J4PC 5EPMB 3TV3L 4GXFA 4KO5A 1M2OA 4RGOL 2DD8L 3N42B 1A9VA 3DXAE 3P4MB 1KGIA 3UTSB 3EOAB 2QELA 4HZAA 2IOIA 2ZOUA 4M5ZL 4XVOA 3U9UB 3KWVA 3L3IB 3BVNA 1R24B 1I8IA 2C9RA 3NIFF 3P3YA 3NK4A 1LXMA 1JHTB 3RWHA 1KIQA 4L3EB 1LD9A 4FAAB 3GTVA 4A2EA 2FL5B 1V3KA 2MPAL 5DEZA 4RMRA 4KY2A 4BFFA 3HTLX 1PZ2A 3GTTA 5DD6A 1MRDH 2PCPA 3SYCA 5L9DL 1OAZH 4TYUA 3QDJA 3UPCA 3DGDA 3N43B 2ZOLB 2DIAA 3QCTH 3VD9A 4QD2E 1NANH 5EUKB 5IW1B 1NGQL 5EBMA 5ANME 4TPRH 3MGOB 2B77A 3Q9PA 4AQEA 5LWYL 1MZZA 4GW4B 1XH3B 2WZPD 4OZHF 3BH4A 4XCCL 4JFFB 4MHHG 3LXBA 3HG1B 1EXGA 1VZGA 2PXYB 2EDEA 2QL1A 5FKPB 3QIUC 4K3EL 3V8CA 4MAUL 1E30A 1N26A 4JFFE 1TUPA 5DJXB 5IEKB 3AACA 4N9GB 4P3CL 2A83B 2P8PB 4OKVA 2Y1AA 3O2VL 2NXZD 1K4CA 3VRIA 3PPSA 2JF1A 4YAQA 3FRPA 4JPKH 3HBQA 4JREC 3WEAA 1EEYA 4M6NH 1SXAA 3IFLH 3IJEB 3VWJA 3UAEA 3F7PC 4PJEF 1DQKA 3H6JA 3NJIA 5LXGH 5H35A 2RJMA 3C09B 4N1CA 2ZOOA 3IVKB 1V7MH 5F1IB 2PN5A 1CURA 4N0YH 2VIRA 1HHJA 2B39A 2VDKB 5CEZL 4FX5A 2DM4A 3SDAC 3VXRE 1LK3L 1U91B 4PG9B 5F9AC 5FV1L 5E8EB 2NY7H 1JZJA 1RIVH 4A38A 3GBEA 4FQJL 3MBEA 4XX5A 5HI4D 1MNUL 3VQ1C 1ESOA 2BK8A 3RU8H 2OM5A 3QHFH 4ZS7H 1H6EA 2BSCA 4PB0L 3WMPA 4F9PA 2FEEL 4WEUD 3ZXAC 1U6AH 1QYGH 1I1AD 4MVBD 4KRPC 1SJMA 2YPVH 2BNRB 5ANHA 5F72S 4Z7UB 3U0WH 1IGFH 3K2UL 4B7LA 4PLJC 4XPAL 2FJSA 1D5MA 1CYGA 2NX5D 3P3RA 4HCRH 3IDIA 1AKJD 2BRRH 1AHMA 1U8MA 4AE0A 1RZKC 1M7DA 2GQHA 1GS8A 2HKHL 3MV7E 5TE4H 4GO8A 1EFXB 2JELL 5IESL 2W07B 2DQTH 2X2JA 1XXFC 3B9DA 1BXUA 3I9GL 1OZTG 5FHAL 4HG4J 2H6PA 1NCUA 2DEWX 2ADIA 2V8LA 3PQYB 4CKVX 5DZJA 4GRWE 2JI3A 5KSAC 2D7PA 3ZDXB 4ENZA 3CG8A 1FNHA 2X9YA 1XZ0A 5DU7A 4DAGL 3MRNA 3AQXA 5FKPA 2XETA 4F7CB 3C08L 1BIHA 4NRXA 2XZZA 4HA1A 3JYCA 4R97B 5BS0B 4X4MA 2OJEB 3MGOA 4Z7NF 3QORD 3MV9D 1UTDA 1KYFA 2XFXA 4JFZL 4M43L 3RILA 4WV1A 1UQSB 3CQFA 4WW2C 2PWDA 2GTQA 5E1GA 2MCAA 3T0EB 2YIHA 3ARFB 3GD1C 1W0WA 4FN0A 4I0PA 1ETB1 3DUUA 3ZVVA 3QZBA 3GMQB 1OGAE 2JJSA 4UQIM 5KYXA 1B4RA 1Z6JT 1I1AA 2G2NA 2PO6D 1W6LA 1ZT7B 3WSQH 5SV3A 4QRRE 1I85A 4NKQB 1PX3A 3PXJA 1E0OB 2HSIA 1P7QB 3HG3A 2DS4A 4LOFA 3ET9F 3LRGA 1HNFA 4QRPB 4JGUA 5DD3H 3BW9B 5FHBH 1OAQL 3MACH 1GY1A 3C6SB 1OF0A 2O6DA 3BDBA 1WCBB 2IOOA 5IW6B 4FLQA 1J5IA 5IK3B 3B1UA 4APQB 5D1ZI 4ZAKC 4PJHE 3V0HA 3H3PH 5HP5A 3OR7B 2WQXA 1G9EA 2X44D 2EXWC 4G42B 2X05A 3T1FA 3TT3H 3P4MA 3L3OB 1CDHA 4DUVA 1QNZH 5DF0A 1AE6L 1KGCD 4RGMC 2DQDL 1IU1A 1C1EL 4YXKH 4JN1H 3UC0L 1EZVX 2APBA 3QISA 4DGVH 3D06A 1T66D 5CCKH 4FJZA 1I4FA 2X0WA 1OWRM 3QJSB 1HAUA 2E8YA 2EECA 1A7NH 5AW4B 3GXMA 2F08A 4YMPA 1NFAA 3MO1B 1UXSA 3TO4A 4N8CL 2OSYA 2JQMA 1ZKAA 1KYOK 4MNQE 4CAGA 3RFZC 3PHQB 4DGVL 5D55A 1RZKH 2Y3NA 4F2ME 3OQ3B 1EAPA 4WI0B 1YEJH 3QJHA 3LKRA 4HT1H 1KIPA 5F7EL 5EBWA 4C56A 4FJYA 5GQBA 3BKYH 1M05A 5HYQA 3F7VB 2AJYL 5TF1L 2DJMA 3F7LA 1S2EA 4ACTA 2E75C 3HI1A 4NC1C 2CJUL 5MEPA 2PP9A 4LP8A 2BSED 4J2QA 4YEEA 3V79C 3CPLB 1MHHA 3VYPA 4MAZA 1LP9B 3Q1EA 3PWVB 2IQ9H 1IB5A 3BIBX 4ODSL 2XG4B 1ACZA 4ZUUA 4UI2A 2ADYA 2BDNL 3UMTA 5EU6B 4DKFL 2YBRB 4KAQH 1DTUA 1T0OA 4MA1B 1H5BA 1YPZE 5EC2A 5GGRY 4HPYL 4GSDL 4ANWA 2R83A 4JX0A 3UC2A 4MDJB 2WLMA 4KXCA 1MRFH 3BAIA 1EO7A 1A3QA 2PTTB 4L29B 5IVXB 1HHIB 2FCBA 5DK0B 5K9OA 1JD9A 3P69A 4DZ8B 3KLAB 2EDJA 4F92B 3L45A 4PJHB 1XO8A 5I76B 4PD4J 5F9DC 2VN3A 2NW3A 2J73A 2NY2B 2DQFB 3LDBC 3SOTA 4XMKH 4AUUA 1SGKA 5F7KC 4DO6A 5I26A 3QORB 4P4RA 5DEGB 1D7BA 1FGVL 3FT2B 3QWNA 1BXVA 3LRHA 4O5LH 4JPIA 2D03H 3ZDZB 1NICA 2XU9A 1CFNB 3DURA 1HL9A 2R1YA 4ODUA 2WAQA 4ZNCD 1N5AB 3ZDXF 3UG5A 2E9WA 5CZVL 2VMEA 4BFOA 1OAUH 3CDZB 4BQ6A 4JZJC 3GJEA 3WXWL 2N1KA 4P46D 1KB5L 4MS8D 4LSSH 3BGFB 2ZXCA 1ZLVH 4HKJB 4NQEE 4EF3A 3GMNB 1RZJH 2YRBA 1RI8A 4GQ9L 3BHBA 1VB9A 4ETYA 4AYSA 4FG4A 4Q0XL 4C58B 1EDYA 2A74A 2E8ZA 3IDGB 4OZGB 1KF9B 4Q2ZB 2NY4D 1UEMA 2CO7A 5D7SL 5J6HB 2QBWA 1G7JA 1Z1WA 2D2OA 1FP5A 3NJXA 4S1SH 3T2QA 5E9DB 1E42A 1FLRH 1KPUA 2VRAA 3T3PB 1C5CL 3FUFA 4H88L 5T5FH 5JW4N 2QEJA 4LEXH 2B1AH 5BRPA 1K9TA 3QIWD 1O6SB 1NFDA 5H4YA 4BHUI 4G59C 3MZTA 2DICA 3VD5A 1VGEH 2DEYX 3M07A 4FFTA 4PP1D 3WN6A 3UYRL 2JTDA 1QVOA 2E86A 3WS6C 4J23A 4ABVA 2V2XA 4A2FA 1RU9L 2BH0A 4WNSA 1OE1A 3MDJA 4U05A 4W9IC 1FCCA 3OHXC 1RHHA 2CE6A 2Z4QB 