4KVCL

2h2 fab fragment of immature dengue virus
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
212
structure length
212
Chain Sequence
NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Obstruction of Dengue Virus Maturation by Fab Fragments of the 2H2 Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Ig heavy chain V region MOPC 21, Igh protein
total genus 50
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kvcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kvcL01
3MRCA 2DLEA 3HE6C 4R26H 1KTKE 5KAQG 3HAEA 1FZKA 5B39A 3JSSA 1N3NB 4NPYB 1QFWH 3MYJA 3CDGA 5KZCB 2JIXD 3ALXA 3V6FB 4M6MH 4EIGB 4YBHA 4IDJH 2ITCB 2XT1B 3IJSA 1H3WM 1HI6A 3MRRA 5ESAB 3QDMB 3EJZD 5IIEA 3BEWB 3TV3L 4HGKC 1PBYA 4X7TB 1INEH 4R6UA 2BY1A 2IPKA 3IFLH 2G75B 4Y16A 1INDL 5GGRA 4UV7H 3D87B 5HI4C 1NUGA 1H3PH 2JKXA 3ZTNL 2D0HA 3NABL 3DSFH 1U8OA 5DZNA 4ZTPH 1HCVA 5TPWL 1KLGB 4U6YA 3G5VA 1GJIA 4Y2OA 4ODTL 2VKWA 1U8PB 2D03L 2X4OB 1XIWA 3QPXL 1GGIL 4LLDA 5I1CH 3O2DL 5DK3A 1ZLVK 1NMBL 3IAQA 5I8OL 2E27H 5KS9F 3HB3D 2D4FA 3HAEG 1CFSA 3KJ6L 1D9KB 3V52H 1FORH 5JTWA 5F6IB 5LXGH 4L3CA 3PQYA 4HUNB 3QDGD 1JTPA 5BMFH 4XVSL 3ZTJG 1KLFA 2CDGA 4ZFOL 3DMMC 1NLBH 2GFBB 2WP3O 3H3PH 5T3XH 1P7KA 5E8PA 5TF1L 4A2MA 1JZ6A 2VZOA 5ACLA 1FDLH 4C83A 1GGUA 1FL3A 3O6LL 1FNSH 4G80B 3QT2A 4C4KT 4JM2F 3EOTH 5DEGA 2JB6B 1T3FB 3ZSTA 5KSBE 3LH2H 4PJFE 4APQC 4XCFH 2QADC 4S1DC 5JORA 5AG8A 3O11A 1AC6A 1FPTL 4OAWA 3QPXH 3ZE0E 1I8KB 2QR0B 4PJEA 3C60D 4PGBB 5SWZE 5SX4H 3DARA 1A64A 3UP1A 2OCFD 5DI8A 4X4ME 4M93B 3IDGA 2WBJC 4JGJA 1CDHA 2AJXL 1IGYA 3CC5B 4ERSL 1FG2B 4K8RC 2P49B 5EA0H 2OXHA 1IBGH 1U92A 1W0VB 4DKFH 4RAHA 3QDJE 2ICEA 1E4WH 4Y1AE 3HZVA 5CEYB 3KYOA 1F4WL 1NDGA 1OAZH 3ULUD 1SM3L 1MY5A 2P7TA 3UAJC 4YK4B 3ARQA 4OZIB 2A6IB 4UT6L 5DUPH 1R0AL 4LCCA 3FHQA 5CJXC 3T4AA 5IGXL 2BXYA 2HFGL 5L0QB 3SDDD 5A1AA 3VXQA 3V6FA 1DUYB 1TTUA 3RAJH 2NY2D 4UTAL 4OLZL 3SDAA 4HS8H 4FQQB 2HMIC 4GG8A 4NPYA 4MDJB 1E27A 2VLKE 3HAEB 3QI9C 4Y7MA 3WE6B 4JO4H 3MV7A 1I8IA 1WIOA 4ODWB 4AG4L 4CVXA 3ZT6A 4ZQKA 3SJVB 3WXWH 4OZHF 5TF1H 1XGQB 4HLZG 1W72L 1BQLL 4CUCA 4R7NA 3UMTA 1DLHA 4QWWC 1QR1A 2OTPA 4QRUA 1AGCA 1UZ6F 4FQXA 1FGNH 4LHUG 3CSPA 3F7YB 4OD3L 5HDOA 2Q6WA 3FT2A 4ZOCA 4YAQA 2BX5A 1CICC 4K7PX 4DN4L 3QO1A 3VFSB 4I3RL 1NCCH 32C2B 1IE5A 4NSKB 1AGDA 2UWEF 4LHJB 4NKMA 5ACZB 1BFOB 2YPLE 4FXGA 2DQJH 3UTSD 3BT2H 4GBXC 1B4RA 5DRZA 2I07A 1WZMA 3G5YA 3FFDB 4HX1A 3GO1H 3NCYS 3RWHA 3BDYH 3DV6A 2MQ3A 4EI6B 4H26A 2UUDH 4N0YL 3DBXA 2CLZB 5FYKD 4HWZB 5FGCE 1JP5A 3QULA 1G7QA 5I1GH 3DYMA 5B8CA 5DGQA 2CO6B 3CH1B 3IDXL 3VXSB 4CNIB 2DL2A 2KZ1B 3QIWD 4P57B 4OFKA 3LKNB 1LDPL 1ADQL 1EGJH 4Y4HB 4M4PA 1BVZA 1IEBA 1IQDA 3MNVB 5L6YH 5HHVL 1YECL 3WXVH 1BJ8A 1HHGA 1NC4B 3V52L 1N64L 4PBVC 4LAQH 1EMTH 4GFTB 1YN7B 4OFYD 1KCRH 2NQCA 5E95B 5C0AA 5CD3B 4FQCH 3L3OA 1AXSA 3O0RH 5CP3A 4HEPG 4DFIA 3OL2A 1CICA 3BUTA 2E3VA 2VDML 1GVIA 4DZBB 4PGJA 1C5CH 5JZ7D 3UTTA 2A6JB 4RDQF 3VRIA 1R5IB 3AM8C 4GKZB 4XXDA 3D2UA 1A3RL 1ITCA 4PD4J 5TDOB 4ZOBA 4GBXA 1WBXA 5I1LB 1OW0A 4NHUA 3TVMA 3EOTL 3IGAB 4HWBH 4QF1B 2FO4B 4MQ7B 1AO7A 4R8WL 3O8XC 2NY7L 1CE1L 5HHMB 2C1PA 4Z77B 3I6KA 3W11C 2DM4A 1TJIL 3WIHH 5HVHC 5LWYL 5FGCB 3GBNL 2Q3AA 5D1ZC 3FOMA 4MJ5B 2A9NL 4JY5L 5GGRB 4Y16B 5BS0B 3V9FA 1VFBA 2PW1A 2Z92A 4MGXA 3M07A 4QTIL 1R5WA 3BEWA 3BXNA 4N8PA 3T0EC 3NCYP 4JFQB 4Y4KB 2ZG1A 4WTZA 4DGYL 4Z8FH 5EFIA 4U6HA 3MLZL 1BQSA 1C16A 3DX7A 3DWTA 4XVTL 3EYSL 4RMUA 4Y1AA 4M62H 5IF0A 3I9GL 5EBLB 5M7QA 1NCWH 5IQ9A 2W9DL 4QXUH 5SWZA 2ED9A 2E8YA 3SE4C 1ZWIB 3NABH 4GW4A 2D31A 4WNQB 4CVZB 4HT1L 3BAEL 1T2QL 2OZ4H 3MFFB 4M61B 3Q5OA 2I25N 4PV8B 1TJIH 4PJGA 2AV1B 1YQVH 5I74C 1N8ZB 4X9BA 2APWA 3IS1X 4QY8A 3O2DH 4MWFB 1KPRA 1KTRL 3QFDB 1JI2A 1BQLH 2XA8H 2B4CH 3VWJB 1RFDL 2E27L 5D1ZA 1XGTB 4NBXB 1HH6B 4OLZH 5F7EL 1T5XB 2H32B 1KG0A 2BC4B 2VLLA 1VA9A 4Y1AD 4JQXA 1EGJA 4BSWB 1BM3H 5FECB 2RCSH 4M43L 2R15A 2X4UB 1OARH 2ADJB 5FYKU 4JKLA 4EUPA 5L88L 1E4XI 1NMCB 4LKCB 3HS0B 5F8RC 3LVEA 5CP3H 4B41A 2MCPL 4M03A 3ES6B 4XCCL 4XC3H 5DYOB 2QBWA 3CZFA 1I1YB 4X6DB 4M7KH 5FO9B 1BIIB 5C0IB 2Y25A 4C56D 2E6JA 5DZLA 5EU4A 1SMAA 3MRMA 4NUGH 4MVBC 1PSKH 4WI4A 3DXAD 4KKAC 1R3JB 4L9LA 4FQHA 1AD9B 1LDSA 4LHUD 1ORSA 2P5EA 3BYYA 3HNVH 4C56B 2VLRA 4OV5A 4EVNA 3MLWH 1LE5B 4OBRA 3AS3A 1P7QB 3WHE0 2NY4D 3HE6A 1IM9A 5JXEC 5JW4Q 2EZ0C 3CD4A 4HWZA 4ZXBC 5DJ8B 2NX5B 1P7HL 2FZ3A 3IJYA 4P3WA 2I9LB 3BP4A 3GSNH 3IDMB 1EFXA 1JTTA 1XZ0B 4Y2DA 2Q76A 1J7VR 2F15A 3QCUH 1RK0B 4G6FB 2X41A 4YNYA 1G7MA 4D9LH 1B0WA 2R4RL 4FQ1L 3NIGF 4OFYA 4HPOL 5JZ7C 4NM4L 1I1AA 3I3BA 3VE0A 2BNQA 1A7OH 4MYWB 1GSMA 2I60L 3TP4A 3QEUB 1T22A 3QXUA 4H20H 2A73A 3OF6A 1A3RH 1WFUA 3GSUA 1EH9A 5IB4A 4PP2B 1HHKA 3GHBH 5CINH 3CUPB 4YHLH 4WI2A 1YNKL 3CLEH 5EO1B 1FN4A 2Y36H 4WU7A 4LHQB 2D7MA 4KC3B 4U05A 1F6LL 1SBBA 1PQZA 3TYFB 1NFKA 4K3GA 1JRHL 1KIRB 1YEEH 4DVBB 5IBUB 5ICYB 5DJZA 3QI9D 1Q0YH 5D7IB 3SGJA 5JA8B 2VQUA 1QHOA 3EJYD 2XWTA 1H0DB 4LGRB 2H1PH 1JF6A 1DSFL 1JVKA 5MEQB 4U1KB 3WE6A 1NBYB 2EDRA 2XV6B 1GC1L 3DROB 4KV5E 1BFVH 2R0LH 4WHTB 4XPBL 4EN3C 2BK8A 