2YKLH

Structure of human anti-nicotine fab fragment in complex with nicotine-11-yl-methyl-(4-ethylamino-4-oxo)-butanoate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
209
structure length
181
Chain Sequence
LLESGPGLVKPSETLSLTCTVSGGSIWGWIRQPPGKGLEWIGSIYSSGSTYYNPSLKSRVTTSVDTSKNQFSLRLSSVTAADTAVYYCVAWFGDLLSLKGVELWGQGTLVTVSSASTKGPSVFPLLGCLVKDYFPEPVTVSWNLTSGVHTFPAVLQSSGLYSLSSVVTCNVDHKPSNTKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB FRAGMENT, HEAVY CHAIN
publication title Different Binding Modes of Free and Carrier-Protein-Coupled Nicotine in a Human Monoclonal Antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 181
sequence length 209
ec nomenclature
pdb deposition date 2011-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yklH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yklH01
2YWZA 3IU4L 4MYWB 3X11B 4Z7NE 1RHHB 4I0KA 3L3DB 1IC4L 3TP4A 1UZ6F 5LBSL 3FRPG 4LPCA 4RDQF 1MFAL 4ODTH 1Z3GH 3BIBX 1MVUA 1X6LA 3PGDB 3S36X 4K7FB 4HDIB 1U95A 5GGUB 1K4DA 5HSFA 5IUSA 5TGBA 1NC4B 3QFJB 1U8PB 5H35B 2P1YA 1M7IB 4LRNH 2FATL 1YNLL 3CVHB 1DBBH 4PJEF 4YBQC 4XP4H 4JQIL 1BVLA 1HI6B 4Z6AT 5ANMB 3EJYD 4KDWA 1BBJB 2JJUA 2VNCA 4FG6D 4GKZA 3GMLB 3RWGB 2ID5A 1F3JB 1XF3A 4S1RL 5CILH 1RUML 4QYOA 4YHOH 1N6VA 3GBLA 4Y2DC 3UJJL 4KGJA 4XGZA 5D9SA 4MJ2A 4ESKA 2PETA 4K71C 4DFIA 3QFDA 1TZGL 4XZUB 1S7UA 1A6ZA 3QO1A 1RURL 4ODVH 3I50L 3Q6FB 2PKDA 4UV7H 5T3ZL 3C6SB 2Z8RA 3OPZH 4JO1L 1U6AL 1YEKL 4LARL 3RL1A 1FZOA 4HF5L 1BEYH 2A83A 5SX4H 3MRFB 1O0VA 5DEFA 2BCKA 4KKNA 3EJJX 1QSEB 2QQKH 4EIGB 3BN3B 1DUZA 4HWEH 5D5MA 3H2WA 3STZA 4D0CA 4HPOL 4YQXH 4KHXL 3KPRD 3ELAT 3I75A 5BVJB 1WZLA 4NO0D 4HZAA 4KI5D 3WFBH 3V6FA 5KN5A 2VZSA 3VRIA 5CINL 2Y06L 3LKNA 35C8L 3MJ8B 3IDYC 3WLWD 4KDTA 1WIOA 4NO3B 2A77H 4P3DB 4W6YB 2R0KL 3KPNA 15C8H 3ISWA 2C4XA 4FXGB 2Y72A 4ZUUB 5T1KB 1T1YB 4OT1H 4LSDA 4Q9RL 3WFDL 4KRPB 2YZ1A 2HRLA 4NKOA 2A6IA 3OQ3B 4GMSL 4YHNA 4G8GD 3DX7A 4JQXA 2VLRB 1QBMH 1MIEL 1PJ9A 2ADIA 3ZT7A 2YKLH 1YEEL 1PKQB 1RJYB 4N0RA 43CAB 5IK3A 2L7JA 5DT1L 5JPMA 1OARH 1JUFA 4PGCA 3QEUB 3LQAC 2OJEB 4JY6A 2R4RH 4P23D 5E2JA 2MQCA 5KSAD 1VPOH 1OHQA 2A6KA 1U3HB 4M1DL 4PP2A 3T1FB 4KK9C 1IEAB 3U4EA 5DMKB 2HT2C 4OCNC 1RUQL 1T7ZA 5CIPA 4K7PY 4YBHA 1S7SB 3B83A 3C5ZA 1F8TH 1EHLL 1U8OB 2EDQA 1YQ2A 4GBXD 4LHUD 2FB4H 2OXHA 3JSSA 1AJ7H 3UX9B 5E2WH 2NPLX 4GG6A 2DDQL 4G8GA 3EAKA 1PG7L 3AB0B 5EOQH 3VFOB 4GAJH 4ACPA 4YNYA 5EC1A 1T0MA 1U9KA 3F5WB 3QPXL 5JUEH 3DTXA 3NCEB 5KG9B 4FABL 3P4MA 2B4CL 4YZFE 3TN0B 4PLJD 3CFIC 5FA3A 3U0TA 4X6FA 2ORBL 3B3IA 4F8QA 5FKAA 3TCLB 2WM0A 5EU3B 4P23A 5KSAA 3RUGA 2EICA 4J8RA 4PRDA 3U0PB 2NX5B 1LK2A 1WEJH 1WBXB 3QT2A 1G7LB 2RQ8A 2EDEA 2MKWA 3NACL 4LHUA 3P3YA 4XXDB 5DDHA 3VRLF 1IQWH 4HKBA 1U8JA 1TQBB 3ARFA 3CXHJ 2UYLA 3NZ8A 3QJFB 1FL3B 2HTLC 4UNTA 5LQBH 3OXRA 2HJKA 2CR6A 3AVEA 1G1YA 5LGHL 4XPFL 4L5FL 3ZL4L 3VXRA 5CGYC 3WIHL 4E9LA 4ZOCA 4BZYA 1T1XA 3QPQC 2YA0A 1IGTB 1UADC 5DJ2A 1D6VH 2H32A 4JR9L 1NCWL 3S4SG 1J0JA 1LEKB 1XGTB 1LE9B 1QR1A 5AEAA 1MNUH 4FZEH 3OKLB 2P5ED 1IC1A 4Z9KB 2VL5B 5EUOF 4QOKD 5FM5O 2D2OA 4M7JL 5FUOH 3GM0A 4PGDB 4CW1A 1CDJA 2IAMD 1VSCA 3B9KD 1EHAA 4KK5C 1P6AB 4DK3A 1OD9A 2VUYA 4KDTC 5E7BA 1DBAL 2MCPH 1QNZH 2VSCA 2WLZA 2R23B 5DD5H 1LEIB 1JZ3A 1RSFA 3GGWA 1GHFL 1CE6A 3S36L 4M5ZH 5FHAL 1QSFE 4J6RH 4M62H 4GT7A 1PSKH 2W0LA 3BDBA 5E2UH 2HJLB 2VISA 4JQXC 4B0MM 5HGHB 4X6EA 2VZVA 4JE4B 4Q97A 5CGMA 5I1IL 2Q8AL 2X44D 4XBEH 4JZOB 4LP4A 2X4NB 4L4VE 4OLZL 3MBXH 5GISH 1C1EH 1Q9KB 3EYFA 5CP7B 3NH7L 1CLYH 2JE8A 5KZCB 3NFPA 1A5FH 1V05A 4F8TA 4E41D 5D1QB 4TVPE 4U1JB 2IAMA 4X6DB 4X5XB 3CC5A 5C70A 4HGWA 4XPBH 4CUCA 1CBVL 1TZHB 5DVNA 4H5SA 3C5ZC 1YC8A 3MGOA 1G7QB 3P2TA 3SHSA 4LLAA 5E5UB 1P7HL 3SKMB 1HH6B 1AGBB 4PJCF 4R7DA 2XV6B 3JTTA 3QZWA 4LLVA 3FMGH 4WO4D 3FZUC 4FQLL 4A2LA 3ET9F 5I6XB 3LPWA 5MERB 3LAFA 3MCKA 5IOPA 4M6OH 5C3TA 1CD9B 2F74A 1DANU 3OGOE 3O11B 1ZLUK 5EZJB 1DBML 1SM3L 2ICWJ 4ZOAA 3ORJA 1AKJD 2RIKA 2VDLH 4HFUL 3PWUA 3CVIL 4P23C 3IKKA 5KSAC 5J13B 2DM4A 4E41A 4YLQT 4MJ4A 1AY1L 4HWUA 4O9HL 3HI5H 2WINA 4R97B 1KJ2L 2D0GA 2PYFB 4BK4A 3HZVA 4L3EA 3QDME 4LLMB 5E6ID 4H8WL 3TBVB 3S35H 4XH2B 4Z5RB 2EE9A 1A2YA 3RZCB 1T2QH 2H2PD 3V52H 4DUWA 5LJYH 3L5WB 3EOBB 3L3JA 3VFMA 1I75A 2DTML 3ARGD 3HMWL 5AD0A 2GJJA 4P57A 3ARFC 2GITB 5SV3A 5LKNA 1Q72L 4XCNB 4D9RD 1MLBB 3O2DH 4WU5A 2CH8A 3ARVA 3DXAE 5IJKA 4F3FB 2M26A 1JNLL 1S7XB 4LNVA 1TTUA 3LEXB 3PDOB 3GMNA 4JN1L 1AKJA 3MMEB 3LV3A 1RUPL 4POUB 5D96C 5C0CE 5B8CA 4Z7WE 1YEDB 2DQDH 4PG2C 2VAAA 3L3GB 4ALAL 2DMCA 4X7CC 4HHAB 3LHPH 1NFDF 4ZTPH 4EI6B 4L8CB 3THML 3ULUL 3VMOA 3ARGA 4MNQD 4Z18A 2V9RA 5C9JA 1FFQA 1FIEA 1HOCA 1LP9B 4G6KL 4XHJD 4YDVB 8CGTA 4GRWH 3KPPA 3ULVD 1INDL 2FGWH 5IMLB 1WWAX 3WEXA 3KS0J 4NO2B 1G9MH 2P8LB 4JFHE 4NBXB 4GS7C 2EXYC 3IJYA 4ZFFB 1SBBA 1AE6H 4XC1L 4UIMB 4G6JL 1WAAF 4H1LB 3GSNL 1FYTB 5CKAA 3HUJE 1W72L 4U1MA 4HS3A 1XIWB 3PV6A 3MRJA 1EAJA 1PLGL 5IMOB 2UWEA 4RMRA 1R5WA 2JJWA 4PJXF 4F57L 2F8OA 4OD2A 3REVB 4HWBA 1G7IA 5B38B 2ERJC 3FQRB 1C5DA 1YY8B 4PJDA 4MJ6A 4ZSOA 1QFUH 2OTWB 5FCUL 3TBWA 4Y1AE 4V1DA 2BVPA 1OQXA 3FO9A 3RKPA 4Y0GA 4URTB 