1I9JH 4LDCA 3MR9B 4F58L 4EI5B 1P4BL 3ME0A 4DWHA 2QQKL 2X4OB 3U83A 2WOBA 5LGJA 4NCC1 2E7MA 3SDDA 1INEH 1K3ZA 1FL3A 1V7ML 1TENA 4TLKA 2J1ZA 2XWTA 1SEQH 4PBDA 4Q6YA 1HZHH 4UINH 4OZIE 4Y4HC 2VZVA 2ZUQB 4UYPA 5CNHA 1BLIA 4G7QB 4PJXE 1RZGB 2VR7A 2XT1B 3B7SA 4G70B 4HV8A 2AJZA 3ILPA 1OAZL 5IEHB 3L3GA 5SX5K 5E2TH 1J12A 1GW0A 4ODSH 1UKQA 2NNFA 2DTMH 5BVJB 5L2KD 3ULSA 1KTLB 2GBTA 3X1GA 1L3WA 1L0XA 2Q7AA 1XH1A 5AOZA 3GPSA 2R1YB 3QI9C 3WFHB 3SJVD 1HXKA 5DZOA 1MAJA 1JI2A 4YNYA 5AG9A 1CD8A 5B39B 4JHBA 2FB4L 4UTCA 3HR6A 1I3RB 2R0ZL 3QEUA 1SOXA 1UWXH 2XQ0A 3AQZA 3NJVA 4P4RB 4HBQA 4TUOB 4XBPA 3DWTA 4JVPA 1SYVB 4HKXA 1BEYL 1N67A 4FMKA 4PGBB 1B4JL 1PNCA 1ETZB 1PSKH 2ARJA 3K74B 4QXWA 1ZTXH 4RDQF 1YYLL 1E8XA 3DROB 3VXMD 5GS0D 3DTXA 4PJFA 4QY8B 4PYHA 4HHWA 5A40E 2FJGA 1WA2X 3E0GA 2NY3C 1E5YA 1KEGH 5HYJE 4YZFE 2Z6FA 1MDAA 4IIZA 4MMZB 3CXFA 1S7UB 5DJAB 4DH2A 2DRUA 5LKNA 3H1ZA 3GSUB 1B0IA 2IBBA 1Q4NX 4ANXA 1C12B 3FONB 2YBRA 3QWQB 1O0VA 5I66B 1HIML 4M61A 2NLJB 2UY7B 4UU9A 4LVOB 1I1FB 1ZXQA 1SJVA 2R8SL 1K72A 1R4XA 2ZWSA 1E5UI 5ABDE 3WJLC 2B59A 3LTVA 1MRCH 2VMJA 3NZSA 4X4XA 3N55A 3RJOA 3A4FA 1FH5H 1M05B 1UM6L 2K3HA 2P52A 1FYTD 3O9WD 1A64A 2FQFA 1KV7A 3TYFB 5CSBA 5B21A 1D5XA 3W0WA 2D7TH 3UGEA 4JPVH 1PW3A 1I3VA 3LEVH 1EWHA 1DLFH 4L5FE 1LQSR 4ERSH 3MRIB 2NW2B 4POZD 4PS4L 2DQMA 3QUMB 4ZO6A 2Q76A 3QO0B 1N3NA 4XI5C 1PFCA 4K94L 4P23D 4YFLI 3RY6C 3LEYH 1KJMA 4X4ME 2CKBA 4Y4KA 1WBZB 2EEBA 3WNPA 2ICCA 1QSFD 3QIUB 1AS8A 3NA9H 3UTQB 5I1IH 1U8CA 2FLBT 1YMMA 4NM8H 3RVXC 3VWKB 1F6AA 3FO9A 3CXDL 3K91A 4IJ3B 3KPNB 2QKSA 1S7SA 3GFUA 4LL9A 1MJUL 2E7CA 4FQIL 4K07A 1WC7B 1XF4A 3V0AC 4XRCB 4B5ZA 4PRID 3F58H 1S7QB 1TVDA 3B2VL 4LOEA 2DMKA 4EJ1C 1BJMA 5KSAB 2W65A 1BG1A 1EFQA 5KBKA 3DHPA 2X70B 1I7UA 2Y2TA 3WNLA 3T3ME 1ADWA 1NC4D 3PGDB 5JIQA 4G71B 3SYAA 5B7FA 1ZT7A 2WYIA 2DB8A 4WFGE 4XVTH 1YNTB 1UCTA 5IVXE 1XBDA 1XF3B 3WJJC 4HGWB 1N5YH 4N8CH 3FOLB 3WTWA 5IBUB 3QEQB 3WLWD 3ZKSD 1UB5B 3MRRA 2AABH 3GZOA 1KLUB 5D1ZC 3V4PB 2HJKA 1CGXA 3VACA 5IB3A 4O58L 2VXUL 4F7CA 2QGEA 2ROXA 4WQOA 5FOBA 4MKMA 1R5VA 1U3ZA 3BDYH 4LCUA 1XF4B 4MXQC 1DVFB 2FR4A 3NIGF 5TQ2L 4LP5A 4DO5A 1AGEB 2NSQA 5T5FA 3EO1A 2F5AH 3FO9B 2UUDK 1SLWA 2YWZA 2DYPD 1RIHL 5FEBA 2DWDB 4C56E 4UOZA 5B3JE 3CE1A 3BP6A 5C0DB 1RLBA 1Y07A 8FABA 5EBGA 3C6LB 4KWUA 2EVHA 3NYKA 5E08L 4AM0A 3U0TB 4PRHE 1V3JA 4OIIH 1J05A 2GBUA 2KI6A 2L7QA 2VMDA 3OR6B 4Z6AT 1T6VN 2UX6A 3B43A 1Q1PA 3MBEC 5EF3A 3HG4A 3INUL 5GXBB 1NGWA 3HZMB 2CGRH 5GRVK 2WXPA 2WJ5A 3LIUA 4NQEA 4DGYL 5BJTA 3X2QB 1M6UA 2WB7A 1CQYA 2X1OA 4X2UA 1TG8A 1SFDA 2J1XA 1KT2A 4Z23A 3OAZK 4MWFB 3BZFA 3CSBA 3EH1A 5L8LB 2CKBL 5DO8A 5AG8A 1YEEL 1HINL 1FDLL 1E3ZA 5DRZA 1AO7D 4P9HL 4A39A 5IMOB 1VZHA 1VADB 4JLRA 4ES8A 3WO3B 4NAJA 4OV5B 3I2CL 1HHJB 2IGFL 1CO1A 3HS0C 4K8RD 3UROR 3PXHA 4WLCA 3QQXA 4X6CE 4HUXA 3MBXL 5I66A 1JYNA 3QR2A 3B2VH 1NUGA 2R4SL 4FG6C 3RUGF 2TRYA 4JL1A 2CNYA 3WKYA 2MOGA 3VFWA 3KEHA 1A3LL 3Q5YA 3MLSL 3VA6A 4LSRH 3WEXB 4L4VD 5HJDA 4GKLA 3GBML 1M57B 5TTRA 4E42B 4JG9A 1KN2H 2YJQA 3LKNB 3BIAX 4ODXB 1BQHG 5BZWB 3VXPB 1HOCB 1U3YA 2YD7A 5C7XH 3L5XH 4HS8L 2JJWA 4PFEA 5IIEA 1P7QD 1ORSA 3ARSA 4AJWA 5FWRA 1BM3L 2BS8A 3HNSH 4I13B 4X98B 5D5MF 5HHXH 4YSTA 3SDXA 1ZS2A 1JFHA 1JXDA 2FLRT 4NQXA 5E2VL 4G43B 5CS7A 1HKLH 2IPTH 1F8TL 4XE5B 4YNYB 4AEIL 2EILB 1U36A 1HN1A 1NM9A 4PWFA 3U30C 5C1MB 3CV5A 1FFPB 2GITB 4NIKB 2HLFC 1DVQA 4L8CA 3QUHA 3ZE0B 1BVNP 1KTCA 4PG2C 5FHBL 3DJZA 3IDUA 1FUNA 1BX2B 1KTKE 5DS2A 1U2HA 1D9KD 2UXFA 4UTBH 1A6VH 4LSPL 3GQFA 3TYGL 1BJ1H 3BWZA 3Q5OA 4MMXB 4JFYB 2Y1VA 5JXAH 2W94A 3EH4B 5JW4M 3P4OB 1EZSA 3RG1C 4Z5RA 2I7SA 3IFNL 4Z3GA 2PW2B 2X3BA 3U9UA 4KZDL 5DRZB 1DBKL 1G5AA 3F12B 4Q9RL 2KKQA 3UDWC 5ELIA 3J27A 1HHKB 3ETSA 3EO9L 1EQWA 3FMGL 4KJPD 3QPQD 4L4TA 5HYJA 4NQEB 5F88A 4BFBD 5L88L 1ZS8B 4YVNA 4OCXL 1ZK5A 1EK3A 3ATEA 4N22A 3IDYB 5CJQL 2BVYA 1IQDB 4LVOC 2AQ1A 5I28A 1C8PA 3NJGA 5DJDB 4Z7VA 5DQJA 4YQXH 4LNVA 3CFDA 4GG6E 3B9KA 4JHWL 2Q6WA 1LHZA 3UH8A 3MLSH 4ELMB 5H37H 4G6JL 3MFFA 1U4EA 3E6HB 1TNNA 6TAAA 2XXCB 2PR4H 5I1CL 3A24A 3EBIA 1OPGL 3CVDA 1L3NA 3P54A 1O5DT 2CDGB 2OMTA 3MV9A 3CVIL 5LLIC 3HE6D 3L48A 4PWKA 4XOCA 4MJ5B 1FIEA 