2VC2L 4TSAL 4FQQA 3T3MF 4M7JH 1HHHB 2P43B 2XYCA 3CDFA 4ZFZA 1V5JA 2YUZA 3I75A 4GBXD 4P4KA 3WFEH 1A8JH 2BSSB 3ZE2E 2A83B 2CKBL 3QO0A 4JPVL 1Y0LB 5GRXG 2OQJB 5JO5B 5DO2D 1T89C 1I3GH 4HK0A 5D6CA 1EXUA 1CICD 2WMPA 4RAUB 4YH6A 4GAGH 3ULUF 2DLHA 3EO1B 2BCKA 3IJHA 4DN4H 4XP1L 2VSDA 3H7BA 1FZOB 3S36L 3OZ9H 4ZUUB 3AS2A 4ZUTB 4XRCB 4KTDH 1BZ9A 3VMPA 3ZTNH 1G7JA 1RIVL 5C1MB 5HHVH 4MA8H 4WW2C 5I8CB 1JFQH 4ERSH 3LEXA 5L8LB 4AT6A 3C6LD 3DMMD 3F8UB 4NRYA 4PGCB 5GHWL 3CU1A 2UY7A 5GZNC 5F8QC 2J88H 4KJWC 5C92A 1AGFA 1I8MB 2APBA 1Z3GL 5C3TA 1IM3A 4U7MA 3MA9H 5C0GA 3FFCA 4CN6A 5MP6H 4ZTOL 1Y6MR 4R26L 5MEPB 4NZRH 1CTOA 1ETZB 4ODVH 1UH3A 3KPLB 5DMKA 1D5IL 4UTAH 4LLVB 4RQQB 3ARFA 2YRPA 1CU4H 2DF3A 2ZSVA 4KRPB 2BJML 4UDUB 3HMXA 4OZ4B 1DEEB 1F5WA 4YHMH 3THMH 4I4WB 5GGRY 4MZ3A 4JDZA 3F7RA 4WFFE 2WP3T 5IHUL 4U1IB 3F7PC 3NN8A 4NRXB 1GC1C 3U30C 4O5LL 4QCIA 2HVJB 5F7NC 2BSTA 3IKKA 1NCBH 4O2CB 2DMBA 4S1RH 4G8IB 1MJ8L 5JPMB 5JHDA 1A02N 5C0JB 2QADD 3EOYG 4NT6A 4P9HL 4S1DD 3MOBH 1MRDL 4RISL 1P6FA 3GSNL 4N0CD 4PB9L 4LPVA 2NY2B 2BVEA 2OI9C 1MFDL 4NZUH 4PJIB 3SGDI 3N85L 4LLYB 4G9FE 4F7PB 1ITBB 3MCG1 2ARWA 2ZJSL 4YIQA 2P8MA 3OJ2C 4JAMB 3U4AA 1MI5A 1TJHH 1JK8A 3ULVD 4HKBB 4HEME 4PJ9A 3V6ZB 1S7TB 1QSFE 2FD6L 4X4XA 5F6HJ 4JFFB 3S3PA 2JCCB 5GJTL 1JPFA 1HZHH 5KBNC 2AV7A 4MNQB 3RVTC 2F74B 1WEJL 3B9EA 1UWEL 2ADGB 1X5GA 4AIZB 1BLNB 1ACYH 4JANA 3Q1SH 4PRPA 3IU4L 1LHZA 1N7MH 1E0OB 4Z7WB 3FQRA 3MC0A 1A0QH 1IBGL 2JTDA 2GSIA 2J4WH 3VXTA 4MNQD 3QBTB 4I77L 4JFHE 3W81A 3KPOB 2OR9H 2EO9A 1FH5H 2AQ1A 1QBBA 2HG5B 5KSAA 5DEZA 3OAZH 5SX4I 3O6FA 4MAYD 4R0LB 4WEUD 1FNAA 3VFRA 4UNVA 3CFDA 1IFHL 4OJFH 4YHPA 5AG9A 3VH8A 5D2NA 3B9KD 4U7SA 1HQRA 3HG1A 3LY6A 5HI5C 4RNRA 1KPVB 3ILPB 4N5ED 3V5DA 5C07B 3SPVA 5EO9B 2FEDC 3NAAH 4Z9KB 3GRWL 4AEHH 3BX7C 5E8DL 4Z7VA 4AEIH 4V2BA 3ZDZF 2YD3A 2YRLA 2VWEC 5D71L 1LK2A 3B83A 5ADPL 4H88H 4L3EA 1I7UA 3E8UH 3TIEA 1XCTB 1MCWM 3MRHA 5E6IB 3GMMA 1QVOB 4XC1L 4Y4FB 3DX8B 5IVXF 3QFJE 3VFMB 1MI5D 3Q6FB 2UZXB 5GXBB 1JHKH 3ZKMC 1ZA6A 4MQXC 1K2DA 3JV6B 2B5IC 3RVUC 5GSRA 4OCRL 1ROWA 3C5JB 4N0FA 1KPUA 4YDIL 3SOBL 1Q9LB 3SGEH 2Y36L 4GAGL 5E2WH 1NMAL 5GJSH 2ZPKH 4CVWA 3CPLB 4PS4L 3BGAA 1R3IL 3O6FC 3FQUA 5BZDA 3VG0L 4KGLA 2LTQC 2D7PA 3UTPE 2X1QA 2G60L 3RX7A 3EJZC 5FDWA 3FCTA 1A3QA 2NYYD 3DX6B 3T0WA 2UWEE 5DXWA 3T1WA 5EU6D 1T03H 5LGJA 1TTGA 1W0YT 4RGNB 1JNLL 3CH8A 3DLQR 4WW2F 3VFUA 2ARJA 3IVKA 3QCUL 2H8PA 1KB9K 5J6GA 3BQUA 2O61B 1DQMH 3IFPA 3MLXL 6FABL 5E7FA 4YUEL 1LO3L 3SE8H 3U1SH 4GMSH 4GKSA 5J6HA 2PO6A 3D39B 1FHGA 4LVHB 4P5TA 5I1IH 1U8KA 4BFBD 1S9KC 5MP6L 1I1FA 1TZHB 2ESVE 5KTEH 1MQKH 1DVFD 4NQCD 4OLVH 5DMIL 2R1WB 4LCUB 1C08B 4NO0A 4JKKA 1CLZH 2EYRB 4KVNL 1MLCB 4UBDD 4H88L 4EKXA 2H9GB 5C08B 2D7TH 2W60B 5DS8B 3V0WH 3GJEA 3L6FA 3FB5B 4M6NL 3E6FA 4ZUVA 4CU6A 2V7NA 3TYGH 4X6CF 1U0QA 1Q0XH 4M5YL 2QHRL 1DZBA 2R1WA 3QNYA 4JN2A 5C2BH 3MO1A 4RX4D 4U2YA 3HI5L 2BZDA 4LL9A 3KJ6H 1U8KB 1A21A 2UWEA 2Z8WC 1G7HB 4I18C 1ZLVH 1W72B 1KSRA 2D9QB 1M7IA 4OSUH 1AE6L 5T3ZL 2R56H 2VR4A 1WQVT 4DCQB 5JHDE 4JM4L 4XHJD 2PNDA 1J0ZA 1CYGA 2DL9A 3KXFB 1JGLH 1FFNA 5BQ7B 5DJDA 3BEVA 3D0LB 1JGEA 3WNMA 3WS6C 2PXYC 5FA3A 4MS8C 1FFPB 4XVJL 5CD5C 5D96B 3RVXC 4JG1L 1CL7I 3GZKA 4KK9D 3L95B 2WUBH 4Y5YC 1NAKL 2Z0BA 3QXWA 4PJHA 1B0RB 1ZVSB 3RZCB 4M5YH 2W65B 2W92A 1BMGA 4Z7VF 1MNUH 4LSTH 3UBXI 3K81A 4WRLA 3PWVA 1IAOA 1KIQA 4QXUL 1OGAD 1YJDH 3RWGA 2F53E 1OAUH 4JB9H 4XHQA 5GS0L 4B50A 4GAFB 3Q2CA 3SKNB 5FCUL 4BQCA 1YPZA 5EZIL 1AXTH 1YZZA 4PTUB 5EZJB 3MSPA 2YD6A 3BO8A 2BNUB 2VDOL 5KSVA 1MUJA 4R4NC 1A7NH 2Y9RT 4PRAB 2IANB 4HCRH 5L7XH 3TN0A 2C4FU 4ZO8A 5DC4B 4HV8A 4P2RE 1TZIA 1AD0A 1TMCB 5FV2A 1EHNA 1S7SB 1U8MA 4I0KA 5D7KE 4W81A 4DAGL 1OD7A 4OF8A 3QZWA 4NWTH 1MJ8H 4NN5B 5ADOH 1I85C 4G6KH 3ARBA 1G6RB 4XWOD 3TA3B 5D2NB 2WIIA 1XR9A 4GO6B 3P0YH 5SWQB 1QPPA 4L4VD 4IRJB 5E2VL 1HILB 1EFXD 4Y2DD 4EJ1C 3KLAA 3PGFL 1A1OB 1Q72L 5GZOD 4XPFH 4XP9L 2AXGA 4LKXA 5FYKE 1M7DB 2VZ1A 2W0FA 3QUKB 4L4VB 5CBAB 1IM9D 4LLAA 3MRQB 4H25B 1YEKL 2C3WA 2X89D 1S7RB 3EYFB 1ZT1B 1FQ9C 1KCKA 3KGRA 4AIZA 4RISH 3PWPA 1S9XB 1AIFB 4JFOA 2IPTH 4G6JL 3OJMB 4TULH 2IAMB 4D94A 3FRUA 2YMXL 5C0BB 1FVCA 1TETL 2YA1A 1G7PA 4I5BA 5F7DB 4DGVH 4Y19E 3QFJD 1M6OA 5F9JA 3FRUB 4K8RL 2IAMA 2PYEE 3PL6A 5AYQA 3JWOH 1MI5B 2YSSB 3H9HA 3MRFA 5CLWA 3AU1A 4OCYL 4YX2L 3LPFA 4TUJA 1RULH 2QV2A 5DJ2B 1QSFD 4LLYA 2IMNA 5IFJA 1CGUA 5DHYA 1F6AB 2Z4QB 3QDME 4X99B 2A9ML 4O2EB 4NKDB 4UI2A 1TVHA 5D7KD 1UM4H 1I7RB 1LO5A 4JCLA 3TH4T 3SDAC 2ICCA 4OCXH 4G8FA 2OJZH 3FQTB 5B22A 5SX5H 3RAJL 3TO4C 1QQDB 5H35A 1D5BA 4NQXA 1A4KA 2VNCA 2P8PA 2KQMA 5E24E 4RSVA 3DV4A 4CMHC 4OB5L 3FTGB 5JHDD 1P4BH 3RDTB 2XXCB 1QA9A 3QEQE 4BZ1H 1A1MB 1K4CA 1Q72H 2BDNH 4JRWA 4MLIA 5EIIA 1DVFA 4NQCA 4NO3A 1FL5A 3QUZD 5FIEA 1MSPA 4U6XB 2GITA 1KCLA 2F8OA 3MRKA 1KGCE 5DMKB 5IV2A 1JWUA 1Z5LA 3RWEB 4DKDC 1PW3A 3HFMH 2FYYA 5KSVB 1U3HA 2KH2B 3G6AA 3NCBB 2XWBB 5DHVB 2GKIA 3G6JA 1ZTXH 2F58H 1NFDF 4U31A 1QBML 3TIDA 5DJ0B 5IW3A 1I7ZB 4HW6A 1AXIB 1KJ3L 4NYLB 4HIHA 4U1HA 4G8EA 2VH5L 4ONGL 1XGPA 4PY8I 3HPJA 1X7QB 1XGUB 4NZUL 4X6FB 