4KVCL

2h2 fab fragment of immature dengue virus
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
212
structure length
212
Chain Sequence
b'NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig heavy chain V region MOPC 21, Igh protein
molecule tags Immune system
source organism Mus musculus
publication title Obstruction of Dengue Virus Maturation by Fab Fragments of the 2H2 Antibody.
pubmed doi rcsb
total genus 50
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kvcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kvcL01
2J1KA 3TBVB 5KG9B 4UAOB 2LAAA 4R0LC 3RUGA 3D0LB 5HDLA 3PIQB 1ED3A 3TWCH 2V7NA 1NANI 4HC1H 4WO4C 4TUOA 5FUOL 4CU8A 3WDJA 4KUZH 5D7JA 5IB5A 3RWCA 2F74A 4MJIA 4CADB 4N0FA 3F7RA 3EYSL 3EYQC 3T08A 4OUUB 3FN9A 5EO0A 3QDAA 2VDML 3MR9A 3D39D 5I30L 5D72H 1Z2KA 1U0QA 4EEEA 2X4QB 1H3XA 4HJGB 4JFYA 1N0LA 3EYOA 3ZT5A 2VLRA 4S1RH 3EO9H 4K3EL 4FQJL 4OZIA 3ZKMC 2YRLA 5K9QG 4HIJB 2FB4L 4LLVB 4P3DA 1MCOH 4G9FE 2NX5E 5AZ2L 1U8IB 3WFBH 3FQNB 2AI0L 1MCNA 2X4TA 5GGRB 4X0KB 2R4SH 4MB5A 1P4LB 4PS4H 2H2PD 4JRYB 2ADFL 4U1HA 1I3VA 1MJUL 5FUOH 1Z5LA 4NM4H 4GRMB 5DJXA 2WUBL 2VLJB 3EYFB 4NBZB 2HT4D 3SO3B 5LCVH 1NQBA 3O4LA 5EUKB 4Y5XC 4L9LC 1OLLA 4LRIA 3T2NL 5DRNA 4D0CA 1QP1A 3WUZA 4I3SL 1AHWA 1S7RA 5D72L 4QYOA 1A14H 4NKMA 3G6JB 4P3CL 3BH9A 4WHTA 3DBXB 3BRFA 5DJ8A 3D0VA 4X8XA 1ND0A 4OZFG 1WAAE 2JJTA 4JGUA 2YPLD 4PRAB 3UTTD 4CVZB 1JN6B 1NKRA 1RIUH 1A5FH 1QKZH 4HIEB 2XKUA 4XHJD 4HT1L 4QRSA 3P0YH 3SKNA 2OSLB 4N0UE 3MLZL 1AO7E 1GRWA 3MBED 1NCUA 1T0NA 3VWJD 5DK2B 3LAFA 1U8OB 4I9WD 5F7DA 5KSBE 5I8KH 3PWLA 4XXDA 2MFNA 1NGYA 1LO4H 5JXEC 3D69B 4FFWC 1XGPB 3TO2A 3QIUC 1UCBH 2CJUH 4EXPX 4HUXA 1ZHBB 4NDMB 3IRZA 3MV7E 3DUUB 3RPIA 1CLYL 4ZO9A 3FQUA 1CTNA 3QZWA 3DV4A 4AIZA 1IQWL 1VEMA 3BH8B 4MJIE 1AI1L 5MEOB 1T4KB 4P59L 1QR4A 3L95A 4O4YH 2EDDA 5B3JE 2ZUUA 3MCKA 1MAKA 1KLGB 5EIIA 2FWOB 1JWSA 2GJ6A 3KPMB 3QUKB 3N1PC 1MPAH 3QB7C 3ULVC 3QI9C 4BFEA 4LVOB 5DI8A 3S4SG 5ETUB 5I8KL 1I9RL 1ZTXL 5MEPB 3RTQA 1G1CA 3UTSE 3ZKXC 5I15H 5CGYC 4HMDA 5D5MB 3NN8B 3HAEB 5BS0D 4GJTB 3LS5H 4MD4B 1K4CB 1AKJA 3DVGA 4LLAA 4OKVA 5CCKL 4Y4KA 3WN5A 5CEZD 2MCPH 1FZOB 4X5LA 5ENWB 4P2OD 5J0BA 3QDGB 1KCVH 2COQA 2Z92B 4HS6B 3OXSA 3QPQD 3OKLB 2OXGA 2ORBL 1I1FA 4WUUB 3L3IB 5HPMA 2EIEA 5DI8B 1KJVB 4RSVA 5C2BL 5K9OB 4C56E 3C5SB 4BZYA 3KPQA 3MRFA 3E6FB 4EDWL 1U3HD 3VFTA 5EOQL 4W6XB 2NTFA 3X3GL 1JF1A 4HJ0C 4WFGD 1U58A 2F15A 5JOEA 5EH1A 2J12B 4TVPL 5I74B 2ICWJ 2QKIA 5DDHB 1U8MB 5BRZD 3VJ6B 3C8DA 4AG4H 4QRQA 3GIVA 4UNUA 2LTQB 3EYFA 3U9PL 1TZGH 4RFEA 3BPNB 2NY0B 3MOBH 1ERNA 3BWUC 3LRHA 1MCCA 2VAJA 4XC3H 1MHEA 5E00B 1R5IB 1T89C 3ZLQC 4DQOH 2ZOLB 4U1NA 3QUZA 3SHSA 1GYAA 1MVUB 2GQHA 2I24N 1D5ZA 1Q9WB 3P3YA 4RIRA 2WINA 3DNKA 3T0AA 4M4RA 3V4UL 1NBVH 4HPYH 3UTPE 4XNZB 2I9TB 1FORH 2FO4B 2AS5M 1F2QA 1BECA 3ZSTA 3MRKA 5SX5K 4EQ3A 1KN2H 1E28A 5EDXA 1Q94B 1EO5A 3PGCB 3HFML 1A6UH 3W9EA 3RTQD 2AJ3B 4PRHD 3L1OL 4WJ5A 3VU2A 1HH6B 1MCBA 4XMKL 1U8QA 5EBMA 5J9PB 2D7MA 1D5ZB 3UBXI 5IB5B 1NAMH 3O6FA 5T3XL 1N0XH 1TJHL 3HE6B 4MJ2A 3PIQA 2WP3O 4HGMA 4ETQB 1L0QA 1WWAX 4FZ8H 4JVPA 2VISB 5GIRB 4YO0B 4GW5A 3AS3A 5FO7B 4JFFE 1KB5A 5F6IB 4FTVB 5I1AA 1FNGA 3DURA 2A77H 4NZRL 4YHZL 4HUVB 1OW0A 2BY3A 3DTXB 3QJHB 3SE4C 4NFBA 5K9KB 5B8CC 4LLYA 2HWZH 1A1MB 3L9RB 2VLRB 4M5YL 4ODTL 5ACZB 5CUSH 4HJJL 3H3KA 1CFBA 5MEQA 1JHTB 2WBJC 1G7IB 1D9KC 2FD6L 1I7TA 1HSAB 3RVWD 1QSEE 5F7UA 1GZPA 4PGEB 4Z7NF 4M02A 5HHNA 5ETUA 5MEPA 3BYTA 4OGYH 2DDQH 3QIUB 2BSED 1WC7B 1FAKT 4NBYB 1K4CA 2Q3ZA 1NGQL 3B8YA 5IJKA 4L29B 4OQ1A 3RU8L 2QQKL 3ZKNC 2JTDA 2ZP0T 3D25B 4LHUG 5HVGB 5DURD 4OCNC 4HH9B 4OF3A 1U41A 5D6CA 1EFXA 3BE1L 3PGDB 2OBGA 4O00A 1ZKAA 1IC7H 32C2A 3TH2T 2AW2A 1S7UB 3O3UN 5C6WH 3OB0K 5E6IA 1IL1B 5BZDB 1AIFB 2WUCL 5JOFA 3LQAL 4L29A 4X8JA 3GNMH 1T2JA 1ZT4B 3P40A 3GJFB 1DBKH 3S9DB 4RA0C 2DKSA 1DBMH 3TO4D 1RUMH 1XCTB 2ESVA 4UQ3A 1WT5C 2CSPA 3DVFA 2J8UA 4YAQA 1F97A 2FIKA 1B4JH 4L4TD 4IIQA 3CFEA 2LE9A 5DUML 4WFEE 2YD4A 4NQDE 5FDYA 3O3EB 2EEBA 1CT8B 1I9IL 4UIMB 3S37L 4XVJH 5ILTL 1FQ9C 3D9AH 2X9YA 3KPRE 2VR5A 4HIEA 3RJQB 1VESA 4PYGA 1K2DA 2CQVA 4N1HB 1R3IH 2OR7A 5I17A 1YMMD 2IANE 4WTZG 3F62A 3MRMA 3O3BA 5J06A 4XP4L 1AQKL 4JPWL 1MY5A 3SCMA 3IJSB 3SKMA 3C6LA 2Y4SA 4FQXC 4YGVB 3UZEA 4X5XA 1KTRL 1QRNB 5FA3A 3QJFB 5HGAA 1JV5B 2X4TB 3UJTL 1T7XA 5GSVA 3IFLH 4LF3B 1EDQA 1MUJB 2DIAA 4OD2B 5KVDL 1NBYB 4JKPL 3MRCA 5IV2B 5L2KB 1G9NL 3S37X 2AK1L 2VQUA 2FJHB 3VFUA 3EYVA 4LGPB 4WI5A 2QSCH 1T7ZA 4BSVA 1RJCA 1I8KB 3HNSL 4DKFL 4DVRL 3OHXA 1MJ8H 5DYOA 3DUHA 2E7MA 3U82B 3TPKA 4KH2A 4O2CB 4RQQA 1CDIA 3MLVL 2VE6A 4Y4KD 1MWAB 4MXQC 1A7NL 1DEEA 2FX8H 4L1HA 4LLDB 1UXSB 1TJIH 4XCNB 5CWSB 3BMWA 3T2PA 1WZLA 5D9SA 4CN4A 3ZYOA 3DIFA 1UXWA 1A3RH 3VXSD 3SDAA 4UTAH 2F54D 2NY3C 1JWMB 2HH0H 3FQRB 1WEJH 3L3KA 4IM8A 3UJIL 2H3NA 3QUMB 4XH2A 2IADA 1CBVL 3QUYA 1DQTA 3N9GH 1CF8L 4DKFH 1OP3H 4X80L 4ZPTB 5GGSY 4JZJB 3K7UA 4ZOAA 2CPCA 5FGRA 2Z31A 1X5JA 3VH8A 3FKUS 4M6ML 5CSGA 5IB2A 4JN2A 2N7BA 4OCMC 1C08B 2Q6WB 3OJVC 4X6EA 1LE5A 1Y6MR 1QQDB 5KSVA 4XNYH 3SGEH 4PB9L 5ACMA 3B43A 