5DTFB 4QKXB 4MNQA 3QUYB 4Y5VB 3FTGB 2Z0BA 3D3VD 3DYPA 3DGGA 1I1AD 1UH3A 4DTGH 3BKJH 4ELMA 4YHYC 3GSRB 4AEIL 4MSWB 1OTTC 1ZVSB 5I9QB 2VLKB 4NJAL 4FFYL 4U6XB 2E27L 5E08L 1ZT7A 2V2TB 5MEPA 2CR3A 2J88L 4OZGF 3WNNA 4ZG1A 3V95A 2C3GA 1E4XH 3DX9A 3L3KB 3ZMRA 4PRID 4IEFB 5GS1A 3KYOB 3W9DA 2DKMA 2EYTB 4X9BA 4Z7VA 1A02N 3QUMA 1RZ7H 5LWYH 1E4KA 3UC0H 3QXUA 5C2UB 1A6WH 2VLRD 4M7KL 4YDIL 1QKZH 2JF1A 3UO1H 1MSPA 4ZDHB 3ZHLA 3I6LD 5EPMB 3ZKMC 1I7ZB 4M48L 3GI8L 4J1UA 3BGMA 2Y36H 2X70B 3KLAA 5MI0C 1J05A 1LK3L 3KS0H 5IM7A 3TJHC 1DJSA 2B1HH 3CFDB 4EUPB 5IFAL 5FYKH 5FYLH 5KVFL 1U3HD 3D0VA 3U4BL 4U31A 5JOPE 4AQ1B 5IJKC 1F4WH 3T0EB 3V5DB 3HAEG 5FHBH 4JKMA 4LPTA 5DMGC 1DQQB 2ZCHH 5GGRY 5C0NC 4PRIA 4OZFA 1V3LA 1I7UB 3PHSA 3F7VA 4JPKH 5ECJE 1GH7A 5K9QI 4RBPH 1DR9A 5J1SC 5B8CC 1CLZH 4RA3A 4R2GD 5HGGS 5GZNC 5K9KB 3HNSL 4PJ5B 1YEIL 1HILB 4U1HA 2NY6D 5EU4B 2QHRL 4CVXA 2V5MA 1HQRA 1OP9A 4WI8A 4EN3D 2DI7A 5EA0H 3B2UC 3QHZH 1F13A 5EOTA 3SE3A 4LF3B 4R3SA 4AYFA 3SY0A 2R69H 1KJ2B 4K3DH 4FQHB 4HD9A 1NAMA 2DM7A 4HC1A 4OCYH 3ZE0F 2GTZA 4WUUA 3BIKB 1XGUA 4RAVA 2OK0H 4Y19A 1KCSL 2KPNA 3F58H 2XTLA 3UPRB 1UM4H 1KIQA 5KJRL 1MJ7L 4G42B 4X99A 4RWYL 2V5SA 3I02A 1H5BC 2Z91A 2ARJB 4Y5YA 5AZEL 4PIRF 4N0CD 3I3DA 2NXYD 1AP2A 2DBLH 2GY5A 1NJ9B 1DANT 3Q2CA 4XB8A 3HS0B 5EN2A 5CJXC 4NQXB 4JY4B 2VB5A 1JGVH 3MJ7B 5BQ7A 2BXZA 5JORA 3FFCA 4M43L 3KPRE 4PGBA 1VACB 1RHFA 3KPTA 1P7QA 4PJEB 4XNMB 1MRCH 1ETZB 4APQB 1Z6JT 4HK0B 3AY4C 4KI5E 5T33L 4HIXH 2CKBA 2BNRA 3MREA 3CSGA 1CR9L 1SEQL 4H26B 5C0JA 2RAMA 4MWFB 5HY9A 4WFFD 4DGYL 1JGDB 1ZMYA 2VQUA 4XX1E 4NQCA 3MA7A 4ORZC 2O26U 2F8XC 2AGJL 4ZPVB 5EOCL 4PJ8B 1TLKA 4MQXD 3IAGC 4GG8B 3RWIB 2VLLB 4DQOH 3T2QA 9CGTA 4EDXA 4NGHL 4GG6E 1T03L 1K6QH 4GRLD 4G8GE 3T2OA 1JE6A 5GS1C 4NJ9L 1RZFH 4YHPA 5EZIH 4FQ1H 4NZRL 5HYSG 1NCCH 2XZAL 4PTUB 1HQ4A 5CP3A 2ENSA 3GSNB 3KPQB 4I2XA 4HUWB 2OZ4L 5B3JE 3PQYA 2DN7A 3RUGE 1I3RB 3ZDYE 1RFDH 4C4KT 1CQKA 5T3ZD 2V2WB 1MJUH 3OAUL 4ETYA 4TSCH 2B2XH 1FPTH 3V0WL 3VFPB 3MRBA 2E9JA 5D1QD 2WNGA 2ESVA 4YHZH 4PB9H 1UENA 1S9VB 4AEFA 4WTWA 4C54A 1K2DB 4FQJL 1CXIA 1LMKA 2HJFA 3KJ6H 4MXVE 3O41A 4AL8L 2LU3A 1JNNL 2Q6WB 3EKCA 2O5ZL 5MEND 5DUML 4WGWB 4D2NA 2Z4QB 2R56H 3DO7A 5I71C 2HN7B 5ID1B 2V7HA 4P9HH 3FJTA 3O0RL 3QWOA 3SGEH 1G7PA 4BKLB 1S7TB 5BOPA 4ODTL 4CAGA 1NCBH 1U91B 2YD9A 4JPWH 5T5NF 3SJVA 4Z7UE 4EI5B 3UMTA 2IFFH 5I19H 4UOW1 4LRNL 4PGJA 4NM8H 2OTUA 1KCLA 3P40A 3AS2A 4XP4L 1QG3A 3EO9L 1S7RA 1HINH 2HKFH 4WDIB 5ERWB 5A2JH 4L4JA 1EXUA 4IRSB 5D6CB 1RMFH 3HLAB 4LSPL 2D9QB 4PP1C 3GMMB 3P9MA 2P42B 3WSQH 3DUSA 3TA3A 2DLIA 3WUWB 3FT2A 2IPTH 4UTAL 1WIPA 1YDPB 3QUKB 5KAQF 1U8KB 2ZOLA 4ZQKB 4BZ2L 1XGRA 2OJZH 4I3RH 5ID0A 4LPYA 4UV7L 1X5JA 4YFLI 2IBZY 2W0FA 5GS0H 1DLFH 1CGSL 4AT6B 4N90D 5EB9A 3BWAA 3EUUA 3KGRA 1I3GL 2Z8SA 5ADOL 4GRWF 5FGBC 3VWKD 1VFMA 3RX5A 3HZYB 2QQKL 4X6CA 1MVFA 4BZ1H 1AQDA 4FTVD 4LLYA 5KTEH 3RWCA 2VERN 1T3FA 1F6FB 2QBWA 3QSKB 5D7JD 4AIZA 4KK8D 4QY8A 2VZ3A 5HI4C 5FB8B 1MREH 2WP3T 4JN2B 4HCRH 3L5XH 3WFBL 3BT2H 4YGVB 2A9NL 1KYOJ 3FONA 3DI3B 1QSVA 4YDJB 4CMMB 1BFOA 3H0TA 4ZFZB 5BZWA 3WIIL 3EYSL 4I0PD 5JZ7C 1QRND 3F62A 4R0LB 4YK4C 5AZ2H 2A6DA 3LKPA 2A77L 2YA2A 3U9UB 5DK0A 5I66B 3TO4B 3H9YA 5BJTB 1MHPL 2EYRB 4GAYB 1M71B 1PW3A 1QZ1A 1RJLB 3S35X 2VAJA 4XNQA 3FB5B 3VFGL 4JZJA 1IGMH 5TQ2H 3VWKA 1QBML 4HLJA 4JDTH 1QFPA 3CH1B 5F6IC 1MHEA 4JANB 4QRQA 2NY3D 5IMMB 4Y4HA 1JL8A 3LOWA 2AK1H 3JV4A 4P59H 4WWKA 5D7JA 5CSZB 4E41E 3L3OA 2XZZA 3LEYH 5DRNA 4JAMA 4PLOB 1OARL 4ELKA 4HIIA 5EFIB 3UAJD 5EUOB 1FVDB 3B2VH 4NKDA 3AU1A 4F33B 2CUHA 1VPOL 2DQUL 2AABH 5I8KH 5HGDB 1UT9A 2GYSA 3T3PE 4LCWB 2NTFA 3WKMH 3RY6A 4I0PA 5EULV 1DCLA 1QRNA 3IFOB 3T77A 1F8TL 2NY4C 1TJGH 3QUYD 3B4NA 3L7FB 5DSCA 2FB4L 4LKCA 2YWYA 5JMOC 2DLFL 1G7HB 5BVPH 1V7NL 4IRZH 3VXSD 1CDBA 4MNHB 4FQQA 5EOQL 1OAKH 4GAJL 4G9FA 5F7NC 5SX4I 4ENEC 3K2UL 3L5JA 4XNXH 3C60B 4JFDB 3WXVL 2FZ3A 5EZLB 1RUKH 3NCBB 1I4FB 1N2RA 2YD8A 3ARBC 1MEXH 3MYJA 3QEGH 5B21A 5IJVB 2CDFA 3VXTB 2NYYD 4CJ1A 2BHUA 4KJPC 5I8CA 2AXJA 3S96A 3T4YA 4B50A 3WIHA 3O9WB 3TWCL 3IRZA 4DKFH 3HNTH 1KELH 1MFBL 3ARTA 4JKPH 3QQ9C 5IHZB 4LMQI 3LKQB 3S7GA 4JPVH 4KROD 3TA3C 2PN5A 2E9IA 3SDXA 2CRZA 4JRXB 2HT4C 4OZHE 5DVLA 4D9RE 4TUOA 1IQWL 2WK2A 4PJCB 4KUCF 3OXSB 2OSLA 1JF6A 5C0RH 3VI4F 4JCLA 1CXLA 4P46D 4OZIE 1U3YA 3HCVB 1FH5H 4PJGF 5KS9F 3VGAC 1R3JA 4G43B 4WW2C 2JCCA 2MMXA 5E5RB 43C9A 4Y4FD 1MI5B 1DE4A 1SEBB 1D6VL 4MAYA 5HVHB 1W0YT 1H3TA 4NN5B 4U1IB 1CD1B 4JQVC 1A1NB 3KYNA 1MNUL 4FZEL 3HB3D 1ADQH 1T6WA 3OG6B 3RA7H 4NHUA 4PJBA 4RQQA 5FUOL 4MNQE 4PJIA 5IIEA 2CRIA 3O6FB 1RK0A 4I3SH 2VDNH 3MUJA 3MXVH 4ELME 2MCPL 1NC2D 3ULVE 2NNAB 4KVNH 5DD5L 4LGRB 1RJZB 5IW1B 2Q7YA 2E6JA 4XWOD 3RGVA 4O5LH 4OUOA 2Q86B 4ZXBD 2DLTA 4J6RL 4R4BA 2NZIA 4M62L 4L8DA 4NNXA 4P2RA 5IKCA 1IM9D 4KVCL 1PSKL 1S9XB 2CDGA 1DBJL 1T7XA 4JZJC 2AP2A 5E2UL 1T4KA 4M3KB 1C12B 3QWRD 3C9NB 4Y4FA 4NC1C 4YE4H 2R2HB 2NXZC 4XBEL 5DHXB 4Y4HC 5ENWA 5IFHH 4YIQA 1FVCB 3QDGD 4WWKC 1NCAH 5GISL 4KK8C 3H7LA 1CLYL 4PY8J 4CADA 4PRHD 2CRMA 5DJDB 2R2CA 1YPZF 3TIEA 4N5UA 2F53A 2VN4A 5C09B 3G6AA 3Q1SL 1EPFA 2CMRH 3D3VE 1J8HA 1P4BH 