5LXVA

Crystal structure of ruminococcus flavefaciens scaffoldin c cohesin in complex with a dockerin from an uncharacterized cbm-containing protein
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
172
structure length
172
Chain Sequence
ETVQISASNAEAKAGDQFEVKVSLADVPSTGIQGIDFAVTYDNTVVTIDKITVGEIADTKAASSDQTASLLPTFDVSIQNSEGYSSVIWSTAVEDSSYWISKDGVLCTITGTVSSNAKPGAESPIKLEAVKRETYVGSGTDNSSISAGYSANDKAVKYTVKATNGKISVPSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Scaffoldin C
publication title Single Binding Mode Integration of Hemicellulose-degrading Enzymes via Adaptor Scaffoldins in Ruminococcus flavefaciens Cellulosome.
pubmed doi rcsb
source organism Ruminococcus flavefaciens fd-1
molecule tags Protein binding
total genus 41
structure length 172
sequence length 172
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lxvA01
2BM3A 2OZNA 4FL4B 4WI0A 1QZNA 3KCPA 5K39A 1AOHA 2O4EA 2ZF9A 4WKZB 5G5DA 4IU2A 4IU3A 2B59A 3GHPA 1TYJA 5LXVA 2VN5A 1OHZA 2Y3NA 3KCPB 2W1NA 2CCLA 3BWZA 4U3SA 2VO8A 3UL4A 3F2LA 2XDHA 1G1KA 4FL4C 5AOZA 2VN6A 4N2OA 4UMSA 2JH2A 1ANUA 4UYPA 4UYQA 3L8QA 4DH2A 3FNKA 1ZV9A
chains in the Genus database with same CATH superfamily
1IM9D 1RMFL 3T0ED 5EZPA 4ZNCD 1KNOA 3K8MA 4LE8A 3WEBA 2CRMA 3T0BA 3QEUA 5AKTA 5F9WC 1EAQA 2QVTA 1H8LA 1LVEA 3I74A 2X4QA 2IMNA 4LZKA 4BA0A 3RDTB 1B4LA 2OMUA 3ME0A 3L4UA 4M8RA 1W8EA 5CEZE 1HQ4B 3Q2CA 4ZO7A 4PJAF 4Y19B 5C0BB 1R3IL 5TPWL 3P9MA 3VFWB 3MV7A 4BWUA 4XNAA 4PM1A 2MPAL 3TZVA 5CCHE 3BP5B 4NUQA 1NBYA 2CALA 3KGSA 1SDYA 2FQGA 5I30L 5E4IA 3M07A 4NO0D 1Z5LA 2ZUTA 1TTBA 1HOCB 3CJJA 1TU2A 2AK4D 2WVVB 3DV6B 3DVNB 3EJPA 4PVMA 4YPJA 3UO8B 4ZTOL 3BGFB 4YXHH 1A02N 1LK3H 1P2CB 3FFDB 2JJUA 4N5UA 2WXIA 1HZHH 3U6RA 5LGKA 3NRFA 3JQOB 3LNIA 5CP7B 3LS4L 4YBQD 4G6KL 4H5SB 4O58L 5ABZA 4MNQA 4QRTB 1EGJH 2V9RA 1L9PA 3GGWB 4UMSA 2H7WA 3ASOB 3ALPA 3OKEB 3QPQC 1C08B 1TXKA 4IOFD 4JDTH 1UD2A 1UT1A 1UWXK 4N2MA 2EYRB 1JTPA 4OF6A 3BPOC 1KJVB 3EDJA 3PFQA 3RU8L 1E65A 1I1AD 4MX7A 1IKFH 2R23B 5C0AA 1FFPB 4ZMAT 3TEWA 5IQ9B 2YHGA 3K6FA 3WKNA 4J3OH 1WZMA 1DVFB 4KZCA 4LHQB 3B3BA 1UWEH 3ZO9A 3AY4A 1JMXA 2A6IA 3FT2A 4JE4B 4C83B 1HU8A 3LNGA 5IBUB 4AE0A 1K6QL 4M7ZC 3NYKA 4E9WA 5CCKL 2Y36L 3LIZA 4LKCA 1HKLH 2ZOLB 1MDAA 4FG6C 3UYRH 4AEHL 2TAAA 1AY1H 4FXKC 5CLTA 1K3ZA 3PWPE 1CG9B 1F3JB 1FL3B 2PXYA 1HCZA 2A77H 3U46B 2EECA 2ZT9C 4UM9B 1M7UA 2K45A 4P5TB 1AKPA 1AGEB 3C6LA 3UADA 5DWPA 1HL4A 3QGVA 4XXWA 3CVDA 4N2CA 4NEHB 2W9EH 3FTVA 4Q6KA 3QO1A 4KQ4H 4JFDE 2DM2A 1CFSA 1ZS2A 3D09A 3KYKH 3U30C 2OZ4H 3OB0K 3P4OB 3EF4A 3CVCA 4UQIM 2G2RB 1IEBB 3KHQA 1E67A 4PJXB 4R90H 4X9IA 4Z3JA 5ID1B 1DL7L 1OGTB 4LDOB 4M48L 3SO3B 3UXFA 2MIZA 1DJIA 5E8OB 2WTRA 4P57A 1I3GH 1B4JL 2GBVA 2OSWA 4OB5L 4FP8H 2ADJB 1F02I 2DEYX 2E46A 3QI9A 3S5ZA 3SDXA 2FSDA 4U05A 3WXVL 1IAII 4LSUH 1BD2E 4QYAA 3BO8A 2F61A 1HHKA 1RJLB 4Z3EA 2BK8A 3LMJH 2RQ8A 2DL2A 1P9MC 4EN3D 3GDBA 4M29A 4MWFA 1ZE3H 1QEXA 1A6VH 1T5XA 1XGTA 4X4YA 2A9MH 1CFTA 1U58B 3JVGA 4D9QE 1SMOA 2EDFA 1J9TA 2O5YL 5EA0H 2WBJB 4LSQL 5IVXE 1NKGA 3CK0H 3QJXA 1ZE3C 5EUOE 2FHFA 4KO9A 3L5XH 1KBWA 3FZUD 1G9NC 3QFJE 3MRKB 4TUOA 4KKBC 1A6ZB 1I9JH 5T1MA 4DK5A 5JHDA 5FV1L 3VH8B 3RVUD 1IQWH 4X4XA 2H6UA 3BSGA 3S5YA 3ZMRA 3VFOB 5F1KC 1JFHA 1J1PH 3PQYE 5EB9A 4G9DA 3QJFB 4XMTA 3U4KA 2XZCL 1F1DA 3ARBC 5I9QB 5HI3D 1IC7L 4OLWH 1KBKA 1RY7B 2ZKMX 5AAMC 4P59L 3ERXA 4PGEA 2BWDA 5CFHA 3F6JA 4PWGA 4ADIA 5JLZA 4U33A 4OCWL 1ORQA 2GPZA 3PYCA 2AEQH 3TCLA 3P2TA 5FA4A 4MD5B 3S8GB 1R24B 3V6OE 5SV3A 1C5DB 5HJDA 4MCZA 1N4XH 4M3HA 3M8OL 5C8JA 2EIDA 3EZJB 4FX5A 3VXME 3QJSB 3OC5A 5C08E 1YUHA 3P3UA 3TASA 2XWEA 4GW5B 1C8PA 2RALA 1G4RA 2D9QB 3MODH 4OTXH 1KZYA 1VZGA 4NYLA 4MJ6B 5CUSL 2A6JB 5LLIC 2WCGA 3GBML 5EIIG 4R96B 3D69A 1RZJC 5MEPB 5JW4M 1KIUB 4KRMB 4R7LA 4OZ4B 3PAYA 2AS5M 4FL4C 1I82A 2FZ3A 3TVMB 3BVWA 3VFUA 2WXHA 5CJXC 4FGMA 4NRZB 1SJVA 4PJDB 3B3IA 4AH2A 3NIDB 4U6VH 1DANT 1RUAH 5EU6A 4PRAB 1DO5A 5E95B 2ZNXA 5INCA 5SWSD 3V7AG 2J1ZA 2XFXA 1QD0A 2EYSB 5EORL 2JKRM 3WY2A 1T80A 4KTDH 2WO3B 5K59E 4CRPA 2R29L 4GY4A 2IANE 4A2DA 1EVUA 1NCCH 5HYJA 1A65A 2KH2B 5INDB 3SKOA 3OM3B 1NGWB 4YAQA 1ZGLA 1GMIA 2MSPA 5IFJB 4KNUA 3IU3A 4OZHA 3KWWA 1AD0B 5LXGL 4X4ZA 3E3QC 4E41D 4Z3HA 3T65B 3DUHA 5CR1A 4Z76A 2APXA 2YEVB 1QFWI 1RUMH 3DMMC 3SE9H 2C4FU 3G6DL 1G7MB 2I9LA 4DT2A 4IDJL 2EVFA 1T4KB 3AM8A 3RRQA 1XT5A 3UGXA 4JZOB 4BFRA 4NWUL 4HPOH 1UH2A 3ZTJG 4XCFL 4J4PC 2FJFB 4TULH 3OSVA 3QPQD 2F58L 1IL1A 1VDGA 2WXGA 1D2OA 4XVTH 3VFVB 1CU4L 4M43H 1KPUA 2E7HA 3JTBA 3S36X 3IJHB 2G3ZA 3L1EA 5IOPB 2GJRA 2CRZA 1GYVA 3CTTA 2NX5E 1QSED 5BOJA 2R0KH 3OPZH 4GAJL 2CGZA 3UTZA 1NCWL 2OULB 4RFOL 2DWEA 4N1EA 3KAAA 4EUPB 1BFOA 3GXTA 5GS1B 2XZQL 5LN4A 3ZX1A 1HCVA 4L3AA 5F70A 1A7RL 1B2WH 3NSJA 4FG6D 1J5DA 2ZP0T 1XFPA 3BT2H 4FABL 3VFNA 3ZT5A 2F8XC 3Q2WA 4K3JL 3LRGA 2CCVA 3O6FA 4D0BB 2UVEA 1AKJA 4Y9GA 3ULVH 4XBMA 3OKYA 2ZOWA 2DQEL 5I1GH 2V2TA 2HT4C 1OP3H 3MJ8A 3C60D 4LEEA 4NRXB 5EO1B 3IMBA 2AJYH 3EFFA 1KPVB 4KJQC 5T3XE 2XWCA 4PLKC 1B2YA 2X0VA 4KKNA 3ULVC 1X44A 4PJBA 5I1HL 2A2QT 3VCLB 1P1ZA 4HIHA 5EULV 3RHWF 2ADFL 3UG5A 2NNAB 2F9BT 4PJ5A 1NGZA 