2BVPA 5T3XL 2F54E 5T3ZD 1G7JB 4J3VA 4ZO6A 5HPMB 5IVNA 1UCBH 3M1BA 1MCOL 5D96C 2XWJA 4AM0A 3O4LA 2R0WH 5B8CC 1WWWX 5EIIB 4KRNA 4PLJC 4PB0H 1Q1JH 3WNNA 4C58B 3MLYL 4CDGC 1EZVY 1YMME 4RA0C 4OM0H 3O6ML 1Q1JL 3RVVD 5I8OH 4IIQB 1ZHLA 1BJ1H 1MAKA 3TJEH 4J12A 2DM2A 2QKIB 3PP4L 4CADB 1MHPL 4JO1H 4MZ2A 4HKZB 1ND0A 4OB5H 5KSAC 2V2WB 1VB9A 3GJFB 4J6RL 4N8CH 1EAPB 2P5WB 1QLEH 3BUYA 1Q9WB 1NH6A 1J9CT 4EOWL 2EO1A 3BH9A 1PLGL 3FKUS 3C9NB 2WWKO 1TTFA 2RFXA 5IFJB 5BVPL 4YFEA 4LVNB 2LAAA 1UWEH 5GISH 5HXMA 4MB4A 4A6YB 3MBXL 4U1JB 2VL5B 1QNZL 1T89A 4G6KL 1FO0H 2ESVB 3W9EB 5DJYB 1VENA 4TPRL 3VXUD 5DK2A 4R3SB 4BQ9A 2M26A 5BV7H 4Z7UF 1T7XA 3FB6A 1JGDB 3LS4L 1WBZA 1OT2A 5E5MB 4UUJA 2ZSWA 3PWPB 3A6OA 4OCSL 3SO3C 5E08L 3FN3A 5F96L 1S7RA 3EYFA 2VDPH 4HK3N 1HK6A 4BFGA 3OJDA 3T0EA 1GZPA 4ALAL 2Q86B 1PSKL 4EDXB 2FL5B 2QSVA 4XCYB 5DJAA 3CCHB 4MQXD 1FH5L 1FFOB 3MROA 1M1SA 1BD2A 5DC0A 3LQAH 5IOPB 2HTLD 2W0PA 1FG9C 4UBDC 1BOGB 1J87A 2FZ3B 2ZOKB 4F37K 4JFYA 3DMMA 1WAAE 1G6RA 3ARBB 1A9EB 5T1LB 4JQIH 3VI4E 3MUJA 1JHLH 1FYTE 4X5WA 4HFWA 2XY2A 1QPXA 1S7SA 1K4DA 1U8MB 2PXYD 3QQ4B 2DICA 3QEQD 5T33H 1DBAL 4FFVD 4POZD 1A6AB 5HGBA 3S96B 3GI8L 4OD1H 1TPXB 5FUZH 4YHOH 4KZEL 1MJ7L 3O3BB 3HZMB 2P4AB 3LV3A 3TIEB 3GSNA 2B4CL 5J12C 2XTJB 5FGBA 3HNSH 4Y0GA 5C0CE 3M8OL 3RGHA 3TO2A 4GMSL 1A5FH 1YPZB 4ZFGH 3IKCA 4H0GA 4OCLC 1U3JA 3L3GA 4S1QL 3SDDA 5EU6E 1B90A 5KW9L 4OFDA 5DEFB 3ZLQC 4FTVE 1YNKH 3CLEL 4YHIB 3S9DB 2WINA 3CXDL 1BX2B 3I50L 4AH2B 5HVFB 2KUTA 1QFUL 3ULVH 5EZOL 5DEFA 2NPLX 4UMGA 1ZT7B 5E2TL 3TBYB 4NM4H 3S36H 4L3AA 3GBMH 4D0BB 3UYRL 3OTTA 2ESVA 4QRSA 4M4RA 4Z7UB 2CXKA 1TCRA 3WHXA 2XA3A 4LQ1A 4B53A 5GRVK 5CIPH 1TDQA 3RU8H 3S98A 1JUFA 1V05A 4LPWA 5I30H 3DYOA 5E99L 3QI9A 3FONA 1YEHL 2JB5L 4X6EA 5C0RL 4M48L 1IFHH 4OJFL 3QQ4A 3VXRE 4WEMB 3WNLA 4F8QA 3MFFA 4PV8A 5BS0E 4HFUH 2GJZB 4RFEB 1EAJA 4JM4H 1YY8B 3D25B 1KC5H 4Y5XC 1B6UA 4JFFA 4K3DL 1J11A 5FGBC 3MRBB 5HHNA 5EBLA 4PBXA 2PYFA 4TOYL 5FK9A 5GS1B 2WUCH 5BXFA 3B5HA 4ELMF 5C6TL 1ZLSL 4WFEE 4TNWF 3WFBL 2NXZD 5KANI 3CK0L 4H5SA 1R5VA 3GMPB 3P4NB 3X13B 4XCEA 3FL7A 1OP3K 3LRGA 4U1GB 3CFEA 3MMEB 4KTDL 1F2XK 3B3IA 3I6GA 1KN2H 2F54D 2W9LA 3ZHKA 4F9LC 3O9WD 1IT9H 2KZWA 1NC2A 1AHWB 5F72S 2F5AH 2CDFB 1CDUA 3DUSB 4Q0XH 1CD1B 2VXTL 5JHDB 4AEEA 5ESVB 2RR3A 2V7HB 1XEDA 2EC9T 2R2CA 4JRXD 5JQHC 5BOPA 2Z91B 5K9OB 3AY4C 3LS5L 3SCMA 1FZMB 1I7ZA 4G6AC 1PAMA 3BKJH 5GGVH 4JRXB 4GRMB 4HUUB 1H5BA 1BVKB 2BXZA 3BFOA 4V1DB 4LPXA 1JNLH 1A6ZB 2FEDD 5J9PA 4NUJA 3LN5B 4RRPA 3D69B 2QADB 3J7HA 2O93L 4WUKH 4Q9BA 1AP2B 4X9HA 5J1TC 1A6ZA 3QAZC 2VLJB 1BAFL 3JV0A 5KVMC 2HLAB 2BMKA 1NCWL 1XH3A 4TSCH 1F90H 4QLRA 3HZKB 3VXOA 3P9MA 4X6DE 1YNTB 2CLRA 3G6JB 2DQEH 3OBAA 1J1PL 4LIQE 3HR6A 2DQUL 4NDMA 4FTVB 5C0FB 4PG9A 3VXUB 1MFEL 4HGMA 4J1UA 1NC2B 3MRKB 3BDBA 3C08H 5CZVL 4JFFD 5FYLL 3MV8B 3L3KB 4QGYA 3SKMA 2AVGA 2OMNA 5ICXB 3O41B 2IAMC 4PLJD 5I1EH 2XXMB 3ULVF 1YYLL 3DV6B 3D0VA 4S11A 4Q2ZB 1LEIA 1R3HA 1VADB 4MDIB 3AU1B 1IC1A 3RPKA 1U8NA 3QYCA 3HUJF 4O58L 4JRXE 4BH8A 1KEGL 5GGTH 3QUMA 3HC0B 1YYML 2D7QA 2HJLB 3MRIA 5I74B 3MRBA 5HHNB 4IHOB 2LV4A 2AJVH 1FVCB 4QOKE 1XF3B 4XBEL 5D5MA 4PR5B 1MCCA 1AQKL 2DWEA 3PGDA 3TPUA 3BKCL 4XTRD 4FQXB 4DVRH 2DQEL 5GGSB 5EUOE 3L7FA 3GGWA 3BD4A 1UB5B 1EBAA 4CRPA 2VDOH 2IH3A 4Z7WA 4NOBA 5DSCA 1Z0NA 4ZAKD 1BBJB 4LSPL 5TE7L 2IGFH 5J0BA 4LGPB 1NBYA 4KJPC 1KF9B 4LCWE 5IMKB 5I6XC 3UDWC 3OB8A 5B38G 2E7BA 1H8NA 3LS4H 1CFVH 1E4XL 2Y07L 4PP1D 2PF6A 4OLEA 5IHUH 4OGAC 4QT5B 4YC2B 3T77B 1FYHB 3EYUL 5F7DA 4G6ML 5I15H 3CDYA 3MJGX 2YD1A 1I8LA 3I2CH 5DUBB 3TCLA 4M1GL 3VXQB 1MJJA 3JWNC 1W8NA 2W07A 3GSUB 5IB4B 3ROOA 1F6AA 4ZXBD 1FIGL 2P7TB 5DVMA 1NCNA 2DN7A 4OD2B 1G7LA 1ZLWK 3QEGH 2Z35B 1ED3B 2IADA 2DQJL 3R4DA 3P3YA 4Z7QF 3VFWA 3KWWB 1FCCA 1RU9L 3DETC 5LAXA 4AZ8A 3FRPG 4P2QE 2PYFB 2BHUA 5SWQA 5IJVA 5GRUL 4O2CA 3C60B 4P59H 4PRHD 2EIBA 4AEHL 5B3JE 3ALPA 4P9ML 3VXOB 3TN0D 2CJUH 1HNFA 2ID5A 4JJ5A 5HGAA 1U91A 1OOAA 2BMKB 1BBJA 3EYUH 1II4E 1JWSA 4PRIB 4HUWA 1WEJH 2YK1H 1DEEA 2BNRD 4O4YH 1PKOA 2XRAL 4Y4FD 3C5SB 3LQZA 5I66A 3BZEB 4LLVA 4RQQA 3ULVE 1JPTH 3V6OE 2WQRA 3WN5B 1G7IA 4LGSB 1X5AA 5IHZA 5T5NF 1VGKB 2OR9L 2BOCA 5IG7A 4LAQL 4EDXA 1B4JL 4L8DB 4YBQC 5DJDB 2BVQB 1AC0A 4XMLH 1MJ7H 4YQXL 3HC3L 1QBMH 2LU4A 2BSRB 3UC0L 2V7HA 3S5LG 4Q2ZA 5TE6H 1BFTA 3KHOA 4X6DF 3FRPA 2R39A 5CBEA 1K5NB 2R9HD 2FHFA 3N1MC 4YDKL 5E6ZA 4OKDA 1KJVB 1WBZB 1B0RA 4ZPVA 2Q8AH 1MCEA 4XWOC 3T2OA 1PFCA 5EU6B 2FGWH 1V7ML 3V7AG 4LRIC 4EQ3A 3NAAL 3GBLA 4FXKB 1VGEH 4LQFH 1MIEH 3FQXB 5FA3B 1WTLA 4NN7B 3HCVA 4HJ0D 4GUPA 1OP5K 3RVWD 2VAAB 4GJTB 2ERJB 3MA7A 4LASL 3GJEB 5D70H 1DQTA 1HIML 2W60A 5FDYA 5C08A 5CJ5A 2X1WL 2R29H 4JHBA 4M00A 1B3JA 4X6BB 1FVEA 4N8VB 3QIWA 2MMXA 3PL6C 3MJ9A 4MJ4A 2JK5A 4U0RC 3SDXA 4OCRH 4RBPK 2UWEB 3AVEA 2ZOKA 5F3BB 3S7GA 2AK1H 4HIJA 4KRMB 1KB5H 2JJTA 3WEXA 4PV9B 3RGVB 2O61A 1H3XA 1KUMA 2KBGA 3QI9B 4HUKB 4Q9QH 4XP6H 4NC0B 1K3ZA 1BOYA 3T0EB 4F7TB 3O6KL 1JFQL 5L2KA 5FDWB 1SJHB 5F9OL 4S10A 3VW3L 4LVOC 4LCUA 4OTXH 4R96A 3H9SD 4ELME 2ILLA 5I1KH 4JEGB 1ZT7A 5JW5B 4FQJH 4UTBL 4PGZA 3CIQA 