5I15L 1JYXA 3V9FA 1NC2A 2EO1A 3U9PH 1PEWA 4JY5H 2W65B 5HYQB 2B1AL 2ZUVA 3CSYA 3HE6A 4ZXBA 1T7YA 3AM8C 2YK1H 5ADPH 1IM9A 1X5GA 4L8SA 4ZYKB 1QQDA 3IU3B 3IDMA 1FVEB 4NC2B 2NCMA 5E8EB 2VDMH 3LN4A 5DRXA 1HHIA 4PRIE 4ZUSB 1DEEA 1FG2B 3D25B 4FOMA 3OBAA 4F2MB 1YJDC 3BPLC 5HYFA 3ULUD 1GZQB 4M6OL 1BLNA 2WIIA 4X4XA 3EIFA 4PJXB 4PJ7E 2BSSA 3RJQB 2I5YH 4GXVH 2VDLL 4YEFA 2VABB 2XTJC 3ARYA 4I77H 3LPGA 5C07D 1MAJA 3I6LE 4F7CB 4X7EC 3R8QA 1CFNA 2Y25A 2DIAA 5E2TH 4NDMA 1DEDA 4ODXB 2HFFA 2IAND 2BVQB 3S35L 4G7VL 2DJ4A 2ZCKH 3R06A 2X1OA 1T2QL 3NGBB 2APWA 1CFSA 2X1WL 2OCFD 2R2BA 4NQVB 4PJ9D 3ZDXF 3DNKA 5F3HA 2NZ9C 3MLWL 4XI5D 1ZLSH 5DHVA 2IQAB 1VERA 3F7YA 1CN4A 1NGYA 1HWHB 3CDFA 3D39D 1CFVL 32C2A 3G6JA 3F6LA 3GJEA 5F9WC 4OZGB 2D7TH 3MO1A 1A6TB 3H3KA 2P44B 4QEGA 3CFCH 3HPLB 5HHOB 4D94A 4MAYC 1KTDB 1XH3B 5EUKA 2VZOA 1BGXH 2EDRA 3T0VA 4X8XA 3CZFA 4XVTH 5I1CH 4ZUTA 3ULSB 3CIQA 2DQIL 2GK0B 5C07A 3MZTA 2FHFA 4L4TB 1JPFA 2AKRA 2DQDL 2ICEA 1J0IA 3UYRH 1DVFD 3IDGA 4JFFD 4CNIA 1UB6A 3WO4C 3CFEA 3BQUB 1R3HB 3NAAH 3FQTA 4M00A 2BNRE 2GTWB 1W72A 2BNQB 1MQKH 4F9LC 3LHPL 2VDRH 5J12B 1Q94A 4ZTPL 4JO2H 5GGTH 4PJ9A 4E5XB 3BI9X 5DJ6B 3HG1B 2F5AH 4M6MH 4NQCE 3U6RB 2GKIA 3RGVC 4N5ED 2J3SA 1Q1JH 4TTDC 1OGAD 4WNQB 1DQTA 2FGWL 5ITBH 3OX8A 5L2JA 2WBJD 1NLBL 2KBGA 2FJGB 5GJSH 1G9ML 3JWDC 3X12B 1IAKA 2VUOA 5EO0A 3ZT6A 4QXUH 4M1CD 3EYUH 3FRUB 1IT9L 2YPKB 3SKJL 1KEGH 2ADFH 1REIA 2ENYA 4Y8DC 3FQUA 1ES0A 1WFUA 4C56D 1S9YA 4JO3H 4TUJB 1BM3L 3WDJA 3IXTB 4U6TA 1N64H 1DVFA 4JFFA 4R4FL 5B39A 5HYSB 4I2XE 1BAFH 1QFUL 2X4OA 4XNZB 5F96L 3X3GH 1P5VA 4HMCA 4G6MH 1U93A 4M6NL 1OVZA 4WFFE 5JLZA 2AI0H 1CTNA 1UB5B 4MNGA 3GMOB 1ZLUH 3HE6C 1GC1H 4DTGL 3BKJL 1E0OB 2AXHA 3CCHA 1ZT1B 3CSBA 4L8SC 3TH3T 3OKDB 1TNMA 4NZTH 3C8DA 1T5WB 2WBWB 1T1ZB 1A7OH 4F7PA 3LS5H 5DYOB 4XPGH 3MNVA 4EVNA 1SYSB 2CUIA 4D9QD 1XGPA 4LCUA 2G9HA 3EDJA 3IDIB 1DTUA 5JPNA 3K3QA 1A64A 3ARRA 4F58H 3QI9B 1E4XL 3KYKL 1F6AB 1FP5A 1IZKA 4OGXH 2HT3D 2LABA 3NCMA 4UB0L 2PO6C 4AM0B 2DLGA 3NFSH 1FORL 5DVKA 4HULB 5F89A 3V0AC 3D5OF 5DQ9B 3UC0L 2EEBA 3D2UA 3PHOA 5CUSL 2EXWD 5T3ZE 4QRTB 2IBGA 5F21B 1QKZL 2NW3A 1QLRB 3UBXI 4KY1L 4HWZB 2C7UA 5MEQB 5IROA 4F80A 1YYLH 5DI8A 2FLBT 4BK5A 3QO0A 3QG6A 2YD5A 1Q0XH 3E0GA 1IAOB 3GBMH 3OR7B 4YWGH 2PF6A 5FYLL 4G8EB 5FYKL 1KOAA 1EVUA 2WUBL 4JFQB 1HK6A 5MENE 5C0AD 2XKNB 1NMCB 4UU9A 1F4WL 3X17A 4IJ3C 5FHBL 1IEBB 3GMPB 3WO3B 2GJ6A 1PKOA 4PBVC 2ZCHL 5DQJA 1WBZA 3OL2A 5F88A 5J3HC 1MJJA 4JPKL 1BJMA 1B4JH 4HQQH 3S98A 3K8LA 3QDJB 3H9SB 3MGTB 1CLZL 4X6CE 3A6BH 1JWSA 4K3JL 5C0IA 5IQ7H 4Q9QH 5D2LA 3RIAK 5I1LB 4LSQL 3FO1B 5JR1H 3ARWA 1I3UA 3C60D 1VADA 5HDLA 1PAMA 2WZPD 3K4AA 1I1CA 4NRXA 2HVKB 5D7LB 3GKWL 2VO5A 3PWNB 1YNKH 3FN9A 5H37G 1HIML 2QKIB 1XR9B 4GO6B 2NY0D 2AJXL 2FJFA 3E6HA 5D93C 5A3IC 5I17A 4HH8A 1LO2H 2V5TA 1TZIA 2R69L 3DSNA 4K3DL 4WHYH 1HDMA 3MRIB 1BZ9A 4OCWH 2W0KA 3M17A 2C1OA 4OCYL 2UVEA 2NY1C 4QRUB 1G0YR 2OK0L 2GUOA 4N90E 1UM4L 3TVMC 2CLZB 4RMTA 4P4KD 3VFRA 4L9LB 3MROB 5DURD 3N1FC 2AXFA 1E4XI 4NNYA 3D48R 1E27B 3W39A 4LEXH 1WITA 4PTTB 4UOW0 4FTVE 4ISVB 2NMSA 4JREB 4MA8L 3KPOB 4P2OB 5H2BB 3C6LB 3UTQA 2O5YL 5DZNA 5HPMB 2R1YB 3X13A 3RFZC 5FUCC 3UXFA 4W70A 4R9HA 1A7BA 4PRAA 4WI9A 4ODUB 1A6UH 3R1GH 4HIXL 3U30C 3KXFB 1BZ7B 1R3KA 4N0UB 3VGGA 3BPOB 2P43B 4RIRA 1QRNE 3GSVA 3UTZB 2WWKT 2YD3A 4NO5A 4PJHA 5DJZB 4EDWH 3UBXB 3P0YH 2YBRA 5EBLA 5DK3A 2OZ4A 1OAUL 4JG0L 1S8DB 1FO0L 1RULH 3WN5B 3D18A 4MD5B 1GYAA 4H20H 4M7LH 5CBAB 3OR6A 2GSIB 1K6QL 3ZE2E 2VKWA 2AERT 1TCMA 1RZFL 4KJWD 3VFVA 1MHHA 4GRWB 5JIPA 1J1PL 4K9EH 5EZIL 3FB6A 5ICYA 4CDGC 1KCVH 3WL9B 4FQ1L 3B8YA 1CFTA 4O2FB 3TIDA 2CJUL 2IMMA 2ICWB 1H15A 3LH2L 5E4EB 5IROC 4JDZA 1DQLH 4W6XB 3RZWA 3DV4B 3IVKB 1MJUL 4LCIL 5ICZB 4TSCL 2B2XL 4H25A 4L3CB 2C3VB 5TDPA 4OGYH 2BVOB 1XF4B 4OGZA 4YHZL 1Z9MA 1UYWL 3DWTA 4PB9L 5C09D 5HGBA 1ZEAH 1H3VA 1JYVA 3OTTA 5BO1H 3DIFA 4OM0L 2E6QA 3KJ6L 4CVUA 4IS6B 2E7MA 1DL7L 1CE1L 3VXSE 1S7QB 3SO3B 4MXQD 4LU5H 1X4YA 3CU1A 1A4JB 3HZMB 2R56L 3B9AA 3OGCA 1OTUC 1KTRL 4MS8C 2JCCE 4P9HL 1AGCB 3BEWB 1OPGL 3O6LL 3VMPA 3KPLB 1OAYL 3ALWA 1VEPA 2APXA 3OHXB 1FZKB 1NCBL 4XAWH 4JPWL 5HTSA 2IADB 3PGCB 4HV8A 4OQTH 4DVBA 1ZGLM 2ZUWA 4XRCA 1JHKH 3JWNC 1W0WA 4QT5B 4P2QB 2Q8BH 3QUZA 2HRPH 3FQWB 3BZDA 2XFXA 1E6JH 3RDTD 3AREA 1ZHLA 4I48A 2D9CA 1HINL 2Z31D 5F9OL 4PJIE 4MX7B 1AO7B 4ZAKC 2WW8A 3E8UL 1ED3B 3DROB 1KB5A 1FDLL 1KG0A 2HFGH 3WSQL 1II4E 3OZ9H 1BMGA 4AEHH 1WTLA 5AYUH 5IVXE 2IPTL 4MJIA 2G60L 2OJZL 4I3RL 1GGIL 2X42A 5CEYA 2WWMD 3P77B 2CXGA 3VG0H 3SQBA 3J8F7 4HIHA 4AZ8A 1YN7B 2HA1A 4OFVA 3L5IA 3OB8A 4HIEA 2YSSA 3BKYH 5E5MB 5D1XC 5I1AB 3K1DA 3DVNA 8FABA 4EOWH 3P9LB 5L2KD 4NSKA 1AFVH 3GEWB 3NCJH 4YZFF 4HUVB 4NZUH 4BZ1L 4ERSH 2R8SH 5F7EL 1RI8A 4OZ4A 1DUYB 5GJTH 4AENA 2R9HD 4XC3H 2EE2A 5C86A 4GRMB 5HYJB 4RGNB 4OLXH 5E1AA 3GRWA 5GIRA 4G8FA 2HFEB 3L5XL 3BT2L 3BQUD 5I73C 5I74B 5E00B 3EO1B 5EC2A 3CDYA 5EU7E 5SWSB 3FT3A 1AGEA 2BNQD 2YN3A 1EK3A 1FNAA 4FQ2L 1WT5A 3NN8A 3MJ9A 3HG1D 3E2HC 3PWJB 2W60A 3O3DB 1Q0YH 4TNVK 3VGDA 4PJGB 5J7CC 6CGTA 4BFGA 3RVVC 5DMYA 1IGML 1UZ6E 3QDGE 3BDYH 5TQ2L 3SGEI 4JDTL 4C57C 5I1DB 