2YKLH

Structure of human anti-nicotine fab fragment in complex with nicotine-11-yl-methyl-(4-ethylamino-4-oxo)-butanoate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
209
structure length
181
Chain Sequence
LLESGPGLVKPSETLSLTCTVSGGSIWGWIRQPPGKGLEWIGSIYSSGSTYYNPSLKSRVTTSVDTSKNQFSLRLSSVTAADTAVYYCVAWFGDLLSLKGVELWGQGTLVTVSSASTKGPSVFPLLGCLVKDYFPEPVTVSWNLTSGVHTFPAVLQSSGLYSLSSVVTCNVDHKPSNTKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Different Binding Modes of Free and Carrier-Protein-Coupled Nicotine in a Human Monoclonal Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB FRAGMENT, HEAVY CHAIN
total genus 31
structure length 181
sequence length 209
ec nomenclature
pdb deposition date 2011-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yklH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yklH01
1A7RH 3UTTB 2J8UF 3VG9B 4YHPA 4K9EC 3GMLA 3LPGA 4KPHL 4LLMA 1BX2B 4HJ0C 4DFHA 1RK1B 5FV2A 4I4WB 4WFEE 4LHJB 1YEKL 4LVNB 3CCHB 2ARJQ 4GXUM 1Q9KB 2UZYB 2B0SH 2ZKHH 2EDNA 4P5TD 3U4AA 5HVHB 2FH6A 2YBRA 3PWNA 4YK4B 1MF2H 2IWGA 2WIIB 5D7IA 3WFCH 3O3BB 1MWAH 1ZT7A 2PYED 5IVXA 3EYQD 3IDUA 5CILH 3QZWA 3DUUB 3GGWB 1NCWL 4ORZC 1AQDA 4YHZH 2F19H 5GGVY 3UBXI 1EX0A 1DLHA 1PAMA 2AV7A 3NFNA 3RA7H 1JZ6A 5T1KD 2BOBA 3UC0H 5SWSB 1MWAB 3L5XH 1IE5A 3QQ3B 2PYFA 4PRAA 3BKMH 3BDBA 2LE9A 1IC7H 4PG9B 3SOBH 4PGZA 4KPHH 3O9WB 4GMTL 4YHOH 1NGPH 1OGAB 5GRJL 2BNRA 4K23L 2Y5EA 2VXSL 3FN9A 2WM0A 4MD5A 5C6PB 5FKPA 5C3TA 3OPZH 2D7TH 4WO4D 5FKPB 1KG0A 4OFVA 3KPNA 5D71L 4UILH 1N64H 2MSPA 1QBML 2NXZD 1EXUB 2A0LD 3V95A 4Y2DD 2V2TB 2NXYB 1Y6MR 4X80H 2HJFB 3QG6A 5C07E 4L8BB 2J8HA 1H3TA 5JO5A 5JXAH 3CGTA 3VFOA 1IZKA 3CSYB 2GFBA 3K74B 4NWUL 1A9BA 1JWMB 5AZ2H 