3GNMH 4GLRH 3MNZA 5JIIA 4PJCE 5LCVH 1A9BB 4NNXA 3F62A 2FX9H 1BX2A 1OP9A 4RIRA 4HIEB 3L9RA 1T1XB 3C5JA 4KKAD 4WY7L 3O6FD 4MAYA 5D6DA 1WIPA 1DE4B 1DQJA 2V7NB 4NKIH 1IGJA 3QIUD 4QTIH 4TUOA 4G8GE 2F9BT 3QUYD 4QF1A 1IQWH 3Q6FA 1T2QH 2OZ4L 5C0EA 2GT9B 4MJ2A 3RDTD 3D2UB 1T1ZB 4OM0L 2O5ZH 3U46A 3QUYB 4O5LH 3ZKMD 5E8NB 3MLUL 1NGZB 1CFTA 3C5SA 4X9IA 3QDGA 4XMPH 1RIHL 4NO3B 1WF5A 1SY6H 4F9PC 3BUYB 3Q6GH 1QNZH 1J10A 3QUMH 5J6HB 1WWCA 4EDWH 1CL7L 4NO2B 4HWEL 4MA7L 2VDKL 3BRFA 1FZJA 1N0LA 1ZA3A 4I9WE 3DMMB 4Y19D 4K9EH 2GJJA 3RA7L 4Y4HC 4X5XA 1F42A 4XMKL 2Y06L 4GMTH 5DK0A 3EYVB 1D5BB 4NQXB 2UYLA 5LAXB 4KWUA 4XXCA 2HT4D 2R2EA 2AQ3A 4AM0B 3ES6A 5E5RB 4XNQB 1WIUA 1LDPH 4HIIA 3WNPA 1UEYA 3BDXA 3QWOA 1D6EA 3OG6B 4NJ9H 3CPLA 1WTGT 5I1HL 4KVCL 5EO9A 5EUOF 3M45A 4AH2A 4PJXB 3MLUH 4OIAA 4YE4L 4UQ3B 1X5JA 1S3KH 2X44D 4HH8A 3F58L 3MGTA 1L7IL 1SHMA 4HPYH 1RUQH 2BDNL 3VRLE 4Q9RH 2AJYH 4CGTA 1EO8L 4J3TA 4Z76B 4K7FA 3RL1B 3AAZA 3G04A 4XWGH 2FJHA 2HFFB 2J1KA 2VZSA 5JIKA 4A6YA 4KROC 3HUJE 3G9AB 5IV2B 4JRYD 4HMCA 4AEFA 4D0CB 4MXVE 2DJSA 3OB0H 4NGHL 3RTQD 2Y06H 4GLRI 4RZCA 4GW5B 5F9DC 5IB3A 5DFVD 2RJMA 3RL2B 2DJ4A 3S34L 1UM4L 2WLZA 1F3RB 5EULV 3EGSA 4I3RH 2MFNA 2XZQL 1DR9A 3GEWB 5CSZA 3UJJH 4YEFA 3CK0H 1EEQA 5I71C 1KPVA 3QJFA 3L3JA 4LSVH 4ZXBA 2EE3A 3DETD 4O00A 4JFYB 5CCKH 4HG4K 3B6SB 2L7JA 3QCTL 3NA4A 1T7ZA 2P8PB 4ZUWB 4I48B 1G6RL 4IOSD 1Q94A 3BPCB 4KY1H 4PJFF 2EDHA 5DVNA 4LPUA 1TETH 3B9DA 5IT2L 3MV7E 3ORJA 2EH8L 1ZEAL 4KXZH 1BIHA 2ICWJ 5J11B 1QFWI 4HXAL 5DLMH 1CK0L 1LE9B 5ANMA 4R2GC 4B7IA 5HGDB 3GHBL 1M4KA 1Z9MA 4XNMB 5CJBA 5F71A 5K93A 3X14A 3VWJD 4YDLC 2FJHB 2HFFA 3FOLB 3MLXH 4IHOA 1KCRL 3DSNA 3IFNL 2H26B 3C8KB 2DDQH 1GGTA 1PG7L 1VACB 2EYTB 5CJQH 2IBZY 4K23L 3U9PH 1CR9H 3UPAA 4FFYL 4MQ7A 1LGVA 2OK0H 2AEPL 1JGVH 3IGAA 2R69H 1UKQA 2ICWA 3C8DA 2Y5TA 4OLYH 3D0VB 5CJ8A 4LVEA 4F33A 5HYIA 3VG9C 1ZVSA 3L1OH 3SGEI 1YEFL 1VCAA 3WLBA 3H6JA 2YRZA 2X4TA 3F5WA 3KS0H 3SDDC 4XNZB 4PJHE 2XZQH 3MBEB 3UJJL 4N1HB 1AXSB 4HBCL 4Z0XB 3P73B 1U6AH 5EOQH 3TO4A 3VA6A 1JZ8A 5DC9B 4HHAB 3NIDE 4OIIL 4FFZL 4KKCD 1H3VA 3MBED 3GSQA 1F4XL 3Q6GL 2QQKL 4NRXA 2EDBA 4NRYB 3MUZ1 2FIKA 5IB2A 2MCPH 4EUPG 3CXHK 3U0PB 4P48A 4QWWD 3DSFL 3KLHC 1AD0B 1EUTA 1O7VA 5T3XD 1FYTA 5MEND 2M8XA 3MV8A 5A2JH 3O3EA 4ZYKB 2W9EH 1CGTA 1XCQA 3TA3C 5E9DB 5C0FA 1XF2B 2V9QA 4M7LL 4O02L 2A1WL 1VFAA 2GSGB 4Q58C 1GGCL 4UINL 5HD8D 1FZMA 4JO2H 1NKRA 1JF5A 1JMZA 1NEZA 3AREB 1RIUL 4LMQE 2LVCA 3MACH 3ZE1F 5EC1B 3VDCA 3U4BL 3VXMD 3T0XA 1CS6A 1OWWA 4WTZG 4U1NB 4LIQL 4P5TB 4KJWD 1D5XB 4PJHB 3CSYA 4OLYL 1HWHB 2GJZA 1F97A 2ITCA 3IJSB 4RFEA 4N0UE 4B5EA 3D69A 5ALBH 3UEZA 4LMQI 5DQ9A 1DLHB 1YJDC 5L2KB 1X44A 4WHTA 3W39B 3EYQC 1R5VB 2C3XA 1NPUA 4I18A 2R4SH 3HG1E 2WBJD 1XF5B 3MLPA 5D2LF 3BIBX 1U8LA 1A6TB 2Q87A 3S34H 3HNTH 1UWGH 2EKJA 2EYSB 35C8L 1JPGA 4NQDD 4FTVD 2KPNA 3SCMC 3EOAA 4LP5A 1CD1A 5JR1H 2AI0H 3TA3A 3RWIB 2WZPD 1JV5B 5DT1L 1NANI 1JPTL 1S5IL 1UXSA 2V2TA 1LP9B 4YZFE 1TVHB 4OTXL 3FB7A 3T4AB 4RWHA 2P44B 4MMZC 4FQLL 1KB5B 4ZSOE 5I1DB 5IFHL 5GSVA 3W2DH 1IC7L 1ONQB 1T66D 3AFLA 5HY9A 3VFMA 3A6BH 1BWWA 1SY6L 4GUPB 5BXFB 2FX7L 3HZYB 3NPZB 2Q76B 4FHBD 5ADOL 3DVFA 2RQ8A 2XTJC 1WZ1L 3C09C 2DLFH 4PJBF 3RWGB 4URTB 3W2DL 4YHZL 3NIFE 3OKOB 3VXNA 1U8HB 1KCSH 5TFSL 4QRRA 3R1GH 4WWKD 1HQRB 2VLRB 3HG1B 3CFCL 1JZ7A 1RJYA 4MD0B 4L29B 2EH8H 2YWYA 4OZGA 1A5FL 1P4IL 2BNQB 4XNQA 3VE0B 3H0TB 4X0KA 3S8WA 2J4WL 4BQ8A 4HWEH 1MPAL 3ZDZE 5ESQB 1RZJL 3QQ3A 4UILH 1X5LA 2R4SL 1J05A 4K9EL 5CINL 2HG5A 5KSAB 1FGNL 4Y4KD 2R23B 2OXGA 3GI8H 1A6VL 1NGXB 3WS3B 1E28A 1BJ1J 3S96A 4RMRA 4P2OA 4MNQE 4YC2C 5DTFB 4J3WA 4JKPH 2L7UA 3LB6D 3WSQH 3ILQD 3QG7H 4LSVL 2HTKD 1JL8A 3QZWB 2VABB 3CFBB 2ATPA 3WDHA 2D2OA 3WLWD 4EVNB 4I3SH 4XPHH 3JV6A 1FAIL 3FB6B 4ZFOA 5A2LH 1FO0A 3GO1L 1GHFH 5IFHH 3DX8A 3QZWG 4Y1AB 2WWMC 1YEHH 2JB5H 5J8OA 2VL5A 4WVRA 4BZ2L 4PS4H 2W59A 1J0IA 5KG9A 4E5XA 5EFIB 1KLGA 2ITDA 4Y4KC 5D6DC 4XWGL 3V5HB 1OM3H 1EBPA 1RZKH 1P1ZB 1RURL 4MAYB 4PJGB 5B39G 3BKYL 1WFOA 2BNRB 3EUUA 4XP6L 4BELD 5T5FL 4BH7A 4ZDHB 3VGBA 4EZMA 1YECH 5CKGA 4R2GB 4WWKC 1HI6B 1MF2L 4OFVA 3T65A 1ND0B 2YK1L 1IAII 1CD8A 1S9WA 1MJUH 2PW2A 4IRSD 3VCLA 2IPUG 2YKLH 2GAZA 4U1JA 2L4OA 4PJEF 3MRCB 3VWJA 1OGAA 4GRLD 1H8OA 1AGBB 4LSUH 1QZ1A 1OTTD 3JVGC 4LLMB 4IMLB 1T20A 2CO7B 3LAFA 5C3LD 2E5EA 1NUFA 5LGKA 2VDNH 3BH9B 3QP3A 3QRGL 4WU5B 5FHBH 2B2XH 4NCDA 5F9OH 4APQB 3JUYA 1MCWW 2IPUK 3CSYB 4NQEA 3W0WE 5JUEH 2OL3B 3W0WA 3BT2L 5C9JB 4L4TE 4X6FA 2FR4B 3WFHB 3PWPE 1XF3A 5GGTA 3B8YA 3QNYB 4JN2B 3GBNH 1KPUB 4JE4B 3JWDC 2YPVH 5H8DA 5E8OA 4X6BA 4P99A 4RMQA 2X4SA 3TZVA 5JW4M 4Q6IC 5D8JH 3A6CH 4HCRA 5EUOB 1RUPH 1GXEA 4U6HB 3NZHH 3OG4B 3DVGB 3DO7A 4CW1A 1FLTX 1WUNT 1YEIL 3MGAA 5CZVH 3X3FL 4L3EB 3IRPX 3OJVC 1ZXQA 4GG6B 4HMDA 1SYVA 1T21A 3FB8B 3UCRA 3LOWA 4WY7H 3EYSH 3L3KA 4G43A 1FYTB 4YDLB 4KQ3L 5JHLL 3C5ZD 2CLZA 1MCSA 4OZFB 3KJ4B 1UJ3A 5CHNB 1QFOA 1TZGL 1ZVHA 4NC2B 5TQ0H 3BESR 2I07B 5DRZB 1BEYH 2H32H 4P2RA 4GSDL 2A6KB 5DMJB 4QRPB 5D4QA 2OI9B 4XBEH 5D1QC 3L5IA 3FN0L 4HHAA 1C5BH 2AKRA 1R6VA 3GSRA 3OHXA 1QQDA 