1BX2B 4EQ3A 4PRHE 1KENH 1BZQK 4P59L 3MV8A 2PW2B 3B43A 2XIDA 3FHAA 4MDJB 3HC3H 1RIUH 3SEPA 3B2VL 3VRJA 2L7UA 1UZ8B 2P7TA 4TQEH 3HPJB 5D8JH 1RHHA 4HJ0C 2WUCL 3L3DA 2AABL 4JGMA 3LS4L 1GRWA 4JVPA 2WIMA 3WKML 3BN9C 4NQEB 1YN6B 3WFHA 1TJGL 5DLMH 1HYSC 1FBIH 1EEQA 5J1AB 4HXAH 4OB5L 1UJ3A 4RFOH 3G5ZB 1KIPB 4K7FA 1JGUH 3G6JE 1EAPA 1RZ8B 4QHMB 1NC4A 1T21B 2YMXL 5H35A 3ULUE 2LVCA 3SQOL 1OAKL 4LLQB 3QULA 4JM2A 2YPVH 5FGCB 5ANMA 4XNXL 1BBJA 3SPVB 1N4XL 5DJ0A 1RUKL 3RWGA 5CIPH 3NIDE 5C07E 3JXAA 5IB1B 3S3PA 3QEGL 3QUZC 5IB2B 1CTOA 3UYPA 2H3NA 3AREC 3PWLA 4JRWA 4MCYA 1YPZB 2IANE 2GQHA 1TETH 5KVEH 4DKFL 3HNTL 1KELL 2E7BA 1N3NA 2V2XA 3BFOA 4ZUVB 1FFPA 5D2NA 3D0LB 3PE9A 4NN7B 4B5EA 5JOEA 1BQLH 1JGEB 4Z0BH 4AEEA 4LGPB 3BWUC 3D39E 4CKVX 1JPGB 3BD5A 3RWDB 3HNVH 1NCUA 1Z0NA 1FH5L 2LTQB 2YRPA 3PHQB 1BQHA 4CRPA 5SWZD 5IFJB 5BVJA 5B4MD 3O2WL 2J8UA 1NBZB 4LQFH 4JKKA 1J18A 2MKLC 5I75B 4JFFE 4W4NA 4GSDL 3MJ8A 2VDOL 3FKUS 4YHLH 4ONFL 4HMDA 3H9SD 5ESQB 1ADQL 1UCBL 4G8IB 3WDIA 3RA7L 2BVYA 1T0PB 2XA8H 1N0XH 5K9OB 5T1KA 1T1YA 4MNGE 3VFSA 1G0DA 2CK2A 3QUXD 1U8MA 4I3SL 4M93B 4UZGA 2VDNL 2WQRA 1OGAE 3MXVL 1WT5C 4Y16A 4MHHG 1KT2B 1B0GB 2H32H 4O5LL 5IBUG 1NANI 1EVTC 1CU4H 1LVEA 1PKQA 5EIIB 3LQZB 5JOFA 43CAA 5FK9B 1NGWB 2F54B 4DZ8A 4LVHC 3VXUB 4WUKH 4X4YB 4JFYB 5D1ZB 3I85A 4C56E 4YE4L 2BOBB 3AGVA 1IILE 1NKOA 3T1FA 5DF0A 5IFHL 3BRDA 3WJJA 2R9HC 4QRRB 3NCYP 5DMKA 1ZS8A 4Z7WF 4FFVD 5I8OH 1U8OA 4M8QA 3QXWA 1VFBB 2YR3A 2EIBA 5DR5H 3ROOA 4U1KA 1HXMA 2YPLB 2CMRL 2FECL 1P4BL 5CEZH 4K55A 2FBJL 3S5LA 5EU5B 3VFOA 3U9PL 4P5TB 1JP5A 3KXFD 1G9NC 1PX4A 3RIFK 2P5WD 1F45A 2YD1A 4P3CH 5KG9A 2VLJD 4R7NB 1FL5A 4K7PH 5BMFH 3BZ4A 3TN0A 1FJ1B 5HVWA 3QNZA 2GJ6E 3NPSB 3TCLA 5MEOB 2VDML 4JM2C 3HUJF 3ZYIA 1CG9B 3SE4A 3LVEA 4KK6D 1I85C 1CD8A 3QXVA 2YUXA 2X4UA 3SDAD 2NX5A 1NUDA 5F72S 1CICD 1P2CB 2EDNA 2XN9B 3PABB 3DUUA 1E28B 3VH8G 1B9ZA 4UT9H 1WBXA 2IH3A 4M03A 3W2DH 4LSVH 4GXVL 4PB0H 5BV7L 3UTPD 3ARQA 4I77L 2HVJB 1KXQE 1KUMA 5DQDH 1X5FA 1HHKB 2Y6SD 1A9BB 2C9AA 4X5WB 4RRPA 2XZCH 4HAFA 3VXMD 4GXUM 2WANA 1HHHB 2ZCKL 1AGFA 3QEQD 1DSFH 4U1GB 5E24E 3R4DA 2P5WA 5C0AE 4Y4KB 2IQ9H 4LIQL 2VLJA 4KTYA 1IGTA 1J87A 3C09B 2BRRH 4LEOB 1QPXA 1ZLSL 1DN0A 4Y5XB 5DZLA 4XCCH 2FIKA 1D5XB 1JFQH 3H9HB 4ODSH 3ABZA 1A7QH 3ARDB 2G75B 3SDAA 5DD3H 1VKXB 3OKLA 1J1OH 1JN6B 2WLYA 5T1LA 3CFCL 2DLHA 2PCPB 1TTGA 1RZKC 2XWTA 5DJAB 1P7KB 4XVTL 5I1CL 3W9EB 4ZOBA 1B4RA 1A0QL 3TYFA 2R23A 4I18B 1LEIA 5HHNB 3UYRL 4XCYB 4BH7A 2X9XA 3BP7A 3ZLQC 1ZANL 4KRPC 3VXMA 1QFWH 1HNGA 2FECI 4LLUA 1BFSA 3A0OA 2E5EA 4P2QD 4JVWA 4RFNB 4Y16C 4JO2L 5GGTL 5SWQA 5F7DA 1H3WM 2AS5M 5I76B 4M6ML 3BH9A 2P8PA 5K9JL 1X5LA 4PJHE 1GPOH 1Q1JL 1AHWB 1KN2L 2ZCLH 3KNBB 4BH8A 2X4NA 5E8NB 4Q2ZA 1Y6NR 3V79C 3PL6A 1IL1B 1Q9KA 5GSVB 1AIFB 5IP4A 1FIGL 2JLLA 4RAUA 3SDDB 2IFGA 4YAQA 1B6DA 1PQZB 1HNFA 2FD6H 4DWHA 4U1JA 2XNAB 1ZA6B 2BFVH 4R90L 3WJJC 3MLXH 2R1WA 5BRZD 3WIFA 3OJDB 4GKOA 2MSPA 1BBDL 3IDJB 5D5MF 4N8VG 5FYKD 5FYLD 2V7NA 3MRLB 1G7QA 2Z35B 1N64L 3PWVB 4U1NB 3SKMA 5JW4Q 1HH9A 1A7NH 5C6TH 4IOFC 4AIXA 3O2VH 1AR1C 3DRQB 2FO1A 2EYSA 3RKDC 3ARSA 3V6OA 5HYJD 3EDKA 3VG9B 1U2CA 1GC1L 1ZV5A 4R4ND 3R0MA 4OIIL 2EKSA 2GJZA 3GHEH 2YA1A 3TN0C 4S1DC 4HWBH 4YHKH 2Z8VC 3WE6B 4H0HB 1A7OL 4R96B 5SWSD 4JJ5A 2DWDB 4XPGL 1K85A 1K4CB 4JFZH 4ETQB 5IHBA 2CRYA 2PYFA 2W59A 4JHBA 3B9EA 5L88H 12E8H 4LLMA 4OGXL 3QQ3B 3AMLA 3TBVA 4WIQA 4XH2A 4UT6H 4Z77B 3NFSL 1ORQB 2H45A 3ULVH 4XCEA 4CBPA 2GITA 5DRWA 5H94A 2L4OA 4XCNA 2DKUA 4KI5F 1MLBA 1HSBB 5CJ8A 3X14A 1C08A 1K8IA 4FXLA 1YY9D 2X4TB 5F8RC 5B39G 4JFOB 1NFDE 3TGXA 1U92A 1VESA 4PPTA 1WZ1L 1F58H 1Q0XL 3IJSA 3GBML 1FV1B 3LEXA 3EYVA 3QUMH 1LE5B 4S1QL 1I7RB 4MJIE 5T3XL 4Z78B 2KQMA 1KBGH 2VZUA 1YEDA 1R5VB 2D03H 4GG6F 1SQ2N 3L3HA 5KSBA 3N1MC 5DJ8A 4FQXB 4LMQE 3T1WA 1WAAE 4QTHB 3F12B 3QYCA 4HHAA 1KPVB 4Q6YA 4L8CA 1B4JL 4HQQL 3RPIB 1ZHBA 4ONHA 4CMHB 5C92A 4Q9QL 3DV6B 2FR4B 2A38A 1U2HA 1I1RA 1LP9A 5JR1L 5B3JF 4YDVA 3RUGF 3TFKD 1A9EB 1FNHA 4NQUA 5IMLA 1FLRH 3WUZA 4X6BB 1MCNA 3E6FA 3SGKA 3QXTA 5C7XH 3IGAB 1LEGB 3GBNH 4KQ3H 4LOUC 4JFPB 4GKSB 4UIMA 3NFNB 4OZFH 5D70L 3MBEB 3VXNA 3F6IA 1A47A 1QA9B 2FX9H 2LFGA 3PL6C 4D0BB 25C8H 4OCWL 3PNWB 2EDLA 3U2SB 2QHLA 3OSKA 1IGJB 3RVUD 2J5LB 1MRFL 1F3RB 4YR6B 3L95A 1ZT4A 2XXCB 2OS7A 5L2KE 2RCSL 4U6YA 1PX3A 4HJGB 3FTGA 4Z7UF 2EDOA 1FO0A 3RX7A 3D9AH 3WYRA 3GSRA 1NAMH 4RNRB 4HC1H 4MSWA 1ZVSA 2OI9B 4P99A 4K3GA 2CPCA 1G1CA 1A6UL 4OD1L 3R1GL 5I6XC 2V2TA 5HHPB 4X7SL 1UWEH 3BKML 1O7SA 3WFCH 5C9KA 4PG9B 4YXHL 3HR5A 1A1MB 1JPST 2C3XA 1KN4H 2OTPA 2EYTA 2RFXA 3KYOA 3N9GH 1A3RH 1FNGB 3FRPA 5JDJA 1FAIH 4GLRH 5J13C 4D3CH 4O2CA 3S6CA 1NSNH 2HKHH 4H20L 3RNKA 2AW2A 3GMRA 5BZDB 3KR3H 4K07A 1INEL 4HK3J 1KIRB 1K5NB 1JMZA 3TLRA 2E7HA 5DRZA 2CKBH 4L9DA 2V17H 3CXDL 4U49A 1TPXB 1T0NA 1XGQA 2X70A 4U2YA 2XQYK 3VXUD 4NKIH 1B0RB 1XR8A 3IFLH 1FZMB 2AEPH 2ADGB 1DZBA 4K2UL 5IWLC 1BF2A 4DVRL 5HHQB 5TH2B 2BERA 5FA4A 2A74B 3VA6A 3L6FB 1F6LL 2X40A 3T0EA 3IXAB 3UZEA 5IT2H 3C87A 2N56A 1J11A 1DQQA 4OGYL 4FZ8H 5TDNB 5J56B 2X4SB 5D2NE 3JUYA 1MCLA 4GQPH 3ZSSA 1D9KB 5CSGA 1ZEAL 1NH6A 4BFIA 3BP4A 5BO1L 1Y0LB 