2VUKA

Structure of the p53 core domain mutant y220c bound to the stabilizing small-molecule drug phikan083
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
molecule tags Transcription
source organism Homo sapiens
publication title Targeted Rescue of a Destabilized Mutant of P53 by an in Silico Screened Drug.
pubmed doi rcsb
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vukA00
4IBVA 4IJTA 2BIMA 4G83A 2OCJA 4IBZA 5AB9A 4IBWA 1EAQA 3TS8A 3D07A 4L18A 3US0A 3ZMEA 1H9DA 2XWCA 4IBTA 3WTTA 3WTYA 4MZIA 3WTUA 3VD1A 3US1A 2WGXA 2AHIA 2IOMA 4L0ZA 2H1LM 3VD0A 5G4MA 2ADYA 1HJCA 5ECGA 4LOEA 3QYNA 2BIOA 3IGLA 4IBYA 4AGLA 5LAPA 5BUAA 2GEQA 1EANA 3WU1A 2J1ZA 2BIQA 4AGQA 4IBQA 5AOIA 2XWRA 4GUQA 2IOOA 5A7BA 3WTVA 1LJMA 3Q05A 1CO1A 5G4OA 5ABAA 3D06A 2YBGA 3WTXA 3EXLA 2J20A 2VUKA 3Q01A 4LOFA 3IGKA 2IOIA 4MZRA 4G82A 1KZYA 3Q06A 1TUPA 4HJEA 5AOLA 4AGNA 5AOMA 4A63A 2J6WA 4L0YA 4IBSA 2J1WA 2X0VA 1GZHC 4XR8C 3VD2A 2FEJA 2PCXA 2J21A 3KMDA 4QO1B 3EXJA 2AC0A 3WTWA 2BIPA 4KVPA 4LO9A 2ATAA 5LGYA 3D05A 1IO4C 1EAOA 2MEJB 3D08A 4AGMA 1E50A 3KZ8A 2J1YA 1CMOA 4IBUA 1GZHA 2BINA 2X0WA 4AGPA 1HU8A 1HJBC 3WTSA 2X0UA 3QYMA 1T4WA 1UOLA 5G4NA 2J1XA 3D09A 5AOKA 2RMNA 3D0AA 1YCSA 2P52A 5AOJA 1TSRA 4AGOA 5KBDA 4GUOA
chains in the Genus database with same CATH superfamily
1T3FB 2ROYA 3VNYA 1EVTC 1NUDA 3O6KL 2LABA 1A1MA 3MYZA 1IGTB 2ZKMX 3FB6A 3FQYA 4PI2A 2FO4A 5MENB 2ENYA 3CXFA 4S2SA 1NAMH 3CCHA 5GGUA 2BP5M 2ED8A 4LSVL 1LDPL 3E6HB 32C2A 3NGBC 4X8CA 3VSVA 3U2IA 3H53A 1RULH 1IJNA 1Y6KR 4EN3C 3IVKB 2VMCA 3FB6B 2R1YB 5EUOB 3OR7B 3WNLA 3QHFH 4G72B 5E6IB 1KTKE 2HFEB 1FVDA 1HHJA 2A6KB 1DEEB 3L4UA 4G11A 3QUYA 2W59A 1VENA 1DSYA 3N6YA 2IWGA 1FH5H 1OGAA 1DR9A 3EDKA 4FQHB 3FONB 3O3UN 3STLA 2HN7A 1J5CA 1PGRB 2D0HA 4PWFA 2AI0H 3TYGL 3KYMA 4AT6B 3HE6C 4ANWA 2DQUL 2EEFA 1MQKH 3E1ZA 4ZUWB 4NNXB 5AVZB 1E6OH 1P69B 2ZUVA 3VXSA 4EBQH 3MOQA 1LD9A 5D7IF 4B9YA 1LILA 4Z1PA 2DTSA 5D7IB 2HN7B 4WI5A 3NSYA 4ZYKB 1PY0A 2BSSB 1E9PB 2EDHA 1HIMH 5C0CE 1LO0L 1FYTD 1J0JA 2RBLA 4KO9A 4GP4B 5JQ6L 4L0YA 1EUUA 5IB1B 4GQPH 4OT1H 1EZLA 4YHOL 2LVCA 5F0LB 4J27A 4L4TB 2XUWA 1WAAF 4MBOA 3HJEA 4OD1L 2O6PA 1RUKL 3G5VB 2Y06L 3DMMA 3IJHA 3NYKA 4N0YH 5DUML 1FG9C 4FKHA 3NTCL 5JW3H 2XA8L 4Z8FH 1O6TA 1U42A 1OM3H 1IIKA 2XYCA 1KGCE 5A2KH 3FUIA 3G6DL 4G7VH 5HJ3A 3CH1B 1A1NB 4E9LA 5FK9B 5EOCJ 2DJUA 4GRLC 4O4YH 1ZEAL 4S10A 4WCYH 4K71B 4XRCB 5JPMA 3QEQE 3QZNA 1QBLH 1AG0A 5DQDL 5BRZA 2G5BA 5A2IH 1QVOB 1T6WA 3CAFA 4O02A 4U1LB 3ZPDA 2FNWA 2P80A 2WBWB 1DSFH 1RMFH 3ZY7A 1HJBC 5JXAL 1I7RA 5EZLA 1BFOB 2WP3T 4K7FB 5IBUG 5TGBA 1FNAA 2JXMB 2WVTA 4CAGA 4Y2DA 5ICZA 5G4NA 1O6VA 4YFEA 4L8CA 4LVOB 4M9OA 3V8CA 1ZLVH 3QH3A 2BLFA 3O81A 5DHVB 1KXVC 4UT7H 1SY6L 2ZOLA 4Z7VE 3BZDA 3RBGA 3AVEA 2H8PB 3C08H 4NQDD 2L7QA 4FQLH 4XZUB 3LKSB 4MMZB 3QXAB 4X7TB 3WL9A 3KG5A 4QIRA 3BZFA 3TZVA 2QLVB 1RY7B 1NDGB 1XHHA 3C5ZC 1S5IL 3CLFH 4ODUB 1J8HB 1QR4A 4X5XA 3LKSA 3HC3L 3JWNG 5H37A 2WSPA 1HN1A 3HI5L 2E0PA 4TULH 3GJFH 3KXFB 4XO9A 3IRZA 1F90H 3JZYA 1E65A 4M7JL 2D7QA 3CSGA 3K6SA 1A66A 1LEIB 3E6FB 5MP6L 5SWSA 1DBBH 1X5HA 3L3JB 3H3PL 1XXDC 3JTTA 3VGGA 5JPMC 1RJLB 2PPDA 4JQIL 1LO5A 3MRLA 3AU0A 3FO1B 2CNZA 1MCCA 4ZFOB 4KO5A 3QG7H 2Z7ZA 1ETJA 2W9DL 4YGVA 3WFCL 3DOSB 1T7XA 4IS6A 1KCBA 4MNQB 4NQSB 3DMMC 5EEZA 4FYQA 5CBEB 2HP4A 4OZ4A 2OZ4H 3JTTB 3HHSA 3JWNH 3LDBB 2QKSA 1N8ZA 3MBWA 2NUTA 7PCYA 3LPOA 1IKFL 1U41A 2F8XC 3FTVA 2Q7AA 4OGQC 1UC6A 2LLNA 5DSCB 5DR5L 3HG3A 3KYKL 5IVOA 5EDSA 4HJEA 4F7TA 2J88H 2Z7YA 1WG3A 1T5XA 3JVGC 2EE2A 3MOBH 5KN5A 1GPOH 1I8MB 5CCHE 1KB5A 5IK3B 2NUTB 4TUUA 2FWOB 1TKWB 1AQKL 3FQUB 4R3SA 4OFYA 5EUKB 1GJUA 4CJ0A 4YX2H 1MHCB 1R4XA 1WK0A 4ODSL 4M5ZL 4NGHH 3C6SB 1AR2A 1GGBH 3DO4A 4LRIC 1CJYA 2V2TB 1U92A 1D5IH 4MDRA 4OLUL 4QEGA 4LCIL 5D7EA 4B0MB 3CCHB 1IQWH 5SX4I 1D9KB 1FAIH 5H2BA 4F7MB 1E2WA 3VH8G 4CMMB 4PJFE 1F11A 2PYED 2R56L 3QNZB 5DZAA 1NBQA 3QWOB 3MRQB 3PL6B 2J5LC 4LAQL 1SDAB 2XIDA 2VIRA 1I3UA 4JM2D 2WYIA 5DXWA 1P7QB 2ICCA 3OHXA 2AABH 2QSTA 4LASH 3SDDD 3UO8B 4R4FL 5CSGA 4OGYL 1EA9C 4JPKH 2GIYA 1ZWIA 3CZNA 5EU6B 1GVIA 4HQQL 4YHNA 4L1HA 2ZF9A 4LCUB 5FFGA 1I53A 2RJMA 4GXFA 5CR8A 5CZKA 1O7SA 3VQLA 4I0CC 5CWSB 2ZQKA 4ZFQA 3MUGB 5I8OL 1HILA 5HYJE 4FHJA 3BSHA 4HCIA 3NMEA 2VLJD 4NQCA 4R8WH 2KBGA 2MNJB 3IN0A 5FYKU 4XPGL 5IEHA 3LEXB 1Z0MA 4NRYB 4PRPA 2X4NB 3L3KA 5EFIB 2GSIA 4FCHA 1YEJH 2ORBH 4W6XB 1SJEA 5FGRA 2CJSA 3KPOA 1N7MH 1MF2L 1MVUB 1WA1X 3R1GL 2IBZY 3N44B 1I7UB 4PHXA 2VDRL 5E6ZA 4YSCA 1SJVA 4M1DL 1AIFB 2EAEA 2L8AA 3ECWA 5GJSH 3D2UB 3BE1H 2J2ZA 3EO1B 2R29L 1MG3C 1HWGB 4F9PA 4HFWB 4E0RB 4P5MB 1R46A 4HZLB 2IC2A 3REWA 1F2QA 2FSEA 3QHZH 4Y8DC 2NXZC 3DLQR 3ZQXA 2XXCB 3RFRA 1P4LA 2YAEA 4K9EL 3LIZA 1QI3A 1E9OA 3NCJH 5SX5H 2CJUL 3T0WA 1NMCC 1OE3A 1PG7X 3FQRA 4QXVA 3I6KA 2O4EA 4WU7A 2BCMA 4NC0B 3BPLB 4L5FE 1UZ6E 1B6UA 4H0HB 3SO3C 4C56B 4H4NA 3OF6A 1CDJA 4A7VA 1A6VL 1RJYB 4WTXA 1X5YA 1JZ2A 5CP7A 5I73C 1J1PL 1QSZA 3M1BA 2GJ6D 3QDJB 3BVTA 1OP3H 3T3MB 1S7SB 4OUUB 4AV5A 3QUMH 1XF5B 2K6WA 1TYRA 5I24A 4DFIA 4P9MH 1XH3A 2D7NA 2E9BA 2VZ1A 3SDXE 