4P2RE 1FIGL 4XNZC 4DP0X 1BFVL 1HDMB 1YMMA 1F2XK 3O9WB 4X5XB 5SWQB 2BSEA 2F5BH 1NPNA 2FWOB 4NUJB 3HMXL 2I24N 3QQ4A 1HQRA 1PYWB 3BVNA 2UY7B 3JWDC 1EMTL 3VO0A 3UJTH 2EEXA 3K0WA 2KBGA 3NESA 4KKQA 3WE1A 2GK0B 3RIAF 3BWUF 3K3QA 2QLYA 4UIKH 2ENJA 4QHNA 1R5IB 2GJZA 4J6IA 3SPCA 5BVPL 3HNSL 3MLUH 4KNSA 3X12B 3OV6A 1YEIH 1LEKB 3X3FH 1E28A 2L0DA 1RZKH 3DWTA 2PW1B 2VR6A 5LGJA 5LB1A 2R9HC 4AIZB 3HI1B 3NEXA 1NWOA 2ZUQC 4EOWH 3O3EB 15C8H 3HCVA 1GGUA 5GZOA 2X4SB 4JHWL 2BVQA 3FBQA 3VGEA 2EIBA 5JHMA 3MV9D 4LSPL 1G9HA 1PJWA 4Y4HB 4JFTA 1RZKC 5G5DA 4KVNH 4B3VA 2VNCA 5EF3A 4WWKA 2H5UA 1I8UA 2V8LA 3TJEL 4KKBD 4BFIA 1RMFH 2XBDA 5HGDA 5F7AA 3AG3B 3F00A 2XIDA 1VESA 1YQVL 3PGCA 2YOCA 3F5WB 2UX6A 1TITA 2EJ1A 3CFEB 4Z7WA 4MKMA 2FEEI 4Z0BL 1NUDA 2X42A 3ARBD 1EHNA 1ONQB 4R4FL 4WTZG 4KAQL 1I7TB 3UTTA 1EFXB 3IDXL 2E9BA 4U7MA 1R3IH 4HUKB 5TPWH 2VL5B 4ORZC 2MPAH 4PGCA 1XEUA 5LG6A 3BUPA 5I30H 4X5WA 5D1XA 4G9FB 4D8PA 4K3GA 4ETQB 5BS0E 3GXNA 1I8KA 3ZGIA 1X7QB 2D0FA 5I23A 2FUQA 1JHKH 1PD1A 4WFGD 3HG3A 3LZFL 3R4DA 4L4VE 3OAUL 3L95B 2YPKA 3HN3A 3SEPA 4WFED 3GXPA 3NJGA 4G6KH 3D4GA 1AHMA 1DQIA 2YPVA 5EC1A 5FB8A 5KUKA 2DQIL 4HLEA 4MA3A 1JN6B 3RGVC 3HS0B 5F0PB 1H6EA 4ONOA 4GAAA 3ZL1A 2EYTA 3Q6FB 1W0VA 3II2A 4Q9CA 4PP2A 5F9JB 2WMPA 3WFHA 1UWYA 3S35X 1UXSB 3WEOA 1AAJA 1A6AA 1T20A 4LHUG 5JMOC 1RJZB 4K23H 5B38G 1W80A 4HJGA 3NIGF 4N8UA 3WFDL 1K6QH 3SGJA 2O61A 4WNQA 4CU8A 5K9JH 5DI8A 4Y5XB 2Y36H 5DHYB 4B9FA 5CCKH 1RUKL 3KNBA 3ARVA 4H0GA 3G9VA 3LS5L 2E9IA 4KROB 3NG5A 2Z34A 5LKNA 5KN5B 2HT2C 4Q9QH 2YD8A 2FBJL 3HC4L 3R1GH 4CN4A 4P2QB 2XQYK 1CGVA 3MNZB 1VA9A 2XYBA 5H2BB 4RX4A 2PPDA 1JPFA 5E6IA 1CLOL 3N41F 4LLYB 5K33A 3U36B 4APXA 3TXAA 2JXMA 1SLUA 4OZGE 5SWZB 3MUUA 4D9LL 4HV8B 2XU9A 3MRPA 3QH3B 3DMMD 3J07A 1QRNE 1UWXH 5D1QE 2VIRB 4PD4J 3RUGE 3L9EA 3ZT6A 1RXLA 1DN0A 1ODAA 4IM8A 4AXWB 4PWEA 2WLYA 1NMBL 3WKML 4TQIA 5FYKE 3VUAA 2EXWC 3JTTA 1ZK5A 3ESPA 3CDZA 3Q01A 4J4PD 3ZDXF 2IQAA 2X38A 3HRZB 5DQDL 4ZXBA 5I1LB 1TVBB 3FO1B 5EU3B 5HSFA 5IB5B 1P7KA 5EOCJ 4BRJA 4Y4FB 2V5RA 3WJLA 2Q76B 1FGVL 4KV5E 1HI6A 2BINA 5KSBF 2YC1B 4MD4B 1OTUC 3QXAB 1Y18A 2NYZA 5D7JB 3WE6B 4OB5H 4H1LH 3CU7A 5EWIL 2ITFA 3GRWA 4M93C 3AAZB 2Y5TA 3QEQA 4UINL 4W4OA 1N6UA 2VH5L 3WXVH 1RULL 1JGDB 1XB3A 2Z4TA 4IRJA 4M8QB 3WEXB 5KANI 2Z7YA 3IFOB 2YWYA 2MQGA 1AZBA 1ASPA 1M3IA 1NBZA 4LQFL 1KGYE 1QA9B 1FNAA 4B9YA 4LSSH 2VB5A 5K9OA 3FO2B 2OSLA 2FVNA 3HUJF 4FQ1L 4DOHE 2X87A 3RI5K 1H9DA 1WFNA 2O5YH 3CZGA 3L3KA 1OP4A 1PBYA 3O2VH 4RAUB 1F6AA 4X6DE 4ACPA 2HT4D 4LSQH 3CZFB 4A7UA 1E6JL 4JLRA 4KJQD 1HINH 2E56A 4KC3B 3I75A 5IKCA 2EDOA 4OV5A 1O75A 3GSRB 4C4KT 4PLKD 4AZUA 1XGUB 5JORB 3ULVD 4P5RA 4QRSA 4BRVA 5IMMB 2LTQC 2IMMA 3VX0A 2OMTA 1RK0B 4NCC1 2HT3C 4HQQH 3QB7C 3QDJB 5K9KB 4M4PA 4V1DE 2GTWB 3ESUF 1V7NL 3L3GB 4MCYB 4UQ3B 4GP8B 3TZVC 2KZBA 4RMQA 3N1MC 4QR7A 2XZCH 4JY5L 4P5MA 3K4DA 3WDIA 1IC7H 4NJ9L 3NCCB 2ADIB 5BZWB 5E4OA 3B6SA 2NXZB 4W9FC 2VR5A 4L3ED 1R4XA 5DF0A 1DUZB 1IEAA 3M8OH 3MNMA 3UAEA 1S8DB 3IVKA 4U6HA 5B39A 5DSCB 4O02A 4J3VA 3S34L 2DQGL 2R9HD 2EQDA 2Y4SA 3DVFA 2GI7A 4IGBC 2CR6A 1CGWA 1T5WB 2BSTA 1E4WH 5CEZL 4XP5L 3RX7A 4L1TA 5CUSH 3LN4A 2DQMA 4NNYA 5JOEA 5EO9B 2JV6A 1DCLA 2VXQA 1IIIA 3ATAA 3SGEI 3RWCA 3AY4C 1CB4A 4TTDC 1CC3A 5AW5B 3RA7L 4I9XA 3BJ91 3W0WA 4GT7A 1C5CL 3QR0A 4HPYL 4GQPH 3RIFK 2BLFA 1GIGL 3GMQB 5BVJA 5B8CA 3DJSA 4G8GA 5I8KL 1MI5D 4KU1A 1ZXQA 1FDLL 1EV2E 1U8QA 2NNCA 4OM0L 5EORH 1U8JB 1MRDL 2DM4A 2AJSH 3B9KB 4M4RA 5D7LD 1YCSA 1Q9LA 3BQUB 2R29H 1JPGA 3DX0A 1JVLA 2PXYC 1QSFA 2W65A 4RMVA 1UUSA 4FRWA 4XPFL 3TCTA 2AVFA 4TUJA 1IKOP 4N0UB 4GRWB 1S78C 3F7YB 3UJIL 5EZOH 2CDEB 2LU5A 3DJRA 5ENWB 5CGTA 1D7BA 4LNRA 4XMPL 5FWQA 2V7NA 2R1YA 4XO8A 2P5WB 3LVEA 3U25A 3B7RL 4LASL 3SPVA 1SPDA 3D18A 4UF7C 3P3RA 5T1LD 1MVUA 2H1XA 5DC0A 2YGNA 1D5XB 5KVFE 1XTLA 3HLAA 4A68A 4JHZA 3BVXA 3MAWA 1UQSA 1ZV9A 4NWUH 4W4NA 4E9LA 3RGVD 3CWGA 2GUOA 3HE6B 1LP9B 2CO6B 5GS2H 1ZA3A 3HOGA 3QI9C 4UQ2A 1U33A 3DX1A 3QQ9C 1GSMA 4AK1A 3IS0X 5D1ZA 5KYWB 3JBG7 1CDCA 2HJKB 2ZYIA 2YD0A 3CDGB 2ILLA 3PP4L 2B2XH 4N0RA 1H8SA 3I9GL 4PPTA 2Z35B 4OJEH 2ZWNA 2X10A 5GGTA 2XDHA 3REVA 3RTQA 4JN2A 2QGDA 4LEXH 1NCWH 4HDIA 2YXVA 1SJEA 3WFBL 5DA4A 1TOXA 3P02A 4A2GA 1A7RH 1AMYA 3ABLB 3QUXB 3S37X 2HT2D 1T1XB 4WTQA 1O6SA 1MREL 3QDGB 4PRPA 4WKZB 1JE6A 1E9PB 1TMCB 4XPAH 3SE8L 4WJ5B 1QNZL 1IFHL 1K5WA 1RSYA 5ELIA 3KCPB 5HGAB 2DAVA 2BZ7A 3JYCA 3CFIC 4ZUWB 5AYTA 3ZRFC 4NQCA 1RERA 1G43A 1KB5A 3RFZA 5DJXA 5LXVA 3IDMA 3VI3E 3F8UB 4YHLL 5LCVA 1EX0A 2E7LC 1PAZA 4L8DB 4PCKA 4RNRB 3P4LA 3FUIA 2FSEA 3LKPA 4WU5B 1U95B 4P3WA 4U3CA 3ZMNA 1IGTA 1UD4A 3GB7B 3X1NA 2EXWD 5F3BA 4O00A 3ARSA 3OKKA 2BOBA 4LF3A 3NP4A 1FIGH 1BZDA 4Q9BA 4YSEA 5B3JE 3QBTB 5E5RB 1G9EA 5HVHB 4HK0A 5EZIH 5AZEL 1UHVA 4I18B 2YMOA 1L4IA 5ESAA 2RTTA 2YD5A 1VLXA 2R0LL 3BYYA 1OTUD 2D7NA 3PHOB 3T2PA 3V95A 1EMTH 2F54E 3A21A 1R19A 1XO8A 4HEPA 5I6NA 1PZCA 2ZWLT 3PJNA 1W6LA 5B3NA 2ZXEB 1ZAGA 2A9NL 2VITA 5BVPH 5I8OL 3HNSH 1TKWB 4NQSB 4HCGA 3VXSE 2B0SH 1TMQA 2E4TA 3BD3A 5KS9B 1MAJA 4LCIL 3V5DB 1KJ2A 3EJUA 2QZ5A 4P23A 4D0DB 3F84A 2F53E 3M1OA 4EIGB 1NBCA 4CVUA 3W38A 1BW8A 4JHWH 2ZJSL 