4LSUL 4G5ZH 1KJMB 3NABL 5CP3H 1OM3H 4N0YH 4LU5L 4UQ2A 1N59A 2QADB 1RZJC 3LDBB 2XACC 3KJ4C 1UKSA 1SVZA 4HLZG 3LQAL 5DK2B 1MFAH 2A1WH 3GB7B 3N06B 2J8UE 3UDWA 2XG5A 4XAWL 4MQSB 4LF3A 3TM6A 3MRCB 4OQTL 5FCSH 4FQHA 5KBNC 3O3BB 3P4NA 2Q7NA 2O61B 2Q8BL 3DJ9A 3K8KA 1E6JL 3BIKA 4XBGA 3V4VL 2HG5B 5DD1L 4JQIH 3UPRA 3PXHA 2HP4A 1XIWC 3LKRB 4X7TA 1AGDB 2GAZB 2BOCB 4S1RH 5E03A 1RUMH 5JNYB 3UJJH 2HFGL 3EYOB 1QFOA 5JA9A 1QSFB 5EBWB 2ZSVB 4AEHL 5AYUL 3G5VA 3HS0A 1MAMH 3QCUH 4NQXA 4YPGA 4JY4A 3MJ7A 4IDLA 2K1MA 3I50H 5IF0B 3QDHA 1VACA 3VDBA 5SWZE 4JO1H 1U6AH 2EDBA 2EIZB 1JVKA 1ETZA 4AH2A 2JKXA 4LARH 4HK0A 3SGJA 4L4VB 3BJ91 4Y5VC 1KLUB 2JK5B 5JDSA 4HF5H 5GSRB 4MWFA 2VC2L 1JGDA 1AFVL 2A0LD 4NZUL 1RJCA 3KLHD 4ERSL 3BZFA 2R8SL 4I5BB 3U7WH 5I9QC 2R4SH 4K7PX 4ZPVA 1GVIA 2NY2D 4WW1B 3VWJD 4F7MB 4A6YB 4XC3L 3MRGB 2VQ1B 2MOVA 4NRYB 4GG8A 3RWIA 1DQJA 4OLXL 2UZIH 4IRJD 3PWPD 3T0AA 1GZPB 5JW4M 1TDQA 1MHCB 1EGJL 3PGFH 5ACMA 1BWWA 5L0QB 4J3XA 3K8MA 4OZHF 4L3AA 1FZJA 4GFTB 2CIKA 2Q1EA 4ZO6A 1RU9H 4JCMA 1WWWX 2XY2A 1MFCH 1DP0A 3WLBA 2GY7B 4OZIF 3WS6A 3I3BA 3KYMB 4HUWA 3WFDH 2V2WA 4GMSH 5J57B 3BDYL 3TZVB 5B3NA 1M7DA 3S88L 5I18L 4ZD3L 4PJDF 1P5UA 3FAXA 4WRLA 1KENL 3UJTH 3AAZB 3MUHL 4OCLC 3SCMB 2Y1VA 3UTSD 4HMEA 2VKXA 3UP1A 3T0EC 3QJHB 4IRJA 3QDMB 3HC3L 1RIUL 5A43C 4QHLB 2LU7A 3RNQB 4TQEL 1I9IL 5HD8D 4G80B 5D8JL 2W9EH 4ELMF 2Z92A 3ULVF 3MLTA 2HN7A 3ESUF 4TN9A 2P5WE 1RUQH 1MCJA 3BEVB 2QSQA 2VLJE 4H88L 5IVOA 3CPLB 1FBIL 4HXAL 1CL7L 4LPUA 4OLYH 3DXAB 4WVRA 5HHVL 2PXYD 3D85D 4EI5A 2IALA 3KDMA 4K8RC 4ZFOL 2ZG2A 4WJ5A 4V2BA 3UDWC 4BSVB 4Z7VF 4J7RA 5ERWA 4WDIA 5GZOD 5C0EB 3MC0A 3QPXH 5C0CB 2FX7L 4Z7WB 3HLAA 1ZHKB 3UTPE 5DJYA 4MZ2A 4FABH 2HLAB 3UTSA 4HKJA 3ARPA 2ORBH 3WUWA 1NGQH 1TQCB 3VFNB 4J4PA 1T04B 1AH1A 1YDPA 3PDGA 3QUKA 3VXME 1GOFA 1OF2A 1TETL 3QEQE 4DAGL 4GXUN 6FABL 5KVEL 5DUBB 2ILLA 1C7TA 1CCZA 4OIAA 4AT6A 4O58H 3SBWA 1G7JA 3MR9B 4X9IA 5C0BD 1BQLL 4Z0BL 1NMBH 1DBKH 1PYWA 1OSPH 3H8NA 3ZTJG 2UUDK 2PXYA 3D85A 2UV3A 3HE7B 2BSRB 4Z7OE 4APQC 2XG4A 4NN6B 4XPFH 3HUJB 4L5FH 3SGJC 3ZL4H 3WIHH 2CSPA 4DUVA 2BHZA 5J9PA 1U8LB 4PJ7F 4QXTA 4JKLA 4MVBD 4IOIB 3RJDA 4FQXD 1NCWH 2AV7B 3CX5K 1OW0C 4YDJA 3QIBD 5CWSA 4Y1AB 4PJ8C 5EIVA 4ZFZA 4R0LA 4N8VB 4YHLL 3U9UA 1T1WB 3TC9A 3TO4A 5BJTA 3LRGA 2XA8L 4PYHA 1N0XL 4E42A 3ZDZE 2A6JB 3V6OE 5HI3C 1WBYA 4GMTL 1PD6A 4TOYH 4WHTB 2LV4A 5IG7B 4HKZB 3GMQB 1CL7I 1GIGL 5FHAH 3WS6C 3CH1A 2VITB 3V5KA 3MBED 3N50A 3GNML 4JANA 5IMMA 4CJ0A 4OV6F 5CSZA 1EFXD 4HPYL 4XAKD 1EO7A 1FVDA 4X98B 5EU6D 5BRZE 4WUKL 4XT1C 5GPRA 4F33A 1MVUB 5I1IH 3DETC 2Q8AH 5FYKE 2NY2C 5FYLE 3KG5A 5ISZD 1U95B 5HGDA 1K4DB 4NCC1 4WENB 4NIKB 1UGNA 3RTQD 3NH7H 3IFOA 5I8OL 5GGSY 5L7XH 2HFTA 2VZTA 1BOYA 1HHGA 1IGIH 1BVLB 3L7FA 5TE7L 1ND0B 1L7IH 2OM5A 1XF3B 1CBVH 4TNWK 4QYOB 2Y5TA 2E7CA 5CEZL 2R0LH 4XGZB 5D9SB 4PV9A 5BXFA 3JV6B 5FDYA 5IQ9A 3WNOA 3QFDB 3V7AE 4DFHA 2W9DH 3QO1B 5EZLA 3DYOA 5HHXL 4IMLA 1HE7A 3MRRB 4UMGA 4EI5C 1EFXA 4K7PL 2D31B 4X9HA 5BMFL 4PBXA 3VXTA 4C55A 5KSBE 3H42L 5EU6A 1FZOB 3VI4E 2A83B 3L3IA 3RIAF 3O9WA 2BCKB 4QO1A 4IRSC 1U8IB 1XAUA 2B8OT 5ISZA 5KS9E 1A1OA 4POZC 1DUZB 3BYTA 3LKQA 1DBMH 2VN7A 4NRZA 3RTQA 5E6ZA 3W2DL 4LSVL 4RSVA 3STZB 4HFUH 4JRXA 4D0CB 4J4PC 1AQKH 2FWOA 3QXDA 1NUGA 1SHMA 1AY1H 1JNJA 3JZ7A 3I75B 3FT4A 1YMMD 2A9ML 3OXSA 5DQDL 4X4MA 4OAWA 3V6FB 5KN5B 1XGYL 3SBWC 3HCVA 3VRIB 1INQA 3LKNB 5D7KD 1DSFL 4JPIA 1IGYA 4GW1A 3HMWH 2IQ9L 5CMAB 1NCDH 2BRRL 1SEBA 1Q72H 1D9KD 1A1NA 4XCCL 5J4MA 3CSPA 5LVEA 2A6IB 4EJ1C 3DX7B 3VMNA 1B88A 1J1OL 5HI5D 3MFGB 4DN4H 3T2PA 2AK4D 1ODAA 2ADIB 1SMAA 3TPUA 4JN1H 2P47B 5IK3B 4R0LC 3KPRB 5JPMB 5C71A 4PGCB 5JXED 5FGSA 3FCTB 4JY6B 5IW1A 3GJFA 3TO4C 4NO0B 3KLDA 3CJJA 5DHVH 1LO5A 1SJEB 1GOHA 2A6KB 4POYA 4PP2B 1QFWL 1IVLA 3U4EB 1BECA 2VWEC 3OKOA 3ULUH 3C5ZB 3V0VB 4O02L 2QSTA 2R2HA 4RBPK 1GPOL 4IDJL 3ZO0A 1P4LA 4LASH 5GS2H 4OTXL 4GG6B 3BGFC 3BSZH 5GGSA 4G8GB 2E8ZA 1QSFD 1JWMB 3G08A 4C58B 2PW1B 2ZWLT 3G04B 1A6VH 4YNYB 2FD6L 2AK4A 1W72H 2BFVL 5JXAL 3U82B 4JVUA 3MLXL 4J12A 1WQVT 3B8SA 4X6CF 5JQHC 1PY4A 3U0TB 4X6FB 3B3IB 5FKAB 1BP3B 5HYQA 3TT1H 4P23B 3GKZA 5KSAB 3RUGB 4J8RB 5T3XD 4PRDB 4FN0A 1A7NL 5C6TL 1LK2B 4M3JA 3N1QC 4ZYKA 3O2VL 1H3XA 3RWHA 4YDKL 1FVEA 1XMWA 3DMMA 4HBCH 4HS6A 5E8EA 4JM4H 3WHXB 1FG2A 4GBXB 4LHUB 3OJMB 5ESVA 3HAEA 4F2MA 2X05A 1LO3H 4HKBB 3E3QE 3GHBL 2UYLB 3NZ8B 5JW5A 3T0WA 4AEIH 1CQYA 3OXRB 2HJKB 3G6DH 4HWBL 4CU7A 4NJAH 1FNEA 2GCYB 1X6NA 5FOBA 3STBA 5C0FA 2VABA 4U3XA 2F5BL 5ABDE 1HKLL 4JFZL 4U0RB 2J88H 3O9WC 5CZKA 4HSQA 3IETB 3QIUD 1T1XB 1FYHB 4MAUH 3RTQC 1T6VN 5L88L 1F3DJ 1JI1A 4F9PA 1CGVA 5E56A 4Z7UB 4UT6L 3TO2A 1QR1B 3BUTA 1WUNT 5CZVH 4M7KH 3BRGC 1UACH 4YDIH 1ZWIA 2AJ3B 1F11B 2EKJA 4CW1B 5BW7C 1QFWI 4LLWA 4P4RA 1AI1L 3QH3B 1A6TA 5I1KL 4WTXA 2COQA 1BIHA 1LK3H 4YBQD 5D6DC 3GGWB 5ILTH 1JWUA 4M9PA 1V3KA 2AJVH 1CE6B 5TDOA 2RB8A 5IFAH 5HVHC 3QCTL 1IGFL 4NN5C 5KVFH 3ULSA 2GK0A 4Y2DD 5A16B 4X6EB 4L4TA 3TT3L 2CLVA 3ZE2F 3QIUA 1CDYA 5EOCJ 2AJYH 7FABL 3MV9A 3O6KL 3O6FC 3F7PC 3EYFB 1D5MA 4EBQH 4E5XA 5DJ6A 4HAGA 4X0KB 3HNSH 2ERJB 5ACZB 5J0BA 1Z9LA 4WNQA 1QO3A 2IAMB 2J7LA 