4KAQH 1JTTA 4XVTH 4JQVC 2BVPB 5KJRH 4ZS7L 4YX2L 3CXHJ 4I3GA 3IAGC 1JRHH 3REVA 3ARBD 3FAXA 3SE3A 2CDGA 1T6WA 3LIZH 2Y5EA 3KS0J 3GHEH 2N4IA 1ZVYA 1X6LA 1ED3B 4IRJD 4XWOC 5C09E 4XCYA 1H5BC 1NMBL 1CN4A 2X70A 4UOJA 4F7MB 4WV1B 4WI4A 5JUEL 3S88H 4ZOCA 4PJFF 1RMFH 1LNUB 2OR9H 3IKCB 4AT6B 1RZ8B 1F11B 5C9JA 4QTIH 1IM3B 3IU3A 2Y9RT 1G7HB 5IVNA 1RHHB 3BZFB 3KXFD 5L2JB 3HE6D 3O81A 3ESVF 1BOYA 1WT5A 2H2SD 1W72A 4NJAL 5C07A 3UTQA 2R2HB 3CDGB 4JHWH 1XGRB 3TO4C 1ZS8A 2B2XH 3MRCB 4O2FA 3RNQB 3S36L 5IV2A 2A83A 5D7SH 4WTZA 5IMKB 4WU7A 3VXUB 2XIDA 3VCLB 5E99H 1I8LA 4KZDH 3JXAA 1XGQA 2C1PB 2F53A 3KYKH 2AAVA 5HHVH 5D1XA 3LKOA 3SOBH 2JB6B 4HEME 4HFUH 1FL5A 3DARA 4R9HA 1DQLL 2C4XA 2WINB 1XEDA 2EE3A 4X4YA 2XZAH 1M7DA 3BGAA 1FCGA 2E27H 5T33L 4S1SL 5AZ2H 2J6EL 2WBJD 3IDYC 2GITA 4ZUUB 3ZE0F 3VD4A 4QT5A 1I1AD 4MSWA 1KIRA 3DROB 4HAGA 2BX5A 2OL3L 1B90A 5DFTA 4PGBA 1NL0L 3AGVA 3Q5TA 4CGTA 4R0LA 4GRWF 2ED7A 4HV8B 3IDJB 4HWEL 4XP9H 1U8KB 3U6RA 3G6DH 4MQ7A 4Z7UE 1VFAB 1JMXA 1GJIA 3PJSA 2DM4A 2W0LA 3PWPE 3OPZH 4WJ5B 5E2WH 4PJ9B 5DD5H 2ZUQC 3G5YA 4TTDD 1OGAE 5HI5D 3L5WA 1QRNE 2FO4A 2J4WL 4W4NA 5M94B 4JKWA 3P4OA 4OCXH 3SDAD 4YNYB 2I07A 1KLUA 3NIFF 5LGHH 3F7YA 1J5OH 2ILLA 1KIUA 1KN4L 4IMKA 5AEAA 3VRJB 5IW6A 2YEZA 3PABA 4OSUH 3G5VB 4Q9RH 3LKRB 3PV7A 3CGTA 4BH8B 4IOIB 1M71B 3S34H 2SEBA 2V7NB 2R1YA 1MNUL 2NY4B 5C0GA 4EVNB 1FNFA 1RVFH 5EU5A 3MPCA 1KLGA 2L7UA 1U8QB 5J9PA 1HOCA 3GHBH 2PETA 3S4SA 1J8HA 2GY5A 5HGBB 3UEZA 5D7IA 1ODAA 3M8OL 3NIGF 3QWOA 5DJ0B 3OKKB 3HA0A 3JVGC 1LEGB 4G6MH 4R4NC 1PZUB 1KF9B 4OLZL 5D2LA 1F8TH 4C83A 4WFHE 4ONGL 5DD3H 2I9TA 1TLKA 2FX9L 4XTRC 5ALCL 3SE4A 1KLFA 1HEZB 2KDGA 3QG7L 4RGMB 1E4XI 3D69A 3OXSB 5HBBA 1UM4L 5BOPA 4DGVH 2Q7YB 5JA9A 1N59A 2D7TL 2R8SH 4P2RD 4Y4HC 4MA7H 2R0KH 1KT2B 1NCWH 1NGXB 3F7VA 3GRWA 5DTFA 5T1KA 3ARTA 5IQ7H 4KZEH 4FFVD 4QXWA 5DRXB 1A6WL 1WLHA 1H0DA 1PSKL 2QQLL 4U1IA 5GGUB 1LDSA 4XPGL 3OGCB 4MMXC 4PJXF 1HWHB 5EIIB 1JZ2A 2PXYC 2BC4A 4JFXA 5C2BH 1DN0A 5IR1A 3A6CH 1H0DB 4CMMA 3B9DA 4OFVA 3HC0B 5FYJE 5E9DD 3PXJA 4I18B 3D85A 2DQHH 4I0CC 4L4VA 2VKWA 1Q0YL 1S9WA 4NHUA 3MUHL 3IFOB 1XIWD 5D1QB 5KN5A 1K4DB 4QRPD 1A1NB 3KYMB 3EO9L 1FVCB 1L7IH 1T5WB 3V4PH 1OM3H 1FRGL 2XPGA 4NO0B 2NW2B 2P5EE 3DGGB 1DE4B 4GS7B 4MVBD 5E5UB 3DRQB 3QI9A 1XCTA 5BMFL 3N1QC 4NO5B 5JDSB 1NBQA 3FTGA 3PP3K 1ES0A 1EFXD 5FA4A 1EHLH 5DZOA 1ZT4A 3QI9B 4KK9C 3ARDD 3EW3B 4P2CG 4G6FD 3KPNA 5J13C 3BPCA 3OJDA 3IGAA 3VGAC 4NCC1 5CILH 5FOJA 4HAFA 1T03H 5AUMB 3FN0L 3RZCD 2LU4A 1Z9MA 5MEOA 2E7HA 3FB7A 4HD9A 1OVZA 4JE4B 1DLHB 5CBAB 1BJMA 4F7MA 3MRMB 4QRUB 5GS1A 1WTLA 3PNWB 5FHBH 4LOUD 1BAFH 2GFBA 5HHME 4G8FA 5TJWK 5L9DH 1FZKA 2R2EA 1FGVL 1FRGH 2OI9C 5IMMA 3HRZA 1ZLUK 2IFGA 4X6BB 3BDXA 4TYUA 1F42A 1OPGH 1XF2A 1JTPA 5DZLA 4ZUVB 4XX1G 2P43B 1FL3A 5TPWL 1IC4L 3CLFH 5DHXB 2Q20A 3Q3GB 1M1SA 1MY7A 1S5HA 2C7UB 3MJ9L 2HG5A 4N0UB 1HEZA 1URLA 4JY6B 3C2AH 2QADD 3EFDH 3H0TA 5DD0H 1T1YB 1OD7A 3B6SA 3SCMD 2R29H 3TC9A 1KULA 3FOLB 1WWCA 4GXVL 4R3SB 3DO7A 4P5KA 4NZTH 1ZT7B 5SV3A 2GCYB 5CBEB 2HJFA 2WWKO 1BQLH 2ATKA 5DVMA 4OB5L 2VIRB 3ARFB 4QXTB 3TN0B 4KKBC 3U0PA 5FCUH 3MBEA 5EULV 1EERB 5FO8B 4KWUA 1FVDB 3T0EC 1KIQB 2PTUA 3FT3B 3S4SB 5JHDB 4FQLH 4LIQE 3OAUH 3IJHA 25C8H 3T3PE 5F1OB 4LEXH 4PJAA 3O2WL 4JCMA 3K1KC 3OZ9L 2ATKB 4N5UA 2EYSB 5DD1L 5C92A 1FNSH 4MLIA 3SE3C 1QSEA 3BSZL 3EO1A 4IRSA 3MRBB 1MRCH 2G5BB 1HNFA 2IEPA 2P24A 1QFUL 1YMHB 3UC0H 4MB4A 2BXZA 2YSSA 3FRUB 3QUZD 2WIIA 3UTSB 3ZHDA 4QRSB 3SKNB 3VRJA 3G5YB 5GGVH 1MCIA 5SWSD 2P5WB 5C6TL 1KCUH 5E2UL 1IGYA 2DQGL 4CJ0A 4WUUD 4ZFFB 4JFEA 3I75B 4D9RE 2D7OA 3WCYA 3B2UC 1I3RB 4AIXA 2W9DL 1R5IA 4PTTA 3MV9D 2EDTA 2YD2A 1DUYA 1TQBB 5IB3B 1F6AB 4IRJC 3Q5OA 3L7EA 1DBBH 4RAUA 3IDJA 1TQCC 2JJUA 4HMCA 1FO0H 5KTEL 4GW5B 3SCMB 1FFOB 1AKJD 4LASH 3UJJH 3B9KD 2F9BT 1D9KB 5AAWA 1UYWH 2PW2A 5GGRA 1IRAY 2VJXA 3IXTA 5GS1B 1C7SA 3GSVA 5I1EL 2OTUA 4GG6A 3QCUH 5K33A 3EUUA 1BPVA 5HYJB 2V2TA 5EORL 4PJCB 5F1IA 5C0BB 3CPLB 3WUWG 4JFYB 2KZ1B 3BIBX 3NFNA 3ORJA 3OKDA 4POYA 1I1AA 1TPXC 1C1EL 4XZUA 4IIQB 3RUGF 3VD9A 2F53B 4WDIB 5I75B 1Q9OA 5L8LB 1WICA 2BJML 1XAUA 5AWNL 2ZNWA 3RTQB 3QUXC 5J57B 4YC2B 2JCCE 2GJ6E 2OJEB 3U36A 4NRYA 5E08H 3HPJA 1FNEB 4QKXB 2A6IB 2BDNH 2WP3T 2HRLA 1CK0L 1KPUA 4PRPA 3CJJA 4HUMB 5SV4A 4G6AC 1HI6A 5HPOA 5L2KE 4NN6C 4OLWL 1JWMA 3FQRA 3HC0A 4Y19E 4F57H 4PLJD 3TYGH 3GMPA 3NH7H 3MRDA 1QSFA 4LCWE 4KQ3L 5ISZE 1BD2B 1F3JA 1N6VA 4MNQE 1K8IA 1QTYT 3NIDF 2AV7B 2EDBA 1QHOA 2Y25A 3AUVA 4N5EC 2PCPB 1G84A 2Z0BA 4P23A 3NZHH 5FM5O 1UENA 5DMJB 4Z0XA 4PJHF 3Q6FB 1VERA 2DMCA 3LHPH 4HXAH 4N8VG 4MS8D 5FEBA 1CI5A 4R96A 4G7VL 4TVPE 2LTQC 4Y5YB 4P2QD 1WBXA 2ICWA 5C0BD 2K1MA 5IKCA 4LPVA 1AC0A 5LAXB 2WZPD 3ZL4H 4FQIL 3SJVE 1UQSA 4P2OC 2R69H 1G6VK 1DJSA 4OD3H 1CXEA 5DT1L 4ZNEE 2V2TB 4YFDB 4DUWA 3TYGL 4WW2A 1UZ6F 4YHPA 2FHBA 4JDVB 4KQ3H 5T5FL 43CAB 1JCKA 3OKEA 2V2WB 3CUPB 5DURB 2OTPA 1J18A 4XXCA 3WNMA 3KLAA 3UCRA 3KPOB 3L5HA 4WO4A 1WSST 3HE6A 2CO6B 1DN2A 2P8LB 4N9GB 1MCOL 4PJ7B 4TUJA 4GBXA 2HTKD 3QZWB 4OM1H 3MV01 4FMKA 5JIIA 2WUCH 3INUL 4JY4B 5D5MF 1U93B 3ILPB 4PGJA 4HXAL 2LAGB 