3TA4D 2TRHA 2VDLB 3T0VA 4M62H 2CKBL 2N7BA 4PRHE 3I75B 2H6OA 3Q7JA 4O02B 1CF8L 4HDIA 4UF7C 2CM6A 4PJDE 4YIQA 3MRIA 4HEMA 2OMUB 4Z3TA 3A6CH 5FDYA 1CYGA 2YD0A 2CM5A 3PNWA 3OMIB 3QXAA 3H7BB 5E23A 4CU7A 4HULB 4I3RL 4IMLA 1IUZA 5E99H 3ZO9A 1MRDL 2EICA 3NCMA 4CVZB 5HVGB 3EOAB 4F9LC 4XO8A 1I8IB 2F2HA 3S2CA 3FMGH 3JUZA 3GKWL 2CLRB 4X6DE 5HYQA 3PWPA 5HD8C 4HUXA 4QWWC 1H3XA 3NCXA 5K33A 3C75A 3A23A 5CLYA 3TNMA 4M4RB 4JFYB 3FB8B 5DFWH 4DAGL 3X14B 2W07A 4KV5E 3EOAA 2FH6A 1KBKA 1U4EA 3GJFK 4QRRE 5FOJA 2D0FA 2EE0A 2IANB 4LQFH 3WLBB 2C9SA 2DTML 1O0VA 3LNDA 3CU7A 2DMCA 3K8KA 1FYTB 4HLEA 2KT6A 3C8KB 2H3NB 5JXED 3MV8D 1YEEH 1SXCA 5AYQA 1INEL 2P5EE 1HWHB 1YJDL 4WI0B 1Q0EA 1BFTA 2F5BL 3NIDF 5BVJB 4QO1A 4FI7A 4IRSA 3GDBA 3V0JA 3S34H 3GMRA 2XZQL 4HCRA 4PJ9D 1ETZB 1GGCH 4WGKA 3KLQA 4Z3IA 1CD1B 1G84A 2IH1A 4IS6B 4Y5XB 2CO4A 2UWEE 2ZWSA 3MN8A 1FO0L 4KPHH 1YEKL 3S5LG 1HEHC 4G6FB 1MHPL 3PQYA 5IBUB 3PV6B 3ZR6A 5CSZB 4E9RA 4L8BB 4I18A 1GS7A 4OZGB 1KTBA 1U9KA 2BXYA 1Q94A 4HGKC 5H37G 5JPMB 1WA0X 4LLMB 5CJOH 5HGHB 2QHRL 4DAGH 1HKLH 4BK5C 1TDQA 5FIEA 2DBLL 1VADA 3BHBB 5HTSA 3GM0A 3SOBL 3MQIA 3GBNL 2KERA 3WELA 2HPTA 2QLYA 1BFOA 3EOBA 3QFJD 2G9HB 4PWEA 5DRWB 1RHHA 3BVNA 1A9EB 3HLAA 5E9DD 1QSVA 5DMJB 2VB5A 4LKXB 1KOAA 3JWDC 5K9JL 3ZBMA 3RTQD 1LHZA 1M9SA 1LWHA 4UQEA 4XCEA 3K71A 3MACL 1JNLL 2F1EA 2C9QA 1EXUB 4ZUUB 5KYNA 3BI9X 1IU1A 1RL1A 3QEGL 4Y7OC 5CKGA 5D1QA 2VQ4A 1WJ3A 3MUGA 5AOLA 5FYJD 1OTUD 4NKIL 3MLWH 2DWSA 3B37A 3UEQA 1WC7B 2EVJA 3WDHA 4WI2A 1OAYH 3L4XA 3MRJB 3ORJA 4L5FL 5C0CA 3GYRA 4P59L 5KTEL 5L0QC 5D2NE 3FQWB 4MJ4A 5EZOL 4NIYE 3SYCA 1XCWA 4F7PA 1YEHH 4BQ9A 4HUCA 3VGAB 2VL4A 1U8PB 4NYLB 4FQCL 1ZSDA 4L8SA 5HI3D 3T0DA 1KIPB 3KH3A 2DEXX 2ENPA 3CX5K 3WUWB 4Q74A 1YYMH 4LP4A 3K6FA 3F3HA 3R4RA 1CXIA 1C12B 1G6RH 4JKWA 2IWEA 4MNHB 2V5YA 4XB3A 5FV2A 3VWJB 4ZFOA 4U31A 3T5WA 5B7FA 4DZ8B 1P4LB 1TJGH 2VL5A 4J4PA 3JVFC 4ZSOA 3HZVB 1JPST 5I8KL 1A4KA 1JNLH 1UXSB 1K4DB 4Q9RL 3RZCB 3NJVA 4HGMA 2ALWA 1PDKB 2X3AA 4GQQA 4PIRF 4ZMOA 1FC2D 2H0FA 3KEHA 3ZK0A 1OGTA 2FT7A 3H9ZA 5EEXA 1MQ8A 5GJTH 3OGOE 3HZVA 1ZHBB 4P23D 1OGAE 4RDQF 4DTGH 2YWYA 2VERA 5F3BA 2V5MA 3PRZA 4JRYA 1VKXB 5DTFA 3H42H 3U4BH 3KLAA 2ZXEB 1QFWL 1LE9A 2LGNA 2XHNA 1C5CH 3NJJA 4OZFH 3SYPA 2XWEA 1M05A 1MCWW 2ARJB 4JZOB 1AO7E 4P07A 2FD6L 1BXVA 1V3KA 4LHUD 1GGTA 2VAAB 1UQSA 4OZIE 3A22A 3ULUD 2XLLA 5ISZE 1PYWA 4LLYB 5I5JA 1E27A 2ATPB 5EULV 1H3PH 4N0UA 4JPVL 4M6NL 4ZW6A 3NIFE 3D8MA 2I26N 5DI8A 1X44A 4P46A 2B4CC 4Z6AT 1B4JH 1ZGLM 1D5IL 4OLUH 1MWAH 2FCBA 2WBJA 4Z76A 2BY1A 4I85A 2UV3A 4MSWB 2F6AA 1F58L 2PR4H 4KY2A 3AC0A 4OZFG 2NNRA 5ETUA 2GJPA 1CD8A 2FLRT 3UJIL 3PWPD 3ARQA 1BXAA 1Z7JA 1P4BH 3VXTA 5DCCA 3FUNA 1L7TH 3VH8A 3TNMB 2VZUA 5EZIH 1DDHA 1JVKA 3SD5A 3DIDA 3ARGD 3GSNB 1EAPA 2N3JA 5CLXA 4W1TA 2I69A 2X4RB 2DKMA 4QHLB 2ICWJ 4JQIA 1KBVA 4Y4KC 3SE4C 1JI1A 3LS4L 4WKXA 3VFRB 4BZ1H 4RMUA 4NWUL 4WK4B 2AQPA 1CXEA 5FAAA 4TTDD 4NQUA 1UWGL 4UIMB 3QDGE 3P3RA 3HG2A 4JG5A 3MLRH 3VMPA 5A16B 3Q3GB 5C0RL 3Q6GH 2QPSA 1X9RA 3U6XS 3WFDH 1WISA 3OSVA 3CDCA 4RIRB 3FUEA 4I0PB 2RB8A 1F56A 1UA6H 2I27N 2BHUA 3J27A 3QULB 1I1YB 1M53A 5HYSG 1HU8A 4IU3A 5HGDA 2ZNWA 3ULVC 4JKPH 2P5WE 1A6WL 2CO6A 3LKPB 3PJSB 5D7KE 4KK6D 3V6ZA 5I2IA 3P3YA 2BWDA 4EI0A 4XBEH 4UQDA 4APQA 1CC3A 3UYRL 2AVFA 3LPGA 4XP1H 3RGVA 3WFBL 1JCVA 1I1YA 3OKNB 2CRYA 4B96A 4KKCC 2WNXA 5IG7B 1NKGA 1I1AB 2AK1H 5E1HB 2R8SL 1OTTC 2BVPB 3BAWA 4L4TD 4OCWH 5C3LD 4ZFOL 1EDYA 3T0BA 4KI5E 4FLSA 2HXAA 3PYCA 5CZVH 3FYEB 4JDEB 5DHVH 4ZUUA 4MD5A 4PJ6A 3VFUB 3TS8A 1G1CA 3DA0A 1EEUA 5E6IC 2DQDH 1MHCA 1I1AA 1M1XA 2X70B 4DEPB 2X1WL 4Q9BA 2VMFA 3DOIA 4B3EA 3DIFB 4R83A 3LRSA 3ARDB 3FUFA 2H5UA 5DUBB 1DJSA 3VWKA 5ELIA 3NCYP 4HZAA 2XU9A 2P5WD 1ACCA 3BE1L 3NFNB 2Z7WA 2EYRB 4JNXA 1QPPA 1Q1JL 3K4AA 4X0KB 3WENA 5ECGA 2PP7A 3QWOA 1NUGA 3RY6A 1QBLL 1VA9A 2CGYA 3KLSA 4DCQB 2BFGA 1BMZA 5IROD 4EAEA 1J87A 2PETA 1A3QA 4NIKB 3G6DH 2WY3B 4G7VL 5KVDE 5KWYC 3TJHD 5DJYB 3CVHB 5JW3L 3MOAH 5CWSA 3MCG1 5BUGA 3MRDA 1JZDC 5TE7L 3OMZA 2F08A 5I1DB 1CFQB 4HKBA 4JFPB 1LL1A 3CMGA 1SXAA 5LGJB 2R29A 2BVOB 1K4CB 4LEEA 3TBCA 4AX3A 1JE6A 2VC2L 3VXOA 1F13A 3L7FB 5B3NA 4ONOA 3OHXC 1XSIA 2VH5L 2ZKXA 1UB6A 4LSSH 5K59E 1X5FA 4ZO7A 4CW1B 4ZBJA 1KELH 2VXTH 1X5AA 1FAIL 3S36X 5D70L 4WEUD 4KX8A 5ICYA 1EJOH 1Q1PA 3JWOH 3NH7H 4OZGA 2O30A 4C4KT 5FUCE 7CGTA 4MRBA 2IADB 1CGYA 1KCKA 1GYAA 2CRMA 1R3HB 4YLQT 1O6SA 3ZL1A 4ELKB 4PJBB 1AQKH 1L5GB 2YJQA 4LLUA 5BO0D 3I9PA 2FDBP 2APVA 4HWNA 4PMFA 1FZMB 3GSVA 1DN0A 3VGDA 4TQIA 5GS1B 1MVYA 4WUKL 2CCWA 2X1PA 4OLXH 2Z35B 1R3HA 2XQBL 1MI5D 3FQTB 2FZ3A 1OD9A 1VFBA 4I0PD 5KANG 1IKFH 4BA8A 3RL1B 1JL8A 1ANUA 3EUUA 1KJ2H 4GSXA 2Y36H 4M56A 1CLYL 2R59A 4DGVL 1GS6X 1NGQH 4JFSA 3SGKC 4F92B 3LIZH 4KKLC 3HBGA 3SZ6A 4AM0A 4K3EL 2BIMA 3RDTA 1M42A 1HH6A 2VKXA 4YE0A 4ANXA 4XP4H 3B5GA 1NEPA 4IK6A 3MLTB 3PWUA 1WCBA 3TBSA 4UZUA 4LCYB 2JB5H 4NM8L 2O5YH 2VM9A 2PPEA 1QFHA 4OCXL 2P42B 2HFFA 3IS1X 4PGBB 1Q9LB 1S3RA 2R69A 4XMPH 2GCYA 5FWQA 4AM0B 4XTRD 3VQ1C 3KBFA 4NN7B 3E3QE 3ES6A 4NFBA 2HT3C 3LNGA 3C8HA 3TIEB 4KH2A 4L05A 4NQDA 