2YKLH

Structure of human anti-nicotine fab fragment in complex with nicotine-11-yl-methyl-(4-ethylamino-4-oxo)-butanoate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
209
structure length
181
Chain Sequence
b'LLESGPGLVKPSETLSLTCTVSGGSIWGWIRQPPGKGLEWIGSIYSSGSTYYNPSLKSRVTTSVDTSKNQFSLRLSSVTAADTAVYYCVAWFGDLLSLKGVELWGQGTLVTVSSASTKGPSVFPLLGCLVKDYFPEPVTVSWNLTSGVHTFPAVLQSSGLYSLSSVVTCNVDHKPSNTKVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB FRAGMENT, HEAVY CHAIN
molecule tags Immune system
source organism Homo sapiens
publication title Different Binding Modes of Free and Carrier-Protein-Coupled Nicotine in a Human Monoclonal Antibody.
pubmed doi rcsb
total genus 31
structure length 181
sequence length 209
ec nomenclature
pdb deposition date 2011-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yklH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yklH01
1R24A 5C70A 3QXDB 3FQTB 5BW7A 4Y8DC 3MLWH 2NZ9C 1EEQA 4ERSL 1Q0YL 1F97A 5T3XE 3LPFA 2XZCL 1GOHA 4KVNL 1EK3A 1HSAB 4RDQF 4HBQA 3BOVA 3L3DA 1CFBA 2V2TA 1D5BB 4JHWH 4M1DH 1KEGH 2OBGA 2XZAH 1Z9SA 4MX7A 1IZJA 3MLYH 3MYJA 1ZAGA 4JY6A 1PLGL 3LZFL 4NBXB 2AS5M 2VERN 3HAEA 3EYQD 4PJ5D 3DTXB 3ILPB 1BAFL 3ULUH 3NMEA 1AGBA 2LU7A 5DUPL 1T1WB 2W60A 3WCYA 2C26A 3QEQB 2Y36L 4LLUB 5D93C 3SE3A 1LEKA 1FZMB 5IFHH 3MJ9L 1IM9D 3GSRB 2EYSB 2PYEE 2EKSB 3PQYD 4U1GB 3QUKA 5DR5L 4P4KC 3HC0B 2X4RB 5C07A 3HC4L 4PJGE 2A9NL 1N0XL 1D5IH 5ISZE 1NANH 5DWUH 1A6PA 4PRHB 3DI3B 3NH7H 4WWKB 4EUPG 1S9VB 3JWNC 1OY3B 1E28B 1N5AA 4HUVB 1V7ML 5IT2H 3S37X 2FEDD 3AU1B 2V7NA 4RDQG 2Y25A 4XMLL 4XNYL 2X4SA 4XRCB 5DQ9B 1P9MC 4PJFA 1JHTB 4CJ1A 1F6LL 5D7SH 5J12C 2VLJA 4JFHE 2DIJA 1U8LB 4XAKE 5D7SL 3WN5B 2WWKT 4P3DA 4OCRL 4HXAL 2R0KH 4QHNA 2AABH 1EERB 2Y06H 1XF4B 2I07B 3MJ6A 4L4TE 3OXSA 2H45A 2J5LB 2W9LA 5EC1B 4XNQA 1FQ9C 1A4JA 3SDDA 3NCFB 4YAQA 2AK4E 3DMMB 4X6FB 5TE4L 3RNQB 4O2FA 3CXHK 2IG2H 4GRWF 2P8LA 3G6AA 2GAZA 4IEFB 2WUCH 4M1GH 3TO2B 4Z0XB 1XF1A 1CK0L 4JLRA 3UEZA 3ZKXB 5K59E 1A14H 2FHBA 3CVHA 3CZFB 2Q7NA 4RAUA 5FKPB 3DROA 4C56A 3FOLA 1A6AB 2ILLA 3I75B 4UMGA 1YEJH 2BVEA 4OLVL 1ZE3C 3TP4A 3NPSC 3EJJX 2X9WA 3Q1SH 2Y72A 1C7TA 4M5YH 4N8CH 3ZKNC 2AXJA 2HLAB 1H8OA 5LBSH 5IW6B 5EORH 1ZV5A 1MSPA 4YXLH 4LF3A 2J1KA 4NRYB 1INDL 4K71B 1INDH 4QRQA 5BO1L 1C16B 2R1YB 2H1PH 4U1SA 1D5XA 3U9PH 5C09A 5C2UB 4FZEL 4ZUWB 3WJJA 3V4UH 1UZ8A 3CCHB 4WGWB 3VGGA 3OKKB 1J10A 3VRLE 1F4HA 4FP8H 4YZFF 2GIYA 3TWCL 1E0OB 1NBZA 3R0MA 4JRYD 1CFTB 3GMNA 4ODTH 3P9WB 3DXAE 4GG6B 3JSSA 2PCPB 1T0NA 5I66A 1DL7H 2VH5L 4UB0H 4IRJA 5IMLB 4KRNA 4J3OC 5C0BD 3T3PE 1L7TH 4NZTL 3FO1B 2RGSA 3WEXA 4Y2DA 4U3CA 2VLKD 4EQ3A 3EO0A 4RISH 3ULUF 1U3YA 4ZO9A 4IIQA 3TPKA 3FRUA 2PYFB 2WMPA 4MXVE 5C9JB 5J4MA 3DO7B 2IC2A 2ATKB 5DJ8B 5I74C 4YE4H 3C5SB 1XCTA 5K9KB 3VG9C 4KJWC 2BZDA 4ZS6D 3WSQL 5LVEA 4G8EB 4LCWD 4WUUD 3LY6A 2Q86B 4PJ9B 6FABH 1JHKL 1VADA 2ZOKB 1DDHA 4X80H 4AMKL 4XAWL 3UZVB 4JO3H 3PP4H 3W0WB 5JW4M 4YPJA 4FS0A 4RAVB 5HI5C 3VFTA 4RFEA 3QUXC 4Z7WA 3WUWG 1DBAH 3TESA 2RFXB 5FKAB 1UXSB 5HVGB 4I18C 4XCCH 2F58L 4S1QH 2VXQL 5GJTH 1ES0B 4ELKB 1OM3H 1RQ5A 3RDTC 1DQTA 3OPZL 3FO0H 5F7MC 3IKCB 3ZSTA 2VZ3A 2F8XC 3QO0A 2X4OB 4GXUM 2MQ3A 1KYOK 4AL8L 2XXMB 3QZWG 1OHQA 1U8QA 3FFDB 4EN3B 5CHNA 3DI2B 3U0TB 3ZLQC 4XNZC 1G7LB 1W8OA 3SE8L 1EFXD 4NC2B 2VOTA 3WXWH 4N5ED 3S5LB 2GK2A 5D6CA 5L6YL 1AY1H 1U8HB 4G80B 2G2RA 4PJXB 4P3WA 4E41D 4GAFB 3ZTNL 3WS6A 4EIZC 4Z7UA 4K3EL 1YNLH 3ZDXE 2Z31B 3C09B 3MZGB 3OG6B 4ZO6A 2UZYB 4X0KA 4Q9RH 4X7FC 5CJ8A 3WFHA 5C0CB 1XR9A 5IVXB 5EBMA 5CKAA 3T77B 2ICCA 3KLAA 4J7RA 3MXWH 2EIZA 4WHDA 3R06B 1N7ML 2AEPH 2DYPA 1MFEH 2BC4B 2CXGA 4IDJH 4LEOA 1A64A 2LTQB 4GMTH 4LPWA 3HR5B 4NO2A 3IFLH 3V0VB 3IDUA 5IK3B 1F3JA 1XGUA 3MGOB 4H5SB 1FFNA 1UENA 1P2CA 4MS8C 5DHVH 5FK9A 6FABL 4TQEH 1PJ9A 1HH9B 2GJ6B 1EUUA 4NC0B 4OZFA 4QXGL 5EO1A 1EO5A 4U0RB 5ESQB 1E4KC 3QEQA 1A7RL 4LLUA 2UZIH 1RZIB 4Q2ZB 3AFLA 1V05A 3GSRA 5E4EB 1DLHB 5GGQH 1M7DB 1DN0B 3PHOB 1NGZB 3FONB 1L7TL 3O6FD 3OTTA 4NZTH 3JBG7 3ZDZF 4D8PA 3V5HB 1KYOJ 5T1LB 5C0AE 3BPCB 5IB2A 1UQSB 4LIQE 4F7EA 3B9KB 3S8WA 4FQQA 4E5XB 2ICEA 3PGFH 3WFEH 4WWKA 1S9VA 1TJIL 3CLFL 1HQ4A 2BVUA 1QYGL 3OAUH 5D2NA 3CLFH 4UTBL 4OBRA 3BP7B 3I9GL 3TFKC 2ARWA 4GKSA 3B5HA 1TVBA 1INQB 1NC2A 3MACH 1WFUA 4NKMB 5TQ2L 3LCYA 5EO9B 2GFBB 4ZYKA 5JQ6H 3S3PA 2QHRH 2VLRE 3DVGB 4QO1A 1RZ8A 3ULUD 4KAQL 5SWSE 1YPZE 3UCRA 3T1FB 2JB5L 4WEBL 3CH8A 4YHNA 2HFEB 3IRZA 3MCKA 3FO2B 4CN4A 3TJHC 1G7MA 3D0LA 4X7TA 5FUCC 2HVJB 3FT3A 4HKZB 4UINH 3F58L 3DUSA 4CVZA 1RURL 5KOVC 1UA6L 3UYPA 4I2XB 5BVJB 1L0XA 3Q3GB 3DX7B 3CSGA 3VFRA 2YD5A 2PKDA 5C1MB 1RJLA 3V0AC 4N8CL 5D1XD 3L1OH 3PABA 4M6AA 4R2GB 5FAAA 4I8DA 5MEOB 4HPOH 1K8IB 2C1OB 5KVDL 2R1XB 1A1MB 1K5NA 2PTTA 3A6CL 4KK5D 4CBPA 4MA1B 1LK2B 2FDBP 2W38A 2HKFL 3RBGA 2YZ8A 3BIAX 1V8HA 2O5ZL 3VWKC 5FO8B 4MGXA 3HB3D 4N1EA 5DR5H 1OP3K 1CGYA 2PXYA 5F88A 3CJJA 1QBAA 4NRYA 4OGZA 5D7IB 1F8TH 2IQ9L 3QDGE 4ZD3L 1DBML 2FO1A 1F11A 1QBBA 1V5JA 3WUZA 2OM5A 3GSNH 4MJID 4AIZA 5AWNH 4JPKL 4JFDB 5LQBH 3VE0B 1NBVL 2AGJL 3VXRE 1NDMA 5CJQL 3BYYA 3KPRA 1NUGA 1H3VA 3HS0A 4ZFFB 4O2EA 4WO4C 1EDQA 