2VUKA

Structure of the p53 core domain mutant y220c bound to the stabilizing small-molecule drug phikan083
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Targeted Rescue of a Destabilized Mutant of P53 by an in Silico Screened Drug.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vukA00
4L0YA 2IOMA 2XWRA 3D08A 3D05A 3Q01A 4AGLA 1H9DA 2OCJA 2X0UA 5AOJA 4LOFA 1TSRA 4AGPA 4G83A 1IO4C 2H1LM 3EXJA 4QO1B 1GZHA 1E50A 4IBVA 5G4NA 3WTVA 3US1A 1EANA 5LAPA 2ATAA 2BINA 2BIQA 4LOEA 3IGLA 1GZHC 1HJCA 4L0ZA 1HU8A 3QYMA 2ADYA 5BUAA 3WTTA 2FEJA 2PCXA 4MZIA 3TS8A 2X0WA 3D07A 5ECGA 3QYNA 5KBDA 2MEJB 3WTXA 3VD1A 2RMNA 2X0VA 1YCSA 5LGYA 3WU1A 2AHIA 5A7BA 2J1YA 2BIPA 3WTUA 2J1ZA 4GUOA 5AB9A 3Q05A 2AC0A 2J6WA 1HJBC 4AGNA 4HJEA 5AOKA 3WTYA 4G82A 2VUKA 3WTSA 4XR8C 4AGOA 4KVPA 3IGKA 1T4WA 5AOLA 1EAQA 3KZ8A 5G4MA 4AGMA 5AOMA 5ABAA 2J20A 2IOIA 2XWCA 4GUQA 1EAOA 2WGXA 2J1WA 4IBZA 5G4OA 2BIMA 3D06A 3D0AA 2J21A 3D09A 3KMDA 5AOIA 2BIOA 3ZMEA 4IBTA 2YBGA 1LJMA 2IOOA 3EXLA 4A63A 2J1XA 4IJTA 3WTWA 1CMOA 4L18A 3Q06A 3US0A 4IBQA 4AGQA 4IBSA 1CO1A 4IBYA 4IBUA 2P52A 4LO9A 3VD2A 4MZRA 1KZYA 1TUPA 4IBWA 3VD0A 2GEQA 1UOLA
chains in the Genus database with same CATH superfamily
4HEMA 4JRYA 3MLRH 1FRGH 2UX6A 4PBVC 4R84A 3SPVB 2AJYH 4KO5A 3GXNA 3CC1A 4MB5A 5EIIG 3I3EA 1UJTA 1JE6A 2P5EA 4G6FD 3P77B 4F8OA 1PZ3A 1BCIA 3QNZA 3CZUB 1AC6A 3O8XC 2BIHA 1O9WA 1FV1A 3QCTL 4KDTC 4XWOC 2HPTA 1X5LA 3V6ZA 2A1WL 2J56A 2ZG2A 3GO1L 3WO3B 3AJ7A 3Q1SH 5C08B 5ADPH 3T0VA 5F1SA 1X7QA 3KR3L 3CC5B 5DZNA 1OSZA 1GC1H 1T7WA 4TUKH 4J1UB 4WHYH 2YZ1A 4A68A 2C3HA 3DNKA 3FU3A 3D3VD 3F05A 3CXFA 4L9DA 3EDJA 1G6VK 4BK5C 3D25B 2E59A 4HETA 2N3JA 4S2SA 5L88H 5EEZA 1WZMA 1QSVA 1JNLL 1WQVT 3HZKA 1ZV9A 4GH7B 2GJZA 3MHZA 1L6PA 2R8SH 2I9LA 3DX3A 3SDAA 1WUZA 3FQNB 4PD4J 3DK0A 2BY0A 3TO2A 3NH7H 1QFUL 3O6MH 4FX5A 4YSSA 3AREA 4UM9D 3K4AA 4MQSB 1YEFH 2YD6A 1ND0B 1LK2A 1EGJH 1FZOB 1OP5K 3T9WA 3WIIL 1KIQB 2APXA 4KRPD 1KT2B 1NEUA 5FUOH 3CDZA 2APBA 3L3KA 4QHUA 2PW1A 3IGKA 4GAGH 2ZZUT 3QZNA 1ORQA 5DEZA 5HDBF 2XQBH 2PYFA 3W5MA 2AZAA 4GXVL 1B0WA 4JPKL 4Y5VB 4AYFB 3QISA 1CE6B 4LLMA 3AABA 2ZX9A 2BHFA 1MI5D 3ZX1A 4GUQA 3CPUA 2DLHA 32C2A 4K7PL 4ZO9A 3NIGE 3IB4A 4WI3A 4LVHB 1BPVA 3IXTB 4Y16B 4K94H 4FFVD 1FUNA 2CK0H 3FXIC 4W9FC 4FFZL 5DEGB 4XRCA 4U2YA 2EE6A 1EFXA 2H0PA 3LVEA 3ZTJG 1LO3H 5HJ3A 1ASPA 1E5CA 3P9WB 3Q2NA 3PDOB 4NQEE 4RMWA 3KWXA 3PHQA 5LQBH 1IC5L 4O2CB 2V2XA 5T5FL 4O58L 1NCWL 1UZGA 3K5SA 3WO4C 2BVQA 3TU6A 4NT6A 5DJZA 3CZFA 1XB6A 4XVOA 4DCQB 3N1QC 1JPFA 4HMEA 4E5XA 5TDPB 1ZE3C 3MRCB 2BZCA 3T2PA 1UYWH 3CZNA 4MXWL 2ICEB 1XGQB 1GIGH 1LP9E 2G9KA 3ZUNC 3RIFK 2ATPA 2XACC 3OZLA 5D2LE 2LABA 4GSQA 3D3VA 3O2WL 3PXHA 4IOFC 1UA7A 2COVD 4U6TA 4DN3L 2GSMB 1CL7L 4JKPL 3S8FB 4P23D 4OD3L 1VGKB 2VLJB 3QEQE 5BQ7B 5DK2B 2Y1AA 3RHWF 3E6HB 4GNKB 5GGSY 5MEND 1U0QA 3FU0A 3QWRA 4WV1C 4G9DA 4J6IA 3DUUA 4WU7B 1L7TH 4MZ3A 2HFEA 4PJAE 2DIJA 3DDGA 4UM9A 4X99A 4AQAB 2ZUTA 1TJXA 1QSFD 3EF7A 1G1YA 5E99H 5CR1A 4RGNC 4Z7WA 2X53A 4XBMA 4HWUA 3TYFB 2ZYRA 5FDYA 3AT9A 3I84A 5GGRY 1CLOL 4L8CB 5MP6H 3MQIA 5EC1A 4D8OA 1T80A 2CJSA 2MQ3A 2ALAA 3SN6N 3SQOH 1TZHB 1IGMH 4JANB 2B0SL 5GGSA 4AT6B 3HE7D 1SHSA 3S35X 3GSOA 3L13A 4HIEA 4M3KB 2DBLL 2VABB 5IM7B 3NZ8B 5PCYA 3UTOA 2WYHA 5IW6A 3AUVA 5ILTH 3MBXH 2R2EA 5T3XL 4HF5H 4AVJA 2PPAA 1AZCA 4JDZB 2FZ3B 2C3VA 2VLKE 5IOPB 1E28A 4OM0H 4YO0A 1KLGB 2ITCA 4G7YH 3S2CA 2IDFA 3DSNA 2DM2A 3VFMB 4DKTA 3C8KA 2R1YB 4Z7VF 3QWOB 1QZNA 3SE8H 1TZ8A 1ZV5A 1NAMA 3CVHA 2ICWA 3JV4A 2ESVD 4TL5A 1N6QH 3TONA 4AL8H 4H2CA 1F11B 1B0GA 3MRMB 3ILQD 4IBZA 2OR7A 2CLVB 3FN0H 3BFQG 4PY8J 4JGJA 4LIQH 2ZSVA 2ORBL 2IANA 3UTTD 5C3LD 4HCRH 2LTQB 3TJHC 1ODAA 4PJCF 5LDUA 5HHOE 4QHPA 2G0LA 3AACA 1PEWA 4ES9A 3N1GC 3P9LA 4QPEA 3MLXL 5E00B 4PJ9D 2PNDA 4YR6B 1BX2A 3ELAT 1GGBL 5SWZE 1X7TA 5GSVA 3VXUD 3G6DH 1F3JA 4BFOA 2NY5C 3VFVB 3EYOB 2BSBA 5MENA 2NXYD 4RQQB 1CE1H 4E41B 1UFGA 5CXPA 1GGIL 4IBUA 4L8DB 5BZWB 1VIWA 2WNKA 2HTLD 5JIQA 1BYOA 1QSFA 2YXMA 3LEYL 1B6UA 2XHNA 4HXAH 4Y4FB 3RTQA 4LCVA 5FUZH 4OZIA 2VO5A 5E03A 1FBIL 2BDNL 1QYGH 4FABH 3WNNA 4NM4H 1OAQL 5E8NA 4P04A 1KC5L 1KEMH 3CN0A 1U3HB 1WA1X 2CZNA 2A9AA 5DUPH 5DQDH 3UTZA 3W9DB 2FX8L 4KBPA 4LCIL 4ANVA 5EPMA 3IRZA 3RKDC 4LOUC 1YJDL 1WC7B 3HE7A 5DFAA 3F7YB 4Z0XA 1T83A 3ECBA 4YLBA 2XIIA 3DA0A 1JAEA 1EANA 2OMUA 1XF5B 3QDAA 4MXVE 5HVHC 2OA9A 1NDMA 1MLCA 5CUSL 5E6IB 1PKQE 4TUKL 3RL1B 1KIUB 4PCSA 4DO6A 1P1ZA 1NCIA 1A0QL 3D50A 3MZGB 1S7VA 3BVUA 4X7SH 1ZA3B 3KPOA 4QYOA 3PDGA 3ABMB 1ADQL 3EDKA 3BSZL 2N0KA 3IT8D 5ID1B 1MVUA 1CJYA 5TE4L 1T0NB 1NC4B 3QYNA 2GTQA 5AALA 4G9FD 4YNYA 3WS6C 2CO7A 4QCIB 3VCLA 4KX7A 1OV8A 1AGBA 2X4QA 3H6JA 1M2VA 2WINB 3ARZA 2W88A 1N59B 1BV8A 3QHTC 3QPKA 4FJZA 1HH9B 4HJGB 4NWTH 3FO1B 1ZTXL 4P0DA 3LTVA 5JIIA 4AE0A 1IIKA 3VFPA 5FUOL 3L3JA 4Y2DB 3TBSA 3T08A 3BIAX 4GAGL 2PTUA 1IAKB 2RD0A 1B3JA 2ODHA 2QMJA 3QE5A 5CJOH 3VXUA 1FLTX 1G7IB 1I7ZA 3IKKA 5CSBA 3ZRFC 2PLTA 3F85A 1AZRA 3WBDA 2CO6A 4FG0A 3NBNA 3MGTB 3Q1EA 1YZZA 3BO8A 4JFWA 3QDJD 4HV8B 4WVRA 2QGBA 3QZWB 1A21A 4WTZA 