1KLUA 4RMWA 3PV7A 4PIBA 3INOA 5GS3A 2R23A 4GRWH 5FV2A 4UWQB 2PW1B 1FL6B 3MRGB 1ZHKA 2G2RB 1Q9LA 3LH8A 4B53A 1ED3B 1P7HL 3DTDA 5C0FA 7PAZA 3N85L 3ZKNC 1H19A 1MW0A 1UZ8A 2EDFA 3OAWA 3FHAA 5FYKL 3BGMA 4Y9CA 3ZZSA 5I5IA 3DX8B 4N0YL 2APFA 4GUPB 4HCFA 1J9TA 2GJ6B 3PL6A 5DUJA 2ED8A 3DX6A 3P3TA 4FQHA 3ZYJA 4A1RA 4DGYH 3I6GA 4PU2A 3FQRB 1B4TA 3MV8A 2RGSA 2ALAA 5E4OA 4HJ0D 3ZKXC 4JPIB 5F6IC 1CJYA 3TA4D 3DJSA 4ORGA 1IKFL 4AY0A 5HHMB 4X9GA 1JBJA 4U1KA 1NAMB 4EOWH 3C6EA 1P5UA 5ECJE 1PCXA 4X8XA 4XZUA 4M93B 5LBSL 3ARED 4H88H 4H40A 4BUGA 2PLTA 2Y07H 4XP5H 2F15A 1S9WB 3K5RA 1FNSL 3BSZH 3JYBA 5IVXA 1ZCRA 1MI5E 2VLJD 2WVVA 3RURA 3T0DA 2R2CA 1CQKA 5CD3B 5E03A 4UV4H 4ALAH 4HWEL 2VXUH 1TQCB 3II2A 4J3SA 2HLFD 4KRLB 3CVHH 5D1ZB 1YQVL 4Q0XH 1WPCA 3WCYA 1P1VA 4OVVA 1T5XA 2EKJA 3Q2VA 4QAMB 3OLDA 3VJ6A 2VXSL 5AYTA 1AG6A 2QHRH 3G08A 4WJG3 4XXDB 1T6BX 5FUZL 4EUPB 2AEPH 1RP8A 4LCCB 4X9BA 5CO1A 3WS3A 3G6JE 2QJDA 4DP1X 1FSKC 5IVZA 4C57C 3PJLA 3ALPA 5HYQB 3QWRA 2RCSH 5KYWA 4FA7B 1LE5B 1X7TA 1U3JA 3QJHB 5L7XL 1TTRA 1LEGA 3O2DA 2IV9A 3VD0A 3CFEB 3G04A 4JDZA 1XGQB 5I8EA 2HMID 1NUFA 4WFFE 1PLGH 3KJ4C 2A74C 4HS6B 2R4RH 4G7YH 5HGAB 5FO8A 3ZT7A 2V17H 4DEPB 3CX5J 1MG2C 3TPKA 4XBEH 1HC1A 3Q8BA 1I4FB 1O9ZA 2AFNA 4OJFH 4B27A 3UOAB 3OX8A 2EIEA 4PJ7B 1ZT1A 2GSGA 2JNZA 4HULB 2EVIA 4XNAA 3O3BA 4UF7C 1PX8A 3L4WA 1WAAE 4FTVE 2F53E 4R83A 4XN5A 5F1KC 3OR7A 1MCQA 4JB9L 4LCYB 4LEOA 1M7UA 4OKDA 3WE6B 2R29H 3ELAT 1NMAL 4TM9A 3TBTB 4QRPD 1JNLL 2Y6TE 1JP5A 4GW1A 2HVBA 1SF5A 1LO0L 1BBDH 5I1JL 1IVTA 2BRQA 3IKCA 4OJCA 1ZLUH 3O6FC 3NBNA 3SE6A 4A6YB 2Y9RT 1AI1H 4N1EA 4NQVA 2PWGA 4NLAA 2DQEH 5KS9F 2NYKA 2I5YL 2QTVA 1T03L 4NN7C 5FHAH 2WQVA 3ILPB 5C0AB 3KDMA 3P0GB 1IGIL 4E9WA 3WFBH 4HS3A 4TNVK 4JY5L 3HJ0A 2R8SH 3TN0B 1S9XB 1FZKA 1GGCH 3QHZH 1E8ZA 2Y3AA 4L0PB 3VFNA 3QYNA 4PGDB 4XOBA 1XGTA 5JNYA 1N2RB 3GEWB 3BQUB 2YQ3A 4EI5A 7FABL 4IEFA 1CG9A 2QHRL 2K4AA 2EIKB 4UAOC 1E3XA 3MNZA 1TTUA 3L17A 4KH2A 3BGFC 1KEGL 3VFUA 5JQIB 1VFAA 2MRYA 2F54E 3QQDA 1OALA 2ZG2A 2H6PB 5AB9A 3OSKA 2EO9A 1DBBH 5C8JB 1DDHB 4BKSC 3KPSB 4AGLA 3UO1L 3WFDL 1XH0A 2O93L 1FNGB 4UZGA 4JFTA 3IETB 3BAJA 5GRVL 3U82B 4JY6B 1LYQA 3HOGA 4PGCA 4A66A 3S7GA 1EO8H 3IDIB 4M56A 3ULVF 5F7HA 1J8SA 5BQ7B 4PP2A 2MQ3A 3ATAA 2JJVA 3BPLB 1KEML 1VSCA 3QPXL 5KANG 1WA1X 1L9RA 2NOYA 2MOQA 2FZ3A 3JWNH 2FQGA 3L81A 3S5ZA 4XPGH 3SDXF 3VFPB 4E9VA 5H94A 5DQDL 5G4OA 4AYEC 1MCSA 1NIEA 4AZ8B 1KN4H 1CXLA 3TF7C 3JTTA 5MP6H 3TP4A 3WNIA 1NL0L 4JRYD 3P4NA 3MGTA 2I26N 5HGDB 2HLEB 3ZO9A 2RIKA 3OJDA 3GEFA 5DGQA 2AKRB 5EU4B 3TH2T 2OTUB 3FB8B 4I9XA 1A7NL 3V52L 3QYMA 3QXDA 5CCGE 1E7UA 2VKWA 2PYEE 4WSJA 5AZEL 2VLJE 2WN2A 4EN3D 3QA3A 4K2UL 2HVKB 1RZIA 3E8UL 4NZTL 5IROA 4RAUA 3BO8A 4EZMA 3QZNA 2DL9A 2J44A 3BLKA 5KTEL 5B7EA 3BVXA 5BO1L 1QLRB 3IJHA 5C0BD 1PGRB 4WU7B 2OXGB 5I0DA 3SE4C 4S1DD 5H8DA 4HEMA 4HJSA 4UT9H 4YSAA 4XMWA 4WI8A 1KFAH 3B9EA 1NM4A 3QNYB 4XX1G 1CE1H 3CN1A 1KLFB 4M9PA 3FRPB 3MRMA 3KPPA 1K4CB 4XCEA 1JXKA 4PJ5E 4N9GA 1E28B 2AEPL 4Y4HD 3FSWA 3KPQB 5TQ2H 43CAA 1ITBB 1BVZA 3D39B 4B6ZA 3QXTA 4Z7IA 4MZIA 5D7JC 5I76A 3VMOA 3ATFA 1BLNB 1BQUA 1A1MA 4Y2LA 1GGIH 1T2JA 3HIZA 2WK2A 4BFEA 3PGFL 4HPOH 1AO7B 4B9GA 3S9DB 3EOTL 1W72B 5EBMB 2PTTA 2W88A 1A3LH 2GIYA 2LE9A 3D09A 4IU2A 4OCXH 2WO2B 1XQ4A 3CN3A 3MLVH 3RHWF 2AQ3A 3T6QC 1J10A 4GKSB 3VFVB 1ROCA 3QCVH 5J6GA 5EU6A 2GABA 5E8OB 1YMHA 5I6KA 2XQYG 5C3LD 4Q9QH 4R0LC 5E2UH 5E6IB 3UTTB 2AK4B 4ELMF 2L7UA 1REIA 5L2KA 4MNQA 1LP9A 4NPYA 4PJCB 4X8CA 3RWHB 3ARBC 4P46B 4N68A 5A6IA 2BM3A 4L4VB 1RZ7H 3S0PA 2J4WL 3UIZA 3JV4A 3CZFB 5I75B 5CZXD 1I8IB 4HIIB 5HGHB 1MVUA 2OCJA 5FF6A 2F9BT 1YEEH 4JHUA 4K7PY 2EXSA 4WWKA 4X5LA 1A0QH 5F7BA 5TH2A 5HDWA 1BZ9A 2C7FA 4AEFA 4Z8FH 5AVZB 4MJJA 5DGRA 2OX5B 4U1IA 1ZLDA 4UOW0 3MJ7A 4GY4A 5KS9A 3HHSB 4PJFF 2IDQA 1NL0H 4JRXE 4AI7A 2WBWB 1CYXA 4X99A 2H0PA 3O3AB 5DRNA 3EBAA 3TZVA 3O0LA 5D96B 4WU5A 5KTEH 4MDRA 4YR6B 4NZJA 4FFYH 1IAOB 4RRPG 3PP3H 3TL5A 2FK9A 4HJTA 2BVPB 3GUFA 4TVSa 3V0IA 2PMZA 3H3KA 3NFNA 2EH8H 4G8AC 4FNPA 4KTEH 5I1CH 3P3SA 3CBKB 3EKCA 2CBTA 5KVFH 4GSDH 2AZAA 4QTHA 2D7OA 2AQRA 3CLEH 3D1MC 4LNRB 2EYRA 5HHPB 1A3RL 4FQXC 3CFJA 5KVGH 3TX4A 