3H56A 1DSWA 4DEUA 4LSPH 3BVVA 4Q14A 4ZFFA 3EBAA 1EPFA 2OMVB 2BOCB 2MJWA 3MRGA 4GAGH 5CINL 3R0NA 2BVPA 1OM9A 4JPKH 3WI9A 4HGKC 3TJEH 1OVZA 1FRGL 1JGEA 1ZTMA 3F01A 3ZXAC 1YQVH 3AUWB 2BSDA 3U1QA 3JV4B 4JFEA 1CK0L 3BFWA 2HT3D 4R3SB 5IB3A 5TE4L 4Y2NA 3WGUB 4WI0B 1H3WM 3MV7D 1FFTB 1IGYA 4JFFE 4E5XG 1KGCE 1MLCA 4RMWA 3TZVD 4PGDB 4Z0BH 1QX1A 4ORGA 5GRWA 4R4FH 4KAQH 1YPZF 2WLKA 3CPLB 3B43A 3FQRB 5I5RA 2CBPA 4F8PA 3PHQA 1FNEB 2R2HA 4QTHA 4XPTL 4N24A 5DQ9A 2IFFL 3AM8C 3EHBC 1FVEA 3V4PH 4EN2A 3UGUA 4MNQD 3QA3A 4R8WL 3OJMB 3LZFH 5ECGA 3AGWA 1WISA 5FYLH 3UYPA 2L4OA 1YYML 1OT1A 4IGBD 4PRIB 2VMFA 1UOKA 4RSYA 4X8JB 3RAJL 3U9UA 1N0LB 4OCXL 5C0AD 2DQIH 5ANHA 2R2EB 4F7MB 2DOCA 4KDTC 3FONA 2HFEB 3GBLA 1YLBB 1XCXA 4RBPH 2ICEC 4Y2DB 3LHAA 3R8QA 4TTDD 1I4FA 1LQBC 3FU7B 3BKJH 5FCSH 5FS5A 4YDLC 2D7TL 2FT8A 4FHBD 1ZHNB 4NCC2 1TZIB 2CNZA 5LGYA 4ZYKB 4PYHA 4GINA 3VG0L 4ANUA 4XP1L 3WFDH 5AW9B 1FLTX 3VXTB 2BHZA 2FYYB 1RUKH 2D7MA 2N0KA 2PXYD 2XN2A 3LSOA 4QRPB 5AAWA 3LS5H 4ZFZB 1ZA6B 1HILA 1QVOB 3HC4H 2IDCA 2Q3XA 3N42B 4NT6A 1S78D 3L81A 4X6CF 2AXFB 3ZTJH 4BFEA 3S96A 5FGBA 5BOZG 3LNFA 5DMGC 3SGKA 5JIPA 4U1SA 5DHVH 4OZIE 3T8XA 4ZMVA 1ZHKB 5TGBA 1J8SA 3CN1A 4MAUL 3GJFK 5AVSB 3IMSA 3QJTB 3RWIB 1FVDA 3BPLC 2R1WB 4AGMA 3DBXA 1WD9A 3NRPA 2C9QA 4FEIA 3MRBA 2EO9A 4BDVA 3S5LG 4K3EL 1FIEA 1YEHL 3GM8A 3WKMH 1HSBA 2VKWA 3EG9A 3DXAB 2WLZA 4G8FB 3UABA 3WSQH 2YGVA 1D5MB 2I07A 5DQDH 3WLBA 3SCMA 3O2WH 3QI9D 4XVJL 1PG7L 3QQ9D 2WUBL 4X8XA 3BC9A 3D48R 1TJHL 3TL5A 2JMRA 3M7OA 3IJ7A 2GJJA 2XNAB 1PCSA 4KUZL 1K4CA 1WIUA 2A73A 1PZ5B 2XWDA 3L4ZA 3MRHA 2DLHA 3WIFA 1K5NA 2R69L 3QIUB 1PKOA 4UINH 5GS2D 4TVPE 1NOAA 2VH5H 1VCAA 1A9EB 1RULH 4DGYL 2V5YA 1SDDB 4HIIB 2NY4B 3FQUA 1MF2L 3NSDA 3T77A 3CBJB 3RILA 2K3HA 4PJFA 2A9AA 3KH4A 5GZOC 2EO1A 3PGDA 1F1GA 3O4LE 4LQFH 4QRBA 2X70A 2WSDA 3J2PA 2YK1L 4PTTA 3D3VA 4Y1AB 4EIZC 2AQ2A 3VNYA 4G5ZH 3ZVVA 2LU7A 4LDLB 5F7DB 1OP5H 3SOBL 5GGRB 1UXWB 4WWKC 2WZ5A 4R7DB 4NKIH 1A3LH 2EVIA 3QRLA 1DDHB 2WGNB 4MLSA 4HIEB 2WNWA 5DMJB 1PLCA 4U1GC 4UT6L 1T66C 1NSNL 3PWNA 5FV2A 1LMKA 5HHOE 3ZHDA 4X5XA 5E08L 1BVZA 1PNDA 5HHVL 3WELA 2IALA 3LNEA 3S6CA 1SRDA 2ZWSA 4XNYL 4XWOC 3BRFA 4PJCE 3ETSA 3VGAC 3OMAB 3N40P 4ELDA 5I1JH 2ZCLH 3N5AA 2GBTA 4YFEA 5TDOA 3VAEA 5DHEA 4C59B 2CJTA 5A40E 2KC0A 1P84K 1G7QA 3UAJA 4JY5H 4NJ9H 5D1XC 1LEKA 3BRGC 4KXZI 1YO4A 4WI8A 3R18A 5F8QC 2Q8BL 1PD0A 3OJDA 4PRHE 5BZXA 3HAEA 2L7EA 5I1DB 3KYOA 4NZFA 3U0TA 4B27A 4UANA 5F93C 4F57L 4MJID 1FFQA 2RAMA 1EAPA 4Y9FA 5F3HA 4XN2A 2R7EB 1NGYB 4J6RL 3PDOA 4B5ZA 2F7QA 5HD8C 1XVSA 2XV3A 4J3TA 2DQGH 2YZ1A 1Y0LB 4ZSOB 2WWOA 2RIKA 2C1OA 3X2QB 1F90L 2F7RA 5CEZH 5CKAA 4UCFA 3EDDA 4QT5B 4FG4A 2UWEF 3FUNA 2X6AA 3AC0A 3FOLA 2WXNA 3HZ3A 3GHEH 4YH6A 3OKOA 2EUWA 4GT0A 5B1CA 3F7LA 3GMMA 3WMPA 1ILUA 2JJWA 5EU6E 5AUMB 3WL9B 1TJGH 3SGJC 4BXSV 1E9OB 2YWZA 5FW8A 4HULB 1J8HE 3FW6A 5C09E 4HPYH 4PJAB 2O30A 1B90A 4RRPM 5TDNA 1D5BB 3F7PC 5L4IA 4I7ZC 5I8KH 1U8LA 1VGKA 1FDLH 5HYJD 2A4CA 2F5AH 5D5ME 1MRDH 2EIZB 2P5EE 1DEEB 1CVRA 1JV2A 1U8IA 3QUYA 5GRZA 3Q9PA 4X4ME 3ZKMC 1FZKA 2BCKA 4I88A 5E6IC 2K9FB 3PABA 4XPFH 4YHZL 2XSKA 4A7VA 2IDFA 2CIIB 3C5SB 3LYRA 4G8EA 5D7EA 3UJIH 1BYOA 1OGAD 3EGXA 2YUZA 3BGMB 2WPGA 2CE6A 2WP3T 4XMPH 1JERA 5IQ7L 3L6FB 1GCYA 1N7ML 4CUCA 1RIHL 1BREA 4LASH 3TWCL 3ZYOA 1HEZB 5AW2B 2KUTA 4ZUVA 2APTA 4RA0C 4XCEB 2YKKA 1R1CA 2PCPB 2P8MB 4PFEA 2BP0A 1DANU 2Z93B 3ZDYF 2QVKA 2NY0B 4OLZL 3W39A 4M3KB 2P80A 3QDME 2ZUXA 4PR5B 2BC4A 5IJVA 2ZG1A 2GITA 2PTVA 4RWYH 2LU3A 2VISB 3EYVA 5JQHC 3V2AR 1Q4NX 3CFBB 1ORSB 1ZKAA 2YSSA 2Y9RT 4ZUTA 1L0YA 3Q2LA 2Z7UA 5DZLA 5AW7B 2X28A 1AQDA 3S2CA 2AEOA 2WTPA 3I9GH 3O3DB 1FFNA 3BMVA 3CH1A 5KN5A 3A24A 4QXVA 3ROOB 4BWWA 1YDPB 4QRRB 3H0TA 5AD0B 1D7CA 4NQDE 3F65A 3WFBH 3T4YA 1YQ2A 1BGXL 2YD4A 3O45A 2IV9A 3DRTA 4RMSA 3L1OL 4E42B 2B59B 1AKJD 2B4CH 2NW3B 2ZONA 4BQ8A 4Y7MA 1FH2A 2P52A 3KPPA 4QHMA 1G7HA 2J5LC 2WXQA 4O5LL 2GSGA 4BKTC 1DLHB 3CN4A 2BNQA 1PNCA 3SE8H 2PTUA 1QP1A 3VXQA 4J8RA 5DMGD 4K71C 4XBPA 2QKIB 4JQXC 1XF5A 4LHJB 3HE7B 4HS8L 1SN2A 4Q89A 4Y5VB 2B4CC 1AG6A 4XCYA 4BSJA 3ZE0F 3MGOB 2HG5B 5KSAA 1DQQB 4ICWA 5C0RL 4ZFOA 4PG9B 3I6KA 3TF4A 3ARGC 3GHPA 1MRCL 2VAAB 4PJ5D 4ABQA 3KYMB 4I2XA 4H4NA 5D2NE 1YMMD 3DJZA 4ONGL 3KGUA 1UENA 1CDIA 2BSED 4U6XA 2IPKA 2PYEA 2Q6WB 2H3NA 1N68A 4JDVB 3QJHA 2UZXB 1QI4A 5DFWH 1C7SA 2F74A 4PUBL 4YIQA 3X3GH 1J0ZA 5AZEH 3PJSA 5CEXB 4ONHA 3FTWA 2H9GB 3DTUB 1CVSC 4HAGA 1ZWIB 2E9JA 2O4EA 1FCGA 5AZ2L 1IC5L 5EEXA 3GSWA 1XSJA 5EF0A 1C12A 2GKIA 2W1NA 4O2CA 3OX8A 5I8OH 3HNVL 4ZZFA 3MNWA 5GZOD 3S88H 2QJDA 1JUFA 3BZ4A 1KTJA 1MHHA 1G7LA 4MMXB 3KPOA 1RPQA 5L2JA 4LCIH 1XD1A 2W88A 3V0DA 1S7VB 3QUKB 1UKQA 4ZOCA 3TBSA 4J3BA 1SLVA 4L4TE 2J8UA 4WWKD 1U3YA 3ZLQC 3HHMA 2ZJSH 3DGDA 2ZUWA 2VSKB 2VXSL 3HZVB 1A7NH 2DQUL 3BH9B 3CC5B 4PJHA 3PWUA 5CINH 1T66D 4BJLA 5B8CC 4AE1A 2FTAA 4MCYA 5DJAB 2ARJB 2BNRB 3S3CB 5HHPA 2OMYA 2E47A 3WNMA 1USQA 4B9GA 3GD1C 4H8WC 1FZMB 1FRGH 4XWOD 3D85B 3OJ2C 2NY7L 4BZ2A 4L0YA 1A6WL 3VRIB 5IEKB 3RX8A 5L0QC 1CFQB 5ES4B 1YN7B 5TE4H 1Q1JL 3UTTD 2XVGA 3W9DA 3V6OC 1N67A 1Z6JT 4M7KL 4PLOB 2H4EA 2Q1EA 3DX3A 1GVIA 5A2LH 