4H8QA 1FGVH 1KG0A 3MXWL 4L48A 4LVHB 2NX5E 1JGVH 4MCZB 2E7LA 5DGQA 3C5SA 3L95A 5MP6H 4QKTA 3B2UD 3G6JE 2GCYB 3TH4T 2Q5BA 3FCSA 4ODTL 1IGFH 1QFUH 3NH7L 1Y07A 3BO8B 3HC0A 4LVOC 4DQOH 2FQEA 1C8QA 1DBMH 4PSPA 2P8MA 2P80D 2Q3XA 2OI9C 4ENZA 2BRRH 2JKLA 5TDNA 2VDPB 3KCWA 5IHUH 4HOXA 4U1NA 4PGEA 4ORZC 4S1QH 4IU3B 1Z3RA 1KBGL 3A5VA 4QCIA 4PY8J 5D72L 4PTTA 2VUKA 3EXLA 1XMEB 1P5VB 1FNFA 3UGXA 2GAZA 2MH4A 4H26A 3DRTA 3DV6B 3INUL 4LCVA 1Q0YH 3DX2A 2G2RB 4LPTA 2QADC 1AGEA 3DURA 1PZUB 1G7HA 5D2LB 4NQEE 1DANT 3GBDA 2DL9A 5TE7H 2G3MA 2OMNA 4BEIA 1FSKC 4NUJB 4Y0GA 2HRLA 2FEJA 4BSVB 1SZNA 3KMDA 2RALA 5L8KB 4X80H 2QR0A 4FEIA 1YN6B 2EDWA 4DKDC 2HA1A 2VR5A 4M4PA 1EXGA 2X2JA 3CFEB 1U8LA 4R0LC 5D1QD 1YQVL 3VGHA 4AK2A 3HW7A 1DQTA 2OMWB 4N0YL 4IRZL 2NZIA 4U1HB 1YNKL 1KPUA 3U7WH 4LLYA 1YYLL 4AMWA 3FF7A 4BE5A 3VGFA 1KJ2A 3UTSB 3W2DH 2Y6SC 2AGJH 4LBEB 4PJ5A 2NRDA 3VDCA 5J6GB 3CFEA 3WUZA 1LO0H 2Z0BA 5BNXD 5GGTA 3QFJA 4XNQA 4MD5B 3BVDB 4XI5C 2ZUWA 4H7VA 4FG0A 4NBXB 1Y0LB 3SE3C 1RK1B 4TNWK 1OM3L 2Q8AL 2OLDA 3FF8A 2R7EA 4FADA 5JLZA 2OXHB 1U8MA 2ED9A 1DBJL 4UTBA 3L2LA 2YLKA 1ZXKA 2HLAA 1KXQA 4W9FC 3LPPA 1OARL 5C0BA 1FFOA 4Q0XL 3PHOB 1IFHL 4XOEA 4ZPTB 5ALCH 1JGLL 5FOBB 1QNZH 3PQYD 3ROOB 5FYJH 1I31A 3G6AA 4RFNB 4G83A 2YGOA 4BKTC 4JFDA 3GIVA 1I8IA 3EF7A 4U1GB 4JO2H 5GRWA 1N10A 1IAII 4OQ1A 4UB0H 4RCAA 5C0BB 3FOMB 5DZPA 4HYTB 4U1JB 4JFDD 5GSRB 3MLYL 4N1EA 4PS4L 3IDIB 2K4WA 1KTDA 4JFXB 3HZKB 2WXMA 4J3OF 4JKPL 3MREA 5FO9B 2DQEH 4YQXH 2BWIA 2E7DA 3DO7A 3A3YB 4YDMA 4OF7A 3QT2A 5C0BD 4AG4H 5A2JH 2A6DA 5ACLA 2C9UA 4EUPB 3D18B 2VN4A 5KG9B 4BH7B 2EEXA 5IMLA 3MRGA 4M48H 1D5ZA 3VFVB 5CM1A 3QUMB 3EJTA 4PGDB 4KVNH 1RZKH 3BZ4A 3CZLA 1M3JA 2CO6B 3CX5J 4P04A 5TDPA 3UTTE 1A7BA 3VI4B 4JFFA 2AQRA 3QJHA 2WYZA 4IBQA 1P84K 1RUQH 2ERJC 2F5AL 3D18A 4LZKA 1MCOL 4N8PA 3FAXA 4GG6E 1F4YH 3DX4A 3JUYA 4AC4A 2ID5A 2CGRH 1G7JB 1S3KH 5LDSA 5JZ7D 4W9GC 3S3PA 4OV5A 2QEJA 2VLRA 4K3EH 3UBXG 4GJTB 1G6RA 3VFNB 1E2VA 1EHNA 5IB3B 1NFIB 4UNVA 1W6LA 5EU6D 2EIKB 1GZQA 2R1XA 5AW4B 5ICXB 4KTGA 5BQ7B 2X6AA 4P9HH 4PWJA 4XVUC 3VFOB 3VXPB 3OXRA 5L7XH 4TUKH 4F15C 5HPOA 3VTTA 4QYOA 4HH9B 2AJVL 5DEZA 3JYCA 2GTQA 4DZBA 1ULVA 3DX7B 1PFCA 4DKFL 2K45A 5I1GH 1E50A 4F80A 1TSHA 2CJ3A 4UTBL 4UTBH 3DPBB 4NSKB 5DUPL 3RTQA 4DVRH 1I7TB 1KLFB 1AKPA 5D2NC 5IMKB 2IAMD 4A55A 1ZLSH 3OM3B 2A77L 1KXTB 3TXAA 5BQDA 4UQBA 4FEMA 5L2JB 3MLUH 3OAWA 4Y5YA 1SMOA 1FZOB 1G1YA 4JY6B 2V7NB 4O2CA 1OCZB 2E86A 1JPSH 1OGAB 4P3CL 4JVUA 3NZHH 1AP2A 4XE0A 5DHYA 4QYAA 4XAKD 4AGOA 1ITCA 1IM3D 1FGNH 4I8DA 4J5VA 4KJWD 3QC5X 2A9ML 1R3KA 1NC2D 4QOKB 5HGBA 1OT1A 2N4IA 1M7XA 1MJ8H 4PJ9C 5HHXL 3LKQA 4OKDA 4ELMA 2MMXA 4DVRL 2E9GA 2AF2A 3VG0H 1PQZB 1A47A 1DQML 4Y19E 3CHQA 3K81A 4DKFH 1GSMA 3MOAL 4J7RA 4JL1A 3P4MA 4ZDHB 5L4JA 4ZS7L 1P4IH 1TTCA 4BGDA 4LVHC 5MI0C 4HVBA 4OCSL 5L8JB 4GAGH 4KXCA 5JPNC 3LKQB 4XNYL 3H4HA 1UJ3C 2DMHA 2HJFB 3LHAA 2EDEA 3EGSB 3F7PC 3PWNA 3TBYB 2BIOA 3FHQA 1C5DB 2ZOTA 1NCNA 1K5NA 3S8FB 2YIHA 5J56B 1N2RA 2QELA 3V5KB 3GI8H 3CDYA 4YC2C 1L7IL 4G8IA 4P57A 3PG2A 4Y4FA 1EVUA 1NDMA 2J1ZA 3FRPB 3PGDA 2MOVA 3O3EA 3EFFB 4ZFZB 5IQ7L 4JFUA 4U1LA 4XN1A 4U05A 3D25B 3QIUA 3UEZA 3H4FA 2ZPKH 5J9PA 4HIHB 3O2VH 2HX7A 2VLME 3OKNA 4ILDA 4XPFL 4AUJA 2R2HB 4YEFA 3TWCH 1MFBL 1QBML 4JFHE 2CE6A 5FYJL 2XA3A 2CHZA 3ARBC 4WNQB 5HHMD 3TVMC 4CGUB 5T33L 1MHHB 3HC4L 1ET5A 1N3NB 3Q06A 1DJHA 1JGLH 3UZEC 4TVPL 1XAUA 1IAIH 2QPEB 3UAJA 5EBMB 1MRFL 3W39B 1WITA 4FNPA 1I7RB 3HN8A 4MBRA 2VAAA 5EZLB 3RWIA 5FKAA 1QR1B 5I17B 3G5YA 3EG9B 1JYXA 4NAJA 2KQMA 2DQIL 5GIRA 2ZOWA 3MLVH 4WRLA 3ZO0A 4FQIH 4GKSA 1OM9A 1JV2B 3SDAB 2X28A 3P40A 3U4KA 3WIAA 2IAAC 4KY1H 3Q1EA 5ANMA 4BK4A 3W2DL 4N3UA 4M5YL 4HEPA 1MFDL 5E8NB 1F4WH 4DVBA 1DQJB 3HCVB 2OCCB 3PGFL 2YRZA 2NY3B 3HC4H 3LTVA 1P84J 3ZOAA 2EC9T 3SGJA 5IFJB 1K3IA 3HRZB 4XCYA 1B9ZA 5SWSB 5D2LE 4GI6A 2Z0UA 1BD2D 3HE6A 3FTUA 4RGNB 3HNSH 4R26H 3ULSA 3DUSA 5DMKA 5F3FA 4XPTH 3MA7A 2RMNA 1AVAA 3QIWD 4FNUA 3HBQA 4Z7NE 2FEDD 1G7PB 2PO6C 4FHBD 3S34L 3SKUD 2JK5B 4JG9A 2B3RA 1VRSA 2YSSB 2Q0ZX 4GFXA 2N0KA 4RZCB 1AZZC 2GUOA 1OSPH 3PXJA 1P4BL 4W4OA 1WAAE 1ORQB 3IPBA 3TN0A 4D0BB 1BD2B 3NCCB 3FO1A 4RGND 3CE1A 1KBGH 1I8KB 1T20B 5E03A 5B39B 1UB6B 2JK5A 2Y6TE 4LKCA 4J3OC 1EHAA 3ULUC 4N2EA 3HZYA 5AVWB 3AXIA 1WD9A 2ZKHL 3V4UH 2FIKB 2V7HB 5IJCC 3EYOA 2DM4A 1ORSB 3O4LB 4B7IA 4ZPVA 3SDXA 3T1FB 2WNGA 1BF5A 1BV8A 3ILQC 3SDAD 4QTIL 3VFOA 3D69B 1O6SB 4KI5C 3VG0L 1IKNC 1ZANL 1JNHA 5TF1H 5I6LA 2MIZA 3NEOA 3BAIA 2FJSA 3CN0A 4UYQA 4Y1AE 2NR6D 4F2MB 1E28B 3QEQD 5IB3A 4G6JH 1NGWA 2EXWD 1CFSA 2Y23A 1RK1A 4DP4X 1WICA 3ULUH 4F1ZA 4N25A 3NPZB 1RIVH 3D3VB 4WFED 3VD7A 3FJTA 1CDYA 2BP0B 4UNTA 1Z66A 2R0LL 2O5NA 2XICA 3QORB 3AB0C 1ET8A 4GUPB 1LE5A 2VMDA 5T3XL 1PZ2A 4EKJA 5EF3A 3GLZA 5K9OB 3PL6A 2EILB 5F1SA 4KKBC 3WE1A 4MB1A 5C0EB 5I15H 1SLUA 1F2XK 1FI8C 3HMXH 3SDAC 5I18L 2YFOA 2WD0A 4DF9A 3DGGB 4NRYA 3U30C 4GO6B 2HT4C 1GY1A 1YEGH 3QUKB 1QO3A 4JFOA 4J39A 2J5LB 3B8SA 2QSQA 1QBBA 3LQZB 4PLOB 3ARFB 5E9DB 4B9GA 1DJIA 5I1HL 3MLSH 1T03H 2EO7A 1BA9A 2NDGA 2KS0A 1TENA 4FFWC 4RAUA 4ACTA 