1SMAA 3BW9A 4Y1AA 2XYBA 5AW1B 3CFMA 1HWWA 4WI9A 1BZDA 5E0QA 4QRPA 5IBUG 3SYOA 5JW4Q 2CR3A 2R4SH 5L0QC 5F96H 5FO7A 4ZS6C 1BW8A 3FF7A 4GB9A 4JDEB 2WJ7A 3WIHA 5I8CB 2GTWA 4F7KA 3QZMA 5ENWA 2WV3A 4MA8H 3WIAA 4JHWH 2HTLC 5F9JB 1KBWA 3LVEA 3O81A 4QRQB 1A6ZA 5DC9B 1WWCA 2KH2B 2ENQA 2G75B 1JGLL 5J9PA 3HI6L 3ARFA 1RJLA 3CX2A 3CFQA 4C83B 4HSAC 5E8NB 2XHNA 3KWWA 3P1VA 1DBBL 3P77A 4JNXA 1O7SA 3US9A 1S7TA 4N8VB 4HVBA 1HDMB 3UG3A 3LZOA 2XLLA 1YNKL 4FYSA 1UH4A 3T2NH 4ETQA 3BD5A 3RGHA 1FO0B 5CEZE 1AI1L 1F3JB 4L4VE 4OZGF 4PAZA 1XGUB 2WGNB 2WO4A 3AB0B 4G80A 1HHHB 2QKIC 4TS6A 4LPVA 3POCA 4YL9A 3VXQB 4PJ9D 1Z7JA 4XMVA 8CGTA 3HE7D 2P45B 1TJMA 1FE8L 3GB7B 5I6XB 2GSMB 5F0JB 2ZD0A 5LB1A 4X80L 1TO4A 1S9VB 4UT6A 5FB8B 4ZDHA 4YDLB 1ZK9A 2X4QA 3PHSA 1INQB 2DQCH 5PCYA 4ZOEA 2M8XA 3VXSA 1QHQA 4GI8A 2PP7A 5CEZD 1AO7E 5EBLA 3S3DB 1WBYB 2P42B 3FRUA 4GOSA 3QAZB 1IO4C 4XE0A 4GG6B 4PV9A 4I0CC 3D6GA 4I8DA 1BBJB 5I1GH 1TFHA 2YLHA 4I1RA 2JB6A 4ZFOB 3MBEB 3ISYA 4OD2A 5ABAA 3AWEA 3JBG7 3IFOB 4R4BB 3KXFB 4RSYA 4CGUB 4LIQL 1TQWA 2PWFA 1XL4A 2YQ2A 3ROLA 2DLGA 5JQHC 5EF1A 4MCNA 1AR1B 1MCNA 4QTIL 4YK4B 2ZT9C 5DFTA 5JHAA 4Y2DD 5I74C 3S36L 2AS5M 5INDB 1J1XH 3DO4A 4P5KA 1YVLA 2YAHA 3QUGA 4NUGH 3RRQA 5IV2A 1RJZB 2F53A 2ZKWA 2OBGA 4OZIA 2PTUA 1FYTB 1W72H 3GXIA 3O9WB 2WC7A 2COVD 4Y7OC 3FUIA 1XIWC 5ETUA 1A6TB 4YIQA 2O5YH 1K4DB 2P44B 2C3XA 5IUCA 1ID5I 1PX4A 1TZGH 5ANMB 4BD4A 4IU3A 2IDCA 1FFOB 4LLMB 2IWEA 3TO4D 4K3JH 1EZLA 2Z31C 5CINL 1BMWA 4MXVF 1A5FL 1J5OL 5CZKA 1F56A 1GZQB 1ZTXL 2AV1A 2BLFA 3KGTA 4QXGL 2PPEA 2G5UA 4LL1A 2Y1YA 4ZPTA 3OC5A 5JIDA 4NNXA 2NY0D 4K23L 1NBYA 1G9NH 4N5ED 1WT5A 3WU1A 4DKEH 3H9SB 1IEBB 3EYFB 4K94C 4OLEA 4JPWL 2ESVA 4HDIB 2Y07L 1BVKB 3GS0A 4MQ7A 2XPZA 5EO1B 5JW3L 3EXLA 3ARGC 1WO2A 3DGGA 3KGUA 5EUOA 3ASOB 3WDJA 4M3JA 4NRYB 2OQJB 4MS6A 4WFGD 1FHNA 2HAZA 3GM8A 4JRXD 3WTXA 4FDWA 3MLYL 4U4IA 5AVXB 3WEMA 5T3XH 3CVCA 5C0IB 2HFGL 3P40A 2JCCF 4X9YA 3B9KD 2A9NL 1IM9B 4LCWA 1DVZA 4BWTA 1DL7H 1HEZB 4P5TA 3HC4L 3TJHD 2YA1A 4I7ZC 3EYUH 1TEGA 3O6LL 5T33H 2V2TA 3BXNA 3Q0HA 2H32A 3LKPA 4WEEA 2DY2A 3BJLA 3DUSB 1NBVH 2P5WB 4FLOA 2F1AA 1C16B 5I8KH 4X5WB 2FX9L 4X7TB 3EFFB 5LAPA 4YBHA 5C9JB 1QSFE 2QLVB 4OIAA 4KC3B 4ZUWA 1JZ2A 1Y1DA 3JWNC 4IBSA 1K85A 1QBLL 4L1HA 4QJ3B 4AG4L 1HIMH 2WBJB 1I7ZA 3B37A 3L3KA 4NFBA 4PJXB 3DV6B 4YC2B 3KWUA 2LVEA 4LAQH 4MJ6B 1M4KA 3RZCC 2YKLL 3MRQB 5AZEH 2Z35B 4Y19A 3HBPA 3V4VB 4EVNB 1X5IA 4B9YA 4K7FB 3MGAA 3VI4B 1NEZG 2OSLA 3CFBB 4MAYD 3HCVA 1CGYA 1OT1A 5KSBF 3AM8A 2IDSA 1F4XL 3WY3A 1K8IB 1P4LB 2NSXA 1SEBB 2HWZH 4YDIH 5F9WC 5ESQB 2R0KH 3I50L 4WAFA 5LWYH 3GGWB 1A7QL 2HN7A 4H1LB 4K8RL 5EEYA 5HHVH 3DPDA 3QEHA 5F7AA 3F58L 1A6AB 2YD4A 1MCWW 1X7SA 4PJ5D 1S9YA 2WUBL 3II1A 2FIRT 5EO0A 1T7ZA 1PZDA 4H13C 1BQLL 2NY0C 3K3QA 5DWUH 2ZPKH 2ZXGA 4P99A 4N25A 5CKAA 3BQUD 4A68A 4TSBL 4JG0L 3HRZB 2F2HA 3BPCB 3MRBB 5C0BE 1WS7A 3GRWL 1P7KB 3TO4C 3L4CA 4J8RA 3UO1H 1BVLB 2C9PA 4LEBA 4NM8L 4V1DA 3LKQB 4JO2L 2J20A 6CGTA 2WZAA 3ECUA 2PYED 4FXGC 4QT5B 2WNKA 4NOFA 4N0UA 4R7XA 4XB8A 1K3IA 4OM1H 2EH8L 1N64L 2VDLH 1NFIB 1R3KA 2X28A 1YEKH 4JQIA 4CN1A 3A6BL 1MFEL 4JRYE 1LO3H 3OG6B 1C5DA 1GRWA 3D2UB 3E6FA 2FJFB 1PU0A 4Q7DA 5D70H 3UZQB 1RURH 5ERWA 3QDMB 1AQKL 3GF8A 4HKBB 5T1LB 3IK2A 4OQTH 3T4AA 2EEXA 4TUKL 3QUYA 3RL1A 2CGYA 2Z8RA 1F11B 3NA4A 3NESA 4PW3A 3VFMA 3MRLA 4YUEH 1JFQL 3PNRB 1H3VA 4JHAL 2A73B 4JKMA 1T0MA 3BWAA 4M1DH 4JANB 1NC2B 3I9IA 1MCWM 5L2KE 1BM7A 5DLMH 2J25A 4ZX3A 3EH3B 3FB5B 4AEHH 1T2QL 4FEMA 4Q89A 3H54A 4K7PL 4X4ZA 5HDLA 3JV6B 1X5HA 2P48B 4R96A 1ERNA 4PRHA 2UY6A 4YO0A 2OMYA 2F54D 1TZIA 3VXOA 1F0LA 2V7HB 3QCUH 43C9B 2CMRH 5K1JA 5EU7C 2I7OA 1KB5B 4U6HB 5DQDH 2D8KA 1KNOA 1ZHBB 2NX5B 5D2LE 43C9A 5DUMH 3IB4A 3CDYA 4AW4A 4EXKA 4WWPA 3ZSSA 3HI5L 5DHMC 4X7FC 1KZYA 4PCTA 4E0RA 1BWMA 2OMYB 3LZFL 4M3KB 5EUOF 2EE9A 2VDQB 4M7LT 4GAYA 1IL1B 2LHAA 3OPZL 3TNNA 5HHNB 3VI3A 4XP9H 2O61B 1HSBA 3SY6A 3PWPA 1THCA 4HEPA 4J6IA 3P30H 4XNQB 1JZ8A 4G82A 2IWGA 1FZOA 2OMXA 1YEJL 1E27B 5IP4A 2Y2YA 3DXAA 1NAML 5HGGS 3VFSB 3NP4A 1FVDB 4RMTA 1DBML 4IKJA 3EO0A 1TR7A 4BZYA 3BAEH 4XGZA 3VD4A 4HK3J 4AYGA 2AJ3B 2VDMH 2CM6A 4PJ9A 2VLJB 4E5XA 3UMNA 