2NY7L 2O5YL 4LVEA 1BFVH 2BNRE 3VXUA 2G9HB 4M4PA 4X8XA 2BMKB 5B38G 1CICA 1W0VB 5D96B 3VD9A 1KC5H 4UILH 4GAJH 5T3ZL 3WIIL 3U1SH 3CMOL 4NZDA 1JNHB 5DD3H 3MRRA 3WEXB 2A73B 4LKCA 4IS6A 3LDBC 5TFSL 1VGEH 4WJ5A 3D3VE 1C08B 4UV7L 4OSUH 4QRUB 4CW1B 4WUUB 1F45A 2BNQE 2GEEA 1JWMA 4XAWH 1EHLL 4NHUA 1P7KB 5GHWH 4BKLA 3LN9A 1Y6MR 2VWEC 4ZTOH 3VA2C 1XCTB 4U6YA 4YHIB 1CDUA 5DA4A 3G5ZA 5I6XC 3AROA 3SGJA 1J0YA 3U2SB 1QSZA 2I5YH 5DRZA 2XWBA 1G9MH 3PXHA 1YQ2A 1UJ3B 3SKUD 3WLBB 3D1MC 2R69L 3W0WA 5ACLA 1PFCA 2X89A 5FUZH 3P4OA 1ZXQA 1TMCB 3EYFA 3KPRE 1IGJA 1BJ1J 4LLQA 2RFXA 4CVWA 5ABDE 5CSBA 4X5LA 1DUYB 2BOCA 1YQVL 3REVB 1DQQA 2CMRH 1RY7B 5F9WB 2R0LL 4RMSA 3MMEB 4MAYA 2XRAH 2GTWA 1KB5H 2AJZA 3GJFB 4D9RE 3BEVB 3WNLA 4ZFGH 1CDHA 3MOAH 4X6FA 1Z3GH 2DBLL 2VUOA 2WWMC 4U6XB 2D7PA 3BWUC 3MLZL 1X6NA 1FFQA 3MOBL 1XGTA 4PRIE 5CJXC 5DQDH 1PG7W 3ZT7A 4BFBD 2DI7A 5AG8A 1I3UA 1UCTA 1JUFB 4KRPD 5HHOD 3HG1B 2NY5C 3QEGL 3STZB 2KQNA 2D7MA 5EO0B 3A67H 4K3JH 4HS3A 4RGMC 4YQXL 4BH8B 3DYPA 5ETUA 2CXKA 4XVTH 1XAUA 5EIQA 1ZWIB 2DYPB 1AXSA 5IV2A 2WWMD 5TDOA 4QRQB 1YPZA 1A14L 5C07B 1MHHB 3NGBB 4ELMA 3MJ7B 4OLZL 4CN6A 3UYRH 3OKDB 5FHAL 4HUVA 3QHTC 4KI5F 2ZPKH 3NA9L 4PUBL 4PJAF 4U3HA 1CS6A 1HH9A 2B5IB 3EYOA 12E8H 2Z31C 2DIBA 1UFUA 1YC7A 5F3BA 3GSVB 1A6WL 2PCPA 1IL1B 1PEWA 1E6JH 1G9NH 4GRWE 1UEYA 3FOMA 3UTTA 5D5MA 1CT8A 2F74A 1FO0H 2LE9A 3HPLB 5KAQF 1S9KC 4JB9H 4YAQB 1K4DA 4PR5B 1IEAB 1S7UA 1VENA 3LH2H 5JW5B 4NQEB 5D70H 1OGAA 1TZIB 1N64L 2ITDB 3IJYB 4IIQB 3UDWC 4DUVA 1X5IA 2KQMA 4NUGL 5GS2H 4Z76B 5CD3B 3TO2A 1YEGH 1NLDH 4JDZB 4MA7L 4OLYH 5EFIA 1R5VA 1BIIA 4DQOH 4CU8A 1AD9A 3RGHA 1IQDA 1BHGA 4JM2F 2YUXA 4G9FD 3UYRL 3T65A 1MFBH 3MLZH 1JZ4A 5T3ZD 1P4BH 1DN2A 1VB9A 5DMIL 2NY4D 2VUYA 2Y23A 1VGKB 1NCUA 1A4KA 2G75A 2GSGA 3BD5A 3R1GL 4GQ9H 4IRJD 1KLUA 4UTBH 4P2OA 2XT1B 4K2UH 5FGCB 4MAUH 2ESVD 2I9TB 3FB7B 1WZLA 1DBKH 2HFGL 3NFNA 5JXED 2DWEA 2VLLB 2R23B 1OQOA 2FR4B 4OI8A 4ELKA 1T5XA 5D6DA 4Z7OE 3V7AG 4ZUWA 4M6OH 3GZKA 1R24B 2R9HD 1PY4A 4IM8A 1IKNC 3QEHB 2XNAA 5DI8B 3DETD 4PGEA 3BMVA 1UCBL 3AAZB 2IPUK 5IB5A 3E2HB 3U82B 4NO5B 2B0SL 1UB5B 3QXAB 2QQLL 4KK6C 3TNNA 4PRHD 3O2DH 4LPUA 3F7YB 3T2NL 4YXKH 2XFXA 3R4DA 4U05A 1FC2D 1T3FA 1GGIH 5LGJB 1YEEL 2X4SB 3X12A 5KJRH 4Z7QF 3VMNA 4DEPC 1H0DA 4WHTB 5GGTL 4AIZB 3RVUD 1KTLA 1G7QA 3I85A 2FIRT 2V7HA 2OK0L 1K6QL 4MJ5A 3FRUB 4YHYB 3KYNA 4OAWA 4KQ3H 3CIQA 3KPNB 1FZMA 1T1YB 4GRWB 4MJ6A 2OP4H 1ZHKB 1A4JB 4TSCL 5HI4C 3CPLA 4EDWH 2W9DL 5FGBC 2F54B 4EDWL 3P0YH 3GMRA 3OKEA 4KTDL 1FDLL 2DD8L 1HQRB 3MRNB 5CSZA 1RZJC 1FFNB 3ZO0A 2VC2H 4RAVA 4QRUA 4RAUB 3V95A 4JG0L 4WUUA 2QSVA 1PKQA 3G08B 2EDBA 4DUXA 3DO3A 1EEUA 1UXSA 5DFTA 2VXTH 3RZCC 4L3CA 5DS8B 5LWYH 3NFPA 3NACH 3ISWA 4XNMB 4XPAL 4RGNC 2YXFA 3OF6D 4KRMB 1B3JA 4O4YH 1JBJA 3U46A 5CZVL 2OJZH 4DGIH 4MNGA 3X17A 1U8QB 1RIHH 4ONOA 5FOBA 4FQQB 4AM0A 4JPVL 5C6PB 4AEIH 4LNRA 2VDMH 1XZ0B 3EYUH 3O4LB 1RK1B 4NUGH 1GGYA 1A1OB 5HYQB 3BISA 1XEDA 1F4XL 1K4CB 3ORJA 3P0YL 3ILQD 2B0SH 3CVHB 5E8NA 4L8BB 5MERA 3QDJE 5I0ZA 1DZBA 3CX5J 3KLHC 5CP3H 1F4YL 1UM4H 5INDB 1QBLH 5ID1B 2WUBL 3V4PH 3B9EA 3DBXB 3M8OH 2GSIB 4LRNH 5C0CA 3O6MH 5FUCE 5B4MD 1QR1A 3BEVA 5JXAL 4KJWD 5IIEB 4NIKB 5GGRB 2D7NA 1RIUH 2NY6C 4F9PA 3O8XB 5E1HB 4LCCC 1NFDE 2FX9H 3VXUE 1MLBA 4PGJA 4RBPH 4PLJD 1KLGB 4J6RH 2BY2A 1A7BA 4I4WB 1QQDA 4LQFL 2COQA 1MNUH 3C5SA 2BRRH 2X10A 5K9KA 1N5YL 4UT9H 4WEMB 5DGQA 3GHBH 2NZ9D 1GSMA 2CO6B 3UTSE 1FJ1B 2WW8A 3QI9B 5F7WC 4OV5B 1U42A 4Y2DD 4PRNA 4X5WA 1GC1L 4TULL 1F6AA 5FO8A 5GGUB 3TT1H 1UXWB 3V9FA 3IFPB 5HGDB 3PHOA 1ZK9A 5FCSH 4BZ1H 3W2DH 3T0EB 1CTNA 1BWMA 1NFDF 2DJUA 5FHBH 4NN6B 4YBLB 2Q3AA 2VQUA 1Q94B 3IYLW 5JHLH 1RAMA 2FEEI 1HQ4B 3DSNA 3SEPA 4P23B 1FHGA 3GJEB 4YX2L 4C4KT 3QG6B 4XB8A 4NWUL 4F80A 5MHSD 3U36B 1I9IH 1S5IH 5KSBB 4WFED 2D0HA 2L4OA 3FQNB 1AI1H 5E8PB 2ATKA 1CGSH 3U7YH 2OQJA 5F21B 3GSVA 1QVOA 1SJHA 3UPAA 3ZSSA 2H2SD 1DE4A 5I1IH 2A9NH 3SDAD 5C07E 1LP9A 4HK0B 4JZJA 4K3DL 2HT3C 4U1MB 3ALPA 1NC2D 5FYJU 1DFBH 4FFWD 5EU6D 3BGMA 4Y4HC 3VXTA 2NY3D 4HH8A 5I0DA 2FX8H 5ESVB 2BCKB 3HE6A 4KMQA 4W6YB 2VR4A 5KG9B 3LKSA 2DDQH 4G6KH 3O6ML 3KS0H 4KKAD 2XKNB 1RJLB 2Y4SA 5KVGL 1H3WM 2O61B 3QWQB 2R2HB 2AJVL 2R8SL 1ED3A 5L2KB 3OMZA 4QXTB 1PBYA 5C0AA 2Q20A 3KXFB 1FORL 1XH3A 2HH0L 3L7FB 3OX8B 4H25A 5JOFA 4A2LA 1W72A 5B8CA 4KKLD 4ZXBB 1NMAH 3Q6GH 1WWWX 4M43L 4GAGH 3C60C 2GJ6A 4PJIF 3E8UH 4X6DE 5ICXB 4RRPG 4BZ2L 4CN1A 1E6OL 4BH7A 2W1NA 5EZIH 5JO5A 5E6ID 1DQLH 2OR8A 4Z7UB 1GPOL 2HAZA 1V7NH 3OKNB 4D9LL 2ZG1A 1IKNA 1BLNA 1VFOA 2APVA 2G5BB 2EH8H 2H32H 3PP3H 3RHWF 4D8PB 2EDQA 5T1LA 4BK5A 3LKOB 2CKBA 3GSXA 2ADIB 3CU7A 5F7DA 2IQAA 1S7QA 2I60L 4HIXH 2BNUB 1AO7E 2W92A 4LEXH 3QCVL 2OL3A 4OZGA 2VE6B 2VZTA 1C1EH 4JO4L 3NCJL 4I0CC 4LCYA 4PBWD 2VSCA 5DD0H 1TQBC 3LN5A 4DKFL 3I6KB 2A73A 5GS3A 5KS9A 1ZT1A 1TVBB 4LLWA 1ITCA 1KFAL 1XIWD 4PJHF 2QQKL 2YSSB 5EO9A 3O6LH 5CILH 3GBML 2VLKB 4LSUL 2DQJH 2A1WH 2M26A 2LAAA 4P2CG 5FCUL 4YDKH 1HKLH 3B8YA 1F8TL 2GW5A 3MRDB 4XPBL 4EUPH 5E9DB 4WI8A 1A2YB 4PY7A 3KDMB 4BZ2H 1WAAF 2NZIA 5HJ3B 4PRBA 1CDJA 1DQLL 4JR9L 1G7MB 3D0LB 4U6YB 4X7TB 2OI9C 4G6ML 5HGAB 5I8EB 4C55A 1D5ZA 