4HK0A 1P1VA 4E5XA 3COOA 3M7FB 4NQDB 3ZUNC 3PCYA 2Z31A 5EU4A 5IHLB 5HHOE 4HIQA 3P9MB 2VXSH 1G0YR 1BZ9A 3IDMA 2OL3H 4XPAH 5ERWB 2Y4SA 2HJFA 3P0VH 3S7GA 1L0YA 3L13A 4LEOA 3RPIA 4WNJA 4X9YA 1QHQA 2H47C 2QTVA 4Y16D 1PLAA 2Y36L 4F33A 2I7OA 1DVTA 3WNOA 4N0UE 3WSQL 1QUPA 3QJTB 2XN9E 4LSSL 1LM8V 4PJ9B 1LD9B 4KKBD 4KWUA 3O0RL 1SXSA 3SO3B 2Y2TA 5FYJU 2Q7NA 2VERN 1W8EA 2MFNA 1ZJAA 1SHWA 3N1PC 2VC2H 5DD1L 1G9NC 5BMFH 3A67H 5HYJB 1RZKL 1JPTL 1LK2B 3S6CA 4XPGH 5EO9A 4I9XA 3SPCA 4NJ9L 1WS7A 4V1DD 5CINH 2LQRA 2WLNA 3EYQD 4F8LA 3QFDA 2GY5A 4WAFA 5IHBA 1BPVA 1CPUA 4IIZA 2Z92B 1RJYA 4PYHA 4F93B 4JRYE 4NZRH 4YL4A 5DS2A 2QR0B 1CGWA 1NCHA 2D7TL 2YN3A 5INDA 5IHZB 3EBHA 1V7ML 3VDAA 1TQCC 1P1ZA 1H15B 4RGNE 3FT2B 3QUXA 1M6OA 1F5WA 1WIPA 5C0JB 5CJXA 3NUKA 4UB0L 4X7TA 1KTRL 3WL9B 4Z76B 1NL0H 4QXGL 5I71C 3TT1L 3P0YH 2QBWA 4P48A 5TPWL 4LMQE 4AKQA 2XTLA 1F02I 1CLVA 3ZE1E 2EDRA 3QXVA 1N6QH 3CQPA 2VM4A 5L9DL 1H15A 4JDTL 4KJQD 3B7UX 1T1XB 5DA0B 3PY9A 4ABWA 2C7UB 3ZDZF 3NJKA 1MIMH 1EV2E 1T1ZA 3HVDA 4NUQA 1T89C 4M6OH 3MNVB 2Z3FA 4ONFL 4J8RA 2J20A 4KVCH 5A6MA 4UNIA 2EP6A 3F83A 2AAVA 1A3ZA 5DURB 3Q43A 3K72B 4OAWA 4L9LB 4JO1H 1LP9A 2EACA 3U9PL 2VLKE 4UIKL 4H0IA 1IEBB 4JHAL 4YGVB 1MCEA 1OTSD 3Q3GA 3WLWD 4E41E 4Y9FA 3GLEA 3ALXA 5KVFH 3EGDA 4PCSA 4OGAD 3OZ9H 2OZ4L 3ZJAA 4FP8L 1GIGH 3D85B 3QJUB 5FEBA 4P5TA 2OR9L 5ALBL 1EXHA 2FECI 3FTSA 4AJYV 1MLCB 4M61B 1EPFA 4WU5A 3BKML 3HI6L 2YS4A 3FZUC 2YD7A 4HJ1A 4Z5RA 1H3TA 3VU2A 3M1CA 1XXFC 2CO7B 1A6AB 5GS2D 3VXRE 5I76B 5KG9A 5AEAA 1AS6A 3G9AB 5FKPA 5I6PA 1EJFA 4Z7WB 2MQGA 5C0RH 3QUMA 4LE8A 5FGSA 4PAZA 4ZOBA 3T4AC 3RA7L 1UWGH 3GTNA 4ORGA 5GGQH 4HUKB 5D7IA 1E4XI 1GCFA 4PYGA 4BZ1L 1WBYB 2DQGH 4LHUG 4AW7A 1AKJD 5I0DA 1PFOA 2MOGA 2RGSA 2BRRL 4P5RA 1AGCA 3MI6A 3ULAB 4IRSC 2XTJC 1DBML 3G5ZB 5ADOH 3SDXB 1TQTA 3LZLA 3KLHD 1KCRL 1MCLA 4P2RA 1KYFA 2HLFD 2ZWYA 5EA0L 4LK4A 3O2DL 5ADOL 4WJ5B 3V0VA 1ADQL 4BRJA 5DD0H 4M6OL 1EO8H 2G9KA 5E2JA 2YUXA 5HI5C 3VGBA 5C6TL 3EOYG 1KCVL 3DYOA 1PY4A 4LGRB 3HN3A 4G8GB 1TZOA 2XV2A 2MCMA 5FYLL 3BH9A 1KTJA 4F9LA 1Z1WA 1QFWI 4C59B 1OP5H 4WKZB 1T0OA 5HHQB 1AS8A 4HKXB 3LQAH 4S11A 3SPVA 1A14L 3QUZD 1BVLA 3I6GB 1MAJA 3BEVB 4G9FA 3GZPA 3CBKB 4MX7B 4WEMB 3BEWB 1YDPA 1BM7A 4H8HA 4QR7A 4GIAA 4ZT1A 5KJ4A 5ESAA 1FUNA 2OJEB 4TL5A 1B4RA 2BIQA 2ZYRA 5EOCH 4NJAL 4OY9A 5IROC 1FZOA 4TSCL 1FLRH 1WZAA 2EIMB 2L0DA 5FYKD 1S78D 3VM5A 4MX7A 4OH2A 4M3HA 3BZFB 3TZVB 5CCKL 1TVHA 5BZDA 1CFVH 5AW0B 2PTTB 1CVRA 1JPTH 4DTGL 2IOIA 5F9AC 4K4KA 2XOTA 3BP7A 2JJVA 2YKLL 1RUAH 3G5WA 4NN5B 3VXMA 4JM4H 1KTDB 4LPWA 3CV5A 2AQTA 4JDZB 1KJMB 5DJ6B 5J7CC 1ESOA 1W0WA 3L3DB 3WSQH 1LEIA 3QDGA 4FG6C 2PF6A 2V9TA 4R7LA 4YXLL 3KPSD 5JHMA 1J8RA 4HK3N 4DIXA 3UPRA 3MGOB 4ZG1A 4QLWA 5IT2L 1XCTA 2WVSA 1C16A 2J25A 1SLVA 3HRPA 4ZFGL 2CQVA 3KBHE 4J2XA 3WO4B 4HDIB 2ICWA 3EO9L 4YIQB 5FF6B 1RUAL 2UUDH 4RA0C 3HFFA 5K9QG 5E24E 4GBXA 4W9KC 1M6OB 3P0GB 1AHMA 1F4AA 1K85A 5FM8A 1X5LA 4G8IB 4P57B 3PJNA 1ZVSB 2VDNB 4YHML 2FL5A 1A1MB 4KU1A 4PRBB 3RGBA 3IPEA 3FU7B 3FFCD 4YNYB 4U1GC 4MZ3A 4LSVH 1XF5A 3KJ4B 4MAYC 3DUUB 3TBSB 3HS0C 5AOJA 4X50A 2KZ1B 3V9FA 2R2BA 2OSLB 2E8YA 4JKKA 3PQYE 3LEVH 1CQYA 4QHKJ 4N1CA 5K1VA 4UM8A 2F61A 3AY2A 3CFMA 1IIIA 3C6LD 3IDJA 2WCSA 4RMRA 2E27L 2ZG1A 2C9RA 4LB8A 5T1DL 5IFAL 5HHOB 5KSVA 5I0YA 1W8NA 2APBA 2OXGA 2DM7A 3EJYD 4Z7VA 3V7AG 5DS8A 3E1F1 3ERXA 3RLSA 4P9HC 1JF5A 4G8AC 4L9LA 2GI0A 4DPAX 1JZ7A 1I7ZA 1T4KB 1MDTA 2WBJB 2W65A 5BCAA 5CMAB 5DQ9B 3VWJC 3WFCH 3HS8A 4RSVA 1ONQA 3B2VH 4FI6A 4YO0A 5JUEH 1BXUA 3FB7A 1MKFA 3P2BA 2XBZA 5LJYH 5E8EA 2OJ1A 4AYSA 1J0KA 5TDNB 5FGBC 2GC4C 3O3DB 3WY1A 1U8QA 1S9XB 3MV9E 1MLCA 4JG0H 2KZBA 5I15L 4FQPA 4PRIE 4M93B 3ZU8A 3I9IA 3V4UL 4DP5X 4ZYKA 3DIVA 3BPCB 5I1HH 4G9DB 2D7OA 5D8JL 5IEHB 3GGWA 3FOLB 4D7BA 4GW1B 4HS3A 4TQEL 1GGCL 3VXQA 4CVXA 1A2YB 1DBAH 4ELMB 2K1MA 2WXRA 3B83A 1RIVL 5AAWA 1HQRB 4ISVA 3FQNA 5HJGA 3ARUA 4A37A 4P5TD 1JZ5A 3PHAA 1DO5A 3NCWA 3BD3A 3CC5A 3V0EA 3VYPA 5ITFA 1EDQA 4OFYD 3KYNA 4OJEH 4UQ2B 3ZUCA 4E41A 3MV8B 3SDCB 3TBWB 1XSKA 3V0WL 4NBYB 4B97A 2PYFA 3Q2LA 2BVQB 3KVPA 4HH8A 4RMWA 4TVSa 5I1EL 1T1YA 1E4XL 15C8H 1NCBH 3PV6A 5AG9A 2XZAL 4K2UL 5E70A 4LLMA 3NIDE 3U7AA 2ZOKB 2BVPA 1UWXH 3EFFA 4ZFZA 2QSCL 4NI6A 4I1NB 1IMHC 2X0WA 5AVUB 5F9JB 1IM9A 3ARDC 3HUJA 3NABH 4WCYL 4PB9L 3HS0B 2DH3A 1UVQA 5C07E 3ELQA 3NFNA 4DOHE 5JHDB 2AZAA 3TBVB 5IVNA 2CALA 5MEOA 2V17H 3TA3B 2DQIH 3E8VA 1HCYA 2G9HA 2VRAA 4G8FA 4I4WA 4P2OD 4JGMA 4KTEL 3DSFL 3EGXB 3DI3B 4NO5A 2F8OA 5GS3A 5J1SC 4IW4C 4L3EB 1T1WB 3LRSB 5DUBA 5SWSD 3VMNA 5E6RB 5DUJA 4YZWA 1A7RL 3ZT6A 4OI9A 4JFEE 2EDOA 3KLDA 4P4RB 5EU3A 3Q6FB 5HHQA 5DJYA 5C09A 1QBMH 3VGEA 1ZV5A 3RHWF 4BZ1A 3ABZA 4NZFA 3QDJE 2DV6A 1WFTA 1H3PL 3FFCE 4TNGA 5BZDB 3W38A 4GRMA 4ZMNA 5DRNB 3S88H 2DM2A 4EBQL 2WZPA 1N0LB 2AMUA 5DC9B 5LNDA 3B4NA 3Q6FA 1UACL 4W81A 4HUXB 3VYOA 1BZ7B 1G0DA 4KXDA 3L7FA 3MLVL 4WTWA 1GW0A 2ZOUA 4QHMA 3FB8A 5FW7A 3BZ4B 3HIZA 4JREB 4LGSB 4M61A 1D7DA 4URKA 1OK8A 2X4UA 5EF2A 1KIPA 3P9LB 3ARYA 3JVGA 2B5IB 4ZX3A 1QRNE 3IN2A 4OZ4B 3QZWB 4GKZB 5GGVY 1L9OA 3TCTA 5IW6A 2WKOA 