4KVCL

2h2 fab fragment of immature dengue virus
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
212
structure length
212
Chain Sequence
NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Obstruction of Dengue Virus Maturation by Fab Fragments of the 2H2 Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Ig heavy chain V region MOPC 21, Igh protein
total genus 50
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kvcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kvcL01
1KLUA 4MJ6A 4HFWA 4U1NA 3MA9H 4JFZH 5JIHA 4C4KO 1N59A 4WO4D 5BVJB 4Q58C 1UM4L 3KXFA 1FL5B 4LPUA 5I76A 1ADQH 2IGFL 4I18C 4NJ9L 1U8QA 1UWXK 4H8WH 5JW3H 4XMKH 4OF3A 3KYMA 3BP5A 1UKSA 4KUCF 2DM2A 5A3ID 5I0DA 1CU4H 2VUOA 4YHMH 4ONFH 3KLSA 3ZDZF 5GGRB 5A16B 5E94A 3O81A 3RL2A 5K59F 4ZODA 1D6EA 5I1JH 4KMTL 5FGBC 4NNXA 1Q94A 4ELMA 4OKVB 4PJCE 1UJTA 2R1XB 1T4KA 1B0RA 5E4IA 1NBVH 3DX7B 3K46A 3RWCA 3A6BH 4ZUVA 3BW9B 5D2LE 1EVTC 1FYTE 2BOBB 3B9AA 4KROD 3MJ6A 4HEME 4KKAC 3WO4B 3LS4L 1TETH 12E8L 2MTPA 3WKMH 2XWTA 2CJUL 4U1JA 4OZGB 3QXAB 3LVEA 4G7VL 2EDOA 3RUGA 3ZE2E 3MOAL 4W81A 4P46B 1J10A 1JPSL 2DIAA 2NY6C 3ROLA 5HI5C 4F9PA 4U3HA 2A73A 4R26H 1MFDL 2FECI 2HA1A 3P11H 3K8LA 3TBWA 3IFNL 1Q9WB 4KJQC 2QHRH 4ODHL 3SDCA 3MYJB 1KYOK 2E6QA 1PZUB 1G9MC 4TQEL 4KUCD 4GRWE 5JW4R 4WI6A 4S2SB 1AGCA 3Q6GH 4M3JA 3PWNB 1S7QB 3RVXC 3MTRA 2F5BH 2J12B 2OBGA 3QNYA 3WIHA 4U6VH 5EZJB 4TSCL 1BVLA 5IVXE 3DYPA 5H35B 4B41A 4FQJL 1JMZA 4P9MH 5H2BA 4JN2B 2NNAB 2Z31C 3EZ8A 5IHBA 5KVMC 5D8JL 2FIKA 2G9HB 4JQIH 4G5ZL 5EZLB 3LRGA 3O3EA 4MB4A 3T3PE 3UDWA 3IF1A 1LO2L 5D2NB 5DJZB 1U8HB 2DAVA 4IJ3B 2QHRL 4ODHH 3IRPX 2HLAB 1UWEH 4I4WB 1A7PL 2X5PA 1J8HE 1U8PA 4QRTB 3IDXL 3IU4L 5IB2B 1KNOA 2ZJSH 5CJQH 4FTVE 4LKXB 3MLWL 1T89A 2QBWA 1NFDB 2BCKA 2EECA 3VFMA 1UQSB 4O00A 2NY1C 3V6FB 3A67L 4KK6D 2BC4B 3FO2A 3I50L 1QPXA 5IQ7L 3EFDH 5TF1H 4JQXC 1BOYA 1GRWA 1OD7A 3VFPB 1AY1H 3GHBL 3U9PL 3F7QA 1GGCL 5J1TC 1BBJA 1YA5A 3QZWG 1DANT 5GS2D 5ITBL 1T1ZB 2PYFA 2ZCHH 1MWAH 2RIKA 1NAMH 4MCZB 4OB5L 1BIHA 3SKOB 4IBLT 1A6UL 3BEVA 4LCCC 4PJCB 3EYVA 2FYYA 5GJSL 3EBAA 4PFEA 4P3WA 1HWGB 2YA2A 2JB6B 4NDMA 4UQ2A 2VDQH 5GGTL 1A4KA 1I1FB 4XC3L 4YZFF 4F37K 4UZGA 5D2LB 3A6CH 3NCFB 2H2SC 3ARFC 5IEHA 2VR9A 3MRPA 4QOKD 4J1UA 4K7PY 4OZFA 2Q3ZA 4FQ1L 5FGSA 2V5RA 1RULH 4XPAH 4ALAH 2BX5A 5E2WH 3GMRA 3L3DB 1NGXB 1MFEH 1V05A 3NCBB 2NXZD 4QTHB 5EZJA 5KVDH 3BJLA 5FYKU 4LCUB 2FIRT 4Y4KA 1KOAA 1MOEA 5F1SA 4DVBA 1GVIA 2NY2B 1N2RB 1KB5L 2CUMA 4K71B 4Y4KD 1FGVL 3VFRB 1PD6A 1XIWD 5TF0A 3SEPA 2O5YH 4M6NL 2IMMA 3WEXA 1AHWC 3HE7A 3TCLB 1INEH 1YJDL 4H5SA 1F4HA 4PLJC 1T7XA 3UYPA 3UZEA 4NUGL 1NCBL 2HKFL 4QGYA 3RUGB 5C6TH 1D5XA 3KLHD 3CSYA 5C71A 1UH2A 4U1JB 3GJFA 5IVXB 3KPQA 5CKAA 1ZVSA 3GRWH 2IBBA 2A77H 3S35X 1URLA 2OR7A 1FO0L 5F8QC 4JFHE 2PXYB 1MAJA 1AKJB 3IDJA 4J6RL 3KYKH 2FD6L 1XF2A 4B50A 4OKVA 5FKPA 1UACL 3VXSA 1QOKA 4XBPA 3L3IA 5HYSB 2Q87A 1X5FA 1CGSH 1J8HB 1ZGLA 1YYLL 2P5WD 3B9KC 3K8MA 5E99H 2XV6B 1SY6A 4R8WH 3VXTB 4YX2H 3K2UH 2C3HA 2O26U 4LNRA 3VRLF 1XR8A 6CGTA 4K8RH 2D3VA 1HDMB 4LLMA 1OGAD 1KCRH 5DDHB 4ZYKB 3LS5H 4NQDE 4LCYB 1ZA3B 5K9KB 3O0RL 43CAA 3HNVH 1NCDL 2GITB 1OGAA 1T66D 1WV7T 3JZ7A 4YK4C 5JUEH 1MRFH 3HUJF 4MXQD 4YGAB 4HH9B 1FZOB 5DMIH 4YJZL 2VLKE 1UCTA 4P0DA 4V1DE 3D5OF 1N6VA 1HK6A 4GXVL 3BH9A 3SHSA 4QXGL 2PW2A 5HD8D 3T77A 2FRGP 3I6KA 1TTFA 2IFGA 5EZIH 2X9YA 3RKDC 3IYLW 4U33A 3FQRB 4JG0L 4LAQH 3PWPD 1MEXL 4Y19E 1KB5A 4Y5VC 2Z4QA 3D85A 4JKPL 4P4KB 4BM7A 1OGTA 5HVHC 3KJ4C 5GZOC 3SDYL 3O3DA 4U1IA 3MBXH 1U3JA 3SDXE 4OGZA 1AGBB 5C0EA 5HDQL 3VJ6A 2YK1L 1FYTA 5SX4I 4RBPK 2JELH 1P84K 3BN9C 5INCA 5SV4A 4NRYB 2J8UE 4JFFE 1VSCA 3TCXA 3MXVL 5E8DL 2DQHH 3QUKA 3G6DH 3RUGE 5IKCA 1H0DA 1KTDB 1LEKB 5CLTA 4HMDA 3QG6A 2BVQA 3BZFB 2OTUB 5IM7B 3VFWB 4M5YH 1BLNA 2N7AA 3QIWD 3QO0A 5KN5B 5DQ9B 3FOMA 1F2QA 5BVPL 4KI5F 4XPBH 5HHVH 4RGOH 1YN6B 3HI1A 1J8KA 4P9HH 1NJ9B 5I8CA 3WLWC 4WNQB 1G1CA 3RRQA 5I16B 2ZUUA 1MCBA 1KELL 1EHAA 1DN2A 1YC8A 4WU5A 5BQ7A 1KPRB 1SJXA 1YPZA 4UIMB 2J1KA 1ZV5A 4QHNB 5IJKA 1FNSH 2F8XC 1OTUD 4MNGB 5CINH 2AJZA 5GS0D 4P2OD 2NXYC 3LKRA 2X1WL 1M6OA 3X12A 4GRMA 3RGHA 3TPUA 3G08A 1K6QH 3QULA 5KJRH 5B39B 5ESQA 3LQZB 3GBLA 3MR9B 1ZT4B 4WW2C 2XFXA 5E2JA 2AV1B 1GHFH 1HHJB 4PG2A 5D1ZB 1R3LB 2R1WB 2JK5B 5DQJB 3MRBA 3H3PL 2EXYD 5D7JD 5JOFB 5C0CA 3GEWB 4QHMA 1HEZB 3HI6L 4WHYH 1AXTL 4Y4HB 1LGVA 4L3EA 3JV6B 2HJKB 5F6HI 1ZKAA 1C5CL 1UM5L 1C5DB 1PEWA 1OAYH 4JQXA 1ZTXH 3QIWB 5IMKA 1F42A 5JO5B 3GK8H 4OI7A 4IHOB 3MLRL 3L9RB 5LGJB 4U4BA 4JFDE 5IOPB 1YEHL 4ZNCD 1D6VL 2YRPA 5B3JE 4HIXH 3VFVB 3QDMB 5KW9H 4LPXA 3S5LB 1N6QH 1KENH 5I17A 3IKCA 4M5ZL 4RAUB 1BEYH 4OFIA 3SDDD 4U6HB 2H41A 3T0EE 3C5JA 3H3PH 3V8CA 3SDXB 4Z7WF 1S9XB 4PRPD 1MF2L 2B7DT 5F9JB 1HSBA 4KRLB 1KCSH 4OUOA 3LIZH 3EO9H 4ODSH 2X4RB 5DI8A 3TVMC 4PY8J 1VB9A 1JRHI 5HGHA 1QFHA 4MXVF 1MUJB 5F7EH 4KZDL 4ISVA 2KH2B 3IJHA 5KVFH 1PVHA 3DIFB 3ZTNH 1S5IH 4R9HA 3ARBC 1F3DH 5I19L 4POUB 1QEWA 4OZIA 2X4UB 1CXHA 4KTDL 2J6EH 5HDOA 1Q0XL 5AWNH 2HH0H 2VSDA 1MREL 2ATPB 2Y07H 2ADGA 4OZHA 2BVYA 1UXSB 1V3KA 1CG9B 