1KB9K 3L7EB 2R4SL 4X4ZA 2UWEA 1E4XH 2VZSA 1HK6A 5EPMB 3RVVD 3M17A 4RX4A 4Z76A 1DBKL 3ILQD 3IS1X 2NY5H 3PABB 1YPZF 3F12A 1GPOH 3GK8L 5FO9A 5F21B 4K8RC 2Q3AA 5GSRB 5I1DA 1J87A 4HIJA 4LLVA 4OCWL 3K1DA 3CCHA 3AM8C 12E8L 1KNOB 4HFWB 3GBML 4LPCA 3VRIA 1OTSD 3ZMRA 3QQ4B 3MODL 5C0DB 1V7ML 2IQAB 4XWGH 3OF6D 4OGXL 4ZFOL 1RUQL 3EJZC 2XXCB 1F3RB 4FP8L 4HCRH 1NBYA 1KPVA 5I73B 5D93C 1MUJA 1JPSH 1IEBB 4OD2A 4RFNB 2HFEA 4QRRE 1CXKA 3MLZH 2I25N 5DRNB 4D0CB 3T0EA 5DJDA 3VJ6A 1FVCA 2VXVH 5I73C 2XT1B 2X4UA 3U0TB 1HHIA 3I6LD 1WFNA 4PRDB 4XB7A 4HUNB 1JI1A 4Q7DA 5DQDH 1IEAA 5EBWB 1YEKH 12E8H 2QKIB 2CJUL 4JRYA 1ETZB 2RB8A 4X98B 3DO7B 1LE9A 4OZGB 3HTLX 4L8CB 1S7XB 5C9KA 1MCRA 4Y1AE 3QULB 2W38A 2WQRA 3TGXA 5ELIA 3O6FC 5C07D 2IGFL 1I1FB 4WUUA 3K74B 1J1PH 1FCCA 4PJFA 4UAOC 2VXSL 5H35B 4G8GD 1CVRA 1SJHB 4F8QA 3MZGB 2ITCA 3QDME 4L8SC 1BX2A 4O5LL 1DVFB 2CLZA 5E4EB 4CNIB 5GJTL 3RY5A 1P4BL 3VFMA 3V5DB 1TVHB 5KSBB 3H7BA 5MP6H 5ESVB 3VWKC 1PX3A 3K0WA 3GB7A 2Z31B 4Z9KB 4F7EB 3F58L 1FFQA 3FO2B 4WI2A 1E6JH 3VXRD 4DKAA 4F9LA 1J0KA 3MV8B 3PGFL 4S10A 4NM8H 5CGYD 5FO7A 1BHGA 1QSFB 3E2HB 4L3CB 1JZ5A 3OSKA 4DAGH 1LO0H 3DMMD 2PTTA 3GSXB 3QCTH 4X80H 3I6KB 2NX5A 1NGWB 2R9HD 3WFZA 1CLZL 1RU9H 1UCTA 2ZJSH 1UG9A 1EJOL 1K8DB 4JG1H 4OM0H 3BZEA 4N5ED 4CN1A 5F9DC 5CWSA 4PRHA 2O5XL 3S34L 4XB8A 1JRHI 2E9IA 2IJ0C 3DRQA 5CZXC 1HSAA 3SE8L 1GL4B 2DMKA 5MEQB 2VWEC 2NY0D 3GHBL 5HYQB 1FLTX 3QIUA 4KUCD 3L9RA 4FQ2L 4KPHH 4RWHA 5TE6L 3AM8A 1EGJL 5FOBA 5CGTA 5HD8D 3TLRA 1KTLA 4UBDC 4G6JH 4KDWA 3V9FA 4HWUA 1E27A 3WHXA 4UDUB 3VXSA 2V9QA 3BEVA 3GMLA 4K9EL 4F15C 3SGKC 3SDCA 3VMPA 1OB1B 3QUYD 2X6MA 1NEZG 3JTTA 2KUTA 4CU7A 4HWZA 2DM3A 4HIXH 3HC4L 2HFGH 5KS9E 1OB1A 3CLEL 1Y0LB 5EZOL 4DZ8B 1MJJA 5E1AA 3RZCA 5IB3A 2FJFA 3AREC 4U6VL 4F9PC 3MV7A 4X6CB 3WUWA 5KOMC 5KVGH 2XWBB 4PJIE 1FAIL 3BPLC 1RUPH 5B4MC 1E28B 4FXKA 4ZFFA 5ESQA 1MFBH 4K2UL 2E7LA 4LDLB 3SKJH 3FB5A 2DDQL 2ARWA 2OTWB 3SE9H 1WBYB 5B39B 4YFLI 2VDQH 2Z9TA 5MENA 3BT2L 5E94A 1FFNA 1SM3H 2DI7A 4YHZH 1BQHG 1MVUA 1YMHA 4YHIA 3QUZB 5CHNB 5CEYA 2G5BA 3C5JA 2XYCA 1FYTD 1WIOA 3BGFB 1H3TA 3TBVA 1BGXH 3SPVB 4E41A 3W39B 3HG1D 2PO6D 2HRPL 5GJSL 1U3ZA 4FQXB 3EOAA 3HI6L 1B0RA 1XR9A 2HFFB 1IM9D 1MH5A 1XGYL 3KYOB 4OIIH 3DV4B 3KR3L 3EHBC 1S5IH 4ODSL 2I07B 4JKKA 4U6YA 1WFUA 4ZSOB 4O9HL 4F3FA 2GT9B 4NPYA 1DL7L 1S9KC 5EO1A 1CDBA 4WI7A 5ICYB 1S8DA 2OJZH 2MPAH 2AV1A 5DJAB 3EJJX 1N6QL 1RD6A 1IT9L 2EKJA 1RZKC 1U8HB 4JY6A 2XRAL 3QFJD 1SJHA 2YD5A 3QEQE 3TVMB 2NY5C 3DMMA 2XWJA 5I18L 5E5RB 4ONHA 4R7NB 3OX8A 4PGBB 4M03A 1QR1A 1EAPA 1S7SB 4MA3B 1Q0XH 5ENWA 3CC5A 5FGCE 4M1GH 3VXRA 3NA9L 5B38B 2H6PA 1TFHA 3L3DB 1RUML 3JV4B 1B0WA 4GKZB 4D8PA 2BSRA 2Z4QB 4DW2H 5IM7B 4E5XA 1S7UA 1BZ9B 3DX7B 3SQBA 3SJVB 5KSAB 4Y4FB 2YBRB 5EZLB 2OR8A 4ALAL 5JLZA 1GGUA 3CU7A 4X9IA 3TPUA 5HD8C 5K93A 4PG9A 3HPJB 3LH2L 3BIAX 4AJ0A 1ZLVH 2ID5A 4JVWA 5TE4H 5I18H 1HKLH 3GMMB 3TH3T 3Q6GH 4GH7B 1YDPB 4D0DA 3TFKD 1CXIA 1EH9A 3VGGA 2YWZA 2AEIT 4F2MB 1IKFH 4GAJH 1CWVA 1U8OA 3MJGX 3BO8B 1CFTA 3UBXG 2O5ZL 4PY7A 2JIXA 3BUTA 3MCLH 4CVUA 4LLDA 2A2QT 2Y1VA 2EDFA 1UWGH 3WD5H 1BEYH 3D3VE 3BZFA 5L2JA 3P77B 4D2NA 3HMWH 5I1KL 3ULVL 4OZHE 4CVZA 1S9WB 2DD8H 5D6DC 3HZMB 3QWRA 4OZFB 4NQEE 1GOFA 5I66B 1EEZB 4NKMB 3ES6B 2GSIB 2APXA 5D8JH 1PDKA 5HDBF 1XF3B 3MGOA 3VDAA 4C57C 3RFZC 2R56L 4KI5F 4EQ2A 1DVFD 1A22B 3GSQA 1WZ1L 4ELKB 1KCRH 1HHKA 1Y0LA 4KDTC 3VFRB 2W9DH 4PJ7A 5DGQA 5IFHL 1S78D 4EI5A 4R90L 3WO4B 3BW9B 4QRRB 4XRCA 3U9UB 2YPLA 4K8RL 4MNGA 1B4RA 4O58H 4OCRL 4YDKL 4B0MM 1OAXL 4TOYH 2F54B 3GRWH 1V8HA 4FQPA 4OFKA 3QRGL 4P9HH 2AK4B 3OKLA 1P1ZB 2AGJH 1E4WL 4GBXD 4F7PA 4X99B 1XT5A 2ICWI 2GTZA 5CZVL 4E42B 4X6BA 4L3EB 3QPXL 4JQXC 4MJIB 1DDHB 4XP1L 3W9DB 4ERSL 2EH8H 1JNLL 2UUDK 2PYED 3BDBA 3NAAH 1EEUA 3I85A 5FYKL 1AQDA 5FYJH 4LFHG 3MC0A 5BXFB 2CDEB 1KCSH 4XMPL 4L4TB 1X5FA 2P8MB 3X3FL 3QHZL 3P4LA 4HGWB 2HT3C 4RGNC 4BSWA 3QDMB 1Y18A 1J1XH 2DQTL 1KACB 3LCYA 5C0AE 2IH1B 2H9GB 1F58H 5T5NF 4C4KT 1DZBA 4EN3A 1C5DB 1H3PL 4OLUL 5DMIL 2BDNL 4M5ZH 2FL5B 3FB6A 5DA4A 4LSDA 3THML 2QHRL 2YXMA 3T0VA 2ITDB 3H3BC 1S78C 1LEKA 4Z7WF 2WANA 4PY8I 1OARL 1T1WA 5K9JL 1WCQA 1CGVA 5FO8A 3FFCA 1S7WB 4NZJA 3V5HA 3LRGA 1FG2A 5F9JB 5EBLB 4WFFD 1YEIH 3ARBA 2WQ8A 2VLRE 5TH2B 1N7ML 1ROWA 4TQEH 1QYGH 1F13A 2VB5A 2GYSA 5DQJA 4NHUB 2DOCA 4Y19B 4F7TB 2Q86A 4BH7A 1NMAL 2EDEA 3QHTC 1U3JA 2XQBL 3GSRB 4POUB 1I7RB 1LILA 4R26H 2OP4L 3RAJH 3O0RL 2G75A 3D39A 3R4DA 3H9HA 3GGWA 1NAMB 1KIRB 4JFXB 4TPRH 1R0AL 3IJSA 5FUZH 4FQQA 4QTHA 4K71B 1B6UA 3B5GA 5D5ME 2EIZB 4M8VA 5IVZB 3U4EB 1OL0A 4D94A 4P46D 4TSCL 5IMLB 4QHLA 1KTDA 4HKBB 3SOBL 2I27N 5TE7H 4KI5D 1UACL 3V0VB 2IBBA 1CCZA 4AIZB 3IFNL 1BBJA 3ZE1E 1LO2L 3LDBC 4JLRA 1KENL 4UT7H 3VI4E 4OFDA 4C56B 5EU4A 4E0RA 3I6GA 4L9LA 3PWNA 2KQMA 1J0IA 4F58L 3O3AA 4HLZG 4JQVA 2DJ4A 5I8CB 2G5RA 1YNKL 2CR6A 1NSNH 4U0RC 3RNKA 4KKCD 1YY9C 2OL3H 4U3XA 2XY1A 4Q6IC 2PW1B 3NCBB 3MXVL 4QHKJ 4CAGA 1O5DT 1INDH 2NY2C 4NNPH 3RI5F 3T4YA 3MV9B 3O8XB 4POZD 2PW1A 5DC9B 2R1WA 5D6CB 4KROB 5TQ0L 4KDVA 2FYYB 4LRNL 2Q87A 3RWCB 3JWDC 4NQEA 3X13A 2R0WL 4OGXH 