2HLAA 2DQHL 1GIGL 3H42L 4XNZC 4WUUE 2ZWLT 3PNWB 4PTTB 3HPLA 3UTSA 4W6XB 4JQVC 5EA0L 4DGIH 5J13B 3ARED 1TXKA 5TGBB 1Q9LA 4P2QA 2CK0H 3ZYIA 4F58L 3F7VA 3MRLB 2Y5EA 1HHGB 3ZKND 4NNPL 1BM3L 3LIZH 1RZFH 4HULB 1MFDH 5DD5L 4AQ1B 2O5YL 4L1HA 3TIDB 2MHAA 2YEZB 3FOLA 2AJYL 4MMXC 4I77H 5DHVA 2XWBA 2DS4A 1E6OL 1TQBC 2BNRE 2G9HB 4KJYB 3EZ8A 4OZGE 4U6XA 3TN0C 4XAKD 4QXGH 1S7VA 2VIRB 4PJDA 4PUBL 1MCRA 5FM5O 2DIJA 3G5ZB 5HDQH 4MXWL 5C07A 4MSWA 3SY0B 5MI0C 3QUXB 3WSQL 3FFDA 4QRQA 1I85A 3JWOL 1XF4B 2OK0L 3IFOB 3SDAD 4OCNC 4OQTA 5HYFA 3T0BA 4HK0B 1X5XA 4LFHG 1BF2A 1IGMH 5D6CB 1UEMA 2E7HA 2F5AL 2VZ3A 3QQNA 4YHNA 1MFCL 4DWHA 1OSZA 2N4IA 1G0DA 4X8JA 3BPLB 3RNQA 5DURB 5GS3A 1UWGL 2CIIB 5JORB 1QR1B 4WWID 1ZS8B 4XZUB 3ZE1E 4KTEH 4Q7DA 4HAGA 3BH8B 1I9RL 3NGBC 4JG0H 1Q9OB 1KBGL 2ZOLA 4QKXB 1LEGA 5IW6A 4KKBD 3RI5F 3QEHA 1YEJH 2PCPB 4R4FH 1JYXA 4WDIB 2ZUXA 5T5FH 3SDYH 1S3KL 3BYTA 4QRSB 5C0GB 4KK8D 1FG2A 5DYOA 4M7ZB 3BZFB 4MD4A 1TFHA 1DBJH 4QOKB 2DRUA 4MNGA 5DI8B 1FN4B 1IAOB 1U8NB 2ORBH 4QHLA 4YDKH 1EJ6A 2X4UA 1XFPA 4R9HA 2F19H 4XXCC 4KMTL 1ZT1A 4OCMC 2A73B 3TCXA 1MFCH 1ZAGA 2P8LA 4M1CC 3L95A 1DJSA 3GSOA 5HBBA 3KYOB 5HHPB 3OKDA 1QSEA 3HE7D 2R2EB 4OZHE 2NZIA 1KG0B 4W6WB 3CJJA 3GSNB 3KLAB 4JFDA 3TLRA 3U79A 1RVFL 3NIDF 3SHSA 2VLKA 3UTZA 1IEAB 5GGQH 1QSFA 5DK0B 4HXBL 3T04D 2CLRB 1HYSC 3GIVA 1MHCB 3ZDYE 5EU7E 5FB8B 2HVJA 3F65A 3MUHL 3T3PF 2IAMD 4YGAB 3ARXA 2VDRL 2Y4SA 1FZJB 1Z9LA 3MXWH 4L8CA 4N1EA 2D7TL 3V0WL 5HYJA 3FT4B 3O11B 2CJUL 1NCDL 2P24B 5KOMC 1F4AA 3GJFH 1AP2A 1J1XH 2GI7A 3SKJL 4IJ3C 2MKWA 4LLDB 3EO9H 3QUYA 3WMSA 4E41D 1MUJB 4EXKA 1KIPA 3IT8D 1AQKH 2OSLA 3SBWC 4XAWL 4X6DA 4WFGE 4Y5XA 4EN3A 1CU4L 1PY4A 1U8OB 1LO0L 5CUSL 1H0DA 3TWCH 2XZCL 3CVHA 2ERJC 3ULUE 1WAAA 2G75A 4O58H 1J1XL 1N5AB 1VKXB 3S4SA 4P4KC 1BWMA 1ZT4A 2EIZA 4U49A 15C8L 4F3FB 4BSWA 5KSBF 4UIMB 1YC7A 3FQNB 3ARBD 1PYWA 4JM2C 4D3CL 5HVHB 3WJJC 4LRIA 1OTSC 2W38A 4K7PH 5F1NB 1B88A 2FEEI 4G6AD 4ZMAT 5EUKB 3ILQC 2PXYB 1WBYB 3MMEA 5INDA 1J1OH 4F9LA 1WWAX 4MNHB 4MJ6B 1EEZB 3FB5A 4X9GA 3TNMB 1XT5A 1BGXL 4RX4A 1OTTC 4PGEB 2YXMA 1AI1L 4WUUA 4CMHB 4YXLL 4JFXB 4P23A 2OMBA 1CT8A 3IXAB 2X9YA 2BY2A 3BZDA 4KXZI 4MA3B 4HKXB 3DGCR 1R5IA 3VRIB 5CIPA 1BQHG 4TSCL 3ROLA 1A6UH 1OAUL 3PP4H 4GW4B 5F3BA 3ARPA 1JYWA 1A2YA 4MXVF 3BJ91 4ZFZB 3R0NA 2NXZC 4TPRH 1P7QA 1QG3A 4LRNL 3P9WB 3ARTA 4NM8H 5FYLE 4BZYA 5DD3L 4PRDB 3MYJB 3O2WL 5DMGD 1PGRB 3VFUB 3IVKB 4PUBH 3NIFF 4F7MA 1WT5C 3UTSE 3RIFF 5TH2B 4BYHA 4JFQA 4WFHD 1TVBB 1DP0A 3VFTB 1J0JA 1JTOA 4KI5C 3HCVB 5BS0D 3CH1A 1P69B 1OT1A 1T66C 4P4KD 5BS0A 5BZDB 1AY1L 5F44A 2BVOA 3LIZL 5BZWB 4KZEH 5EBWB 3MUY1 3E2HB 3K74B 5FECA 2A6DB 4MAYC 5F7UA 4JFEA 3FFCE 3TT3H 5LBSH 3K2UH 2V5MA 3CU7A 4PYGA 1YEKH 4ZPTA 4OIBA 5KVEL 3CFDB 3R1GL 4K3HA 3MNWA 1ACYL 3SCMD 1OQOA 4L8DA 4NHUB 2HT2D 4S1SL 1NQBA 1NC4D 3FCTB 5H37H 3MV7D 3PHOA 3O2DA 1RK0A 2FJFB 4GXVL 1CFVL 2A6JA 2IG2H 1CLCA 4BK4A 5IK3B 3EYOB 3OKLB 4RDQG 3LQAL 5FUCC 3TT3L 1OAKH 3O9WA 4NQUA 5SWSA 4JPWL 3RWFA 4FQPA 2AV1A 3G6DL 3LKSB 4M61A 5JIHA 2OL3L 2OP4H 4OV6F 3HRZA 5D7SL 3LMJH 4OV5B 5JOEA 3BDYL 3PXJA 1ZA6B 5EWIH 4WEBH 1QSED 3HE7A 3LMJL 4L9DA 4Y4HA 2XNAA 3VD3A 5MEOA 4JN1L 1NCAL 3WD5L 3WFCH 1FFOA 3FAWA 3MROB 2G2RA 1JK8B 4TVPH 1U2CA 4NNPH 5AUMB 5I18L 3QIUB 3OAZK 4YBQD 5J13C 4N0CC 5EIVA 3SDCB 1NANH 1D5ZA 4PJ8B 1MWAH 4KKLC 5EO0B 4QHKI 4D0DA 1BLNA 4JANB 2VSCA 4PRPB 3WDIA 4LEXH 4OKVA 5IWLA 3P77B 4GS7B 4JDVA 2ZNWA 1LO4H 3NCJL 4G3YL 5DUBA 3KLHD 5JPMA 4S2SB 4ODSL 3KNBA 2ZPKL 5T1LD 3SOBH 5CAYB 4JZJC 4EI5B 5F9JB 1G0XA 1AGDB 4PRPD 3QHFH 2WLYA 1RZ8A 2B2XL 2AJUL 4EOWH 1WAAF 2APTA 3GMOA 4UTBH 5CJOL 1UJ3C 4RMVA 1EJOL 4G42A 1OGAE 3BI9X 3OPZL 5GS1C 3QFDA 4XP5L 5E7BA 2I27N 1V3MA 4F7PA 4DQOL 2MWCA 3WKML 1YMMB 3HE7C 2VB5A 1EK3A 1RUAH 3QAZB 4LSSH 1DQML 1CLYL 1M7DA 1U3YA 4BKLA 4WHCA 4FFYH 4FN0A 4OZFG 1HILA 3BKJL 4O51B 3MRIB 1I8IB 3O3AB 1DN0A 4KHTH 4HKBA 4ONFH 4P9HC 4WHYG 1C16B 3DX7B 5ETUA 3ZE0F 3VXRD 1E27B 2PTVA 3DI3B 2GYSA 2QQNL 4PJIF 4Z7UE 4CU7A 2LFGA 3B9KB 1RZGA 2J5LB 1UGNA 4YHML 2HKHL 4O2FA 5CJOH 5MERB 1H3TA 5C0BD 5FF6B 1OAQH 4QHMA 4P3DB 4OIIH 2DQDH 3CX5K 3W5MA 1SY6A 4ZSOA 1BZ7B 1EHLL 3WXVL 3TFKC 1BJMA 1QLRB 1ULVA 4KV5F 1NFIA 5HHXH 5L2KD 4P46D 5C0DA 5ILTH 3NTCH 2J2ZA 3HLAA 1F13A 2C1PB 2FSEA 3NCCB 4HC1L 3H8NA 2A2QT 3L5WA 2X6MA 3Q5YA 5AYUL 5KS9E 3GSOB 5JO5A 2FB4L 1H5BC 4H0HB 4PJ9D 3QQ9D 2VLJA 3DYPA 4GKZA 3QDMA 3QNZA 3QQ9C 4UDUA 1YQ2A 1EV2E 1UCTA 3LD8C 1V3JA 3ZKXC 1AGCB 3DVNA 4NQTA 5DQJA 5MEPA 3RNKB 3BPOB 5F7EH 1QKZL 1UM5L 1RIUH 5LJYH 4NWUL 5GZND 4YUEH 1S7UA 5LKNA 2CIKA 4F80A 4ZUSB 5TFSH 3NIGE 2AGJL 3MNVA 2GW5A 4YPJA 3V5KA 4JPWH 1L7IH 4K7PL 4NFBA 5ESVA 1RUPL 3QNXB 3ZL4L 2VKXA 1WC7B 4NKOB 1HOCB 4ONOA 4JY4A 5F3HA 4V1DE 2B1HH 3LCYA 3MO1B 1X4XA 4OGYH 1G7QB 1KFAL 5ECJE 1X6LA 4P2QD 1KULA 5AWNH 1CG9B 5GZOC 4FZEH 1J0KA 2J6EL 5M94B 2DQHH 5DHYB 3ZO0A 1DLFH 1UZ6E 4IEFB 4U6VL 1OAYH 3DROA 3LEYL 1FRGL 2XTLA 4P3CH 2NW2A 4ODHL 3GMLB 2EIEA 2EDLA 1QLFA 1EUUA 5EC2A 5AD0B 3K8KA 2NY3B 3GHEL 1HDMB 3MLWL 2EYRA 1L6ZA 1QLFB 1AY1H 3QUXA 1MIML 4TSBH 1I1FB 5HJ3B 3VXUE 4U6VH 4UOW0 3VH8G 