2GTWB 4M5ZH 5DC4B 3GMQB 3ORJA 3VG0H 1FHGA 3T04D 3U2SB 4ZPTB 3WSQL 4OCYL 4GW4B 4NT6B 5EC2B 1Z9SA 3F12A 7FABL 3HTLX 1P9MA 4FG6D 4ZUWA 4G8GA 3BDXA 3SGKC 2VZVA 1ZLSL 1YEGL 4YXLL 3QI9D 1A14L 1YZZA 1A7QH 4M7KL 5IMMA 4WUUD 1G84A 2Q8AH 2MHAB 3QYCA 3CAFA 4UU9B 1RVFH 3JTTA 1PW3A 3B5GA 2DLHA 1ZVYA 2ED7A 1S8DB 1WAAF 2B2XH 4Z8FH 1DSFH 5F3HB 3MLPA 2VABA 1YEDB 5J9PA 4M8QB 4NO2A 4U1LA 5I1LB 4JHZA 4XWGH 1EPFA 2DQIL 1D5MA 2V17H 2R1YB 1YDPA 3QDJA 2YUVA 4PGCA 3F6IA 3JWOC 4HULB 3EOBB 4DKFH 2EYSA 2MCPL 3V52L 1WWCA 4G7YL 1BOGA 5IR1B 1RHHA 3O6FA 5ISZE 3L3JA 1SJEB 4OIBA 2IG2H 1CD0A 3VD9A 3BXNB 1EXUA 1R3JB 3P0VL 3QDJD 3H7BA 1XAUA 4DGIH 4G42B 2Q8AL 2VAAA 2X1QA 3SOBL 5IW1B 5IVZA 4HKXA 3TBVA 4WDIB 5CBEB 3C60C 4U1HB 4G9FD 1VFUA 1N5YL 2OXHA 3DI2B 1WCBA 5EBWA 2J8UA 3CK0L 1H5BA 3QPXH 1XR9B 2B1AL 1I1YB 4YHPA 2NW3A 2R29H 4UV4H 5E8PB 4FFWD 2YPKB 5GRVL 1ZLVH 1DBBL 1OF2B 3BKYL 2I26N 4X6DB 4XMPH 4PIRF 3H3BC 1XF4B 4L3CB 4KY1L 2NY0B 4MVBC 4EBQL 1K8IA 1NSNH 5LBSL 1AD9A 4JJ5B 5DJ6B 3X14B 4H0GA 2I9LB 3RVTD 4JM2D 1WT5A 4DZ8A 4P23C 4DK3A 2Y7QA 5LAXA 2HKHH 2FZ3B 3T3MF 4UILH 5D9SA 3O11A 5KVGH 4Y5XA 4CN6A 1IMHC 4QRQB 4X6FB 4NBYB 1NLBH 1IM3B 1GL4B 1SQ2N 5CLWA 1JYXA 3T2OA 4PB0H 4JRXA 2D7PA 1N4XL 1T03H 3UTZA 1BZ7A 4F2MA 1H8SA 1AGDB 4YE4H 2I9TA 1CQKA 1YY9C 5DJCA 2XG5A 3LKNA 1H3GA 4CU7A 5L6YL 2YKLL 1UXWA 3W81A 2A74B 3CXDL 3QDJE 3QUYA 4R3SB 2OS7A 5L2KD 5INDB 4NRZA 4LARH 4MJID 5C0NC 4GAJH 4OLYH 1D3CA 2VLLA 5DWUL 2P8MB 3BOVA 1FL6B 1N5AA 1DVFA 3TO4C 2HRPL 4RDQF 2DDQL 1RFDH 2E7CA 1CWVA 4NKQB 4PGDA 3GSOB 2HTKD 4I8DA 5HHME 3V5KB 5GSVA 4HH8A 2BSTB 2Y5TB 1CLCA 3W39A 2QQNL 4NNPL 3HPLA 2DQTH 4X6CA 1I7TB 4TTDD 3WV0A 2CK0H 5D7KE 1PZ5A 4QRSB 1G9NL 1Z2KA 1I7TA 1UCBH 1L7TL 4G9DA 4ERSL 1LEIB 4N9GB 5D1XD 4L9DA 2CXGA 1BD2A 3ALWA 3MLTA 4YIQA 2DD8L 2HVKA 2HG5B 2IQAB 2OL3A 4UT6L 1DDHA 4CW1A 2VDKL 4FP8H 3KLAB 1TZGH 1HXMA 5C2BL 5T1KB 1DBKL 4QO1A 3HRPA 4UOW1 4LEXH 3F58L 4NQTA 1MCHA 2MNUA 3HKFA 3FZUD 4M6NH 2IH1B 1QFWM 1E4KC 3ALXA 4ZPVB 2YUXA 3PWLA 1INEL 4NNPH 1MJUL 4F15B 4G6ML 4JFHD 1JPGB 2F54A 1ITCA 1AGDA 2I9TB 1BX2B 1I3GL 2O5ZH 2OK0H 3Q1SH 43C9A 4POYA 5EPMA 1P1ZB 5E9DE 5C0GB 3BKCL 1T1XA 2XWJB 4XNYL 1OPGH 5D4QA 4ODWB 1A6TA 5EUKA 4D0CA 4EDWL 1TQBB 5DHYA 1LD9B 2DQCH 1WGOA 3I75B 1LHZA 2WP3T 1NFKA 1EAPA 4HGMA 5GRVK 2DQUH 5JDSA 2OMBA 1MVFA 4QTIH 2FGWL 4UDUB 5C0IB 1MIMH 4HJ0D 1ORSB 2L0DA 4URTB 4TUKH 1OAKL 1I7UB 3OB0K 1FFPA 4HSQA 4R2GD 4K7PL 1P7HL 5KS9F 2Q8BL 3NH7H 2XICA 4LMQE 4OLXH 3LEVH 2XTJC 3F7PC 5IHZB 3O4LB 1LO5B 3BISA 1XR9A 2P5EA 3ZT7A 2VXQH 3B9EA 3TYGH 4Z95H 4NSKA 4KK9D 4KK8D 4U1HA 3PWUA 1IGFH 4XB8A 4XCEB 4CL7A 4YFLF 3MLVH 3TGXA 4MQXD 2AV7B 5CJXC 2VITB 4D9QE 2PF6A 4KDTC 4QXTA 1ZLVK 1BOGB 3KPLB 5EZIL 3B83A 1X5HA 1XGPA 3C5ZB 5F72S 5AZEH 5HGBA 4J23A 2ED9A 4F37F 1J7VR 1QVOA 4R7DB 4K3DL 3MFGB 4YBHA 5LXGH 1RK1B 1XT5A 5DJAA 4OTXL 5EULV 3OR6A 3JTSB 5KG9B 5FOBA 3HAEB 1VGEL 2AVGA 2PTTB 2V2WB 5FM8A 5LVEA 1HWHB 1QSEA 4Z0XA 5AUMB 4XPFH 1MWAB 4Z7VF 5E6IB 3QIUC 1KJMB 3LKPB 4UV7H 4GW4A 3U2SA 1A6ZB 3O2WL 2JIXB 4EI6B 1NMAH 2CLVB 3HS0A 4NJAL 5FK9B 3G6DL 4YHNB 4C56E 3CSGA 4J3WA 3GMPA 1HI6B 5E1AA 3TBSB 4HDIB 3GGWB 5DHVA 2DBJA 1HQ4A 4HPOH 4X9BA 3SGEI 3QIBA 4NQED 1SJHB 2X4UA 2EIZA 2XZCL 4S10A 3DURA 5EO9B 1ZAGA 4YHIB 2MQ3A 4DCQA 3T3PF 1NC4D 1KXVC 1MELA 3U6RA 3HFML 3JWDC 2BZDA 2ICWB 2AJUH 2P8LA 1GOGA 1G7LB 4H1LG 3KLHC 2AS5M 1OSZA 1MFAH 3K8KA 3QIBC 3PE9A 5E2VH 2YSSB 4NRXB 1NMAL 1KIQA 3ILQC 5FUCE 2VLME 4NO3A 5ACLA 1AXTH 1ZHNA 5MEOA 4D9RE 5BO1H 5FOJA 3VE0A 3O4LE 1I7RB 4YC2C 1KCUL 3DX9A 3GMMB 1X44A 3BQUA 4MA7L 4JPKH 5IOPA 5L7XL 1ZS8B 4XP9H 3MLSL 5ETUB 1RMFL 3L9RA 3GIZL 2F74A 4QOKB 3RWIB 2FO4A 3GM0A 4W4OA 2FBJL 4GKSB 1FVDA 1FORL 1UZ6F 1FNGB 4KC3B 3K3QA 1QFWL 4CVXB 3B9KB 4HBQA 5KW9L 1HOCB 1U36A 1MRDL 2GSIB 3OXSB 1F90H 1DZBA 1NMCC 3FQXA 3VFOA 1EJOH 2AKRA 4HUXA 3MRFB 5D1ZA 3PG2A 4FQHB 1CT8A 1H3UA 4D9LH 1A6VL 3QULB 3UTTD 4QWWD 1N6QL 5IUSA 1UB5B 4GRMB 4WTWA 2VNCA 4NQEA 5D70L 5HYJA 4ZD3H 4WCYL 3UJJL 5CJQL 3P2TA 1EEUA 5I19H 1GGUA 2FSEA 4F7PA 4Y2OA 1GC1H 5I1IH 1J1PH 1BWWA 4QHNA 2AGJH 4QYOA 4O5LH 1NAMB 1FORH 1X6NA 1KPRA 1QFWH 4U1KA 3HG1E 1K4CB 3O9WB 5TE6L 4IMLB 5ICYB 1KXQE 3RBGA 1A6AB 1CD9B 1NGZA 5EBMB 2W0FA 4QEGA 4LNVA 3U9PH 1IAII 3LV3A 3QQ4B 1FN4B 4PJ7E 2ZG3A 3PP4L 2NZIA 1A6ZA 1MREH 2Y07L 2OX5A 4PRNA 1FGNH 3KDMA 3VXPA 1ZE3C 3BH8A 1LEGA 4QHLA 2XY1A 1K5NA 2WWKT 5I74C 5I75B 5JHLL 1AE6L 2V2WA 5GS0C 4J3SA 3QWQB 3BPNC 3VD3A 2C1OA 3CCHB 1T1YB 1AR2A 4IIQA 3OAYK 4DOHB 4EKXA 5CEXA 3RVXD 3NN8B 1S3KL 2LAAA 4MD5B 3BP7B 4HUWB 3B8YA 4FQCL 1RVFL 1QBLL 3PP3K 3WJJA 1NANI 3EO1B 1Z6JT 4RGNB 2VLRD 1IQWL 2ADJB 4PJDB 4I0CC 5I1DB 1MVUB 3ZLQC 1FNEB 1FGNL 2F19H 1WZMA 5FGBA 1K9TA 5ICZB 8FABA 5C0DA 4PJ9C 3HC3H 4UT9H 2NQCA 4M7ZC 1RJZB 1G7JB 2X9WA 4ZG1A 3SE3A 2XZAL 4I5BA 2Z93B 4JRXE 3QFDA 2NY1B 3BH9B 1BQSA 1CE6B 4GBXB 4LFHD 3MRMB 2AJXH 5FYLD 1S3KH 4NSKB 3AXLB 3LS4H 1QFUH 1G6RH 2XPGB 1CF8L 4GAGL 1G0XA 1OGAB 1TFHA 4YHML 4IOSD 3T4AA 1MCOL 5HJ3B 3DX8B 3P77B 2VXTH 2R0WH 3CFJB 1W0VB 2R29L 1G7IA 4LSTL 5GPRA 4K94H 4U0QB 3DV6A 5FUOH 3OHXB 1M7IA 2BSED 3RUGF 2XZAH 3CFEB 