3IFPB 1OQXA 5DUBA 1EJFA 3RVTC 4IRSA 2VDNH 5D1XD 1M2VA 2VE6A 5LHDA 3I3BA 4DO4A 12E8H 2J12B 3BAJA 2OQJA 1M57B 1U3HA 2WUCL 2CO3A 3CDYA 1S9YA 3U9WA 3W9EB 2J72A 3BP6A 2H32B 3KDMA 4OD2B 4Z5RA 1EIBA 2IFFH 1WA0X 2YEZA 1NDGB 1AR2A 1ZJAA 1AZCA 2R83A 2ZUSA 1G6RB 3VA2C 2R15A 4L48A 2OX5A 2IADB 4N8VA 1T7YA 5JW3L 2Y5QA 1SOKA 2OXGB 1FL5A 3MOBL 3QNYA 5D1ZC 3MLXH 2VLJA 3KLQA 4OCXH 3VJ6B 4YGAB 5C9JA 1OOAA 1ZPUA 1RHHB 3FB6A 3BWAA 3TT3L 3THML 5IB2B 4RQQA 2RCSL 4M6NL 3UBHA 3QUML 5KVGE 4DUVA 1HOEA 2WINB 3RTQC 1T6BX 2EC8A 3VXRA 1ZVYA 4MS6A 1L3WA 3WTTA 2D7TH 1MAKA 1VFMA 3CPUA 3MO1B 5F7NC 3S4SG 3ARFA 2X4RA 3ULSA 4UOJA 1I1CA 5I18L 3ULUH 2CBOA 1L9RA 2JWYA 2EACA 3PUUA 5I19L 3VG0H 4MB1A 1P69B 3CZUB 1UXLA 2ICCA 4RGMB 3BPNC 1MWAA 1PZBA 3QG6A 4RX4D 4GKOA 3WO4C 4UZGA 1ZRUA 3ZKMD 1XGRB 5E6ID 3ZYZA 5LN8A 1F4WH 2LQRA 4PJIF 3QXUA 4JKMA 1DCEA 2Y2TA 3FRPA 4PGBA 4X0KB 1KIQB 5EPMB 3EO1B 3ULUC 3NCEB 3D0LB 5F6IB 3UC2A 4XMZA 3IAQA 2FO4A 3LXBA 3KLLA 4QOKB 5B1JC 3LV3A 1QLRA 1KIRA 1JZEA 5E94B 2EO7A 4XAWH 1R3KA 3BEVA 3UOAB 4Y4KA 1CT8B 1TYRA 4FFYA 2EE2A 3BMWA 4WHYH 2QDWA 2A83A 1VFAB 1I1RA 4GUOA 4JY6B 4L3CA 1A3ZA 4CKVX 2ZCZA 4Z3GA 5C07E 2K8QA 4K3EH 1YEHH 2CIKB 1U2YA 3CN2A 4UU9B 3WIAA 1T03L 4I5BB 3GK8L 1E7UA 3CFKA 3FTGA 3BLBA 4WDIB 4J2XA 4JRXA 2YBRB 4Z7NF 1BLIA 1CXFA 1U91B 1BIHA 2CLZB 2ODHA 1PG7H 1WPCA 2WUBH 4FNPA 4CW1A 3F2LA 3QEQD 2CJUL 5FECB 1TJHH 1DUYA 5DHXB 4KUZH 1FSKC 4H40A 2NY5C 2ZUVA 3GS0A 4LSRL 3N1PC 1XZ0B 5GRYA 4RAVA 3QC5X 2R69H 3BIKB 3NH7L 1KXTA 4HZLA 7CGTA 4GO8A 1F2QA 2DMKA 1L0QA 4GRLA 3UG3A 4P23C 1MF2H 1R9FA 4J39A 2OV0A 4ZFQA 4FTVD 1QMUA 4YHIA 3GJFH 3SDYH 4L18A 1MDTA 2X9XA 3PREA 3UPAA 1J1XL 2YK1H 4S1DC 2ZZUT 4NQTA 4IBZA 1SYVB 3SOBH 1J9CT 1RJYB 1T3FA 2OR7A 2WZ6A 1DZBA 3NP3A 4NDMA 4UNIA 4AC4A 2FHCA 1S3RA 1BVNP 4N9GB 1BJ8A 1M53A 2PWHA 5ID0A 5E1QA 1U8HB 1NSNH 3KXFA 2J73A 2VLLB 3IBEA 3K72B 3LQAC 1CZ8L 3O3AA 4WEUD 3ARGD 4A2MA 5F1NA 1FG2B 2YN5A 4ZPVB 2NSQA 4YO0B 2K7PA 4HFWB 2E4FA 2YRBA 4RGNB 4N68A 3DA0A 2YN3A 2QPDB 4I1NB 4LBEA 4NOFA 5C0CA 3DHJA 5K1JA 3MN8A 4KI5E 2V5SA 2YKLL 1LEGA 1F6FB 1YEJL 1E5ZA 3GRGA 1VGEL 2ITDB 4AW7A 5T3ZE 3WUZA 3N6YA 2CDFA 3HG1A 4HT1L 3CUPB 2ZPKL 2Q8BH 1BZ9B 1NAMH 5MEQA 1PVHA 3KL0A 4G82A 4F57H 5IJKA 2LVEA 1E4KC 2DKMA 4MS8C 3MX0A 4W9KC 5ESQA 2QFRA 1M7XA 4OKVA 2K6WA 1NEZB 1RH8A 2E86A 4F37K 2QSQA 5GRUH 4J6RH 4CC4A 2BOCA 1GKOA 2VN4A 3QFJD 5F7KC 2P8LB 4W93A 2C9RA 4QXTB 4CVZA 3UO1L 4D9RD 2WVTA 1EHXA 3P30L 3BE1L 1MCLA 1YEGH 3FQ1A 3L3DA 3OG6B 1HAWA 1V55B 2ZXDA 4P8QA 3ZDZF 5CJ5A 1GW6A 3W0WD 2H6PA 3DTXB 2ATAA 1J86A 2OXHA 4G8GD 1F00I 5HI5C 1F56A 5JUEL 1JD7A 1NEPA 3BWSA 2DYPB 2BMKA 2UXGA 3BN3B 4FQXA 4HKJB 4Y19E 5AVUB 5C0BE 4N87A 1BXUA 2VRKA 4WW2A 1OO2A 1IVLA 4YLQT 5AAWC 5E9NA 1ESOA 3BUIA 4FOMA 4QYOB 5CP3A 1VACA 4O2FA 3LN5A 2VKXA 4NBZB 4GLRI 4XZUB 4LPXA 5FGBC 1WEJL 2ORBL 2YQ3A 3EJQA 4KNTA 3WIHL 3APCA 4NGHL 3RVTD 3ZZLA 2SEBB 3WD5L 2Y5EA 4YHZH 5K5YA 1C1EL 1JGVL 5CJ8A 2MNUA 1HKFA 4MDJB 3FO0L 4AI7A 4NRYB 3SD5A 4GSUA 4CNIB 2X4NA 3BKYL 3LHPH 1BQ5A 2Z8VC 3LQMA 1M2OA 5IQ7H 4QHUA 1KTLB 1JVKA 5D6DA 3WUWA 2OL3A 3BH8A 3FU0A 3MRFA 1RIHH 4AX3A 1SLWA 1ECZA 3LXCA 4X8GA 5GJTL 3TWCH 3TV3L 3VWKC 4NAMA 1IBZA 3SCMC 1UJ3A 1WCBA 1IT9L 3RJQB 3TH3T 1XB6A 5D1ZD 4A2HA 1EEZB 3IEAA 1HVXA 4OLZH 1M9WA 2Q2LA 8FABB 1PEZA 2A6KB 5F21B 3NIGB 1BWMA 4KHXL 5DRWB 3ARUA 4N8PA 3MROB 3RTQD 2ZSVA 2IAND 4NQEB 3VXTA 5JW4N 1XL4A 1PY0A 1QUNA 3TBYA 2GJ6A 3DBSA 3JWOL 3IJSA 5BRZA 5L2KB 4Q2ZB 5DEZA 3HI6H 3H6JA 4LPCA 3CVHA 4B41A 1MFDL 1TZHB 3FB7A 3K1KC 3N41B 4PRPD 5F44A 5FYKH 4JFXA 3IPFA 3UTQB 1Z9LA 4URKA 5I1CL 4H0LC 5EN2B 4NQXB 3ULUD 1HHGB 4KVPA 4ZUUB 5HYEA 1DFBL 4AUYA 3CHRA 4PD4K 4G7VL 4JPIA 4ZT1A 4NNPH 3OAZK 4HS8H 2ZAIA 1WAEA 4L8CA 3ZDXB 3HG2A 4PJXE 5DJZA 4YDKH 1MCQA 1KTDA 3DNKA 4YDJB 4TVPL 4APQA 1NIFA 3CVIL 2R0WL 5C0RH 4NB7A 3IFNL 1HK6A 2AJZA 3FUFA 4LPYA 3RWGA 1RPKA 2G5BA 5EBLA 3GS7A 4Q52A 3DSNB 4GBXB 5J13B 5KSBB 1LO2H 3UAJC 2G3XA 2G75A 5F89A 2NX5D 5FO9A 4TKWA 4KI1A 3ZYJA 4BK8A 3A6BL 2PWDA 1PQZB 1AO7B 4DERA 1LWHA 4K5PA 5LBSH 3GSXB 1OARL 2Y3NA 3QORA 3I02A 4JM4L 1XD0A 2OR8A 5EU5A 4L8SB 1P7BA 3NGBC 2CLRB 4PV8B 4LFHG 1LGVA 2EDWA 4NAJA 3IMTA 5E2JA 5F88A 4A66A 4CSSA 2WB7A 4C54A 3L4YA 1CLYL 1WITA 1IC5H 3TO4A 2NPLX 2CQVA 2IVFC 1WGVA 3HN8A 5BQ7A 4P23D 2HLFC 3MJ9L 1B0RB 4MAYB 4MTMA 2Q7AA 4OJCA 3LQZB 2BSSA 2LE9A 4S1DD 5CJQH 4X0NA 4Z7UA 3LKQB 1X6NA 3BEWA 3BAYA 3C12A 3E80A 5EOCL 2BHUA 2OJ1A 4JHVA 5IHZB 4QAMB 3WY4A 5IP4A 1NIAA 2O5XL 2VXSH 4PS7A 4M5YH 3VSTA 2DQUH 4F20A 5JOFA 1NCBL 3E2HB 4JFED 4IJ3B 3MRLB 3E8UH 1R0AL 2CWRA 2BS9A 1GS8A 2OTUA 4J3XA 1T1ZA 3TX4A 3UBXG 4A7GA 2IBGA 4LLWA 3VU2A 2WN3A 3GMPB 5HDBF 2G0KA 5E24E 1AGBB 1XGZA 1G7PA 3NZ8A 4UB0H 2AKRA 1QO3A 2WOBA 1FF5A 4G59C 2G0LA 4KRPB 4XHQA 4HZ1A 1QW9A 4M7KH 4U1HA 1BZOA 1J18A 3LRSA 2IDQA 4CMHC 4GXVL 5BZDB 2AQNA 3BSZH 4LNVA 4DFIA 3CD4A 4PIRF 1MJJA 2BVOA 5H94B 5I8CA 2YSTA 3RPBA 3B9VA 1SXNA 3M1CA 2WUCH 2FATL 1JTOA 1UASA 4AGNA 2UUDK 4KKLC 3WS3A 4DO5A 4MS8D 4ELKB 2N1KA 4ODUA 3UAFA 4L9LA 1EXUA 1Z9PA 2G4GA 3AW5A 2FT7A 3VFTA 3BZEA 1RUPH 3HTLX 3H3KA 1E8YA 3FFCB 1FAIL 1FV1A 4JQIA 3SPJA 1XSIA 3P73B 3L7EA 5MHSE 1TYJA 1SVCP 