4LARL 4U33A 5FA3A 4XCCL 1IAOA 3AB0C 5BRZA 4FZ8L 4ZOAA 1IBGL 5DRZB 4S1RH 1LE9B 4LGSB 4Y1AD 4WFGE 4L8DB 5K9QI 3ULVL 4LDLB 5ACZB 1G7IA 3WUWA 1EZVX 4LHQB 2UWEB 2HMIC 4Q6YA 1WFOA 3EUUA 4FZEH 1YJDH 2OTUA 2X4UA 4JGJA 4Z7WE 1UZ6F 3RWIA 1ZHLB 5DYOA 1AP2B 3ZE0F 2J8OA 1IGCH 3IDIB 5T3ZE 4JM4H 4NM4L 4AEHL 5LGHL 2HJLB 1H8NA 3ALXA 4KROC 5DHVB 2AQ1A 4JVPA 1N5AB 1QBMH 4QHLA 5HHPB 3CSYB 4WHYG 5I30L 4RX4A 4IHOB 4FXLA 4PJIE 4X6DF 4CVZB 5DQ9A 3EDFA 4DAGH 5CGYD 3VRJA 1CFQB 2A74A 1XZ0A 4EDXB 1FYTD 3K2UH 2IFGA 3PDDA 7FABL 5DUBA 5K9QG 2Q6WB 3VFGH 5C08A 1GGIL 2NX5B 3QFDB 5D8JL 5L9DH 3PGFL 5ENWA 5MEPA 5GGTH 3I02B 4PYHA 4WO4B 4K23L 2GY7B 3KPOA 1NCBH 4U31A 4GRMA 4E9LA 4XNQB 1MREL 3ZYIA 2B4CH 1VGEL 2D7QA 4MJIB 3RWHB 3KVQA 3EOBB 3LN4B 4HIHA 3EZ8A 2ARJQ 1FNSL 4U1JA 4ZFZA 4OKDA 1PEZA 2LQRA 2R0ZL 4OLXL 1K8DA 4XP6L 3DXAA 5E94A 1N4XL 5IV2B 4ZPVA 1NSNH 4PGDA 1GGBL 4Q6IB 5DD6B 4HT1L 3H3PH 4YHKH 1D6VL 5ALBH 3SKOB 4Q7DA 1MI5A 5C09E 3QEHA 5JDSA 3MROA 3P2TA 1KIPB 3RI5F 5IBLD 2WQRA 5D71H 1QYGH 2ZNXA 4PRNB 4MQXC 4KJPC 2FGZA 5EOTB 4IJ3B 4FQLH 3IF1A 2VITA 3WYRA 2SEBB 2Y36H 4KU1A 3T3ME 1YY9D 3SDXF 4XC3L 1DBBH 2HKFH 2BRQA 2RQ8A 3X12B 2EXWD 3C2AL 1I7RA 3TWCH 2UWEE 4PRPD 1OARH 3IB4A 5DJXA 2AXFA 4HWZB 1YECL 4CW1A 3NIFE 1BECA 5EIIB 5K9OA 4OZHA 1WIUA 4Z7WF 4GXUN 1N4XH 1QLFA 3CFBB 4LKXA 4KGJA 5EUOB 5AYUH 3TPUB 1HXMB 5JPNA 1R5VB 1UA6H 1CFVH 4OCYL 4HWBA 4Y2DB 5J3HC 3RAJL 1OGAD 3O6FC 1JGDA 3JV4B 3BW9B 3MUGB 5T1MB 1GZQB 1P53A 3NCYS 1XF5A 3SPVB 1BD2D 3IXAB 1EJOH 4YEEA 4IRSB 4ENEC 1J05B 1TPXB 2CDFB 2VAAA 4OUUB 2F19L 3GSQB 2AEPL 2VLJE 1WIOA 3GRWL 4RFNC 5DJ8A 2I9TA 4XBEH 1JUFA 4B7IA 4ZSOB 5DZNA 3GMOA 4QHKJ 4UIMB 3TIDA 3PV7A 4I3RH 4LSRH 5I1DB 3O2WL 5DSCB 3QDJD 4OCSH 3BPNC 2X1WL 2XOTA 3BZEB 2XV6B 1U3HD 3GBMH 3ZTNH 4NO3A 1JRHI 1BWWA 4X6BA 3AM8C 3JUZA 1KPUA 5ISZA 2DD8H 3VDAA 4JHAH 1KT2B 2V6HA 1KCRL 1EGJL 2D3VA 3GI8H 3KPSD 5JOPE 4NN5C 3TBVA 3WE6B 4ZO8A 1CLZH 2N1KA 1FGVH 1KPRA 2D31A 2V2WA 3JV0A 2PYEA 3QUYC 4GT7A 2O26U 1LO2L 1LO0L 1RZFH 3F7YA 3MV9E 4L3EE 1T3FB 4RMQA 2EDXA 3UX9B 4BH7B 1GIGL 3ZKND 5L2JA 4XNXL 4H26A 1ORQB 3D5OF 1NGPL 4FG6D 1NH6A 4PD4K 2Q8BH 3N1PC 3BIKA 3FFDA 3DPBA 4AK1A 3QJFA 2X09A 1P9MA 4GKOA 4UDUA 3I3DA 3MYZA 4JQIH 4NKOB 4WENB 4KTYA 1M7IB 1U41A 3ES6A 5EUOE 1WVZA 4F9LC 5ETUB 2ED9A 1PX3A 1KG0A 4NM8L 5E7BA 2FLBT 1YDPB 5CEZH 4P9HL 2DL2A 5I1GL 4XPBH 1NMCC 3BESR 2Z31A 1MHHA 1NC4A 4AMKH 4PGBA 5GZOC 3N85H 4Y1AB 2Y07H 4Z7QE 1S5HB 3ILPA 1MRFH 1LNUA 2NY2C 4HKBA 1YMHB 1FVDB 5I30H 1U92A 5HYJA 1I7UB 4HZAA 4N0FB 4OI7A 3SE3C 1A6ZB 3W0WE 3CZJA 1CE1L 2EIZB 1TDQA 2BVOA 4XC1H 3I2CL 1A2YA 3RVWD 3H7BB 2FJHA 1F6AB 3O3EB 4M03A 2HFGH 3B6SA 1TCRA 3QUXB 4ONFH 4XCEA 3JV6B 5KBNC 5EN2B 2ID5A 3A6BH 5ANMA 3BVNA 4ZAKC 4I3RL 4DZBB 1KXQE 3DOSA 5CMAB 5FK9B 1DUZB 1D9KD 2OP4L 1QZ1A 1OLZA 1CFSB 3VXSD 2W91A 5JW5A 3LB6D 4M1GL 1NAMA 3K8LA 4M43H 2FGWL 1W0WA 3T3PF 1U8IA 2XIDA 5EB9A 3RVWC 3HI5H 1QRNE 5E8NB 3CFIC 5A1AA 2HJKB 4J3TA 3QHZL 1UB5A 4HJ0D 2EZ0D 5EOCL 2CR6A 3T65B 1UWEH 2QSTA 4ZNEE 3S9DB 4KKCD 5ID1A 3L1OL 4BSVB 4LSSL 4HBCH 3MRMA 5GRXG 1XGPA 2GY5A 2BNRA 4F33B 4QHLB 5H35A 4ORZC 3BGMB 3G6AB 1MJJB 4JFED 1GOFA 1NUFA 4NKMA 1OTSD 3WL9A 4EDXA 3VXRA 4OF8A 4HUMB 5ALCH 3DROB 4C56B 1IGTB 4KAQH 4I4WA 3SE4A 2Z93B 3DYOA 2DAVA 1MIEL 4WEBH 3WHE0 1ND0B 3BRGC 2XWTB 1BZ9A 5D7JA 4ESKA 3FFCD 2R2HA 1A6UL 5BXFA 4K9EC 2DB8A 1H15B 2HVJA 3FT3B 4HKZA 3S35X 4MJIA 1FCCA 3EDDA 4LF3B 3C9NB 4KTEH 4YHZH 1A7QH 2FH8A 3BI9X 4YHZL 4WTZG 3QIWB 4WY7H 3DV4A 5JLZA 4Z8FH 5EZOL 3VI3F 4ACPA 3NFSH 3OKKA 1MVUB 3GUTB 5KVFH 4KV5E 3DX6A 3KJ4C 1P4IL 1X7QB 2VRAA 4RNRB 1ACYH 5C8JB 3D2UB 2WLYA 3DX9B 1JCKA 2F53E 4YUEL 1ZOXA 2AJSH 3F6LA 4NQVB 3UBXB 3EOAB 4KKNA 2AV7B 2FD6H 3VFPB 1ZVSA 5CP7A 3V6BR 3DHMA 2YK1L 3FQUA 2BXYA 2YWZA 3LKQB 2BFVH 3C5ZB 5CBAA 3O4LA 4JFDA 3VMPA 3HPJB 3MQIA 3U0WL 4BSWB 1NEZB 3ULUC 5FHAH 3S36L 2R4SL 4PLKC 4P5MA 3T0WA 4XHJC 4U6VL 2YN3A 3HNTL 4KK9D 3BZ4A 12E8L 3RVVC 4DAGL 5IG7B 5D2NE 2Z8RA 1ZHBA 3LDBB 3NCBB 3TBTA 3CFBA 5HHOE 3VFGL 3VW3H 5B39G 5GZNC 2X4QB 3P4MA 4Y16B 2ARJB 3JV5A 5I1JL 5FO9A 4PJBF 2ZOKA 4JY4B 2DQCL 3GMMA 5I8EA 3QQ3B 2DM2A 4L9DA 4G8GB 1QO3B 1ZTXH 3QEUA 2KZWA 2KUTA 4X8JB 2YD6A 1Z5LA 3AB0B 2OJEA 3OKMA 1T2QH 4Z7NE 1HH6A 4X5XB 2MMXA 1S7TB 2XKUA 5L2KA 1R3JB 1EZVY 3ARGD 4AM0B 2BVYA 4P59H 1AQKH 4F57H 5GGTA 2QL1A 3ARUA 3L6FB 3BP4A 1OF2B 3DURB 1NCAH 2CO7B 4PJHE 3BQUC 5I71C 5C0FA 3OR6B 2DBLH 3N85L 2EIBA 4NO0D 4DN3H 3QIUA 5BV7C 4NKDA 1AE6L 4OGYH 5HI5D 4W81A 5D1ZC 3UP1A 4XP5H 4YBHA 4HJGB 5GIRB 4YIQB 4QT5B 5E8OA 1YN7B 3RY6C 1NQBA 3OAYH 5F89A 1JNNH 5BOZG 5DUPH 3ARGA 3TM6A 5KTEL 2IFFH 4CRPA 4PJXA 2AI0H 3U1SL 3O4LD 4N8VA 4JFDD 5DD3L 1WC7B 2HLFD 4QY8B 4GW1B 2YBRA 2CMRL 1WGOA 1QSEA 2OR7A 3MLVL 3EDEA 5GRZA 3I02A 3I50L 5GRWA 3RUGA 1B9ZA 4P59L 4PBXA 5KAQG 1PSKH 1NEUA 5E56A 4Z7OF 3QJFB 2BY1A 5DVMA 1FLTX 1RZKC 4PJBB 1RU9H 4XCFH 2WBJB 4NQCD 2XTJB 3KYOA 3V5DB 3WV0A 1JMZA 4Y4HB 3KJ4B 2JJUA 1I8LC 5D2LA 1KN4H 2DBJA 3QQ9C 3EOTH 5E2WL 5BV7H 5ITFA 1TJGL 2DQCH 3H6JA 2CLZB 5IHLB 2QKIA 1U93A 1H5BB 2H3NA 3U4EB 3VXQA 1A3LL 4IOFC 4OT1H 4NQTA 4R8WL 1LD9B 2FL5A 3KGRA 4GXVL 4BUHA 1NFDB 1DN0A 5IP4A 1ZHNA 1AXSB 3ARFB 2OL3H 