3CX2A 4HWBA 3AMLA 3EOYG 1I85A 3QEHB 4XBPB 5HYSA 1FO0A 3CH8A 4PJGA 3MNVB 5E2TH 3E6FA 5JIKA 3KPSB 1YEKH 4NM4L 3ME0A 3AREB 1JYVA 2YA0A 1DQQB 2WBJB 3M07A 1A7OH 3CZFB 1E0OB 2DQEL 4GG8B 4BUHA 2DYPD 4PREB 2F53B 1KJ2A 4F7TB 4KVCH 2VLKA 4WWKB 1VEOA 2ILLA 4KKBD 4Z7OE 4FXGB 1U8OA 1WFTA 1TJIL 3V4UH 5J1AB 1MCJA 4LLYB 5DZNA 3IFNH 4U6YB 1MIEH 1F3JB 4HK0B 1ZK9A 3EIFA 4OCWL 1MCRA 1F11B 3CZJA 1IGTB 5T1KA 4MX7A 1L0QA 4A6YB 3EJJX 1IGML 2B39A 1U9KA 4DOHE 4MWFA 2BNQB 5CJ5A 1JE6A 3WMSA 5KOVC 1IAKB 4PJ9B 1WFNA 3JWNC 4LIQE 1N2RA 4JGMA 3MRJB 5GRUH 4JZNA 2Y4SA 5HPMB 2DDQH 3T1FA 5C07D 2C1PB 3D69B 1LDSA 3U36B 1S7SA 3RJDA 2OP4L 5I8EA 1YNLL 4ORGA 4FFYL 3VFSA 3EO0A 4YHOH 1G9ML 2BSTA 2Y5TA 3VI3E 3FRPG 4HCRA 5DUPL 5HHOA 2CRYA 2YD1A 5T3XH 1KJVA 3FRPA 4NDMB 1P4IH 1ZEAH 1FFQA 3MV7A 3Q6FA 3HC0B 4LHQB 2BNUA 4UTBH 4GAYB 4M9PA 3FO1B 1QRNA 3SKOA 1NKOA 4P2YA 2VDKH 3LD8B 1S7WA 4PG9B 2SEBA 4YO0B 1M7DA 2OTPA 2NX5E 1XGTB 4FQXB 2RJMA 5J8OA 2OSLB 1REIA 4IRJB 5MI0B 3HR5A 3KXFE 1NLDH 5D1XC 3TEUA 5T5NG 4F2MB 4F8QA 4LSSH 4H8WC 2HFGH 2ADIA 3IFLL 1BVKB 4WI4A 3S4SG 4IS6B 4W70A 2ZSVB 2P5ED 2NY3D 4MQ7A 2EC8A 2DQCL 4Z5RB 5T3XL 3NBNA 2V7NB 4MA3B 1F4WH 2AXGA 3SBWC 4I48B 5TDOA 3SKUD 2PCPB 3MUGA 3V79C 4XX1E 3TO4D 3HMXH 2BY3A 1XGYL 4TNWK 5K9JH 1WLHA 4TUKL 2Y9RT 2VQ1B 1KJ2L 2J8UF 3TWCH 4UNVA 2R15A 3BAEH 4NHUA 4IJ3C 5HI4D 1ES0A 2CK2A 4LIQH 3ULVF 4GRLC 3CUPA 4YXKL 4GLRH 4HV8A 3CGTA 1P4LA 2DQUL 4JQVA 2K3TA 4ZS6C 5FO8B 4ZDHA 3GJFK 5IT2L 2WBJD 1F45A 1BVLB 1U8KB 1C5BH 1NDMA 5DRZA 2E6JA 2J5LC 2IEPA 3Q0HA 1S7RA 4I0PD 4GRLA 3K74B 3LKSA 4TVPH 3EFFA 2JJSA 3BDYH 3PL6A 4JLRB 3QEQB 4OM0L 1A7NH 3VG9B 4J3OC 1I8IA 3SGDI 2ORBH 4YX2L 2D7NA 2H3NB 3S6CA 3VXQA 3JBG7 3VA2C 3AU1B 1KENL 1FVEA 1QSFA 2DJ4A 2DKMA 1S9VA 4XCYA 4EXPX 1R5IA 1QQDB 1MVUA 4K3JL 4RAHA 3QUXB 3O41B 2VR5A 5F21B 2MPAH 5IP4A 2R23A 4HGWB 3T8XA 4DVRL 3F7YB 5DVNA 2CQVA 1WSST 4FQQA 3OKNB 4R4NC 4WO4B 2QQLL 1QLRA 4P5KB 5D7IA 5K9QG 3R8QA 3TM6A 1F97A 3GIVB 4WI3A 3BP7A 1I3VA 1U3HD 5F9AC 2PETA 2GEEA 4LAJH 3NOIA 4GSDH 3PGCB 2NXYB 4KPHL 3LZFL 1A9BB 5T3ZE 1R0AL 1KF9B 4Y4FB 1CL7I 3TV3H 2AW2A 1RJLB 5CHNA 2GHWB 1B0RB 4S1SL 1Q94B 1LDPH 4XBGB 1R3KB 3BQUC 1J11A 2JB5H 4NT6A 5D6CB 3FOLB 3BFOA 2DIBA 5DD0L 3E8UL 2NX5B 4IRSD 5CP7B 5E94B 4ZPTA 2IADA 2PN5A 3IJYB 3T0AA 3C87A 5EC1B 1JZ2A 2VUYA 4EN3C 1XF1A 3BPOB 5T3XE 5IG7A 3KNBB 1MRFL 3MNZB 2VOTA 1PEZA 4YXLH 3VD5A 4NO5B 4ZOCA 5B8CC 1K4CA 2MMXA 3QAZC 1M71A 4XB7A 3UMTA 2X4TA 3MJ9A 2AEQL 1ZOXA 5EU6D 4E42A 4JREB 1CGUA 3T4YA 1S7XA 4HPOL 4RZCA 2GJ6B 4ISVB 3UEZA 3UZQA 3MA7B 4N8VB 5C09B 2K7QA 2DI9A 4NO5A 3RFZC 4YR6A 3QI9C 1XZ0A 2XWBA 2X4RA 4DGVL 4DWHA 3KNBA 4LDOB 4PRBA 4EI5B 1T04A 3E8UH 4KMTH 5FYKD 1K8DB 3D3VD 1TITA 3ZE1E 2VE6A 2EICA 5B22A 4B7LA 2VDNH 2CUIA 1JL8A 1HHKA 4FNLL 2NX5A 5CP7A 3VGGA 4F7EA 3BYTA 1RMFH 3DUUA 3VXOA 3UPCA 2DLGA 3OG4B 4MNQA 3WN5A 1XGUB 3HNSL 3L95A 3MV7E 4YC2B 1RJLA 5CHNB 3RGVD 1OAZH 5EU3A 3CDFA 3B9KA 5CUSL 3VWJC 3FFCA 3ZHKA 1WZKA 3ARBD 4JDVB 5FDWB 5IMLB 3ZDZE 1C5DA 1CGXA 2DQHL 4NPYB 4HT1H 1JN6A 2RAMA 3E6HB 3QG7L 4QOKA 1AFVL 3RWIA 5JR1L 3ZT6A 2WMPA 4NOBA 2FBOJ 3ARGA 1VFAA 2R4RL 1DN0A 4XPBL 2C3WA 3D0VB 1I7RA 1HZHH 4G6FD 1IKFL 2JK5A 5KSUA 1FRGH 5B38A 4MJIA 3ULUH 1JNLH 2QLVB 3DRTB 2NPLX 3QWRA 3UPRB 3V5HA 2XFXB 4EDXB 4AJ0A 2CRIA 3RNKA 2H3NA 3MCKB 3BGFB 3DMMD 1C1EH 5ESQB 5I6XB 3CPLA 1OD9A 3MXWH 1MLBB 1J1PL 4X99B 3KXFD 1R3IH 3EKCA 4TUOB 3TN0B 3PGFL 4R4FL 2CLRA 1FZMB 2MKLC 4S11A 3BIKA 3G5XA 1Q9OA 1D9KC 4P9ML 4N8VA 5I66A 4QKXB 4HIJB 4OZGE 3ILPB 1CXLA 4ZD3L 5TH2B 3CFIC 4CN1A 1BFSA 4WFEE 4PP1D 5GGVH 3V0VB 6FABH 5FHAL 2IANB 1EAJA 5BV7L 1MCNA 1KN2L 5T5FH 2VXVL 2R2CA 2ZOLB 4PJFB 4HDIA 3MJ9L 4HV8B 5EZOL 3U7AA 5T1MA 3RDTA 2CDFB 3O3UN 3JV5A 4Y16A 3ZSSA 1SY6L 2F54E 4WEBH 3TJEL 4P23A 3S3SA 1IM9B 1I8KA 3AROA 5C6PB 1LEKA 4AL8H 2YHGA 1KCSL 1UM5H 1UWXH 5ICXB 3RWDA 4IMKC 4L3ED 1RI8A 2GY5A 3TBYB 4P2OC 3DO3A 3HE6C 5TFSH 3WHE1 4W68A 1G9NC 3TA3D 2W0KA 3T2NL 1GGCH 3OR6B 5KG9A 2DQTL 3RWEA 3BDBA 3MNWA 3GIVA 4BFBD 1FVCB 1R5WA 1L7TH 2I5YH 4J3TA 1WTGT 4P5MA 3FB6B 3BO8B 5ERWA 4DAGL 1BZ9A 4OIIH 4Z7UF 3JUZA 4HWNA 2EEAA 4JG1H 4IRZL 3C5ZA 3HAEG 5A43C 5I1CH 1RUAH 2FEEL 5JW4N 1QSZA 1PAMA 3INUL 3QUXC 3NFSL 1E4XI 4FTVB 3MV7B 3Q6FB 2OJZL 4U0RC 5TQ2H 4HUVA 2DLFH 1NFDE 3H7LA 1KJVB 3P9MA 1CFVL 3FL7A 3ZE0E 3C2AH 2NY2D 2XTLA 3G9AB 3RX7A 2P43B 2FR4B 3GKWH 4G80A 3NCMA 3BIBX 4JVUA 1QYGL 1FZOA 4XAKD 4GG6A 1QLFB 4G8IA 5I1HL 5I1GH 3IDMB 5L9DH 4PJ8C 1GAFH 3UZVB 1PBYA 5DRZB 3CVIL 1NGQH 4A6YL 3T1FB 3H9SA 4ZO6A 2H26B 2ZG2A 2O61A 1I3RA 4XNYH 1KT2B 2GUOA 1WZLA 4GRWH 5GXBB 1KIRB 4PRIA 3OZ9L 5EO0B 3SPVB 1J0KA 1U58B 3QNXB 3O6ML 4P2QA 5FM5O 2E7LA 1HDMA 4LLMB 3CFDA 4JPIA 3DXAD 4Z77B 2Q20A 2MQCA 3CUPB 2VISA 4M1DH 4WGWB 4DW2L 1IGTA 3MBEB 3S3PA 2XN9A 5ID1A 1FV1B 5HYSG 4ZAKA 5SV3A 1BQHB 3HZYA 2XKNB 3DLQR 4LSTH 3QCTH 5F7WC 1QA9A 5IHUL 3IVKA 3VMNA 3PV6A 1RK0B 5DXWA 3IXTB 3PQYD 5JNYA 1ZWIA 4FFZH 2OR9L 4HIEB 5FKPB 4Z78A 2IQ9L 3P9WB 2QKIB 4CMHC 2IANE 5SX5K 5IB4A 5FUZH 2FD6H 4GG8A 3RVVC 2FJFA 4D9RD 4PJFE 1YNKH 4Y1AD 3BKYH 1EFQA 2EZ0C 4FQPA 3P0YL 4P57A 5ILTH 2DM7A 4NUJA 3QRFM 