4PJDE 1I31A 2NQDA 3NIDE 1UB5B 4HUUB 5J9PB 5FA3A 3ZE1F 5JW3H 3SJVB 5C6PB 4ELMA 3K4AA 1H6UA 3U2JA 4F33B 2YD9A 4QXUL 3THMH 4QXGH 3Q7JA 3BAIA 5GGSB 5HI5D 4JFZH 5DR5L 1LK2B 5HY9B 1P4IH 3HPJA 4NC1C 3BW9A 3LZOA 4ZW3A 4NI3A 1YZZA 2HUEA 1WZAA 5I18H 2ZE0A 3GNMH 3PV6A 4FNRA 1SOXA 5I19H 3VMPA 1QWNA 5KVFH 1VZIA 2ESVA 4P46A 3SDXF 2PWGA 1B0GA 4W6YB 1UB6B 3JSSA 2QVIA 3PWVA 2HFTA 5LXGH 1RZPA 3H9SA 2WBXA 4EZJA 1CD1B 2FB4L 1HH6B 2JQZA 4L4VD 1ZCRA 5I73C 5ADOH 1E4XI 1QR1A 4ZQTA 1CDJA 5MI0C 3VVWA 5KSAC 1WBXA 3ILEA 3ABKB 1FCCA 2XWBA 4CL7A 2V3EA 1ETJA 4M7JL 5KSUB 4DGVH 3CFJB 3C2SA 4R5VA 4WEEA 4BE6A 1VB9A 5I1KL 4OI8A 1R75A 1B4TA 4LLDA 4A6YL 4MMZA 4DN4L 4NIYE 3MR9B 3VGGA 3VWKD 5C9KA 4KZEH 3ARQA 4AW4A 3SCMD 2BFVL 3ORJA 2XKNB 5DZ9A 4F7TB 1JZFA 2Z92A 3EBHA 5LAPA 1QRKA 1H3GA 1SJHB 3LNDA 3GK8H 1T22B 1B6UA 4NO2A 5AKVA 3TURA 3DO4A 1FVCB 1QEWA 4FS0A 1S9VA 3IETB 2PPCA 4OIBA 5T1DL 1BVLA 4EAEA 2C4XA 4WRLA 1MFAH 3D7PA 4PVBA 2CJUH 3FPXA 5TDPB 5CFAA 3QNZA 3K80A 1B0WA 1JWSB 4LSRH 1ILSA 1DDTA 3H3PL 3K5SA 4YBLB 3NCFB 4JJ5A 5DEFB 2AMUA 4MYWB 2APBA 1EJOL 1MCJA 3D3VD 2F8IA 3EIFA 4GS7C 4YFLI 3D6GA 5I74C 1QFUL 5GSVB 4K94L 3GSUB 1N2RB 1XF4A 4H26A 5ISZA 3OAWA 3GPEA 1IAOA 1J1XH 4HSCX 4YZFE 3SDAA 4CU6A 2G60L 4AY0A 2XN9B 5FO8B 3RWJA 5FYKD 4LCCB 2K4AA 4FERA 1H3VA 3T6WA 3SKJL 3EOBA 4FDWA 1UOLA 3H3BC 3E6FB 3UC0H 5JIDA 5CBAA 3T0AA 2X2YA 4X50A 1OSPL 1FPTL 1P7QA 1CZ8H 4DKEL 3B34A 1KLGB 1BQKA 1NC2B 3RIKA 3OTTA 1IM9B 4ZPTA 2ENPA 3RNQA 4HIJB 1G9MC 4N2BA 3IDJA 3UAJD 3ZIMA 3L7FA 5FOBB 4PY8J 4IRSC 3QQNA 5ICXB 5IQOA 4P0DA 3FQNB 5JNYB 2YKLH 3MRDA 1U3HC 3FUEA 1EK3A 1TQSA 4P48A 4AT6A 2EXTA 1OTTC 4HT1H 5B39G 4DF9A 1Z9NA 1RHFA 4R2GB 1IBHA 2COVD 1KACB 1KWKA 1MG2C 2G3NA 4AV4A 3LRMA 3AACA 4KPHL 1C5BL 5GIRA 2UZYB 3RY4A 1KN2H 4NP4L 3U7AA 2AK4B 2V37A 3IJYA 4KRNA 4L9DA 3IDNA 3Q6GL 1P5VA 4WO0A 5DZVA 3KHOA 5DZNA 4OZHF 3G6AB 4JGMA 4QEGA 1U8KB 4HETA 3DYOA 1S9KC 5AFAA 4FKEA 5L8LB 3N40F 1WC7A 2OJZL 5C7XL 4YDZA 2MNWA 4HGWB 2BXZA 1L7TL 3EYOA 4W9DC 2XG4B 4I8DA 1QQDB 4LRIC 1ZD6A 3NCWA 1JK9A 1JL8A 3LB6C 3BE1H 3MGAA 2OK0H 4N28A 4ZMQA 4YC2B 3DX9A 4V1DD 2O6DA 5HDOA 1OKEA 2DB8A 2P8PA 4U3SA 4W9LC 3V0EA 2C3GA 5A3IC 5JUEH 2X2UA 3M88A 1I1AB 2JIXB 1DBKL 2YUXA 4E9VA 1YPZB 3OXRB 3QUYD 2J88H 2FBRA 1J9SA 1Z9SA 2GSIA 3VSVA 2ID5A 2F0CA 3DJTA 1MH5A 4G9FE 3CIAA 4I77L 4ZQKB 4FFYH 4LHUB 4DZBB 2P24B 5AYUL 3MCLL 5B38B 3QJQB 1WEJH 3WIHH 4CGUB 4NGHH 1WH0A 4F2MA 4HKXA 5KVGL 5GRVK 4NHUB 3Q9QA 1JGVH 4DEPB 3FTYA 4Y4KC 3FO0H 4ILDA 3AQZA 2NXYC 1T2JA 1SY6H 3BKYH 3IFLL 5I71B 1MAML 2L04A 4KKLD 2I26N 4F7KA 4HK3J 4F7PA 1F5WA 1WIPA 3NCYS 5HJ3B 3HB3C 1ND0A 4YNYA 2XTJC 5ACZB 3KDPB 2X9ZA 2V7HA 5GJTH 2P80D 1FO0B 5DWUL 2XKUA 1I7RA 2IH1B 1D3CA 3OG4B 1RURH 1UA7A 4PG2A 2EVJA 3VRLE 3BIAX 1A4BA 2F8OA 1X5GA 3L3JB 2D3JA 5HYSA 3ENEA 3FSVA 4WUUA 2GIYA 2LABA 5DRXB 2PTTA 3F7VA 4PJBF 5DMKB 1FORL 3NSXA 5T3XD 5D6CB 3D25B 3V6ZB 2NYYC 4YQXL 2BOLA 5DDHB 4JDZA 1P4LB 3QIBC 4MRBA 4P2QE 3B5HA 3O3BA 4R7NB 2VDML 4IOSA 4X6CB 4AVJA 1AXSA 1KIQA 1NDTA 1INEL 4AL8C 4ZD3H 5GPRA 1I3UA 1XWVA 2HKAA 4IS6B 5SWZE 1IQDA 2COQA 1HHJB 4JHAL 4KQ3L 1MFDH 4RZCA 2W07B 3SBWC 4FYQA 2BNQD 4TVUA 1FGNL 4K2UH 3C75A 5K39B 3V55A 4QRUB 3QRFM 5JPMB 2PYFB 1N6QL 1XGYL 1GGIL 4EN3B 5I1CH 3T2NL 1KGJA 1S6NA 5DTFA 1THCA 2A74A 4U1NA 3K8LA 5CIPA 4EO5A 5KSAD 3EDFA 4FXGA 1WFTA 1F4HA 1DFBH 5IMLA 3K91A 5J3HC 2BVUA 4G7VH 3GRWL 3DPBB 4Z7VA 4N2EA 3JUZA 1T1WB 2BSRB 3SKUD 4HZAA 1YSOA 2Y22A 4X7SL 5F71A 2PYED 1CI3M 1CDUA 2ZYRA 4JANB 4TVPH 3STLA 3TCXA 2R0WH 3Q2NA 4F3FB 1G5AA 3IFNH 1CXEA 4YL4A 5FDYA 2VJXA 2X4TA 2V8MA 2IWFA 3BLKA 4G43A 7PCYA 1JK8B 2B08A 5JXAH 4FJYA 5CZRA 1HZKA 2FX7L 4OCYL 1KJ3L 1WZKA 2CRIA 1FI8C 2GTZA 3ETBJ 4C4UA 1OM3L 1JXFA 4MSWB 1X5HA 4MNGB 4UIMB 5DK3A 1NCOA 3A6BH 3PL6C 1NJ9A 3D39B 4HEPG 5DK2A 2F68X 1TJMA 3LRHA 1M71B 1OARH 4NI6A 8PAZA 2QSCL 2EIMB 1MVYA 4DKTA 3MUGB 2ZAGA 4Z7WF 2H26B 2OMZB 3BYTA 3CBKB 3EOYG 2VWEC 2BZDA 3AMLA 5D7IA 4PSRA 4N2KA 3ML9A 1W16A 3GXMA 4OF3A 4CC4C 1FYTA 1DVTA 3NN8B 5F7HA 3QYMA 4M00A 3FT3A 3V4VL 4NUGH 3GUTA 2WYIA 3MJ9H 3AREA 3JT2A 1N59A 3GHBL 4RA3A 1FZJB 1JNHB 4P06A 1JZ3A 3PXJA 1JWMA 4WGVB 3RE0A 4Y5YA 1I7ZA 5EOCH 5I66A 5KBKA 2JKXA 1K2DA 3QDJE 1TQBB 3FB5A 4YHKL 5D1ZI 1OE2A 5E2TH 5ILTL 3S3BB 2LW3A 3NCJL 4FQXC 3LVTA 1BXVA 3T4AB 2QPFA 3HPLB 1MFUA 4YFLF 3RNKA 2JF1A 4JCLA 4F58H 3I6GB 4NM8L 4XBGB 3MRQB 1C16B 4KUCD 4LP5A 2PPAA 3FULA 1JZ8A 4L1DA 2AXHA 1R0AH 4O02L 3NJKA 2OJEB 3RI5F 5JIHA 2YRZA 5BXFB 5F9WB 1PKQB 4BH8B 4OD3H 4P3CL 5FKPB 1TUPA 4IRSD 3A5VA 4LOVA 5SWSB 1MCIA 5DVKA 5D7HA 4ES8A 2W0LA 1U3HD 2GCYB 4OAWB 4GXVH 4I1RA 5FK9A 2WNXA 5F7UA 1X6LA 3BX7C 3I85A 3QJVB 2VDOB 1WV7T 1OTTD 1INQA 5D6DC 5CLZA 4L29B 2F19L 4DGIL 4QXTA 4YXLH 1FZOA 3J8F7 1TZGL 4FMVA 3DDFA 1IJNA 4OLYH 1X4XA 1JWUB 5TE6L 1CD9B 3ARRA 5FUCC 1UJ3C 3NOIA 5HVWA 1AGDB 4E41B 2UWEB 4MCMA 2VLJD 2EVGA 4JAMA 3LH9A 4O9HL 4EPSA 3DHMA 3QFGA 4AQEA 4HJJH 2QMJA 4DP5X 1JXGA 3DJ9A 2R4SL 1HYRC 1NOLA 5CHNA 3LB6D 3R0MA 3VXRD 2KMWA 1FJ1B 4QXUH 3V9CA 1E30A 2PF6A 3TNNA 1Z5HA 4MQ7B 1V7ML 2VABA 1W91A 3PDDA 4BXVA 5A3ID 4X83A 5L4MA 2YRPA 4IIQA 4W70A 4N0UE 4GRWE 5JIQA 3T71A 3H9HB 5IBTH 4GG6A 3RKDC 