3B9KB 1FLRL 1MCOL 1MJ8L 3CC5B 3Q6GL 1HCFX 4HGWB 1X4XA 1BOGA 2MTPA 1J0HA 3DVFA 5C7XL 2C1PB 3GBNL 2YD6A 3MGOB 1I9RH 3FRUA 3MLSL 2C3WA 3SDXF 1EEZA 3Q5YA 4TNVF 2FX9L 3JTTB 3DUHA 3QZWB 4LLVB 3RWFA 2X1PA 2AJZA 4ONOA 5E6YA 1EIBA 4TUJA 5J6HB 1KCSH 5HYSA 3MCKB 1F3DH 2Q76A 4AMKH 5IOPB 4M61A 3OF6D 2JCCF 2F74B 4YXKH 4KMLB 5I8EB 2GI7A 2NW2B 1G7MB 3PWUB 4X9FA 4E41B 4NCDA 4PYGA 3D9AL 1ZA3A 2DL9A 3HZVB 1NAML 3PWPE 1T5WA 4NKMA 4PJBF 1ZTXH 3DMMC 5JW4N 5T33H 4PJIF 1UWXK 2K3TA 2QSCH 4RISH 3DVIA 1NBVH 4DGYH 5AD0B 5T5FH 3WFCL 2NR6D 1KTLA 3QI9A 4J3WA 2LE9A 3TBSA 2OL3L 1KN4L 4WO4B 3PJSB 1A3RL 5EOCH 4KK9D 5HJ3A 3VXPA 2HT2D 2X4QA 2DQTH 4H1LG 5I1GH 1NSNL 1QEWA 1BPVA 4KMQA 3OF6A 4LP5A 1T03H 4QRTA 3KR3L 4BSWA 4Z0XB 1VEOA 2CKBL 1H8OA 4QCIB 3TBYA 4F9PC 1AKJB 3LV3B 5B38G 4NZRH 3G5YA 1R5IA 2XZAH 1G9EA 4NKIL 4KC3B 3UTSE 3N0PB 3OR7A 1RK1A 2VAAB 5E6IB 4CVZB 2DI8A 4HLZH 2OZ4H 2XKNA 4QRSA 3S9DB 5KVDL 1XCTB 4BQ6A 3I3EA 5IV2B 3VFUB 3ARGB 3OAUH 1IEBA 4G9DA 4FZ8L 5DJCB 4HT1H 3V0WH 1HOCB 4OZHB 4JFXA 1G6RB 5AUMB 2XXMB 3KPPB 2E7LA 3WEXB 4FQJH 3TEUA 3QIWD 3IJYB 2Y7QB 2YXFA 3QIUC 4TTGA 4OZIB 1JNNH 5I1LA 2O5ZH 1OM3L 3FO1A 5DUMH 3H7BB 1R0AL 4N0YL 2QQLH 2DQHH 4U1MB 2G5RA 4YDLB 3PV6B 1YEFH 4UBDC 3MRJB 3TNNA 4NFBA 2HTLD 4HUUB 4JHZA 5J12C 2HVKA 5D7LA 4PLKC 4LCYA 1FN4A 3O0RH 4OD2B 5HHMD 2A1WL 3VU2A 4WU7B 1XR9A 5CGYD 4MJ6B 4OLWH 2P45B 4I8DA 4D9LH 1K3ZA 1YUHA 2BVPB 1X5HA 4XPTH 3QPQD 3FO9B 3MRIA 3T3MF 3QRGL 4QRUA 4MNQB 3IJHB 3EOTH 4N8PA 4RMQA 5GRJH 1ERNA 1C5CH 3EO9H 2CLZA 3DGGB 4ELMB 3MROA 4EUPG 4KKLC 4LSPH 5C0BE 3QBTB 2PTTB 3QIWA 1MAKA 3NMEA 3U79A 1JZ6A 2D7OA 3O2DA 4GLRI 4KK5D 3I6KB 1MAML 3QCUL 4UTAH 3G6JF 5MEPB 3ALPA 3KPOA 2YOCA 4LDOB 4ODWA 4N1HB 4BZ2H 3OG4B 2VDKL 4ZS7L 3ULUF 3DX9B 3MV01 1L0YA 1EGJA 2R1YA 1CGSH 4U7SA 3W9DB 1AC0A 4NQSA 3QUMB 3DYMA 1I3GH 5ADOH 3ILQC 5EZOH 3M1BB 1BZ7A 3NIDF 2ZSWA 4P3WA 4BQCA 1OQOA 1JGLL 1KB5H 3RVTC 1FFNB 3U7WL 2R4SL 1PVHA 2OP4L 1DQDL 5CLWA 1BWMA 1F2XK 2J8OA 2VXSL 4J1UB 3BGMB 3D3VB 1CLOH 1I1AB 3WN5A 2UZIL 5FECA 1J05B 3RIFF 2HLFC 5IM7B 1ZOXA 1UEMA 3QI9C 2CIIB 3PGFL 2A9NH 1EJOH 5C6WH 4OUUB 2ZNXA 3WIIH 3EYSH 4KJYA 1UQSA 2BX5A 5KOVC 1QBBA 1RU9L 3HC0B 3C5ZD 1QLFA 1PDKA 3GSXB 4QHKI 5F70A 1MFCL 1AD9A 4N8CH 4XAKE 4PRIB 1MHPH 1ROWA 4RDQG 5T1DL 3VFWA 5EU6E 1TIUA 1WZKA 3GRWH 2UZXB 3FQNB 3VFGH 4PJ7B 5FYJL 3DV4A 2IJ0C 5ISZE 3FZUD 4U2ZA 2BVOA 4LIQE 4B7IA 3HC4L 4M1GH 1IRAY 4MD4B 4U1HB 3UJTL 1NMCC 1KCRH 3MJ9H 3JWOL 4IS6A 4ZFOA 1TJIL 1PZ5A 1NUFA 2YZ8A 2NR6C 4X4ME 5IBLC 1JMXA 5EOTB 4UDTA 1WWCA 3S37X 2DQUH 2E7LC 2W9EL 1A4JA 5LCVL 3C5JA 5CJ5A 2G5BA 4K94C 1NAMB 1Z5LA 4UNVA 2GTZB 2WMPA 5KOMC 3ROLB 1T66D 1FZKA 4XMLH 3O8XA 4OLYL 3PGCA 2DLFH 3ARFD 1V7NH 3I02B 4QF1B 1F90H 3FQWA 4Y5YB 1BVKA 1YEGL 2PTUA 3BUYA 4HBQA 4PJFE 4R2GB 1AP2B 3VXRD 1Y6MR 3L7EA 5EN2B 1SY6A 3K2UH 2NY6B 1Q9LA 3WXVH 3MACH 4EN3B 1MWAA 3U36A 1MCEA 3BXNA 4CDHA 1YMME 4OF7A 5DS8A 1TVDA 3MTRA 1NGQL 2BNRB 3RWEA 5C0JB 3GSOA 2X09A 3EFFB 2ZUQB 5HY9B 4HFWA 3TWCH 5D7KE 5ALBH 1MFBH 3QIWC 4NQCB 1J0KA 3MA7B 2ATPB 1F42A 3LD8B 5ALCH 3P9WB 4O58L 1MCPH 2BK8A 4N9GB 1YJDL 4JREC 5I1AA 4P2OC 3P9LA 3C6LC 1NMBL 2KQNA 1DBKL 1OSPL 4HUVA 3DX8A 1LDPH 4X5LA 4YHPB 2NXYB 2AK4E 4GRMA 2W91A 2EDWA 5IW6A 3V4UL 5CEZD 2EXYD 3MRDA 4LVNB 3BPOC 3O4OB 3EJZC 4I2XB 5E2VH 4TULH 3P0GB 3RP1A 3WN5C 2F8VA 1KXVC 3X3FH 3RGHA 3PWJA 4PG2A 2JELL 2NTSP 2J6EA 5F6HI 3WUWG 2VL4A 2X4RB 1CLCA 3MNZB 4Q9CA 1RAMA 3O41B 4TOYL 1FL6A 2GT9B 4GRLB 1RZKH 5DUPL 5E4EC 3CX5J 2PYED 2VIRB 4KVCH 2PW2A 2XY1A 1DBJH 1XF5A 1OTTD 4BSJA 1H3PL 3UEZA 3QWOB 4MDJA 3T04D 1G7PB 3VA2C 3ZT5A 1UZ8A 1A7RH 1URLA 3RWJA 1NDMA 1X7QA 4HX1A 1OY3B 1T22A 5T3XE 2YEZA 4DN3H 4NBZB 5L7XL 1NBYA 4NQEA 2OTUB 3IFPA 4YFLF 3RVXC 5J1AA 1IGIL 2XWBA 3QQ4A 1R3LA 2I9TA 1L7IL 4MA7L 3Q1SH 3GJFK 1KLGA 2SEBA 4J3TA 5I15H 3JWDL 4L3ED 1YQVH 3P9MB 2CKNA 2R0LL 1KNOA 3DUSB 3TA3B 4PJHF 5FKPA 4LLQA 4XB7A 3FT2B 2B1AH 3ZKMD 1LWRA 5MENB 3O8XC 2W9DL 4NQTA 1CVSC 2ZOLB 3SPVA 1XGRB 1TVBB 5ID0B 3MRQA 1P1ZA 3LKOA 4M8VA 2PYEA 3TJHD 4PJAE 4C4KO 2P8MA 3S34L 1Y6KR 4OF0A 4MHHI 1QR4A 1M05A 3MV9E 3GUTB 3GO1H 2D4DA 4KKAC 4R8WH 4YHIB 1ZVYA 4X6CB 5DMGD 2AEQL 2HWZL 1AQDB 4ZUVA 5C0ND 3RWCB 3P73A 3HR6A 3P4OA 4JJHA 2UUDH 4YHML 3D0LA 4YEEA 3MRMA 1AQKL 2F15A 4G7YL 4OLUH 4QY8B 4GJTB 5GZND 5CD3A 3RWDA 3QWQB 2J4WL 3CNKA 5GGVY 5L8LB 1BFOB 3H0TB 3K74B 1T66C 1JPTH 4G7VH 2M2DA 1JIBA 2A6DB 3LKPB 5DK0B 1IM3A 3B2UD 1P9MA 3WNLA 4IIQB 1KPRA 1NCDL 4IBLT 3MLWH 4XVUC 3LQMA 1EZVX 4YBLB 5GRXG 3IFNH 3IAQA 4RX4A 3LN5A 1CFVH 3TJEH 4XNQB 4LLDB 2FH8A 4JZJB 2GSGA 3VWKB 3UZQA 4OFPA 1NFKA 1MCCA 4DN4L 4XP5L 1UWGH 3S37L 4FTVB 1WSST 4IM8A 5I74C 1MHEB 4QRQB 5IEHB 3GM8A 3QNYB 4P2CG 4WWKB 3JV4B 5D7JB 3STLA 1FHGA 3L3OB 1SMOA 5DRNB 2DQIH 4KHTH 4DW2L 4ZO9A 2H1PL 5FM4A 4YXLL 3O6MH 4YFDB 1OP5K 1OAXL 1SYVA 1KPUA 3AU1B 3NZHH 2CQVA 1NBQA 5HDOA 1N5YL 1C16A 4V1DD 4JEGB 2GW5A 2NTFB 4KRNA 4PRNB 4I0PB 5FK9A 1NGWA 1QRNB 4HEPG 3EOAB 2APVA 2F54A 1MCWW 5FXCH 1ONQB 3U0WL 3QA3B 5DSCB 5D1ZA 2DM3A 3O3UN 4LKCB 1IKFL 1W0VA 1YECH 3DRTB 1ZGLB 3EHBC 4QRRA 1QYGL 3M07A 3UZVB 3ZZ1A 2IWGA 1NLBH 4LASL 3BSZL 2ICES 4FQQB 4WHCA 2W0PA 1A6VL 1IT9H 4OSUH 