3K1DA 1A9BB 2Y07H 3TYFB 4PJXB 3BWUC 4QEGA 3SJVE 2ID5A 5EZJA 2AKRA 1J1XL 1XR9B 4ZO6A 1JPSL 4GMTH 4OD3L 1L9MA 4J2XA 2IFFH 3N85H 3S6CA 4EDXA 4NNYA 2CSPA 5LXGH 1KOAA 4U1KB 5KN5B 1V3MA 1FH5H 1UH2A 4OZIA 1AKJB 3GFUA 3LRHA 4O2EB 4QXGL 1GAFL 4HW6A 4D0CB 5B39B 5AAMA 1Q8MA 1FNHA 1L6XA 3QQ3A 1V7NH 4PB9H 4O9HH 3O45A 1KLUA 1NJ9A 1CFQA 1D9KD 4PLJD 3S34L 2BNRB 4DVRL 4NKDA 2IFGA 2AABL 1N5AB 3RVWC 1KN2H 3VFGH 1VPOH 3DRTB 5CZXC 1DQJB 1UA6H 3IDJA 4XH2B 5D6DA 5HGGS 5E5UB 3QQ4A 5F7DB 1NCAL 2G2RB 1XGYL 1DQLH 2G2RA 4V2BA 3IDXH 4Z7UA 2OJZH 4APQA 5B4MD 2YA2A 4HGKC 3PDGA 3EYUH 5DK2B 3WFEL 3QIUC 3U82B 5DJ2A 2OYPA 2PETA 1CXHA 1BVKB 1E27B 1VESA 3K8KA 1MJ7H 1YMMB 4I13B 3V5HB 4YQXH 3RUGB 4QXTB 1HCVA 3MUY1 2GYSA 3T1FB 1U8NA 3OSKA 2PO6C 4IRJD 3LAFA 1HE7A 2PYEE 5D1XD 1XMWA 5GISH 1UQSB 1QFWL 3MREB 2DJUA 1LP9B 1VPOL 1JNJA 1B2WH 3VGGA 1IEBA 1A6AB 3QXWA 5F1NB 4OLXH 5C2BH 3KPPB 4KUCD 4KZEL 2FJGB 3T3MF 1VGKA 1HYSD 1CLOH 4GT7A 1ZE3C 3F58L 4DZ8B 3O11B 3WFEH 3S37H 3QA3B 1MQKL 4PJCE 1F8TH 5FGBC 1YEIH 5SWQA 3TVMD 1MOEA 3MO1B 1LEIB 5GGVL 3RIAK 2PW2A 3PQYE 2NW2A 2QSVA 3GJEA 3O6FC 3ILQD 5EULV 4JG1H 4P5KB 2GY7B 4PJ8D 4ODWA 2X89D 1HXYB 4HEPG 1OAQH 5LGHH 4LHQB 4XGZB 1ITCA 3MJ9L 5DGQA 4HC1H 5IK3B 1OAUH 4NOFA 4GAJH 4IOSD 4P23A 3CZFA 5K9JH 2IALA 1OHQA 1RZGA 2CMRL 3NTCL 2OK0L 3PWPB 3LRGA 4DUWA 3WDIA 1NMAL 1YDPA 2IC2A 3H8NA 2W60A 4LSUL 1FGNL 2EDTA 1XF5B 2X6MA 1DQTA 1U58B 1IM9D 3G6DH 3V6BR 1TQBB 2PTTB 4O5LH 1QFOA 3KYNA 2BHZA 4NHUA 1MQKH 3V7AG 1UJTA 2BVYA 1IGML 4HDIB 1U8OA 4HWNA 3SCMB 4C58B 1UH3A 3IYLW 4BKLB 4LLAA 2ORBH 5SWSA 3IT8D 1HH9A 4ZS6D 5DS8A 4NSKB 1BVLB 3D2UD 1NAMA 5HYSB 1T7WA 5A2JH 2J6EH 5FO8A 3U9PH 4ZUVB 4ZYKA 5J11C 2R0LH 4YPGA 1U3HC 3AREA 2EEDA 3I9GH 2HFEA 4Y19D 2XACC 1F8TL 