3WY2A 4YDVB 4U1IA 2H32B 4PJIB 2XFGB 4OTXL 1HZHL 2JJSA 4DZ8A 4OV5B 1NLDL 2JH2A 1FO0A 2HVKB 3ARBB 2DQHH 4C4UA 3PP3H 4XC3L 1SMAA 2RFXA 4HJUA 5BUPA 1ZTXE 4EZKA 3MKKA 5BRZD 2YPLD 1S8DA 4LSUH 2QQKH 4Y1AA 2WLZA 2YEVB 4HT1H 4YH6A 3GXDA 4G3YH 4H25A 5IREA 4JJ5A 4JRLA 3OXRB 4AL8H 4Q14A 3BQUD 4FERA 4WSGA 1OAQL 3FU7A 3Q2CA 4P4KA 4YBQC 1MFBH 1ED3B 4EO5A 5DDHB 3HZYB 2YAOA 1W72A 2ZX8A 2W91A 3L9EA 4HP5A 3U2SB 3QRGH 3UP1A 4S0HA 1DANU 4XN4A 2WTRB 2A83B 5I8OH 1I7TA 1BVZA 1S9WB 1CDIA 4ZUVA 4FA6A 1NEZA 3TURA 1CLOL 1OOAA 2DQTL 2IALB 3KWVA 1RZGA 1YMMD 5K9KA 5ID0B 3VGAC 2WQ8A 3WKNA 1A9BB 3E9UA 4G6AD 4AGMA 5I6MA 2J1YA 3SQRA 1MVFA 3O4OC 4QTFA 3VXSD 1E27B 1N7ML 4AKOA 4N0UB 2BDNL 4X4YA 3ZE1F 4X5WB 3MLTA 3PWUB 4O9HL 5FC9A 5E8EB 4PRPB 43CAA 2X44D 4FFWD 1OP9A 2OA9A 5B1AB 1U2YA 4AJWA 1Z9NA 4ZAKC 3ZHDA 2VDML 3IAPA 1OGSA 2VZTA 4K3JH 1DQQA 2ADGB 3SDCC 4MB5A 2WZAA 3TIEA 3TEZA 3FO2B 3EO0B 4Q6IB 4L4VD 4LLWA 1KENH 5IB2A 4W9IC 1NUNB 4OAWB 3O3AB 2BCKB 3X1BA 3KJ6L 4WUUA 1V05A 4IKIA 1XF2B 1KT2B 4JR9H 5I28A 5DUPH 2RA1A 1W0VA 2CBTA 1XB8A 4V11A 3QIWB 4TUOB 3V6ZB 4PBWD 5FUZL 2IMMA 2E76C 3CVHH 3PU7A 5LCVH 3LB6C 2AJYL 3D85A 1HZKA 4IHOA 2Q6WA 3O3BB 1XF3A 4ZODA 5BV7H 3MPCA 35C8L 4PS7A 1ZIAA 5C2BL 1IQDA 2WLHA 3PGCA 2QGBA 4NUJA 2WUCH 5F0JB 4ETQA 3VXRD 1F1AA 4M7KL 4OCYL 2WWMC 3QZMA 4Y5XC 1F8TL 5A2CA 2QVTA 1YAZA 3QR1A 3T3PE 1NBYB 2Q2LA 3JT2A 1GTFA 1AD0B 1JGIA 1KLGA 4LOVA 4NP9A 3QQ3B 5T3ZD 2ETWA 3CZGA 1FNGA 5MHSE 1QA9A 3RWHB 4MS8D 1UWEL 1PPIA 4W9CC 5IEKB 4KROC 2Z64C 1BECA 1SXBA 4KGLA 4LGPB 5FCUH 4PTUA 4G2AA 4NO0A 1VERA 2J8UF 4PQXA 5DK2A 1U8IA 4PMEA 3VG9C 4XNMB 3ZL4L 3P3SA 5A40E 4G1MA 1IEHA 2J8UB 4G6KL 1U8MB 4CVZA 1MWAB 5BRZB 4UTAH 4NFDA 3FT0A 4QRSA 1MFDH 1UD8A 1XGTB 4IOFC 4E41D 2ZJSL 2OSXA 4Z3EA 1RH8A 4LSUL 2V5RA 4PJFA 3SBRA 1XD1A 4KHTL 5TQ0H 4X6EA 2F5AH 3ZT5A 1ZHLA 2J8UA 1NBZA 5T1MB 2UXGA 1J18A 5DK0B 2A4ZA 5F7BA 1KSRA 3RB7A 2CDEA 3TH3T 3P4NA 1I8LC 4MS8C 3HI5H 3T2OA 3KWUA 3WS3B 1E8YA 3POCA 4QLRA 3U9WA 5D6DC 3S3BB 4HXBH 2BVUA 4HEPG 4M48L 4XMLL 4BDVA 2Y3AA 5C9KA 3QIUD 3IMBA 1AZNA 3S35X 1ZHLB 4J2QA 4O2EA 3CVIL 1F3DH 2CKBH 2ARWA 5D7LB 4IMKA 2APXA 2COQA 4GRMB 2HTLD 1LO3H 4BFBD 5J89A 3TFBA 1FV1B 2BHYA 2ZUSA 4L1SA 4ZD3L 5DZLA 4JKLA 4KK5C 4AQAA 1WZMA 3RNKA 4JPIB 4FG4A 5D1XE 4ZK8A 2HWZL 3GLAA 1QWUA 3ARSA 2YPLE 1DQIA 1V3MA 1NFKA 4MCYB 1OOWA 2IH1B 4OFDA 4Y5XA 3ZKMD 3D12B 4QHLA 2AZUA 4N0RA 4X4MA 4KH9A 4GMTH 1IFHH 1ZT1A 5TK2A 4JRXA 3QEUB 5AD0B 3M8OL 1F45A 4PGDA 5EO0A 5DZOA 1CTOA 3ZL2A 1QRNA 1R5WA 4IOIB 1KJMA 3A47A 2ITEA 4OV6F 4AYDC 4JRXE 5JW4M 2B39A 1MQKL 1A9VA 2B5IC 3CN4A 3R19A 2B20A 3ABLB 5CJ5A 4K9JA 1EH9A 3OKKB 4R0LA 2D31B 2PWDA 4A7TA 1SMDA 4CDHA 1DJGA 4GH7B 3FT3B 1IGCH 2GEEA 3RY5A 2ZG3A 1JP5A 4NDMB 1ZTXH 1SFDA 1T83C 1F18A 4YHOH 2F58H 3GFUA 4LCYA 1XGPA 2YAMA 1QI5A 3K91A 1KULA 4RGOL 2X87A 5D72H 5TH2B 1ZVSA 3LZRA 4J1UB 1M9WA 3UOAB 1OZUA 1A7PH 2MQ3A 3K2MC 1RV6X 1NAML 1MY5A 4JO4L 3KXFD 3O6MH 3ZDZE 1PSKL 3CPLB 3EYVA 1VCBC 5DJAB 1QTSA 2Y0SA 3CVDA 1YC8A 3GNML 4G8GA 4NSKA 4YR6A 2D3VA 1U3JA 4KK6C 3MNZA 3F05A 1T0MA 2DW5A 5C0BE 4X6BA 1DBAL 2DIJA 1I3RB 4XR8C 5EU6A 3T8VA 1VACB 3MFGB 4YOKA 1R3JB 1L0QA 4C56D 4QTHA 4UU9B 2ZONA 3IDNA 4JRWA 4RDQG 4YEEA 2P45B 3PXLA 3R4DA 1AO7B 1DUYB 1RULL 1WLHA 1WT5C 5L7XL 4AYFA 5F7HA 4FFVD 4YO0B 3QQ9D 4M7LL 5LBSH 3ZZLA 4BM7A 1BCIA 1JK9A 1UKQA 4I87A 5DC4B 3ELAT 5CGBA 2PKDA 2X05A 2DDQL 4M7KH 3GF8A 1OZTG 2EXYC 2HPOA 3NZ8B 2XTSA 5C2BH 1F6AB 4RMVA 1NC4B 2XKNA 1VFUA 5DEFA 2WIMA 4ZAKB 4GG6F 2I60H 1HL4A 2FUQA 2IBGA 3KD4A 4NNYA 1TCRA 4W9LC 2VWEE 2DLIA 1TZHB 2RHEA 1RERA 3M07A 4FOMA 2VUOA 2ESVD 2AMGA 4C54A 5GS0H 5FB8B 3MJ7A 3KLHC 3REWB 4GFTB 4DH2A 5FA4B 5AKRA 3QUXD 1JMXA 3SGDH 1X5MA 1GKEA 2AJXL 4TSAH 3FUHA 2Z92A 5T1DH 2C9PA 1WAEA 4GUOA 4MA7H 3I02A 5J1AA 2IH3A 3I84A 4W9DC 4YE4H 4YHPB 1NCWL 1NCIA 5A2FA 4BHUI 3MSPA 5EN2B 1W16A 1AGEB 3DURB 2H4EA 2GTWB 2HG5A 4JQVA 3ZDXE 1MWAA 1NIBA 2AXWA 1UXLA 3QO1B 3DRQB 3QZBA 4IDLA 4PRPE 5F7KC 3CSBA 3KGUA 4QRSB 4TULL 1U8KA 4HV8A 4DT2A 1KEGH 1OPGL 1HDMB 5AYUL 1A1NA 4RBPH 5MHSD 3MLYH 4NERA 1XH3B 4UTCA 1QR1A 5KEZA 1SVBA 2XIIA 1CVSC 2Y7OA 3G6AB 4JS7A 2DQ6A 4PW3A 2Q3ZA 2D0GA 4N5UA 2AK4E 2DN7A 3F8UB 2I07A 4MMXC 1DVFA 4GAYA 3L6FB 3PWLB 1UVQB 1JS4A 1OAXH 5ALCL 3IDGB 1NJ9B 3H7BA 4DKTA 4PJFB 4OD3H 3MNWA 5ES4B 4FQ1L 5KBNC 3QUXC 4DVBB 3NOIA 2OR7A 2ZT9C 1B4TA 5E5MB 3SE8L 4EI5B 4JW3A 1KB3A 5DT1L 4R26L 3ESNA 2NY6C 5D7KD 4GKSB 2C5DC 2OXGB 1U95A 2VRKA 4ICXA 5HHME 3AS3A 2RACA 3L3JA 3GJFA 1LTXA 3QUHA 4IKJA 4GRLA 4P2YA 3NDYE 4FQJH 1Q9LA 1X4XA 4NI3A 1KUMA 1J12A 1MW3A 4OQTL 3RIFF 1DYZA 4NT6A 4JFFB 3C6LC 1IKNA 3FB7B 3BLKA 1CF1A 1TCMA 2D03L 1A1OA 3QUGA 4K94H 4KQ3L 4KXBA 3LKOB 3UIYA 4P4KD 3GJFB 3GRWL 5D71L 3WHE1 4KKLD 1XH1A 4ZW3A 1DE4A 1KJVA 4XH2B 3TL5A 1DCLA 1SQMA 4W9ZA 4Y1AD 3HG1E 5K9QI 4FDWA 1B0IA 4WF7A 4H20L 2IPTH 1FJ1A 5DD6B 3WNKA 5E8DL 2YSSA 3LXBA 3APCA 4J3UA 5CZVL 4PJAA 3VFGL 3WKQA 1GZHA 4B27A 4A2HA 1LO5B 1OK0A 4JRXB 4ZPVB 2ZIDA 1WS8A 1HI6B 1UH2A 4LMQI 5BW7A 2JCWA 4FXLA 4S0SD 3UROR 2Q3AA 2G3XA 5E6UB 2B77A 1G7MB 1U8OB 1P6WA 4UV4L 5J12B 4HLZG 4QMEA 3L3OC 