2XTJD 3HE6B 3AY4A 1JPGA 2F54B 4MS8D 4LBEA 4WO4C 4NGHH 1S9WB 3D3VA 5IVXA 3GJFB 3N1FC 5B4MD 3MNVA 2EKSA 4X9IA 1VEPA 4K8RL 4FHBD 4X8JA 4GAYA 4WI5A 4RFOL 3EOTH 4WW1B 5FYLL 4KFZC 4EN3A 1VA9A 1TVHB 1YMMA 3LEXA 4OAWB 1IC5L 5KVGL 3U4AA 3V9FA 1BF8A 4LQFL 1KIRA 4PRIB 5D96B 5GJTH 3T08A 4I77L 1H3PL 5DMIL 5AZEL 1U91B 1MH5A 2H26A 4N9GA 3N85H 1Q8MA 1UEYA 1DVFD 4H88H 3D2UD 1FYTD 2YKLH 1HH9B 5H37G 3HE6D 2E27L 4C55A 1C08A 1QLEL 3LPFA 5CWSA 5DD6B 5IEHB 4N1EA 1QSED 4U6VL 1N5AB 4AIOA 2Q6WB 1T5XA 3IB4A 4NQDB 4LVNB 4Y88A 2XQYK 1IC5H 4G6KL 2LU3A 5DVOA 2P7TB 3LQAL 1F3JA 1TVBB 3GBML 5HVFB 2X09A 3GI9L 4MXWH 1UH4A 4PY7A 4LSPL 3ULVC 2A74A 1QR1A 4G6JH 4FXGA 5JMRA 5DJCB 4X4ME 5DEFB 2VLKB 1I75A 1T0MA 2Y23A 3TFKD 4Q0XL 4RRPG 2ZJSL 3FO2B 3I02A 4BFEA 1T1YA 4R0LB 2CKBB 1A3LH 2R2HB 4GKZB 3A67H 4HG4K 4WV1A 3AREC 1I4FA 3SE9H 4WW2F 4LCCB 4D0BB 3E6FB 5BVPH 2AK4A 1BWMA 5LAXB 3PL6D 2DMBA 2BXZA 3DMMC 4LCWA 2VN7A 3BSZL 1U6AL 3CFEA 4GMTL 4GH7B 3WFBH 2YR3A 5CP3H 5FM4A 3IF1B 4LSPH 2Z92A 3IDIB 1J88A 2VB5A 5DFVD 1R6VA 2CDFA 1VGKA 5ITBH 1ACYL 4WFFE 4MLSA 3P73B 5DJ2A 3MOBH 4KZEL 1A6AA 5DYOB 3JV4B 4JR9L 5FKAA 1S7UB 5IF0B 2VDRH 1OF2A 2LU4A 3FN3A 3MLUL 5DZLA 4WHCA 1MCSA 3BKJL 5CEYA 3L1OH 4LGRB 3BKCH 5DSCA 3EJZC 1UYWL 2J8UB 2KZWA 3ULSB 4JFFB 1XEDA 3ILPA 5JPMA 2DTMH 4QYOB 4QRPD 5B8CB 5IT2H 4XPAL 4ALAL 3NA4A 3QHFH 4KI5E 1G7MB 5D93B 2CLRB 3M8OH 1ONQB 3NZHL 2WNGA 3F58H 2G75B 2B5IB 3SDCB 4KH2A 4X5XA 4JFPB 4V2CB 2DM3A 1JBJA 3DVNB 5CILL 2A73B 3QQNA 4UT7L 1U95A 3O6FB 2L7JA 4PUBL 2WUCH 3MRFA 3U1SH 5BOPA 3X3GH 1D5IH 3VFOB 5GS1A 5DZOA 3NH7L 2D31B 1CFTB 1F3RB 1YJDH 4YUEH 3NFPB 3QIUA 4OCMC 3U0TB 1UYWH 4XVUC 5EOCJ 1EZVX 1EO8L 3OGCA 3BEWB 1A21A 3B4NA 4H1LB 4U31A 1L4IA 1T22B 3NTCH 4JDVA 4TSAL 3T3ME 1NCCL 4IIQB 3I2CH 2ARJQ 5GS0L 3QA3B 1UFUA 2BRRL 3BQUB 1CFSB 3KPPB 4XNUH 2BMKA 3VFUB 5HHPA 1GGIH 1U92A 2IPUG 4AT6A 3WDJA 4UMGA 3AS1A 4OCXH 4F7EB 2B4CC 3LIZL 4ODSL 5D5MA 1HHHA 1Z9LA 3RTQD 3FTGA 5FYLE 5C3LD 5D7KD 2EDRA 5HI5D 5LCVH 1C7TA 3WHXB 3NIGE 3IT8D 3CH1A 3C5SB 3C8DA 4GQ9H 4J4PC 1FC2D 4WHTA 4KTDH 3LEYL 4DCQB 1A8JH 4NCC2 4KAQL 4JFDB 3DURB 5EO9A 4XP1H 5EU5B 1NAMA 3S34H 1FL5A 3DSFH 1XGRA 4MDJA 4EI5C 4RWYH 3BWAB 3SKMA 3ZYOA 5F96L 4FA8A 2W0PA 3TBSA 3T0EB 4NNYB 7FABH 3PDDA 3HS0B 1OP5K 1LP9A 5D93C 1GYAA 4FFVC 4N0FA 1JI2A 3V6BR 1NUDA 3DSNA 1GZPB 4QXGH 2FEEI 3QDMA 4R26L 5IV2B 1LK2B 1ZLUH 1E4XL 4OQTH 4YHZL 3UO1L 2B2XL 4Z8FL 1VEMA 5I73C 3BKMH 5ADPH 4Y4FA 4H25A 4P4KD 4PJAA 4YDIH 5LGKA 4Q6IB 3KPRD 4DEPC 1KBGH 1LVEA 2Y6SC 1RJYB 3KJ4B 4TSCH 5CEZL 2FX7H 5EA0L 5JHDA 4ZUTB 1NC4B 5C0FB 2CDGB 1T2QH 5JW5A 1YPZF 2O5XH 3EYQC 3KPNB 4MJ4A 1YMMD 4HJ0C 1XGPB 1R5IB 2R1WA 4MAUL 1FIGL 4L4JA 3ARDD 5DA0B 1MCCA 1SBSH 5BO1L 5J06A 3QWOB 3W0WD 4UNTA 5GGUB 1TPXC 2MCG1 3VXQB 2VITA 3LQZA 3H42L 4F80A 1E6OH 1RUPL 5GGVY 4JRYA 2GKIA 4X5XB 2FECL 4MCYB 5BRZA 1O7SA 5CJXA 3PL6B 2ICWA 5IGXL 1QSFD 4YDIL 3VH8B 1O5DT 3IDYC 2NY3C 2XZZA 5E03A 3LN5A 3MCLL 4PGBB 4JFYB 2HT4C 3EYOB 3BZDA 5JPMB 4JFFA 2WQRA 3FQUA 3R1GL 5BQ7B 3KYAA 5CMAB 5DSCB 1LO5A 1U8KA 4DKEH 4OCSL 2AJSL 3TA3A 1J0JA 5ISZB 3EYUH 5ALBH 1P4LB 3QAZB 4XP4H 3DRQB 1NC2B 2VN4A 1TQCC 4BSWB 4MDIB 2QTEA 4YHNA 3MGOB 3OPZL 4AIZA 1A4JB 2AAVA 2EH8L 4LFHG 4PD4K 2CLVA 4EI6A 1P6AB 1WF5A 2F15A 3MV8E 2VQ1A 3BZFA 5DC9B 1X4YA 2BVQB 2C4FT 3ILQD 5F1NA 2X9XA 2AJ3B 3MROB 4O2EA 2BSRB 5D70H 4M43H 3TT3H 3PHSA 4AEHH 5ANME 2EE3A 4D0CB 2BVPA 3TLRA 1OTUC 2R2HA 3ZKMD 1GHFL 1PQZB 4WW2B 5CKGA 3HRZB 3S4SA 4K7FB 3UJTH 4XPTL 3ARZA 1EO5A 4GKNB 4TTDC 3HI6H 1LO4H 2OP4H 1N26A 2H2PC 3HR5B 2ATKA 3OX8B 2OSLA 4PRHD 3P4MA 4F58L 1G0DA 1DQML 3LH2H 1M7DB 1J86A 2OJZH 3ZYIA 4PY7B 5TQ2L 5IW6A 2VYRE 2CMRH 4FRWA 3GDBA 3MFFA 1RIUH 3KPLA 2O5YL 2MSPA 2BVOA 4PRDA 4XT1C 1HXMB 1JF6A 3FQRA 5I1IL 4ZFOB 3C8KB 4JFXA 2XQBL 1AE6H 4CW1B 3T77B 4KHTH 3MRHB 4JGJA 4Z76A 2HKFH 2HG5A 2IQAA 2ICEB 2V2XA 4U1SA 1C08B 4BYHA 2OJEA 3VFSB 5TE6H 4OSUH 3RVUC 1Y6MR 2FHCA 1LP9F 1SBBA 3MJ8A 4EOWH 2DOCA 2BDNH 2HRLA 1P7KB 1QBLH 3U4BL 3C6LB 3ZZ1A 5I1HH 5GZOD 4J6RH 5GSVB 1ZA3A 3CVIH 1A9EB 4LP5A 2P4AB 1PLGH 4NO0D 3QCTL 4QXWA 2A9MH 4MX7B 3VFGH 3DTXA 5HHMB 1FH5H 2E8ZA 1XH3A 3ZKQD 4U3XA 2X6MA 2A0LD 4UI2A 5FEBA 3O6MH 2M1KA 4R3SA 4XVTH 5T1DL 4BZ2L 4N9OB 3CFKA 3FQWB 4R96A 3UTQB 4ONOA 4LBEB 5EG6C 1A6TB 1YJDC 3SN6N 4JCMA 5MEQB 1KJ2B 4F7TA 4YXHH 5BCAA 3QUZC 5EOCL 5C0GA 2VIRA 5JA9A 2C7UB 3VDAA 4LLUB 3VRIA 2WBJA 1FSKC 2IQ9H 2J88L 2XKUA 1KG0B 5ITFB 3QEUB 4FQLL 1CYGA 3AS0A 5EU6A 3MODL 3RVUD 1EEZB 3UTQA 3FT2B 3FRUA 4LASH 3O2DL 1ETZA 4QTIL 1RK0A 4MZ3A 1PYWA 4OD1L 2IH1A 2EE9A 4UOW0 4X7EC 4NGHL 1WBYB 3NABH 1AC6A 1JWUA 4HC1L 3GI8L 1G9EA 1KC5H 2OR8A 5GQBA 4PJ9D 2ED8A 1OP9A 1JYWA 4PP2B 1J9CT 5T1LB 1DBJL 2VL5B 4DKFL 4O9HL 4HKZB 4PRAB 3SO3B 2C3VB 4YXHL 4Z95L 5T1LD 4BQBA 3PNWA 3WJLC 3OB8A 2PW1B 4DVBB 1I1AD 1U41A 2NW3B 5JORB 2AEWA 4I3GA 2FDBP 4C4KT 2F5AH 1H5BB 1JZ4A 4JQIL 3SOBH 1LO3L 4GSDL 4YHYB 3VGEA 4XVUD 1R0AH 1NEZG 4GMSL 1DLFL 1AP2A 1TZIB 2BFVH 3MRMA 4X5WA 4K9EC 4K3HA 2FR4A 5IW1A 1FCCA 5DMGC 2XA8L 4WEMB 2QQKL 1YECL 5FCUH 1G7JA 2QHLA 4ZFOA 2AABH 1TENA 2HVJA 4JANB 2UWEB 3VGFA 4DGYH 5DD0H 