4PJ5A 4MS8C 5GGSA 1VKXA 3ARBB 2HFEB 4G8FA 1QLEH 3TIEA 1U8KB 1FO0B 3L3JA 4UBDD 5IHUL 3FHQA 2F53B 4FQQB 1TVDA 4I2XB 2YD5A 4U3HA 5A3IC 5IQ9A 4W4OC 5C9JB 2HFFB 3RU8L 5EORL 4XPTL 3BW9A 3WNKA 4I0PB 5GGRY 1DBJL 4AY0A 1TJIH 4L4TB 4W6YB 1FGVL 4GXVH 1YA5A 2X70B 1T22B 3BP6A 4KXZH 3C5JB 3HC0B 5JTWA 3MRQA 3H7BA 4OQ1A 2UVEA 3L3KA 4NKQB 3VG9C 2WUBH 4XBEL 1YN6B 4QHNB 3QI9C 3W9EB 1YQ2A 3QDJA 5I17A 1Y6KR 1ZT4A 4JREC 4QHNA 5I74B 5JOEA 4LQ1A 4X6EA 1DN0A 4IRZH 4HCRA 3GMPA 1IC4L 3QNZA 1E28A 3V5DA 4RAUB 5I8OH 2CXKA 4WW1B 3IRPX 3KPOB 3SPVB 3WNNA 2ADIB 2J3SA 1DE4A 4HH8A 1G7PA 4F7MB 2FX7L 1KEMH 5FO9A 5B21A 4GKNB 3EFDL 4M6NH 1HH6A 1JHTB 5F7UA 5EU3B 4KMQA 3MUJA 2VSCA 4X7SH 4KRNA 3TNMA 1WISA 5F97E 2IFFL 4ZOAA 3C2AL 4CL7A 3CLEH 3EFFB 4ZTPH 5C0RL 3VFWA 4R4NC 1BBDL 2BRRL 1T20B 2WWMD 1IEBB 5F1NA 1U36A 5CAYB 3IJYB 5GRXG 5JNYB 5FO8B 4PGBB 2QTEA 5HI5D 4Q58C 1BECA 1DN2A 5GSRB 4HKZA 3GRWL 4WV1C 2P5WA 5IB2B 4I5BA 4HKZB 1WWWX 3L5IA 3RNQA 3EGSA 4M5ZL 3U0TB 4YHPB 3BO8B 3G6JF 3TWCH 3OKMB 4GQPH 5J1AB 3N06B 4G6FB 1LILA 3SKMA 3IETB 4EUPB 1IGYB 3R8QA 4LF3A 4QY8A 4GG8B 2CPCA 3BKJL 1QBLH 3UEZA 2YSSA 3P0VH 1P9MA 5IVXE 2Y72A 3PV6A 4U2YA 1NKRA 3BGFB 4XB8A 5AYUH 4KK5C 3QXDB 1ZVSB 5MEQA 4JO3L 1QHOA 3OKDB 1G9NC 4XPAH 3EYSL 3PHQB 5KS9F 3EOYG 4HC1A 3QUZB 3MCKB 1JGEA 4FQLL 4H25B 1UWXH 3KXFE 2GITB 3SGKA 1T1XB 5IEHA 2JCCA 4PLOB 2DI7A 1ZHNA 3M1BB 4PRNA 4IIQC 5ESQB 3O4LE 2E7CA 3IFLL 5JA8B 3GMQB 2FGWL 3MUHL 4M5ZH 1NGPL 4KQ4L 2B5IB 2LVCA 1EAPA 4FA8A 3V5KB 3DOSA 1FAIL 4YX2L 1BFOB 1FZOA 3GSWA 3OAYH 3DMMD 3OXRA 1D5ZB 2ICES 1EO5A 5CINL 2F19L 4NIKB 2FWOA 2D7QA 1CU4L 4Y2DA 3LSOB 4NRYB 4GUPB 1QFWM 3PWVB 5BS0B 3VD3A 2ZG3A 2ADGA 1CQYA 3O6KL 1MHEA 5H2BB 4Q97A 3UJJL 1SM3L 2WLYA 1K8IB 1IAIM 1WJ3A 2WP3O 