4QRPE 4WSGA 1IKOP 3B4NA 4ZFFB 1TJHL 5I5RA 3PUCA 2IADB 4JO3H 3BP7A 4IGBA 4TRPH 3MXWH 1X4YA 2F53D 5IOPA 2YPVL 4FTVD 4KZEL 1KV3A 1FN4A 3GO1L 4IRSC 3EYSH 4XMKL 2I60L 2RHEA 4Z77B 1DLHB 1JMXA 2AXFB 2P8LB 1DANU 4A37A 2EUZA 2G3ZA 4K5LA 3SGEI 4HLEA 4U1NA 3GO1H 4L37A 4UDTA 4TV3A 3MLTB 4KTDL 1CT8B 2OMVB 3IPFA 4KPHL 4AWJC 3OMZA 3U4EB 4YFDB 3GSOB 1XHHA 1IM3A 1DVYA 3T8VA 4W1TA 2CUIA 4OTXH 1VACA 1KCVH 4WFFD 3U25A 3WLWC 1TETH 2OV0A 2EADA 4UYQA 4CBZA 2H1LM 5FDWA 2DQUL 1U8LB 2N7AA 3QI9B 3ZGHA 3VFTB 4JAMB 1ECYA 1FZJA 2QPSA 1JRHL 3V0DA 2EABA 3RL2B 2L7EA 5C0NC 5DEFB 2R56L 4MSWA 4FYQA 4ZI8A 2Q86B 4YE4H 1OSZB 3D12B 2NQ3A 5EZLB 3SIKA 3WGVB 2QQNL 3ARBA 2Q3ZA 4FG6D 2ZCKH 1U8PA 1KMGA 1KTJA 2WLNA 3AUWB 1YEGH 2OLDA 5I1LA 2OS7A 2Z92B 3SDYL 5I30L 3L4VA 3WAKA 3L16A 2JK5B 1FAIH 3NMEA 1W80A 4HH8A 4K7FA 3HVNA 4LFHD 3VI4A 2X3CA 7TAAA 4KZEH 2AEQL 1RUML 2LABA 4MJ6A 1IIIA 2YAOA 1MI5D 3OJVC 2DMGA 3VUAA 2K7PA 1GY2A 1JNHB 4ZAKA 3TFKD 1WHOA 2XA8L 5SWSB 2P3YA 2WXMA 3PWLB 1WFJA 2AQNA 2WIIB 4O2CB 1BZQK 4WWKD 3O3EB 2V2WA 5DD0L 1CXHA 1PLAA 1HL4A 2IANA 1OSZA 4N2DA 4Z7VF 5D8JH 3BZEA 5IQMA 2XA8H 5DEFA 5FUOH 1T5KA 2OR7A 5EU3B 3NTCH 3RL2A 2F54B 2XQBH 1T0NA 3DRQA 3MRKA 2K9UA 1GJIA 2R1WB 4TUKH 3T1WA 3ESVF 3TURA 4KRNA 3N04A 3UYPA 3ZUCA 3MV7A 3RWDA 4OLXL 1IC0A 1ZLEA 5DUML 5KOMC 3X1FA 1MLBA 2C3VB 3JWNE 2XIIA 3ZDYE 4Q9RH 4OZFG 1Q72L 3IFPB 3SQBA 1NDGB 3A6BH 5TE7L 5EUOB 5IG7A 3SDYH 4OZHE 1OB1A 3MJ9H 5DUBA 1JGVL 1DFBL 1H0DB 4MXQD 5GIRB 4U1NB 2WUCH 3H7LA 3TJPA 3U4AA 4I2XE 1NBYB 2R9HC 3EGDB 4JG1H 1NGXA 3HFMH 4YDJA 4N2OA 4M8UA 4J2XA 4EZKA 4HZLA 4R26L 4PY7B 3IFLL 4TNWK 1QRKA 2AV1B 1JZFA 3LH2H 4ESKA 1JRHH 5IHUH 3T6WA 2VISB 5DLML 2CSPA 5T1DH 1QFPA 2D7TL 4IU3B 3C8KB 2P28B 4MQXC 1OD7A 3APCA 5DCCA 3K5SA 2C8NA 1RUPH 4JKNA 1EV2E 5FYJH 1MXGA 4N8PA 3FB7A 1DEEB 1DVSA 5I73B 4WTQA 4YDVA 2Y7SA 1FFQA 3UFIA 3FJTA 1TKWA 4HIHB 4P5MB 4DVRH 3N44B 2VYRE 2QSQA 3WDHA 4YL4A 2RALA 4CVZB 1FZOB 4AGMA 3RJQB 1ORQA 4KK8C 1HSBB 1DQTA 4UM9B 5DO2C 4N0UE 4D0BB 5HYSA 3DARA 3Q2NA 1EZUA 3JVGC 2JB6B 4D2NA 2ENYA 3Q6FA 3CSTA 4DQOH 3ARPA 1QSZA 1R3JA 1RHFA 4Z7NB 4PM1A 4RMUA 1JOIA 4F3FA 3WE1A 1MW3A 1ZPLA 3W81A 3CZKA 3VXOB 3TASA 1DVFC 2YAPA 2OL3B 1A3RH 1IX2A 2BOCB 4J12A 3U0PB 1J9RA 4DP0X 1AGFA 4RESB 1CFSA 2A9MH 1G6RA 3RB7A 2ZF9A 1TCRA 3PXLA 5JR1L 2OMUA 1ZA3A 2O1AA 4F7EA 1NGZA 1MCPH 3QQ4A 4R2GB 2NX5E 2OMBA 2XZCL 1U8QB 5D2LB 5E95B 5AENA 1HHHA 3GSNB 5DFVD 1AGCB 1QASA 3LQAC 4U2ZA 3SHSA 5BV7L 3PU7A 2PWHA 1FO0A 4NENB 4G8IB 4Y4FB 5CKGA 3VX1A 2XWRA 3GLDA 3RVVD 4Y5VC 2JJSC 2ZJSL 3NRQA 5I9QB 5BOZG 1QKZH 4QF1A 5ERWB 3SDDD 4TVPL 1MWAB 5D5ME 4MB3A 4A2HA 1DFBH 1XD0A 3SY0B 5HHQB 5IW3A 3H9ZA 2X4RB 1EHXA 4LQFH 3MLRH 2ICEC 3ZT5A 3FSZA 4K23H 3VXRD 1E50A 4EI5D 2ZTBA 3KLLA 3OV6A 4HFWA 3MLPA 4NO2B 5TE6H 2AITA 4AVHA 4M62H 1WAAA 4FTVA 4P05A 4NAMA 4DCQB 1OGTB 3CSYB 4M5TA 5GRJH 3SQOH 5ITFB 3V4UL 1XB6A 1G5GA 5F89B 1JZ7A 4UUJB 1HS6A 3EIFA 3SGDI 5KVFE 5F7DA 5HJBA 3ILQC 2CHNA 4IOFD 2HFGH 4DCQA 4P3WA 3N50A 2CRZA 5B1AB 1HYSD 4QTHB 4AIZA 2H1PH 1GXEA 2C1PA 3GI9H 2A6IB 1M9SA 5KVEL 2BVUA 3JVFC 2DQIH 1N8ZB 4JFWA 4OCSH 4GSXA 2ERJC 4NEHB 3WHXA 5B1KA 3VG0H 1SUJA 1SRDA 1VGKA 2APXA 2K70A 2Y5EA 3GJFB 4JFFD 4PJGF 4TNEA 4PRBA 3S35H 1H8NA 1OT4A 4LHUG 4YQXL 1P4UA 3BX7C 4KJQC 2NYZA 1DQJA 3GXDA 2GHWB 3CH1A 3LIZL 2P49B 4AXWA 2H2PD 3OM3B 4PRAB 1K5NB 3TZVB 3UPAA 1EHLH 3HCVB 2OSLB 3CFBA 6PCYA 3BSZA 5GZOC 4PH8A 2J88L 1BGXL 1EXHA 1UJ3B 3D85A 4FNQA 3CC1A 1R0AH 1UWGL 5D2LA 1UB6A 3H7BA 4MA7H 2C1OB 4PRHD 2ZNWA 1HKFA 4G8GA 4XBGB 3VXNA 3JWOL 4GMTH 4M7KH 5CEZH 4MJ2A 4UT9L 3WKNA 1Q0XL 5C0GB 4HZ1A 3V4UH 1MVUB 3GJFK 4C56D 1E3FA 1WFMA 4X5WA 1DHKA 4QKXB 3MJWA 4BH7A 2IH3A 4MMXC 2EIMB 3GMMB 4OFVA 5E5MB 1A9EB 2V2TB 4RMSA 1U58A 4GH7B 5FA3B 3CXDH 3GSRA 2B0SL 2WVTA 4FHKA 3RPIA 2QFPA 4PBVC 2E9JA 4LCWB 3LN5A 3V52H 1UYWH 5J6GB 5E99L 2XJKA 3NGBC 5DQ9A 3GNML 4MRCA 4J3WA 1JGVH 5D4IA 1L9NA 3RDTB 2ITDB 3HC0B 4JR9H 1NFDE 3I6KB 4H5SA 4ONHA 4OZFA 1UA6L 2YQGA 4NQDA 4P2OB 1BJ8A 3GMLB 4ZUVA 4ZX6A 3NN8B 1L5GA 2B2XL 2XN9D 4HJJL 4ZSOA 1FZMA 3UBFA 4NRYA 4I3GA 1G9MC 2FEDD 4PUBH 2WKOF 4CVZA 1CPUA 3LEVL 3L3DB 1BLNA 2IQAA 4XCCH 1Y0LB 1E6OH 1H6TA 3AREA 4IHBA 2EDQA 