1I1RA 1RHHB 5ICZA 3AY4C 1V7NL 4K3DH 5KBNC 1CVRA 1ZT1A 4NHCL 4XXDB 2ZUXA 1IGJB 1T1ZA 2PYFB 4XNXL 1NMCB 3CC5B 5FF6A 1NCWH 1U8NB 3HZVB 1U8JB 4M8QA 4NO2B 4U1LB 4M7JL 4KGJA 4MNHB 4YFDB 2J6EA 3D39A 4TVPD 3BZ4A 1LO3H 1DUZA 4LHUA 4TRPH 4Y2DD 5CEXB 3NGBB 1HE7A 3HE7C 5EUOA 1W8NA 3NPSC 5KSVB 2BVPB 3HPJB 3U7WH 4F9LC 1IT9L 4ZFGL 3RWDB 4O2EB 1HQRB 1CE1H 3CFBB 4WFFD 4MAYA 3SDDC 1A3RL 1NGPL 2NR6D 4P2RB 2P46B 3SJVD 5DJ6A 3ARDC 4D3CL 2G60L 1K4DA 3GMQA 3BRDA 3KPSD 2Y1VA 3LV3B 3FN0L 1U6AH 5F1KC 4ZS7L 4POZD 3ROOB 1NGZB 4OCNC 3AM8A 1IC4H 1OT2A 4AG4H 4NIKB 1C5CH 3ARYA 5EBWB 2DL2A 3HZKB 5EOTB 4FZ8H 4U7SA 5HGHB 2FSEB 1IT9H 1DANU 1FZMA 4Y89A 1BM3H 2FO1A 1E27A 2DQGL 4N5ED 4NQSA 5F9JA 3D2UB 2VAAB 2P24A 4N8CH 1NUNB 5M7QA 4OF8A 2HT3C 4C56B 3QO1A 4ODBD 2Y72A 4ELKB 2AJVH 3RNKB 4J7RA 3PWVA 1RUMH 1BHGA 1T20B 4JQVC 5C9JA 4LL9A 1A1MA 5H94B 3S5LA 3CDYA 3RX8A 2A77L 3IKKA 3MV7D 3FQXB 2R1YA 1D5MB 3S36X 2R0ZH 3RHWK 1HOCA 2PYED 5JW5B 5J3HC 1FZKB 3O6LH 3ZE0F 4IHOA 2M8XA 5TJWK 3S88H 4HIHA 5SWZA 5BZDA 2AI0H 1BQLH 2UVEA 4PLKD 1OSPL 1WAAE 3NCJL 4BJLA 2BOBA 3IJSB 2D0GA 3B5HA 4L8BB 4X4YB 4X98A 5EU3B 5TDPB 3GSXB 2ESVD 4I3RL 5GISL 4PS4H 5I8KH 2P5EE 2APBA 5IV2A 1U42A 4QY8B 4RA3A 2H32H 3QIWC 2N4IA 4LQ1A 4NN7C 3DV4A 1ND0B 4M8VA 2R56L 5FUCC 4EDWH 3LPGA 3C6SA 4NNYA 1OSZB 5HGGS 5JUEL 4CJ1A 5JQHC 1Q0YH 1EBAA 3U6RB 5LCVL 3NCJH 1U2HA 5I75C 4C83B 3IJHB 4G6AC 4O02H 4KTEH 2G5RA 3QB7C 4GW1B 5FECA 3WN5C 1OCWL 5FM5M 4P2RE 3CMOH 4L4VD 5DI8B 3O8XA 1NJ9A 4O4YL 4H0IA 3WHXA 2ZUTA 5FK9A 4V1DD 3PQYE 1W0YT 1S9XA 1HSAB 2IBGA 4ZAKD 5A2IH 1NBVL 1JZ5A 2IH3B 3LKQB 3RPKA 1JPFB 4NN6B 4YBQC 2DWDB 4ODTH 1TETL 3OWEA 4NFCA 3W9EB 3HG1B 3I3EA 3TV3L 5FAAA 3RZCD 3DVGA 4I0PC 3X3FL 1CDCA 2FX7L 1NAKL 3UTPE 4W4OC 5IMKB 5FOBB 2I07A 1CDGA 5DJ0A 4JO1L 3EJZD 1QRKA 3BKML 5BJTB 4D94A 4JM2A 5GGSY 1ZA6A 4NCC1 4PJ7B 4HBCL 1QVOB 4R7DA 3B3IB 2YBRA 3QIUB 5I1JL 2EYTA 4BZ1H 4KMQA 4TVPE 1NFDF 2KL6A 4MB3A 2Q7YB 5GS1B 2NZ9D 3MRKB 3QUXA 3TBTA 1TQBC 1E6OL 4GLRI 4XZUA 1QSFB 5BMFL 3H8NA 1NBQA 1D9KB 3U7YH 1X7QB 1HHIA 3QUXD 2E9BA 3PL6C 4HUUB 2AV7A 1TLKA 5D7LD 3WKML 2GAZB 4Q9QH 1JZ6A 1YEIH 1JGEA 2AXHA 3SQOH 5CSGA 1M6OB 3X12B 3MOAH 3H42H 1Y0LB 5IB3A 5T3XD 5HTSA 2VH5H 2QADC 4L9LC 5HDBE 4RGNE 3EYUL 3LD8C 1RZ7H 3QXUA 2P5EB 2EYRB 4NO0A 2YZ1A 5HI3C 3N50A 4K94L 5IHZA 1JGUL 3BUYB 5DMKB 1UJ3B 5JLZB 4PJIF 3CU7A 2EH8H 3TH2T 5K9KA 3R1GH 4KRPB 4J3VA 1IKFH 3ZHDA 1A1OA 4ZYKA 4K9EH 4FABL 2V5MA 5DJDB 1V5JA 4PJAE 5IJVA 4XNQB 4ODXA 3D18B 5EB9A 1QZ1A 3UTSB 4NCDA 3MZTA 4AEHL 5IM7A 4V1DA 2HFTA 5GZND 2E9WA 4NKOB 1HINL 1H0DB 1KTDA 5BZWA 3OPZH 4FQJH 4PJ5A 2PCPA 3MUGB 2HT2D 1H9VA 3NIDF 4LCCA 4D0BA 4HT1L 5DRWA 5IQ7H 1BGXL 2NCMA 1ZTXL 5IFJB 4JKMA 4PJDF 1T7ZA 4TTGA 3GHBH 3H9HA 4J3XA 1ZLUK 3N85L 6FABL 2W91A 1KPUB 5HHQB 5BV7H 4ZXBA 4QRRA 4MA7H 4N0UB 5E6ID 1MJ8L 2JJWA 2JJTA 3STBA 1A6UH 4IRJA 1UA6H 4FABH 3ARVA 4N0RA 2P5WB 5IIEA 1S9YA 3RAJL 3PWLB 3Q48A 3TJEH 1S7WB 1P2CA 4QRRD 2P7TA 2IBZX 4G3YH 3OB0H 5DLML 1AHWB 2BNUB 3KPSE 2EIBA 1AQKL 4RQQB 5C2BH 4U2ZA 1NGYA 4KQ3L 5J0BA 5C2UB 1BJ1J 1YYML 4EOWL 3HI5H 3CX5K 5GGVL 4XGZB 3OAUL 1HYSD 4G6MH 2A6KB 3BN9D 1KN2H 3KGRA 2Y6SD 4KHTL 3ARDB 2EEBA 2FLRT 1KLGB 4W6YB 5TPWL 3HZMA 3T1WA 2R0LL 5JXAH 3HB3C 2FJGA 3EYSH 1BF2A 4PJHF 1NGXA 4PBVC 4H20H 1FJ1B 3L3OA 2P42B 1QSFE 1AKJD 1KGCD 3U9UA 2P45B 3I3BA 3R4DA 1DQTA 3QXDA 4MWFB 3QISA 4ELMF 1F4YL 4JDZB 1T5WB 3N1PC 1A4KB 1FL6A 1I1FA 3NACL 1RUQH 2BNQE 2P8MA 4NJ9H 1WQVT 2CGRH 1IL1A 4OFDA 4DZBA 2GK0B 2CLZA 2CO6B 5GRJH 5BOZG 1CD8A 3IU3B 3IAGC 4LSSL 1PG7W 2A9ML 3VFGL 5I0ZA 1VACB 1A02N 1CZ8H 1GZQA 2VDPL 2BVTA 2Z31D 1YEFH 5T1KD 3MRIA 5KOMC 4FFWC 1IKNA 1X5LA 2BNRB 3LEVL 2R0LH 5JXAL 5H37H 3CZFA 5A40E 5KSBE 3P4OB 3MRLB 3WUZA 1EZVY 1VFBB 1A2YA 2PR4H 4H1LH 3SGJC 5IB4B 5HYJD 4O51B 5I30H 4YPGB 4UUJB 3E2HC 4RMUA 3KPSA 2HAZA 1KNOB 2VLKD 2UYLA 3CSYB 1X5YA 3ULVE 1WT5C 4PJGB 2NY2C 4L9LA 2CGRL 4IOFC 5E8NB 3P0VH 5IK3B 1QA9B 1KCRL 1FAIL 2DB8A 2XKNA 3ZYZA 5DJZA 3GBNL 4JN1H 2VXSL 4PJGF 3L5WA 3DBXB 4XAKE 4NQXB 3TCLA 4F7CB 2EIDA 1TTUA 5EZLA 4KRMB 4PUBH 4RMVA 2OR9H 1TQCB 4OJFL 4R7NA 2R2EA 2B1AH 1FNLA 2MKWA 2AQ3A 4CVZA 1DBBH 2MJWA 3T65A 5T33H 1UB6A 2G2RB 4YHPB 2P5WE 3CNKA 3B9DA 4GQPH 4PLKC 3OKOA 1AGCB 3UAJD 5E4EB 3QXWA 3RDTD 4MNQD 4L4VA 1ZHBA 3BP4A 1QFUL 2NLJA 3DECA 1QBAA 5L88H 3GBNH 4JN1L 4GAGH 4XCNA 1NCDH 4HXAH 1KJ3H 2WBKA 2Z35B 4JFEB 1UC6A 8FABB 5IR1A 4PJCA 2W65B 1AR1D 1BIIB 5C0JA 4M7JH 5CJBA 4PJBA 5ACZA 2C9AA 2BNQD 1T0NA 1A7RL 2QADB 4L9LB 5E8NA 3PWJA 4OZGA 1FG2A 2IPKA 2OLDA 5D1XA 1M7XA 3QDGA 1JPST 4QRPA 4H88L 4Y5XC 4M02A 1HN1A 4NYLA 5IROC 3X13A 3PHOB 3ZSTA 3QEQE 1DBMH 1JHTA 4RGND 3P4OA 4JM4L 3ABZA 2EDDA 3MXVH 5DURD 1CR9L 1GC1C 5IEKB 1CDJA 5JXEC 4MA8H 3VFMB 4Z6AT 1WBZA 3TVMD 4U6XB 4G8GB 2OQJA 3JWOL 1OP5H 3UYRH 4EVNB 4D3CH 5F96H 4DJMA 4C59B 1RFDL 4Y2DB 4AM0A 3CXHJ 4PRNB 1INQB 3E2HB 4OLUH 1N6UA 4P23B 2NR6C 1RY7B 1TJIH 4NC0B 4Z7UE 2BNRE 3BP5B 3MACH 3QQ4A 3WDHA 4XBEH 5KSBB 3QSKB 1G9NH 2ZOLA 1WK0A 2WIIB 1S5HB 1SYSA 3BVNB 3RU8L 5KANG 3VWKB 4PG2C 1CLOL 3VGDA 5CINL 4JRXD 5JW4Q 5H35A 3QHTC 4DQOL 5JXED 5E00B 3VGAB 4G8FB 1F6LL 