3AUVA 4HGWA 5DMKB 1FPTH 1DEEA 2P43B 3TCLA 2P7TA 5GRUL 3GSOA 4ELMB 1LGVA 1NCWH 3FCTA 3H42H 3QUXA 3KPSA 5B8CB 2JJSA 4KKBD 4EI5B 4U4BA 1P4LB 5IFAL 5C3LD 1BVZA 4I13B 2ZUYA 4QRRB 4MQXD 5HHPA 4OZIF 2CGRH 3QDJB 3QPXL 1I1YA 2O5YH 5C0JB 4LSTL 4OZHB 4UBDD 3MRKA 1VEMA 4NFCA 4NRZA 1FL5B 4P2RE 4RISL 2F54E 1LO5B 2N7AA 3GJFK 1QHOA 5J9PA 3MFGB 5JPMA 3U6RB 5ENWB 4KUZL 1YA5A 3MCKB 2QJDA 5E8DH 1F42A 3FMGL 1CU4H 4OCMC 3EO1A 1HSAA 3KPOB 1Y6KR 1L0YA 3EJZD 4HH9B 4TVSa 3GIZL 3O6KH 4M7LH 3S3JA 3LEXA 2ZSVA 4LCYB 5E5MA 1S7UB 2EDFA 3LIZH 1A02N 4J3SA 3AM8A 3HFML 1XGPB 3HG1E 3LV3B 1KCLA 4XWGL 4MZ2A 4ZAKB 1NLDL 1MCPH 5HPMA 2DQUH 3S4SG 4U7MA 4DQOL 1ZS8B 3ARDA 2X05A 2QQLH 1JI2A 3NABL 3W2DL 2XWTA 3RU8H 2XQYG 1BLNB 2IANE 3T0BA 5IEKB 5JNYA 5DEZA 2FIKB 2VDLH 1IMHC 3P0GB 1SYSA 4ZUVA 5HY9B 1KCUL 2FX7H 2JK5B 1FAIL 2VDQH 3B8SA 4M02A 1HKFA 3VGAC 5JXEC 4A6YL 1I7ZA 2IAMD 2X4PB 3G9VA 1F11B 4HUXA 2VITB 3QIWA 5ACZA 2OL3B 2X1OA 2CRZA 4OZGB 4PJEE 4C56E 1IC7L 5HVHC 1MCLA 1C5BH 2FJFB 3SDDD 3VE0A 1AC6A 4BFIA 1RIHL 3O81A 1HEZA 3LIZL 3HB3C 2R0LH 3B9KD 3AAZA 2FB4L 5A2KH 4D0BA 2XI9A 2G5RA 3KPQB 5E9DA 3BO8B 3KJ6H 4HFUL 1U3HA 3TLRA 4JPIA 2Y5TB 3KNBA 3M1BA 3BAEH 5DJCA 2EC8A 5SX5H 1FNAA 3UZQA 5HVFB 2CKNA 4G6JL 3VRJB 5FYJD 4LCIL 5HVWA 1CF8H 1KTLB 1UB6B 5T1MA 3SE9L 1LK3H 3M45A 1JGUL 4NJAL 2MQCA 1EHNA 4P5TD 1GGCH 4PTUA 2EYTA 1EV2E 4YXHH 4ZFOL 4R7DB 4N0FA 5B39B 4M93B 4H0GA 1F58L 1XGYH 4A6YA 1I85C 3HC4H 4UT9L 2VLRD 2HWZH 3N1QC 5DWUL 1KELL 1TCMA 1KB5B 1KULA 4G8GA 3CDCA 4LHUG 4Y0GA 3OKMB 2XN9B 4NCC1 1J8KA 1J1XL 5BZWB 5SWQA 2D03L 1RUAH 2N56A 1CICC 1DQJB 2GUOA 1PKQB 3G08A 4JR9H 4GUPB 1KB9K 5C2BL 5JHDE 4P46C 4HUWB 2K1MA 5AEAA 2YC1B 5JDSB 3MXVL 3QDGB 2VDOH 4PJ8B 3VDBA 1JPSL 1FE8H 4Y4KB 3BP5B 5GRYA 3AREC 4KK8C 2B7DT 1ORQA 2ZUQB 4XMPH 4MCZB 1N59A 3LMJH 1AFVL 4ZOCA 5HI3D 4MNQA 4OTXH 3MCLH 4YHLL 1JF1B 3KAAA 4H88H 2MPAH 5DO2C 2Z4QA 3MRMB 1B0GA 1YN7A 1KJVA 3QXTA 5JXEA 1WBZB 2KBGA 1DQML 1AGDA 1NMBH 4P9HH 5C0NC 4XCNB 2HT2D 1LDSA 3QDGD 1MRDL 4M3JA 3TVMC 3WFDH 4O02H 3G6JB 2K3TA 2Y07L 4LARH 1S5HA 4LKXB 1PQZA 2YD7A 3T2NH 1BQLH 1E4WL 4HG4K 2Q8AL 1E4WH 1R0AH 1MJ8L 3W9DA 4NQDE 3ZE2F 4S2SB 5SWZA 1VFAB 1NGWB 2VZOA 1VADB 3QHFL 5GQBA 5EUOF 1KC5L 1QFWL 3NACL 4KJPD 2VDNL 5FYLE 4IRSA 2IH3A 2M8XA 3H9SE 4XGZA 2AJVH 2R29H 4DKFH 1LP9F 1GH7A 4F7TB 1YY8A 5DD0L 5DMJB 4ODSH 3BHBA 3FQWB 3QIBA 3CD4A 4PS4H 3GMOB 5HHNB 2WZPD 2CPCA 1FFPA 1RPQA 4NYLB 4FOMA 3IU3A 4LLDB 5C8JA 2AK1L 5SX4I 4MYWB 1RULL 2NY0C 5DJZB 4L5FL 1J8HB 2ITCA 1PZ5A 1BVLB 3GSUA 1WZ1L 3BKYH 1BX2B 4GRWH 3WN5C 4OLVH 4Y5YB 1YEEH 3O3BB 4JO2H 4G6FD 2D31B 2ZCHH 4H1LG 4LVNC 1IC4L 3C6LD 4QRPE 2OK0H 4LNVA 3OL2A 1ZLUK 1OWRM 4I3SH 2A83B 4TUKH 1JVKA 4A6YH 4JQIL 5KSBA 4YNYB 4FQHA 5EOQL 2HRPL 3HE7C 1ZEAH 4JGMA 4N90D 1IQDB 3ZKMC 1OAXL 4CVXB 1ZSDA 3TIEA 5F9AC 4JZJB 4CUCA 5FGCE 4H8WC 4M6OL 1VKXB 3U4BL 1LEGA 3LRSA 2XY2A 3MFFB 1A7NL 4UQ3A 2XZQH 4G42A 2GQHA 1Y18A 5HYFA 1KG0B 1PG7H 2XZQL 2UWEF 2ORBH 2K9UA 2AKRB 2H41A 4YEFA 5D1XB 2VLRB 4ONHB 5HD8C 2P46B 4GKZB 4XNYH 4CL7A 3MLXH 1QPPA 1HYSD 4ZSOE 3QUMB 3S4SB 1OAUL 4NP4L 3L3HA 4FQCL 4IMKA 4M93C 4X6CB 1OB1A 4UDTA 1I7UA 3MXWL 3PWVA 2EDDA 1RUKL 3V5KA 1ZS8A 3IJSB 1X4ZA 1NCBL 2R1WA 1D5BA 3O4OC 3DSFL 1KUMA 4QRPA 4NKDB 5IMMB 4RNRA 1ETZA 4NPYA 4PRDA 3CC5A 5K59F 4WIQA 4Q6IC 3VXOA 2DM7A 4UOW0 4APQB 2FATH 3MODH 4KMTL 1OP3H 4QT5A 2D7OA 3QI9D 2Z9TA 3MV8B 5HY9A 4MD0A 3CFDA 3PHQB 3QFJB 3RTQB 3GIVB 2UZIL 2ICEB 1RULH 2BFVL 3IJHB 4HC1A 4JHWL 5D2NB 4HV8A 1IQWL 5L88L 4Y2DC 2ORBL 4M7KH 3WJLC 1YEFL 1HINL 4P57B 1V7MH 3F58H 3O8XD 3NIGE 4TVPD 5GJSL 4JREB 1F3RB 5T1LD 3NAAH 5F9JA 3BZ4B 4AQOA 5D7LE 1U0QA 1SJEA 3PQYE 1RUQH 2IGFH 3TZVB 3TBSB 3ZKQD 2V2TB 4Y4FC 5LXGH 5EUKB 1QFWH 5D9SA 5L9DL 4MD4B 2X4QA 3QCTL 4F33A 5EIVA 3LN5B 5IVXE 5DJCB 5TQ2H 2EO9A 4JY6B 2B1HH 5JUEH 1URLA 1JV5A 4OBSA 5AG9A 5DLML 1MCEA 1N6QL 1MNUL 2QR0A 2J8UF 1LILA 1A9BA 3JTSB 4X5XA 1S7TA 4N1CA 4J3UA 5C0RH 1YNKL 4LSUH 3VCLA 1RUPL 3C5JB 2CRMA 5CGMA 1HHHB 1CD8A 5I1EL 3EHBD 3PABB 5GGVY 3RA7L 2WSKA 3VWKA 1U8OA 1NDGA 4P2RD 4POUB 2E27L 4PJ7E 4I9WE 4PTTA 3KPMA 5KSAD 1GGBH 1ADQL 2DTMH 2X44D 1OPGH 4KKLC 1FVCB 3MRPB 5MENA 3JZ7A 1FV1B 2P7TB 4RMTA 3NIDF 5DQDL 1Q8MA 1U8NB 2P49B 4JFXA 1OW0C 4K7PL 1JPSH 5FA4A 4R90L 3QWOA 4FQ2L 4NOFA 1T2XA 3LRHA 5C0BE 4XXCA 3DIFA 2Y7QB 3K4AA 1X7QA 5JIKA 3IFLL 2B1HL 5B4MC 4HS6A 4KKBC 4ZXBC 4UAOC 4WI3A 2XTJC 1KCVL 1MVFA 3IDGB 1EMTH 1KELH 3FQXB 3HE7A 4XHJD 3B9DA 3UO1L 5BVPL 3DVIA 3RGVB 4NQDB 4DZ8B 4NN7C 4BQ8A 3PDOB 1N8ZB 1MLCA 5GGSB 4OQTH 3QT2A 2ZSVB 3AY4C 1QEWB 4GMSL 3QSKB 1G1YA 4LKCB 4UNVA 2P8LB 1LO2H 3OGOE 4U6HB 5EU4A 4UOJA 5CKGA 3S7GA 2L7UA 2PO6C 2IMNA 1WAAA 2I60H 1ZLWK 5HHXL 1WK0A 4HHAB 3U0PB 3PL6B 5F8RC 2BSRB 2I26N 1FJ1A 4BK4A 1VERA 1P7KA 4UNUA 3SE4C 4BKLB 3INUL 5IWLC 4XCYA 4DK6A 4I0PD 4EI5C 3DX9A 3LN4A 4WW2C 4YHIA 3MV7A 3OGCA 5F96H 2E6PA 5FYKH 2R2EA 1FSKC 3P0VH 5IR1B 3DXAD 3BRDA 1EEZA 5KN5A 2YMXL 3SKNB 5SWZB 4Y5VB 4M7JH 3PGCB 4G8GD 1RFDL 4ALAH 2JCCF 2X4PA 3C8KB 2PYFA 3WLBA 2R1YA 3PGDA 3RWDB 3FB5A 5A2LH 4X6CE 4XMKL 1GPOH 4CU7A 3QG7L 2C1PB 4D3CH 5EC2B 3SJVD 3EGSA 4P9MH 4XH2B 5ICYA 3JVGA 5J6GB 4PJEA 4PJ9A 3CDGA 1A7PH 1TJHL 2NR6C 