4LGSB 1T22B 1S7RB 4GRWE 4DOHB 4LSSH 4FRWA 3JV5A 1Q1JL 3O2DA 1ORSA 4HS8H 5T3XE 4DN3L 1V3LA 3D3VB 2P8PA 1TCRA 2W0KA 2VIRA 2WWMD 2ZSVA 5T1LA 5JNYB 2X4NA 4HUWB 3ZYIA 3QA3B 1JGUH 5F3HB 3B9KA 3FQNA 5LCVL 3OXRB 3T2NH 2VLLA 4KTYA 3IXAA 1UJ3A 4QOKD 3UZVB 3WEXB 3I02A 4XVUD 5D7LD 1TMCB 3UYRH 1F4HA 5BV7L 4LRNH 2R0KL 3H9SA 1RK0A 2BNRD 1V3MA 4ZO8A 3I2CL 2X4NB 4HUWA 5DJ2A 4R97C 3BQUB 2EH7L 1DLFL 4XPFL 4NO3B 4XAWL 4S2SA 3RVUD 5LXGH 1N5AA 1HOCB 1S8DB 1YY8A 5HDBE 3DXAB 4M93B 5F96H 1ZHNA 4XH2B 3VGDA 3ISWA 4NWTL 3HS0A 5C0IA 3UP1A 1UJ3B 2XY2A 2GJJA 5JW4Q 2Q7NA 1NFIB 4KVNL 4AM0B 1PGRB 5KG9A 5D2LB 5CEXB 1F3DH 2VZ3A 3JUYA 2PYFB 2C3WA 1EZVX 3F7YB 1CFNA 3LHPL 2DYPA 3HR5B 4MGXA 3ARUA 4XP5H 1PG7X 1RZFL 3Q1SH 1RZJL 3ARRA 1ZGLA 2W9EH 4M7JH 4LSTL 1MFNA 1X5KA 5DD6A 5CP7A 4RISL 5MHSE 2VRAA 1P84K 1UH4A 4PJ5B 1EFQA 3TNNA 1BFTA 2XZQH 2EC9U 4IRZH 4F7CA 2PTVA 4NRYB 2FX7H 1KCVL 2IALB 5MEND 4JFZL 4WCYH 3CDGA 5ESAB 5J6HB 1OAZL 2R4RL 3TM6A 2BVYA 3LD8C 5ICXB 3WE6B 3VFSB 1T03L 4WEUD 4E0RB 2BP3A 5HYSA 1QOKA 3S3JA 4K7PH 2H32H 3ZKMD 1M6OA 1V7NL 1I9RH 1ZTXH 4XZUB 4QOKB 2EEAA 3MLUL 3RKDC 3QBTB 4FS0A 3KPPA 4NKIH 4OZ4A 1LO3L 3T4AA 3WIHL 5CCKH 2HJKB 4OV6F 5BMFH 5MI0B 3INUH 1NC2B 3B3IA 3OXRA 3DVIA 1F5WA 4U7SA 2J5LC 5HYSG 3BQUD 1UB6B 5BV7B 5HYJA 3I84A 3SKUD 5HYJD 1NFKA 3LKQA 1GPOL 4G6JL 4OAWB 2A74A 4V1DE 2IBGA 4KQ4H 3QISA 5KS9F 5D2NE 1OAZH 5DJXB 1N4XH 2F5AL 4W68A 2XTJD 2N7AA 1V7MH 4LU5H 4XWGL 4I5BA 3FRPG 4A6YA 4U1HB 1BAFL 5M95B 3MFFA 3EHBD 3BKML 5C0ND 3F6IA 1KN2L 3QDJE 4M9PA 1T1XA 4HS3A 3BPOC 4KJPD 5CKGA 1JFQL 4LCUB 1RUKH 1FZMA 5KS9B 4Y16A 3TZVC 1BM3H 2DQUH 3EO0A 5J6GB 1HHGB 4PY7B 3VCLA 1IGJB 3VI3E 1LGVA 2IADB 2MNUA 4XNQB 3BO8A 2WUBH 3QXAB 1IARB 4D9QE 1AD9B 1EV2E 4U3CA 1RZKL 1XF5B 3S96A 5JOPD 2MHAA 2VC2L 5IK3B 3PWNB 4EDXA 1VKXB 4OJFH 4YPGB 3OZ9H 2Q76B 2BVEA 2G2RA 2OX5A 3ARDC 3ARED 1B0GB 5DEGA 3BKMH 1LK2A 4WVRA 1D5BA 3BXNB 5C0FB 2CIIA 5FAAA 1DDHA 5DF0A 2CK0L 3MO1B 4F33A 4K7FB 4NNXA 3X17A 4BFGA 4PRNA 5CUSL 2H8PB 3AU1B 3T65B 3H9SD 4HLZH 4EUPH 5BVPH 5INCB 1QHPA 4U1MB 2QHLA 1R6VA 1EPFA 4DZBA 5KZCB 1EHNA 4XVUC 3LEVH 4MD0A 5CJQH 5HHOA 3F58H 5GS3A 1CLCA 1VFAA 4LCWA 1SHMA 4QYOB 2XWJB 3L6FB 4ODXB 2ADJB 2H3NB 3QUMA 1KJ3H 1YC7A 4WI3A 2XRAH 1I8MA 4D3CL 1W0VB 3REWA 4OFIA 4YDLB 3QNXA 3V5KA 4WI8A 4DGYH 1UKSA 5BJTA 3IDIA 1N2RA 5FIEA 3WSQL 3EDDA 5I6XB 4OZIF 3WN5C 3QQ9D 1II4E 3BKJL 3NFPA 3BWAB 5C08D 1KEMH 1CD1B 3I3BA 4JKLA 5KSBF 3NPSB 3QEQB 4MNGB 5I66A 1JJUA 1MWAA 4MD5A 1CE1L 1P4IL 2IG2L 5C0CD 1BOGB 1T7WA 2DLGA 4PLJC 3C09C 3HUJB 3DRTA 1Y6NR 3FRPA 4MWFA 2ED8A 3D1MC 1YQ2A 2EKSA 4WGWB 1R3HB 4PJBB 5KVMC 1I3GL 3G08B 2JIXB 5EIQA 2X40A 4D0BB 3MRGB 1BBDH 3GEWB 4R2GC 4LPUA 2B39A 2O93L 4JFQA 2FEEL 3MGTB 4MAYB 4QHUA 5E7FA 5C09B 1GSMA 1R3LB 1IZJA 2ADGA 4MWFB 4XP6H 4X7SH 3VRIB 3A0OA 1VFUA 4UT9L 4HWBA 4YBQD 5FV1L 4L4JA 2IAMC 32C2B 3P77A 4Y16C 3L7FA 1VB9A 3HC4H 2NZ9C 1P1ZA 4QHNB 4BKLA 5JLZB 2X89A 2J8UF 5F6HJ 2OK0H 5DFVD 3CLEH 5IMOB 4NWUH 4Z76B 2D03H 2X44D 4FZEH 5J11C 3ALWA 4IRSC 5FKAA 1PFCA 4ZUWB 4CMHB 4P4KB 3UTTA 1OAUH 5GRJL 1XMWA 4P2RA 4U1LA 5FECA 3RDTD 1YECH 3D9AL 4N8CL 4IS6B 3BP4A 4CDGC 2A9MH 5HJ3A 3SDAC 4HPYL 3MRIA 1KJVA 1GAFL 4NQVB 1U36A 2F19L 1IAOA 2XN9E 3T3ME 2RJMA 4YHNB 2UWEF 4LMQE 3CX5K 4S1DC 3BUYA 1U92A 4KJPC 4ZD3L 1YYML 3HAEA 4GKZA 4W4OA 3UJTH 4JN2B 4OZ4B 1T3FB 2PYEB 3P4NA 5DSCB 3AY4C 1K85A 1Z9OA 5D7LA 2CLRA 3QIBB 1NEZA 4G7VH 5IBUB 5I76A 4H0IA 4ZXBC 3L5XL 1EFXB 3PGDA 5C0EA 1C12A 1PJ9A 2Z91A 4NKOA 2PXYD 2NXZB 3DMMB 4N8CH 4YHOH 2I9LB 4E41E 2X7LA 3LVEA 4HUKB 3QDJB 2KH2B 3CH8A 2WNGA 4DEPC 4ISVB 4D0DB 3MLSH 3EJYC 5F1KC 5E6IB 4JB9L 1PVHA 1JUFA 2J8OA 1OAYH 4F37F 1T66C 2ZUVA 5EOCH 3MLYH 1O7SA 5IVXA 4UTAL 1B0RB 3KPTA 1JHLH 1KBGH 3FFDA 3VFPB 3MUGB 1L7TH 2YZ1A 1FZMB 4QXGL 4XBEL 5H8DA 1FNHA 3T0ED 3RL1A 1NLBL 1H8OA 2HTKC 3GUTA 3VFVA 4OQTA 3VFMB 5FFLA 5JR1H 4Q0XL 1QEWA 4XXCC 3SY0B 3MLRH 4ZS7H 3PHQB 4BZ2L 4PJDE 3ARSA 4AYFA 1J0JA 5IWLA 3VXME 1NMCC 3BJ91 4YHMH 5LWYH 2BNQD 2YPKA 4LVNC 4YDVB 4JFPA 4PJIA 5DR5H 1I8LC 3PP4L 4H0HB 5IP4A 1OAYL 4LSRL 3FOMA 1MAML 3FO9A 3MBEC 1HINL 1Q9LB 2X5PA 1A14L 1G7MA 1U9KA 3MV8E 2BMKA 3R1GH 5GGTL 2DS4A 2WWKT 3G5ZB 2XQBH 5BZWA 3ULUD 4WWID 1AH1A 1A7QL 5J12B 4PJEA 4J3TA 5I17B 5IFJB 3O6LL 4U6YB 1CG9B 5DUBA 2HT2C 3ULVE 2PR4H 4RX4D 1MH5B 5GRVK 3VA2C 4Q9QH 2R9HC 1MI5E 1Q9LA 5AG8A 4PJXA 1G9EA 3GIZH 4BZ2H 5HYSB 3P30L 3VXMA 4QEGA 4Y4KB 4YHML 5LWYL 1P53A 5HY9B 3MA9L 5EUOF 1OTUC 3ESUF 2AJXL 3MJ8B 1LO4L 4Y8DC 2E9JA 3VXUA 3MRJB 1JGEA 3MTRA 5SWSA 1E27B 4GSDH 3W2DL 3WHXB 3TNNB 3BP7B 5I1JL 1CLYH 4O2EB 4ZAKB 2NYYC 4NJAH 4LFHD 2CGRH 5IVXB 4IRJA 1WVZA 3DGCR 1IBGH 2Y72A 4N0RA 4KI5C 2D2OA 4NQCD 2ENSA 3MUGA 3L3JB 4FFYL 4G42B 2P44B 3EDKA 1D6VL 1RU9L 5IBTH 1N3NA 4HWBH 3IFPA 5CEXA 3WJJC 3HC3H 4WWKB 3QEQA 4HPOL 3L5JA 3DX9B 3MNZB 3T1FB 1DUZA 4G8IB 4NP4H 3QDJA 4QXUH 4AENB 3NBNA 4B50A 3P30H 4GT7A 2FJFB 4JKPH 2C3GA 3V6FB 4L3AA 4LEOB 5D7IF 4UT6L 5TQ0H 2DWDA 3LEXA 4NZUH 4OZGE 4WY7L 1CDYA 1OWWA 1CDUA 3LQAC 1NGYB 5JXEA 4JRXE 5KSAA 4CNIA 3C60A 1YY9D 1ZLUH 3W2DH 1YEEH 1KG0B 3HE7C 2DQJH 4NRXA 4PB0L 3JWNC 2BVPA 1AGEB 1K9TA 