4LARH 1QEXA 1CFMA 5CZXD 2OR9H 2B4CL 3HI1B 1Q9LB 2JE8A 1PZUB 2EIZA 2J4WL 4D3CH 3C2AL 3RPBA 3DROA 2WWKT 2CGRH 3AXHA 5AW8B 3HPJA 3JYBA 3NZUA 1TPXC 2B7DT 4HT1L 4IJ3B 3ZR6A 3QXVA 4KKRA 1O6SA 3FT4B 1JL8A 4S10A 4AITA 4BK4A 1UJ3C 5D7HA 3K1DA 1KWKA 4RFNC 3FQXB 4EN2A 4HPOL 1IGFL 2GUOA 2OMVA 3ARRA 3UYRL 3LNFA 4OAWB 3RWJA 1ZT4A 3DTUB 4NRYA 4LSUH 4NQVA 3D39D 3GHEH 4N22A 5D7KD 5T1LA 3L45A 1ZLSL 1TQWA 3RZCB 4GRWE 2YD0A 3HZVB 1KJMB 5IQ7L 5J6HA 2NR6C 2E27L 4G9FA 4GT0A 5CILH 1OLLA 4AGPA 1YSOA 5TF1L 5D1XE 4X6DF 1HSAA 4JBSA 4P5KB 4MYWB 2P8PA 1HCVA 2RCSH 3MNVA 2BSSA 4FCHA 4LXFA 4R7NB 2Y7NA 4PGEA 1QHOA 4OV5A 4QT5B 2EYTA 2BSED 3Q48A 5AG9A 5L8JB 3S3JA 3WFDL 3QP3A 2E8ZA 1LTXA 4N9OB 1QLFA 4W68A 4XMPH 5JW4M 5KBPA 5LBSL 5MP6L 4YE4H 3NSCA 2FEJA 4UYQA 3PWUA 4MZIA 2C9XA 4Y4KC 3O3AB 4WK4B 3TIEB 4V1DB 4XGZA 5TE6H 1YYLH 2YHGA 4NNPH 4OZGF 5MI0B 3AT0A 2BLFA 3FDWA 3VXOA 2YEQA 1F41A 1NEZB 2YA0A 3QDJA 1TQBC 4X7TA 2YOAA 1ZXQA 2OJEB 1TYEB 1IEBA 2L04A 3TA4D 4ELMA 4GUOA 4ZOEA 1G7JB 3BKJH 4Y2LA 4YPGA 3IN2A 1IC4L 3AQZA 4XC1L 2X4UB 3X13B 1NCBL 2B59B 1H5BC 1HHJB 2FYVA 2XJLA 4KOCA 3TT1H 3TV8A 3WTYA 4PHXA 4K9EH 3MOQA 3QDMD 3GMMA 4J3VA 4Z7VA 5K9KA 3D85D 5ANHA 4UDUB 5DWPA 3MTRA 3T4YA 2R23B 1JPTH 1AD9B 4S1RH 2YPLD 5GGTL 4JRWA 4YFDB 4P99A 3BPCA 3AWFA 5B7EA 2EH8H 4BSWB 1QSZA 1X6NA 2NX5E 5IEKA 3EJTA 3MRGB 2HKFL 1TJGH 4L8SC 3HG2A 3L3IA 4MA8H 2BP8A 4B9YA 2EYRA 5CFAA 1YMHB 5ISZB 5J7CC 3DGCR 4P2YA 3BDXA 5GRJH 3S3PA 3K6SA 4LF3B 1ZK5A 4WFFD 3MO1A 4XNXH 4IBTA 5E4IA 3HC2A 2Y23A 4AKPA 3KYKH 5DRZB 1NBCA 3OMZA 3MV01 4U1SA 3MRBA 4PJDE 2QR0A 3GMOB 4OJFH 1T89A 2NCEA 1YPZE 1RJYB 1TITA 1JGUL 2BSEA 2X2HA 3EH3B 1BOGA 4JUSA 5J57B 2OJZL 5GRZA 1KZYA 3MACL 2XVGA 4PMEA 4ERSL 5IB2B 3T3PE 1FJ1B 5EO9A 2EDKA 4ZMTA 1G9EA 3VYOA 2Z92B 5C9JA 4EF3A 5D1QA 2VO8A 1MCQA 2IOMA 5DUPL 5F3FA 4JZNA 2M83A 1TSRA 3LXCA 3ZHLA 2DQIH 5E6SB 5I6KA 1LEGB 1NGXB 2BNUB 3CFEB 1OT4A 1XZWA 1GPOH 5DLLA 1BQHB 1OALA 4IHBA 2WP3O 1CBJA 4JJHA 5FCUH 4CN6A 3REVB 3GK8H 4KJWD 5AL8A 1D9KB 3FQRA 4LGSB 4X5RA 1M7UA 2LLGA 3EYSL 1AGFB 2QHLA 3H9SE 1JHLH 3EUDA 1IEAB 3ZRCC 3D87B 1B2WL 4AEHL 2FQFA 4X4XB 2QDWA 5FPIA 3JWNH 1CG9B 4OB5H 3VNZA 4FLRA 2O5XL 3D85A 3DJZA 1N8OE 1OD9A 1KBKA 3GLAA 5A2LH 3KLSA 3OC5A 3L4TA 3QAZC 5CSZA 1GYAA 1BWWA 1DP0A 2BRRH 1Q9OA 1E9PB 2AK1H 4JFTA 4P2OC 3ZOAA 4D2NA 3PV6B 5IVZB 3RTLA 3BIBX 4ABUA 2A9BA 3LH2H 3DXAD 5B4MC 3UYPA 2RMNA 3VD1A 3DURB 1VFBB 2HLAB 3O11B 1TVBB 5I16B 2R9HC 5K59E 2JJWA 4WTZG 4OZHB 4ALAC 1YNKH 3ZTNL 2BHYA 5E5RB 3RU8L 3GMPB 3L7EA 3BWAB 3CX2A 1IGYA 4CGUB 5FF6A 1I7TA 1Q1PA 3PWJB 3LKRA 1JZGA 3WJMB 1IE5A 3HG1E 1Z9OA 5KJ7E 3ZHNA 5IUSA 1AO7D 4IIQA 3N1FC 3L54A 4L2LA 5D7SL 2CMRL 2YD3A 2VAAA 4AQ1A 2CKBH 4MA1B 3UBGA 4ZUUA 4LEOB 1E4KA 1WDAA 3VM7A 1EH9A 1OSPH 3MOBL 3MRRA 1GZPA 2IQAA 1RZJL 2IH3B 2VNCA 1TVDA 4NC1E 5HGBB 1BFVL 4ZS7L 3S3BB 2Y24A 2GJ6B 2JJVA 4UT6A 5I5JA 3ARDC 4M7LH 4OKDA 2CGRL 3BPLC 3PIQA 1IAOA 4WY7H 3BZFB 4OJEH 1G84A 4PQXA 3FUKA 2CA3A 4P4RA 3QB7C 3QZLA 2ZYHA 3H42L 2WLKA 2YBRB 3RGVB 2ZP9A 4ORZC 4X6BA 3E8UH 5F7YC 2R2HB 1S5IL 5C07A 4QHKI 2FGWL 2A2QT 4HS6B 3ZDZF 4I0PD 1E9QA 3IPBA 4GO8A 4OLXL 3D18A 3NQKA 3FH8A 5C09E 3VWKD 1N64H 1ZCRA 1L9OA 4IDJH 5JNYB 3KGRA 1SVCP 3CFKB 2YSSA 4AQEA 1PIGA 3FB6B 3D4CA 3OPZL 3QFJA 3SCMB 3VGHA 5KYWB 3HLAA 4XN1A 1TQSA 3D33A 4L0YA 4U3SA 4UYPA 5JOEA 5GRXG 3V55A 4LPUA 1KTLB 4P59L 4HWBH 4X9HA 1S9YA 1VFAA 3U4EA 2DKMA 4RSYA 3GJFB 4X6DA 2YPKA 4H8WL 2XLLA 3ZTEA 4NZTL 4KXBA 4KKLC 4BQCA 4IEFA 3GJFK 5C0JA 1TZIB 2EIMB 1UM4L 3ECVA 1F42A 4R3SA 3TNNB 1PL3A 5D5MB 1N6UA 2R27A 1JUFA 4BUHA 3OKDB 4KNUA 2I7SA 1MFEH 2OBGA 4GSUA 1LD9B 4F8QA 4G11A 1MRDH 3E3QC 1AC0A 3TYGH 1XCTA 5KSBF 4HUVB 2WK2A 4OZGA 5ICYA 1FYTB 3VX0A 4KK6C 2P8LB 4P3CL 4PGBB 2ERJC 4XBGA 4BXSV 3G6JE 3LXBA 3RUGE 4HC1L 2H8PB 4FZEL 1P9MA 1R0AH 3RQ3A 5HYJE 1QHPA 4NSKA 3IU4L 1MJ8H 1TDQA 4NX0A 3O0LA 3FQWA 1DVUA 4M6ML 2YD1A 5JHLA 3EGSB 4AIXA 1OTTD 4PWKA 4BQBA 2ED9A 3LD8C 3LNDA 4OGYH 4U7KA 1S4IA 4WI0A 5EOTA 5IMMB 3WS3A 2VDLH 1FIEA 4BWWA 3WJLC 1E8XA 3VWKA 1TJGL 5E4OA 4AMKH 3GS4A 5E7FA 4V2BA 1UACH 2UY6A 3HBQA 2ITFA 1F3DH 4P2RA 4NO2B 3W9EB 4XNXL 3KPQB 3CQPA 4YHOL 5IMLA 3KYKL 1N3NA 1JF1B 3FQYA 4QTFA 3EIFA 3MV8B 5EEWA 4J8RB 1E6OH 4TM9A 1KJVB 3O2DA 3ZGIA 4E9RA 5KYYB 1P7KB 5DZLA 3KPSD 4ZTPL 5JHMA 2W9DH 2J1XA 3ATBA 2BERA 1A6WL 1A7BA 3RHWK 1HAWA 3ECWA 5CP7B 3KYMB 5HHVH 5IQOA 2VRQA 4KK9D 2XX1A 3KYOA 3AITA 4TPRH 1EO5A 1J05A 4LNRB 5CR8A 3GHBL 5TDOA 1TEGA 4G8FB 1T3FB 4YQXL 3S88H 1RL1A 4GLRH 4MJ6A 3ULVE 1MELA 2JB5L 5JW5A 3Q8FA 3CDGA 3HE6D 5K1NA 2EH7L 1OW0A 4JZJB 4KI5D 1IT9H 3LDBC 3JTBA 2NY1D 1NTDA 1YVLA 2XA8L 3QNXA 4BE5A 2J71A 4XP6H 3GK8L 5HTSA 3FQTA 2HN7A 4NQSA 3BD5A 4KRPC 1GZHA 2X4TA 3DIDA 1TU2A 2HXAA 4YL9A 1ZHLB 3CZEA 3SPGA 1LO4H 3PQYE 4IGBD 4LLUA 1FLRH 5DMKA 1Z5YD 3L2LA 2VMEA 3VFOB 4A6YH 4X8JA 4B53A 5JA8B 2BIQA 1HQ4A 1RIUH 2BRRL 5A3ID 1F3RB 3IAPA 3LQAL 4AZ8B 5IHZB 3IU3B 2CE6A 5DRWA 3LNEA 5G5DB 2CHWA 2JJTC 5KN5A 4K71B 3WHXA 4M7JH 3UGEA 3AY4C 4FFVC 1FNGB 3VMPA 3O3BB 3VVWA 3ZT5A 2JB6B 3VGBA 1T2XA 2PWGA 2V7HB 2YK1L 5GZOA 3OXSB 4Z9KB 3VSQA 3ZGHA 