1I1CA 3GSNA 3N1FC 4X4YA 1I4FB 4HEPG 4UILL 1UJ3C 1QACA 4G9FB 2AJ3B 3HZKB 1YPZF 1INEL 1B90A 4ORGA 1ZTXL 4KKAC 3QEUB 3VXTB 5EH1A 1AD0B 4QOKB 4HXBL 4MAYC 3GKWH 4P0DA 1I1AD 4JKPL 1ONQA 5CGTA 4GLRI 1KF9B 5T1DL 1JE6A 4PJAA 4PTUB 3D2UD 4MA1C 1QLFB 3GHEL 4J23A 4NCDA 4JFZL 2A6IA 4HK3N 3MZTA 1R3IL 1RK0B 3K3QA 3RZWA 3T0EE 2VH5H 4UB0L 5E8EB 4X9BA 5J3HD 2QBWA 5EO0A 32C2B 2Q86A 2UVEA 4FABH 4P46D 4HQQL 1A6VH 1S9XB 5F8QC 4S1DD 3F8UB 1KTDA 3C8DA 2R15A 4HS8L 5E8OB 2E6QA 3RHWK 4I5BA 5E2TL 4TNWK 2A9MH 4J4PA 2E8ZA 2XG5A 4HX1B 1MCJA 1X6LA 4PP2B 2DLHA 3D6GA 1QP1A 3SGEH 2JB6B 1XR9B 4D9RD 1JYXA 3SE8H 1KENL 4E0RA 2ICES 5EWIH 4JQVC 3KLAB 4DOHE 2FL5B 3GRWA 3QIWC 4WI6A 3K4ZA 5SX4H 1A3RH 4CADA 4X7SL 3QWRA 4JFEB 4GBXC 1JFQH 2X70A 1NCTA 2CDGB 4ETQB 3U0TA 1T20B 4W4NA 1GC1H 4TULH 1XGUB 2ZPKL 3MGOA 2ADGB 5DGRA 2PYEB 2OMBA 4L4TB 4QRRA 3BUYA 5JQHC 3NPZB 3B2UD 5F7LB 1AGDB 1IT9L 1DJSA 5SV4A 4Z8FL 1B6UA 2NY2B 5TDNA 5EU5A 4MNHA 1AGEB 4RCAA 1KIQB 4NFBA 3QUML 4OZFH 3OAUL 5HYSA 1NAKH 5IHUH 4BA8A 4FQ2H 4K3GA 3C5ZC 1DQDL 4OFIA 5D2LE 1JNJA 3WFHB 2QKIB 1MUJA 3U4EA 3VXQB 1BIIB 1IAKA 4X7CC 5KVEL 1LEKB 3WXWL 1X9QA 1S7WA 5D1QC 4OD1L 3TBSA 2YEZA 3I3EA 1H3PH 1J0ZA 4MD4A 4WTZA 3K81A 1ZGLM 4JN2A 3S98A 2IH3B 3BP7A 1H3GA 5IB1B 1JHLL 1IGIL 1I3GL 4KI5E 4YPGB 4NO2B 5ADOL 3NN8B 3F12A 5FIEA 1SMOA 3H42L 3WJJC 4WEUD 3V0VA 3KS0J 5I1LB 4N8PA 3O2VL 4WV1A 3QIBB 1E28A 3T0EC 2WP3T 1YMME 3ARDB 1RUAL 5C0BA 5EOCH 5C0DB 4PJ8D 3GK8H 1FNGB 1SY6L 1CGXA 4P3CL 2ADFH 3VCLB 2YA1A 1EO7A 4UQ2B 1I8IA 2P5WE 2WLZA 3QRGL 5GZND 5E2VL 4LCUB 3BH9A 4OF6A 3L9RB 3CFEB 4JRXE 4LHUB 1BJMA 4QF1A 1HHKA 3HUJF 3JV6A 4L8SA 4L8CB 3INUH 2APTA 2IPKB 4I48A 4MA3A 1UYWH 1WBXB 3DX7A 4HIEB 4R0LC 3GM8A 1HWGB 3RWEA 1KJ2B 1CLOH 3CCHA 1UZ8B 2A1WL 4UTAH 1NCNA 3OQ3B 3PWPA 5IB4B 4YHML 3HZMA 1U36A 2QSCL 2AK1H 1T21A 1RUMH 5ID0B 2P24A 1AQKL 2DTSA 2R1XA 1CQYA 4HULB 1KCRH 2LU4A 4TTDD 4Y19B 1MWAA 2AK4B 2I5YL 5FKPA 3L3DB 4JCMA 1TNNA 4OAWB 5EZJA 3LRGA 5L2KE 5DD5H 1C12B 4MDIA 3RWGB 5IJVB 3HUJE 3QAZC 4GKNB 4OF0A 1ULVA 1IAIH 3RGVA 4U1JB 5H35B 4ZFZB 4JRXA 3PDOA 1CI5A 1X5HA 5GGSA 1QFWM 2FIKA 3PIQA 1SYSB 1DBKL 3RGVD 5A16A 4U2ZA 4K2UL 1NDMB 4L4VD 3B2VL 3RIAF 4YZFE 3EW3B 4JFYB 4GG8B 1HQRA 4X83A 5CSZB 1I8KA 1V3KA 1MHPH 3RFZC 3V4UL 3ULVF 2J5LC 1UVQA 5MEOA 1U2HA 1ZT4B 4HHAA 1ZANH 1B4JL 5D70L 2XPGA 1MAJA 5IUSA 1IEBA 4U1KA 1U9KA 2VR9A 4LP4A 2ZSWA 2X4RA 4P4KA 3MROB 4XCYB 3C9NA 2APBA 1FC1A 4JFQB 3HUJB 5HHVL 5DVNA 2PR4H 3BZFB 5HTSA 2E27H 2ITCB 4JQXC 3BH8B 3JTTB 1SVZA 4XBGB 5JLZB 5BQ7B 5BZWA 2VIRA 5T33L 1GHFH 4MHHI 3GIVA 4JY5L 3AREB 3PGDB 1I7TB 4ZUSB 1NAML 5DO2D 4P2RB 2D4DA 5I8CB 1RK1A 4ZMAT 5K9JH 2IADA 1CXFA 2WBWB 3U7AA 3KPTA 3QIBC 2EZ0C 4HJ0C 3I3BA 2A83A 4GBXB 3HS0B 1QSFA 5HDQL 2O5ZH 2A6DA 4KHXL 1VCAA 2DICA 25C8H 2A77H 4QRRE 3TPUA 1Q9WB 4MCZA 4ZOEA 3QZWA 1ZVSB 4OD2B 4DN4L 1MAML 5IROA 1T7XA 4UIKH 4LSRL 2DWDB 3L3GA 5CBEB 4FP8L 4RA3A 1AQDA 4WW2B 1WBYB 3JV4A 3S36X 5FYLL 2DQDH 4O2CB 3OJMB 2YR3A 5HXMA 5L8KB 1RHHA 2AJXH 1WWCA 2JCCB 4P5MB 4AENB 1JYVA 1KNOA 3CZFA 5KSBE 3GO1H 5KVMC 4OQTA 4XMLH 5TH2A 3S4SA 4WUKH 5CEXB 4U0QB 4D2NA 1OB1B 4CDHA 4R9HA 4P48A 4XTRD 4I18A 3ROOB 4PTTB 3T4AA 3TN0C 5T3XL 1DTUA 2X4TA 1TVHA 4OD3L 1SYVA 4W70A 4X8JA 4XP4H 3QO0B 1Z5LB 2W9EL 3MGAA 1DBBL 1OP5H 5DRNA 5GRJL 5IBUG 2OSLB 2X1QA 5EOQH 1AIFA 4APQA 2V5SA 5DK2B 3T0EA 2BXZA 3QWOB 5IWLA 5C08D 3UTSB 5CD5D 2FBJL 3P77A 1FLRL 3DURA 4QXUL 3CDYA 1R3IH 5J89A 3RZCD 3RP1A 4XCNA 4HS6B 3LS5H 5F7UA 4M7ZC 2XTJE 1LO3H 4QCIB 4Y89A 2R4RH 1DQQB 4YHKL 3U36A 2J6EA 1T0NB 5ANME 4I0KA 1NGZA 1M6OB 2EDRA 1YJDC 5TDOB 4NQDA 4DZ8A 2PN5A 1G1CA 5JZ7C 2CDGA 1AGCB 3W9DB 3NBNA 1A5FH 2D0GA 5AUMA 4BQBA 4BSJA 1K3IA 3SGKC 4XGZB 4M61B 3T0XA 3SY0B 2CDEB 2V5MA 4YNYA 1N0LA 2F15A 1AGEA 3MLVH 1FPTL 1HCVA 5KG9A 3ZYZA 5HHNA 2WIIB 1IL1A 5BS0A 1ZA6A 3NH7L 5JW4R 4P4RB 5HGGS 1VKXA 3HCVB 2GITA 4GAYA 1F90H 2YWYA 4E41B 1ZA3B 1FNHA 3VXMA 3W11D 4O02L 3HPLA 5T5FL 4P3CH 2O93L 3VXMD 4BFEA 3MV7E 4YDJA 2H2PD 3MRQA 4HC1H 2CUHA 3MNWA 2YRZA 5JA8B 5LWYL 4YPGA 5E2WH 5BV7L 5CD3A 3VWKD 3QNYB 5DMGC 4YK4B 4R4NC 4K7PH 5JXAH 3GBNL 3KWWA 2YZ1A 2JKXA 1WFNA 3LMJL 4LEXL 1SJVA 3ZE2E 4P2OC 3G5YB 4X9HA 5F1NB 1FYTB 2WP3O 4RWHA 1LK2A 3MA7A 3MR9B 3ARFA 2XKSA 1OTTC 1RVFH 4G9FE 1SBBA 2P5ED 3FHQA 1VDGA 1TQBB 3P40A 4G9FA 4FFZH 3CFDB 1X5AA 2VTFA 2IQAB 1P6FA 3LQZB 5E2JA 3RVUC 2OS7A 1Q72L 2BSTA 4U1GC 2H9GA 1NKRA 1PVHA 1RIVH 3SDAA 3VU2A 4F3FA 1A21A 4FZ8H 4V2CB 1IGTA 4LL9A 2HFFB 1FNEB 3NCMA 4M8QA 1J88A 1J5OH 2H6PA 4PRIB 2QADC 2FJGA 3AXLA 2R8SH 1RZJL 2H1PL 1IEHA 1JPFA 2C1OA 3MRJA 1ETZB 4NPYB 1NANI 1RJZA 2LAGB 5IBLC 4B0MM 4YE4L 2YPKB 1D5ZB 2R2EB 1A4KB 5IK3A 4I5BB 2JIXA 1WCQA 2NY1B 4L9LA 4HIIB 4KXZH 1TETL 2DQGL 4LCWA 2V5YA 4L4JA 3PJSB 4XNUL 5HDLA 3U30C 2CQVA 1CDGA 3IJHA 4JPKH 3RPIA 3L5XL 1EFQA 2EH8L 1AR1C 4OGAD 3THMH 4RA0C 4BQ6A 2W0FB 3FZUD 2YKLL 4XAKD 4ZFFA 1FVCA 1PGRB 3MRPA 5FFLA 5MENB 4NQVA 2JK5A 3TV3L 4JO1H 3UZEA 3MRHB 2ZJSH 5DYOB 2ZCLL 3WDJA 4OF3A 5KW9L 2IANA 4NCC2 4AEEA 4XX1E 5FB8B 3QIWD 1P1ZB 3MRNA 2NY5H 4WRLA 4Y88A 1CBVH 4XBEL 3JWDC 1SM3H 4RGNE 3TNNB 3A6CH 4XPTL 2PO6A 3F7RA 4JFPB 4FTVB 3DRTB 5CSGA 1AHWC 1MI5E 4Z78B 3BP6A 