5AG8A 3SKJH 1VFBA 2AJUH 4O2EA 3CD4A 1Y18A 2FZ3B 2NY3B 2YPLA 3MFFA 3ES6A 5IR1B 3MYJB 1H5BA 2BY0A 4Z76A 2CDFB 4LRIA 1VHPA 3MXWL 4F7EA 1BM3H 3TT1L 4R4FH 5CJXA 3BP5B 5F96H 1YA5A 4AG4L 5LXGL 2ZP0T 1IAMA 4XBPA 4R7NA 4M6NH 1KULA 4W6WB 1FJ1A 1W8NA 1WICA 4HBCL 4JM4L 3AY4A 1MRDL 3RVWC 2D0HA 1LO3L 3RI5K 4QNPE 2XN9A 2OSLB 2H9GA 3G6DL 3VXSB 2X7LA 3K4ZA 4ZS6C 2HVJA 5IB5A 5JIIA 1JTOA 2JCCB 3IDNB 4UUJA 43C9B 3KYKH 4MAUL 4X5WA 4PV8B 5TPWH 4NN7C 5C08D 1HHHA 4UB0H 4NYLA 1FORH 2QTEA 3KYNB 5CZVL 4Y4KA 5CUSH 1UACL 4B41A 4NHUB 4RZCA 4RQQB 4PD4K 3WO4B 4KROB 4KY1H 4PJIB 5IVNA 2LTQC 1RK0B 5E8OA 2VXTH 3H9HA 5DWUH 1I9EA 2D0FA 3ARDA 2G75A 1BF8A 2I27N 1JN6A 2Q7YB 1P9MC 5ILTL 2AJVL 5IVXB 5DJAA 2WUBH 4NNXB 1S9WB 4P46B 1MPAL 4TRPH 4WFHD 3FL7A 1P7KA 2P49B 4S0TD 2CDGB 4PP1D 3W9EA 1MOEA 3FB8A 1T4KB 1WCQA 4WUUD 4I18A 4IHOA 4OCXH 4Y19D 4Y4FB 2PTVA 4JM2F 1FFOA 5HHME 2AJYL 4YIQB 5C08A 4M93C 3BRFA 1PEZA 2BSTA 4EBQL 5JHDD 4CADB 5LG1A 4OD3H 5I76A 4K3JH 2DIJA 5D5ME 2AJSH 4LSQH 2EIDA 3O4LD 1KSRA 4WFEE 4OF5A 4OFYD 3TIEB 3G6AB 5KSUA 2H41A 1HSAB 3FFCD 5GSVA 1OAZL 3KPSD 5C6PB 1P7QD 5DVOA 1NC2B 3GKWH 1N6QH 3SDDA 4NPYA 1HIMH 1I9RL 2BNRD 5D1ZC 5TF1L 1EFQA 3CSYB 4ZXBB 2AJXH 2FL5A 1ZA6A 5HI4D 2WV3A 3MYZA 4LQ1A 2DQCH 1IM9B 3BE1H 4KKBC 3OJDA 4HW6A 5FAAA 4NQCD 1CWVA 1QQDB 2DWEB 5GS0C 3IDMB 1AXSA 3LRHA 4OFKA 5DRXB 2M1KA 2Z35A 1NL0H 3MJ6A 3PWVA 1DEEB 1MCHA 4U1NA 4UAOB 5JZ7D 1A6AA 4RFEA 4QGYA 4YGAB 4MD0A 4AMKL 3HRZA 3QDGB 2WIIB 4YXKL 1E4WH 4LRIC 2JJSA 2J8UF 3DRQA 5JHDA 2OL3A 1CXFA 1J10A 4XP6L 4P5TC 4PRHB 4LFHG 4NUGL 1C5BL 3NCFB 1SJVA 3O4LA 4MA8H 2R2EB 3LRSA 5FGBA 4OFYA 5AWNL 4Z7QE 2O5YH 4TVSa 5INCA 2A73A 3KPSA 2MQ0A 3PIQB 3NPSC 2HFFB 3ARUA 1ZTXL 1NGZB 3PQYD 1U8HA 1P69B 3UTTD 2QSCL 3NA4A 4GAGL 1CFSB 1NBVL 4RISL 4ETQA 2R2BB 2R29H 4XNUH 1BFTA 4NQDA 5T5FL 3MGAA 5F3HB 3U83A 4DUXA 4M7ZB 3WKNA 2NY5C 5DHVB 2ESVD 3A6CL 3QQ3A 4PY7A 3F7YB 1NGYB 3G6JB 4MDIA 4Z77A 1CGYA 1OAUH 4JG0H 1ORQA 4LSRL 1FO0H 2DQTL 5I1GL 4HJJL 2NY4D 2FEDC 2KUTA 5CCKH 5EUKB 1HSBA 2FYYB 4UILL 1J1PH 3LEVH 4EQ2A 4GW4B 2E8YA 4U1GC 5C07B 3BIAX 2X4TA 4Y4KC 2ICEB 2AKRB 3WJLC 4CNIB 5BS0D 1UB6B 2CJUH 1OT1A 3CFEB 4ENED 1FV1A 3TNMB 3LH2H 4UOJA 2IANB 1LE5A 3SJVD 1W72B 1N5AA 1I7RA 2JIXA 3ARBD 3UTTA 3WNMA 4Z78A 3ARDC 1Q94B 3SDYH 4PJ9B 1R5VA 4WI7A 4LCIH 4LNRB 4KJPD 1C7SA 1KCKA 2X41A 3AXLB 3BHBB 4HT1L 3A6OA 4KFZC 5GGRA 4QTHA 1UYWH 5D93B 5J6GA 3ZKQD 3OX8B 3PP4L 5L2JB 3D39B 1KPVA 3QQ9D 1OGTB 4OM0H 1CF8L 1NMAH 2NY1B 1EHXA 1IAKB 4I18C 2NY7H 1NEZG 3TA3D 2YXMA 1DL7H 2HT4D 1CE1H 5JW3H 1QOKA 2QQLL 2DQHL 1A9EA 4MZ3A 3VXRE 2XICA 5CD5C 1YEFL 3MNWB 2Z8WC 1BJ8A 1ES0B 4X6BA 4RFNC 4MXWH 3IGAA 1LEGA 1CFQA 1OPGH 3O6LH 4JFPA 3UROR 7CGTA 1WCBB 1OAYH 3NFNA 3DSFL 1DVFB 1SJHB 4JFFB 5BS0A 1ZXQA 3ZKXB 4OLWL 1VDGA 2X4OB 4PGZA 3RBSA 4D9LL 2DYPD 1QA9A 5F7LB 4KXZI 4UT7H 4XPTL 5SV4A 3LIZH 4QLRA 3ARBA 5LAXA 1D3CA 3U2SA 3SDDC 1JRHL 1DDHA 4HZLA 3EOTL 1CT8B 5GRJL 4MNGB 1PBYA 1C5CL 4XVJL 3U30B 5F9OH 1OGAB 5FYJD 3E8UH 1X4ZA 1YYML 3MLPA 2WBJB 1KF9B 5JHLL 1JV5B 1J5OH 1FDLH 3WD5L 4F37K 4JFEA 4EVNB 3MNVB 2D7PA 4QHUA 1GOGA 3RU8L 2G60H 1GGIH 1UWXH 4UV4H 2PNDA 5CEZE 2JJSC 4C56B 3O3AA 2BY3A 4WV1B 5FV2A 2EH7L 5HPOA 2IMNA 3VG9C 5EZOL 5F89B 2ED8A 5F7UA 2DYPA 1S3KH 4WW2A 5GRVL 4G3YH 3IKCB 4PG9A 1KB5L 5F7EH 2NXZD 2NW3B 3F65A 4TNWF 4Y4HD 1FNGA 5DI8B 1HXYA 1DLHA 4WWKD 4JQVA 1ZLWK 1QUNA 5KANG 3P0VL 1CLOL 5DC9B 2I9LB 3U46B 1B6UA 2CD0A 3QO0B 4PRBB 3QG6B 5DFVC 4PS4H 5F1OB 1KIRA 4Q74A 1K5NA 1EJOL 4MJ5A 2WBKA 3I2CH 1RZIB 1EBPA 1OSZA 3K2MC 4FQ2H 2EIEA 1JK8B 3NIGE 3Q5OA 2PYEE 3JVGA 3DLQR 2GJ6B 4Z7OF 4N8CL 1WBZB 1LHZA 1FZMA 2FDBP 5HHQA 5TH2A 3REWB 3K81A 3ZKSD 4PGEB 3VD7A 3GRWL 5T5NG 4F7TA 3BAEH 1XCQB 1JWSB 3WHE1 2AQ2A 3ECBA 1KLFA 1J1XL 1K3IA 1FFRA 4G9FD 2X4SA 4LKXA 4M1GL 1VADB 1OL0A 4OGAC 5IW3A 4MCZB 1L9MA 1RIHH 1KCRL 3QR2A 2VRAA 3MJ9L 3QEHB 1JRHI 2H6PB 4MGXA 4L3EE 2OQJA 2XTJD 3ZDZF 4KJQC 4EZMA 2FJFB 3E6HB 1A3LL 4FQIL 2WUCH 5I17B 2YUVA 3LS4H 5C0AB 1TZIB 4FFWC 5FFLA 5EO9B 4N1CA 4TSBL 1BZ9B 3SKUD 3UBXG 3M17B 2C1OB 2BP3A 5KAQG 2R0WH 3QXAB 4CMHC 3BZEA 4ODBD 3I6GB 5A1AA 4XMLL 4OB5H 4E0RB 3VFRB 4KMTH 3MRCA 1NANH 2HMID 3AM8A 2MJWA 1WC7B 4OCRL 2AXFB 4NNYB 2YMXH 2NZ9D 4OFIA 3W39B 1F90L 1FE8L 1I9JH 2ZUUA 3SQOH 1WGOA 2I07B 1I8KA 3AFLA 2VXQH 2DOCA 2JB5L 1N4XH 4Q0XH 3MACL 4KTDL 5TF0A 5C0GA 5JNYA 4DGIH 4MAYD 3X13B 5EBWA 2ZSVA 2J5LC 4PRAB 2EDKA 4KWUA 4JHAH 2DF3A 1G9NL 2NY0B 2VR4A 1R3KB 1EEUA 5ALBL 4D8PB 5IF0A 4RIRB 3CVHL 4NO5B 4XPAL 4PJHB 5ALCL 4GKNA 1ORSB 3SDCA 4TPRL 5EBLB 2YBRB 4FA8A 1M6OB 1MCPL 5T1MB 3BPNC 4P4KB 5E95B 3QNXA 5DURB 5F44A 1IQDA 3E2HB 3OR6B 3FFDA 5KSBF 3RGVD 4I5BA 1LDPL 2DLEA 2OI9C 4WW1A 4TTDD 1J88A 4L8BA 2BVTA 4OBSA 1N6UA 4P2RD 3GSQA 1MHHB 4A6YA 2KH2B 3FB6B 5E99L 2ITCA 4NNPH 1T2XA 2UWEE 3TIDB 1EJ6A 3WBDA 3O2WH 1H15B 1LP9F 2IEPA 3KPMA 5E2VL 2AVGA 2CO6B 4JDZB 4TULL 4PJDE 4GSDH 4ZSOE 5FF6A 2VDOH 3BKCL 1QFWM 3T65A 4V1DE 4ONFH 4K3EH 4EXKA 3X3FL 4H25B 1UCBH 5GQBA 3GK8H 1NCNA 4K23H 3KYMA 2VDPL 2F53D 5HGBB 3OAZK 1TPXC 1JJUA 1MF2H 3EW3B 1J8HD 2QR0B 5D71L 4C83B 4F9LA 4LPWA 3FO2A 3DVGB 1FNSH 5FO8A 3JVGC 1OB1B 3JWOC 1I8LA 1MH5A 1MCIA 1U3JA 1RZKL 