3PJSA 1MUJA 4MHHG 4UINH 4F7PB 3QH3B 5HHVL 2A6KA 3HAEH 2V6HA 2XOTA 4KU1A 5I6XC 3FQTA 5ESVA 3VI4F 4U1NB 2D7MA 4X7SL 1OQXA 4MXWL 2W38A 1KLUB 4MJ6B 3FAXA 5D7JB 3IDNB 5ADOL 5DO2D 2R0ZL 3HR6A 3IKCB 4XBEL 3QIBD 5F9WC 4Q9BA 2AKRB 4D9LL 1G6RA 4QRUB 1WFOA 2GSIA 2QR0B 3MREB 3T0WA 1S7TB 1X4XA 4BQ8A 1KIUA 4AENA 5LGJA 4UQ3B 1TJHH 4OFYD 3QFJE 5C09E 3DXAB 4HMCA 1OB1A 1IEAA 5LJYH 3OKDB 2JE8A 1II4E 3QJFA 3KLDA 2X70B 2EDWA 1BFTA 1HZHL 3FFCB 1MHEB 1FCGA 2VZOA 1EH9A 3HLAB 1NLDL 2AK1H 3S37L 3DGGB 3A0OA 3SDAC 5IFJA 5FO7B 4HWBH 3DGCR 2AP2A 3L3KB 5IW3A 1KACB 4ZOEA 4F33A 4GFTB 3AGVA 5BZWB 4HIIA 1RZGA 5E8OB 2YEZA 3P4NA 2DQJH 4KJPD 4NO3B 3C08L 3DGGA 4NZJA 5HVWA 4M3KB 3D39D 2GT9B 3LRHA 1UACH 2E9JA 2YD6A 3IDYB 2EDTA 3ULUD 5DJDA 4OI9A 2VDOH 2X70A 3WXWL 3ZHLA 3C6LD 5DK2A 3BZEB 1KJ2H 3TWCL 2N56A 3RY4A 5SWQB 4ORZC 3NTCL 2C3XA 4HIXL 3K2UL 1RZIA 4OT1H 2H45A 4HK3N 2CH8A 3MLVL 5CEZE 1S7TA 4G8GE 2EYRA 1NEZB 4NO0B 1GXEA 2YRLA 4QRUA 3RVVD 1U3HC 4Y5VA 4IDJL 5IB3B 2OTWA 4LKCA 5I18L 4PJEA 5IESH 2W59A 4ZFOL 3U79A 3OJDB 4AL8L 3MRRA 4Z7UB 4OCXL 2YD4A 3WLBA 5DQ9A 1OCWH 3K1KC 3LDBC 3JWDL 2JIXA 2IADB 4HWEH 4EIGB 2VZ3A 4NC2B 3FOLA 3C5ZC 1IZJA 3QH3A 4OM0H 5ANMA 5TQ0H 2I27N 1MCKA 3T2NH 1IAOA 1CLZL 4ZUUA 1TJGH 3WFHA 4Z7QE 1U93A 3N9GH 5AYUL 4ZQKB 1L9NA 3ZMRA 2BSSB 4PLNC 4BFIA 1WC7B 5MERA 4MXQC 5ENWA 1A9BA 5BJTA 4HCRH 5EIVA 2DQFA 4XWGL 3EGSB 3O6KL 5I9QB 1T66C 4LLDA 1LK3L 2AJYH 5I1CL 5SWZE 1IQDB 3K0WA 1L6XA 4PGEB 4YDLB 5KAQF 1XFPA 3E0GA 4HFUL 3OKKB 3TNNA 4ZS6D 3IDUA 4PRPA 5SX4H 4AM0B 4GS7C 1RAMA 4R2GB 3RPIA 3WFEL 3PABB 1FVEB 4JAMB 1FH5L 2YD2A 3QFJB 2B1HH 3DXAE 4N90D 4ZNEE 1WEJH 1XCQA 1IGCH 2VR4A 4HWZB 1UENA 3ARSA 3V8OA 3EJYD 1JHTB 3QEQA 1JYNA 4A6YH 3O8XB 3S34L 5JHDD 4UV4L 2DQIH 3FFCE 1GIGL 4PJEB 3RTQB 3HFMH 4PJ5D 2AJUL 4M7LT 1IGIL 1I8LC 1MI5A 1NEZA 1P7QA 5EO1A 4BFGA 3IFPA 4D0DB 1L0YA 1C16B 43CAB 2GCYB 3ZKMC 4NZUH 4MGXA 4MAUH 3B5TA 3B6SA 3AAZA 1SBSL 2FL5B 1KEML 2YRZA 3ARWA 3C6SB 4UDTA 2ZKHH 5FHBL 2GYSA 1EAPB 5JDSB 5AG8A 2CDEA 3RNQA 3GI8H 4A2MA 2HLFC 1UG9A 4OD2A 3U0PB 4RMSA 4XPHL 3RL1B 2KQMA 3L3IB 1K6QL 4I48A 5TDOB 1PY4A 4YHLL 1EO7A 4MA3A 5EUOE 3IDJB 4E41D 4X80L 1DLHA 4RMRA 3O2DA 1CGVA 1MHEA 4X4YA 5IROA 3BPLB 4YBLC 1PGRB 2PO6C 43C9B 1CXEA 1QFWI 2ZG1A 4M62L 1IEAB 5DGQA 3GMOB 1NGWB 1CCZA 5CUSH 3KPQB 3ZL4L 4WI2A 4FFYH 4AENB 5IQ9B 2SEBB 4LF3B 4YO0A 4OFVA 1T3FB 3LHPH 2XA8H 1F00I 1OAQL 1AFVH 5F89A 4HKBA 4I1NB 4UUJA 3PWVB 3HUJA 2YN5A 1RZJC 3IDNA 3MGTA 4XP5L 1B6DA 3K4AA 2ZOKA 1FFNB 3ZKND 3SGJA 2P24B 1JNLL 3REVA 1UCBL 3BD4A 2AJSH 5KSAD 4ERSH 3BGMB 1E27B 1QNZL 2DI8A 2Z9TA 2B0SH 4KRNA 4E0RA 25C8L 3X17A 1AI1L 2VDMH 3PJSB 1LO4L 1N7MH 2JCCB 2C1PA 1OAXL 1J0ZA 4QTHA 3BI9X 2H1PH 2YWZA 1N64L 4CU6A 1IJ9A 3QDGD 2HRPH 3RZCC 5F7EL 3VWKA 2APXA 1UADC 4RGMC 1IAKA 2V5YA 4PJ9A 5F93C 3V5KA 2BNQA 5GRJL 1TIUA 4WENB 5F7FA 2ZP0T 1RV6X 5EOQL 1S7VA 5IB5A 4Q9CA 4PRIE 2VLLB 5K9JL 3U9UB 4KDTA 1YUHB 1INQA 4MD0B 3WE6A 1X5XA 4KI5C 1LWRA 2OK0L 1DTUA 3V0WL 4OBSA 5J1AA 4JHWL 4EVNA 3VXUD 1KLGA 4PRPE 4N8PA 5JOEA 3ZKSD 4WWKA 3WSQH 1N7ML 1UM6H 4OGXL 2F53A 2UVFA 5F44A 5CZXD 3WO4C 4I0KA 3REVB 2XYCA 4KHXH 2FNBA 1QRND 1DQQA 2BC4A 5DTFA 1JNJA 4I2XA 5EFIA 4HF5L 1NFDA 2BCKB 3WFCL 1SHMA 1P69B 4QRPB 4F9LA 4J4PD 4RAVA 4ETQB 5D9SB 1MJUH 4P46C 1S78C 1X5GA 4AEFA 1KXTB 4PV8B 4N8VG 4DZ8B 4WTZA 1AQDA 2ORBL 5HPOA 4C56D 1ZLWK 2W65A 1U8MB 4CVUA 4R6UA 3W9DB 4HKJB 2UWEA 2XIDA 5B3NA 1FAIH 1G7IB 2BDNL 1RUAL 1MCPH 1MJ7H 3CFJA 3HUJE 1IAMA 1WVZA 4OGXH 4DFIA 5HJ3A 1DLHB 2IG2L 5E8PA 4I18B 1I1YA 2R0KH 4L8SB 3QBTB 1WCBB 2XPGA 4KROC 5EN2A 3AXLA 3LZFH 1RU9H 4NKOA 1I9JL 1GOHA 1QACA 1AGFB 2CRZA 5DT1L 3RNQB 2UV3A 5HGDA 3IGAB 4DUVA 2EKJA 4OZGF 4NOFA 5LGHH 1T2XA 4OLXL 3X3GL 5DUBB 3VXRA 1D5IL 3ZE1F 3FFDB 3LQMA 1RJZA 3PXJA 3TZVA 3LN4A 4CNIB 1JHLH 3L5WB 5CCKL 1U8MA 4NP4L 3WJLA 3QNZB 1WBYA 2YUZA 3UYOD 3IXAA 1J1XH 4CMHB 3QRGH 4TSAH 3FRUB 4KK8C 1Q0YL 3RTQA 2CKBH 5DTFB 4MD5A 3VD7A 5F8RC 1I8MB 2IPTL 4F57H 3BW9A 5DR5L 4HHAA 2VIRB 4HUUA 1XCQB 4J4PA 4BKLB 4X4ZA 2MFNA 1RIHL 1HHIB 5IMMB 3MRIB 1ZHLA 4PTUA 5I73B 3P9LB 1YPZE 3STLA 3N1MC 3QUMH 5D7LE 3BH8B 2QSTA 4DFHA 3IU3A 4MQSB 1X4ZA 4GQ9L 4PRPB 4MD0A 1OTTC 1XH3B 5L6YH 4FNLH 4WRLA 4RMQA 4BH8A 1CG9A 4G8GD 1ZANL 2DQFB 4G9FA 1MPAL 4RFOH 1V7MH 2M26A 1DQLL 3QUZB 4GAFB 5ALCL 4QRPE 4X0KB 3PIQB 4UV7L 4Q97A 1I8LA 1U93B 3RU8H 2DWDA 1QP1A 2D03L 3O8XC 4KKCD 3F7RA 4BQ9A 1KTLA 3MLZL 5HSFA 4O2FB 1MY7A 5E70A 3IETB 1JK8B 3L6FA 1JI1A 5L0QC 1MNUL 5DVMA 3EHBD 1WJ3A 4MB5A 4U6HA 3HUJB 3ECBA 3MRNA 2B8OT 4D8PA 2A9NL 2BVOB 2NYYD 4PRDB 4LKCB 2BHZA 1MCEA 4JY6B 3MFFB 2HYMA 4M61A 3EAKA 2F8OA 1RZ8B 4M5YL 2BHUA 4PV9A 1DEEA 1IC4L 4RGOL 1IGYB 3P4MB 2WLYA 5DC0A 3VXNA 4CRPA 1DFBH 5JO5A 5KTEL 1FNGA 1NL0L 4OGAD 3QIWA 5DEGA 3STZB 3GJEB 4UAOB 4ZFGH 4I13B 4YHKH 1EEYB 3HA0A 1BFOA 3G5VA 3H9HB 1I1AC 3KAAA 1KCUH 1SVZA 1X5JA 2IAND 2DQJL 5K9QI 5JOFA 3EOAB 1RZGB 3DX9B 1I7ZA 3L5IA 5LWYH 3VH8G 3W82A 1JGDB 5C0ND 2XG4A 4E5XB 3H9YA 5SWZD 3SE9L 1GC1L 1UVQB 1RZJH 1VERA 3MGOA 4YDJA 5AD0B 3IJSA 3G08B 1EEYA 1HHGA 1FNSL 3LKRB 3BSZH 5BZDB 4KMLB 2AJZB 1ORQA 1JJUA 1YPZB 2GFBB 2V7HB 