2Y7QA 3S96A 1XGYL 4QWWD 3EOYG 4ZYKB 2NY1D 2HH0H 1A9BB 3JTSA 4JHZA 3IFOB 2YA2A 4YDVB 1DSFH 2CKBH 3ROLB 4U1IA 3D85D 5DJ0B 2E9JA 3T1FA 3KYNB 5TJWK 3OHXB 3GMQA 4NRXA 1MRCH 3WIHL 3UJJL 4N0YH 3VFSB 1S7WB 5FOBB 1MLCB 1OCWH 3B9VA 3P4NA 4BZ1L 1IGFH 4PRID 1SEQH 3C5ZD 3S97C 3LD8B 2I9LA 3W5MA 3SJVB 1UGNA 3PWLB 3ABZA 4QHKI 3E6FA 5KVFL 4ZG1A 1CIUA 5FGRA 2CK0H 1ODAA 3VXPB 3RVTC 4FTVD 3VG0L 4DOHB 4R3SB 3DECA 3L6FA 3BKMH 4R7DA 3O6KL 4M7LL 5D1ZD 2C4FT 3LS4L 4M48H 3U0PA 4OZIA 5DEGB 2IBZY 1ZLSL 4K7PX 5IQ9B 4DTGL 1CGSL 1XT5A 3OR6A 1N2RA 1N6UA 2FO4B 1RD6A 3L3JA 2AQ2A 4Y4FB 1MIEH 5IIEA 1I1AB 5EU6B 3C6SA 5I2IB 4AEFA 4QF1B 2DKUA 1DSFL 2CKBL 3K0WA 1IRAY 1NL0L 4K3EH 3UTPE 4PD4J 3KPPB 3WKML 3L3KB 3VG9B 1QSFE 3QEQD 4GUPA 4K9EH 1HYSC 1RJCA 3KHQA 4QOKD 2VLMD 1T21B 2P24B 4XVJL 4C54A 3RY4A 5ICYB 3QDMB 4GW1A 2YBRB 3QHFH 3TBYA 5A2IH 4YHYC 4K23H 4LOUD 4KPHH 4D0DB 1T66D 2F9BT 1I4FA 3Q48A 4MNQB 3VDCA 4CMMA 4XVSH 4I0PC 5IFJA 4J1UB 3MJ9H 1MUJB 3QAZB 3HFMH 3BXNA 1QR1B 1NCCH 5F6HJ 1YQVH 1BPVA 1JTTA 3OB8A 4O58L 1JGDB 5GGRA 5GSVA 4QRSB 4JZOB 4LIQL 1IEAA 2FLRT 3CH1A 5D1QA 3QCUH 1KIUA 5E03A 1JHLH 3C8KA 4M61A 4KTDH 1TNMA 3BKCL 4P46A 5IFAH 1SBSH 3VH8G 1G9EA 1CLZL 1QBLL 4ZDHA 1CE6B 1G9MC 4JANA 4LRNL 2NNAA 3TC9A 1WCBB 3H9SA 4P4RA 3ARBB 3PG2A 1EXUA 4ZOBA 3SOBL 4DFHA 4X4YB 3HUJA 2J12B 5SWZE 4QNPF 5CCKH 5IEHA 3BE1H 3GSOB 3MRLA 3CFJB 4AL8H 5KSVA 1HZHL 4K7PY 2QQNL 3L5JA 5D1QD 1KGCE 5E95B 2J2ZA 1R5WA 1KCVH 1TITA 2JB6A 3ZDXF 1AD0A 4QOKA 3N9GL 3LPWA 4H20H 4Y5YC 2XRAL 3PWPB 5IB4A 2O61A 1NJ9B 4GAGL 4OIIH 4NSKB 1RZKH 3FQNA 4Y5XA 4U1HB 1IKFL 4XCFL 5IROC 2X70B 4ETQA 3SGDH 3O2DL 2PETA 3V52L 3WMSA 1BFOB 4CNIB 2FEDC 4WNQA 2E7LC 32C2A 4MNQE 1VESA 4PJ7F 1CDBA 2HT2C 3TVMD 3PWUA 2P5WA 3L5WA 4G7YL 3G6DH 2VDOL 4XC1L 3VGDA 1RHHB 1DVFD 1BVKB 1FH5L 2P47B 1I1FB 3PIQB 3E3QC 1CXLA 1YMMA 4FQHB 5KSAB 3GEWB 3K2MC 5JHDA 4KQ3L 1YEIL 4PP2A 2H26A 1UADC 4Z7VE 3MV8D 3KYKH 1MCFA 4N0CD 4JFDE 1NCCL 1K85A 2FR4A 1FNEA 1D9KA 5GRVL 2G60H 3P9MA 5AAWA 4FMKA 3IVKB 1VFMA 3NTCH 1EBPA 1RSFA 2NXZD 5FYJH 5JNYB 2FZ3B 1T83C 3ZHDA 2FJHB 1BZQK 5SWSB 2IBGA 3MYJB 5GPRA 1AIFB 2EH7L 4NO5A 1CFNA 5I1AA 3QXAA 2F8VA 5IJKC 2JIXB 3P73B 3GNML 4IJ3C 4ISVB 3T0AA 2VLKA 3TZVD 4YXKL 4LLYB 4N0UE 1FNGA 4CJ0A 2IGFL 5J7CC 4YXLL 1J86A 3UTOA 5T3ZH 5TDNB 1T03L 1EA9C 4NQSA 1P7QA 2YUVA 1GL4B 1G7QB 5E08H 1BQHA 2EICA 2R2BB 1EIBA 3BKJL 4KRPC 4MXWL 1KCSL 4F7CB 4JB9L 1YEKL 1QSFB 3BO8A 3D25A 3ILQC 1GXEA 4I48B 3GSXB 4LAJH 1CR9L 1CT8B 1TPXC 2ADIA 2Z92B 3LKPA 4XP1L 2C3VA 4JZNB 1VPOL 4UIKL 4RFNB 3M07A 2FBJH 4LNRB 2DQUL 2ED8A 3MRCB 1F6FB 1OGAB 1WBYA 3IJYA 3IGAB 3VFUB 2P1YA 5IB1A 3O6FB 5C86A 4EBQH 3LS5L 2V5RA 3EYSL 3X13B 3CFCL 2HKHL 5DA0B 2YSSA 4Q9BA 4MSWB 1R6VA 4AENA 3K1KC 9CGTA 1Q1JL 3HE6D 2VL5A 2ATPA 2ZUUA 3G5VB 4JO2L 4RMRA 2WIIA 2HJLA 4DK3A 4PRPB 4LLVA 4LPTA 4GKNA 1EO8H 4LSPL 1FAIH 4KZEL 5DDHA 4TNVK 3QBTB 3CX2A 4WI2A 5IBUB 1JMXA 4FFYH 5IF0B 4Y19D 3O8XA 5IMOA 2CUMA 2DQFA 2A6KB 1MAKA 2WAHA 1HYRC 3HRZA 4GW4B 2Q6WA 4HSQA 3P11L 1Q0YH 3D39E 5DZLA 3ZKMD 4ODHL 3HAEH 4NJ9H 4ZQKA 3DGGA 3QDME 5B38A 1YZZA 3DX6B 3PWNB 3LD8C 4G9DB 3MRFA 1UZ6E 3UTQB 2QSQA 3MA7B 1C5CL 4HIHB 5IW3A 4D3CL 4IIQC 3EKCA 5E6IA 1FV1A 5MERB 4J4PC 3VXSA 2J88H 2YA0A 3NA9H 2PNDA 1MEXH 5E94B 2EXYD 4YK4C 3JUYA 3K4DA 3V79C 1O7VA 3EOTL 2Z4QB 4G6FB 2AV7A 4G5ZL 3VFPA 3RNKA 1BP3B 2QADD 4IRJC 4U6TA 4GRLA 5C09B 4LSQL 4P2RA 2IADB 2HT3D 5F96L 5E5RB 1U8PA 4P23A 1XF2A 2YOCA 1IARB 5I16B 3G6JA 3S37H 2PW2A 1QQDB 4RAHA 4FHBD 2BNQD 2FNBA 2D2OA 3LPGA 2M2DA 3LEYH 3TO4C 4WU5A 2NLJB 3QCUL 3IF1B 2LVEA 5EU6E 1PSKL 3VJ6B 3P4MB 3BKCH 4PJXF 3C08L 5DK0B 5CP3A 3TYFA 3OKEB 2E7BA 2Q7YB 1ERNA 1JGVH 2J8UA 1UXWA 2D4FA 4FQXD 2NTFA 3CXHJ 4U6HA 2HTLC 3IRPX 4FXGB 2A0LD 5GSVB 1OTSC 5C2BH 3SQBA 2WINA 3O9WA 4HIIA 2ICWB 4PJ9D 5EIIA 4LCWB 2LABA 1BBDH 1R5IA 4LU5H 3MV9A 1ZVYA 1S78D 4KJQD 1I7TA 3SQOL 3X3GL 5FYJE 1BBJB 4OZGF 3SQOH 4NZJA 4JN1L 5TGBA 3BSZL 4Q97A 3BYTA 4LBEB 3T4AB 5JUEL 1CE6A 1G7HB 4NWTL 3RQ3A 1IC1A 1RJYA 5FM4A 3GSWB 2FSEB 1PZ5B 1G7PB 3BT2H 2XN9E 1BGXH 3G5YA 5F1NA 3P11H 2JJWA 1FYTA 1H3UA 4MNGB 1H3PL 4ONGL 5EPMA 1YEDA 4LMQE 1SEBB 3ARZA 2GJZB 3QJHB 5LGHH 4AEHH 3TZVC 1HSBA 1IGIH 4O2CA 3F7PC 5C0EB 4YBLC 4ODBD 4DCQA 4YDIH 4PY8J 3RUGF 4GRLD 1CL7I 1B0RA 1QSEE 2WIMA 1KEGL 3G5XA 1I7RB 2BOBB 1GZPA 2P44B 2ZCKL 4OFYA 1K9TA 1HHGA 1MY5A 43CAB 5IW1A 2R56H 3N1MC 1FG2B 2Z35A 3LSOA 2JF1A 3I6LD 1I1RA 5E2VH 4P99A 1AGFB 4WI5A 5CEZE 4L29B 3P30H 3VW3L 2AI0L 3MFFA 3H8NA 3IT8D 2EE9A 2AW2A 4HKJB 5IESL 2EDJA 4ZFOB 4IRZH 5LKNA 3VGFA 5D6CB 1XF3B 2UUDK 3IAQA 3KLDA 3L5WB 4LLWB 4PJHA 4X7SH 3LQAL 3DRQA 4NN6C 3RVVD 3HAEB 5ESAB 4ZXBA 4HCRH 5C6TL 5CD5C 3MLSL 1NCAL 3MV9D 2PYED 4PPTA 3REWB 5I8KH 4JAMB 5JOEA 1AGBB 4M3KB 1IQWH 2FCBA 3ALWA 3TA3B 5L88H 4Q0XL 4RX4D 1ZA3A 5IVXA 1YEFH 5EBMB 4X5WB 4L3AA 4KV5F 2OR9L 2X7LA 1UM6L 3ZE1E 3C6SB 1DANT 1FO0B 4OUOA 5I2IA 3HMWH 4WFGD 1EX0A 3RU8L 1YDPA 3SGKA 4XX1G 4LVHC 4X6BB 3SE9H 2BC4A 3TT3L 1S7XB 4PJFF 3FB8B 4HF5H 6CGTA 1U3JA 1GC1C 2A9ML 3L3KA 3TH2T 3BKML 2H2SC 3RGVC 15C8H 2X9XA 5T3XD 1W2KT 3AMLA 3BJLA 4G7VL 5D96C 3LQAC 5F97E 25C8L 2A77L 3G04A 4G7VH 1EVTC 5J1AB 5JQ6L 1IVLA 5IB3A 2EE2A 