3VD4A 5EG6C 3TESA 3OJ2C 3QNZA 4X98B 4A6YA 3O2DH 1MG2C 3MJGX 3D3VA 3P73A 2GUYA 2BNQA 2ZX9A 4M43L 1RP8A 2VLJE 1BBJA 3N1GC 2B9AA 5DVPA 1JGVL 3NT0A 1TKWA 3K3QA 3WFDL 1JNNH 1NOLA 3Q6GL 4Y89A 1BW8A 2EE9A 4P5SA 3BPOC 1BXXA 2X4TB 4FMFA 4NQTA 1XZWA 3H55A 4AW4A 1YDPB 1XFPA 4U3XA 4I48A 5DO2C 3LYRA 3MHZA 1VDGA 3ZW3A 5EPMB 7PAZA 3O6LL 2WINB 4M9PA 4CSPA 5DJ0B 3WHXB 4N1HB 4MAYD 3HEIB 1I8UA 4TNFA 4Z7IA 3IGLA 1SJEB 5DJAA 2IPKB 1I9JL 2BC4B 5F0MB 3WDIA 3MNZB 4TVUA 4GINA 4YHYB 5DRZA 1FV1A 5JYLA 5CO1A 4DO6A 1IM9D 3V0WH 2VDMH 5CEYA 2CBQA 5JZ7C 1QFWM 4AITA 5FUZH 3WFHB 4Q8BA 1U3HD 4F58H 5CP3H 2OMZA 4KK9C 5ABAA 1BG9A 1UWEH 2ERJB 1OY3B 3LRGA 2A6IB 4IYKA 4MDJB 2EKJA 3CK0H 2Z31B 3LNFA 2FEEL 3QWQB 4K8RD 4FNSA 1PTZA 2AQSA 2E8ZA 2FWUA 2G2NA 3IFLL 4XAWL 3TEUA 4NWTL 5F6HI 1RLWA 3TASA 3T6QC 4R7NA 4RFEA 1F3JA 3IAQA 4XHJC 1UT9A 2APTA 1CU4H 5DEGB 1XGRA 4FD0A 1XGUB 3S3DB 1A5FH 2JCCE 3DX9B 4JO3H 3WTWA 1XGYL 1IAIM 1EJ6A 2JJUA 2DQMA 4JDTH 3FTWA 2Q6WB 3N3EA 3NA4A 1FF5A 4BHUA 2ZICA 2VXTL 1DVYA 4GAJL 5HXMA 1G6RL 4YSQA 3G5VA 3IJHB 2JKIS 2NW2A 4ODXB 2J8OA 4XNXL 4GW5B 1SYSB 3NBNA 3U48A 4AL8L 2PWEA 2XX1A 4A1RA 1GAFL 3BN9D 4J3BA 4KMTH 1MFMA 4ZMXA 5I8CB 2APWA 1FNGB 3GRWA 4MLIA 4EVNB 1N12A 4HUVA 3IXTB 1E3XA 2NY6B 4PBXA 4WZ9A 5EC2B 4HISA 2A6JA 4LFHG 2EDJA 2P52A 2Z7UA 4NJ9H 4MJ2A 3K8LA 2DQHL 3FT2A 2VDKH 3UZQB 2VE6A 4IBVA 3IXTA 3UYOD 3X14A 1X5GA 3ARXA 3IMVA 3L4VA 5AL0A 3MXVL 3OR6A 3QH3B 4OSUH 5DHVA 1EFXA 1DVFB 3OKEB 4GAYB 2X6UA 2V5SA 2VW7A 3UBFA 3US0A 5BXFB 2HFEA 2R0WH 2YRBA 4GW4B 4GRLB 5DA4A 4XGZB 2IBBA 3O6FC 3P4NB 4Q6YA 3MJWA 2D73A 4HETA 4JAMA 1TG8A 5ETUB 3UJJH 5C9JA 3U0WH 3F7YB 1YC7A 4JHUA 5FO8A 4PRID 2BJMH 3B9VA 3L48A 3KW7A 3AUWB 4D94A 3FOLA 1R3IH 1OAYL 4NNXA 3SQOH 4KJPD 3ME0B 1YJDC 2C3WA 4XGZA 3UJTL 4UTAA 3CFCL 1UD6A 5AALA 5D7LA 4JAMB 5C9JB 1QG3A 4LPVA 4H26B 4N2FA 2GSGB 4PJHE 4D3CL 4IU2B 1ASPA 2CUHA 2AVGA 3BP6B 3NN8B 1OP5K 3ULSB 5K9JH 1LYQA 3ARBD 4YS4A 1OAKL 5EV7A 3V0FA 5EIIA 5AW2B 3BJ91 4MZRA 2WAQA 1FJ1B 2F5BH 3RWEB 2DIEA 3T0XA 4J6RH 4EOWH 1VESA 2QSCH 2DBLH 4N0FB 3DJZA 1RP9A 5DO8A 3UAJD 2QHRH 4HK3J 1QNIA 4BFIB 3V9CA 3T8XA 4XMTA 3ULUL 2DI7A 4Z7NF 1IAKB 1PBYA 4KPHL 3J07A 3PJLA 2WJ7A 1L9SA 2QKIB 2VLJB 3IAGC 3HI1B 1OD7A 1FQ9C 1CLZH 1JV5A 2EIZB 3RWCB 4ZO6A 3BC9A 4YDNA 5BVPH 4K2UH 1A8JH 3CZKA 3L08A 3PUUA 3GBLA 4JFFD 4LHUB 4U6TA 1IGML 1U3NA 5CCJA 3OB8A 3QUKA 5C70A 1T4WA 3QBTB 4LSQH 4UQIM 1FORH 4FMKA 1OSEA 2AK4A 2VN5A 1MCWM 4WFHE 4PP1C 3ECBB 3QUZA 4HPYH 2YBRA 4Q97A 1AOZA 1MFAL 3D0VB 3NIFF 3ESPA 3GSXB 1FORL 3FU3A 1AZCA 1S9YA 5D8JH 2PR9A 4J6RL 2D7PA 4WSKA 4CILA 1IGFL 1QFUL 1TFHA 2OQJA 1X4YA 1OB0A 4PB9H 3IDMB 2ED6A 4R2GB 3R06A 3BDYH 3VXUA 1Y1DA 1DJYA 3MRJA 1OTUC 3CIQA 5F7FA 4X6BB 2OSWA 3Q0HA 3VA2C 1NFDA 1X7TA 2XJKA 2Z8WC 3BP7B 2VR4A 1P9MA 3B2VL 3P54A 5IW3A 3QG6A 1T04A 4KFZC 1MCFA 5CILL 3N41F 3ARFA 4LQFL 1NC2A 2WGXA 3O8XB 5F1NA 1RURH 2ADFH 1ZGLB 5IOPB 3G04B 2IOMA 3O4OB 3DOSA 6CGTA 3SKNB 1XGRB 1IE5A 4PB0L 1OB1B 2PTTA 4TNVK 4G8GE 1Y18A 3LPFA 3GHPA 3GB7A 3SBWC 4AXWA 5M7QA 5A3ID 1QABA 2IQAA 5GISL 3MRHB 5IFAH 4N9OB 1XCXA 4PLNC 5L6YL 5D1XD 2IPUG 2MNWA 3RVWC 5ERWA 3V2AR 2Z8RA 3WOVA 3B3IB 3GRWH 4AE1A 1AE6L 4WWKB 1TCRB 2EIEA 4U0RC 1Y18B 2XN1A 4AXWB 2ICEA 2DWEA 3U4BL 1K4DA 25C8H 3I2CH 3MRHA 3A6CL 4HGWB 5L2KD 4MD4A 4MJ6A 1KYDA 1QWNA 4A2DA 4TVPD 1I8KA 1KGXA 4FQJL 4G6ML 2WLYA 1ZD6A 5GRXG 2E27H 3CFJB 1SLWA 4Z7OF 5IJDC 3HRZC 4N8VG 2Y1ZA 4WQOA 3QDMA 4ONHA 2Z4TA 1WBXA 2V37A 5D93B 3TWCL 4PRDB 3OKDB 2PW1A 1Q72H 2EDFA 1BVKA 2EYSA 5GS1A 3T1FA 4I2XB 2PO6B 4LT7A 5EEWA 1MDAA 1NEZG 3CX2A 2XKUA 4F2FA 3F7VB 2FHBA 3MRPA 4K7PX 5DZNA 5J57B 4LARL 4YXLH 3A4DA 1EEQA 1ZTMA 1Q9KB 4KROD 2IPUK 3EO9H 2BFVH 3HR5A 5GRJH 4W6WB 4X8JA 4WFFE 4Z0BL 4Y9GA 3U6XA 2ZP0T 1INDH 4CC4C 1U8CA 3MDJA 3VTMA 4LLAA 4KKCD 1XBRA 4E5XG 3DETC 2XWJA 3SBPA 4BYHA 4F24A 3SHSA 5BS0A 5FO8B 1OW0C 1IQWL 1AC0A 2GJZA 4MXVE 2JIXA 4NM4H 4EIZC 4H13C 5CHNA 5D1XA 3NK4A 5I66A 4FNLL 3VFRA 3HOGA 4G7YL 1RIHH 4M1DH 4E9YA 3CSYA 4ODSH 5AKVA 5FO7A 1L3WA 3C2SA 4KXZI 4Y5VA 1TMCB 1P7KA 1TJHL 3ABKB 3B9DA 3WIFB 2ICEC 2X4OB 3C8DA 2QMJA 1MCHA 1NCWH 2GSGA 4NM4L 2ISDA 4UDUA 1YN7A 2X7LB 3E80A 2ZKWA 1FGNL 3DO3A 3T0EC 2A1WL 4DN3L 2CR0A 3FFOA 4PG2C 1J0YA 4RGMC 2W80C 4F7EA 3LQAL 4XMVA 2F8IA 2VRQA 5I8EB 3DVGB 5GGRY 1ZV2A 4Y19D 1A4AA 4PRNA 4PJEA 4WGWB 4OM1H 2Y72A 3GGWB 4ZNEA 1JK9B 1MHPH 3V5KA 4A68A 2X9XA 2WAHA 1ZT7A 2DQFB 2E6PA 4TNEA 1KCVH 3KYNB 2OMBA 5DJ2A 4L0ZA 4O58L 2AABL 4Y88A 3WAKA 2DDQH 3TBWA 5F7DB 1RFDL 1QLFA 1HNGA 2AK4D 5JHLH 4M7LH 1QLRA 5LBSL 3S37H 2ZX6A 1DLFL 3V52L 4BSJA 4ZMYA 2YKLH 1BVNP 3ARFC 2EDKA 3U4EB 1UD5A 3NFPB 3EH1A 1LXMA 1JWUB 3RIKA 1X9LA 3FFDA 1Y1UA 1BAFL 3X12B 4QJ5B 5CCKH 3VFTA 4NPKA 4NPYB 2ITFA 3LRLA 4RSYA 1OSZA 4F58L 2VR3A 3CFBA 4BZ2H 1NINA 2H8PA 2JVUA 4FFYA 1IE4A 3A21A 4GP5B 4ZS6C 3W0WB 4GS7B 1NOAA 1TZIB 5DK3A 2FLMA 4A2LA 5I17A 4OVVA 2CMRH 4ZZKA 3AREB 4GKLA 4OZGE 2EIZA 3O6ML 3ZE2B 5A2LH 3HA0A 3SJVA 2QMKA 5JIQA 5EBGA 1DQLH 3OBAA 1DBBL 4QRTB 4DK6A 2YR3A 5BXFA 1HS6A 1TJMA 4R7VA 3ZLQC 5D1ZC 1RSYA 1E6JH 5E8NA 2C3VB 1A6PA 1Q9OB 2BSED 2GJ6B 4U4IA 4NENB 