4N2KA 2MCG1 3FB6B 1WK0A 3KPQA 4KBPA 1V10A 3VRLF 3BAEL 2WLJA 2A6JA 4PRIE 2CPUA 5AALA 1MJ7H 5I8OL 2WZ5A 3KVPA 5ADPL 2VISA 3WG7B 1NBQA 4G3YL 1FF5A 3N2JA 1E4HA 4F37F 3OB0K 1CBJA 5HVFB 2R2EA 3DSNA 1RJZA 2F53B 3KCWA 3MV8D 4HIJB 4IRSB 3HLAB 4JN2A 3VSVA 7FABH 1SPDA 2VJ0A 3L1GA 1XGYL 2HYMA 4TSAH 3QRGL 3CFCH 4XVTL 4U1LA 5DYOA 3AREC 3I02A 3CWGA 5CM1A 2PXYC 2NXZC 4XP1H 3T6XA 4NKDA 1UJ3C 2PO6C 4KUCD 3D0LB 3MJ8B 3TLRA 2R0KL 1TO5A 3O11B 1ETJA 4ZFOA 3A6CL 2E5EA 3UYPB 1IARB 4NNPH 4BQ8A 3AG4B 3I74A 3RVUC 3KHQA 2HX9A 1RKRA 1FYTE 3KNBA 2P8MA 1WT5C 4QHKI 3HG1E 1DBJL 3GSVA 4KI5C 5EBLB 3NFSH 1KGYE 3RA7L 4XNXL 3FTWA 3SPIA 3VXSB 3ARGD 2QVTA 1CDUA 4JN1L 3HZ3A 4PJ6A 1VF5C 2HKFH 2X4QB 2P7TA 1AQMA 3DX1A 2V2WB 2BNQD 4GS7B 4OGZA 1CK0H 4LSDA 5T1KD 4IK7A 5LQBH 2VQTA 3PWLA 2BMKA 4PGCB 3JV5A 2BCKB 4QCIA 1SXBA 3AW5A 1QFWH 3ABMB 3SO5A 3IU3B 2UWEE 2F6AA 5DFVC 3ZTCC 5E2UL 1E5CA 1MIEL 1RIHH 1F1AA 3HAEA 1NMCB 2PO6A 4F33A 3SDAB 2YUZA 4HIXL 1QPXA 2QMJA 3FQXB 3BMWA 5SX4I 2BWQA 4JE4B 1BHGA 1RZQA 5HYJD 1TQCC 1INEL 3QE5A 4CSPA 1HCVA 5JPMB 3PL6D 3EOYG 4JRXA 2J5LB 1N7MH 3VXME 3LZPA 1P9MC 4BZ1A 3VGAC 1F4YH 4L8DB 1A6UL 1WG3A 3KJ6H 5E8NA 3NP3A 1QQDB 2AQ2A 3GXNA 3CXHK 4Y1TA 3O4LB 4PJ8C 5KZCB 1JVOA 4IKKA 4EI6A 1FNFA 1JGDB 3PCYA 4G5AA 4LOVA 4U7MA 3NJHA 1I8KB 2E0PA 3BE1H 2GT9B 5G5DB 4L3CA 3SJVE 1E9QA 4MAYC 1EJOH 1KBKA 2XY1A 1ITCA 4J6RL 3FUDA 1MDTA 1N4XL 4RA0C 2IAMA 5J89A 4E9TA 2QV4A 1RL1A 4J3VA 2EDDA 3GRBA 1U6AL 1FVCB 3C87A 4IOSD 1ROWA 4YGVA 4JFEA 5HHPA 2WBJD 3TH4T 4GP4B 5I9QC 5FXCH 2UVEA 1RSYA 4ZUTB 5I2IB 4R5TA 2Q9OA 3IWUA 2F8XC 4WI3A 4UB0H 5D5MA 1SJEB 5CILH 1JVLA 1MAMH 2OYLA 4PJ7A 3L95B 2FNWA 4MHHI 3BSZL 3IWVA 4RX4A 4Z3EA 5EF2A 2D7MA 2YPLB 3O0RH 2ZCKL 4KGLA 4JDTL 1QSEB 3UAJA 3FULA 2ATPA 5KYYB 4DVBA 5CBEB 2WLIA 1CXKA 5D5MB 1A25A 2AJ3A 3HN3A 1QABA 3HMWH 1H9DA 4PRPB 2MCPH 3KYNB 1VCAA 2GCYB 4Y9FA 3NZHL 1IEAA 3UZEA 2HUHA 2JSFA 1TYEB 1KXTB 5IVNA 1R3IL 2DBJA 2WP3O 3GXTA 4L8BA 4OGYH 3E3QE 2CA3A 3NJJA 2IH9A 1ND0A 1X5JA 3SD5A 3SPJA 1N6UA 4RA3A 3VXUE 1ASQA 3FT1A 3TNNB 5HGHA 2X2IA 1E9QB 1TTCA 3WN5C 3QJFA 4BH8B 5MEOA 1IQWL 1AHWB 3HE7A 3QRFM 1RUQH 2KHAA 4KKRA 3LHAA 4NPYB 1N0LA 4P0DA 4NO0A 1FH2A 3KGRA 1HXYA 3SQRA 2EUXA 2VLLB 3VQMA 3X1BA 2J5LC 3KPMB 2I60H 4OZFH 5F3HA 1A14H 1U8IB 4B9CA 1T2XA 2WZPA 3ZZQA 1THAA 3VFVA 1B0WA 3DOSB 1IC5L 4NQED 4AL8H 2A6DB 1QRNB 3UP6A 4ABUA 4Z7AA 3DDGA 1TQBB 3T2NL 3MOBH 5GRWA 1EJ6A 1XSOA 3VTTA 3ARZA 5I6LA 2BVOA 3H53A 1M53A 3ZKQD 4H44C 2NQDA 1KCUL 1TMCB 2XZCH 2Z34A 4OLZL 4AENA 4I89A 3ZDYB 1WS8A 5IF0A 1OCOB 1JERA 1N12A 3L9RA 4UIMB 1JDCA 3GI8L 3IPBA 3VRJB 3HE6B 2IV8A 5KW9H 2VLKD 3MRLB 4QRAA 5FKAB 4BZ2L 1RZKL 2IDFA 5ISZA 4EDXA 3ULUF 2P7TB 1TZHB 2W80C 2WAHA 3QDMA 1KGJA 3TJEL 4DPRA 1IJ9A 4RDQG 1CLZH 2H2SD 3I6GB 1C5DB 3S36H 2GK0A 1NSNH 1FRGL 5G4MA 1OAJA 2X4SA 4TNVF 3RX7A 4WU7A 2IH8A 4O2EA 1ZXKA 3BSHA 3NABH 1PKQA 4LAQL 4RCAA 1PZBA 1TVHA 2ED7A 5A2JH 2AAVA 2J8HA 3D2TA 4NKDB 4CC4A 5I1GL 1DR9A 2CA4A 3EH5B 3QXDB 3KR3L 4RGMB 1MWAL 1T2QH 2ESVE 5DYOB 2OTUA 3FB8A 5B1CA 1NINA 1MCJA 3BUIA 1NC4A 2KQMA 4W93A 2HVJA 1D6VH 2Y36L 1NCIA 4Z7WA 4ZBJA 2FECI 4HIJA 2JJTA 4LESA 4YWGH 3ALWA 4NKMB 1CU4L 1JPTH 2B9BA 1RUPL 2FSDA 5FUOL 3LV3B 3IF1B 5LVEA 1OAXL 1EAJA 3H56A 1J5DA 3KYAA 4N0FA 3TT1L 3VFRB 2CH8A 4PP2B 3U9PL 5JIIA 5DJDA 3ZYIA 5T3ZH 1T22B 2YHGA 4K2UH 3UACA 1WVZA 1K8IA 1IBBA 2NCEA 1IQDA 1I9RH 5IMMA 1YMMD 4UIMA 4KKCC 4JM0A 1RIUH 1H8LA 4MNQD 3G5VB 2ZKXA 4O4YH 3RPKA 3V5DA 4HLJA 3OZ9H 3BISA 2FJHA 3N42F 1R6VA 4X9FA 4HWEH 2P24B 4X6CA 1PLBA 5E6ZA 4X4YA 1CDBA 2YEVB 2VSKB 1U8OA 3IKKA 3NN8A 5DEJA 4C8XA 1MKFA 2A6DA 2FD6H 3FBQA 1LQBC 5C9JA 2HPOA 1SYSB 4P2RB 1KGCE 2EDHA 2L3BA 1GH7A 2P5WA 3OKEB 4PGDA 4E41E 3LVTA 4MZ3A 4L4TE 2IMNA 4K5NA 3T3PE 2R51A 2R1XA 1NC2D 5D1QA 5JW5B 5KW9L 4FMVA 5ACLA 1Y1UA 5DJZA 5FX3A 3I2CH 4XH2B 1D5IL 1JV5A 4BH7B 4FS0A 4XI5D 3D51A 2FO8A 2VDKH 1ZEAH 4JVWA 3N43F 3T4YB 5EDXA 4NQVB 4G6KH 2WXKA 1CD1A 4QRRD 3S88L 4G8GB 5L4MA 3VI4F 2EDWA 2X1QA 2CXKA 1KOAA 4JFDA 1XTMA 2DWEA 1OGAD 5HJGA 2A4CA 3DGGB 3VFGL 1GAFL 3D85B 4F15C 2VDKL 1BVKA 4MQ7B 2BY2A 4NQXB 1SHMA 1LLAA 3HB3B 3KYNA 3G6DH 1FAIL 3H9SA 3RKDD 4X98A 5C0RH 3V0WH 1A6PA 2CO1A 3MV9E 