2GAZA 3TA3B 5GIRA 2VDOL 3DVGA 3FB7B 4WFFD 3UTZA 2BCKB 1OP5H 2JJWA 4K8RC 4FMKA 4YBLB 3PF2A 3WMSA 1ADQH 1YPZE 4JFQB 1S78C 4WDIA 4EBQH 1JWMA 5GQBA 5FCUL 2EDOA 5JR1L 5DJ0A 2QKIA 5FOBB 5D72L 4JRXE 1FC2D 5FOBA 4G6JL 3RL1A 5KS9B 1V5JA 4Z77B 5LAXB 3I02B 4N8PA 1LE9B 5LAXA 5CINH 2XZAL 5DYOB 2DYPD 5CP3H 3DTXA 3IDIA 4LQFL 5FYKE 3WFDH 2GTZB 5GJSH 4HH9A 4DGYH 1EHXA 3MRIA 4YNYB 1FFOB 5IIEA 3CDFA 4G42A 1QFUL 5JIHA 1A6UL 3A6CH 4N0UA 4KK8C 4OV6F 4LIQL 3PL6B 4OFYD 4POZC 1QVOB 4FTVD 2P42B 3PL6A 4K9EH 2HT2D 4RFOL 2R1YB 2DQEH 3GSNL 3VXUD 1PQZA 2EYSB 5IBUG 5IV2A 2XN9B 3VXRA 1MWAA 5C07D 1N5YH 4WI7A 3GZKA 4TPRL 3FRPG 4XCNA 5EWIH 35C8L 1U42A 4MNHA 4PREB 1TZGH 5HHXL 5BS0A 1ZA6B 2HRPL 5DK0B 3S8WA 2MFNA 1MLCA 1FAIH 1FNFA 5D6CA 4RMUA 5C6WH 4Y5VC 5T33H 3I6GA 4H8WL 3QJFA 4ZPTA 43C9A 8CGTA 2CDGB 1FZOB 2EE3A 4WVRA 3UBXB 4LAQL 2VDKH 2YK1H 3O3AA 4F9LA 3JVGA 1MFAL 4PRIA 5L8JB 5JO5B 1UVQB 3PJSB 4XXCC 1OAXL 4HIHB 1DFBH 3P3YA 5HVFB 1CIDA 4DW2L 1LD9B 4ZFZB 1G0DA 4XNXL 1MCFA 3KJ6L 2ZUXA 1DDHB 3MA9L 5CJOL 3MLXH 5ACZA 3VRIA 3BP7B 3NCMA 2BZDA 4G80B 4EVNB 1JHKL 4JHAL 4J8RA 4URTB 4QRPB 1H3WM 3SKMB 1F2XK 4NNXB 4K55A 4FABL 3C5ZC 5E9DB 1BQLL 3SGDI 3U30B 5KG9B 2IH3A 4FTVA 3FQXA 5E8NA 4BH8B 5GZNC 4KK8D 1ZHLB 4MXVF 2XZQL 3E6FB 4LSVL 5L2KA 3QI9B 1SEBB 4LLVB 4NN5C 3DRQB 1AD9A 3MXWH 2EE9A 4UOW1 1OAQL 4YXHH 5HPMA 2E6PA 5EH1A 1UZ6E 3OKEA 4Y2OA 1DR9A 4KTYA 2E9JA 5E8DH 2R56H 5J6GB 3DX6A 4KRPB 3SKUD 4M7LH 3KLDA 3U30C 5CIPH 3VI4F 4OZGE 3VXOA 1H9VA 2FIKA 4K9EL 3ZDXE 2CGRL 1KIQB 4Q6IB 4PJEB 2MTPA 4PY8I 3WFBH 4P2RA 5B39G 4IEFB 3DMMB 3IDJB 4XH2A 1HEZB 1I7TA 4HGWA 5MEOB 3I75B 3W11C 3HHRB 3QUML 3T2QA 4V1DA 3BUTA 1JZ7A 1C16A 1ES0A 5KW9H 3UROR 3TZVB 4FS0A 5A40E 3PWUA 5DD5L 1G7JA 6FABL 5I76A 3HG1B 