4X6EA 1MAMH 3EDKA 2E9WA 4FTVA 4UT7L 1N6QH 3I6KA 5TPWH 5C9KA 3AY4A 5I1IL 4PB9H 4P2QE 3T0VA 1J1PL 1MELA 4ELME 3B6SB 3ARQA 3AS2A 3OZ9H 1QG3A 2BX5A 4IRSD 1X5FA 4MAYD 4GAYB 3CFKB 3RY6A 4NHCL 3V5HA 1RURH 3BVNB 4WFFE 5AYUL 4HFWB 3LKNB 4GSDL 4Q0XH 1ADQA 3VGHA 1NUNB 4PRBB 4R4BB 3NZ8A 1MWAL 5T33H 4H1LA 4KK6D 4G8FB 3SDDB 3VFVA 4JZOA 2FHFA 4B7LA 3SDAB 4XXCC 1DVFA 3BZDA 4OIAA 1NAMB 1OQXA 1VSCA 1BD2A 2YPLD 1CZ8L 2BVPB 1RZJH 4JDTH 4AIXA 5F1IA 4X9GA 1LO4H 2IAMA 2KDGA 4Z0BL 2GFBA 3ZE1F 2B4CL 4CGTA 1G7IB 2IMMA 5IQ7L 5HYJB 2H6PB 4PRIA 3V0WL 4J3VA 1DCLA 3BD3A 2J8HA 4YGVB 1UKSA 3WD5L 2JCCE 5GS1C 3FHAA 3DVNA 2JIXD 4DTGH 3H9SB 3ARBA 1C8PA 2VDML 4WV1C 2RHEA 4P23C 4OGXL 4DVBB 4C57C 1QKZL 1A6UH 2CJUL 1F2XK 4HIJB 3RIFK 1OL0A 1U91A 1D6VH 4KJQC 3BGFB 3V4VL 3MNZB 4QGYA 3CSYA 4Y4HD 2FH6A 3MX0A 5ADPL 1OCWL 3M8OL 2WNGA 1OVZA 1X3DA 3QWRD 3CVHL 3SCMD 5KANI 5B38B 5DRWB 2R69H 4W6WB 1MFCH 4G9DA 3BPOB 3DLQR 4N9OB 1UKTA 3IDGA 3QCVH 3VH8A 3TBYB 4F2MA 5I18H 4NKIL 5F7DB 2JE8A 4F15C 4QRRD 1I9JH 2BNUA 4ZNEA 4HWEL 4LVNB 1JK8A 3PL6D 4JZJC 2YHGA 4JPVH 4GXVH 3PWPD 3DRTA 1A6TA 1B4JH 4D9QE 3BN9C 4NFDA 5EU4B 3EYVB 4Z7UF 1RFDH 1GGUA 3WL9B 1N0XH 2EDLA 2VAJA 3D9AH 2B1AL 2MFNA 5KS9E 4JM2C 3O0RL 4HW6A 2ERJC 2VR5A 3HNSH 1DVFC 4PY7B 1C12A 4UUJA 5IJVA 3RPIB 3L5XH 3VFSA 1AO7A 3VXRD 1M05A 3MO1B 2ADFL 4HPYL 3T0DA 3B83A 5CEYA 4A6YB 5L0QC 1BAFH 5D1XC 1GGCL 4AJ0A 2EDEA 5FXCH 5D7JD 1I3VA 4IS6B 5A3ID 4JFYA 3RPKA 4GG8A 4DGYL 4QRTB 2NTFB 1C1EL 3UTTD 4FFYL 3BRFA 3D85A 4PJDE 3MJ9A 4RIRB 3VFTB 4MA8H 1BGXL 5HYJE 3UMTA 3BQUD 4OZFG 3GUTA 4TSCH 4XRCA 1FGNH 4Y16A 1FZOA 5BVPH 3RL1A 1J9CT 2XZCH 3CDGB 3MA9L 5DJXB 3DGCR 4JY4A 4LBEA 5KSUB 3WN5A 3QDGA 4NO3B 1J1XH 4JFFA 4OB5L 3MBEC 2W0KA 1KPUB 1I1AC 2NW2A 4XBGA 3IXTA 4GS7B 5EUOA 5ACMA 1N59B 1EEYA 1AKJA 2VIRB 2ICWJ 5CP7B 5EPMB 4D94A 2VXQH 1X44A 3IS1X 4C83A 3MBEB 3E2HC 3NAAL 1HI6B 2NY4B 4K8RL 2YRPA 3EBAA 4BSWA 4P2QB 1L6XA 1QFUL 4JRYB 2BSSA 3AVEA 1MIML 1WTGT 1CGTA 3UXFA 5GRJH 4PFEA 3D3VB 2ZUWA 4JO4H 4V1DE 4YXHL 3TVMA 1C5DB 1MQKH 5CJOH 4OD1H 5E8EA 1AXTH 4LLVB 4HJGA 5GIRA 3RWHA 2XQBH 3EOBA 4B50A 4HWUA 1M7IA 3GBLA 1BQHG 1OARL 3PUCA 4BJLA 3SDAC 3ARGB 3QQ3A 1OSZB 4HKJA 4PG2C 4QRSA 5JHDD 4DUWA 5DJ6B 3DNKA 4R0LB 5DD1L 5LQBL 1RMFL 1V7NL 1FG9C 3NABH 1DFBL 5SWSA 1KBGL 5JORB 4HFUH 4PGDB 3QXDA 3HNTH 5INCB 1EAJA 1FVDA 4H8WL 4TUJA 5DURB 3C6LB 2V2WB 3QFJD 5D71L 4FQPA 3BD4A 1PW3A 4I18B 4JVUA 5H2BB 4JAMA 1NCDH 2JLLA 3UTQA 3L5IA 5DRNB 4HS3B 3QPQD 5TE6H 1BQHB 2GI7A 4JKKA 4NWUH 2DLEA 4PGZA 2AJUL 3A67L 4JJHA 2WQ8A 4NKOA 4Y8AA 4XBPA 1JPGB 3GKWL 4YFDB 1S7XA 5CJOL 1E4JA 3BXNB 4L4VA 3UTSA 1KPVA 3W82A 4EOWH 3UBXI 3GB7A 4XP6H 2VABB 1A0QH 2AAVA 2CLZA 4Z7VF 1NCWL 1E4XL 1CL7H 2IPTH 1NSNL 4S0TD 3ULVE 2UY6A 4KVCH 1YEJL 1NFDA 4OF7A 1Z0NA 3EYOB 3HG1D 1J7VR 2EH7H 4NSKA 4Y5XB 5F7EH 7CGTA 4P46B 4M6NH 4N0RA 1A6VL 3H3BC 1XGRA 2BERA 2HJKA 3NZHL 2ZJSL 1GOGA 3FCTB 3ZDZE 4PJBA 1WT5A 5DJ2A 5HHOB 4UNTA 3BEWA 5DK0A 2CIIA 1N7MH 4KZDL 3VI3E 5D5MB 2Q7YA 4DGVH 4WFHE 1I9IL 1S5IL 4R4BA 2GT9A 1BVKA 3CSPA 4R8WH 1I1FA 3MRLB 3CFJA 1QRNB 3C60B 5ITBH 3W9EA 3DUSB 1TZIA 2ITDA 3IETA 1RVFL 5F1SA 3L3HB 2VLJB 1CR9H 4NM4H 1FL3A 1BBJA 4TUOA 3STLB 4G3YL 1WQVT 2VNCA 4C59B 1TZHA 5EDXA 3BZEA 3IKCA 2Q1EA 1MRCL 4M1DL 3N50A 4YGVA 2FYYA 3FN0L 3LEXB 1A47A 5B21A 1FIGL 1KT2A 3T0ED 5CHNB 3FT2A 1BFOA 2DLGA 3OXRA 2EC9U 1UWEL 1WICA 2NXYD 2Q3ZA 4P2OB 4S1RL 1RZ7L 1CD1A 4HBCL 3HC3H 4ISVA 3ULVH 2QEJA 2HG5A 1U8HA 1YN6A 4JN1H 3MGTB 4XI5C 4WUUE 3O9WD 1T1XB 1CBVL 4V2BA 1MJJA 4WVRA 2J4WL 1I1YB 4TUKL 4HUKB 4X99B 2HMID 3LHPL 2FECI 4DW2L 2Z35B 2DJ4A 1KLFA 1BIHA 1R3HA 1UEMA 4WCYH 3KR3L 4F7CA 5I16A 4WDIA 1LO5A 3CDFA 1CG9A 2P5EB 5CILL 1D9KB 4U7KA 5J13B 2NPLX 1I3GH 5ADOH 1HKLL 5DD1H 3ARSA 1U95B 1D5XB 4QXWA 2DM3A 4NZUH 4PG9A 5ERWB 1OGTB 3QIUD 1LHZA 3FB6B 4Y1AA 3PE9A 5CZKA 5JMRA 5J12B 1NGYA 4MMXC 3HHRB 3DV4B 4HDIB 4AH2A 5TF0A 3I2CH 1KJ2H 2V7HB 2Z8SA 4KUCF 5HBBA 1DEDA 1CFTA 4ZUTB 5EU7C 4OM0H 2DMBA 1JWMB 4P2QD 3PDGA 4EQ2A 1BMGA 3VWKB 4GFTB 1IGYA 4BUGA 4XVSL 2R2BA 1N3NA 2E9BA 5DLMH 3GMMB 1FO0A 4Y4KD 2OZ4A 3IDJA 4PRAA 5DFWH 5M7QA 2DQFB 2EE6A 1XCQA 4NC1E 3BPCA 5IB2B 3B3IB 3RUGE 2ESVA 5JW4Q 1YEDB 2VSDA 1CFSA 3FQUB 4HUXB 5F9OL 4OLYL 1O0VA 5CFHA 4N0UB 5FA4B 4O51B 5DMYA 4K7FA 1VACB 3BP4B 4PB0L 4Q74A 5FO7B 1AE6H 3AGVA 1QLEH 3J8F7 3MRFB 3MLTA 1NC2B 3UAJD 2W0FA 2JJSC 4KHTH 3FZUC 5D4QA 1FFRA 3CAFA 4LHJB 4LCIH 5IVOA 5IW1B 3UJTH 3W5NA 3PP3K 4JRWA 4HIXL 3ESUF 3HE7B 3EFFA 4LFHD 5L8LB 3U46B 3RNKB 2PO6B 4LVOB 2R0WH 2DN7A 1BJ8A 1T2JA 4PJCF 5GS0C 3DARA 4YHPA 4NDMA 4CDGC 3VXRB 5TPWL 3H0TB 5D7IF 3X14A 3P3YA 2MOVA 4PJEF 1JYNA 4NNPL 4TNWF 2GJ6E 1SVCP 3SGJC 5EZLB 3HZYA 3D9AL 3TO4B 3O41A 3U0WH 4DKDC 1JF1A 3OAZK 4M62H 35C8L 5C0FB 1JP5A 3SJVA 3MRGA 1HHIB 4JY5H 2VMFA 2OR9H 2X7LB 4CKVX 1KB5A 4KKCC 2PXYB 5E6IC 5DJ6A 4R0LA 5JW4N 4HXAH 5D1ZA 1D5MB 3HAEG 4QEGA 2CIKB 2MHAB 3ZYJA 1LVEA 1S9WA 2B2XH 2JTDA 4Y16C 3RTQD 4LPYA 1KJ3L 1ZEAL 4N0CC 1FL6A 1G7JA 4PJIB 1FNSH 3ARGC 1T83A 4ELMF 2XA8H 1AJ7L 1BF2A 5DRWA 2R0ZH 4OLXH 5IB3B 3UJIL 5H2BA 1I1AA 2PW2B 5AZ2L 1G6RB 1KOAA 2PTVA 1FFOB 3TO4D 1NBYA 3E3QE 3LQAH 1W0VA 2B4CC 4XMKH 2WWKO 4C58B 2AJYH 