4NNXB 5E0FA 4ZS7L 5EU6D 5I71C 1GGCL 3QHZL 4MTMA 2HPTA 3GXPA 3LKNA 1O5PA 5KBDA 1BVNT 1QEWA 4UZUA 2WB1A 2NNAB 1QLFB 4NT6B 3L95A 1VGKB 1YJDL 2W9EL 3CFNA 2KZBA 5DJ2A 3ENEA 2GG1A 3M7FB 3VD7A 4YH6A 1IAKB 1QR1A 1PG7H 3VDBA 2ICWJ 3NZUA 3RVTD 5IFJB 1FYTA 3O9WA 4FZ8L 4R0LB 1H8SA 5E6IC 4Z3IA 1QFUL 3MV7D 1VESA 3TZVD 1TQSA 1D5IH 1LE5A 1HH9A 1KJ3H 2ITFA 1S7WB 1VFBB 2JIXD 1G84A 4PJBF 1QZNA 3LH9A 4DOHE 5IROC 3RBSA 2CU9A 1AQHA 2VDOL 5ICUA 3WFCL 4BE6A 1YNKH 4GG8B 4EUPH 2VW7A 4ODVL 2H3KA 3ZE2E 3T8XB 1B0RA 2ZQKA 5E6YA 4P9ML 4FTVB 5GJTH 5IJBC 4PLKD 4B5EA 4G6AC 4ILDA 2L04A 4ZOCA 1ZSDA 4DPCX 5KYUB 5IBTH 4PJ7E 4P23C 1SOSA 1ZPUA 1II4E 2APSA 4G5ZH 4EI6B 1Z2KA 4X6DF 1NJ9B 2WD0A 3V0JA 3ARYA 3LD8C 1S7RB 3B8YA 3G6DL 1KTDB 2HRGA 4X7SL 3QUML 2P24A 4KK9D 4X6CB 4X4YB 5FR3A 2K78A 4AQOA 2WINA 2EDMA 3KXFD 5DHYA 4EN3A 2F58L 5JZ7C 3FOMA 4K3JL 4AITA 3ZMEA 4H20L 1HZLA 3FHEA 1QLEB 4NS0A 4LEEA 1G9NC 4XHJC 4AM0B 1DJSA 3MREA 1KWGA 4W9DC 3FQXA 2YAEA 3KCPB 3QR0A 1IKNC 4GIPD 5EO9B 3HAEB 1X6LA 1I7TA 5GZNA 2RACA 5C0CE 5IREA 3VXQA 1CF8L 2KC0A 3PDOA 2F0CA 3UABA 3NJLA 5KVFL 4G80B 4ZPVA 4KKAC 1AGEA 3MCKB 1QTPA 1DVFA 2FR4B 2XUWA 2VCOA 1WJ3A 1W8EA 2EIBA 1IBFA 1NGPH 3PY9A 2V7NA 2YEQA 5HDBF 1BF5A 4TNFA 2ENJA 4XWOC 2BERA 5AWNL 5GGRA 2F5BL 5BRZD 4Z7WB 2AQQA 4EN3B 3SCMB 4C4UA 1J0ZA 2Z4TA 5HYSG 4X0KA 3KWWB 2HVJB 3RY4A 1LK3H 2DL2A 1RVFL 4D8OA 1IGTB 1NCOA 1S7RA 4HF5H 5EZOH 3H9SD 5AAWC 4WFHE 4AT6A 5IJVA 2P4AB 1J8KA 3FCGA 4F9PC 1HI6B 1QMUA 4CW1A 1GOHA 1UM6H 5J8OA 4AW7A 1ZSDB 3DJRA 1NUDA 3CK0H 3PQYE 5D7LB 4XC3H 4F8OA 5ENWB 2BZ7A 1YZZA 2GTWB 4XVJL 4JZNB 4O2EB 1HSAB 2FX8H 4ZAKD 2DQGL 3L2LA 4L1LA 4JG0H 4YHOL 4TVPE 4B9KC 1CLZL 4NNPL 2AV7A 4BRJA 1SJHB 1WLHA 5F0MB 4HIEB 3B2UD 4PTTB 1GTFA 1NLBL 3M86A 3BKYL 3UZEC 4BFRA 1ACCA 1JGEA 5FFLA 1ONQB 4ZFZB 1CICC 3ZHLA 3BJ91 3T71A 5E2VH 4E9LA 5D2NC 3T3MB 3PF2A 4K8RH 3SPGA 2YMOA 1T1XB 5I1EL 4Y4KB 1ODAA 1MFEH 7CGTA 3WTUA 1OCZB 2VB5A 3A5VA 2WNGA 3DXAD 1UD8A 3RTLA 2AJXH 4B9ZA 4TOYL 5J11C 3SE3A 4XPFH 1PEZA 2Q76B 3QO0A 1YQ2A 4B9PA 5DRNB 4GMSH 3QUMA 3BDXA 5FPIA 1NMCC 2EIZB 2PNDA 4Z95H 1D2OA 4DUXA 4Q6KA 1H0DA 1AYOA 3QS2A 1BIIB 5D72L 3C12A 2YMXL 2ADFL 2DM7A 1T7XA 2MCPL 5G2NA 1BEXA 1E2ZA 1U8IA 3BUDA 5IVXF 2NY5H 4HQQH 3BUYA 3FS9A 3OLEA 1BZ9B 4QYOB 5L6YL 2X2UA 1RULH 2VSCA 3DK2A 4HH9A 4TMPA 2ZP0T 1CDYA 1TLKA 3F62A 4R7VA 2PW2A 5MEOB 5DWPA 4AZUA 5ITBL 2F54A 4N2EA 1JV5B 1UJTA 2XCMC 3KHOA 2R0WH 3E9UA 5E5LA 5AL8A 15C8L 4GYBA 1UATA 3VYNA 4NNYA 3K6IA 4RNRB 2FATL 1G43A 1RFDH 4XP6H 3ZDZF 4MAYB 3WN5A 1A2YB 5E5MA 4N2BA 1A7BA 4H8QA 1TOXA 3MMEA 1RH8A 4QHLB 2CZNA 5CGBA 3NACL 5F3BB 4P2RA 4UMSA 1GYWA 5SWSA 4PMEA 3ZQXA 3KYKH 3AGWA 2K7QA 3KPSE 1KELL 4JPSA 5KVMC 3BVUA 1AY1H 5CBEA 4QWWD 3OKDA 4PJFB 4QY8A 4YSSA 1TQBC 5MEQA 5CGTA 5K1NA 4XZ4A 4KXZI 3FQTA 3B2XA 5G4NA 4R5VA 4AQ1C 4LVHB 2I9LA 3H42L 4K5OA 4DKEL 3AAZA 1X5KA 1KELH 3VQLA 1PKQE 2LTQB 4TSCH 2G3NA 4JHVA 1H8OA 4TNGA 4XN8A 4I2XA 2QDWA 3UX9B 4DQAA 1MCRA 4XXWA 3JWDL 3MYJA 5FA4A 4PRBB 4WO4C 1C5CH 1A4KB 3G6AB 4YGVB 1NGQH 3BPNB 4GRWF 4N0FB 3C5SA 3O8XB 4QGYA 4JFPA 3RVWD 3VFWB 2V9UA 2AI0L 3TCXA 3EJYC 2OAAA 3ALXA 4ES9A 5FYLE 2EVJA 4KDTA 1V3LA 1XCTA 3N1GC 2Y22A 4BFIB 4AIZB 3GDCA 5DC2A 3S5YA 5LN4A 3IRCA 1KCLA 1MIEH 3MTXA 4NZ8A 1R0AL 2LOEA 5IGXL 3ULAB 5K9JL 2YA2A 3UAFA 5DMIL 1NC4B 3O6ML 3BN3B 5CMAB 4HGKC 4BFKA 2DF3A 1U2YA 3MA9L 5DJ8B 2YC1B 2HJFB 2GYSA 1CIDA 2OI9B 5DFAA 5LQBL 1WH0A 3GSNL 4W9GC 4PJ5A 1FBIH 3N41F 4XB3A 4UBDD 3FYIB 3QR1A 3ILEA 4L8DA 1WEJH 3P11L 4GQRA 4GPVA 1G9NL 4LQ1A 1EERB 1F3RB 4P06A 1ZV2A 1XF2B 4Z77A 4GAGL 2BFVL 2VN6A 3RTQC 4I5BA 4I3SL 1T5WB 3T3PF 4JL2A 3R1GL 4QF1B 2ZX5A 4KROB 5BQ7A 2KMWA 3S2AA 1MH5A 4CC0A 4YSUA 1AXTH 4Z0BH 2Y7LA 4ZW6A 2CNZA 4ZZFA 2A2QT 4G8IA 4NENA 4Y4FA 4W9LC 3HE6A 5HYIA 1AGCA 1FNGA 4PRDB 4WVRA 3AZUA 5JIHA 3IJSA 4IW4C 4UIKL 2XNAA 3C6LD 3A4DA 5DR5L 2OK0H 1I8LC 2GY7B 4YXHL 1F4AA 1F58H 4FA8A 4OI9A 3FCTA 3LS5L 3UAJD 4J1UA 4LQFL 1J9CT 1KYDA 4WK0B 3RGVC 2A1WH 4M9OA 5FOBB 3MROA 1BQSA 2AP2A 4YDLC 3BYTA 1BA9A 2OL3A 4EBQH 1SBBA 3O11A 3RIFF 2LTQC 5I15H 2VLRA 5C6TL 3KPMA 1QW9A 1MCOL 4BYHA 4OU3A 2E7LC 1AACA 3ZHNA 5LCVA 3QIBB 4ZZKA 1O7VA 5GS0H 5EEWA 4HP5A 2CLVA 3IGLA 1GMEA 