1KLFA 1KJ2H 5ID0A 3VWJD 2GUYA 4EKXA 3F65A 4MCZA 1DFBL 4NQUA 3ZBMA 4Y8DC 4Y19E 2GHWB 5AAMC 4X98A 1CF8H 3HEIB 3S4SA 2JCWA 4BK8A 2J8UA 3KPSA 5A40E 2XFXB 3CJJA 3BGFC 3HAEB 2HVJB 1ES0B 1ZWIA 3PHOB 2K3HA 1VACA 5DDHA 4UOZA 4JFDA 4G7RB 4PVMA 3CLWA 3I9IA 1W91A 2XZAL 5DVLA 3RWFA 2WWMD 1XGTB 1HH6B 2GK0B 3FU6A 5JDSB 1QRND 2LVCA 2VERN 4P23C 4AQZA 3B9AA 2OQJB 2UXFA 4JFUA 4P2QE 4G8GD 4XWGH 3RWGB 4OGAD 2XTJE 3FUFA 3N42F 1WVZA 1NBYB 1U3NA 4H8VA 4XN2A 1HT6A 2ZOLA 1S7XA 1QFPA 3ZE1F 3QUMH 1DL7L 3FT3B 5H2BB 1KTBA 3HR5B 1DBJH 4JDVA 3ZDYF 1GAFL 3RTQC 1RI8A 2ZCHL 1N64L 3I02B 5KVGH 4YPJA 1BBJA 1QPXA 1F90L 3CK0L 2OMXA 3IJSB 3QZBA 2WXGA 4I87A 4MJIA 4P5RA 3M86A 1LEIA 4EUPH 4N90D 3VFSB 4H25A 2MSPA 3NYKA 3GBNH 3FT0A 4FQIH 2VN6A 4HWBL 4G8IA 4KHTH 3S37X 2ADJB 5FB8A 3FQ2A 3HE7C 1WWBX 3F64A 1K6QH 5HGDA 1XX9C 2X6UA 1Y6NR 3V0WH 3D05A 5BRPA 1NKRA 4IW4C 5I1DB 4U1GB 5C0BD 4N2HA 2DQ6A 4FNSA 2VLRB 4WK2B 5FA3A 1I9IH 4GKZA 3VWJA 1T0OA 3VXRE 5IMKB 3MA9L 5AW0B 1K4DA 1RY7B 3FPXA 4QY8B 3EYQD 3EBHA 2WHVA 1N0LA 1NGPH 4GQQA 4PWFA 4PRAB 1RKRA 3LPWA 2PPDA 4JB9L 4NO0B 3OJVC 4PJEB 5D7JB 2XT1B 4D9QD 4Z77B 4ZX3A 5KSBA 4UT9H 2RTTA 3ILQC 1Z5HA 3HFFA 3CQFA 3W39B 5JHBA 1XSKA 3LIUA 2M26A 5SV3A 2G0KA 1IAIH 3VJ6A 2ZUYA 3ZRSA 2GAZB 4YDJA 4ZMLA 1UWGH 5KVFH 4UTBA 4FQLH 5FYKU 4HJJL 4PJXE 1Z9PA 5C08D 5GS0D 2X2IA 5E9DB 4K7FA 3RJDA 4L4VE 4PJ9C 2Z64C 3B2PA 1AJ7L 5DC2A 1AQ8A 3KPRA 1RHHB 4QIRA 2NXYC 2Z3FA 4QNPF 1G0YR 3K6OA 1YMMB 1DQMH 1U8HB 4OGYL 3FOLA 5DFTA 4ZPTA 4Z78B 1M7IB 4BH7B 1WAEA 1UWXH 2IWGA 2W0LA 3BAEL 3BDYH 2HTLC 3F7LA 3MAWA 4FFYA 3IFOA 3K91A 2FX9H 1CDCA 4PM1A 1X9RA 2FO4A 1SJEB 5FYKD 5KVEH 1UACL 2XXFA 5TQ2H 3PABA 2TRYA 4UTAA 1LK3H 2HJKB 1KBGH 4JJ5B 4HIJB 4E9SA 4XN8A 1Z5LB 1AZBA 4RA0C 1WWAX 3WAJA 3T6XA 4FI7A 1AS6A 6PCYA 2WM0A 1VZGA 4IRJB 3WNJA 3UEQA 1ZLWK 1DVFB 4O2FA 2G2RB 5GRUH 5EMYA 4C83B 2WVVA 4XCYB 2A74C 4X6FB 1DSWA 3MXVL 3S3SA 2J1WA 2ADIA 4ZOBA 5A2AA 4IKLA 4XPHL 3ULSB 1OB1A 4KPHH 4PGZA 4MJJA 2XTLA 1JV5B 2F5AH 4LDCA 2IDTA 1YN7B 1PYWA 3QQ9D 1CFTB 4TSBH 4Z5RB 4WW1B 1A6AA 4GAJH 2P43B 1EO8L 3P3TA 2P45B 5HJBA 1NUNB 5ICZA 4KHXH 1ONQA 4R0LB 4E9XA 2DH2A 4ZYKA 3AB0B 3L4XA 4P4KA 3T0WA 3US0A 2A83B 1KJ3L 4Y16D 2KDYA 3QXDB 5IJCC 4WSKA 3SO3C 3F5WA 1N0XL 3NABL 1MCJA 4Z3IA 1P7QB 3E6FB 1G7LA 3B5TA 4F15B 5I6NA 3O4LA 3IFLL 1NGWA 2J6EH 4OFPA 4F5CA 1TZAA 4X80H 1VPOL 1G43A 4JFPB 2XKUA 4XP6L 3SDDB 3UDWA 3VXME 3JTTA 2B5IC 5AW7B 2GBTA 3MX0B 5C08A 4LDLB 1HHGA 2VXQL 4Z7UB 4UZUA 5KVDH 2R1WA 1FZJA 1N7ML 3N43F 1HAUA 1L6ZA 4M4RB 4OQ1A 5F7WC 2CBTA 4YQXH 3CC5A 4HCGA 3TEXA 5HHXL 4A6YL 2VDNH 5IV2B 4BBWA 1GSKA 3DIVA 4J1UA 3C5XA 3V6OC 3KS0J 3QDHA 2XICA 3S4SG 3N06B 2E75C 2DQHL 4PV8A 4FFWD 2Y3NA 1QTYT 3N5AA 4M7JL 3JV0A 4QTHA 3RFZC 2FWOB 5JQ6L 2X4NB 2VLJD 3CHPA 1SF5A 3I9AA 5CZXC 5AVYB 3WEOA 2AJUH 4PRPE 1ROWA 1Y1UA 4YX2H 4H8UA 4JO1L 4ZUVB 4ZMQA 3FQNA 2G3XA 1KJ2L 1HKLL 4UV7H 2A3TA 2F15A 4PJHE 5H4ZA 2DQUH 5ETUB 4FXTA 1FVCA 1ND0A 4NUGH 4RAHA 2NW2B 2XQ0A 1NSNH 1KIQA 1KT2A 1DJYA 3CSTA 3QO0B 2IPUG 3QA3B 3QC6X 1KTJA 4RMQA 2BS8A 2WUCL 5K39A 5F7FA 2IQ9L 2HJFB 4Y5VA 4YDLC 3ZE2F 3BZEA 1PS3A 1AXTH 4YC2C 4YHZH 3GSQB 2ZUUA 3GUTB 3VNYA 1OB0A 3GBDA 2JKLA 2P24B 4DEPB 4K3EH 4Y7OC 3Q6GH 1KOAA 2NY5H 5DEGA 2VDQL 1UZ6E 3RWCA 2AQRA 2R0WL 3PDOA 1S7UB 1P6WA 3ULAB 4ISVA 1KPRB 4LLQB 1A9BB 4O2CA 4LNVA 5EZOH 5CEZE 1TJIL 4LVEA 3W38A 3IJ8A 1ODUA 3WEAA 3KMDA 4BCXA 1H8OA 5T3ZE 4JPSA 2OR8A 4GEIA 5FYJU 4NKOB 3UJJL 5FV2A 3PAZA 4XBEL 2CNZA 1E4JA 1PCSA 5KW9L 3QXUA 4FYTA 3WE6B 1BLNA 3GBNL 3DHJA 1GJWA 43CAB 3BVDB 4W4NA 4JKMA 2EXYD 1JTPA 4GG8A 3V7MA 2FQDA 4N8CH 1OGSA 4KJYB 4HX1B 1HNGA 1U3YA 5EORL 3OAYH 5BW7C 1RV6X 3L1OH 2G5BA 5CEYA 5BQ7A 4AEIH 2CUMA 5EO1B 5AG8A 1HDMB 4Q74A 3TVMB 5FYJD 3ZHFA 5H94B 3E0GA 4HEPA 4XPFH 3S9DB 1R5WB 1WD9A 3HHSA 4LEXL 3HMWL 4E41D 3LEXB 4UOQA 3HC0B 2XYCA 1L7IH 3P0VL 1OANA 1GGYA 4Y4FD 2D7OA 1BAFL 3UBFA 3SJVB 3VI4F 1MFAH 3N44B 1MXGA 4Y1AB 1A9EB 2O6FA 3L5JA 3CFCH 1H3WM 1XH1A 1MUJA 2VGLM 2JELH 3I74A 3QO1B 5I6OA 3TBTB 2WLLB 2ZKMX 3QSKB 3AS1A 4XXDB 2COQA 4NENB 4MGXA 1U3HD 2EUXA 4NRZA 2EUVA 2Y22A 3V5KA 4W6YB 1UWGL 4FQLL 2IVFC 1Z66A 2C7UB 3ALWA 1XH3B 4ONGH 5D96B 3NQIA 5E51A 4Z76A 5I66B 5IM7A 2VABA 2XZCH 4ODVL 5A2BA 1SYSA 2JQMA 1WG3A 1A7RL 2ZOKA 5E6ID 2MHAB 4WWKA 3I9PA 3LPFA 4V2CB 3FT9A 2E3VA 5JHDD 1J48A 2FZ3A 4IIQC 3MVSA 5CO1A 3LN9A 3PPEA 4A7VA 5IOPA 1RK1A 3VFMA 1KLGA 3T1FB 4AQ1C 2Q2EB 5J12C 1NFKA 3QWOA 1FC1A 3PGDB 1MEXH 5E2VL 1DLHB 4JO4L 4X8GA 1MFUA 2WNXA 2XJKA 5F1OB 2Y5QA 3MRMA 1ZVSB 1NWOA 1CD0A 1P69B 3P69A 2CLVA 2Q8AL 1RZ7L 2ZKXA 5H37A 1WGVA 2XNAB 3BT2L 5KZCB 1CBVL 2R59A 1G1KA 4TUUA 1UUSA 2L0DA 3BISA 3DVIA 5FHBH 2EACA 4Y2DD 4LHUA 1OEZW 3KYNB 3KPTA 4ORGA 3A4EA 1CD8A 1UOVA 1T6BX 5IGXL 5D7IE 2HZHA 4L5FE 4YR6A 4FQ1L 4OVVA 5I5RA 5JA9A 4TS6A 1HEZB 4L48A 3D0AA 4GAJL 4KJWC 4RQQA 2ZXBA 3DTXB 3I85A 4E41A 2ZWSA 4DP8X 4YDNA 2IBGA 5CIPH 3ULUH 1F2QA 4MQTB 4ANKA 3G6AB 4A63A 4PRIB 3EYUL 3DO7A 3GSNL 4ZO7A 2GSGB 3TH3T 1PY9A 4RRPM 4XVJH 1A6UH 4FF9A 3F2LA 1MAML 5G55A 3QJZA 2AK4B 4X9YA 2J6EL 1PFOA 1U3HA 3WDIA 3W9DA 2DH3A 4F8TA 2C9PA 