2P46B 3CXDL 2FCBA 4DOHE 4Y4HD 3OG4B 1VDGA 3L3GA 2Y06H 1I4FB 5HHPB 3H9HB 4UNVA 4ZFGH 2CRYA 4FQCL 1N64L 3DV6B 1NL0H 2GTWA 5D1XC 3B2VH 4I3RH 4XMPH 4QO1A 5CJ8A 5IKCB 1A47A 1EXUB 1IGTA 2BY2A 4ZYKB 2PO6A 1J1OL 3STZA 2VNCA 3OQ3B 4XNMA 4LP5A 1KG0A 1S9VB 5H35A 5EA0L 1S9XA 5EU3A 1TCRB 1XF1A 3S35H 2HT3D 5C71A 2HAZA 1CDJA 3G6JF 2A73B 2VISA 4JJ5B 3I9GL 2DMBA 1QSZA 1QA9B 5KVGL 1MFAH 4MCYA 5FYLD 3X14A 2A9NL 4UV4H 3RKPA 1FJ1B 2NXYB 1AGFB 5C0CA 2IPKA 3PWVB 3J8F7 1EUTA 5GS2H 1NUFA 3GMPB 2WLZA 2IH3B 1PKQE 1D7FA 2HMIC 4HIIB 5F7EL 3LZFH 1QYGL 4X7TB 1AGCA 3X11B 1N26A 5EZOH 4MA1C 1CICB 1OTTD 2XWTA 3OKNA 4LVEA 2X1PA 4GKSB 1NMAH 1JE6A 2H2PC 1IC5L 3EOBA 1ZWIB 4ODHH 4B7IA 5KVFH 4BK4A 3B9KC 4HQQH 3Q1SL 2W9LA 4J3VA 4JCLA 3HAEH 1PG7H 1MVFA 3G6JA 5HDQH 3I6GB 1JZ7A 4NHCH 4RMUA 1RFDH 1C5CH 4TSCH 3UYPA 4X9HA 2A9NH 4UV4L 4F7PB 4FABH 1UH3A 1RJYA 4TRPL 3WS6A 1CZ8H 2R4RH 3MLPA 2G9HA 2XFXA 1CXLA 3AREA 4N90E 3H2WA 5IGXL 3U2SA 2A74B 1U8PA 3AROA 2NR6C 4NCC2 5JO5A 2W59A 4UV7H 4NUGL 5IB4B 3BGMB 4GKNA 4L4VD 3KPQB 4NGHH 3IJYB 3DOSA 1W0WA 1VFOA 4WW1A 4LHUB 4F7TA 1GGBH 2E6QA 5KAQG 1PG7L 4JFPB 3TV3L 1W72L 1CIUA 1TZHB 5F9AC 1PBYA 2QR0A 3STBA 4M1GL 5HHOB 1F4YL 4RWYL 4FABL 3OKEB 5JTWA 3V4VL 2NZ9D 4HULB 3P0VL 5L88L 4KKLD 1J05B 1CGYA 1NDGB 3UTTE 3HNTH 3MROB 4U7KA 2ZCHL 3V0WH 1BD2A 1F3JB 4JM2F 5L6YL 3O4LE 4YUEL 4HG4J 4HK3J 2F5BL 2H45A 4X7DC 3VI3F 4UV7L 2R0ZL 4P2YA 5CJXA 1AO7D 1XGUA 2FR4B 1B0GA 4K3DL 4JHZA 2DQUL 3QWRD 3VDCA 2MMXA 3VXNB 5SWZD 3C5ZB 2LV4A 5D7JB 1FSKC 3CFBB 2XICA 5BXFA 5HGGS 4XP9L 1M71A 4EBQH 1IFHH 3I6KA 1HWGB 1F4YH 2NX5B 3FT3A 4XWOD 1IC1A 5HHXH 2G2RB 3MV7D 2A6JA 5EC2B 3X13B 1JBJA 1WITA 1P9MC 3OPZL 4KK6C 5IW6B 3BYYA 1NCAH 1G0YR 4Y1AB 4P4KD 3SEPA 4KI1A 3QIWC 3QCVH 3JWOL 2GTZB 4GRLC 3IT8D 1RIHL 5D7LB 3HI1A 4NKDB 3CUPA 2DD8L 2CKNA 1KPUB 4PRPB 2BSRB 4GXVH 4D8PB 1TJGH 1C12B 3K46A 4LCWB 5IESL 3BP5B 5GS0L 1RK1B 2VQTA 2HT2D 4Q9RL 5CMAB 3ULUL 4P99A 5I8CA 4AEFA 2O5ZH 1IKNA 1GC1H 5I8EB 5E8OA 3QJHA 5BS0E 1EMTL 3O11B 2E3VA 3LN5A 5BVJB 5ALBH 3BW9A 3BUYB 1GHFH 4JM4H 3WKMH 1E6OH 2FEEI 5CEZE 2NY4D 3HI1B 4I77H 2P5WE 35C8L 4PJBF 3WNOA 3VWJA 3MO1A 4U1LB 5FECB 5ID0B 3LEXB 3QCVL 5JMOC 1OF2A 1EAJA 3WNKA 1HIMH 1U6AH 3NGBB 5FK9A 1R5WA 1BMGA 1PLGL 1FZJB 2AJYL 2B1HL 4X0KA 2JJSA 4FQHB 4KMTL 2HFFA 4M6OL 4YDIL 1U8NA 1U8PB 1ZVSB 2W0PA 3QHFL 2D0HA 3PF2A 5IBLC 1GGIH 1J12A 2Q86B 4BH7B 1A64A 3VFWA 4I8DA 4OGZA 4YK4B 2DYPD 4OZHB 3P4MA 5F8RC 3BSZH 2YS4A 3BMVA 3U46B 4KK8D 1PQZA 3CXHK 5IJVA 4FQHA 3T77B 5EOCJ 1T83C 4QHMB 1J1XL 2DQTH 2IALA 4K3JH 4Q58C 4Q97A 1BBDL 2VDRL 3DMMC 4ZTOL 2F53E 2W65A 3NACH 5I1DB 5DD6B 5F9OL 4KMTH 1JYVA 4HCRA 4M6OH 4YDIH 4X7SL 2GHWB 4MJ5A 2EH8L 5C0BA 3MXWL 2YD1A 3N85L 4PRHE 3V79C 5LKNA 5F44A 3FO0L 4ZUSA 5HI4C 1KCSL 5C0RL 3WDIA 1A4JB 3RGVA 4P5MA 5I8EA 3O41A 5DJZB 5D2NB 2FEDD 1EBAA 1GZQB 1RJLB 1NAMA 3AVEA 3ELAT 3RWEA 1VADA 4Y5VA 3CFDB 5FDWA 3KLAB 2HKFL 4IMLA 4PRBB 4M62H 2C7UA 4KAQL 5GRJH 4X6DE 5D1ZA 2VH5L 4S2SB 1F4XH 5F70A 2A9ML 1XF2B 2XKSA 2GIYA 3FN0H 4MDJB 5JA8B 1JPTH 4P5KB 3RWGB 3CFJA 1Z3GL 4JRYD 3T65A 1DSFL 2M26A 4OLVL 1OWRM 3CFDA 3H0TB 4ZTPH 5FDWB 2KQNA 3BOVA 1SEBB 4M7LL 2HWZL 1MREH 1OCWH 4WIQA 3HN3A 4DZBB 4G6AD 3FB6B 4J4PA 3KWWB 4ZXBB 3RDTC 3WIIH 3D3VA 2J88H 2AVGA 3HI5H 2AEQH 4KRLB 4LLUB 4O51A 1J0ZA 1LO2H 1NFDE 2DN7A 3AAZA 5FGSA 3M1BA 3ZKSD 5F3BA 4DGIL 4LCYA 1DBAL 5FUZL 4PTUB 4HZAA 3WLWC 3RPKA 5T5NG 1ZHBA 5I1CL 1ACYH 1WCBB 4MAYD 3TJEL 3C2AL 3CVIL 3D48R 4RGND 4LNVA 1JPTL 5FUCE 4GG8A 3NH7L 4YPGA 3UZQA 1CYGA 4JHBA 3O4OC 4GW4A 4JB9H 4N1CA 4Z18A 3VD3A 4IDLA 1A1NA 3KYMA 4M7LH 8CGTA 5DYOB 5ITBH 1S9VA 5KS9A 5J7CC 3MLYL 1T0NB 1G9NC 5J4MA 1QVOA 2IQ9L 3OKOB 2PO6C 5F7KC 3GKZA 4WHCA 4PGDB 4GG8B 5E2TH 1RIUL 1G1YA 3CIQA 1A5FL 1BX2B 1QKZL 5IHUH 3WS3B 5E1AB 4LCUA 1I4FA 5HHPA 4IJ3C 3UAJC 1RZ7H 1KEML 1BVZA 3P9LA 2CIKA 3TCLB 5LVEA 4C56A 1CTOA 4XCEB 4JFHE 3GSOA 2A6KB 5JPNB 5DD1H 3AS0A 4ELMB 2A73A 4XPTL 3C6LB 4NQDD 2LVEA 5DUMH 4ZS6C 4PRID 3K2MC 4LBEA 3GSQB 4UQ2B 5DC4B 4Y4FD 1S9XB 3JWDH 5EU3B 5IBUG 1KGCD 2EXWD 3TJHC 4ELMA 3F7QA 5ILTH 3BRGC 2ZG3A 3WS3A 4X6DA 3CVHH 5IVZA 5IMOA 4LAQH 3TCLA 2DQGH 3ARQA 3TBTB 3FT2A 3QNYB 4ZQKA 3H9YA 1RQ5A 1AQKH 4PJFE 4B7LA 2I60H 3QG6A 4JGJA 1G6RB 5DFWH 3V6OE 3O6LH 1VACA 2NY1C 3VG9C 5ISZA 2Y6SD 4S1QH 1XGQB 4GKSA 2NY5L 4YQXH 2FGWH 3HRPA 2VDNH 3TO4A 2ZCLL 3IU4L 5IFAH 2X4QA 4ZAKA 4IMLB 1KPVB 4XBPB 5ANMA 5D7IB 3IYLW 3FFCE 3O2DH 1I8IA 4QCIB 3MA9H 2DTSA 1EHAA 2YPVH 2XZZA 2QV2A 4OUUA 1OGAB 1HCVA 3UTQB 1KV3A 3H3PL 3ULSA 1YEKL 4GRWB 1CS6A 3ARYA 4AENA 3PG2A 2EC8A 1ZGLM 4J3WA 1DANU 5TGBA 8FABB 3DLQR 2JLLA 1OTUD 4BYHA 2KBGA 3B5HA 1OHQA 5SX4H 3JTSA 2D7QA 5GRXG 4MXWH 2B20A 1A6AB 2NLJA 1E4JA 1KJMA 4JFDD 2Q76A 2APVA 3MBEB 1Z9SA 3KPRB 1MHCB 4QY8B 1L0XA 4KJYA 3B5TA 4PRIB 1V5JA 1DVFA 2X89D 4FXLA 5FM8A 3EJZD 4NO3A 4LARH 4I48A 4OZHA 1F02I 1U8KA 3UJIH 2WW8A 3DXAA 1SJXA 1LO3H 1SBSL 4KRPC 4JO4H 2K3TA 4DJMA 4F9PA 4M00A 4WW2B 1CK0H 5C0NC 4PV9A 2F58H 3FB5B 3P2TA 1TZHA 1PSKH 1IAKA 4E9LA 1X5XA 4AZ8A 3I50H 3ARGC 3QPQC 4ORGA 3RGVB 1AI1H 4X7EC 4OI7A 2KPNA 3UBXB 1VADB 4R96B 2NNAA 3KJ6H 4PLKC 4JY5H 3NOIA 