3GHEL 4F7EB 2P44B 1J05A 4HFUH 2JB5H 3UJTL 5CZVH 2EC9T 4GG6B 4NRZB 5L0QB 4M7LT 3ESUF 5DVMA 1ZA3B 1DVFA 2UY6A 3H9SD 4YR6B 1ZA3A 3D5OF 1K8DB 4HV8B 5DD3L 2E6JA 3LS4H 3SCMC 2F5BH 2F58L 2V5SA 4NCC1 1UM6L 3OXRB 1M71A 1TQBC 1MCJA 2C4XA 4HUMB 3I02A 3QB7C 4L8DA 2YHGA 3O6KH 4MAYB 3RUGA 4PRPD 1RURL 1QSFA 4FNLH 4NQCD 1G9MC 4L29A 3N0PB 3UTPE 4U1JA 5IBUB 4GAGL 3B6SA 4Y4FC 4ODTL 3QWQB 4WHTA 5T3XE 1RAMA 1C8PA 4IHOB 5DD6B 3HPJB 2QQLH 2A77L 3D6GA 4GW5B 3QG6B 3U7YH 2HJLA 4S1RH 2DKMA 1DQDH 2ICCA 5DTFA 5DEGB 3JZ7A 2PR4H 2HMID 2ZOKB 2IAMA 3V7MA 1J0KA 3UAJC 3FO0L 2P5WB 1X5LA 5HI4C 4E5XA 3QPXL 3WHE1 1ZVHA 4TVSa 5CKAA 3QJHA 5F88A 5B38G 3U9UB 4KHTL 3OV6A 5HDBE 5DZNA 1CU4H 3I3BA 3QUXA 4P2OB 3NCBB 5L2JB 3OKMA 2BC4B 4QXUL 1BD2D 1SVZA 1NGYA 4JVPA 1FFOA 1UEYA 3ROOB 2A6IB 2VISA 2IANA 1F4YL 1WCBB 1DUYA 1P7HL 4CDGC 1FYTA 4S1RL 4Y5XC 3FB6A 3VRJA 1CK0H 1NMAH 2DQTH 5IVNA 3BP7A 1H8NA 3DSFH 5CWSB 4GG6F 5IFJB 3M45A 3M17B 5D5ME 1A7OL 3H2WA 5DRZA 3QFDA 2BY0A 3MV8D 4LBEA 1EO8H 4KKLC 2B5IC 4L4TD 4X5LA 2VLLB 1TFHA 3M8OH 4NM8L 5HGAA 4C56B 3CFJA 4CU8A 4P4RA 2G60L 2GJJA 4TOYH 3C2AH 4M9OA 1NAMB 1PG7W 2A73A 3RWIA 4R96B 1HI6A 4KTDL 3P11L 2ZUQC 3P0YL 5DRNA 3MJ9A 5DVLA 1UENA 3ARBD 1ZLUK 4J3SA 4XP4H 8FABA 4HWUA 3KYMB 3VA2C 2H9GB 5HD8C 5INCB 1OQXA 3TN0A 1LDPH 3RWJB 2VL5A 3QUXB 4P2OA 5J1SC 1IILE 5EZOH 3H7BB 4KV5E 1J7VR 5D7LD 5I1GH 4XPTH 3P9LB 4GW1B 3V52L 1MFNA 2A1WL 4WWKC 3X3GH 1A6ZA 1FFQA 5FYKL 1WBYA 1VSCA 3I75A 4HD9A 3VXQB 1J1OL 3HKFA 1FYTB 4HIIB 1F45A 3VGFA 5TE4H 4G5ZL 5FO7B 1FYHB 4ZAKB 1OCWL 2R2EA 4Y16A 5EN2A 1KTDB 2GK0B 3DECA 1WF5A 3RBGA 1VENA 4RIRB 2Z31C 1I7RA 1DVFB 3TO4B 3KPQB 4X6EB 3UTPD 1YEDA 3E1F1 4ZUUA 1TNNA 4MJ2A 3LDBC 1K6QL 3RVTD 4PJFE 4X6DF 1JGVH 2BNUA 3W81A 4CMMB 3G04B 