2HRPL 1YEHL 2PP7A 5CBEA 3FT2A 1AP2B 3LKOB 3F7YA 5D7LB 2GABA 5JLZA 4DTGH 3HFMH 1XF5A 2HA1A 5E6IA 1HCYA 3RL1A 4B97A 3NZHL 2ODIA 5T8IA 1RUQH 4YSTA 2FE0A 3RPKA 1N18A 2OZNA 5EUOB 5J4MA 2H1XA 3O3DA 4UINL 5DZPA 5AVTB 5BVPL 4JO3L 3FF8A 3R18A 4PRHE 1WS8A 2DW5A 4X9BA 2ICWJ 5ID1A 1FVEB 5DTFB 3RZCD 3FU8A 5EU4B 1NC4A 4K5NA 1PPIA 5ICXB 1ZAGA 4AH2B 1VLXA 4XMXA 4YJZL 3IMRA 2WIIB 4PJGF 1HVXA 3C9NB 4IK6A 2YR3A 2B1AH 3GJEA 4YBQD 1JNHB 3RIKA 5KOVC 4UV7L 3HLKA 4DP6X 2Z35B 2WINA 3F7QA 3NTCL 2V5SA 3JWDC 3ZDXE 4MJHA 3IAQA 1A3LH 2F54B 4Y2DA 3QCUH 5DUMH 3H6AA 4O9HH 3L3OC 1YDPB 2X0VA 4ABVA 2IGTA 5BO0D 2AJVH 3RL2A 2EO9A 4PJ6A 1KB5H 4FADA 4XODA 4QGTA 5DS2A 4I0PC 1XD0A 5KANG 1UB5A 4V1DD 3FJTA 4WWNA 3QEUB 3VWKC 1SLWA 3MGTA 2AXJA 4CC4A 4NP4H 3SGDH 3QDGE 3MUJA 4HV8A 3NJNA 4Z7NE 3R7RA 3TWCH 3ZYOA 5FM4A 2WVSA 1V55B 2IADA 3HI1A 4ZW8A 5MERA 3VI3E 5C0CB 3HC3H 4APQB 1Q0XH 5E94B 5KS9F 5DXWA 2EDYA 1UT1A 5DRNB 5EU7E 1AHWB 2DEWX 3C12A 4KKZA 2MCG1 1JGLH 1CXEA 1BHGA 2F1AA 5JIDA 4XN4A 1GOHA 1GS8A 1INQA 1D5BB 2FNWA 2WXMA 3FB5B 5GGVY 2HT2D 2VDOL 4FMVA 4HEPG 3DBXA 2X4PB 1K5NB 1MRCL 5AOIA 4PB0H 3IYLW 3BRFA 1QR4A 1RSYA 3W2DH 4ZUWB 5TGBB 2EDLA 3RNKB 4Z7QE 3H4FA 2AERT 4OJDH 2G75A 1YHPA 3TT3H 3GM0A 5ISZD 1ETZA 3ZE0B 1KJMA 1QACA 3LMJH 4AEIL 4JW3A 3T2NL 1JGDB 4LCWD 4BWUA 2HTKD 2VITA 3IDNB 4DN4H 4OGZA 3U6XA 1L7IL 2X6AA 1I1YB 2CUIA 3UYOD 4LSVH 3CLFH 2HX8A 1OSYA 1XB8A 3AU0A 1DVTA 1QBLL 4YVNA 3OHXC 2R0ZL 4N1HB 3DX6B 1BJ1H 5IBTL 5TFSL 3VI4A 3MLPA 1OTTC 1RCYA 3O45B 2D3NA 3C8HA 4O51A 4UIKH 3PJSA 3HNSL 3O3AA 3V4PL 4DQOH 3MRFB 4PJ8B 4XP5H 4G59C 3SGEH 2CO2A 4M56A 1GTFA 4CDHA 4RBPK 1JWSB 3HB3B 1I9JH 4PJBF 5IQMA 2WKLA 4FNLL 2KPNA 4JRXA 4LCCC 5H37G 3WV0A 2PR4H 5IKCA 3EO1B 2R56L 5AYQA 1D9KD 2J44A 3NSJA 4PWIA 5FKAA 1MZYA 4G8EB 3X13A 4LHUG 1Z9NA 1HHJA 2DQJH 1EK3A 3DX7B 5C3TA 3VMOA 2DQDL 4F7EB 2IWEA 4QHLB 3OB0H 1HKFA 2BNRB 3H2PA 2R23A 1L6XA 3AS3A 4Y5XA 4LFHD 3MXWH 2AAAA 1WHOA 4KK9C 4NKMA 4PIRF 3TX4A 2UY7A 4BDVB 4TLKA 4J3UA 5CJQL 5LDSA 4KUCD 3HNVL 4Z7OE 4HIIB 3MRGA 2DL2A 5E56A 3QEGL 2YN3A 3D2TA 1OCWH 1YMHA 3K46A 5ISZA 3K3QA 5C0FB 4LGPB 4KI5C 1RZKH 2D3VA 1CLZH 2MQCA 3BYTA 2HG0A 2NY1C 3BAWA 5FHAL 4HUWA 2C3GA 5E5LA 3VYNA 2AQSA 5DRZA 1QFWL 3CFTA 3UIZA 2AV7B 4A38A 1HXYB 1B0RA 3MLUH 1S3KL 4MA7H 1AS7A 3QC5X 3RVTD 3L3DA 4IGBC 2C4XA 4GI8A 3IDIB 1FA4A 3FMGH 4N26A 5JOFB 3UCRA 3LV3B 3IAGC 4NKIH 1ILUA 5A3IC 2GJ6D 3H56A 4PRBB 5E2WL 1VEMA 4N4YB 3HG4A 3QRGL 1N4XL 4M6OL 2ADGB 1IL1B 1JXFA 3PF2A 2KHAA 3X11B 1LEKB 2CKBB 2V5YA 1LQBC 4ELKA 1WISA 4ODHL 1JSYA 2WANA 2YEVB 4MA3B 3RGVD 8FABB 1BQUA 1FG2A 4P8QA 5TH2B 4NCC1 2H0FA 2QKIC 4ADGA 2BNUA 5CEXB 3VWJC 3P73B 3ARXA 3REVA 1RUQL 1S7QB 3WKNA 2P5WB 1J1XH 5IW1B 1TFPA 1AGFA 1U95B 3BUPA 2HP4A 2EC9U 5SWSB 1AR2A 1IEAA 1PDKB 5BQDA 4F7TB 3F6JA 4AENA 5L2KE 2BVOA 1E5YA 3I9GL 4TOYL 4XMKH 4L1BA 2O61B 3SCMD 5LWYH 5ALCL 3U9WA 4CU8A 2AJXL 3D48R 1EPFA 4N8UA 1E9PA 2QT6A 4Y2OA 3C5ZA 3ROLB 1UUNA 2WWMC 3PAYA 1IE4A 4FL4B 2HLAA 1VFBA 2IPKB 3O11A 1TVBA 5I16A 3D4YA 1A3LL 2R7EB 3KCPB 1WBYB 3KBPA 3T04D 3MV11 1H6UA 35C8H 4EZKA 1W8OA 3GMPA 3HUJE 3BWAA 4O9HL 4OGAC 3T3ME 1AG0A 7FABL 1CFSA 2X42A 4TNVF 3PWJA 2QEJA 3D0LB 2CXGA 3WJMA 1YECH 2BHZA 5F0MB 1I8IB 5D8JL 3S7GA 3QBTB 5CZVL 3WU1A 4KQ0A 4AC2A 5CF3A 3GIZL 1JHTB 2OTUA 4LEOA 1JERA 1FYTD 1F4AA 1O5PA 2E7HA 2FGZA 3KDMB 5HDQL 3HS0C 5EEUA 1XMEB 4DKDC 3GBML 3CFMA 1EHLL 1E27A 4I2XE 1IKFH 4MD5B 2WOYA 2GJ6A 1E3FA 5JTWA 4E9TA 1HHIB 4KI1A 5CP3A 4AIEA 3BZFA 1ZJBA 1WICA 1J1PL 5EG6C 1URIA 3D4GA 1JXDA 5CKGA 2WYZA 4PPTA 1P2CB 4HFUH 4NFBA 2ZNWA 1PLBA 1I8UA 2R69H 2YBRA 5E4AA 5LN4A 3CX5K 2PWHA 1R5IB 2WXOA 3WHE0 1KEGH 2IOIA 4PGDB 4PB0L 1MDTA 4IU3B 3LIZA 1IAII 1QP1A 5EDSA 3TBVB 3EYQC 2XN1A 5E2UH 3W2DL 3CDFA 3MROB 5IR1B 3VG0H 1K4CB 1NIBA 1XGPB 5JYLA 1J87A 1FL5B 4PS7A 1MCDA 3FB6A 3CXHJ 2D4DA 2V3DA 5GHWH 3LMJL 2G9HB 3WKML 5KYWA 1D5XB 1S9XB 3UX9B 2BVPB 3BP6B 3MV8D 4LLDA 1F13A 4MJ5B 3UDWC 4DN4L 4Y88A 3KXFE 4RFEB 3O3UN 2ZX5A 3BVNB 4YUEH 5GS0C 3V52L 3UEZA 2XX0A 4PCYA 1A4KA 2GITB 4KQ4L 2GEQA 2VJ0A 3MMEA 4WFEE 3NA4A 3AC0A 3TNNA 2ZUSA 2PWFA 5D5MA 2APVA 4AGLA 2N59A 2OMZA 3MKGA 3OKDA 2FBJL 3U36A 3V9FA 1ZVNA 4ZFOL 1EAPA 3VDAA 4DQOL 1CFNB 2XU9A 5DZAA 1C8QA 1DBML 1OZTG 5I1GL 4DF9A 3C5JB 1CFVH 1JJUA 3MFGB 1I9JL 2EEDA 4GRWF 5T1KA 4PGBA 5DC9B 3W1ZA 1QBAA 4PJBA 5HPMA 2VB5A 2BSRA 2VZVA 2FL5B 3CHRA 1ZANH 1BLIA 2TSAA 1EXHA 1E8WA 1OD7A 3GXIA 3U9UB 4JE0A 4BFIA 1CK0H 3PGCA 3MUGA 2BS9A 3GRBA 4JN1H 4AYDC 4NZJA 2RBLA 2EDRA 3BZ4A 3NDYE 4Y5VC 3QQ9C 4YSOA 5AW9B 2NSMA 1AKPA 1HILA 1RVFL 3DRQB 1PY0A 4KK8D 4WEUD 1MN4A 1HC1A 1A1MA 5J8OA 3VW3L 2X1QA 2Q5BA 3A0OA 3CVIL 4BFRA 5IMMA 3DI3B 4LVHC 3N41F 4L3EE 1KCRL 2AJZA 4RGOH 2HKHH 4Y16C 4GG6E 2CPCA 2R29A 3ULVH 4P9HL 4UQ3B 5FEBA 5A2CA 3X1EA 4A6YB 2CALA 4FNTA 4MCYB 3PWPE 4NO2A 1X5GA 3D52A 3W9EA 4G82A 1IGTA 4MMYB 1KF9B 1N5YL 4WTWA 4YZWA 2ZX6A 1FAIH 3D5OF 1MHEB 4J8RA 4TVUA 3JWOH 5EN2A 3GXFA 1RPQA 3MLUL 4EZLA 1CGWA 3QW9A 4B9ZA 1P84K 1P7KA 3FHAA 1DBAH 3KPPB 3NZSA 4Q0XL 1NCHA 4YHKH 4PAZA 5B1BB 3OKYA 1KJ2B 2ICEC 2ZT9C 4DVRL 4IMKA 5FM5M 5CP7A 3KYMA 