3AXLB 1KJ2L 4OM0L 1HHKB 4NNXB 1Q0YH 3TZVB 4P5TC 3S3PA 1P7HL 1DTUA 5DJ0A 4DK3A 3HFMH 3K4AA 4GMSH 4JFOB 5DS8B 2CKBA 4N8VA 3O6FD 3SDCD 5DEGB 3VW3L 1QNZL 3V6OA 2HKHH 4POZC 2IBZY 2JIXD 1SBSH 5K59E 3P0YL 3UTTB 2A0LC 1ZMYA 3UDWC 5JR1L 2R69L 2JELH 2F58L 4NNYB 5E1HB 3LIZL 3CDCA 5C8JA 4P46B 4X4XB 3ES6A 3GSUA 4NOFA 4P23D 2HJKA 3RWIB 3ARBC 15C8H 4OCLC 4JG1L 3MV9A 1YYLL 3OV6A 3VMNA 1RHFA 4XGZA 2EDLA 1RZKH 3LY6A 3VE0A 4FMFA 1RPQA 2DKUA 1YEHH 3LOWA 4V2BA 4YBLC 4LCCA 4XGZB 1Q9WA 3BD5A 4RZCB 4NO0D 3F12B 5EZIL 2AXFB 1UJ3C 1B6DA 5GGTH 3QXTA 1L9MA 4HIXL 4KHXL 1K4DA 2NY7L 4KV5E 2KL6A 4AEHH 3IVKA 4PGZA 1BQHA 4HHAA 2F8XC 1QD0A 4L3ED 5EU6D 3GK8H 4L4VB 3ZDYE 1UH2A 2B1AH 3CMGA 4NQUA 4UB0H 3D2UB 1MLCB 4XC3L 5EG6C 4OGYL 4NT6B 2BSTA 4E5XB 3KYKL 5HHVL 1I9JH 5CAYB 3NPZB 1HDMA 4O02H 2YA0A 2JF1A 3DROA 3GSWA 3Q2CA 5IIEB 1U3HA 1P9MA 2YBRA 5EZLA 2AJXH 4HEPG 4N0CD 3VWJB 4OV5B 3MRFB 3LS5L 4KK9D 2AQ3A 3WMSA 3LB6D 4U7MA 1NH6A 3PXHA 3QWQB 1VPOL 4PJ8B 3SN6N 4IMKC 4C58B 1JWUB 4UIMA 4GO6B 1YEFL 3VA6A 4L8BB 5L7XL 1BGXL 1PY4A 4M3KB 5E95B 2W60B 5C3LD 4OB5H 4Y5VC 5C08A 4JEGB 2ESVB 5I1GH 3BZ4B 5DQDL 1UT9A 3PWUB 4UOW0 4Z7QF 4EI5C 3LKSB 4P2RB 3UXFA 1SM3L 4P4KA 3V52H 1OGAD 1UKQA 1QRND 3VXNA 3KDMB 5FB8B 3HCVB 3TNMB 2A1WH 3JTSB 4PV8B 5HI3D 2A77L 2GY7B 5C9JB 3C2SA 4Q2ZB 3VDBA 2MPAL 1DEEB 1AC6A 5IB1B 3RPIB 4WWKC 5SX4I 5CFHA 4NDMA 5GRUL 4EVNA 3FO2A 3QDGD 3IF1B 1HH9B 1QBLH 1A21A 5GRVL 2PUQT 1R3LA 3DYPA 4FQCH 5JHDD 5IHLB 1UXWB 3W39A 1PY9A 3T8XA 3DUSA 2CDEA 5DZNA 3H6JA 3PQYE 1SY6L 2GUOB 1CGSL 4IOFC 3JUZA 4LF3A 3QQ4A 4CVXB 3I3EA 2AK4A 2VE6B 1N6QH 3SDDA 1YZZA 1RIHH 2V5TA 1UYWL 4X9FA 4EZMA 4X99A 3OHXB 2AK1H 3OR6B 2IPTL 4FZ8L 1MJJB 3KPLA 4ALAH 1A2YB 4YWGH 1I1AC 2ZJSL 4U1JA 4DVRH 1UM4H 5EC1A 1YNLL 3DURB 2UUDH 5CJBA 3O8XC 3NA9H 3MLTA 1L0YA 5EORH 4P2RE 1B2WL 1LDPL 1MHPH 4PGCB 2J7LA 3HUJE 3TZVD 4OD1L 1NJ9B 4Y2DC 4I0KA 3BD3A 3VFNB 1NC4D 4YJZL 2CIKB 4TTDC 1MWAH 3PDGA 5AYQA 2AEPH 5GGRY 1U6AL 3MRHB 4AEIL 2AJ3A 1KEGH 3L5XH 4FXGA 5IOPA 2BVQA 1T5XB 5JPMA 1J11A 3PQYB 4PJEE 4WI9A 2NMSA 3S3SA 3MYJB 1INQA 4XI5D 2XWTB 5JIHA 1NPUA 1BWWA 5H2BB 3QUMH 5ESQB 4Z0XB 4PJ8C 5GPRA 2E8YA 4N0YH 2OCFD 5EBLA 2YC1B 3WLBA 5DXWA 4JFEE 1G7HA 1QA9A 3LPWA 4XNYL 1U93A 3GKWL 3ILPA 3WYRA 4NJ9H 5IK3A 1VKXA 1WIUA 5CP7B 1GGBL 4KHTL 1HYSD 5IJKC 2AEPL 3J7HA 3PE9A 1UEMA 3FQXB 5CKAA 5KJRL 1MFBL 3RX5A 4R4FL 2BNUB 3GRWL 4PRPD 3K3QA 1JMZA 1HILA 4W4OC 3EAKA 3GJFK 2AGJL 2ZSWA 1W8OA 4FQQB 3BT2H 4GXUN 5I76B 2GTWB 2CLRB 3RVVC 2XOTA 1LD9B 4R90H 5FF6A 2BOBB 2P4AB 3K8KA 3STZB 1FGVH 1U8LA 4GBXC 1A7NH 4APQB 3FL7A 3MJ8A 2FATH 2Z31D 2DM2A 1ZLVK 1BVKA 3UAJD 3S97C 4PD4J 1FYTB 3SQOL 1WZKA 3S8WA 1L7TL 4R4BA 4YHNA 1Q38A 1KXTB 5T1MA 3GKWH 4PJXB 1RULH 4OCYL 5EZJA 5IEHA 3NFNB 3ARWA 4OM1L 5AD0A 4P23B 4LGRB 3CLFL 4C54A 3BXNA 5C0FA 5HGHB 3CSYB 4NC1E 3S36H 4FQ1L 3IJYA 4I48B 3D2UA 4MYWB 5DWUH 4LAJH 1JWSB 3KPMA 5HHXL 3QEUA 5D2NA 1W8NA 1AIFA 3GSVB 4X83A 4WWKA 2MHAB 1S7TA 4CW1A 1AFVH 1VCAA 4H8WL 5IEKB 3GMNB 3RVTD 3T0BA 1NC2A 1YQVH 1F00I 5AYUH 3C6LC 1ZLSH 3FJTA 1NCTA 1ZANL 4M1DL 2P8PB 4QOKA 3SPVA 1MCLA 3GM8A 2NY2D 4Y16B 1F58L 3MREA 5TDOB 2DBLL 5CEZL 1X5AA 4NO5A 3UPCA 3CAFA 4KKBD 1IZKA 1FE8H 5JORB 1ACZA 1RURH 4U1NB 2AKRB 3GBLA 5E24E 1IGML 2YUXA 3NMEA 2FLBT 2VZTA 5GRZA 2VXVL 3TT3H 5TF1H 2DKMA 4H88H 1MRCL 3U30B 1AGDB 4XCFL 4HPOH 3WJLC 5IQ9A 4XPHL 3T4YB 1A0QL 1P7QA 4NP4L 5T1DL 5GGVL 4XAKD 5KSAD 3EDFA 2UWEB 3RIFF 3NCJH 4ZAKD 2FHFA 3PWVA 4S1RL 1YJDH 1KCKA 2DLEA 2O26U 3MV9E 1CF8H 4N9GA 1A6VL 4JZOB 4K23H 2IPUK 4KY1L 4W6WB 1J7VR 2V2WA 3MLWL 3TJHD 1KT2A 1AY1L 5KANI 1BD2E 3VWKA 4L5FH 1M6OB 2P8LA 4QRQB 4F37K 5L0QB 3KPOA 1N59B 5DJDB 5E6ID 3MBXL 43C9A 3HMWL 3FT4B 1G7PA 3L6FA 4ODXA 4Z0BL 4XX1E 2CO7B 3O11A 4MQSB 5MP6L 3KPLB 4PB9H 1UM6H 1OP5K 3BDYH 3NCYP 5INDA 1HH6A 4MAUL 4RAHA 2ARJB 5HSFA 1RK1A 1ADQH 3RIAK 4C83B 2MCG1 1IGFH 1I7UB 2Z8VC 5TDPB 3S35L 4OLZH 5JW3H 1ZGLB 2Z92A 4L9DA 1TTGA 1B3JA 4U0RB 1YNKH 1A3LH 1TTFA 4JO1H 4HIHA 5FM5M 5B8CA 3O4OB 2YD7A 2FX9H 4UILL 2J6EH 4PRNB 2IH3A 2P1YA 2APTA 1X7QB 3K8MA 2BNQB 1PAMA 2E9WA 2EIBA 1S7WA 2VDOH 3LMJL 4QHKI 3TF7C 2B4CL 2YPVL 3PWPA 2ZUXA 4J8RA 2XTJC 4RMSA 4QNPE 1OP5H 4EJ1C 1LK3H 5CSZB 2DTML 4TUKH 4M7KH 2OM5A 1NUNB 4Y19D 4RMQA 4DVBA 2BRRH 1S7TB 2BNRB 1SY6A 3LKPB 2GAZA 4LCWD 1EXUA 4ZYKA 3HMXA 3RVWC 4AMKH 4FXGB 3L3OB 2Q8BL 4HUXB 1I1YA 4XPFH 4MNQD 3OGOE 5A3ID 4HK0A 1T21B 4MA3A 1D5XB 5BO1H 1UQSB 1TTUA 1OCWL 2YUZA 3CD4A 1GC1C 1S3KL 5IEHB 2NW2A 1Q72H 5BS0B 2CLZB 3VFNA 4LARL 3T0DA 1J8HE 4NC1C 3Q0HA 2X1QA 2JJSC 4P2QE 5D1ZB 2Q6WA 4DCQA 3GMQB 3L3HB 4OKDA 2MQCA 3K4DA 1FHGA 2FJGA 3IXTB 3KLDA 5F9WB 1W0WB 2QHRH 3O45B 2ESVD 3OJ2C 5HJ3B 5HDOA 1DLFH 1CG9A 5DUBB 2D3VA 5I1AB 3QDHA 4HH8A 2ZSWB 4P5MB 4WEBL 3W0WD 1AGBB 3RBSA 3IETA 4NWTH 4APQC 1X5HA 2HLAA 1YEIL 5DRXA 5FYLH 3CK0H 4PJGA 3H8NA 1XR8A 1EA9C 1IKNC 3X3GH 1CFSA 3VFRA 1MF2H 4OI8A 4G3YL 5IBLD 1ES0B 1U42A 4AG4L 1INEH 3EGSB 2DQEL 1P5VA 3RAJL 1TZGL 2C3XA 1QNZH 3VXOB 2HKHL 3EZ8A 3JVGA 2IQAA 4QHMA 5CSBA 4I2XB 2BSSB 3ARGD 3QP3A 4RZCA 3OAZK 1W2KT 4LHUD 4KUZL 4OFYA 4EI5D 1AJ7L 4M9OA 5C7XL 4Z7WE 4JLRB 5DUPH 