2FNBA 1HH9B 4KFZC 5BW7A 2ICWI 3V52H 1D3CA 1PLGH 5ILTL 1WVZA 3OTTA 1QBAA 5C8JA 5C0GA 3KYKH 4NZTH 3IXTB 4UIKH 1P53A 1I1FB 2EEBA 2YN3A 4Z7OE 3SE9L 3CFBB 4MJIA 4PD4J 5I74C 4EVNA 1KTKE 3O2VH 1MVUA 4UB0H 4ZS6C 1BD2E 1F6AB 2ZCHL 1T5WA 5K9JL 1T83A 4G9FB 2R4RH 3MLWL 1N0LA 3P73B 4M1DH 4HXBL 4OCSL 4HIHA 1FL6A 3NGBB 4XTRC 4PJHE 2ZCKH 2OR8A 3VD9A 5SV4A 1JPFB 2VDLH 1A21A 1FN4B 4KROC 5DC9B 1ZS8B 4WI3A 4U1HB 3QDJE 1R5WB 4H1LB 5DQ9A 4ZTOH 3VXTA 3UTTE 3MNVB 4PYHA 3ECBB 2GY5A 2DLIA 4UMGA 4HC1L 5B22A 1Z9MA 4TPRH 3E0GA 3KLAA 4KDTC 2OXGA 3V4UH 4P23D 4WI6A 2NX5B 1NGXB 1MQ8A 2ZP0T 2HTLC 1N59B 5T3ZD 12E8H 1U8HB 5IV2B 3C60B 2NXZC 3P4NA 2IG2H 3V6ZB 4QRPE 4U1IA 3O8XD 3MRBA 4NQXB 4KJPD 2PCPA 3HE6D 5I1KL 4OKVA 3BIAX 4NWUH 4JFDE 1TITA 1B3JA 2NY4B 2XTJB 4I0PA 5GGTL 4X7EC 3RGVA 1BREA 2Y4SA 4I3SH 4XPHH 4PB0H 2V5TA 3QHTC 1LDSA 4KRMB 1PVHA 4TUOB 2I9TB 3N1GC 3EOAA 4Q6IA 2EXWD 2UYLA 2EXWC 3MZTA 4LPXA 4X6DB 3VFRA 2I60L 5C0CE 2CDGA 2ATKB 1HXYA 3WLWC 5EWIL 1BBJB 4P59L 1C5BL 4LSRL 1QRNE 1OD9A 3B9KD 4RA3A 1CICA 3ARDC 4K3DH 3MRMA 4PJ9C 3H9HA 1ED3A 2O61B 3B5HA 4GFTB 4MVBC 4FQPA 4G8GE 2BNQB 4B7LA 2NY7H 3N1PC 4Z7WB 3QUYD 4FTVE 1DQML 3RL2B 4RMRA 4OTXH 1KPRB 1CL7I 4Z7WF 2WQRA 2YR3A 2OZ4H 4N1EA 5JOPD 3VG0L 1E6JL 3UPAA 1Z3GH 1SJEA 1TDQA 3VDCA 3MLZH 3EW3B 2VZUA 2BCKA 1IQDB 3O6ML 1UJ3A 5E6IB 4ZS7H 4ETQB 4C54A 4ZQKA 5ESAB 4N5ED 4I18A 2OL3H 4XT1C 3FT2B 2EDLA 5HHME 4Z7QE 3DYMA 3ALWA 4QRTB 2WLZA 5CSZB 5DHYA 5KVEH 1WZKA 4NO0B 3ZO0A 1PY4A 3C60A 3P4NB 4O2EA 4MJ6A 1S9VA 3W9DB 1SEQL 1XF4A 2OL3B 3MUGA 5D7KD 1DEDA 2YXMA 2NXZB 1BWMA 2XYCA 3BH9A 4C55A 3MRDA 4YJZL 5KN5A 5IJKA 2ARWA 1CXFA 3O3DB 4F57H 3QIWA 4KAQH 1PKQB 4JY5L 2IG2L 3TPUA 3UZQA 2QSCL 2DAVA 1KLGB 2Q87A 4CADB 3NACL 1YYLL 4C83B 5E8OA 4X5WA 