2YJLA 1SHXA 2Y9RT 2JJSC 4BFNA 1J8HD 3MV7B 4WI9A 4JPSA 3HNVH 3TBBA 2HKHH 3AU1A 3VSTA 5CD3B 1TPXC 2NY7L 1RMFL 2GK0B 3FCBA 2ZWKA 3H2QA 1NPUA 3L3IA 4GY4A 4HHWA 4BFKA 4X5LA 2Y22A 4TOYL 1QKZH 4M6ML 4MCMA 1TT6A 4ODHL 5IQNA 4AIXA 1SN0A 2GJ6A 3MMEB 2AV1A 4AGPA 2X42A 4LIQH 4IKKA 5C0ND 3B9KB 4M62L 3ZDZB 2DWDA 2VZSA 1BMWA 3CIAA 5F89A 1KPRA 1IEAB 3BCFA 5ESAB 4AE0A 5D7JB 4QRRA 4IRZA 3DPDA 5F7EH 2UZYA 3KW8A 3LSOB 1HT6A 1RUKH 2CGZA 2WXNA 3D7PA 3PDOB 5CEXA 2IFGA 3ULUF 1Y7VA 3EJQA 1MIML 2ZYIA 5IZ7A 2XVKA 4I2XE 2BMKA 1TSRA 4R2GC 3CDFA 4UAHA 4UAOC 4JPWL 1AAJA 1ZLWH 5A1AA 2YGVA 3K1DA 1OV8A 4FJYA 5I6OA 4YFLI 1J7VR 4K8RH 5B4MC 3DX6A 2QDVA 3TJEL 5KVGH 3FQUA 4R3SB 5EUKA 2GJRA 3ZHLA 4XXDB 5FHAL 1S7VA 1XCQB 1ILSA 2FGZA 1FNEA 4V1DE 2AXFA 3UMTA 3QJHB 4P4KB 3WNJA 1TNNA 4WWKA 1ED3A 2OTPA 3V4LA 2KUTA 1IC4L 2H3KA 5L9DH 1MFUA 3T6XA 1A7NL 4IOSA 4AMXA 1MW0A 2R2BB 4DPRA 3N9GH 5BZXA 2W60A 2VIRB 1CL7L 1D5XB 3QR2A 4P2AA 4PLKD 5D9SA 4JFDE 4JHAH 1X9QA 3SZKC 5DYOB 3CFTA 3GSRB 4JM2B 4R2GD 4HS6A 2W88A 1M05B 4S1SL 3RWDA 5C86A 5JQ6H 5DMIL 1OAZL 4PRDA 3E6HA 2YUVA 5DS8B 3HE7B 4D9RD 1N0XH 3UG3A 4N6RA 2DKUA 1A6UH 2Z35A 3HB3D 4YSPA 3WKMH 4DEUA 5KVEL 3U83A 5KYUB 4JM2A 4QWWD 4PJ8C 4URTB 2IFFH 4OIAA 2H1XA 3V95A 4FA7B 3ZE0B 7FABL 2I9TB 1URIA 3VDBA 1UD4A 2Q76B 4HIIB 2NZ9D 3IDNB 4JN1H 2R69H 1A9BA 3SQBA 4YLBA 4NHCH 5D1QE 2QVMA 2J1WA 2X0VA 4OGXH 1AGFA 5JOPD 3RVUD 4TMPA 4KJYA 3IGAA 5HGAB 1MPAH 2EIJB 5EBLA 4Y5YB 2ZWLT 2APFA 1UATA 1A65A 3IKCA 4FNRA 4TSBH 3VCLA 4ODTH 4AEEA 4MQTB 4BUHA 4L37B 1J9RA 1NIFA 4YX2L 3VI3B 5E2UL 1JFQH 5CINL 5JHLA 3HMXL 3I9AA 5C0FA 5IKCA 4G1EB 3CC5B 5ITFB 1S9XA 5HHMB 3W3BA 1XEUA 3VB8A 4BKLB 4EN3A 1W0VB 1JTOA 5CP7B 1VSCA 1OLZA 4GAGL 4BSVA 2ZCZA 4MJJA 4OCSH 4FA8A 4NAQA 3GMPB 1HTYA 2BSSA 5EO9B 1T22B 1RI8A 4MAYA 1DQMH 5DTFB 1A2YA 3F6LA 5JHAA 2ICWI 2CIIA 1IQDB 3PGCB 5T8IA 3A6BH 1X4ZA 5DJXB 5GHWL 5LKNA 1M1SA 3MUUA 5M94B 3TCLA 1T2QH 5IHZA 5INDB 1Z9PA 3QEHA 1JDCA 3QPXL 2GB2A 4Y19A 1N2RB 1PZ5B 1HXMA 2NNCA 2WLIB 4JBSA 3GSQA 1KJ2L 4ETYA 1JPSL 1RVFL 5A7EA 1KJ3H 3QDJA 1TPXB 2JKTM 2EO9A 5HD8D 2AEPL 4BFIA 5FA3A 3VD1A 1L3NA 4JO3L 3HC3H 4I0PC 1TVBB 2WBJC 3MV9A 2R2HA 1U8CB 3PP3K 4XX5A 1CGVA 4LSPH 4Y2DD 3MV7A 5I1IH 5EC2A 2BW4A 4QRRD 4GYBA 5I75B 4FX5A 1I4FB 5IV2B 2F54E 1D5MB 2L3BA 2A9AA 1EZSA 2ADJB 2I25N 3H54A 4YDLB 2DYSB 3CUPB 3K72A 2OMYA 1W6WA 4JDVA 4GS7C 5JQIB 1SY6H 1G43A 2WQSA 5E1GA 1LJMA 3IRPX 1UXMA 2ZTBA 2X4UB 3EGXA 3KPPB 4CBPA 1XT5A 3D06A 3HNSL 4WO4B 4DP9X 4MYWB 3UYPB 1EFXB 3OKEA 1IEAA 1VFAB 1D5MA 1BLNB 4WJKB 1CWVA 4P2QB 4B50A 4JPIA 5KSBF 3H0TA 4P2OB 5AOMA 4CA4A 3CVHA 3EJSA 4LVNB 5LCVA 2GFBB 3D1MC 3MA9H 2UZXA 8FABA 3PPSA 4HT1L 3B6SA 3MRFB 1PMYA 1KLUB 4OZHF 4FJZA 4DSYA 2XWBB 2HWZH 4X4ZA 1NMBL 3ULVL 3KPMA 3WKPA 3FXIC 4P2QA 3K0YA 2ZKHH 4X7CC 5T1LA 1XIWB 4L29B 3GM8A 1FE8L 3L4TA 3NPSB 5CEXB 5D7SL 4OTXH 2Y7NA 3PHSA 1IFGA 1ZLVK 3P9LA 3IU3B 2X53A 5DSCA 5I2IB 4PP1D 1E4KC 1A6TB 1TU2A 2IVFC 4N8CL 3FSVA 2YQBA 1VADB 3BUPA 5HVHB 2NY0C 3L7EA 3GB7B 2PN5A 4OM0H 4NKDA 2NLJA 1MH5B 4YVNA 1FN4A 4GMTL 4Y1SA 1DFXA 4M43H 3E8UH 3MFFB 3NZSA 2PCPA 5KSAC 1R17A 2UY6A 3F2LA 1SUJA 2X2HA 1CI3M 2A83A 4B9IA 1I1FA 2WO4A 1FHGA 2HUHA 4P9ML 3OJMB 4JVPA 5B3JE 2JELL 2JELH 5C0IB 3MLXH 4BINA 2DWTA 5I16A 1PNCA 1CDBA 4PJGF 2GYSA 4E2OA 4GG8B 1WV7T 4IJ3B 5TH2A 2CDFB 1PEZA 3IB4A 2Q7YA 2OBGA 2E46A 3OHXB 1T80A 5CFHA 2WXHA 2UUDK 3WYRA 3ASOB 3LX9A 1IAKA 3FQWA 3MLXL 2I9TA 5I1JL 4PJ7A 1AFVH 4HXAL 12E8L 1GZQB 2G0LA 2R1XB 4HF5H 1ZLUK 4AQOA 3MRQA 5GPRA 1GXEA 4N2KA 2QT6A 4M5TA 3PWJA 2P24B 3SIKA 3X11A 3LMJL 4LQ1A 5K39B 2W0KA 3GMMB 1HE8A 3IGAB 2XKSA 1EXUA 4WV1A 4YAQA 2FQGA 1YY9D 1SGKA 5JXEA 5HVWA 3AGVA 3BT2L 4ODWA 3FRUA 2GI7A 4IBYA 4KHXH 1FC1A 1PL3A 2FX9L 5D7LE 2XETA 4MQXD 3KPNA 1KPRB 1AYRA 1LWJA 3GJEB 3ZL4H 3RWFB 3S3SA 2AJYH 1ZLUH 4EUPH 5D1XB 2VQ1A 5FCUL 5I66B 4KQ0A 2NX5A 4BFOA 5J3HD 1UFGA 3BVVA 4YZFE 4APXB 2GSIB 3WGVB 4DESA 2A0LC 3RUGF 4HUUB 2FYYA 2WWMD 3KGRA 1XTLA 3MJ9H 4U7KA 4UDTB 3VSUA 3KLKA 3RUGB 1F3RB 3NCEB 3VRIB 4DOHB 4B41A 4PRHD 1WWBX 3INUH 1T22A 2AXGB 1I8AA 5F3HA 3N06B 5CEZL 1PX3A 3Q13A 4K3JL 2VLMD 4PUBL 1X6LA 1TZ8A 5E2TL 5MEQB 4Y4FB 1JZGA 1XCTB 3RTQC 4PTTB 1JXJA 4DW2L 3X1GA 2XJLA 1FH2A 4TQEH 1B2YA 3PABA 2WXFA 3RHWK 3B5HA 4G80B 1U3YA 2WZ6A 2YRLA 2WXGA 3MLUL 3UBXI 1NCCH 1YY9C 3MRRA 1QLEH 5CGYD 3QARA 3WNPA 4CN1A 3WMQA 2Z4QB 5ESVA 1CU4L 1WZLA 2MCAA 4NOBA 4CMHB 3SYAA 3ESUF 5BV7B 4AQ1B 1JUFA 2A74B 1XX9C 3A6BL 3KYKH 4JRYB 1J1XH 5GHWH 3UADA 2IDSA 3NFPA 4Z23A 4QAWA 3TYFA 3MJ9L 5CS7A 1CCZA 3FB5B 3MBED 4A38A 2HRPL 3UBXA 1NANI 1HHKA 4I77L 2BSTA 4JHVA 4NO3B 3VMOA 1U8HA 2FT6A 1LK3H 3VW3H 2ATKA 2JV6A 1NCJA 3ZKNC 1QFOA 1A7OH 3B7YA 3QFJE 2OMYB 1TZIA 2TSAA 1J0HA 3NCYS 3LIZL 5CMAA 4OCMC 2YQ2A 2VR8A 1LO4L 1IARB 1SYVB 3SE9L 1XGTA 1J10A 1H5BC 1GC1H 2VXQL 4GXVH 3SBWA 1HKFA 4MCZA 3H0TB 3BJLA 1JRHI 4FQ2L 4M7JH 3EADA 4HOZA 5JPNB 3MNWB 3G5YB 1WZ1L 3FTXA 4NENA 5E56A 3FU8A 2ZAHA 2CR3A 3DWTA 1MW1A 3BQUC 4PW4A 3B2MA 2NY0B 4ZTOL 3ZT7A 5FDWB 2BOBA 3IJ8A 4O00A 3FK3A 1ET7A 4KBPA 3BP6A 2Y5EA 1W72H 1CDUA 1UZ6F 4Q4EA 1MI5A 1KIRB 3C60B 1A4BA 3MX0A 