2V2XA 4DUXA 1HNGA 4K55A 1YN6B 3SDCA 4OAWB 1H3UA 1F45A 2IANE 5FYJL 2CRZA 2XN9A 1PKQB 4M93C 5FFLA 3DI2B 3ZL4H 1T2XA 4G6FD 1AD9A 2EH7L 4LSRL 5EORH 1FAKT 4FG6D 4DW2H 2XWTB 5EU4B 3ULVL 4HUXA 4LFHD 1ZLWH 1N0XL 2AGJH 5GIRA 1IC7H 1CLYH 3TYFA 5KN5A 1IGCL 4FABH 1E4KC 1CGWA 5GRJH 4TQEH 5HGHB 2BOBA 5JOFB 3OPZH 5DZOA 2EDYA 2VR9A 4Y2DC 2AK4A 4KY1L 3U2SA 3MV11 2NY0C 3QB7C 3TBSA 3WNOA 2ADIB 4FQHB 1DTUA 2Z8RA 2EDEA 1UENA 1YUHB 2IBGA 3LHPH 4Z78B 4O4YL 4M8QA 4JM2A 2NR6D 5DHXB 1I9RH 2B5IB 4I2XA 3LDBB 5BZWA 5EORL 2L0DA 5I75C 1LD9B 3Q3GB 5I76B 3QWRA 3O45A 3VWKC 3PWVB 1RUML 1F4XH 4HFWB 3MOAL 1B4JH 4NBYB 5HYJE 2CDEB 3FB8A 4KVNH 3WUWA 5IIEB 2NTFB 4HS6A 5BVJB 4F2MA 1MY7A 5I18H 3ABZA 2MQ0A 4YXLH 4JFDE 1RZGB 3NFSL 1E4KA 5A2FA 3U0WL 3O6FB 3RVUD 9CGTA 5B39B 1CBVH 4DTGL 1TITA 2QSTA 4EBQH 3U4EA 4PLKC 5E94B 1KPRB 1MIEL 5FO8B 5IHLB 1QSZA 1X5FA 1J86A 4MA1B 1CE1H 5D1ZD 2F8XC 1QFPA 5CJQL 5I16B 2VYRE 4NN5C 2PW1B 1T7VA 5J1AA 1MJUL 4WU5A 2YPLB 4C55A 3FN0H 3VFPB 1YEDA 3EIFA 4X6CB 1KELL 3V0AC 1WV7T 5DDHB 2AERT 3VXRA 2NY1C 3O4OC 4LHUB 3WCYA 4PJAA 4MNHA 3V4UL 1OWRM 2FO4A 3ULUH 4LHUA 2LAGB 3MLTA 5EOQL 1HKLH 4Y4KA 4HBCH 2AXFA 4PBWD 1NLDH 4GT7A 4G8GA 43C9B 3UPRB 3ARWA 1X5ZA 3WUWB 1AKJD 4ODHH 1UH2A 4KUZL 4ODBD 3LEVH 3MOAH 1AR2A 1ZLUK 4YGVA 1SBSL 3V0VA 3PG2A 4TNWK 2EEAA 2AEQL 2R0KH 4GAJH 1JRHI 1MCPH 4RGOL 3EO0B 4HZAA 3IDIA 4GW1A 3RZWA 3TV3H 5EIQA 4NM8L 3PF2A 3NA9H 4MB3A 4KQ4L 2IALA 3TVMB 4WI3A 3LEVL 3KPRB 1C7SA 2ADIA 4IRJC 5C86A 2AABH 4QNPE 3LKNA 4HWNA 5FGSA 5T1MB 1CN4A 4P57A 3D6GA 2AK4B 1G9MH 2AABL 1YEDB 5B8CB 2A1WH 2VABA 3REVB 1GGCH 2X10A 3ARFB 3N06B 4ELKB 2E9IA 1NGWA 3T08A 5HVGB 3E3QE 1BBDL 4KDVA 3AGVA 1IL1B 3GMQA 1HHJA 2NNAB 2P5WE 3GIZH 4LDLB 1DQQA 1A6WH 3DUHA 4CJ1A 4I2XB 5ISZE 2FLRT 1KCSL 2XQYK 5IMMA 1RI8A 2VLKB 2VUOA 3IU4H 5E1AB 5ESQA 5FYJH 4MA8L 1AO7B 4RRPG 5EOTA 1HH9A 2APXA 3B5TA 3ARYA 2X1XR 3D18B 2PN5A 3LKOB 3PHQA 1CFQA 4HS3B 4F2MB 3CMOH 3AS1A 1H15B 1JWUB 1Z5LB 3RWEA 4JZJA 2FATL 3GSWA 3UTTB 3DXAB 5BRZD 2BOBB 1OB1B 2VLME 4NHCH 1WITA 4ZAKC 4TVPL 4WJ5A 3H7BB 2RAMA 1N6UA 1DUZA 2HT3C 3E1F1 1U95A 4UOW1 1MVFA 3I6LE 4RMTA 1CL7H 5KSUB 2OS7A 4Z78A 4N9OB 2ZCKH 3L7EA 3SDXE 1IEBB 1A0QL 3MV01 5KSBA 4CKVX 5E8DH 5HHMD 4NO0D 2Q20A 4JJHA 4LQFL 4BFIA 3WDJA 3QDJB 5I73C 5IB5B 4I1NB 3U2SB 3JZ7A 4LCYA 3U6RA 4X80L 1AJ7H 4Z7NF 3I75B 4S1RL 4P5TD 1CGSL 3EKCA 3S3SA 2V2XB 4HLZH 1CDJA 3L3IA 3U6RB 3DBXB 1U3ZA 4NQSA 4NKOA 3O2VL 4HKJA 2F54A 4R7NB 3OAUH 1NDGB 5FKPA 3P2TA 5GIRB 1FYTD 1A6WL 2YSSA 1P4BL 4FXGB 1FNLA 5F70A 1S8DB 1IGIH 4ZUSA 1JZ4A 3VI3E 4PJGF 3EBAA 2JELL 2AJ3B 2ZJSH 1WCBB 3JV4A 3ZKSD 3ALWA 2X9XA 4YAQB 3KJ4C 1G84A 2M1KA 4JZNA 3WIFB 4BQBA 2BY3A 2AJUH 2X4RA 4KMTH 4QHUA 1YMMD 3IRZA 3UXFA 4FOMA 3QCTH 3T0EE 3PWJB 5B38A 1GHFL 4G7YH 5BRZE 3PWLA 2EC9U 2K9UA 3GSWB 3RU8L 2JLLA 4QHUB 2R1XA 4DK3A 1I4FB 2AJ3A 3REWA 1I1AB 1NAMA 3NFPB 5I1GL 2OTUB 2P42B 5EOTB 2IH1B 1S8DA 1IAKA 1MCQA 4CVXB 3EOBB 3V4VH 3OKNB 3ARRA 3WNKA 5D7LA 4HDIB 2X40A 1J0YA 1D5IH 3MTRA 8FABB 1N4XH 1RZKC 8CGTA 1IL1A 2X2YA 5L2KE 3L3IB 5H37G 5DD0L 4W70A 2QR0A 4GXUN 1FLRH 4PTTA 3G5XB 3ULUL 5IQ7H 3SE9L 4Z18A 1X5YA 2X9WA 4I0CC 1TZIB 4QYOA 1WC7A 5CMAB 2EKSB 4I9WD 5IB2B 5CEYA 3B9KA 1Q0XL 1L9NA 3QFJB 4IOIA 3S5LA 1INEL 1NFDE 1K85A 3TPKA 3QIBB 4QRPA 4YPGA 3L1OL 5HI4D 5ETUB 4M5ZH 4ZAKB 3CXDH 3I50H 2GFBA 3WO4B 1UCBL 4X7SL 1KACB 5IFAH 1WSST 4D8PB 1FSKB 3OXSA 1B2WL 1Y6KR 4Z0XA 4OT1H 2NY7H 5I71B 4OM1H 4G43B 4XP1H 1VESA 5HHPA 2WV3A 3F5WB 4P5TC 3PV7A 5FF6A 1I3UA 4XMKH 3C8HA 5ID1B 2X09A 3MRRB 3OWEA 5I9QB 1T3FA 1BZ9B 3PWLB 2JB6A 3D48R 4UINH 5DD0H 2VDLL 3W9DA 1YEFH 1TQCC 4PRHB 1FZOA 1M71A 3T2NL 3RWCB 1OPGH 3MRJA 4KDWA 3TZVB 5LWYH 1LP9F 3FHAA 1WCBA 1QEWB 3TBWA 3C6LC 2B1HL 4IRJD 2OX5A 5CSGA 4FMKA 1IC5H 2KQNA 1A7QL 3KXFA 4DOHE 4JRYA 3X14B 25C8H 1OP5H 3PQYB 4KHTL 4ONFL 3KPRD 4Z7QE 1YJDL 1HSBA 5C09D 3S3JA 1M7IB 5IMOA 4UAOC 2Y6SD 5I19H 1TLKA 2H2PD 2EKSA 1CIDA 4TNVK 1OVZA 1FO0L 5IBLC 4P4KB 5CZKA 2DQUH 1PZ5B 1MCDA 4R2GD 3AY4A 1HKLL 5E94A 3BHBB 2J8UE 1FPTH 3QUYC 4POYA 2VDQH 2B4CC 4FQJL 4YHNB 3E6FB 1AGEA 3VRJA 2R2BA 1UZ8A 2YS4A 3RJQB 1EHLH 1RZ8B 1JWMB 5MEOB 4O51A 2XICA 3HE7B 4P3CL 3B6SA 4KK6D 2HWZL 4HS8L 2IC2A 2IH1A 4DJMA 3LRSA 5E6YA 4YHKH 5D9SA 3P11L 4QRQB 4OKVB 2CDEA 2R56L 5FCUH 3REWB 3TZVC 4Q6IA 3I3EA 3VMOA 5EO1A 1PKQE 3H9ZA 4DN3L 4HH9A 3V5HA 1FNFA 2V6HA 2YD7A 1J5OH 2G5BA 5GRZA 3CFKB 4UT7L 5J12B 3VXPB 3QG6A 2FJFA 5IEKA 2WBWB 1T1YA 3PHQB 3LKOA 2OJEB 5ANME 2VJXA 5ICZA 4NC1E 1MFAH 3IETB 1HH9B 4P23C 1KIUA 4KROD 1XIWD 1JGUL 4YNYB 1KCVH 2XZAL 4YHLL 3ARVA 4UQ3A 4F8TA 5FKPB 3W82A 2WAHA 3LSOB 3DRTA 4BSVB 3SQOH 3X12A 3KDMB 4G7VH 3GHEH 2NX5A 5DJ8A 5L0QC 2XPGA 4PJ5B 4P2OB 2A77L 1N7ML 3REVA 4HIIB 3TM6A 4XNYH 1EEYA 5K9KB 3KPQB 3QIUA 2D9CA 5AWNL 3LPGA 2J6EH 3ESUF 1MCHA 4AEIL 3WKMH 3ZTJH 4WTWA 4K94C 3MV8E 4MA1C 4XAKE 2A77H 1WWBX 3FZUC 3U7AA 4TVPD 4F15B 4PY7B 1HSAA 1JCKA 4F7EB 5GGQL 4Y4HD 4HH9B 3CSBA 2XPGB 1ZMYA 2CRYA 2ADJA 3FO2A 2HJKA 2QSCH 2ADFH 5D2NE 3VGHA 3FT3B 5CWSB 5IVOA 5I30L 2JJSC 2QHLA 2AXFB 4ODTH 3DTXB 4AMKL 3PHSA 3G9VA 4L8SA 1CGSH 1U58A 2I60H 3NCEB 4CW1B 1VFUA 