1XIWC 2ZWLT 2NX5D 5DJAB 1KJVB 4BQCA 4I77H 4TVPH 1E27A 1QFPA 3LKNA 4HFWA 4ORGB 1CXEA 1IFHL 4H8WH 1IGFL 4F7PB 2DQIL 2J8UB 2NXZB 1P4BL 2HTLD 4JFHD 1YEHH 4JHBA 1HHGB 43CAA 3HTLX 4X6DB 2UZXB 2WM0A 3V8OA 1RZIA 5IHZB 3NCYP 2R0KL 3MV9B 1J11A 5JHLL 3MRKB 3QNZA 1A7OL 4Q9QH 4TN9A 1CZ8H 5E7FA 4UI2A 3MV8E 1CLYL 3QEGH 4F37K 1KCSH 4MJIE 5C0CD 1J87A 1DE4B 1BEYL 3EO0B 3BT2L 4NN5B 1AXTL 5J8OA 4FFVC 3RVTD 1SQ2N 3OF6A 3OR7A 4XPFH 3BEWB 1MPAL 4KI1A 3MRQB 3H9YA 1VHPA 2VDPL 4AQ1B 5F9OH 5CIPB 4PRPE 3RRQA 3TCLB 5HHQA 5I8KL 1CCZA 1P84J 4F7TA 3SDYH 2GJJA 3LOWA 1MH5B 3SDXA 1VA9A 2CLRB 2PF6A 4ZFGL 4ZDHB 4RMWA 1YYMH 3T2PA 3ZHLA 3AC0A 3W11C 4LLQB 4JANB 4NBZB 4PV9B 4OZ4A 4KK5C 1I8MA 3T8XB 3K2UL 2B39A 3MR9A 4G42B 2VXTL 1J8HA 4R90H 4P5TC 4LU5L 4N5EC 4F8QA 4WW1A 5T5NF 4QXTA 3FB8A 5C0AB 2FEEL 4TVPE 5B22A 4F2MB 3GMLA 3A6BL 2DKMA 1X5LA 4EI6B 3UTZA 4N8VB 4KY1H 3O6LL 1WC7A 2HYMA 1JZ5A 3I50H 1LDPL 4BFIB 4LSDA 3VMOA 5IKCB 4JRYA 3VD7A 4JRYE 5EU3A 5LGJA 3IU4H 1AY1L 4GS7C 3RIAK 5EBGA 4J3XA 4YDLB 2X40A 5T5FH 4PB0H 5EBWB 4CVXA 4OIBA 3VI4F 4CVUA 1ZMYA 2YD9A 3HNSL 1JF5A 5F88B 1IT9H 3VFOB 3KNBB 2J88L 1RJZB 4MX7B 1OM3L 4G80A 3NZ8B 5IHBA 1S7QB 4XP5L 1OSZA 4DVRH 4DVRL 2BDNL 3BDYL 1K6QH 5IOPB 3F12B 4P57A 1PDKA 2H26B 1S7RB 3S88H 1AO7D 4FNLL 1T1WA 2W60B 1AH1A 3IDXH 1PKQE 1KJMA 3U9PL 4HWEH 4TTGA 2FJFA 3D48R 5C0BB 2EO1A 3VRIA 2I25N 5CINL 3VGBA 3IVKA 3QIBD 4MDJA 3ARDC 3I6GA 3R06A 1U2CA 2EYRA 3WIFB 3CSBA 5HJ3A 1PD6A 1VEPA 1EHXA 3GI8L 3HI1B 1NBVH 4XBPB 3FTGB 1FGVL 5GGRY 4JFFB 4X4ZA 3MV8A 3IXTB 2OTPA 1B2WH 3K46A 1QFOA 2P4AB 2DDQL 4NO0A 3NFSL 3C5JA 2A0LC 4W4OA 4OZFB 5EO1B 3IDYC 5LAXA 2NMSA 2AV1A 3A0OA 3QUMH 3WHE1 1T04A 4L4TD 3ZT6A 4LASL 1S3KH 2CK0L 4MAUL 4U1IB 3JWDL 2C5DC 3GRWH 4LMQI 4XC3H 5HYSG 3F5WA 5BCAA 4Y19A 5A2JH 3BP5A 2D0FA 3MJGX 3NGBC 1AP2A 1AI1L 4XP1H 5B39A 3TZVA 1JK8B 1UJ3A 3UJIH 2GKIA 2FD6L 3PV6A 2GSIA 4NJ9L 1YEGL 3PWLA 5C0AD 5AAMA 4BQ9A 1KEMH 4NQXA 4EXPX 3F7QA 4QRPD 2AGJH 5EA0H 1T89C 4OCYH 5TDPB 2VB5A 5GJSH 4K9EL 2W65B 3KXFD 2BVQB 2VLLA 5A3IC 5I1CH 4RZCB 3PXJA 2RCSL 5FUOL 4TUOB 3STLA 4LSSH 1PQZB 3FQXA 4M5YL 2HFEA 2DYPD 2EIDA 4YGAB 2FO4A 4FQJL 3MMEA 3ULSA 1Z2KA 5IEKA 2XPGB 2AJZB 3GJFA 2RAMA 4IDJL 4LSQH 1ZGLA 1KCKA 4HAGA 1P4IH 5I6XB 3SJVE 3MACL 4PGEB 4Y4KA 5IMOB 4LPXA 1MHCB 2AXHA 4WWKD 1OW0A 1WISA 5AZ2H 3U7YL 4DN4H 3UROR 5MEND 2GCYB 1PYWA 3BFOA 1T1XA 3V6FA 4JFZH 3QUYA 3ARTA 5J57B 1K2DA 1V3LA 3D3VD 2N7BA 3EYQC 1XFPA 3QUXD 5DJZA 5CJXA 4KVCL 3D18B 3KPQA 4F37F 2X9YA 2CGRL 1EGJA 1ZWIA 5E8PA 5I1CL 1WF5A 3GSUB 5D5ME 5IFJB 5IMLA 3V4PL 4LSVL 1T03H 4C83B 1HNFA 4P4KD 3QUZC 3CPLB 1NGWA 2EDNA 3RVXC 1J5OL 5CJ5A 4NQUA 5C9JA 3PNWB 2BCKA 3HE6B 3L5HA 5C7XL 3T08A 1Z9LA 2G60L 4OFDA 2ESVE 4ALAL 4YO0B 3CUPA 3MV11 1HXYB 1D5IL 4YC2B 2NNAB 3ZTJH 1S9YA 2FECL 3MA9H 3PP4L 3UBXG 4EBQL 5JPNB 5K93A 3SKMB 1DDHB 3OGCB 3UTTB 1PG7X 1QNZH 3IDJB 3HR6A 2XN9A 3BQUB 1WZ1H 3OV6A 5I71B 5D1XA 3VXNA 1G6VK 3WIHA 1EEYB 4FRWA 3RBSA 4GKZA 1NEZG 5HHQB 2CDFA 4Z76A 1WEJL 1ES0A 1HI6A 3Q0HA 2HG5B 2ZUVA 1AFVH 2GJ6D 5ILTL 2FSEA 2R2CA 3FAXA 3ZL4H 4PRDB 5IVZA 2AERT 4X4XB 4M7ZB 3C8HA 3DBXA 4AYFA 3MLWL 5CUSH 1RZGB 3UAJC 2YD1A 4GG6F 4HX1A 4LRIA 3UO1H 3B2UC 1MFDH 4OJFL 5FDYA 4UT6H 2XWJB 3OB0K 3BX7C 3FO9A 4ODWA 5T1KD 1MCWW 3EDJA 3N0PB 3UTPD 3H0TA 5FECA 5F44A 1MLBB 4PBVC 3SDCD 1FG2A 1KLGA 1HOCB 2WBJC 3ET9F 4X0KB 5INCA 5GS0D 4CADB 1MCSA 4OLUH 5FYKD 1LO0H 1AGFA 1Q0XH 5DI8A 4HDIA 2P8MB 3OKLB 4AH2B 3FQRB 4GAJL 5IB5B 1JGUH 3OKOB 2D9CA 5FV1L 4OM0L 4XNXH 4DGYH 1AR1D 4OGAC 3MJ8A 1FE8L 4K3HA 5F7KC 4W4OC 5F1OB 4I3GA 2V5TA 1YY8B 1GJIA 4EUPB 3QXUA 4C4KO 5ELIA 4H5SA 1Y0LB 4O58H 3QXWA 3U48A 4RRPA 4TNVF 3BN9D 1ITBB 2EDKA 1S9WB 4HUNB 2ESVB 1DBMH 1S7RA 5HDOA 2BNQA 1V3MA 1AC0A 4NQSB 4QLRA 5DT1H 3EYSH 2YD2A 3O3AA 2FYYB 3RIFF 2R4SH 1L7IL 2F5BL 2HFTA 1MEXL 1NKOA 4IOIB 3RTQC 3BWAB 3QXVA 2OTUB 1BBDL 2X4UB 2X89D 3FT2B 3S5LG 3HC3L 1QVOB 5TE7H 5F9JB 3QRGH 3OXRB 5KZCD 4HK0A 2F19H 4JGUA 5I1LA 3UPRB 2E7LA 2BY3A 1U8KB 5ANMB 5I18L 3G04B 5MEQB 1JTOA 1I9JL 4YUEH 4NUJB 3DX8B 4Q58C 5DVLA 3BDXA 3ARYA 4F7MB 1Z0MA 1INQA 3EFDH 4X6DA 4NDMB 2E7MA 3IETB 3CXDL 3SDXE 1NPUA 5HD8D 3SCMB 4EOWL 1XGQB 3AS3A 3L9RA 1YECH 2VQTA 1GAFH 4L4VE 3NA4A 4PRPA 2NY4C 1RV6X 2NCMA 2UVFA 1IAKB 1HCFX 4WO4A 4GSDH 5GZOD 4EZMA 1D9KC 3TO4A 4HIEA 3TT1L 3BAEL 4WO4D 5I15L 2DQIH 1QEWA 3VFMA 2HP4A 2EDHA 1NLBH 5BS0D 4WFEE 4HQQH 2YXMA 5HYQA 4H25B 3NOIA 1EJOL 1MJUL 1TJIH 1MH5A 3SDXB 5EFIB 5F7HA 3ULUL 3V5KB 1MQ8A 4MJ4A 3O45A 5DVKA 2YN5A 2BVQA 4KJYB 5HYJD 3ECBA 2VLJD 2FX9L 1P5VA 1ZLVK 4JPWH 1C5BL 1ND0A 1FRGH 3BPLB 5FYKU 1P69B 2XA8L 3CC5B 4NZRL 4XPFL 5F70A 1B88A 1LP9E 4EN3C 2HN7B 4FQIL 2YUWA 4HCRL 4L8CA 3PHQA 3RTQA 2IANB 4EVNA 4V1DA 4F9LA 3FB5B 1IKFH 1X5ZA 4HV8B 2VZ1A 4K7FB 4M62L 1CDIA 5D72H 4ZS7L 5IBTL 4F58L 3X11A 1A7PL 1XF2B 1NMCB 5EC2A 3RL2B 3TV3H 4F7PA 1IEBB 4U1KB 2AVGA 1F02I 1G6RH 1FZJB 3DYMA 4HWZA 4BYHA 1JWUA 3KYMA 3QPQC 1CU4L 4ODXB 4KDWA 3B2VH 3MRDA 3ARWA 1HZHH 3PL6A 2IH1B 2BSRA 5CZVH 5TF1L 5HGDA 5L0QB 1A3LH 3EHBC 1EFXA 1J8HD 4JFFE 4XP9H 1N3NB 1Q9LA 4MWFA 3MRRB 5LJYH 1UWXH 3AREA 5TE4H 1JV5B 4XVTL 5C0GB 2I9LB 1Q94A 1PY9A 2IALA 4U1LB 1JZ6A 4JM4L 3EIFA 3QG6A