2MQ0A 4X0KA 2DQTL 5FFOA 3K6NA 4M5ZH 4ENZA 4FFWC 4EIZC 5JPMB 3WMPA 2OKMA 4J3OG 2DYRB 4NAQA 3UO1H 4HZ1A 1INEH 4OW6A 4NZFA 5HHPB 4XOBA 5I8CB 5CJXC 4PYGA 4PJ5B 2H3XC 2Y07H 4NN5B 4ADIA 3U0PB 2O5ZH 3B7UX 2X3CA 4QF1A 4UQEA 1J1XL 3QUZA 3PP4H 2TAAA 5IT2L 3LHPL 5CFHA 1ZIAA 2YA2A 1DJZA 3P2BA 2CBMA 5FK9B 4DT2A 5T3XD 1AS8A 3VFOA 4N24A 3ZIMA 5ACZB 4ZUTA 4J3TA 3H53A 2F5BL 1FSKB 2HX7A 4WW2B 4JFZH 5KUMA 1IM9B 5K33A 5SX4H 4RMRA 2K4AA 4GAYB 5JW3L 1I3UA 3I3BA 4ZSOB 3ZR5A 3FCUB 4PJIE 3HOGA 3NPSB 4K3GA 1EJFA 1CPUA 4ODWA 1C1EH 4DP0X 3B8YA 1JS4A 3O3BA 4OM1H 4JHBA 4PB9L 2BOLA 3LPPA 4CC1A 1BZ7B 2ID5A 4JFEB 2NNFA 4YZFE 3UAAA 2V7HA 2VLRD 1J8HD 1OAXH 3BFOA 4PJFE 2ZYSA 3FFCA 4XE0A 5D70L 3RVVD 5C92A 1TEYA 3MLSL 2VN7A 1YECL 1HU8A 5J1AA 5ESVB 1IGJB 3FRPB 3SKNA 2H0JA 1BOYA 1W0VA 4NO0D 5D7JD 5DJXB 3V0JA 3S8WA 3TXAA 3L4ZA 1S9WB 5BRZB 4WCYH 2XFXA 3COOA 3FAWA 3VQMA 4PV9B 3O6FA 3QHZL 4B3VA 5C0AE 1BZOA 1DQJB 4X4YB 5C7ZA 4D94A 4NXKA 4QXGL 3ARGA 1AACA 2NZ9C 2XWZA 3QHFH 2WUBH 2LTQC 4LE8A 5I8EB 2OK0H 1XGTA 3S36X 2EXYC 2ZQKA 4U1KB 5JDSA 1R3HA 2DDQH 5E9DD 3PE9A 4TMPA 1E43A 3RFRA 2JCCE 3EYFB 3VO0A 5K59F 4MLIA 2YGVA 4LPVA 2Z4QB 5AKVA 3MBWA 3RWGA 4D0DB 1TQTA 3L9RB 3RWDA 1KEGL 1AI1H 1YMMD 3UACA 4E42A 5KBKA 5IEHA 3FT3A 2CG9X 1TCRB 3HR5A 4HEME 5HSFA 1ZY9A 4Y5YB 4Y4FC 1IFRA 2P7TA 4M1DL 2OMTB 3R0MA 1B88A 1CFQB 3I02A 1C16B 4POZD 4YSRA 2WCSA 3H2WA 1WK0A 4PLNC 1I7RA 2AXGA 2P5EE 1X5FA 2OW7A 3LOWA 3VFSA 4IRJD 3DX1A 1AIFB 2X9ZA 1MPAH 1DVFD 1WHPA 1U3HC 4L4TA 3NVQA 4QXTB 4GXUM 4G7VH 1UM5L 2DF3A 4XP4H 3FNKA 5LNGA 4O02A 4WEEA 5AYUH 4NOBA 2L3BA 1RLBA 3G5YB 5E6IC 5F9JA 4GKLA 1HEJC 2VLRA 3SD5A 3S5YA 3BXNA 4NJ9H 1T20B 1WPCA 4N2KA 3R06B 4MBRA 3QZMA 2BNQA 4XXWC 3V8OA 3TV3H 3QIWB 4YLCA 2JWYA 2K6ZA 1PNCA 1V7ML 2Z31A 3NDZE 3NN8B 5IW3A 1OT2A 4Z7AA 4M5TA 3V5DA 1S7SB 5T1MA 4HVBA 3FTGB 5AW2B 4OQTL 2VQ1A 4OZFA 4ZAKA 4WU5B 1P7QD 5FKPA 2PCPB 2HRGA 4Q14A 4JY4B 3W39A 3SY0B 1HZKA 1E4HA 4FERA 5GQBA 3WY2A 2R4SL 1QFWI 4J8QA 4OJCA 3QIBB 4UAHA 3DYOA 2VZ3A 3SDDD 2CR0A 2R15A 3MRNA 2GAZA 5JQIB 1L0YA 5IWLA 4AUYA 3ECUA 3UMNA 4MMXB 2QPSA 3GSNB 3MRKB 3MV7A 4Y2DC 4LCUA 4G7SB 2V2TB 2CRIA 4CW1B 1CLVA 3A4FA 4I3SL 4LSTH 4WHTA 1T5WB 3VFRA 3EJRA 3CN4A 3RLSA 3APCA 3MLWL 3FRUA 1VESA 3MRQA 5JHDB 1YMMA 3RY6C 3WN5B 3IE9A 2EEXA 3FYIB 4N9GB 5FA4B 4CC4C 4JKKA 4BE6A 1HCFX 4HOWA 4ATTA 2BPBA 2M2DA 1SJEA 1P6AB 2QSVA 1DUYA 4RLDA 3ULVL 3TO4A 3CCHA 1RULL 2VDNB 4PG9A 1NMCB 5DJ2B 5I1EH 4PI0A 12E8L 4DGVH 4OCSL 3H3KA 2F53A 3F58H 4I4WB 3IJHB 4Z0BL 2B3IA 2JIXB 1DVFA 2DAVA 3EO9H 3QIUB 4JM0A 1FAIL 2A4CA 3NIGB 4I48B 4C83A 4IJ3C 3AG3B 4FKEA 4O5LL 4X6FA 1KTDB 2FLMA 4HH9A 4E68A 1PKOA 2OZ4L 3CH1A 3T65B 4M43H 1DBAL 2Y6SD 4JG1H 1MHHB 3G9AB 4WGVB 4ZX4A 5KBLA 1AFVH 1JV5A 4APXB 4NQEB 4CJ0A 1QI3A 1YN7A 2OXGB 1OARH 3BKMH 3BPNB 3K7UA 4Z5RA 4YHYB 4WO4B 4WW1A 1TG8A 4ZTEA 3UZVA 4FYQA 2J20A 1EGJA 1G9HA 3DECA 3NESA 4OLVH 2H1PH 2XIDA 2A83A 1FNHA 3RZCC 2AEQH 4ZNEA 2F74A 1SYVB 2KLRA 1H3VA 4Y9FA 2GK2A 3LH8A 3SQRA 3II2A 5MEOB 3F7PC 4YBQC 1LP9B 3HMXL 1F4XH 4ZRGA 5IK3A 1WBXB 3NIFE 2O5ZL 5DA0B 5C0RH 5D2LB 1ZRUA 3VGDA 5B3JF 3NT0A 1AGDA 4JFPA 5CN3A 5DJCA 1CD1B 2I9TB 4RWYH 5JIKA 3V4VH 1NQBA 4J3BA 5I28A 2XCMC 5L9DH 4Z7WE 1Y18B 3QEQB 3SGDI 2HRLA 4M7KL 4G3YH 3WEXB 3SDXF 4IMLB 1KBVA 1OOWA 5C2UB 5D9SA 5IV2A 4PJAB 4UZGA 1UADC 1MCPH 3GQFA 2DB8A 5JPNA 1UWEL 5BV7L 4FC3E 3HC4H 1Z9LA 1KPUB 3UJIH 2KUTA 3H3PL 1C1EL 2KLSA 2W95A 3OG6B 3T4AB 3FB8A 5DMJB 2X4NA 3TPUB 4M7LT 2D9QB 1XR9A 3DV4B 1LE5B 4ZUVA 4ONFH 2AMUA 2NNCA 2Q7YB 3TVMD 1U8LB 2Q0ZX 4KKBD 1YEIL 2H6OA 4HQQL 5A7EA 4NQQA 1P4LB 4UNIA 4X5XB 1S7WB 4LPTA 1I9RL 4FXKB 4JFHD 4N87A 3SJVD 2VLMD 1IBZA 1Z0MA 3QO0A 2HT2C 3CV5A 4K9JA 4FQCL 4Y1AD 5T3ZH 4DOHE 3DETD 1NFAA 1XWVA 1J5CA 1I1AA 4XPGH 2EXSA 4LU5L 1EEYA 2ALWA 2NDFA 2VLKB 2XWTB 4DEUA 5DT1L 3GSQA 2IANE 1QNIA 4MKMA 1JF6A 3HJ0A 4JHVA 1QFOA 1X5YA 5A16A 3NJJA 2P24A 5K1VA 5FW7A 3K6IA 2XWBB 4DGYH 3V79C 2AMGA 2Y5TB 2OYKA 3V0FA 2LW3A 2Q3AA 1O5DT 4OCNC 4X9FA 4EQ2A 4N5ED 1ERNA 2HTKC 3BVTA 5MENE 4ODBD 4GQ9H 4PREB 2A9MH 3ORJA 5EU3B 1A9BA 1NJ9B 3P4NB 5CLZA 1RJLA 2DQMA 3DVNA 5HHOB 3P9MB 5L4JA 4JHAH 3O6LH 1QSFE 3GGWA 3K8KA 2F8XC 4F8NA 1GH7A 1W72H 3TZVB 4PTUA 3S34L 5SWZB 5L7XH 2OP4L 4AGMA 1AZNA 3LH9A 2OSYA 2XWCA 1I85A 2NY6B 1P53A 1OXYA 5KZCD 1B9ZA 1VKXB 1AMXA 1DVXA 2J21A 43CAA 2X44D 4X9IA 3BVXA 2BZDA 2C1OB 3OVUB 4G7VL 1AQDB 3A4AA 4OZFG 4KJYA 8CGTA 4HX1A 3SE4C 2UYLB 5AYUL 3LPGA 9PCYA 3NPZB 1WS7A 6PAZA 2W80C 1G6RL 3GMNA 2ZTBA 3TVMA 4NJ9L 1D3CA 1D9KC 3HI5H 3OTTA 5A6IA 4N85A 5I1IH 1U8CB 3LEXA 4OD1L 4HCRA 3JTSB 4N6QA 4PWHA 5HHQA 2YRPA 1S7RB 3SJVA 2FLBT 1KSRA 4JCWA 1G7PB 2WTRB 1E4XH 1PKQB 4MAYA 3SKOB 2BCMA 3S6CA 3WXVH 2AK4D 3QO1A 4ZD3H 4HK0B 4LSRH 1UH2A 2WLLA 4PUBL 4W9ZA 2RACA 4XXDA 1A5FH 1T04A 4NENA 4DERA 5CIPB 1GHFL 3A3YB 4HOMA 5KYXA 3ECQA 3B3IB 5DJ0B 4NPYB 2WWOA 4EI6A 1FNFA 2OXHB 7PAZA 5D7LD 3MRLB 5G4NA 4WHYG 4JX0A 2K9UA 4CNIA 4H40A 4N0YL 3AAZA 4YXLH 3MNWB 2MHAA 5B8CB 5HDBE 2BINA 1ACCA 2PABA 1JI1A 3PY9A 4H8PA 4MA1C 4RSVA 1G1OA 4R96A 3RVTC 1M2OA 3CLEL 3WEMA 1DJGA 1FNEB 3RVXD 1RIHL 1ZSDB 