4NNYB 3RIAK 1IZKA 1T5XA 2H32A 5EU3B 4I3SL 4JHAH 4WENB 1KB5A 1ZANL 4JFEB 4NN7C 4M9PA 4PJAB 1KBGH 4NRZB 1JF1B 3F7YA 1VGEL 2GTWB 2QJDA 1T03L 4U3XA 3PXHA 3GSVA 3WO4C 2Q8BL 2NZ9D 5SV3A 3STLA 1G9EA 2IG2L 3QIUC 1A2YB 1OPGL 4JR9L 4F3FA 2OL3A 1LO0H 2QTEA 3VD5A 4HC1H 4EI5D 5E4EB 1NAML 2YZ8A 3MLSH 2J8UB 4RWYH 5J1AB 4CN1A 4LLWA 4ZOEA 2AXHA 3I3DA 3ZMRA 1JPFB 2H1PL 4KTYA 4ZQKB 3SJVA 3PV6A 5AAWA 1KXQE 3RFZC 4WUUB 2B7DT 1S7UB 2NR6C 3AROA 1L4IA 4BJLA 4JHWL 4I13B 4NZJA 5IEKB 3EO0A 1UT9A 3C09B 5EH1A 1N59A 2HKHH 3RKDC 4YJZL 4QXTB 1QFHA 1IAIH 5GHWH 1NCCL 4G9FD 2JJSA 3QHZH 4LASH 1KELH 4DUWA 4UIMA 4GAYA 4K8RH 4M6NH 4GXUM 1MNUL 4LSTL 4H20L 5CKAA 2LQRA 1P6AB 3HZVB 3MXWL 3BKYH 5CIPB 2AJXH 5AZ2H 5AEAA 1DQLH 3OXRB 5E70A 2NLJA 2H2PC 1IRAY 2V5YA 4G8IA 4IDJL 4JFZL 2BFVH 4ZAKA 1FFRA 1UZ8B 4MJ6A 2DKUA 4YPGB 4JREC 5FO7A 4QTHA 2OJZL 4FQLH 1C1EH 2QQLH 5GRYA 4ZYKA 1JGLL 4XAWH 4PJBA 4M7LH 3JVGA 3RI5K 4PJDE 1MELA 4PLOB 3MRNB 2P46B 2YD9A 3RWJB 4RGNE 2J5LC 2A0LC 5JOFA 5CBEB 2E9JA 1RMFH 4R97C 1UQSB 3W11D 3KPLA 2BNQD 2VUYA 5A43C 3KPTA 8FABA 1JNHB 1C5BL 3ULUC 3RHWF 1MWAB 1OAZL 3TBVA 5I73B 1QRNB 1XMWA 1NC4A 1YDPB 4XMPL 5E56A 1HZHL 2JJWA 4FA8A 1GIGH 3EOBA 5J56B 3MRJB 5CSBA 4BKLB 5BVPH 1GL4B 3QEHB 1NBVH 5ALBL 5I17A 4P46C 5TDPB 3VGGA 5T3ZE 3W0WD 5CGMA 4OI9A 1D9KA 1ZGLB 1IQWL 2NX5E 1RJYB 2R1XB 4GSDH 1KJMA 2VZVA 1VPOH 1ES0B 1CVSC 2D03H 7FABL 1JGUH 4PRIA 3ARDC 4JO4L 5B38B 3BN3B 3P4MA 3PIQB 4JN1H 2X70B 5JOPE 1CXEA 4GRLA 3STZA 1JNJA 4PGDB 2WSKA 1IEHA 3P40A 5FYJE 4UV7L 5C0DB 3BZFA 4GRWE 2DB8A 3RPIA 3G5YB 4OUOA 1OD9A 4RAUA 1JHLL 1S9VA 3UTZB 3WJJA 1EERB 1YUHA 3KWWA 1CTNA 1Y18A 2MOVA 1BQHB 4CMMB 4A6YL 4OD2A 3FO1B 2GTZA 4J4PC 3C2AH 1NL0H 5I1DA 1P53A 1NDMA 4QRTB 1K8IB 5DA0B 3G5XA 4M6OL 4QXTA 1W72H 4LCYB 2XKSA 3JTTA 4N90E 3MCLH 1RZKL 1BBDH 5F6IC 5JMRA 1DN0B 2MPAL 3N1QC 2VITA 3NGBB 4R4ND 4I3GA 2K3TA 3TGXA 1MFBL 3R0MA 2E8ZA 3QXAB 1EDQA 4HF5L 4YE4H 4M6OH 1J5OL 3U82B 5C9KA 4F9PA 1FNSL 5IROA 3E8UL 4MJIA 3JTTB 2FECI 4APQD 4Z7OE 5HHQB 3O9WB 1TJGL 5IB3B 2FD6H 2W1NA 4TRPH 5IESH 2DQTL 1WCQA 4HS3A 3V79C 3LKPA 5D5MB 1KEML 4ISVB 4NN6B 1MAJA 2OR7A 2APVA 4MCYB 1FC1A 1CGXA 4MS8D 4J4PA 5J3HD 1F02I 3MRGA 4LSDA 3TBTA 4JO3H 3P30L 4LLUA 4CJ0A 2VDKH 1NFDA 2NXYD 4MX7B 4XX1E 3CC5A 3UZEA 1VADA 4MDIA 5D7SH 4ORGB 2NW2B 2R0ZH 2X4PB 2APFA 3P30H 2DKSA 3FT3A 1MFAL 1FAIH 3N1FC 3RGVD 1G9MC 3MLVH 1F4WH 3BIKA 1S7VB 4ELKA 3O3EB 3BJLA 4P3DA 3SKMB 4X83A 5F3HB 4KUCD 5E2UH 2X4QB 3VXME 1ZOXA 3VXMA 4ZS6C 3CAFA 3QHZL 2ESVD 3QNXA 5IP4A 4HJJH 3S88L 3KPRA 3EYVA 3O9WC 5AYUH 5C0CB 2EDQA 4PRBA 2MHAB 4KTEL 5KW9H 4G80A 1MLBB 2FX8H 5F1IA 3IDIB 1I1YA 1U8JA 3QH3B 1YMHB 1RMFL 5F1OB 3GSXA 5TGBA 1DBMH 5A2IH 4OZFA 5EOCJ 3GMQB 1MRFH 1EFQA 3ELAT 3FO9A 5D72L 3NFSH 2EXYC 4G9DA 4NQDE 3KPRE 4XBPA 4LCIH 4NQDA 3BD3A 3MX0A 5T1MA 3VFNB 4PJBB 3OHXB 1IARB 3IETA 1AGBA 5J1SC 1DBML 2BC4A 3RVXD 3KLDA 4P9HH 4XNXH 3TNNA 1NCDH 4UT9L 1IGJB 1RZIB 4DGIL 2Z91A 1HINL 4R8WH 5TE4L 1G0YR 3SDXF 2BRRH 3EDDA 4MWFA 4RIRB 1DQQB 4DZ8B 1QLRA 1RPQA 4U33A 5C9JA 4DN3H 3SDCD 4QO1A 3VWKA 5HHOE 5B21A 3EHBC 5GGUA 5IM7A 1H8SA 1SYVB 1T21B 4KU1A 3QUXD 2ZKHL 3ARFD 3SN6N 4LPCA 4WI6A 3U7WL 2CLVA 2IBBA 4Y5YB 2Y7QB 1UFUA 2IALB 5D72H 3RUGE 5GS2D 5DRXA 4F7MB 3CDGB 5IW1A 4X7CC 2R2BB 1HQ4A 2LU3A 2PW2B 3SBWA 2VDQL 2X7LA 5DRXB 1IGFL 2EDNA 2C1OB 4M9OA 1WJ3A 1LNUB 4NQEB 3HRZB 1VHPA 5HYJB 1T80A 4RGOH 1KLUB 1S7QA 2VISA 4PJBE 2BRRL 5HI3D 2DLIA 1QO3A 1FVEB 5CZXC 4K23H 3KLSA 1G9NH 4R97B 3V4PH 25C8L 1LD9A 3Q3GA 3RJDA 5D7JC 4JRYB 4NQED 3LN9A 3MLTB 3MODH 1OGTA 2RCSL 4M43H 4E5XB 1EHAA 1NUDA 3K4DA 2BHZA 5HI5D 5JHLH 4BFEA 3GB7A 4NKIL 3S36X 1S9WB 1IC4L 3OAUL 1U58B 3H7LA 5FKAA 2CK0L 3KNBB 4S2SA 4DGYH 3I02B 3U0TB 4FNLH 2YD5A 4MD0A 1U6AL 4X9FA 2NYYC 4XXDB 4DW2L 2MJWA 5J89A 5DMGC 4ZDHA 5L8JB 5BJTA 4YHOL 5K9JH 4YFLF 2IJ0C 1WFTA 2C3VB 2E9WA 4QHKJ 2FO1A 3BGFB 3O45B 1D6EB 1CXHA 1RQ5A 3I2CL 2F53A 2ENSA 4FQIL 3SKUD 4CN4A 4D8PA 1NGXA 5KVGL 1MH5B 4EN3B 3QIBD 3QH3A 4WUKL 4R4BB 4PJ7E 4HUXB 5CLTA 3IDUA 3DECA 4OFPA 5LXGL 4ZS6D 1GZQA 1T7YA 2C7UB 3MRDB 4N9GA 2K1MA 3ZHDA 1BFSA 4D9RE 2PYED 3KAAA 2IPTL 4QYOB 5BVJA 4KMLB 3C6LA 3EFFB 2O5XH 5D7JA 1UC6A 4QRRB 1PDKA 3T0DA 1P4IH 3UJIH 3GKWL 1NBVL 3KS0J 1YN6A 3NCMA 5HGAB 4AIOA 3RNQB 4X4ZA 3VGFA 3P0GB 4TVSa 1OSZB 4S0TD 2HYMA 4NCC1 1XGRB 4WHDA 5I1AB 5LGHL 1MREL 1MHCA 5KN5B 5E8NA 3PGFH 4JFPA 1J05B 2MQCA 4J3OC 1I1AD 4JFDB 4U0RB 2FWOB 3TA3D 1XF5A 3VFSA 3T2PA 1I8LC 2B39A 1ONQA 3ECBA 3PQYD 1M05A 3QISA 1FNEA 1KC5L 1NGYB 1I4FA 5LGHH 5KANG 2ZCKL 2HN7B 2DBJA 2VIRA 1S78C 1KNOA 1KCUH 5F88A 2P5WD 1MJJB 4AY0A 3HAEH 1CFNA 4QHLB 5E5MA 4IS6B 1HOCA 1D5XA 4F57L 1N6QL 3QUXC 4JZNB 3WIFA 4FABL 2EC8A 1QFWL 4XMLL 4H1LA 4LCWB 3WKNA 1A7PL 4QOKA 5HHOD 2A9MH 5EBGA 4CDHA 4XGZA 4X6CE 3W9EA 1ACZA 5DRNB 2XN9D 4MQSB 3UYRH 4KPHL 3O4LD 1R24B 4P4RB 2EECA 1ZHNB 3DX9B 5IESL 5HY9B 4XB8A 3H9SE 4M1CD 3JTSA 1PVHA 5J06A 4MDJA 3UZVB 5CP7B 1BQUA 4JPIA 3WBDA 4ZFFA 4PRDA 5DQ9B 1GC1H 1QOKA 4PV9A 4TTDC 4MXQC 1IKFH 4HF5H 3O3DA 1D5MA 2GQHA 2YA0A 1AJ7L 1CXKA 3KPSA 2HH0L 1QACA 2A6IA 5JW4R 3MZGB 3FT4A 1EAPA 4U1SA 3ROLB 4P46A 