4IRSB 1PW3A 1VHPA 3EOTH 5HI5C 1HE7A 1I1AB 2E9BA 4KK5C 4FXKB 4YXKH 4G80A 1CFQA 5FYKE 1J8HB 1MHEB 1P6AB 4CMMB 2EYSA 5GGVY 4XNXH 5EPMA 3O6ML 4ENED 3BH9B 3QNXB 4LSPL 5FO9B 1T1ZB 3EYUH 1G7MB 4NZTL 3DECA 3PDOB 4CU6A 2NYYD 4Y5XA 2NY4C 1WISA 4MJ4A 5AG9A 1NSNL 3GSRA 2NZIA 1U58B 1EHXA 5C0JB 5HGHA 3I6LE 2HVJA 3FN3A 4MCZB 1TJHH 5E8EA 2CR3A 4YH6A 1OAKL 3P4OB 4OT1H 1BZ9A 1LE5B 3QI9D 5IG7B 1ZEAH 2XA8L 5HHOE 1X5IA 4GUPA 1NFDA 2ZNXA 1YEDA 4YHPB 5ALBL 4Y1AD 1CXFA 3IXAB 1VPOH 1UCBL 4MD0B 5GHWL 2CUMA 4QGTA 3WN5B 2ICEB 4HV8A 5IVXE 2VLJE 5F3HA 5JW4N 3Q6FA 4XPGH 4Z7WB 5E9DA 4XRCB 3U9UA 4OF5A 3ZDZF 4EIGB 3C8HA 1D5XA 2VXSH 5HGBA 2JK5B 2GFBB 1U8HA 2M8XA 2ZOKB 3TIDB 2B0SL 2C3VA 4LQ1A 4CADA 3ARDA 4Y1AA 5E4EC 4ZDHB 4GXUM 1LE9B 2GT9A 4NPYB 1MHHB 2R1XB 4IHOB 3WL9A 3PNWA 3C5ZC 3G5VA 4BM7A 1U3YA 5C3TA 1T04B 1FFPB 2UZYB 1UWGL 5I2IA 2DI8A 4L3EA 3TO2B 3Q5YA 1ZAGA 3PL6C 1Q9KB 4JM2B 3WO3B 4C4KO 1FO0B 4K3JL 5ICZA 3E6HB 1P6FA 1FFRA 4XBPA 2VLMD 3U6RB 1CR9L 4AEEA 3RGVD 3A67L 3O3AB 4R7NA 2DBJA 1BREA 3RKDD 3BI9X 4Z7VE 4NYLA 1JHTA 3UTZB 1NCDL 2J5LB 5CP3H 3IDGA 1EX0A 2CXKA 5MI0C 5ABDE 1A9EA 3WFCH 4J1UA 4V2CB 4XP5L 3B9VA 1ZA3B 3AY4A 4RMRA 4WW2F 1XIWB 5D7KD 1KJ2A 1KTDB 2V17L 2IMMA 4HKBA 2JJVA 2YWYA 1QBMH 1H5BB 4QNPF 1WTGT 4C56D 2VDRH 4Z7VF 1MLBB 1OPGL 5BVJA 2Z8SA 1G0XA 2EE2A 3MNWB 4XVJL 4HXBL 3T4AB 1FFOA 4YWGL 1GOGA 1IC4H 5EOQH 2BVUA 5C6TH 2BHYA 3G04B 1OSPL 3OAYH 4WFGE 4NO2B 2X10A 3WKNA 5F7NC 4BQ9A 4P46C 4OLWH 3SGEI 4CVWA 1X5GA 3LEYL 1PYWA 1LDPH 1MHPL 1P4LA 2FECL 1JYNA 1R24A 3IGAB 2DL9A 4CVXA 1T2XA 5T3ZD 3I75A 4Z7UB 2IF7A 4KFZC 3SGKA 2NR6D 2DQIH 3MGTA 4YXHL 2VSCA 3BAEH 2VL4A 4P2OA 4PTTB 3C5JB 4F2MA 3LN4A 1RY7B 4JN1H 3B9KB 1G7QB 3SDDD 1RUPL 3GUTB 4H8WC 2XPGB 2AK4D 5IVOA 4D9LH 2EDXA 4DVBB 1T5WA 5B39A 4K2UH 3FZUD 1KNOA 4ZFOB 3UTPD 2JJTC 3TP4A 1M7IA 3HUJA 5I1EH 3BPLB 3ULUC 3TIEB 1JGDA 2ZUYA 4WV1A 3QEGH 4YFEA 1DSFH 1D5BB 4U2ZA 1XGUB 3RTQC 2HMID 3BIKA 3OBAA 3DYMA 4PRHB 3MJ7A 4TNWF 5I75C 2X4OB 3MUY1 4EDXB 5BOZG 5T3ZL 1A6TA 1TVBA 5D1XD 1JPFA 3TIDA 5I1LB 2YUVA 2AEQL 4UIKL 5T3XH 4Y4HA 5HHQA 2EECA 3DX6A 4BA8A 3HKFA 2ADJA 1EUUA 4W81A 2RFXA 1G7IA 4AIOA 1T0MB 1I7UA 1BVLA 1H15A 4J6RL 5LJYH 2F8VA 1SEBA 5D4QA 5F7MC 2J8UE 1ACYL 1KFAL 3WFBL 5E8NA 4G9FD 3IDNB 2F19H 4JR9L 2FJHA 3D5OF 4LCIH 5AD0B 2J8HA 4NN6B 1LVEA 2HTLC 3G9VA 1MFCL 4ZUVA 1CQYA 1CICC 3ZZ1A 1Z0MA 1IT9H 1BQUA 3QFJE 2BVTA 3QEQD 4K94C 1ZK9A 1GGTA 3CH1A 1S5HB 4MA8H 4U1SB 1BVLB 1H15B 2WBKA 1A7PL 1D9KD 2CUHA 2ATPB 2H26A 3ARGB 4M7LT 1HZHH 5I1HL 1ZT1B 2XV6B 2FB4H 3ZTJG 1K8IB 2QTEA 1FL6A 3C9NB 2KZWA 3MQIA 1MHCA 4R4ND 4PJ5D 2H1PH 1TDQA 5DJ6A 3C5ZD 2I60L 5D7JD 3BEVB 3BEWB 4PJXE 3V6FA 2G60H 4OLYL 2QBWA 4JAMB 4QRUA 1CGSH 2HFTA 4GQ9H 3GMOA 3MRRB 4GLRI 3TIEA 4G8GB 2JCCF 2BJMH 5EO9B 3QXDB 2APFA 4FFZH 4NFDA 3ZSSA 1F6AA 3U36B 4PJGF 3U30C 4I9WE 1IC7L 3FTGB 5SWQB 3RWFB 2ADGB 1X44A 5T5FH 1IAII 1DVFC 1A7PH 1QACA 1G7JB 4YZFF 5I1HH 3DGGA 4WRLA 4ZSOE 3B9AA 5EN2A 5CEZH 1YNLH 4HS8L 1JYXA 3RDTB 1HQ4B 3QIWB 3R1GL 3NTCL 4Y4KC 5EO9A 3MJ6A 4PJGE 3NIDE 2OSLA 3D2UD 4Q0XH 2BY1A 4KTDH 5SWQA 4MJID 1J9CT 5TF1L 1MFEH 4L4TE 2DAVA 2H9GA 4JFOA 5DS8A 1CFNB 3LQMA 4ZQKB 4CRPA 2WAHA 2BCKA 4LLMB 4OZGA 1R5VA 4KRNA 2R15A 5DJCA 5ERWA 3HAEG 3PP3H 3F5WB 3SDYL 3FMGL 1KB9J 4UDUA 3OR7A 3VXSB 4LNRA 4LSUH 4GRLD 1JNJA 3D39B 1OF2B 4HFUL 3UTSD 2IAND 1D9KA 4DTGH 4RCAA 5FHAL 5CD5C 3MCG1 1L6XA 3IAPA 3V6OC 2BVOA 2OZ4H 5TH2A 1EAPB 1S7SA 4GG6F 1JPSL 4GW1A 4MNHB 4BQ8A 1JHKL 1NMCB 2CD0A 1EEQA 4EOWL 1X4ZA 4LL9A 2R23B 3HUJF 2OL3B 4ZNEA 5J3HC 1W0YT 1ZS8B 3RNQA 4PBXA 4JY5L 2HG5B 4N0UA 4Z0BH 4DFHA 2AV1B 1TNMA 1AD0A 1BFOB 2RGSA 1GIGL 5F9JA 2BXYA 1MFDH 1OT2A 1XCQA 5E8NB 2NLJB 1MCPL 1YPZE 3GSXA 1A6AA 1BFSA 5BRZE 2HH0L 3SDCC 1V05A 1IEAB 3VFPA 1DUZB 2GK2A 4G8IA 4XPAL 4Z95H 3NABH 1FPTL 5AZEL 3QAZB 2X4OA 1C5DA 1IBGL 3JBG7 4EN3B 2FX8L 3L3KB 1CD0A 4LHQB 2PYEE 2FX7L 4U1KA 5DEFB 1D5IH 5IBTL 1FVDA 3JZ7A 4RA3A 4WUKH 3GBMH 4XVSH 5DK0B 1YYMH 3D6GA 1NBVL 3VXSE 3P9MA 1A02N 3MRDB 4Q2ZA 5I1IL 1DQML 4Z78A 3ZTNH 4FOMA 3GDBA 5DJ2B 3EYQD 4YBHA 3QUZC 43CAA 4I18C 1J8KA 2JB5H 5CD5D 5IOPB 1G7QA 1N6UA 4OLUH 1HHGA 1YN6B 5ADPH 4WW2C 2UV3A 5D1ZD 3QG6B 4DQOL 4MQ7B 2FDBP 4KRPB 4YX2H 1XIWC 2QSTA 1YYLH 4U31A 3MA7A 4WFFE 4GUPB 1LO0L 1KC5H 1G6RL 3QJFA 1PYWB 4Y5YA 5IROC 4KQ4L 2GK0A 4W70A 3MFFB 4PR5A 1TZIB 2CRMA 1ZVHA 5LGJA 1ZLSL 3G5XA 4JPVL 2B8OT 5E2JA 5JUEH 2RFXB 1J86A 4H25A 4L8DA 5IHZA 5F88A 1PEZA 4I13B 1DQMH 5DLMH 2HLAB 4MA7L 4P4KC 4B53A 4AEHL 2EIZA 5B3JF 1EEZA 2JB5L 4ODWB 1JRHL 1J1PL 5FCSH 1U8JA 3O3EA 1IM9A 2ZCKH 2B1AL 1UGNA 4G7YL 5GJSH 1NAKH 5C09D 2ENYA 2FD6H 5DC0A 3LQZA 1NGXA 4M4PA 3RUGE 4KTEH 3OKMB 4HSQA 7CGTA 1RMFL 4O2CA 4RQQB 4YEEA 5D1XB 5IMKA 2V5SA 5EN2B 1HCFX 2VDKH 4UU9A 3VFSA 5DRWA 4P4RA 1M05A 2VC2H 4Y4FC 1AHWC 1G7LA 4OLXH 2JCCB 1QBBA 2VZVA 2Q8AL 3ZKXB 5IGXH 1IC5H 4R2GD 3VE0B 4S1SH 1FO0A 4P59H 4PTUA 4WHDA 3HB3D 1OQXA 1K8DA 1YDPA 2ED9A 4WTWA 3O3DB 3SJVA 1ZV5A 4W6YB 1U8MA 1WK0A 1T7VA 4PIRF 3MRBA 3CDFA 1C5CL 3GMNA 2EYRA 3D25A 3HR5A 4HMEA 5IM7A 1OW0C 1NGPH 1NUGA 5H94A 3FQWB 5IUSA 5J89A 4MNQB 5GGUA 1MOEA 1MRFH 3PWJB 4JFDA 3VXUE 