3RP1A 4KK9C 1WWCA 3BKML 2NNFA 1KYOJ 1XH3B 3ET9F 4X5RA 1IM3D 1W9XA 3CNKA 3U4EB 2P5WE 4UV7L 3DHPA 3HA0A 1XCQB 5JW4R 5I6PA 2VMCA 5DJDA 4QHKJ 2ITCA 2K8MA 2FB4H 2ZF9A 4ZNEA 3WTUA 3ZKSD 4FXKB 4BFJA 2YAQA 3BESR 4IRZL 1PZUB 4WWOA 5A7BA 3ZY7A 4Y4KD 4PRDA 4JO1H 4XCNA 2NXYD 4N2FA 1RP8A 3ZDYB 4M7JH 1LP9E 3VMNA 4P5SA 3BP7B 1DJHA 1SM3H 1XBRA 3HB3D 3C60B 1SGKA 1IVTA 5EN3A 2XTJD 2GVYA 3ZHKA 4AYBA 2CKBA 3H2WA 5A2AA 1XL6A 2OSXA 4GQQA 5GGQH 4JRXD 2QADC 1ZXKA 1KPRB 3S35L 3GSOB 3T3MF 4TN9A 3QORC 4I9WD 2VSMB 3BN9C 4F9LC 3U30B 4HAFA 5DK0A 2LGNA 2G5UA 5IK3B 1H8OA 4FLHA 1YEKH 3UTPD 2HB0A 2ADGA 3LH8A 4S2SA 2IPUK 3ZK0A 1KB5L 5T1DH 5KYXA 3TO4C 2NYYD 4HWNA 3QIBD 5LCVL 3QDGE 4GRLD 3C9NB 4KI5F 4FNSA 3KM1A 1EUTA 3M86A 4HKZA 1NA8A 3C5ZC 4MQSB 5T33L 3ZRSA 1ZANL 1XXDC 3MRCB 2VLMD 5KVMC 3CSFA 5DQJA 5E00A 5BZZA 3TYFA 1QFUH 5MEOA 5EZJA 4U1LA 3ZE0B 4K94H 4G6JL 3JWNE 1DBBL 3QNXB 2XPYA 2XWTA 1B88A 2FJSA 1MY7A 3VFGL 2G60H 1RVFH 4Y8DC 3KXFD 3D30A 3QHFL 3II1A 4DCQB 1I8IB 2HYMA 5J3HD 4HUCA 1JSYA 2BWIA 3H55A 3VD1A 2MCG1 3MV9B 4RVBA 3GC3A 1D5ZB 2AFNA 1GKEA 4L05A 4BKSC 1CO1A 3FC8A 5C0CD 4FA7B 4DKEH 2ED9A 2X1PA 1S7QA 2HCZX 2YMTA 3SQBB 2D3VA 4X9HA 4NKDA 3F64A 3OKDB 3PGFH 1ES0A 1GOFA 1X5MA 4YDNA 5F1IB 1WS7A 1KULA 1ZLVK 4GRMB 2LT9A 4X6FA 4UQ9A 3HG1D 2NLJA 3HAEG 4JZJA 4U6YB 1KBPA 4ZUSA 1IGFL 3PL6D 3IDIB 3QJRB 4LCYA 5D2LA 1QHQA 1JFQL 5KS9E 3ARBB 4OBRA 1I7UB 3U2SB 1T0OA 3MRMB 5HYIA 5AOIA 1P4UA 5EUKB 3C6EA 4L9LC 4X7EC 1RUQL 3FQTB 1YNLH 2HAZA 4QJ5B 4H20L 1HT6A 4S1RL 5FYJE 5HYQB 4ZX6A 5DZAA 4ODTL 4E36A 3CFCL 4U1KA 5KVDE 4A7QA 1HXMA 4NP4H 3I50L 2NCMA 4O4YL 3Q6GH 5IHZA 3HC0A 2RD0A 1BAWA 4HF5H 5AKSA 4DK6A 1TEFA 4YWGL 5HHOD 2Z8RA 4XMLH 3NA9L 4LIQL 4B9ZA 4HAKA 5BJTA 5C7XH 1ITCA 4NFCA 3L2MA 1L6XA 4JRYA 4JZNB 1SHWA 4G6FD 1MHEA 1N8ZB 4U2ZA 5IVOA 3P4NB 3GSNB 4FQXD 2AEPL 4M5SA 3Q5TA 3OR7A 1A7PL 1OF2B 3KPNB 4NLHA 3STZB 3P4MB 4WVRA 2DD8L 2Y7QB 3H1ZA 4EF3A 3ARTA 4MD0B 4M8VA 4M6ML 1S4IA 2DQCL 4JO2L 2BP8A 5FCUL 4BEIA 5J1AB 2DWDA 4OFVA 2C1PA 1A4KA 3EAKA 5DZPA 3P77A 3UZQA 2NUTA 4MA7L 4F93B 3UPCA 1NFDA 4FADA 4H25A 5AYUH 3EYUH 2HKHH 2P48B 3QCTL 3RZCA 1KIPA 3WDJA 1T2QL 5TE7L 1CFNA 5LG1A 4GNKB 4OQTA 4JPVL 4QXWA 5LAXB 5FF6A 1DE4B 5KVGH 4PRIE 3P73A 1D2PA 1U36A 4BFOA 5A2CA 3QPXL 5DXWA 4QMEA 4TF4A 3QXWA 2JKNA 2P5PA 4MMZC 4OUUB 1TEGA 3IFLH 1MAMH 2VOTA 3OAYK 1ACZA 4JK0D 2FNBA 3B5GA 4QF1A 4TXVB 5ANMB 2DWTA 2WLMA 4NQVA 5G2NA 5KVEL 1NLBL 4EJ1C 3NDZE 1OIOA 3HBGA 2B14A 2F7PA 3QEGL 5DWUH 2XWZA 4A39A 2HH0L 4F8QA 1R5WB 5DZJA 3CGTA 1E0OB 4HKBB 1PU0A 3EFOA 4FQQB 2O5ZL 5JO5B 2GJ6D 1S7WB 1SEQL 3QULA 3I9IA 1I3RB 3L45A 4G5AA 3O6MH 1FORH 4QRPE 3QE5A 1BP3B 4BKLA 1KFGA 4I87A 1IC0A 5FHBL 4ZODA 1S7UB 4PJIB 4OJYA 1SVBA 2VZUA 4GKNB 3RKDD 2VDMH 4LVHB 4KK9D 4NAQA 1INEH 1BX2B 3M17B 4KKCC 4HVBA 3KPRA 4HUVB 1L9QA 3CSBA 3GMNB 3IYLW 4KO6A 4OLVL 1GRWA 4NBYB 4QHLB 3US1A 3MV8B 1N6QH 1VEOA 1GGIH 1XGYH 5GS3A 2Q7YB 3QP3A 4J3SA 4CJ0A 4EEEA 2P7TA 3GF8A 3E9TA 3UTOA 3VFRA 3DX8A 2K7QA 1R33A 2OI9B 3KR3L 4JO3L 3WS6A 4M9PA 1T83A 3ILPB 3DXAE 4TL4A 5CGBA 2D0GA 1UZ8A 2WXMA 1F86A 2CBQA 3LKOB 4BQ9A 1IU1A 4ANWA 4X7SH 2K70A 3H42H 3KS0H 4Z7NB 1TTAA 3S36H 1MKFA 2DQHL 3K81A 2CAKA 2QADD 1MQKH 4WU7B 5DO8A 4LLVA 3S9DB 5DEGB 2IGFL 3WTXA 1L9TA 3QORD 2FX7H 3BN9D 5H37A 2VC2H 1SHMA 1OM3H 1BVKB 2Z4QA 1G7IA 3HI5L 3SB3A 4OFIA 1KLFA 1KXQE 4XNZB 3G6JA 4GOSA 2EC9T 3AXIA 4NQDD 4R7XA 2GEEA 4M62L 4O51B 1Q9OA 4XC1L 1U8OA 3TO4D 4YHPB 5JA8B 1BZ7B 2V9QA 4Y1AE 1DJGA 3C09C 3AU0A 3S37L 3AFLA 4P5KB 1Q9WB 4YLCA 1UZ6E 5F7EH 3ROLA 4MB3A 1MEXL 2IO5A 4FMFA 2GY7B 1UC6A 5DYOA 1KC5H 2EILB 3C5ZD 4RMRA 4PWJA 1KCVL 3LX9A 3ARDA 1S9XA 4L3EB 5IW6B 2I9TB 3V4VH 1E43A 4IKIA 1AYOA 3GHBH 3MNVB 3H7BA 1WFOA 2GFBA 1MUJB 2XPGA 5FIEA 4A7TA 5B21A 4P07A 5T3ZH 2ZUQB 2C9PA 3BUYB 5I2IB 1MW2A 3T0EA 1W0WB 3GWJA 2DLEA 2OSYA 1WK0A 1G0DA 2VUKA 3KPQA 3KPTA 1CYXA 4JREC 1SLXA 5E03A 4AYFA 4DWHA 3FKUS 3F83A 4NM8H 4XX1G 5DFTA 4JGNA 2GB2A 5AKRA 4PB9H 2JCCA 2R39A 3VXNA 3SDDA 5C0DA 2CO7B 2OMXB 3UZVB 4AMWA 1RCYA 3V4LA 4JM2A 4JFVA 2QHLA 2OTWB 3OC8A 2X7LA 4OCRL 1MI5B 5DO2C 5C3LD 5FFLA 2PPEA 4YX2H 4X99A 2AP2A 2ZOTA 3CX5J 5FM5M 5AW0B 5T8IA 4BM7A 1YY9C 4LVNC 5LBGA 3B7UX 5D7LB 3SY0B 4ALAC 4NO0A 5E0QA 3FTZA 3QXVA 3NFNB 3TTYA 4X98A 4R5TA 3MYJA 5IF0A 2XV2A 5ALCL 4ZSOE 2PW2A 4JFWA 1S5HB 3QUMB 4XNMA 2NT0A 5DJYA 4HFUL 5GXBB 4N8VG 4F80A 2GAZA 1AHWA 4GP4B 4N0FA 4L4TD 3UACA 1TZGH 2WYHA 1J1OL 5D9SB 1NKRA 5TE6H 2MQ3A 3HHSB 3ZDZB 4PG2C 5A6LA 3MU3A 3MKGA 1OAJA 3CFNA 3L3IB 4KTYA 1W72A 3RDTC 4FQCL 4UT9L 1AGFA 5IUCA 5C0JA 1J5HA 4XNQB 1FH5H 2QR0A 3FRUB 5DHMC 5T1LB 1VADB 4PJAE 4UOW0 4I85A 1S46A 1WFIA 5BV7C 1MZYA 2YPLA 1A1NB 4N4YB 4DZ8B 3RGVB 1NINA 2VN6A 1A22B 4XO5A 1C9SA 3T08A 4PI2A 2C34A 1V7MH 3BGFC 3HN5A 1CXKA 1MOEA 4QO1A 1N9PA 3IKCB 4DKAA 5IM7A 2ESVD 2BIIA 3L3HB 1SF5A 3BRDA 2WIIA 3H9SD 2VM4A 1XF3B 2MCPH 2A74C 3CFMA 4DQOL 4PJEA 3LEXB 4UV7H 4J2QA 5DA0B 1T89A 1KDJA 2WLLB 3WNIA 4YDVB 2OBGA 3FHEA 2EDXA 4GUPA 4Y16A 3TT1H 4H0IA 4PJ7A 4PJFF 3NFPB 1DVFC 1BF2A 1E7VA 2AXGA 3BAEL 4IRZH 3AU1B 5T3XL 1URZA 1OSZA 4K73A 4MBRA 4NERA 3EBIA 5IG7A 1ZLUK 4KK5C 2CPCA 1ACCA 2DIBA 2FJUB 2YA1A 4AIXA 4KMQA 1PSKH 4JFOA 