1KB9J 2D2OA 3PDGA 4WVRA 4KV5F 5D7LB 1G6RB 5I16A 3U46B 2DMKA 4M61B 5FYJH 3AB0B 3DETC 3P30H 5I8CB 4X6BB 4L29B 3MRNB 5BRZB 1KCKA 2GAZA 2MPAL 3LKOB 4HC1A 1FE8H 3D9AL 3QO0B 1QKZL 1RZJL 3FHAA 4KXZH 4M6AA 3TIDB 2QL1A 4XZUB 5HD8C 3MRKA 2GY7B 3TBTB 5JW3L 3NAAL 1QSEE 4MVBD 5C0BE 4NWTL 5F7UA 1LK3H 2AJYL 4F7MA 2EYTB 5I1EL 4UB0L 1YEHH 2W1NA 4CDGC 1ROWA 1RJYA 4KK9C 1EMTH 4I3RH 5LG1A 2LV4A 1RK1A 1K3IA 4XCFL 2ERJC 4PJ8D 4ACPA 2IFFH 3Q5YA 2VDLH 5J56B 2MWCA 3VRJA 3MV8B 3TVMA 3MQIA 4M7LL 2DL9A 2HH0L 2W9EL 5ANMB 1OWWA 4WTXA 1U2CA 4M1DL 3HPJA 5FV2A 2APVA 4DN4L 1WBZB 1HCVA 1OOAA 3T2PA 4U6TA 5CJOH 3ZTNL 4JRYE 3I6KB 5I15H 1TZHA 3D1MC 4NYLB 4KVNL 4G7VH 3V6ZB 5IBTH 1EK3A 4QF1B 4MNHA 3QDGB 1I9IH 4LU5H 3FO0H 3U46A 4RSVA 1EA9C 1Q72L 4OLEA 4GS7B 3RGVA 4PJBB 3OXRB 3OKLA 5C0JB 3TNMB 5CP3A 5JOPE 3LEYH 1I7UA 2W9EH 4HJJH 5IVNA 4ZTPH 4BH7A 1FZJB 4UDUA 1XR8B 3HNTL 5AD0A 3UP1A 3D39E 2V17L 5CJOL 3BP4B 1EHNA 5F7YC 3I75A 2OMNA 1FIEA 3EOTL 1AP2B 5E8OA 5DD5H 1T7YA 4LSDA 2VWEE 1FDLL 2OL3L 4AT6B 5DHYB 3MCG1 2XRAL 5EN2B 1CBVH 3LCYA 3MV9E 4NQCB 1CFSA 3KPPA 4APQB 2IALB 1TXKA 3GHEL 3OKMA 1KEGL 1XIWB 3GMLA 4ODWA 4XTRD 5C9KA 3MODH 5TDPA 4R4BB 5F9WB 4G5ZH 3ZDYF 4CVZB 2PXYA 2VC2L 4L8BA 4JEGB 4WI7A 3VWJA 5BRZE 2VL5A 3QJFB 3GJEA 4JPKL 5L7XH 2FJHB 2HT4D 2NXZC 4PJ7F 3F5WB 1UWEL 3A6BL 4P5TA 3VI4E 1CTOA 2ZNWA 3SO5A 2V2TB 2D0FA 4WGVB 3NFPA 3T0BA 1IFHL 2PUQT 3W9DA 5DD3L 1D5XB 3V0AC 3D25A 3ARFD 12E8H 3TO2B 1BFVL 4QWWC 4G8EA 1PYWB 4KY1H 5L88L 4IMKA 1WBXA 4HXAL 3RVWC 2KKQA 3PHQA 1A1MB 5C0BB 3FT2A 2EEDA 5D7SL 5DFWH 3KLAA 4NC1C 3TJHD 1MFBL 3CLEH 3QPXL 3U4EB 1EJOL 1H3VA 3MUZ1 2F5AL 2FHBA 1B4RA 3I3DA 1TCMA 3D2UA 3EYQD 2G75A 1A7RH 1QFPA 1MFDH 2L7UA 2H1PL 4G9DB 1NMBH 3OJVC 4O58H 2Q3AA 1N0XH 4Y4KB 3IAQA 2KPNA 2R2BB 4WY7L 4P4KC 5CEYB 5IGXH 1YC7A 4OFKA 1HXYB 3A6CL 1AI1H 2VDML 5KSAB 3RGVC 1RZKH 4I2XE 1OTSC 3MRPB 4PGDB 1ZT7B 2WIIA 1S7VB 1T83A 4XC1H 4HPYH 5D2LA 4UILL 4EUPA 4XNXH 4DKEL 5EU4B 1T5WA 1AQKH 5D7SH 2Z92B 1XGQA 5KVDL 3CXDH 5GS2H 4JM2C 1EX0A 3D48R 35C8H 2GK2A 1FNFA 2FJGB 2BHYA 4MAYC 5JQ6L 5I8OL 2BVUA 1GH7A 3ARDA 4PJBE 2NXYD 3E3QE 2VDRL 4OIIL 4P2OA 1MLCA 2VERN 2OJEB 3NPZB 3S97C 4WFED 4YGVB 4AYFA 5AG9A 3RY6A 3SKNB 4CN4A 2ZOKB 4OD3L 3CVHL 1FG9C 4LPWA 1KUMA 3C8KA 2PNDA 4JFXB 3D39B 2UWEE 3WLWD 2UZYB 2X42A 4KK5C 3W11C 2DLFL 1UJ3C 3PHQB 5C0BA 1AHWA 5A2FA 4LIQL 4LVOC 1U8PB 5GSRB 3KG5A 3P40A 1B90A 1DP0A 1ZMYA 3CDGB 4RISL 4OQTA 1A0QL 1U8HA 4NQCE 1S9YB 3OAUH 4Z0BH 5D2NA 3EYFA 4FP8L 3RTQC 5I1AB 3NPSB 1DEDA 1TZGL 2V2TA 4N1HB 4UT7H 2Q6WA 2NY0C 4WUUA 4AG4L 3QIUD 3BQUD 1CGYA 1E28B 4JPWH 1EFXB 2JJUA 2NY5C 1AGFA 5EWIH 5GGTH 5F88A 2NY6B 4HS8L 3F62A 4IOIB 4TVPL 4ODVL 1KCVL 5DJXB 3OZ9H 5ID0A 3QNYB 4WIQA 1X6LA 1RUQL 2BSRA 4PJ5B 4HQQL 3VRLE 1OVZA 4WDIA 5CBEA 2OI9B 1G6RL 2R2EB 4R7NB 5J6HA 1SEQL 4NQCD 4APQD 4L8DA 4K3JH 4XNQA 3NVQA 2YPVH 3BGFC 4BH7B 4NQXA 4F7CA 1C5BL 3L3JB 3B2UC 1FGVH 3HN3A 2F58H 2GJZB 4PV8A 1IVLA 4P46A 4MD4A 2G5BA 4MQXC 1OPGL 3OF6A 4HS8H 4GJTB 1JWMA 4LLVB 5T33L 4ETQA 3H9ZA 3S37X 4MJ5A 3LN5B 1VCAA 4JFDD 1EUTA 1RIHH 4I2XB 3O2VH 4Y5YC 3V6ZA 2PKDA 3N06B 1V3MA 4HQQH 4PS4L 1R5VB 2APWA 4MCYA 4KRPC 4LCWD 2DKUA 5F7MC 4HS6B 2BNRA 3DX7A 2VXQL 3PF2A 4K55A 1F13A 5HY9B 3FQWA 2YPVL 3SDYH 3ZDXE 3GSNA 2DBLH 1IC1A 3V7AG 5C0RH 3EDEA 4PBWD 3WE6B 3TVMB 1O7VA 4ZAKB 3AMKA 4ZFFA 1YUHA 2CDGA 4AEIH 4DZBB 2L4OA 2B4CH 4PGEA 4GBXD 2YBRB 3V4UL 1OARL 4JM2B 2F8VA 3L7EA 4UBDC 2C3GA 2ADGB 4PR5B 1IC7L 1LDPL 4ENED 3IFOA 1CGWA 2BY1A 4BFIB 5KANI 3LAFA 4Q2ZB 5DJYA 3O45B 2Z8WC 3ARPA 1IAOB 2EDFA 1KJ3L 1JRHH 2ZCKL 1GZPA 4OLVL 1YQVH 4WFGE 3TIDA 3RP1A 1NEUA 1N59B 1W72H 5BVJA 3EUUA 2E7HA 1CDBA 3LQAH 4Z76B 2EXYC 4JFOB 5TDNA 4ZFZA 4J12A 2LTQB 1NGYB 5J11C 4X83A 3RY6C 4PJHE 3AB0C 3BWAA 2Y06L 4HUKB 4X6BA 1U8IA 4JB9H 1YEJH 2A83B 4L4TE 3ZDYE 3W0WE 1A1NB 4S1RL 5IFAH 1XGRB 3RA7H 4U1GC 5CAYB 4TULH 1W0WB 4PRID 3MV01 4N1CA 1A7BA 2ARJB 3RWHA 4Y4KC 3WFZA 1JHKH 1MRCL 1NPUA 2FX8L 4NKIL 3QI9A 3FFCD 4PJXE 2N7BA 4QHKJ 2ATKB 1ORQB 2QQQA 3P4LA 2X4PB 3RWEB 4GKNA 1HHGB 1MFCL 2XZCH 4TNVK 1DVFC 3TO4A 4F3FA 3CLFH 3HRZA 3S4SB 3NCEB 2B20A 3PQYB 4ZNEA 1DE4B 2Z31B 4M93B 3R06B 4JFQB 2YPLD 2X89D 2YEZB 3P4NB 4Q6YA 4HIIB 1DQJA 4Q9QL 5ICXA 4F33B 4HGKC 4APQC 3R8BB 2FEDC 2BMKB 5FYKH 2VRAA 4S1RH 1DR9A 3QQ9C 2AXFA 2ZKHL 1AGEB 2WWMC 2ESVE 1I1CA 2KZ1B 2EDHA 2W60B 4XWOC 1CK0L 15C8L 3G5VB 5T5NF 2FL5A 5IFHL 3VG9C 1XGYH 3B6SB 1C12B 4PJFA 2XI9A 2R4RH 2RQ8A 5FHAH 1C16A 3QJHB 4Y1AB 2DN7A 5DFTA 3KR3L 3O9WC 3ULUF 1L6ZA 1KLFA 3FQUB 3W2DL 3OR7A 2AK1L 3KHOA 2NY1D 1Y0LA 4E9LA 2EDLA 1J0IA 3QEGH 1T20A 4JZOA 3DVNA 4QNPE 1YN6A 3HI1B 1JGEB 2YD3A 1AO7D 2NY4C 2DRUA 2HJLB 4XI5D 4XMLL 3H9SD 5J13B 1PX4A 4P23D 1X5KA 3C09B 3RVTC 1D9KA 4UTAH 3T0EC 3V95A 3GUTB 5ISZD 3HZKA 5EOTA 3UJIH 4CBPA 2J6EL 5AAWA 3DHMA 2YMXH 5E00A 5AWNL 4HX1B 3D87B 4XCFH 5DD1H 1TVDA 3EDJA 4YQXL 5JMOC 4X0KA 2YD8A 5GS0H 1L7IL 1M4KA 4Q74A 4DAGH 4WCYH 3UJJH 1FL3A 1UM4H 2ITCB 2I60H 5FDWA 4PJAB 5JZ7D 1BZQK 3UTSE 2X4SB 4QHUB 5MI0C 1HH6A 4PJHB 5CZVH 3AFLA 3C08H 5FA4A 1JFQL 4TUJB 4ONHB 3W0WB 1D5ZB 1JWSA 1HQRA 3AC0A 5TFSL 3LKQA 3VMOA 