3L9EA 1R3KA 3HBZA 3PHAA 1HXMA 1UXSA 2NY3B 1MAKA 1WCQA 3JZ7A 4NPJA 3U30B 4CC0A 2H6PB 2VIRB 2LGNA 2F54D 2W60B 5HXMA 3LRSA 1NIAA 2Y7OA 2ZJSH 3RGVC 2GW5A 4JG1L 3HZMA 1MRFH 1OAYH 1M4KA 3TN0A 1S9KC 4GAAA 3DTXA 1UKQA 1T5KA 1DYZA 2NW3B 3GKWH 1EV2E 3LRLA 1PZBA 5DLML 3ALPA 1Y0LB 4JM2F 4PH8A 3K6FA 1JZ2A 4IKIA 3G6AA 4PRIA 4B27A 3CBJB 2DMBA 4MNGE 5F1IB 3SCMC 4K23L 2YRBA 2GSGA 5B7FA 1DANT 4QRRA 2H3KA 3C6LB 4G9FE 4PR5B 5C0CD 1AHMA 4APQD 3KWWB 3OZKA 1F4XL 5C0EB 1F1DA 1A7PL 25C8L 1DUZA 4A7TA 5C0RL 2CDFB 5J0BA 1YC7A 1JGVH 1NL0L 3RWHA 2VDKL 1SM3H 4ZBJA 4RWYL 3OKLA 3V4VL 2A6JB 5F7KC 1B2YA 2DIBA 5KJ4A 1AP2A 1G7QB 5I6LA 1O75A 5D1ZD 4KKPA 1FO0L 2F61A 4K2UH 4NGHH 4OIIH 2IXQB 4MNQA 1A4JA 3SDXA 4YAQA 5JW4Q 1M1XB 1U3ZA 2H0EA 2V8MA 3CFBB 4NJAL 5CGMA 1XF4B 1TJMA 3GSVB 3NFSH 4N86A 1LO2L 1RFDL 4U49A 3IF1B 1FVEA 1XEUA 3UJIL 2AC0A 1MIEL 4S1QH 5EU4A 3B2MA 3GSUA 3QDJE 1NIFA 4IOSD 2FAUA 1XXDC 1DQLH 4D9RD 1H9DA 1YUKB 4IOIB 1ROCA 2BZ7A 1JBJA 4HA1A 4QRAA 2Z35A 5CEZL 5JQHC 2WCGA 5J06A 3GI8H 3TJEL 1UQSA 2K6WA 2UZYB 1MG2C 1A8ZA 1LDPL 3KEDA 4Z7VE 1D7FA 3MJ9H 4DW2H 5L6YL 5T3ZL 2WXNA 1YDPA 2I32A 4TVPE 4YHPA 5J13B 3B2VH 4I9WD 4K3JL 5DHMC 5DWUH 3APFA 1VZIA 1KGCD 5BMFH 1THAA 4PSPA 4TLSA 2ADYA 4M1GH 2QHRH 4PJ8D 4LLVB 3G08B 2ZCLH 4XMVA 3E7JA 2DLTA 3G5XB 1LMIA 1T0MA 5E8EB 4HISA 3HB3D 2WQVA 5F96H 3OKNB 1OGTB 1Q1JL 1EZVY 3G5ZB 5EU6A 3OAUH 3R0NA 4I18B 4OCXH 5T1DH 5A7BA 5C0CA 3CX5J 3WIHL 2ZUVA 2NX5B 3NFNB 3LXUX 2W81C 1KDIA 4KVCH 4ZFOB 2ENYA 2A9ML 5JUEL 5I19H 3RY5A 5DRNA 1WV7T 1TENA 1AHWA 5GSRB 1E9OA 4GW4B 2RGSA 1FFNB 2QV4A 3I6GB 4JHAL 5FO8B 4N2MA 4PRNB 2BNRD 3FB5A 5LXVA 1R34A 2X4PA 4XVSL 1C12A 4EIGB 3SDYH 2O72A 1RURH 4PJDB 3EBAA 2YD7A 1GS7A 1B4TA 4MQ7A 2C5DC 4WGWB 3BVWA 4ZUWA 1L3NA 3RNKA 1J0YA 2IO5A 3SKMB 3L7FB 5D1QE 1F02I 4K0OA 5J1TC 1YPZB 2R51A 3WY3A 2XWEA 1QTSA 4RFOH 4JZJC 2BIMA 5AYTA 1X5ZA 5AW4B 3ZU8A 5BS0A 2CNYA 3FO0H 4GS7B 3T3PB 1X4XA 1JGDA 4H0LC 3ROOB 1A22B 4U1NA 3QPXL 3I75A 3SPHA 3FCTA 2BW5A 4FYRA 1WZLA 1A14L 1I1YA 4XO4A 1EEZB 1A3QA 1KWGA 1JPGB 4AGQA 4BH8B 2XXGA 2EILB 3DX6A 4KK8C 1VF5C 3WXVL 1BQLL 3JZYA 3L3GA 2HT4D 1DBBH 1F6FB 4PFEA 1NC2A 2BY3A 3A22A 3H9SB 4K71C 3KGTA 5J1SC 4PJ8A 4BZ2H 4IIZA 4NM8H 2Y9RT 4P46B 1JWSA 4MD0B 4A2EA 4PN6A 5KSUA 4L5FL 2WTOA 2YRZA 4MCMA 2QSTA 4XAWH 3S5ZA 4AYBA 4HWEH 3DVGA 3MOAL 3K8MA 3EO1A 4JRFA 2P5WD 4YXKL 4PWGA 5ENWB 4CSPA 3RY4A 3VSVA 1QG3A 1KIPA 5J6GB 4H0IA 3EOTL 4R6UA 4LP4A 3DX7A 3BRGC 2H7WA 1YYCA 1RUKH 5EOCH 4F7EA 4GW1B 1XF2B 3D0VB 4QHLA 1SDYA 2BNRA 1JVOA 2GC7C 4M61B 4LK4A 4GRLB 5H35B 1KPVB 3HG1B 5EFIB 3RJOA 5I15L 3OMIB 1BW8A 3BH4A 3QG6A 4OZ4A 2YKKA 1FC2D 3D07A 3PWLB 3LZRA 4M00A 3V10A 3VFNB 4KNQA 4QGYA 5EF1A 2E4TA 2XI9A 2XYBA 3AFLA 4C56E 4RMSA 3KLLA 1P84J 3WNPA 4W81A 1O7SA 3TESA 4YWGH 2J1ZA 4Y1SA 3PGFL 1NUFA 3QI9A 1OAYL 4M6NH 4OSUH 4QYAA 4UTCA 3SEPA 3IVKA 5SX4I 5C07E 1HNYA 2F58H 4PJ7B 5TDNB 2VLLA 2A6IB 2KMWA 4NCC2 2BP5M 1HI6B 5I5IA 3MR9A 3HTLX 4XNZB 1BD2E 4Q6KA 3K2KA 4EOWL 3SOBL 5I1LB 1AVAA 2ENJA 2WO3B 3BVVA 3VH8B 4MDJA 3AVEA 4P06A 4JM2A 1UXWA 2ZIDA 3QFJE 4I5BB 4XBPB 1I3VA 5EULV 4WAFA 2OPCA 4OFYD 4L2YA 1FE8L 4U1JA 5AKTA 5AW1B 1QKZH 5FDWB 2R0KL 5GS0H 3K72B 1M3IA 2HRHA 2WOBA 5FO7B 2ADGA 1IL1A 4YHNA 5C09B 3RBSA 3X11A 4X6DE 2YUWA 2CKBA 3LKQA 1LEKA 3KLHD 4WFGD 1HOCA 5HYSB 5DD0L 1P7HL 3L95B 5FLVA 4JPIA 4U1GC 5KYUB 1Z0NA 3OZ9L 5TH2A 5IJVB 1UURA 4FKKA 4AKQA 5CEXA 3RVVC 4NGHL 3BFWA 1NFDB 3P73A 5FYKH 1CYWA 2LVEA 2JI2A 1JFHA 2H32B 1U95A 3HCVB 2FRGP 5SWSA 4JDTH 5D7JC 1OTUD 2XSKA 3RA7L 3QJFB 1O0VA 1UCBH 5LXGL 5EBGA 5MHSE 1N19A 1JK8B 3NSDA 4OZGE 4HS8H 2NY0B 3MJ7B 4MCNA 5EUKA 4HJSA 1DQLL 3ZTDC 2I26N 1UA6H 3BW9B 1YAIA 3ARPA 5GS2H 1FFTB 5FECB 5FGCE 2FHFA 1DHKA 2X89A 5IWLC 5DVOA 2CBQA 2WQAA 4GIPD 1ZHNB 2IPKA 1RZFL 4AXWB 4QXUL 1OHQA 2R7EA 3KCPA 2YGNA 2FTAA 3MJ9L 1TXKA 3G6JB 1AD0B 1BJ8A 3RUGB 4JFSA 2QQKL 3GM8A 1N5AA 2DWDB 4AJVA 3D0LA 5HI5C 1OKEA 4HWBA 2P28B 2BP3A 2Y06L 3UJTH 1YJDC 2X4SB 4M1GL 1I8IA 4NZ8A 5HYJB 1J88A 1XF2A 5E08H 5E8DL 1REIA 1ZLUK 3WKQA 3M6DA 4POZC 1JHTA 4M62H 1MI5B 4FAAB 3KDMA 4JPVH 5KSVA 5F96L 1YLBB 3GS7A 4S11A 4P2RE 1GXEA 3OAUL 4X6CA 2OYPA 4MD5A 1NCCH 4IRJC 3RWEA 4QRUA 1DVFC 2VZTA 2CJ3A 4KVCL 5AVXB 1R9FA 1HHIA 3QPQD 4UMSA 4QRQB 4TQ8A 3EOBA 2B9BA 2FR4B 2HUEA 1S9VB 3QORB 4YK4B 2HX9A 3WTUA 1E8ZA 3ZDXF 2Q8BH 1P2CA 3EYVA 4DHLA 4EPSA 2O1AA 1DANU 3RX9A 3I2CH 3WFBL 1R5IA 5C0DB 1Y6KR 4YHML 4R0LC 1RURL 3U9PH 3AB0C 4DK6A 1NAKL 3MROA 2JKXA 2IFFL 4A2LA 1PX4A 2PTVA 1VGEL 4RMUA 2BOBB 3E1ZA 1FN4B 1XGPA 5LCVL 4F15C 3EFDH 2G9HA 4Z7NF 4DO5A 1Q72H 1J10A 1S9XA 3TL5A 4FQJL 4D0BA 4DQAA 3BP6A 3ZKSD 5F7BA 1U2YA 4HXBH 2FX7L 3SDDC 3I50L 4Z6AT 4RFEA 4P5SA 4PY8I 3BUTA 1JRHH 3BVNA 3FYEB 2ATKB 1WP6A 2MKWA 4N0UE 2B4CC 2ZF9A 5E0QA 2D0GA 1OOAA 3CAFA 4LHJB 1E3ZA 2JH2A 4WJ5B 3QUYA 2W07B 1KYFA 5I30H 3QUKB 1BXAA 2E46A 1FDLH 1H3TA 3SBQA 3AWEA 5KAQF 3IDXL 4OF8A 2OMWB 2NUPA 4U1MB 1JYXA 1CFNA 2FB4H 4BZ2L 4JGNA 1X9LA 2MOQA 3WUZA 5F9AC 4YHIB 4Y9EA 2JQAA 4LDEB 5SX5K 1MCRA 4PJ5D 2EDDA 4M7ZB 4CRPA 3IM1A 4IRSB 4MNHB 1QVOA 3BP7B 1JWMA 4NQXB 4RETB 1AHKA 4B7LA 4RZCB 