2X6CA 2ZXGA 4L8BB 1JTTA 4MLIA 2RACA 4GKLA 4O2EA 2AV7A 1T0PB 4FNQA 1IGML 3NABH 4HC1A 2D3NA 4G42B 3CHXA 3L3OA 4QRRE 3GXUB 3KLAB 3UX9B 1M6OA 2D2CC 3B83A 3KL5A 2WYZA 2XX0A 4DKFL 1MFVA 5FDWB 5C0EA 4ODXB 3TESA 1C8QA 5I1EL 1UCBH 1RZGB 1UD5A 3AREC 3QCVH 4OZFB 1OHZA 4PTUB 4PIBA 4ERSL 2NTFA 3LPOA 4M93B 3WKYA 5ISZD 3IJ9A 1FHNA 3KE0A 4KKCD 3MLVL 5E2VL 1ZANH 2WJ7A 3CSPA 1A64A 2XA8H 2BP5M 2Y24A 3EOAB 4Y5YC 2QQNL 2UYLB 4LPUA 4P3DA 1ET8A 2C3HA 4G7YH 4CMMA 4ZI8A 4GKZB 4G6JH 5I82A 3MREA 5ESVA 3HBQA 4UYPA 1MCHA 4R84A 5E1IA 2R8SL 1K8DB 5AVQB 2AABL 4WNSA 4LCWA 4QRQB 4WI2A 1G7JB 3AWGA 3VFGH 3VFSB 1P7QD 2QV4A 3P9LB 3QHFH 4AMXA 2LLLA 1X5XA 4JBSA 1V05A 4ENEC 1KNOB 1OQOA 2VZ1A 1J88A 3QEUB 1UT9A 4Z77A 1BOYA 1KT2A 1PD6A 3BDYL 1M7DA 1XBDA 3BPCA 3U1PA 3QAQA 2NY2B 4BZ1A 2XWJA 1EO5A 2HRLA 3AADB 2X4QB 5AVVB 1X9UA 4BELD 2BS8A 2G4EA 4HOMA 2OMUB 3ME0B 1X5FA 5TQ0H 1TVHA 3TBWA 1UURA 3HC2A 4PEEA 1IGFH 4QTIL 4Z18A 5MERA 2YMXH 3P9MB 3MV7B 2N01B 1JXKA 5GSRA 2V2XA 3TZVB 1LO5A 1WSST 2DY2A 1JFQH 1NBYB 1SFHA 3QHZH 4HP5A 3C8KA 1TU2B 2OR9L 4HWBA 4LBAA 5E9AA 1F58L 5I1IH 5JOFB 3L4VA 2B9BA 3ARWA 4H20H 4BZ2L 4UQCA 2IWGA 4S1RH 3VM7A 3CV5A 3QWOA 3U6RB 5HGBA 4A1RA 4W68A 5T1KD 3IRPX 3AJ7A 5I6XC 1PX8A 2BNRE 1MIML 4MNQB 4DEWA 3JT0A 4YWGH 2AF2A 4R7VA 3W11C 4C4KO 4L1LA 2A0LC 1JCVA 3NA9H 1KYFA 2X6UA 5FUZL 1JRHL 3DUUA 3NK4A 3ZKNC 1GXEA 1AD9A 5HDBB 1ZT7A 2YIHA 4GO9A 4UTBH 1E6OH 4MX7B 5C0AB 3QRGH 2XV0A 4IIQC 2AEPH 1MJ8H 3OGCA 1A7PH 3V0HA 1KGUA 3RPIA 1TCMA 3O2DH 2BY0A 3AITA 3FT2B 2A6IB 1QI5A 2R27A 3TOPA 3N2JA 5T3ZD 2F8VA 5IROA 3B5TA 4Z78A 2DQCH 3KCWA 4JO2H 4QJ3B 4JO4H 2GBAA 1MCPH 3W37A 3WFCL 1YNKL 1J5CA 4DH2A 4WWNA 5DO2D 4C47A 2BCMA 4LKCB 2H0FA 1YY9D 3MJ7A 3E1ZA 1YY8A 3WHE0 4ZX5A 4U0QB 2W0PA 2YAPA 3ECQA 4FNLL 2PXYB 3SQOL 3QCTH 2K6ZA 1T2QH 5TE7H 2KL6A 3HFML 1H3UA 4H13C 4EZLA 3VWJA 4DIXA 1PLAA 2LFEA 4G1EA 1MXDA 5L7XL 3ZE1B 2W5PA 3QPXH 5EOTA 3C6LB 1DQKA 5C0IA 3ASNB 1HX0A 3L48A 1MW3A 3QO1B 3L8QA 4HMCA 1CFSB 1MWAL 1NLBH 2KZ1B 3RDTD 1A14H 5A1AA 4KK6C 4WUUD 1PAMA 3DUSA 1R5VA 4TL5A 3U79A 3BFQG 1EGJA 4QCIA 2O5ZH 2WQWA 1NFIA 5T1JA 2WTRB 4P57B 2VLRA 1QSEA 2Q3AA 4S0SD 1SEQH 3U7YL 1ID2A 3DI2B 4IOSD 4RWHA 3QI9B 3SDXB 4ZMOA 2WZAA 4NHCL 3B2DC 2D7PA 3NJNA 5FHBH 4RRPA 2PP7A 5IVZA 4HH9A 4YSQA 3BO8B 2DMCA 1HHKB 3FQWA 4OJFL 4WV1A 5C0GA 4QOKE 4Z7QF 3QHTC 4IOIA 4LLMA 4DPBX 2CBMA 4MWFB 2J4WL 2MNJB 4M1GL 4N2AA 3B7YA 1T5XB 3PAVA 5BCAA 3CXDL 1XGTB 4OUOA 4X4YB 4KDWA 3OHXA 2JELL 5HHQA 3TBVA 1CBVL 1CFTB 4EUPH 3SGDH 3EFDH 4XT1C 1DVFD 2Y06L 3KR3H 2AI0L 2UXTA 2AGJL 4NFBA 5I26A 1SHXA 3AG2B 3VRJA 5KZCB 4TUOB 4NXSA 5T1MB 3MFFA 2OAAA 3UTSA 4KK5D 4NLAA 4U1IA 4XXDA 4D0CA 3QR2A 4X4XB 5JHDB 2J8UF 2JI1A 2P45B 4LSDA 1CD8A 2Y2WA 3HC3L 4JZJC 1MCOL 1EH9A 3A47A 4S11A 1O7SA 4PJHF 2KLSA 1OL0A 1DBAH 3COOA 4UTAL 5DS1A 4G9DB 5AG8A 2IGFH 6CGTA 4Z0XA 1QNIA 2OZ4A 2X4UA 3HI5H 3AWEA 4PGEB 1G6VK 4JVWA 4KUCF 1ZK9A 4N6RA 5JLZB 43C9A 1ORQB 4MA1B 4XAKD 3TCLB 5FA4B 4FKKA 1FYTD 3KEHA 3S37H 5D7IE 1U8CA 1TTGA 4MCZB 3ZT7A 1MEXH 5C8JB 1QLFA 3ARED 3MUZ1 2Y72A 4YPGA 1BDYA 4YFDB 4LVOC 3QWNA 1KCVH 4ZK8A 1YUHB 2HMIC 3BWZA 1AZNA 5D7SL 4NYLB 1YA5A 1JOIA 1GJIA 2WLHA 3D69B 2W59A 4RGNE 3QG7H 5K1NA 4CC1A 2F7IA 3CMGA 1UACL 3APDA 1MPAL 2FZ3B 3VFUB 3MHZA 1H19A 4ENED 5EZLA 3B3IB 4AH2B 1GYAA 3VACA 1VKXA 4UZSA 4NCDA 1HXYA 2CO2A 5F6HJ 5FYJL 2J5WA 5EU6B 4JY4A 2XQBL 5AB0A 4Q7DA 5KVDL 5INCB 1U9KA 2XFXB 5HDQL 4JKNA 4N2DA 3ISYA 5AAMA 1I8MB 1GOGA 4GAYA 5MENA 1F8TL 1N6VA 2F15A 5HYJB 4UTCA 3SKOB 4JR9H 2VDKB 2DICA 1RSFA 4YAQB 3V6FA 4CU7A 1ZGLB 4UT7L 4XB7A 1GW0A 4NOBA 4XO9A 5E9DA 3IU3B 4OZHB 3KWWB 4W1TA 5ALCH 1MHCA 3CX2A 3CE1A 3MRIA 3P2BA 4KZ0A 2DJMA 2W80C 4Z76B 3D0VA 3QXDA 3MZGB 3JTSA 1FUNA 2ZXWB 1FL6A 1MFEL 2I9LB 2IH8A 4NZTL 1S7XA 1JF6A 1FC1A 1N5YL 5D7KD 1OALA 1KEGH 4FQCH 4UT9H 3W11D 2A0LD 3V4UH 1U0QA 1IL1B 3INOA 4MCNA 3NBNA 4K4KA 3ZKND 3PE9A 4U4IA 3RL2A 1KPUB 3Q1EA 1A4AA 4Z95L 5I75C 5F0JB 4QRAA 3SPIA 4TUUA 4MXWH 2CM5A 2H1PH 4F37F 5B7FA 2WZ0A 3K6SA 3MRNA 5F2FA 4UUJA 3UTZB 3T8MA 2DWEB 3TPKA 3FTXA 5A2KH 1BFOB 4YDLB 2CZNA 4PJGA 1II4E 4ANVA 3ECWA 3EW3B 3PWLA 1QSVA 4NS0A 2ATKA 1FNLA 3N06B 4WUKL 1I9RL 3VFNB 4XOBA 1EBAA 3WJJA 3O6FB 1E2WA 4PB0L 1T83C 5HBBA 1AKJB 4EBQL 1WAAA 3WLWC 5CCJA 2V2TB 2RHEA 5EDXA 3DMMA 3SKMA 3H4HA 1SMDA 1PX4A 1ID5I 1BM3L 3MJ8B 3BAEH 2FL5A 3CU1A 3HZKA 3EFFB 4HCRL 3SPGA 3IS1X 3NIGE 3QZWA 1NEUA 4PJBB 2Y1YA 2MRYA 4OSUL 4NQEE 5C7ZA 4G7QB 1L0PA 3O41A 3OWEA 4HIHB 2R2BA 4KK6D 4KROC 5MP6L 1U21A 4PJ5B 4QRFA 1NGZB 3DRQA 5DD6A 4K8RC 5SX4I 1ZT1A 2KZWA 4NO3A 3FAWA 5DD0H 1YMMB 4C8XA 5L2KE 2WN2A 4GYBA 3CZKA 5D4QA 5GS0L 1K8IA 2GJPA 4AEFA 3QQ4B 1AE6H 1HQRB 5F0LB 5F9DC 1QW8A 3BVNB 3TWYA 4FLRA 4H88L 2IXQA 2VR3A 1NQBA 3L4CA 3GMNA 3DIFA 3MA9L 5C92A 3K71A 2AJ3A 3MKKA 1FLRL 3NJXA 4WY7L 3ARDC 5CMAA 4QHNB 4N0YL 2GJZB 5GGRY 2MMXA 4P4RA 1Q9KA 5CM1A 5DHDA 2DS4A 3D5OF 4TV3A 2APFA 1EO8L 4Q58C 1E28B 3P3TA 4YHOL 4CADA 4ERSH 4B7LA 5EEWA 5LGJB 3MLVH 5D72L 3ZDXE 5KW9L 4IMLA 3ZZSA 1SJXA 3E0GA 5M7QA 1OE1A 2OTPA 1ZLUH 5IESH 3HCVB 5HGHA 4FI8A 4K5MA 4Y4FC 2BVQB 2R8SH 1RFDL 3EJSA 2AABH 2ARWA 5KSBE 5G5DB 4TRPL 4B97A 4KHTH 1IUZA 2ZX8A 1NCGA 3DROA 