4DKEL 1X5YA 2VDKL 1KJ2B 1P5UA 3H7BB 4AQ1B 2ICWB 5E94B 4HX1B 2WMPA 1H8SA 3GI9H 4PLKD 1K6QH 3VXRB 1PKQA 4WFED 5DHYB 2PO6B 1FBIH 3QFDA 1TCMA 4NYLB 4ORGB 1CVSC 4UQ3B 1JGUL 5IB2B 4C59B 2ICEA 1NFDB 2XZCL 4NQTA 3KPRD 5L8JB 3FFCB 4X4ME 1DFBL 4QOKE 5E70A 4JGMA 3BGMA 4QF1B 3V2AR 2P5WA 5D7LE 4GG6B 5GGTA 6FABH 3EDJA 4ZS6D 1AGEA 5BV7H 4U1MA 1P2CB 1XR9B 3C09B 4GQPH 4OD1H 1MIMH 4J2XA 5IHBA 2FBJH 4L8DB 4XAWH 1JZ3A 2R2BA 4Z8FL 2HVJB 2F5BH 4G6ML 5F89A 1KN4H 5DK0A 4RAUB 4Y16D 3ROLB 3MJ7B 5LQBL 5F96L 3QFJB 5JIKA 4AMKL 1R3IL 2DLFL 2VAAA 1MRDL 3KAAA 2B0SH 3AMLA 5DVKA 1MNUH 1KTLB 4GFTB 5DHVB 1CL7H 1CD8A 2K7PA 1YEJH 1PZ5A 2Y7QB 1N3NB 2HA1A 4HDIA 4DGVL 1INQB 3W5MA 1DFBH 4P9MH 1UM5H 3EFFA 3K80A 4YGAB 3M8OH 4F9LC 3RWIA 3CPLA 1MIML 3BFOA 2VO5A 1DQDL 3EFFB 3QYCA 3JV6A 1NLDL 1JGEB 5SWSB 4M8QA 3BISA 3JSSA 4FNLH 5JDSA 2CKBL 3TH4T 3HNVL 1IGIL 5DHVA 4Z7UA 2ZOLA 5LQBH 1QSFE 2F54E 2VDPH 3GIVB 4GW1B 4MNHA 4X6CA 3WUWB 4AH2B 3VWJC 3V8OA 2D7TH 5E03A 2B1HH 4F80A 5F7EH 4GRMA 3N9GL 4MSWB 2NTFB 2DLHA 1JIBA 1DL7H 4EN3C 1W0VA 4DUVA 5HTSA 3QT2A 5FYKH 4I77L 5EC1B 4Z77B 3VH8G 1ZT7A 4PFEA 3SO5A 1WWWX 2IFFH 3SDCB 3T3PF 4OAWA 3FB8A 3WD5L 2PN5A 5DGRA 5EBMB 1OD9A 3G6JE 1UA6L 5GZOC 2H41A 3RGVC 4XCCH 1CIDA 1BJ8A 1JGLL 1FYHB 5FYJD 3EYOB 5TFSL 1PLGH 5AAMA 1EHLL 1Q94A 1VGKB 3QCUL 3GMQA 3L3HA 2XN9B 2I5YL 5F7YC 5D8JL 4FQ1H 1OSPH 2XTJE 1I1RA 2QQKH 1U2CA 4JRWA 4WU5A 5SWZB 3ARBB 1L7IL 3LPFA 5GGSA 1TPXB 1J0HA 2AJZA 3BX7C 1ETZA 4G8FB 4TQEL 5DMKB 1RZGA 4YXLH 2QL1A 5KVEL 2CDFB 2MKLC 4ZO7A 4KRPD 1ADQA 3AFLA 5I2IB 1VA9A 1JNNH 1XF5A 2VXQL 2FSEB 3B8SA 3NGBC 4ORZC 3KXFB 3V6ZA 1VFBB 1QLEH 1D3CA 2GSGB 2MSPA 3KG5A 2AJZB 1ZEAL 2XA8H 2X42A 1I3UA 6CGTA 5F6HI 4OZHF 4LSVL 3VFTB 1GVIA 1I8IB 1CU4L 5JDJA 4AM0A 1RZGB 3TT3L 2H6PB 1HSBA 3CC5B 4IOIA 1NMBH 1DQQA 5HVHC 1GZPB 4PGEA 3V0WL 3Q3GA 1G7JA 1GGCL 5E7BA 1I9IH 3R06B 5KANG 1WC7A 1VACB 1FZOA 2UVEA 1G6RA 2NY2B 2ARJA 2YN5A 1NANH 3NIGE 4M62L 4S0SD 2PYEA 3P4NB 5DSCA 1NEUA 3H9SE 4G8GA 4EUPA 3E2HC 4RMVA 5TDPA 1NUDA 4APQA 5BVPL 3RIFK 5F71A 1CGUA 1A4KA 2VH5H 4LHUA 4I18A 3R8BB 2W07A 1DR9A 5IFHH 5EUKA 1R5VB 4FQIH 2ADIA 3FO1B 4MCZA 5H94B 4LVNB 2R29L 4FTVD 4K8RH 4IOFD 5D93B 4EUPG 3S35X 1AHWB 5DVNA 4XC1H 5HYFA 3DX6B 3GSOB 3P0GB 1NC2D 1OAQH 5FXCH 3QNZA 4RDQG 2ZSVB 4FG6D 1UJTA 5D7JC 2DM7A 4HKXB 4WNQA 4HHAB 3ARFD 4ZUUA 2X4UB 2YMXL 1HZHL 3TN0D 5FA4B 2W0FB 5EU6B 1E4WH 1BIIA 1TZIA 4GSDL 5DO2D 3QH3A 1CLOH 2HTLD 5F1NA 2VITB 4FQLL 1GC1L 3BQUC 2A6DA 2GKIA 5EWIL 2QEJA 4ERSH 5LG1A 3MYJA 4KKCC 5D1QA 3JV6B 5KN5B 1J5OL 1K5NB 3FQTB 5DMYA 3WIHA 3EYSH 3MRKB 4RNRA 2BVQB 2F74B 4P3WA 3BP6A 4Y8AA 3BDYL 2VITA 1I3GH 3VXOA 3LMJH 5ITBL 1HSBB 1HIML 4RBPH 4YHLL 1L6ZA 3RUGB 5DD5L 2A6DB 4WUUE 3VFWB 2P7TB 5ID1B 3P11L 4HF5H 5JW3L 4ONOA 1CBVH 1IAMA 4UINH 2R2BB 2J4WH 4S1DD 4EI6A 4I4WB 5EBGA 5DHVH 4RGOH 43C9B 4MQTB 3HS0B 1G9MC 3IDYB 1ITCA 3U7YL 3SGDI 2X1XR 3AXLA 2NCMA 4GBXB 5F1SA 5ADOH 5JIPA 4PS4L 3QEUB 5EWIH 4WFHD 3DSFH 2CDFA 2VXUL 1MFEL 4ODUB 3X12A 4JZOA 5A3IC 1K2DB 1INDL 2VWEE 4UDTB 5IEKA 4I0PC 3L5IA 3ME0A 2E5EA 1T7YA 2ADIB 1F6LL 3SDYH 1U92B 2JB6A 5DQ9A 1KB5H 2DQFA 4R26L 4Y89A 3LRSA 4DTGL 1XGTB 1NCWL 3P11H 4HF5L 1I7TB 4YDVA 4YK4C 2XN9D 3QAZC 3MR9B 5BQ7A 1HN1A 4P2QA 1A9BA 2WK2A 1LMKA 2YRPA 4UUJB 3GJFA 1O0VA 2FGWL 4ZPVA 5D70L 4Y7MA 4EOWH 5D5MA 4ZD3H 5JHLH 3HLAA 3A6CL 3MNVB 2H2SC 2R1YB 4O5LH 1KPRB 4R8WH 4YDJB 4MS8C 4JFDB 2CMRL 2RAMA 1FH5H 2CXGA 3AS2A 4FTVA 3UPRA 3HPLA 3QQNA 2L7JA 2XTJB 2MKWA 3HHRB 4XNZC 5IQ7L 1MQKL 3MYZA 4NT6A 1SYVB 5L2KD 5IWLC 3PGFH 3MOAH 1MHHA 3WS6C 4BSWB 1PX4A 5ESVA 2R0LL 4NRZA 3KLHC 2P7TA 5ID1A 4DAGL 4QHUB 1IVLA 5ISZD 2VDLL 3PWUA 2DQDL 1RSFA 4GAFB 1RFDL 5DT1H 5GXBB 5D2LF 2AJUH 3W9EB 3WLBB 3PGCA 4I3SH 4G80B 4Z7WA 5GGSB 4KK5D 1FFNB 2YSSB 3FRUA 3NZHL 4L8BA 2XKNB 3DRTB 2P48B 4CJ1A 4TVPD 1JPST 1RZ8A 3NIFE 3O2VL 4Q6IA 3MOQA 3T0EE 5T33H 3OKMA 5C0BE 1PZ5B 4RIRB 2EDNA 4HT1H 3RWDB 4NUGH 5C7XH 3ET9F 4NBXB 5HHMD 4LNRB 3MLRL 1CGTA 3C8KA 3S6CA 5L0QC 2WV3A 3VXMD 3CVIH 3QUXB 5F7WC 2ORBH 5M7QA 2AJSL 2YD9A 4HKXA 2NY3B 3U0TA 3BZDA 1FIGL 5HGAB 4RGNB 3OWEA 1MLCA 5F88B 1FNAA 5TPWH 3VXPB 2H26B 5I30H 2NY1B 5E2WL 4YFLF 3UO1L 4G9FA 4PLOB 1MIEH 3OR6A 3PUCA 1A7BA 3C8KB 3BPNC 2AXFA 2XACC 5B21A 5LGHL 1W72B 5C07B 3KPPB 4RNRB 1U8IA 1RJYB 2ZCKL 4RGMC 2EICA 2D0GA 3EZJB 2H8PA 1NBZB 3AU1A 2NPLX 4ZO6A 3QIWD 1AXTH 1G9MH 5HYQA 5HVWA 1MJUH 3DVGB 4OKVB 5C1MB 4HX1A 4LSQL 3KHOA 2AQ2A 1FIGH 3RVUC 4CUCA 2W91A 2P24B 3DXAE 4OQTL 1KCLA 1EK3A 1QFWM 1ZWIA 1HKFA 2VABA 1YEHL 2BOCA 1TVBB 3DIFB 3FHQA 1RZJH 4P3CH 3TN0A 1RV6X 2W9EL 1A6UL 1HQRB 4L4TA 1IL1A 5BZDA 3AMKA 2VABB 4NQCE 1FSKB 5JXAH 3AAZB 3UDWA 1S9YB 3TNMA 5B38G 4N9OB 1QO3B 3MMEA 2EIDA 4RMWA 5ALCH 8FABA 4LVOC 7FABH 4QXTA 3RWHB 3RGHA 1JNHA 2VDNL 3HC3L 4Z5RB 5SWSE 1FNEA 4ZOBA 2X9WA 4TVPH 3B9EA 1CE6A 4TULL 4XNUL 1UZ6E 5E56A 4PREB 1T6VN 5CJOL 3FONA 4WY7H 3CSGA 3RWGA 3PWLB 4XXDB 3U79A 4KMLB 1A9BB 5GRYA 3OMZA 2X9XA 3O6KH 2MJWA 5C2UB 1KIPA 4PB0H 1IAOB 3ZYJA 2HJLA 4X9GA 2VLKE 3NN8A 5BV7C 1VGKA 3GI9L 3NCCB 4X5WA 4TTGA 4EI5B 4JHAL 4XPBH 2VKXA 1KCUL 3LKNB 5E2UH 4ONFH 5KBNC 2DJSA 1FBIL 1I7ZA