4DNLA 3JWNG 2X9WA 5HPOA 3PV7A 4HIHB 3U9UA 2J2ZA 1S8DB 2JLLA 5F21B 1BA9A 4KX8A 1WUNT 2FHBA 2Y6SC 4OCWL 2J8UE 1RUKL 3W81A 2VXVH 3VRLF 4NIYE 3STLB 1XBDA 5F7NC 2L7EA 3NCEB 3BH9A 1J5OL 2IGFH 5D71H 2CLRB 4JFDE 1IM9D 4U4IA 1N8ZA 2H6UA 5EA0H 4FHKA 1RXLA 3K2UH 4DEPC 1RU9L 1QO3A 1KV3A 2ZXGA 3ESVF 3OKMB 1FORL 3OF6D 5GGUB 5FYJH 4CVZB 4E0RA 5DUJA 4F58H 4JFED 4UQ3A 5CGBA 4A6YA 2XN9A 4OLUH 1JDCA 3BGMB 3V0VA 3DPDA 1HL4A 1U58B 3GRWH 4EZJA 3A5VA 4MMYA 1ZLEA 2VW7A 1KFAH 4NI3A 1JD9A 1ZS8A 4BJLA 2XTSA 3FAXA 5LAXA 5BV7B 4PD4K 3FCGA 2EICA 3ZDZE 4B5ZA 1JDDA 4P2QB 5BRZD 2YGOA 3KPPA 1BVKA 1Q9KB 4JQXA 4N0FA 4J23A 4K8RH 2WB7A 4MJIE 4KXZI 3TIDB 3KM2A 4KOBA 1HESA 4NZUH 4XCEB 5DZVA 5EV7A 1IGCL 5E1QA 2BC4B 5FO9B 3BUBA 1KGXA 4WUKL 3DRTB 4Z23A 1RHFA 4Z7OF 3FTYA 4Q97A 2LFGA 5I8CA 4LESA 3UC0L 3OG4B 4H44C 1WEJL 3TVMC 4PJ5A 1JYNA 4KKBC 2CHXA 2PP8A 1I1CA 3O2VH 1AQMA 1KDJA 2D31B 3MNZB 2ZWKA 5CWSB 1ML0A 3VXNB 2XZQH 1JMXA 1U21A 1CU4H 1H15B 3KS0H 1FNSH 1FVDB 3H7BB 2YUZA 3MKKA 4WFHD 2VWEE 5B38B 4Q9RH 4XNQB 4ZMWA 5BPPA 2BVUA 2GHZA 1T21A 3DETC 5FAAA 4N2GA 5KSBE 1TQVA 3PWVA 5ABZA 5INDB 2CDGB 4YFLI 1RD6A 2C9UA 3EFFB 4O4YL 3KPNB 3VXRB 1UA6L 3QUMA 1HIMH 2P44B 1YEJH 3L2NA 4GAYA 2UXTA 1BYPA 4ZSOA 5D96C 4HAGA 2Y7QB 2E7BA 3RDTB 3C5SA 3NCFB 5LGHL 4FJ6A 6FABH 4OY9A 3J7HA 3OF6A 1SLVA 1BZ7A 4GKOA 2BRQA 3O8XA 2DJMA 1KN4H 1M05B 4EUPA 4P9MH 3LEVL 3KPRE 2LU5A 2Z91B 4WNQA 2XPGA 2K9FB 2W91A 2DMKA 4XZUA 3QIWD 4FRWA 3DBSA 4NQDA 5ESVA 4Q6IB 3FRPA 3M1BB 3BE1L 5FUCE 3GBLA 4PJXB 4XB8A 4GW5B 5E08L 1N67A 4L4VB 3IJ9A 3UP6A 1S9WA 5D6CB 1G6RB 3S5LA 4PV9A 2V3FA 4CADA 2A9NL 1TTUA 1FPTL 1DQJA 3O6KH 1KN2H 2P26A 1UM6H 2A99A 3ME0B 3AUWB 4BK5A 3QIBD 4PP2B 4N90E 3MLZH 4L8BA 4XT1C 2E9IA 4QRBA 4UAOB 1A6TB 3F83A 1OT1A 3LY6A 4FEIA 1A6VH 4KV5E 1YY8A 5CCKL 5D2NE 1AH1A 5EBLB 1UB6A 1ZVYA 1F6LL 2EE2A 4N5UA 4N2IA 5CBAA 1QSEA 3CSYB 3LAFA 4UT9A 3EYFA 3U7YH 3WIFB 2DD8H 3QK0A 5E2JA 3MU3A 1E4XI 5GGQL 3HKZA 4D0DA 3HUJF 3L9RA 1GTNA 2FJFB 2HG5A 3DX8B 3T3MF 1YEGL 1JZDC 1BM3H 1MWAL 3MUZ1 3U9PL 4P49A 2CO1A 3FONB 2ZP0T 4CMMA 2APWA 2J1KA 3APMA 4KVNH 4QHNA 4YDLB 2OMTA 4DGUA 1EMTL 4BQ8A 1CFQA 1Z9SB 1U8KB 1UD3A 4WSGA 4MB1A 2P80D 2OL3H 3IBOA 4UV4H 1E2ZA 1M53A 1X4YA 3NAAH 2KQNA 3O4LE 4YGAB 3QQNA 5HGHA 3ZLQC 2X3AA 4F5CE 2JIXD 3BP5A 3QIUD 1ASQA 5DZJA 2NXZB 5EBWB 4J3WA 2FEEI 3MNDA 2XN0A 3QJRB 1RZJC 1NICA 4LMQE 1IQWL 4HKXB 4N68A 4U1LA 1E65A 1A66A 4XMWA 3REWB 2WBJB 4FQ2H 3G5YA 4NQED 2F7OA 4TSAL 4WO4D 3F84A 3AGWA 3R06A 1RZIB 4F9LC 3OQRA 1WBZB 3VXMB 1U42A 2DM3A 3CGTA 3QIWA 4ZXBB 15C8L 3K2IA 3Q3GB 1UXMA 1K85A 1T1YA 3OXRB 3LS5L 2WLIA 2DLFH 1S7SA 3FTGA 2FEDD 4JQIL 5LJYH 2DMGA 2ZG1A 4ZOAA 1BREA 5F97E 3RVXC 2K78A 2ZD0A 3PFQA 4WU5A 1DSFL 3PXJA 4GSRA 1P4BL 1OWWA 4KUZL 5B39B 1ESOA 1DFXA 4DUXA 1QW8A 4DPCX 4M6AA 2O6EA 2PTTB 1V8HA 3ELQA 4CKQA 3RKPA 3GEWB 2WQSA 1CGVA 3MREB 5DURB 1IBBA 5AKSA 5B22A 3QEQD 4HGWB 4CW1A 4PRPB 4WV1A 3ET9F 5MEQB 3T0EE 3HI6H 2VAJA 3QZPA 1P5VB 3HA0A 1IO4C 4N6RB 1BYNA 2J6EA 3IMSA 2VDPL 4DEWA 5KSAB 4PJHB 4H8WC 1SN0A 1OGAE 3H0TA 2WXJA 3PLYA 3WN5A 4GFXA 4U6HB 4CAGA 4NUJB 3MRPB 4N9GA 3V4VB 4YHLH 4F37K 4XVTH 4AM0B 3Q8EA 5B3SB 4F58L 4U6VH 1RZGB 1NMBH 2AI0H 1FGVH 2WB1A 2P80A 4APQC 1Q94B 4ACPA 1CCZA 1WFTA 3I6SA 3C09B 3IJHA 5JYMA 1AHWC 4OLWH 4EZMA 3BGAA 2MPAH 1ID2A 3N04A 4YGVB 1RUMH 3P11L 4UQ2B 3E80A 1SOSA 3ZE1E 3MDJA 2V7NB 3B3BA 3ZDYE 4W9EC 1MHHA 3MODL 4YDIL 2OXGA 2QZQA 4K8RL 1KB3A 4WO4A 4MRCA 2VLKD 4K5PA 5D55A 4R4BA 4AG4L 1OTSD 2E8YA 1HYRC 4HALA 1DJWA 3VXTB 4HKJA 3C60D 1O6TA 3SGJA 1MVYA 3DJTA 4GQPH 3BUYA 3KEHA 4WQOA 4ALAL 2NRDA 4GSDH 3OKOB 1ZVHA 5MEOA 1G9MH 3IFNL 4JRLA 2ZCKL 1MF2H 1R17A 1WBXA 1H3UA 1XH2A 2XXCB 3O2VL 2A4ZA 3UTQA 5D2LA 3BMWA 4HG4J 5CAYB 1BXXA 5IREA 3ARUA 3QJVB 3GUFA 4JFOB 1CD1A 5HHOD 1FNSL 3CMOL 2NYYD 1SVZA 1BQ5A 3TZVD 4EUPG 5SWZD 3WN6A 3WEXA 4XNUL 1I1FA 2KL6A 4L9LB 1DBKH 2XIBA 1MREL 4R4FL 4HHAB 1YC8A 3J07A 2D7NA 1T1XB 3FRPG 2NY6D 2YWZA 3D34A 4HGKC 3IDUA 3IGAB 4PJ8C 2E7MA 1F58H 1C5DB 1QATA 2ARJB 2FH6A 1WFMA 1W72B 1KPUA 2W65A 3GMLB 4KMTH 4LO9A 3S5LG 3HB3C 3GTTA 3O3EA 5D4JA 3T4AA 6FABL 1ORSB 3DV4A 1LE5A 1UVQB 1YEEL 4G1EB 1A1NB 3X14B 1U8LA 2BCKA 1SUJA 2I25N 2XG5B 3QJSB 2Z4TA 3MCYA 3T6WA 1S7WA 4ZFGH 3NACL 1NH6A 1XCQB 4WI5A 1J5DA 4QNPE 4KTEH 4FXKA 5AAWC 1E67A 4HIPA 1GJUA 3X3FL 2X70A 2YC1B 3OX8B 1QAWA 4XNMB 3NCMA 1S7TB 1CN4A 1NDGB 3BZDA 2NY4B 4P5MB 3US1A 5JZ7D 5I82A 4AC4A 4DKAA 5DHXB 4J5VA 3DKHA 4NHUA 3JWNC 2MCPH 3HRZB 2EDQA 3DGDA 3SZ6A 2B2XH 1PZSA 3ESNA 1H3PL 4AEEA 4UT7L 1A1OB 3PNRB 2FUTA 1S5HB 2ZG3A 4W9GC 1AQKH 3QUGA 4GMTH 4YZFF 3WSQL 1EJ6A 2MNUA 1T66D 2UZIH 5IFJA 4JKWA 4PJFF 4HIQA 2BWQA 5LGYA 3WL9B 3N40F 3ZYZA 2I27N 5F88B 4U05A 2PPEA 5D7IB 3FHQA 4QHMB 2F7QA 5SWZA 4UV4L 3GJFH 2HT4C 3NAAL 2EECA 4K5OA 4NYLB 2O5NA 4YL4A 1QTPA 3QYCA 2AJSL 4JM4H 3V2AR 1BGXH 5KAQG 4PY7B 3VXQB 4JK0D 1QBML 1AQDA 1JN6B 2W9EH 3MRJB 5EZLB 4TL4A 3Q9PA 5TK2A 4UF7C 4PU2A 4X83A 4HULB 3MCKB 3WFZA 3QG7H 1TJHL 1AAJA 3B9VA 3CHSA 2F1BA 2F8OA 3Q8CA 3RNQA 2O6CA 3L5XH 5JXAH 3HS8A 1KYOJ 1U8CA 1TKWA 3JTSA 4XC3H 3DX2A 5IVXB 5K9QI 2W8CA 4W1TA 