1ZDQA 3FQNB 3KL5A 5CN3A 3GZOA 5JDJA 4NUMA 1S3KL 3EO0A 1PW3A 1YUHB 2BIIA 2GY7B 1NSNL 4WFHD 2DZEA 1PLBA 4AQAB 1CXLA 4PG9B 1NAKL 3VQMA 2XNAB 1K2DB 2OJZH 3ASNB 2EUXA 1A6UL 5F97E 4RGOH 4NZTH 4JM0A 5JA8B 4LOFA 2JQAA 1JYVA 5KOVC 1CGSH 2YA1A 4KNUA 4WHDA 1H6TA 4Z5RB 4ZOAA 2FJGA 5IQLA 1ZE3H 1IVTA 2CK0L 4WW1A 3FS9A 1G9EA 3BGMA 1MCPL 1M57B 5HGDB 1WBZA 2X1QA 5LG1A 3DSFH 3MBXL 4YHYC 5B8CC 5AFAA 1AJ7L 1I8LA 1OP4A 2NTSP 4N22A 4QHNA 2P44B 3AJ7A 1RZJC 1RPUA 4UV7L 32C2B 4YHIB 2WSKA 1HSBA 4RISH 3FT3A 3C9NA 3NQKA 2B0SL 2LTQC 3O9WB 4UUJB 3P73B 1C5BL 5AW5B 4WHTB 2K78A 4FXKC 3SKOA 4BSWB 4OT1L 3U0TA 4WY7L 2FBRA 2XZAH 1YNKH 1XDTT 4WIQA 1L0PA 4AYBA 4A67A 3LN4B 2OTWB 4HH9A 2V6HA 5B4MD 1D7FA 1BDYA 1CK0H 2CPCA 3WI9A 4AZUA 2E47A 1A7RH 2XQ0A 4NYLA 2JKXA 2NY2C 3ZKMC 1FL3B 1BQ5A 2OKMA 1DBJH 1EO8L 1VGKB 4XXWC 2C3GA 4FQ1H 1O9WA 3RGHA 3VXRA 2JB6B 4UZSA 2VISA 4W4OC 5KBDA 2DI8A 4K8RL 4KMQA 3QZLA 3VWKD 1USQA 2ZCLL 4Z7QE 1N6UA 2L4OA 3TIDA 1F6AA 4K5MA 1UJ3B 2BC4A 2H0PA 4TOYH 3GXMA 4YDJB 3HJ0A 5K5YA 3UG4A 2EEAA 2NZ1A 4OZFA 4CMHC 5JW5B 3QZWA 4KJYB 3FCTB 8CGTA 4AEHH 1R3LB 5F7EL 3GD1C 5SWZB 4BWUA 2JTYA 2O5XH 2BNQD 4CKVX 3DXAA 4HSCX 3W9DB 2J4WH 3QQDB 4L4TA 3B9KC 2UWEA 3JZ7A 3KPOB 4N8VB 5I1DA 4WI4A 1O5DT 1FVCB 2Y7MA 4QRAA 2I32A 4K9EC 4X99B 5L8LB 4PJBA 3VD0A 4JFEA 4GG6A 1ZOXA 3FCTA 4UQ3A 3UDWC 2W9LA 2V3EA 3EHBB 2HX9A 3GT6A 2CPUA 5EOQL 4YHLH 3ROLB 2NY7H 4Z9KB 4NC2B 2HJLA 4G6KH 3NACL 5MEND 4R4BA 3SBQA 2A4EA 1BQLL 2XWRA 2XVLA 2DYPB 1BM3L 5E99L 3SDDA 4P3DB 4UQ3B 2HRGA 1W72B 1F41A 2B1AL 4PWGA 1SYSA 4AENB 3RFZA 2CUIA 2YBGA 2WWOA 1U6AH 5EO0B 3MV01 1TIUA 5D1ZB 3FAWA 4OLXL 1HC1A 4NO2B 4WUKH 5EZIL 1M56B 3SEPA 2HVJA 1JIBA 4Y4FC 2F1BA 1CE6B 2X40A 2XDHA 1FFNA 1S9VB 4MNGA 4N28A 4TQ8A 1U2HA 5I1CL 2IIJA 1CLYH 3ET9F 4NAMA 1NMCB 4HIHA 1Z9SA 4GBXB 4JFTA 2YPLB 3W1ZA 4WWPA 3PWJB 4TSBL 1N64L 3BUYB 2DM3A 5ADPL 2CXGA 1EJOL 4AI7A 3MTRA 1BGXL 1BVNT 3ES6B 5K39A 4E9SA 3EDDA 4MMXA 4XX1E 3TO2A 5BOZG 3D05A 1R34A 1P1ZB 4NM8H 2PTVA 1NFAA 2FJHA 2VH5H 4GT0A 5D1QC 3KZ8A 2ZSVA 1FVDB 2K4AA 3GRBA 2GBAA 2R1WA 4JR9L 4X8XA 4Y4HC 4J1UA 3TT3H 5TTRA 5CP3A 4OF0A 4U4BA 4PJAF 3CDZB 1EERB 4JN1L 3OWEA 5AZUA 2H26B 2D7TH 4JO4H 3X1FA 5LNGA 4RMTA 2OULB 3ZE2E 1TJHH 4RETB 2YPVH 3ME0A 4WUUB 2IFFL 3H9SA 5E6SB 1JGUH 4PRAA 4YR6B 1TOXA 1DLHA 4ZMWA 3WKML 5D1ZD 1NPNA 2N59A 3FT9A 1XAKA 3MJ8B 4PLJD 3STZB 5I8EA 5D96C 1YYCA 2FGWL 1TXKA 4OLYL 4OZHA 1VEOA 4XVJL 1KYAA 1DO6A 2HVBA 2WZ0A 2W0FA 4HWZA 4G7QB 3O3BA 2WQAA 4BKSC 2B9BA 3LXCA 3W11C 2BOLA 1KIRA 1DUYA 4ZZFA 3O6FB 3UO1H 1ZTXL 4J3XA 2K3HA 3GHBL 3OGCB 4LSTL 2BWQA 4QJ3B 3SDDC 5KBKA 2VDNH 5F7DA 4G80A 4MAZA 4OF6A 5C0NC 5AAMA 5JDSB 3MCLL 3TZVD 3WG7B 4OBSA 4HAGA 3LZPA 5C0DA 3BPLC 4WNSA 4OGYH 4OI7A 4K94C 2RIKA 3O4LD 5JHDD 2YD3A 4PWHA 3QRGL 5HDOA 1Z5LB 1U92B 4KNSA 1A14H 3D25A 1EGJA 4LAQH 3DV6A 4RQQB 4XPHL 4QHNB 4MXWH 3RWEA 4FRWA 5IMOB 1U8IB 3MRMA 3D6GA 2MJWA 3MFFA 5ISZA 1M2OA 4LCIH 3LH2H 3MLSL 3CXHJ 4FQCH 4Y2DB 1I3GH 1JV5B 2VDQH 3ECVA 3RL2A 3HB3B 3VI3F 5HPMB 1EJ8A 1WCQA 3H2PA 2JQZA 2I5YL 2HTKD 3F7KA 3LZOA 1U8HB 4H0GA 4OIFA 3MR9A 5CGTA 4DGIH 2JCCA 2J3SA 3QXDA 2AAAA 5DD0L 4CSSA 3PHOA 4LPUA 3C12A 1HAWA 3TX4A 2VW6A 2AS5M 1HZHH 4YN3A 3RVUC 3UG5A 3QO1A 3FRPG 1D5BB 1GZHC 4F57H 1UENA 3HG1D 2VLKD 3BAJA 2X2YA 2B1AH 2LW3A 3BSZA 4HXBL 2Y6SD 1N5YL 1R5VB 2AP2A 2P48B 3O6FD 5JO5B 5LVEA 3CZFB 4FULA 4QDGA 3UXFA 1EHLH 4OFVA 3VYNA 4N9GB 3JV0A 4PVMA 3UAAA 3R8QA 4MWFB 4NRXA 5AB0A 5TQ0L 3CZUB 2XX0A 2DQDL 4H8VA 4A7SA 2CLZB 5GISH 5D4HA 3W5MA 2PPAA 1TZAA 2BNRE 2Z93A 5B1JC 1TQBB 2BINA 4PJGE 1GHFL 3DX1A 2JWYA 1QOKA 4G71B 1KCRH 1OKEA 1JZIA 2C34A 1G5GA 5DRZB 5DRNA 5G55A 5J1TC 1H3VA 1KFAL 4FQXD 4MA8H 2BNRA 2Q86A 4PG9A 2HJKA 2K7PA 1BMGA 4JFXA 1QRNB 1R5WB 2F7OA 4HHAB 4PJCE 2R27A 3NQIA 2KHAA 3L5HA 4HCRH 5DGRA 5LG6A 4JO1L 3RA7H 3N43B 3D39E 3L3OB 4HLJA 5DWUH 5FM5O 2V2XB 4FQLL 2GIXA 3CQQA 2H41A 4XVUD 3EYUL 2IADA 1U0QA 3FQ1A 3QJQB 4Y4HB 4EIBA 4FTVE 3EDJA 1GH7A 4YVUA 2OM5A 5I30L 1KB5H 2F7QA 1UOWA 4D2NA 2MWCA 1BJ8A 3Q8CA 2W5PA 3B3BA 3RJDA 4Q9QL 1N6QL 1RZIB 3NAAH 1HSBB 4HGWA 4G42A 3ATFA 5FK9A 4M6NH 1QX1A 3MJ9A 2BNUB 5KVFL 1VKXA 1F4WL 2WQRA 2Z4QA 5TPWH 3FFCA 3MV11 3UCRA 1F1DA 5C07D 1J5HA 3OPUA 4OB5H 1CE6A 1L7TL 4P99A 4Z7QB 3PWPB 3CXHK 5DRXA 3S48A 4D9QD 3T1WA 4FYSA 4L9LC 4KVCL 3F85A 3FUDA 3TYFB 1HAUA 1MRDH 2Z91A 4RGMB 3V4PA 3WIHL 4BV1A 4XXCA 4M8QB 3N42F 4GLRI 3T2LA 2GJZB 1MFEH 4Q56A 5F44A 5IBTH 3SCMB 3TA3D 2CK0H 4EOWL 4F8QA 1B4JL 2NNFA 2JLLA 4TLSA 4AMKL 4YHKH 4HSAC 4MQ7B 3H9SB 2BDNH 4X6FB 1E5CA 3LEYH 4JUSA 3K8MA 3ZDYE 3MJ8A 3U82B 4XVTH 2H2PC 5HDLA 3CDZA 4H8WL 2BJML 2VTFA 4BFGA 2ITCB 1GGIH 3ZE1B 1QWHA 1YZZA 4N2GA 5C0FB 4PI0A 5IKCB 3DXAB 3VXMD 2EVFA 3M17A 3TYGH 2P4AB 4NC1C 2NY3C 4PV9A 5DQ9A 4HKJA 5LGYA 4RWYL 2C1PA 3RKDC 3C2AL 1W72L 3V10A 2OP4H 3OQRA 3WIHA 1WRFA 4LCCB 5F93C 4LLWB 1B0RB 1URZA 1ETB1 2FATH 2OMTA 2Y2YA 4XO5A 3TBTB 4X9BA 4N85A 4HUUA 5KVDH 5FGCE 2OMXA 1AZBA 3KNBA 2QPUA 3QEGH 3RUGA 3UIZA 1RSFA 1QUNA 1OAJA 2PYFB 1YEHL 1CB4A 2DJSA 1GGIL 5KYXB 4ABUA 5FKPB 2VDRH 1JTPA 1HXMB 1AZVA 4U1HA 5BZWA 3B7TA 4NKIH 3L17A 3APDA 2A9BA