4UTAL 3QHZH 4XH2B 2LFGA 4OFPA 5KSVA 4HXBH 5HYJE 4PTUB 2ICES 3L5JA 3KS0H 3O4OC 1OAUH 2Y36L 4BKLA 1K8DA 2NY6D 3I85A 1TNNA 3I02B 4M00A 5E9DA 2IGFH 4Y5YB 3MRRB 1NGQL 5ELIA 2ZUWA 4N0UE 4P5TC 4JG1L 4P59L 5DEFA 2OTWB 1I9RH 1CL7L 2R56H 5I15L 5C09A 4XRCA 1U8JA 5FFLA 2GJ6A 5EU5A 1FG2B 5D5MF 5L8KB 4C83A 4KKAD 2J4WL 2X4TB 3PUCA 3ESUF 4GKOA 1BIIA 1ODAA 3FO0L 1Q38A 3QDAA 5IMOA 1VADA 5J12C 2QSCL 3U48A 4LCYA 1YMHA 4NZTH 3BZEA 1MCFA 3TZVB 1RD6A 3O6FC 3IDGA 4M6MH 4XCNB 5DUBA 4Q6IC 1CLZH 3VXRB 5A2LH 2VZUA 2NLJB 2GT9A 3N9GL 4O2CB 4WU7B 5CWSB 5DD6A 3FTGB 1Q9KA 4PYHA 5HGDB 4X5WB 3GHEH 1KEGH 3RIFF 4PRHA 4O4YH 4MNQE 4U1MB 5D6CA 2COQA 3WIIL 2CR3A 3B43A 3VXSB 5CSBA 3UBXI 4DN3H 3ARRA 4FMKA 3WNMA 1OWRM 4I18A 4OCYH 2RR3A 5JTWA 3BMVA 1U91A 1CIUA 2J4WH 3S98A 4NM8L 2R0KL 1HNFA 4NN5B 3TIEB 3LQAC 1IEBA 4PYGA 4UT9L 4Q9RH 1BFVH 1OB1B 3LY6A 1CF8H 4PJXA 1VENA 3OKNA 3U0TA 1IARB 3DBXA 3X3FH 32C2B 3CU1A 1JWUB 3NMEA 2D31A 1MCOH 2R23B 5KS9A 4PJIA 4OV5B 1IRAY 2QQKH 1N0LA 3FT4A 1OLLA 3GSWB 4M1CD 2UYLB 1U95B 4JDTL 4RAVB 3SE8H 3SCMB 5FUOL 5K33A 1JNHB 1OW0C 4NHCH 1FRGL 3MRLA 3FQTB 5ESVB 2C7UA 1KULA 2FJFB 4NQSB 4KJYB 1I3UA 3RZCB 3J7HA 1G7MA 5FO9A 3I6GB 4Z18A 5D8JH 1TCRB 4R96B 2XY2A 4Q9RL 3ULUE 4PJGE 4TRPL 1WISA 3MX0A 3PGFH 4KK6C 4R4FH 1JUFA 1MHHA 2H32A 4L1DA 3SO3C 5EU6E 3ARFB 4JKWA 2XN9B 1IAIL 1IL1B 1MI5D 1S5HA 3QXVA 1T7WA 2JLLA 4JPIB 4K3GA 3K80A 3PGDB 4JDTH 2A6DA 5FB8A 4JDZA 3EW3B 3M1BB 3S5LG 1OM3L 8CGTA 3IDIA 1CE1L 1MWAL 3HC4H 4JY4A 4MAYB 1LE5B 1A7OL 5JZ7C 3EFDL 3FN9A 1P7KA 2OZ4L 2P48B 4LSRH 4U6XA 4QCIA 25C8H 5HGAB 1QLFA 4G8IB 1A3LL 1NANH 1G7HB 1DQLH 4F58H 4AIXA 4IS6A 3BGMA 5MEPB 2Z8SA 3N1GC 5L8JB 5E2WL 4X9HA 2ADIB 3UYRL 4E41A 4OB5H 3VXUA 4RNRB 5E7FA 4JHAH 1NFIB 3VD4A 1GJIA 1RURL 3DJ9A 1T0MB 1T1WB 3C5ZD 3GI9H 2PYEB 4HUVB 2VDQL 4OLUL 4G6JL 4MA1C 4JFEE 4JKLA 2IPKB 4L5FL 2N1KA 4ONGL 5D1XB 2XQBH 3CC5A 2A2QT 3VXSE 1TVBA 5D2NC 5IW6B 4EN3D 5CIPH 5IQ9A 5MENB 4A2LA 2VLMD 1NQBA 3NIFE 3RI5K 4M6OL 1TTGA 1RUML 3O3EB 4RISH 1JZ7A 4CMMA 3MNWB 5L2KE 4ZXBB 4K8RC 4ZSOB 4HZLA 4MHHI 4JN2A 3MPCA 2AXJA 4L4VB 1PQZA 1TZIA 4ORGB 1HH9A 1DFBL 5I8EB 1NL0H 3TBYA 1CFNA 3D69A 3D6GA 1Z3GH 2Y25A 3GKWL 3Q5TA 3QXTA 3FB5B 2HFEB 1JPTH 3X11A 1FFOA 1QYGH 5DQDL 4NN5C 2RHEA 4NKMA 3RWJA 3QQ9D 4PRAA 5F7DB 5D1QB 5D6DC 5CBAB 3U1SL 4NWUL 4H20L 5CGMA 1NC2A 3DRQA 5T1LA 4PP2A 2H9GB 2X7LB 4UT6H 2GCYA 1YYLH 1X9QA 4WFGD 3RKDD 1BPVA 3DROB 3NACH 4LCIL 1ETZB 4PGJA 4FQLH 3KPOB 4OGAC 1U8OB 1F8TL 2WIMA 3HMWL 1F4WL 1T80A 4RCAA 5EU6B 2XN9E 5C7XL 4P57B 3VXMA 4KTYA 2MQ0A 4XNUL 5E6ZA 1CDHA 1RU9L 3VXUE 4DK6A 1GCFA 3RWCB 2WBJC 4B53A 2R1XA 5CSZB 3HCVB 1F58H 2Q1EA 1HIML 1RQ5A 4EQ2A 5BS0A 4RDQG 4JFED 5D1ZC 4PPTA 1A7NL 2Q7YA 3NCCB 1FE8L 3D9AH 5ID1B 2GK0A 3N0PB 3MLXH 1JP5A 3OHXA 5AYQA 1NCCH 2CSPA 2X44D 4Z77A 4HEPG 2F54D 5DS8B 3RIAF 1A6WL 2ZNXA 4OZHE 3QXDB 1SEBB 3D85D 4AEIL 4JO2H 5TGBB 1CN4A 4H25B 5E6YA 4IDJH 4OV6F 2FGWH 2ITDB 3T4AB 4LLWA 2PYEE 2IPTH 3FT3B 2O61B 5FGCE 5SWSA 1XGUA 2QQLH 4OJFH 5LGHL 3HZMB 4I3SH 5CD5C 4QT5B 1J0YA 3MJ8B 3MV8D 2YK1H 5MENE 5B3JF 2VLJA 1CE6A 4HJGA 1CICA 3VGHA 3K4DA 4DUXA 2D4DA 5TQ0L 4I5BB 5HXMA 5IFAL 4J8RA 5E56A 4XPGL 2LU7A 5L2KB 3FZUC 5D6DA 3IDGB 1AIFB 2E8YA 4ZSOE 1YMHB 1K2DB 5C0DB 3KWWB 2FCBA 5T3ZL 4HAFA 1ZANH 4X7DC 5CIPB 4MJIE 5C86A 3MRDB 5J12B 4KPHH 5I1DA 4FMFA 3DHJA 1V7ML 2WK2A 1S7XB 3F65A 1VESA 2UUDH 4U1GB 3FQNA 1ED3A 4PTTB 1V3JA 4XRCB 5HDBF 3CVHA 2IMNA 2LVCA 4HFUH 1MQKH 3G5ZA 2NY7L 3KPMA 1SM3L 2XXCB 2D03H 4K7FA 1MRCH 4NKIH 1K85A 5HYQB 3RJQB 4LPTA 3SDAA 1A3RH 1NGPH 4LSQL 5EC1A 5LXGL 5L2JA 1UT9A 5FIEA 5D5MB 1VDGA 2WINB 3D0LB 4Q0XH 5DRWB 2P49B 4FTVD 2H2SD 1Y6KR 2XZQL 2X4OB 3OKYA 4ZTPL 1CR9H 4X5LA 3O6FD 3HNTH 2AJ3A 4C58B 1E4KA 2NMSA 4CVWA 4KI1A 1KBGL 2YUWA 4PB9L 2DQDH 4Y16B 4X98B 3SKJH 1NBYB 3RDTB 4GO6B 3PGCA 1F02I 3ARGD 1P5UA 2W0FB 1F2XK 5GIRA 2ITCA 4H1LA 1F90L 5EBMA 3WYRA 4HIHB 5SWZB 4DGVH 3OBAA 3TA3B 1QLRB 5D7IB 3O9WA 2DQGH 4EJ1C 2R69H 4ZMAT 1LNUA 2DLEA 2PTUA 2UY6A 1H15A 1DJSA 2NY0D 4Y19A 3VWKC 1BMGA 5LWYL 2BOCB 2Z8RA 2YOCA 2QEJA 4XHJD 3C09C 3CPLB 3SJVB 5F1IB 2C5DC 2NY4B 1N3NA 2ESVA 3NZHH 3H0TA 3MZGB 4PJEE 1G7QA 5E95B 4X7SH 5FGCB 4L1HA 3D0VA 1P9MC 1OSPH 5E2UH 1NDMB 3GK8L 3ARGB 3HI5L 5CILH 2I60L 4LOUD 1CDIA 4TSBH 1NC4A 4RBPH 3QJHA 2FWOB 1ZA6B 4PJ7A 5DYOA 4YFLI 3ROOA 3SDCC 4HS3B 1CFQB 5GIRB 4Q6IA 1ZLWH 3MLSH 2NY5H 2P44B 2ZPKH 5CGYC 2I07B 3BUTA 4RIRA 1YY8A 3DVIA 3MV11 4WJ5A 2F74B 4ZTOL 1C1EL 2HN7B 2VLRA 5ETUA 1BBDH 1T21B 2AXFB 2P8PA 4J2XA 4KJQD 2BY0A 1HYRC 5EIIB 3VE0B 5ABDE 2IH3A 3NCYS 5MEOB 2OQJB 1RSFA 3ISWA 4XPTH 5EUOB 3V6OC 4YNYA 35C8L 4R0LA 2YD7A 3HB3D 5IVOA 1GGIL 5HYQA 1BVKA 3UDWC 5DK0A 5I1EH 3U4BH 1S9KC 4KTEL 1B9ZA 1PFCA 5SX5H 4XX1G 4YR6B 1Q0XH 1YEFL 1KFAL 3CVHB 5T5FL 4GW1A 4YK4B 4Y16C 4LSUH 3RBSA 3WXVH 1ZSDA 1XMWA 1F6AA 2X4NB 3OJ2C 3PWJB 1EJ6A 2BNRD 3RWHB 4BQ6A 4E42B 5ACZB 4U2YA 4PG9A 5EOQH 1I9RL 5TE7L 3MRDA 5EU7E 3FO1A 4XWOD 4O5LL 1A3QA 4GUPA 4NQVB 3KWWA 5LQBH 3WUWA 5JPNA 2WBWB 1NDGA 3GSRA 4MMXC 5IG7B 3CH1B 3OL2A 3M17B 3VFTB 4ODTL 1LE9A 3V0WH 2ZSWA 3NAAH 4CU8A 3K81A 4N0YH 2E7MA 1ND0A 1HHHB 4M4PA