1S7RA 4QRSA 3C6SB 1KCKA 1R3IH 5IBUB 3L9YA 2DQFB 2V2WA 1SJMA 3C6LD 1JNNL 3GMRA 1M6OA 3DMMB 3ASNB 3E2HB 1B0IA 5IB3B 3FS9A 3NG5A 5AWNL 4FL4C 3KVDD 1CTOA 5CIPA 3CDYA 3NK3A 1Y1DA 4JHUA 1WIPA 4PRHB 5ESAB 2NR6A 1QQDB 5KG9B 3B3IA 1U6AL 5ANMA 3CQQA 4MSWB 2XVBA 4UU9A 3QCTH 3K1KC 2I07B 2ZUXA 3S98A 2A1WH 5D1XD 4DO4A 3MNWA 5B8CA 1RPUA 1IUZA 3ZE2E 3KR3H 3UXFA 1H0DA 1YNTB 5F9WB 4BSJA 5GISL 4OUUB 5D6DC 4WK0B 5K69A 2YZ8A 2ZX8A 3K80A 3DGGB 1FNEA 5HHME 1RUPH 2EP6A 1GW6A 4Y4KA 5IHUH 3A67L 2XQYA 4Q9BA 3VTAA 4W9JC 1JNLH 1JZEA 1YO4A 4HD5A 1TTCA 2ED6A 3PYCA 4N1CA 1SHXA 3N1MC 4NRXB 4OLWL 3QRFM 2Z7YA 3H9HB 3CN3A 3KLHC 1Q4NX 3ES6B 5DD5L 2W60A 1QFUH 2OCCB 2WLJA 3FH7A 3QDGB 4JQVC 4C57C 3FSWA 2JLPA 1JK9B 2CSPA 3VI3B 3LSOB 5E7BA 3WIIH 1CXLA 1PX8A 4L1TA 3ZYJA 4MJ2A 4CGTA 3TFBA 1H5BA 1NCNA 4DSYA 1X7SA 2Y7SA 4JMNA 3SDCB 3QEHA 4JPKH 4HSQA 2NW3A 4RAVA 1GCYA 3TBYB 1OTUC 3QS2A 1PZ2A 5DJAA 5AVWB 2X4OB 2VSCA 4CILA 1ID5I 4DP4X 4X5LA 4ANXA 4ADJA 2FJHA 3C6LA 4Y9BA 1AXSB 1KB5A 3KWWA 2NX5D 4U31A 5E8PA 5C0EA 3PNWB 3EZ8A 4L8SA 3INUL 4FFZH 4Z7QB 5I0VA 5ESQB 2CDFA 4ODXB 4B9CA 2ZSWB 3HE6B 3T2OA 2ZE0A 5F7LB 1TLMA 3IETA 3FB7B 2Q1EA 2A6JA 1IIIA 3LZFL 1U8MB 1IC5H 3F3HA 3CVHL 1NAML 4O58H 1BXUA 5DI8A 3HPLB 1NCWH 5DYFA 5T5FH 4MFHA 5H4YA 4TVPH 3VI4E 3TCLB 3VRIB 4BA8A 3OBAA 2Q76B 1WITA 4L3CB 1V3JA 4HJ0D 3CFBA 4MWFA 4L3FA 2Y72A 3FFDB 3O81A 5IBLD 4KKQA 3NCJL 3GSVA 1FH2A 4O2EA 2X9YA 1SVBA 2Z65C 4DZ8B 1CMOA 1PCXA 2YQBA 2I5YL 3JVFC 3O2WH 4DN3H 1CL7H 4JKPH 4JRXE 4IOIA 4HSCX 3GSXA 1IM3B 1KIRA 3QFDA 2VM9A 3CBRA 3QPQC 4HUUB 4KRLB 4TQEL 3HAEH 1T1ZA 2AKRA 2QKIB 3S35L 1RZQA 2Q7NA 2J8HA 3P4MB 4MTMA 2UZYA 4QEGA 3U46A 5FOBA 4BHUI 5KWYC 5CD5D 5GJSL 2RIKA 5F7DB 3SPIA 2BH0A 3WNOA 1SRDA 3ILPB 3T77B 3H9SD 1G0XA 3EG9B 4UUJB 4DETA 1CLOH 4A2MA 3UZQB 1JRHI 3G08A 1J9QA 2QTEA 2NQCA 4X4ME 4P46D 3FCSB 5E8EA 4J39A 3I3DA 3DVFA 4P2OA 5ISZE 4N3UA 2AZUA 3OKNA 3G5ZA 4LEBA 4I18A 3QT2A 4EXPX 2WKOA 2YARA 2N0MA 3O9WB 4K4KA 3CHQA 2DBLH 4B96A 3U1SL 1MFCH 4TSCH 4ZFOA 5JR1L 1JXJA 4G8GB 4Y4HB 4GW4A 1MCBA 2YAHA 1I3GL 4Q56A 5T3XH 5JW4N 1A9VA 5I0DA 1B4RA 4M8VA 2PW2A 2E56A 3D9AH 2N7AA 4GRLD 2Z1PA 3L1FA 3MLYL 3HG1D 4RDQG 1BSIA 1AMYA 2CD0A 4R26L 5FGBC 1JCKA 4QKTA 3VG9B 1H8SA 1MQ8A 2UWEB 3OD3A 5JPMC 1BGXL 1HWWA 2SEBB 2X1OA 3UFIA 3L7FA 3LRKA 3MPCA 3BP4B 1VRSA 4HJEA 4JREB 4AJ0A 1JPSH 1J0HA 2ORBH 1MQKH 3B2DC 1JFQL 3V0DA 3OAWA 2WV3A 2Z8VC 5FO2A 4KAQL 3U2SB 3FOMB 2QDVA 2V6HA 4LSSL 1U8JB 3MLXH 4HKZA 3LKNA 1GGBH 4XC3L 4BEIA 5D72L 4P57B 1XMWA 4UMGA 4U7SA 5I1AB 1HCZA 5EZJA 1GGIH 1PD1A 4EIUA 4NLAA 4D7PA 4HZAA 4OZIF 4WW2C 1FSKC 1TNMA 3LEYH 3V6FB 5CCHE 4ETYA 2D0HA 3ZSSA 2SODB 2IBZX 3AZUA 4PJGE 3UP1A 1FBIH 1BEYH 5C09D 1UH4A 2WBKA 3NPSC 4PW4A 2BDNH 5L2KB 1KACB 4QOKB 3MLTB 1OAQH 4HK3J 4NFCA 2WLNA 3GD1C 1KC5H 4P46A 2XQYG 2H2PD 2FX8H 4LCIH 1D5MA 4KJQD 1Z6JT 3VFGL 1ED3A 3CFJA 2H4EA 3ZN6A 1YJDH 3RWIB 4FP8L 1KTKE 4XP9L 2FCBA 3IJEA 4J2XA 2BSTA 1NOFA 1EXUA 2IBZY 5C8JA 3HIZA 3BMVA 4NEHB 3L1EA 5CUSH 1ZLWH 5J6GA 2WPGA 4XMUA 1OK8A 3WMSA 1G7MA 1UZ8A 1A0QH 2ZOWA 3HUJB 1KTCA 3KW7A 4GW1A 4GQZA 3T3MB 1RUPL 1ADQH 2NY0D 1PU0A 2OTWB 3BSZH 5FS5A 5H35A 5TE4H 5IHUL 1E2WA 2WZ0A 3KVQA 3L3HA 4G6JL 5CZKA 2QGEA 2GJ6E 3VSTA 5IJKA 5LN8A 2MPVA 1IEHA 1A7QL 2NYZA 5KS9E 1U8IB 3X17A 4LP5A 2LV4A 1C08A 2IWFA 4Q2ZB 3KLQA 1ZTXH 1TOXA 3RYMA 5A2FA 1O9ZA 1O7VA 1R75A 2KH2B 4H1LB 4Q52A 1LNUB 5HJGA 3GPEA 5TDNA 4PJ7A 5HYJD 4LASL 2A6IA 2OSXA 4Y5YC 4Y9CA 1HI6A 3ALXA 3KWUA 4ZMNA 3T0AA 5I1LA 5CLXA 3T6VA 5IIEB 3VH8A 1V10A 3IDMB 3FU7A 4I5BA 4JAMB 3NRFA 1YEKL 4GJTB 3WJLA 1F0LA 5E8OA 3F12B 3NJVA 2X6VA 3TEYA 1C7SA 3K72A 2B4CH 1QASA 2J4WH 1FG9C 3C2AH 3P3RA 1K3IA 3QORD 4IU2B 5C0GA 5IHLB 1DZ0A 5HYSA 5C6TL 4FHBD 5KYUA 3IDJB 4TQHA 4HT1H 5JHLH 4TVPL 4L05A 2DYPD 5D5ME 3QIWC 1NFDA 3KXFB 2EKSB 3ESOA 4H5SB 2DBJA 1SXNA 4ZQKB 4TVSa 3K5RA 4HPOH 1IGFH 1UA3A 3UYRH 3V5HB 1E90A 3NIDF 3QJFA 2R69A 1OF2B 3LN5B 2HVKA 1FIGH 2HKAA 2C4FT 1BXVA 2CCLA 3MJ7A 3KD4A 3R1GL 3QIBC 4PJBE 1ZLSH 3BW9A 1INDL 5ALBL 1UGNA 5IQ7H 2E27H 4RAUA 1YN6A 5CD3B 2FIKB 4MMXC 2KKQA 5TF1H 43C9A 1ZHNA 3ULVD 3RE0A 5F89B 1HQRB 3IKCA 2GTWB 3EOAB 2B1OA 3PAVA 4R90L 3CH8A 3B37A 3GXPA 3G6JA 1AD0A 1SLXA 3SGKC 3P4LA 4ECNA 3WN5C 1KCVL 1U8NA 1IFHL 1WWCA 2WXHA 4LRNL 3L9BA 3ZY7A 3LKPA 3Q01A 3WFDH 1M57B 1PMYA 1RZ8B 5I1JL 2OI9B 4W6XB 5LBSH 2X2JA 4ODUA 5BXFB 1EZSA 3QJQB 2Y1YA 2R4RL 5C2BL 4NAMA 1J8RA 1FZKA 4PSRA 5JOPE 1MI5A 2XFGB 1NMCC 2XG4B 4I77L 4IRSD 5KBMA 2JJTA 5FM8A 1MHPL 2IH1A 3P40A 1XO8A 3U1QA 1MHCA 2ZX7A 3QIUC 3AY4A 2EDMA 1MFCL 4TSCL 1KG0B 3U4BL 1LILA 3CFQA 3CWGA 3WEBA 4ELMF 1USZA 2D8KA 4GG6B 4DZBB 1S9VA 4D7BA 5DUBA 3QORA 4FG6C 3CVCA 4K73A 3GZOA 2DJSA 3MV9B 1IC4H 4XC1H 3PWPB 1FFOB 1U92A 1NCBH 3BPNC 3D9AL 3JVGC 4YHYC 4WO4C 3QCVL 3VU2A 3LNHA 3AU1B 4KXDA 5AAMA 4MX7B 4QRTA 4Y19D 4JG0L 4YSCA 1D5ZB 1EXGA 3RPIB 2CHDA 2GJJA 4CBPA 4F93B 1IC0A 1MAJA 3SGJC 3POCA 5GGTH 4OI8A 3L5WA 4NN6B 4HLJA 3WD5L 1SNRA 3KNBA 2FEDC 1ZHBB 3V4UH 1ZKAA 2BOBA 1V27A 1JPSL 1MQKL 2WYIA 5FWQA 2WD0A 4DPRA 3ZKND 4QJ4B 1BZEA 1R3JB 2HKFH 4FQHB 3GZPA 1X3DA 4P23A 4HWNA 2I69A