1A1NA 2NXYB 5FYLD 1WZKA 4PJAF 5I1CL 4G8GD 2R0ZL 5DQDL 5MENA 5KTEL 4HKXA 3BN9C 3KYAA 5DVKA 3TH2T 1F11A 4RGND 3V5KB 4MHHI 2AP2A 2FSEB 2RHEA 3VD4A 2YN5A 5KSUA 3ARDA 3LKRB 3G08B 4JO1L 4MJID 4U3CA 5ENWB 1MHHA 3MLSL 2BJMH 4PGEA 3QEGL 2VAAA 3W39A 1XGYH 1KTDA 3ZT5A 2BFVL 4PJDB 3KPSE 5ICXA 1OAXH 3FQXA 2VZTA 2CMRL 2AEPH 3M1BB 3INUL 3N9GL 1NJ9B 4N0UB 1BP3B 4Q6YA 4ZPVB 4MNGE 3WIHA 3QJHB 3U0PA 2V9TA 2VC2H 4G7YL 1ZGLA 5IFAL 2EIZB 3NTCL 2VLRD 1AFVH 1Q38A 4M6ML 5EC1A 1T6VN 3HC3H 1JPSH 5C08D 4R90L 3L5WB 3RIAF 5E2UL 4OQTH 5DJ0A 5DURD 1QRNA 1WK0A 2B0SH 3T3ME 2NXYC 2DQDL 5IVXE 3EJJX 3P73A 3P0VL 1AO7E 4LSQH 4XBGA 3N85H 4FXLA 1INQB 4XNMA 5J3HC 2ZUQC 3V4UH 1N5YH 2Z31D 1NGWB 4LEOA 3U9UA 3S97C 5EZIH 4WWKA 3MV9B 1AI1H 1PD6A 4BZ2H 5CMAA 5E4IA 4PJFA 3AXLA 1SJEB 1ZGLM 2JJTC 1HIMH 3VD9A 3B8SA 1H5BB 3DO3A 1JN6A 1YEIH 2AJVL 1RZ7H 3WFZA 3HRPA 3V95A 2IQ9H 5IBTH 3BN9D 1OARL 3GMOB 4GW1B 1E6JL 5AZ2L 1UA6H 1WICA 3LQMA 5C8JA 5E2JA 4WFFD 3TO4B 5F9WC 4HT1H 3FQTA 3THML 4NN6C 2DBLL 3MBEA 2J12B 3WL9A 3L3JB 3ZKNC 2IPKB 3WV0A 4WEBL 1UKSA 5JNYB 2PR4H 1K6QH 3TO4D 5MERA 4HUVA 3EGSB 3C08L 3AREC 2YMXH 4JVUA 1CDGA 3D39E 4H8WH 4GS7C 4XCEB 4QXWA 1N5YL 5F7WC 3DVGA 3OKKB 1EO5A 5KG9B 5F93C 5AUMA 5I6XB 3LH2L 3M17B 5A2KH 1ZGLP 3U36A 1HCFX 4FP8L 5E8OB 5FCSH 4ZO9A 1LO2H 1KFAH 4KH2A 4OQTL 5D1QD 1BAFH 3BP5B 3DGGB 5DD6B 3MGTB 4HPYL 1S9XA 1Z6JT 4K94L 4Q9QL 1CD0A 5KVEH 4YDVB 3LKSA 4U0QB 4L5FH 4ODUA 5DJ6A 3OKEB 4HKJB 2UUDK 2GY7B 1B0GB 3CZJA 3GMRB 3KVQA 1D5ZB 4PJ8A 1EHXA 3OKLA 3QWOB 2QEJA 3S37H 1CWVA 3BPLC 1WVZA 4RFOH 4WGWB 1N4XL 3PHOB 2DQCH 1SYSB 4RGNC 2E7MA 2YUXA 5HVWA 1IGCH 4Y5VB 3ZYOA 4Z76A 1MRFL 3N50A 2ZZUT 2BHYA 4JFHD 1I3RA 3D3VA 4U1MA 1L0XA 3NCFB 2N7BA 5F1SA 4PREA 5FOBB 4JQVA 5CWSA 4RMSA 3V4VL 4HZLA 1WGOA 1WLHA 3DUUB 4LOUD 5HYQB 4XHJC 1B9ZA 3PGCA 1P1ZA 1IKNC 3SDYL 5L6YL 2YC1A 4D9RD 5EG6C 3TN0B 2ITDB 1VFMA 4P5KA 5IB1B 3BZ4B 3U46B 1U8IB 4PIRF 1NMAH 1SEBB 5GJSL 5AAMA 4PJCA 1KYOJ 5TE6L 4GRLC 2XACC 1QR4A 3MLVL 4ZPTB 5I0DA 5E1AA 1KXTB 7CGTA 3KPNB 4KRLB 1QYGH 1P84J 3DURA 1NGQL 1EEYB 5K9KA 1ZA3B 2SEBA 1P84K 5CEZE 3DPBA 4PJXA 2LU7A 1S78D 4PJXE 1UXSB 4GQ9H 2FHCA 3WFHA 4PJ5A 5E4EC 1UJTA 1M7XA 3OKMA 1JV5A 2MTPA 5IK3A 2CKBB 4L4TB 1QP1A 3PNWA 2R2HA 1A7OL 4NUJB 1CD9B 3TJEL 1ZHBA 1C12B 4QRRE 4Z95H 1TVBA 4XNYL 3VFTA 1FCGA 4KK9C 3V6BR 4WI5A 4QXGL 4G5ZL 4OZGB 3FO0L 3H3KA 5FA4B 5KVDH 4EXPX 3OJDB 4KI5D 2A6DA 1L9MA 1T1XA 3WEXB 2DI8A 4N5EC 2BVOB 4DGVL 4NJAH 3P4LA 1S7WA 2EEDA 3PQYE 2EDXA 2Z31A 4FQXD 4UU9B 4YDJB 3WLWC 5I2IB 3O81A 4J8RB 4Q6IB 3BMVA 5DK2B 1NGZA 1PX3A 4N8VA 1FLRL 3UPRA 3OR7A 3UTQB 5TQ2H 1OHQA 1T4KA 4F57H 1ZSDA 3GMPA 4H5SB 1MOEA 3VGEA 5C0EB 5TH2A 2GSGA 5BW7C 1P4LB 4ZD3H 1JWMA 3SE8L 3U1SL 3IU3B 4PB0L 4TN9A 3S35H 1DDHA 4HJGA 1R3LB 2X4SB 5E9DA 4K71C 5HYJD 1T83C 3BHBA 3G6JE 3C9NA 1DL7L 5ITBL 3ZHLA 5H2BB 1S5HB 5HHXL 4WO4B 4WV1C 2H45A 2Z31B 2AQ2A 4WHYH 4CAGA 5JW5A 2JK5B 3SDXB 4E42B 5C6WH 5LVEA 4K7PY 1JPST 1IC5L 4CADA 4FNLL 4K07A 3T4YA 3IS0X 3CVHB 2VXSL 5IEHA 1MFEH 5FB8A 5FA4A 4QHNA 4JFXA 2K7PA 3TC9A 2HFGH 1QEWA 5AZEH 3TBWB 5F1KC 1EEZA 3TNMA 2CGRH 3EDFA 2GUOA 3HFML 2O5XL 3DX6A 3B9KC 2NMSA 1KIPB 1MHEA 2YPKA 1M71B 3T1FB 1UM5H 1QSEB 5DQJB 5F1NA 1L7TL 1V7NL 3TH3T 2HLFC 1DFBH 1ZHKA 3IDJA 4U1NA 4GRWH 3T2QA 2R8SL 4N90D 3S4SB 5DRWA 1UXWB 1JZ2A 1O0VA 1XAUA 3KPNA 3SDDB 4OI8A 4MNGB 3HLAB 3ZDXF 1YPZE 3GIVB 2EE6A 2X4NB 2DQIH 4FS0A 5CEXA 4D9QD 1A3LH 1GPOL 2OSLB 4IM8A 4U1LA 3QIBA 2AK1L 2MSPA 1MEXH 1QRKA 3C5ZA 2PTUA 2OR8A 4F37F 1DLFL 3ULVC 1GGIH 2P24A 5IVXB 2HVKB 5ID0A 1S7XB 1LEKA 3BOVA 5HGHA 4DKAA 1CDCA 4AK1A 1W0WB 2DWDB 4NO5B 1HXYA 1FORL 3ISWA 4HDIA 3WS3A 5E9DD 4OUUB 3MV9E 4MCZB 5IOPA 2MKLC 3TZVD 5A3ID 3GIZL 1QSEE 1AR1D 4OZHA 1IEAA 3QXDA 3BW9B 3P0YL 3QQ3B 5EZOH 1U8LB 1BVLA 5FYJU 1R3IH 3CCHA 3WN5A 4DVRL 1G7LB 2DIBA 1LEGB 4ETQA 5FAAA 5DLML 4KK5D 4K3DH 3RL2A 4PJAE 2I9TA 4AQOA 4P5MA 4LCWD 1I3GL 3C60C 3SKOA 4RFOL 1IGTA 5L7XL 4D0CA 2J3SA 2NY6C 1RUKH 2X4RB 2DWEB 5IBLD 4G42B 2ZCLH 1PX4A 2ATKB 3ARGB 1GRWA 4NHCL 4ZO7A 3X3GH 1DBJL 1QTYT 3OR6B 3C8KA 1V3KA 1CXLA 2ED7A 3MOQA 3DOSA 4OLXH 4R7DA 2A74A 2HJLA 5IJVB 3HC0A 2BERA 4PRNB 5C09A 4V2CB 3V6ZA 2LE9A 3HZYA 4YX2H 1FNGA 4I0PC 4JKPL 5C0AE 4BQ6A 5E00A 1YC8A 4G9FB 3WUZA 4JGMA 5EC2B 3FFCD 4KKCC 4JG0L 1IGTB 1FJ1B 4P2YA 1DSFH 1J8HE 5CEZD 1MPAH 4JFFE 2UY6A 2VN4A 3RQ3A 4OLXL 5JNYA 5TDNB 2YBRB 4IIQC 3PABB 2ZG3A 3CLFH 3PGDB 3TPUB 4Y8AA 2G9HA 1Q9WA 4HIXL 1A1OA 4PG9B 3VXUA 3EJYC 4NJAL 2IF7A 3EOAB 3BW9A 3MR9A 1JYNA 2EICA 2FIKB 3L3HB 5J57B 3ZSSA 2FEEL 1FGVL 4W4OA 3T77A 5JW4N 4X5XB 1A6TA 1SEQL 4HBQA 5JQ6H 4I0PD 2I5YH 4X98A 1U95B 1CGYA 3QJFB 5E2VH 4U1IA 1R3HB 4P2OC 1LEIB 1KEMH 4OSUL 3G5ZA 4JFED 1JN6B 4OZIE 4HPOH 1LEKB 5IROC 1G1CA 2FX7H 4NIKB 3MJ8B 4I0PB 2P47B 2YKLL 3L7FB 5E6ID 2NY6D 2Q7NA 3DVNB 2ZSVB 4DFHA 4DTGH 4EBQL 2GK0A 3C5ZB 5C0BE 3OX8A 2FIRT 5GPRA 2N7AA 3QNZB 5J9PB 4M5ZL 4NDMB 3MBEC 1CFQB 3QWQB 2NTSP 1RIVH 4PTUA 5C07E 2HLFD 1WFNA 3W5NA 1T0NA 1K8DB 2VXTH 1KJ3H 3AAZB 2HT4C 2DOCA 1A7PH 1NEZB 3AREA 3LDBC 1EVTC 3NOIA 4HIXH 4YEEA 2F58L 1NSNL 4OGXH 4C57C 4AIXA 3BE1L 4DUVA 1XH3B 1K8DA 1QRNE