1Y18A 3MOAH 3MRCA 3LS4H 1PJ9A 5DDHA 3US0A 3HE7B 1AHWA 5AKTA 1XGYH 5EHFA 1DZ0A 1BM3H 3QNXB 1ZSHA 1JXJA 2WQRA 3KDPB 5DRWA 5TD4A 5LGKA 4G1EA 1AGDA 1EBAA 1U33A 4BKLA 2DQHH 4YSRA 5IR1A 3R4RA 1HOEA 3B7TA 4O2FA 2X6UA 3NCMA 2WNWA 1CFTB 4P2QA 1DJYA 5KVGL 4J3OH 1DQLL 1DEEA 3ECBB 5K39B 3OKMB 4Y5XC 3QEQE 5FUZH 4F24A 3EFDH 3WE6A 1CXFA 1FJ1A 3HAEG 4HUMB 1J1OL 4APXA 1N6QL 3QUKA 5F7FA 1UUSA 3QUXA 5I6PA 2DQFA 5LGHH 2GPZA 2BNUA 1L9OA 2J2ZA 2WTPA 3L3OC 3RL1B 3RWEB 5C09B 3C8KA 4KI5F 1AKJA 3SGKC 2FWUA 2GAZA 1UXWB 5C6PB 2PPDA 1OTTC 3PP4H 1CF1A 2QQKH 4L3EE 5EWIH 3QUMH 5J7CC 3SYPA 1G7QB 4FXGA 4KVPA 5FW8A 1F4WL 4WI6A 3L5JA 4ZFQA 5J0BA 3HI6H 5DC4B 5D4HA 5I1HH 1N3NB 4D3CH 4JKWA 4MDJA 4R5XA 3X1EA 1BZ7A 4NOBA 4WHYG 5HGAA 5FO8B 4OCRL 4NQDB 4KROC 4NCDA 3WXVH 2WYTA 1BVLA 4QJ5B 2XI9A 5J56B 2VKXA 1P7KA 5DS8B 4NQCA 3UTSD 1QR4A 3TCTA 1PTZA 3TM6A 4ZUSA 2DLHA 3VSQA 1TTFA 5FGBA 1Y6MR 1H6UA 3O3UN 1A9EA 1SY6A 4QHUB 4XHJD 1GR7A 2QPUA 4CGTA 4OCNC 4UIKH 1XAKA 3MRKB 4P5RA 3SDAD 2AVGA 1YUHA 2QV2A 5CSZA 1JGDA 3HZKB 5SWZD 3BZEB 3O4LA 3QEHB 3LXUX 2W9EH 1AXSA 5F7MC 4MA7L 1UB6B 3AM8C 5FWQA 2VXQA 2J3SA 2XG5A 4EO5A 1AKPA 1JGUL 2WZ0A 3ZO0A 3WNJA 2JLPA 3F00A 3GK8L 4FXKA 3OL2A 4Z7QE 3L08A 1QACA 4ELKB 4XBEL 2F1BA 4G9FB 4ABWA 2DM3A 4PJBB 3MXWL 2Z1PA 4YOKA 5K59E 1KLGB 1HL8A 4KQ3H 3NVQA 2CIIB 3ULVE 4F33B 3QWOB 1KN2L 4W4OC 1F6LL 4QAWA 4PTUB 3RZCB 2ROYA 2WLKA 4OD3H 4FHJA 3GSNH 4LCCC 4KUCF 4QRBA 2JE8A 1GYAA 3Q5TA 4G42A 3VTMA 1I1RA 1C5BL 4ZQKB 5GGQL 3F7RA 4LEXL 5I1LB 2XTJB 2J43A 3FT3B 1H3TA 3C6SA 1DVUA 1YY8A 1HXMB 3NIGB 4H26A 3MLZH 3D4CA 5L0QB 2BS9A 2N59A 3CVBA 3QK0A 4HISA 5CSZB 3QO1A 4IJTA 2Y24A 4HK0A 4MB1A 3GSVB 5E1QA 3VSUA 5JYMA 4ECNA 4RQQB 3RHWK 2XYCA 3SCMC 1IM9A 3L9BA 3W9EA 3KNBB 4AUYA 4F8NA 3VFTA 1MFDH 3L3GB 2YARA 2DYRB 4KKCD 5JLZA 4UNUA 5ID1A 4M62L 2H1XA 2XJLA 4FJ6A 4LSQH 2DIBA 2FWLB 3V9FA 3EJUA 4KKZA 5JDSB 1OARL 2VJ8A 1IUZA 1ES0A 2A9ML 1FL3B 2B7DT 2VDOH 5DA0B 2CJSA 2R23B 1L0PA 5BS0A 1KJ2H 5EO1A 2H7WA 4PI0A 1YEGL 3MRFB 3UBGA 3VMPA 1RZPA 3C09C 1MFMA 3Q2LA 3SY0A 4JQXA 5C86A 5HTSA 3B3BA 2FB4H 1SBSL 1E2VA 2F74B 2HB0A 4H8WL 5LJYH 2RH0A 5GZND 1BD2A 1CDIA 2RQ8A 4RZCB 3WFZA 3Q8EA 3IU4H 2IBZY 1MFAH 2ADIB 4UT6L 1F41A 2IADA 2C34A 4KQ4L 3TEWA 2HRHA 2IAMC 1FFOA 4EAEA 2PWEA 4LVNB 4AGPA 3QQ4B 3UTTE 1IJNA 3NH7H 4PJ9B 3FPXA 4JG5A 3V95A 3UXFA 3IMBA 1ZGLM 3K6DA 3RWJA 3GSWA 2YXFA 4NQSA 1L6PA 2YXWA 1F8TH 2QADC 4F5CA 2DBLL 2NR6D 4LCWE 2XKUA 3RQ3A 3FUJA 4ZMLA 5J11B 2DWYA 2PPFA 1OE2A 2ZKHL 4A2LA 4H0IA 5GZOA 5DJ6A 1Q1JH 3MCYA 3MCLH 2JKIS 4F27A 2CIKB 3U2SB 25C8L 3RB5A 3BRFA 4Q2ZA 2JI2A 2N01B 5D96C 2A74B 2ISDA 1QSED 1C7SA 1BOGB 2AQPA 3EFDL 3VGBA 3PHAA 5JO5A 1OW0A 3BD3A 3GZPA 4PJGE 3MNMA 4WO0A 3RDTA 5IJCC 1BBJA 4LU5L 4U3HA 1QUNB 3GMNA 2DQDH 2VRQA 4H4NA 1IGCH 4TLTA 3HMXH 4FNRA 5IHWA 4GUOA 4NHCL 5I74B 3WL9A 2CM5A 1WBYA 3FRUB 4X7DC 5H35B 1YLBB 1GCYA 1J0YA 2IXQB 4OSUL 4XP9L 1EXUB 3T2LA 1A9BA 2IH3B 3NCJL 1YC8A 4I48A 4OH2A 4XNYL 2GUOB 2EDNA 3VWJC 4FGMA 3MVSA 5C0GA 2WUBH 2EDBA 3RWJB 4XNMA 3FB5A 3SE4A 3KBFA 4XNYH 2VERN 2DIJA 4JQVA 4WO4A 4NM4L 1CFNA 2VXTH 1TQUA 3DURB 1FC1A 1HHGB 4G43A 5AWNH 4TNWF 1BXAA 1T7WA 5INCB 2P8PA 3WHE0 3BWAB 1T0MB 3VXRA 3IMSA 1SLUA 2CRYA 3R19A 2CLZA 4ZG1A 4IBUA 2OL3L 3QUYB 4AL8L 4JK0D 4UDUA 5B3JF 5H37A 2PXYA 4DJMA 4OGAC 2E27L 2Y7QA 3NRPA 4XAKE 4W68A 1C1EH 4YXKL 3E6FB 3UZQA 4AQEB 2PP8A 4N4YB 1G7LB 1CCZA 1JHKL 1LP9F 3X3GL 3MRFA 1JI1A 4C83A 4JY4A 2CWRA 2PPAA 4M1DL 2AEIT 1VEMA 1LE9B 4QXTA 2NY6C 2X40A 4YHLL 1W0YT 1LO4L 1Z9SB 3KPLB 3QXAA 2JKSA 4O51A 5I71B 2VWEE 1A6ZB 2MNUA 1D5RA 1AXTL 3S48A 5B8CB 2FQDA 3RWDB 3FSOA 1PZUB 5E6SB 5AEAA 4H7VA 3VMNA 5DLLA 3T5WA 5G55A 1SY6H 4U1SB 5FO7B 4HXBH 3EXJA 1I8LA 1YEWA 4WF7A 1OCCB 5I0YA 1JFQH 4Y5XB 4ONOA 4UUJA 4Y19E 3A0OA 4QHNA 2IANB 3NIDE 4H0HB 4WJ5A 5JYLA 2OSWA 4OF8A 5DD0H 4HFUH 4IMLA 2FGZA 2XKSA 4NO2A 3IS1X 1FBIL 5FYJU 3ULUD 4NJAL 5EBWB 3H2WA 2WBJC 1NCAH 3K72B 4LPTA 3SE8L 3IN0A 4KRMB 1IKNA 3LMJH 2E7BA 2JKTM 1X5GA 3FFDB 4ZTOL 2E7LA 5C7XL 2VLKB 3PHQA 5AOMA 3C08H 3GIZL 2CCVA 1YQVH 3TA3A 1JF5A 1RUMH 4FERA 2W0FA 3OR6A 3CZNA 2NZ9D 4NGHH 4FFZH 4RETB 1YJDH 1HQ4B 3MRQA 5D2NA 2XG5B 5GRZA 5IY5B 5EU5B 4S2SA 5B1BB