3HE6D 2VH5L 5E94B 3AAZA 3VH8A 2AEWA 1RQ5A 4S2SA 2IH1A 2GHWB 3QJHA 1FRGH 3DBXA 3BH8B 4S1SH 2F19L 1A7RL 1BD2A 4Z7VE 4HV8B 4DVBB 2W07A 3D69A 4XRCB 3UCRA 2FJHA 4FS0A 1W0WB 3K4DA 3QUZB 4DN3L 2XFXB 5L8JB 1D5BB 3AREB 1ZHLB 4ZNCD 3CPLA 3O81A 1J7VR 2PO6D 3MOAH 4FXKB 4MA1B 4I48B 4XP9L 1ZE3C 5INDB 3HN3A 2QADC 3DXAA 4OLVH 3V7AG 5A2KH 3LDBC 2DMBA 1NFDB 3CGTA 5BOZG 3R8BB 1YQVL 3DURA 1KB5B 1KG0B 2FBJH 3TESA 1IJ9A 1Q9WB 4YFEA 4BSVA 5DO2C 1EEYA 1GAFL 1T83C 4QWWD 4MJIB 3IYLW 1AXTL 3ME0A 5CEYB 3WXWH 4TUKH 4QTIH 4UIKH 1LNUB 4HIHB 1PG7X 3ZSTA 3W11C 4ZTOL 3VFNA 4UDUA 1MIMH 2YSSB 2EZ0C 3DVNB 1MY7A 5C08E 1MCBA 1OT2A 5KVGH 3GO1L 4R8WL 5DUBA 1D5ZA 1MFEH 4OZ4B 5J3HD 2EDTA 3RDTB 1N7ML 5BV7H 2PO6A 2MCG1 2Z31B 5E1AB 5GS2D 4OLUL 4W68A 5GIRB 1IFHL 3V6ZB 4G8FB 3MRPA 5CAYB 1RPQA 3SDCC 3FT3B 1AGEB 1JPTL 3JUZA 1NDGB 5I1JH 3ZTNH 4H0GA 4ZUWA 5J11B 4FQPA 1U8LA 3NN8B 5DHYB 4WFHE 2HMIC 3BPCB 4LIQH 2OMBA 3VXQA 4IOIA 2IPUG 4WUUE 3IFNL 5IB4A 1NFIA 4RGOL 5A3ID 4Y19E 4X9GA 4KTEL 3TJEL 2APTA 1E6OH 4N8VA 5TE4L 3H3BC 2J2ZA 2NY1D 5L2KB 1YNTB 1R6VA 3LKSA 4DCQA 1UWGL 5JHDE 5IMKB 3TVMD 5L0QC 4RAHA 4BQ9A 1IAIH 3B6SA 3W0WD 5HGAB 3O4LE 3VI3E 2HTKD 1D7FA 4KHTL 3DX6A 1A0QH 3SGDI 2WSKA 2FLRT 3O6ML 3FFCE 4WTZG 3VRJB 3KPSE 4HKZA 3NZHL 4DZBB 2VITA 1LQSR 3SN6N 1ZANH 1YEHH 1B3JA 4LCCB 3OMZA 2OMNA 4NQDE 2XWJB 4WY7H 3TZVC 3N85H 4X98A 3WFHB 1I8LC 5K9JH 1UJ3B 3NTCL 1JF1B 1KN2H 5C1MB 1YECL 4JDVA 1UJTA 3SCMC 1EO8H 1EAPB 1ZSDA 1FIGH 3GJFH 4WGVB 1H3UA 2DRUA 1H0DB 3IDXH 3QULB 4JM2B 4OSUL 4HXBL 5FEBA 1LD9B 2AJUL 1ND0A 3BJLA 3TVMA 3SKOA 5FO9B 5DJ0B 4R90H 3GSWA 4JGUA 3MV7D 3W0WA 2JJVA 4OFDA 1ZGLP 3BP6B 2HAZA 1PFCA 1G84A 1BBDH 1EZVY 2H3NB 5DVMA 3JV6A 3PWLB 4MCYB 2DQGH 4LAQH 4L29A 4ORGB 3LB6C 4NHCL 1RUAL 3CK0L 1L6ZA 3D2UD 3PQYE 3W81A 3MRRA 3UTTE 1UVQB 1N3NB 1CGUA 1KYOK 2D31A 2V2XB 2IBBA 1W2KT 1FFPB 1HZHH 1Z9OA 5D2NB 5J8OA 2ESVE 1D6EA 1QP1A 1IEHA 1U8IA 3V4PH 3BX7C 4OIIH 1HHJA 3AMKA 2P48B 4CVWA 4ZODA 1TQCC 1BQHB 4K9EC 1WJ3A 1NEZB 4QRPD 3HMXL 5GRUL 2DQFA 1X5KA 2GJ6D 3MV7A 2J8UB 4ZFGL 3Q3GA 5BS0E 5TPWL 4GW5A 3HAEH 5DJXA 3KHOA 1OTUD 3EZ8A 3K1KC 4MS8D 3UJIH 3SJVE 4FP8L 1NKRA 2L0DA 5CMAA 3HE7C 4NN6C 3GSUB 3MLRH 5F1IA 4AY0A 3EDFA 4HEME 3VFSB 1L7TH 1U8MB 2VXTL 1M7XA 5DWUL 4QWWC 4PRPD 4Y16B 3PV7A 3GIVB 5FYKU 1U58A 1WZ1H 1NLDH 1OP5H 4JFEE 4ZAKD 5HDBF 4G6AC 4X8JA 4S1QH 4TRPL 1CD0A 1IC5H 5JOFB 5T3XH 3KPRA 3P30H 2BMKA 4JRYD 4QRPA 2H26B 3FCTA 5SWZB 4DZ8B 2KDGA 1S5IH 1LO4L 4OCXL 4NO0A 1N8ZA 1I7TA 4J23A 1SJEA 4PD4J 2Q3ZA 3FQXA 5FO7A 5EWIL 2XPGA 4D0DA 3RAJH 3DOSA 4GQ9H 4HH9A 1ZS8B 1JNHA 4DEPC 1S7WA 3V0VA 3TCXA 4M8QB 4OD3L 3MOBH 3KYAA 1YEJL 1YC7A 2AJSL 5D1XD 2IGFH 5IB3A 2ZUTA 4OF8A 3ROOB 4U1KB 3LMJL 1HXMB 4MQ7B 3QUXB 4PREA 4PRPA 4KQ4L 5FYJE 3S5LB 1JWMA 1N6QL 2PW1A 3G04A 5D70H 5F1NB 1JHTA 1OD7A 5JMRA 4AK1A 2NQCA 2JTDA 4ZAKA 1RZJL 2ED7A 4HKXA 2DQCL 3BE1L 1FL5B 1MLCB 1OLLA 3BZ4B 1RZGA 1B0WA 5DD6B 4JRYA 3QNZB 1J9CT 1NL0L 1MRFH 4KUZH 4HS8H 3K46A 2X4UB 5CFHA 1XF2A 2O5XL 3DUUB 1S78C 2H2SC 4UQ3A 2HTKC 1E4WL 2IH3B 5CHNB 5IHUH 2RCSH 3VD4A 3ZYOA 3WHXA 3HZKB 4GBXA 4NC1E 2ZUYA 5D1XA 3RVVD 4U6VH 5I2IB 2EECA 2K9UA 2KKQA 3L9RA 5D7IA 4NM4H 2JB6A 2GCYA 4JG1H 1AGFB 4OD1H 2B7DT 2P5WB 4X7SH 5I0DA 2R29L 4XNUL 4EIZC 3BKMH 3IETA 1F4AA 3KWWB 2VLJB 3CMOH 3ILPA 1EUUA 4R6UA 5FUZL 4YXHH 4U05A 2BNUA 1DN0B 4HJ0D 4Z7UA 2FIKB 4X7FC 5KSVB 2DB8A 4BFEA 2X1QA 3EJYC 3BN9D 3SDAB 4FG6C 1CICB 4LHJB 2CLRA 4P5MB 2AV1B 4XTRD 5T1LB 1HYSD 1L9NA 2AJ3A 1F11A 4I3GA 3U7YH 1INEH 5CCKL 4O00A 1LO0H 2XWTB 4Q6IA 4G9FE 3CXDH 1WWBX 3MLYH 3LEVL 3QH3A 1UG9A 3TYFB 1JZ8A 2GFBA 4DOHE 3PXJA 2AXGA 4BH7B 5JTWA 3BP7B 5ETUB 4NUJA 4K2UH 1AD0B 4DVRH 5E9DD 3VXMB 2XTJE 3QEQB 4LLUB 5DGQA 4RGMC 3QUZD 5SWQB 5A16A 3SDYL 5F7DB 3ARED 2FO4A 2EO9A 1CFBA 3BH9B 2P8PB 4RMUA 4BH8B 1CXHA 4Z8FH 4Q2ZB 3SDXE 3PL6B 1UXSA 3MZGB 3VD3A 1OAQH 2DTSA 3FOMB 1NMAL 3JBG7 4LSUH 1G0XA 2BC4A 4RAUB 3H9ZA 2NY7L 4YAQB 4X0KA 3NABH 2P5EA 4LSTL 1NGXA 4KI5C 4I4WB 4QOKA 3WHE0 5ACZA 1O5DT 5JW3L 3P11H 4MJID 3VJ6B 3B9KA 1J8KA 2R1WB 3WIFB 5C2BH 3WLWC 4MXWL 2C1PA 2H8PA 3LQAH 1D5IH 3AUVA 3BW9B 5D7SH 5E8DL 2V7NB 1WFTA 2R1XA 3NOIA 1LGVA 1HH9B 4G6FD 3ZHKA 5E9DA 4K94H 4UT7L 3L5HA 3LIZL 3BO8B 3EGSA 4KZEH 3BD4A 2EYSB 3V4VH 4PJBE 5J6HA 1Q9OA 1TVHB 5DD1H 3MQIA 1CXKA 2YRLA 4FHBD 1P4IH 3QP3A 4LVEA 2EKSB 2GJZB 5L6YH 5I8EA 4K8RL 3CLEH 1J5OL 3FB7A 1K8DB 1ZHNB 2NW2A 1G7MA 5IESL 4JJ5B 2W38A 1TXKA 5FDWA 3CX2A 2YN5A 4P2RE 3VCLA 1CYGA 4JO4H 1WVZA 2FSEA 4IMKA 4J3OC 4UV4L 4JZNA 5BRZB 1KJVB 4PJFF 2I60L 1X3DA 5I1HL 4GBXC 1BD2E 1U42A 4XCEB 1CGWA 1S3KL 2VC2H 5I1EH 4G3YL 5DRWB 2D7QA 5H94B 1FSKC 5F7HA 4XMPH 4WO4A 3PJSA 3X14B 4WHDA 5B22A 5JO5B 4OV5B 1C08B 1K8IB 3MV8D 3CFKA 1MCSA 4U0RC 2F53E 1LILA 3G9AB 1V5JA 1U92B 1J8HE 5EIQA 1EGJH 4PS4L 3IJSB 4Z0XA 3EYVB 4PLJC 2G2RB 4QCIA 3I2CL 3VDCA 4P0DA 5MP6H 4NT6A 3T8XB 4PR5B 4O4YH 5F3BA 2W9LA 5K59F 3L3HB 5DEZA 5KSBB 5DJ8B 3EZJB 4ODHL 1JZ5A 4X83A 4XNYL 5E8PA 5E6IA 4XWGL 4Q6IC 4CVZA 5KS9B 1XCTA 3KJ4B 1NC4D 3QFJD 5IV2A 3VFUA 1ZHBB 3BAEL 2DJSA 4ONHB 3VGBA 3Q0HA 4DKEH 2X2YA 5FM8A 5DJCA 4JM2D 3S88H 5IEKA 2N7AA 5I18H 2EEDA 4OZHA 4ZD3H 1G6RA 5AUMA 2RR3A 5CBEA