3SDDC 4WWKB 5E99L 1HTYA 2IH3A 4BFIB 1AO7E 4A63A 3I9PA 4JM2C 5HGDB 2CNYA 4IK6A 3VD2A 3PGCB 1YMHA 4U1GB 1JDCA 2EDDA 4DESA 3B8SA 2VN3A 2WCPA 4GG8A 5CLWA 2W60A 1V8HA 3ZJAA 2DQTH 1ADQH 2HJLA 4Z7WB 3MV11 1SF3A 3NAAL 4GSRA 3VGAB 4JKPH 4WFFE 4YS4A 2Z8SA 3UTTB 4WW2F 2IOIA 4QTIH 1NKOA 3KLDA 4OKDA 4KMTH 3G5VA 4PGCB 2H6OA 5CKGA 1AHWC 5EMYA 4RGOL 1JPTL 3J7HA 5DRNA 1A5FL 4X5WB 5D1XB 3OR6A 1LDSA 4D8PB 5G55A 1I8KB 2Y07L 2OR9H 3ATFA 3WEAA 2HVBA 3SYOA 4MA8L 4JG0L 4TVSa 2YPKB 2J6EL 4YL9A 1I8MA 3MRJA 1WFUA 4WI7A 2CK0L 3MLSL 4JRYD 1A3RL 4IBQA 2HMID 1PL3A 1QABA 3TA3A 5EC1B 5E8NA 1MIMH 5FB8B 4MA3B 2VXTL 2X9WA 5AG9A 3I6LE 5KJRL 5CF3A 2EIJB 4UILL 4R4BA 2Q7NA 3H54A 1JRHH 4GB9A 2A9BA 5DMYA 3GI8L 2EYTB 3WAKA 1W0VB 5IT2H 3V52L 4PP2B 2R2CA 5HVFB 2XXGA 1J9RA 3WFHB 1D6VL 1A6AB 1OAQL 1T20B 4XB3A 3FBKA 1MCKA 4AGLA 2Z0UA 2VZSA 1ZIAA 3B4NA 4HJGB 4JPWL 1BMZA 2O61B 4WNQB 5DI8B 3KJ6L 4OFQA 3KNBB 3WFCH 1YNKH 3RZCD 2C7FA 2MH4A 4OLXL 4ZO6A 3GBEA 4Y16C 2IPTH 3GSVB 1XMEB 3LTVA 1MCWW 1P6AB 3SBRA 4JFYA 3FFCE 1CGTA 4FNLH 3SQOH 2O1AA 4AUUA 1JPFB 5E6IB 2J1XA 4APXB 2JXMB 4DP7X 2DYRB 3S2AA 3SJVE 3Q1SH 5A43C 5L7XH 3MRPB 2A6DA 2ICWA 3CZSA 3X11A 1FYHB 2JVUA 1Z0NA 4GRWH 4IKLA 5IVNA 5KWYC 3WFZA 4M02A 3B9KC 1DN0B 3SQRA 3FHQA 3JTTB 2KLTA 4DHLA 3WKQA 3WEMA 3L3OC 3CDZB 4C56A 1YNTA 2IQAB 4F24A 4K9EC 4ZXBB 4YXKL 1Q38A 3MLWL 4DP6X 1P7KB 2DEXX 3EJJX 1IC4L 4ZS6C 1ZS8A 5D71L 1HI6B 3CXHJ 3FT4A 3U7YH 1Y18B 5IB1A 1CDHA 3ASWA 1KYOK 3QO0A 3V0WL 3IAPA 1UM5L 2Y5TB 3QEQB 4J12A 1NUNB 4N90E 4NHCH 4CBPA 3KPRD 4IRJB 1J11A 4PLNC 4QGTA 3VXPA 1O6TA 1HHHA 3T2QA 2M8XA 4OJFH 1J0YA 1G5GA 1NBZB 5J6GA 2WP3O 4GW4A 2J4WH 4PI0A 1TLMA 4M1GH 3IXAA 5K9OB 2OSLB 5E4AA 1SYSA 4POUB 2JELH 1CBVH 3MLTA 4FTVB 2JKIS 2ZUYA 4P4KA 2VDQB 3L3KB 3CLWA 5ICYA 3WLWD 4NKQB 1F6AB 2WWKT 2J5LB 1PLGH 2UY6A 4EI0A 1Z32X 2Y06H 3WYRA 1Z1WA 1PFCA 2AI0H 2AGJH 3FH7A 3T3MB 2WXRA 4JLRB 4K71B 4RLDA 4XP6L 5AB1A 3TGXA 1A9BA 3I75B 5IKCB 4OV5B 3O6KL 4Z7UF 3L4TA 3W56A 4Q8BA 3X13A 5LDUA 4YOKA 2ZX5A 4QRSB 3E9UA 2ATPA 2OMTB 1V54B 2Q10A 3HC3H 4XN1A 3TBCA 1MCOH 2JQMA 3RKPA 5J57B 4K8RD 2Q5BA 3QUGA 4UTAH 4H2CA 5L8KB 3JWNH 2IAMA 4HG4K 3AB0C 4P5MB 1WDAA 4A7GF 3D05A 5E8PA 3J27A 1J10A 4LAQL 1OAUH 5TQ2L 2CBTA 2QVMA 3B6SB 2UYLA 1WG3A 3ARDD 1CR9L 3JWNC 1RV6X 1TQCC 1GHFH 3BZFA 2XN9E 1IEAB 4H1LA 4X7TA 3F58H 2D03H 3FUKA 1EVTC 4DW2L 4U6HB 2QVFB 5B39B 3IVKB 2FIKA 4LGSB 4O02B 2IBZX 1RZ8A 1EZVX 5GHWL 1KUMA 5LBVA 3UYOD 2BSTB 2VJ8A 3WMSA 3U6XA 5JTWA 1NGPL 4Y4FD 1CCZA 1YEFL 5D7SH 3LN4B 4NNYB 5SX5H 1BQRA 2N56A 3PXLA 4W9HC 1LJMA 1N26A 3RWCB 3CZLA 1UM6L 4FD0A 4JHUA 2FWSA 3WN5A 1KGIA 3DLQR 1UACH 3SDDD 3S48A 3OXSA 4XVOA 5IROC 4GI8A 4M1CC 4JM2D 4EDXA 3W0WB 2FO1A 2OP4H 1OAXL 5FYJH 3MBXH 5BVJB 1HS6A 5B8CB 4G8GB 4ELMF 2XQBH 4N2OA 5DJ0A 2EC9U 1QASA 1DJYA 4N5EC 1U8QB 4X5PA 5KVDH 2HVKA 2WAQA 5HDQH 5DUML 5I1AA 3W5NA 2Q86A 4M4RB 1Q9LB 1NEZG 1LE5A 1NAKL 1JPGB 4Z8FL 1QSFB 5JOPD 2IPUG 1BZQK 5L0QB 4NFDA 2W65B 2ZNWA 2B3RA 3VWJC 4TUJB 2MOQA 2AK4E 1BQHA 1KELL 1Q94A 4HA1A 4QKTA 4UT7H 1EDQA 1ZMYA 2ZG3A 4PVNA 2QQKL 4WJG3 2Z91B 4KX9A 3WO3B 1G94A 2D31A 2PLTA 2EDHA 5FPIA 4LNRB 5ITFA 2V7NB 2R1YB 1WBYB 2WD0A 4ZAKA 5CWSA 4ATWA 3HZYA 3MACH 1SXSA 4RFEA 1TSRA 4NENA 3TBBA 4IGBA 3SPVB 3D18B 3QDJD 4U7KA 3ZL2A 1MVUB 1MFEH 1XGQA 2F1BA 3MJWA 1HZLA 3R06A 4PHXA 1DVQA 3BP4A 3HLAB 2EIEA 1CYWA 4JGJA 2YPLD 1UQSB 3C2AL 3B7SA 3BZ5A 4XNUL 1QACA 2BRRL 2GUOB 1YPZE 5BO1H 2EDKA 1ZA3B 1G6RL 1JDAA 4FG0A 3U6XS 1EEUA 4HBQA 4X9YA 1CFVL 4UQ2B 3PWJA 1TENA 2E6JA 5D1ZB 4Z95H 4Z3IA 2ZXCA 2JKLA 4J3OC 2A1WH 2X05A 4WV1C 1HE8A 3REVB 3RTQB 4JN2B 4KX7A 1P1VA 4HDIB 1BF8A 1SN0A 4XTRC 1SJEB 5KBNC 1TF4A 3OHXC 5IREA 1A1MA 2P49B 1EZSA 2NUPA 3HFFA 4Y16D 4AYSA 4WUKH 1I9RH 1O6SB 3GLAA 4PRPB 3Q13A 3GBNL 2R29A 1DQML 4Y2DC 4BSVB 5A7EA 2WKOA 3WO4B 2P3YA 4EBQH 5BUGA 2VCOA 4QLRA 2PO6A 4NQCB 1KB5B 3RFZB 2B39A 2GIMA 5DJXB 3IDMB 1DQJA 4JKWA 5LJYH 4WO4A 4HCRH 3O4OC 3U1SH 2JKJA 5TH2A 3B9KD 2YRLA 2AJVL 3AS2A 2FSEB 1CTNA 3LKPB 1IGTB 2AQ1A 5F3BB 4OSUH 2Y25A 2FD6H 5EF2A 1MJUL 4F92B 3OKKB 25C8H 2BOBB 4FE9A 4LF3B 4FXLA 1NANH 2GUYA 2OCCB 3TEXA 5KBMA 4GMTL 4X6CE 3CH8A 4HK0B 4ICXA 1ZSHA 1KCRL 5DD5H 3NJLA 4ZS6D 2ODIA 1EDYA 2AQ3A 3T6XA 5ESAB 3VM5A 4BYHA 3BQVA 3UIZA 2EE0A 1P5UA 1H15A 2DMHA 2P5WD 3FXIC 3T0VA 3MA9H 1Y7VA 4V2BA 1A66A 1YEDA 1M1SA 2I69A 1LILA 2XZZA 1FSKB 4IIZA 4N0YH 2VITB 2ZOKA 3QJUB 2J1YA 1ZSDA 4UV4H 2FO8A 1CIDA 1KN4L 5KW9H 5IIEA 4LCWD 3W2DL 2FDBP 1L9MA 1KJ2B 4F2EA 4P23B 3VW3L 3RIAK 3V0AC 4U31A 4NP9A 2QPEB 3C08L 1U8NA 1ZHBA 2C9XA 1UTDA 1L9NA 2NOYA 4PLJC 3VXUA 3FFOA 1HEHC 1YVLA 4UAOB 4ZFFB 3K74B 3MRGB 2E7LA 2X4PA 4TRPH 2BVPB 1KMGA 2DBLL 4JMXA 3Q44A 4MNGE 5E99H 2KHAA 1KOAA 3D39E 4LCVA 2VW7A 1U8MA 1JGEB 2B1HH 4X6BA 2NW2A 4U7SA 2DWXA 4JFEB 5IHLB 3TYGL 2ALAA 1NMAH 1UYWL 5IB3B 5AVXB 3FN0L 3T1WA 1H6FA 1HNYA 1U6AL 1JNLH 1IGYB 3FB8A 1MLCB 3DOHA 4LU5L 1KTRL 5ALBL 3NAAH 3NCMA 4ORGB 3ZR5A 1U30A 2J71A 3E7JA 4LEOA 4AQOA 5GJSL 1UD8A 2JSFA 2EEFA 2CSPA 3FO9A 3G5YA 3PHQB 4BGLA 4MJIA 2DBJA 2R2HB 5IHHA 2EDRA 4RGOH 1JPTH 4QTHB 4OCNC 4AMKH 1A5FH 5DQ9B 1AMXA 5CJOL 2BIQA 3RYMA 2Y07H 2OMBA 1FVEB 1J5OL 4ZBJA 3QA3B 1JBJA 3VI4A