5L7XH 3NZHL 2FX9H 5ADPL 2ZWLT 3QIBA 2EYTB 1ZLSL 4GSDL 3DVNB 4JGUA 5DLML 3TVMA 3HI1A 4DKAA 4NQTA 4U0RB 3D85A 1FZKB 5AZEH 4RA0C 2YPLB 3BJ91 4PRBA 3TJEH 3RWCB 3THMH 1IAMA 4Q9RH 3UTTD 3V8OA 4D9QD 3CFDA 1IFHL 2A6JB 4WY7L 4OGXL 5I6XC 4JCMA 5K9QI 2DM7A 3GNMH 5E6IA 2Q1EA 1ERNA 3C8KA 4PRHE 2CUIA 3BKCH 4LRIA 5KVEL 5MENB 3NACH 2PYFB 2A6KA 2D7PA 2QLVB 1AD0B 3C6SA 1JPSH 2YD6A 1UXWB 4PJIA 3SDXB 5JNYA 4BJLA 4JFDD 3D69B 5ICYB 3VRLF 3B4NA 5LKNA 2P24A 2H2SC 1FSKB 3ME0A 3PIQB 3U7YL 3BWAB 4FQJL 1NCCH 4MJID 3QWRD 5IG7B 5LGJB 4MA7L 5TF0A 1ORSB 4LCCB 3ZKNC 3MLXL 4ELKA 2C3VB 3VGAB 3DYOA 2DMBA 5FYJU 5KANI 4NBXB 1T2JA 3W5NA 1QRND 3MJ6A 1KN4L 3L3HB 5FEBA 3TBVB 4JJHA 2RFXB 2Y5TA 3JWDH 3QEQB 4JR9L 1MCPL 3SN6N 5ANMA 3HRPA 5GSRA 3T4YA 1T5XA 4G7VL 5A16B 1F42A 4GBXA 4J6RL 5TE6H 1DL7L 1QFHA 4IM8A 5TQ0L 4NPYA 2PYEA 3IDMB 3G6JA 2HVJB 2WMPA 2EO1A 1J8KA 1HNFA 4WTZG 1P69B 5DQ9B 4KUZL 5ID1B 3LKOB 3RZCD 2BC4A 5D1QC 3W0WA 1AFVL 4X7FC 3P2TA 3QDJB 5I17B 3WNLA 3ZE1E 1UC6A 5EU6E 1EEUA 1RULL 4PG2A 1BAFH 3TNNB 4HBCH 1RJLB 4U1LB 2ZUQB 4Z7VA 2QHRL 1EFXA 5T3XD 1JF1B 1J5OH 1A6TA 1HDMA 1LP9F 4J3VA 5C0AE 2YBRB 3JVGC 5GGQL 1GOGA 1E27A 1CE1H 2DBLH 3ARGA 2AVGA 3B83A 5IHUH 1TQCC 5CWSA 2AABH 1JZ4A 1JCKA 5KSAD 1F02I 4ISVA 5EOTB 1RZKL 5GS0C 1KJ2H 5CGYC 2Z91B 1KNOA 3S36X 4L29B 3WLBB 2E3VA 1NC2B 2EIZB 1UB5A 2HRLA 2C26A 1CD8A 4HMDA 2B4CC 3QNYA 4XAWL 5GS0L 3BPCA 1B9ZA 1WBXA 5JW5A 1IT9L 2XTLA 3GMRB 2A73B 3TCLB 4HCRL 3BVNA 5I75B 1JHLL 4QYOB 3VJ6A 4AENB 2BK8A 5F9OL 3B8YA 2H45A 4ODSL 3QEHB 3QFJA 1TETH 4U4BA 3EGSB 4FMFA 3EAKA 2VLJE 4C57C 5JQ6L 4I5BB 3QDAA 4R3SA 4PP2A 1GYAA 4JFYA 4KJQD 2NY2C 3KYOA 4JFXA 4UT9L 3D9AL 1NFIB 3LKQB 3WIIL 1TZIA 5KSUA 3QUXD 2ARJB 2HJLB 5FYKU 5IMOA 5C0CA 3AS3A 4X6FA 5DJ0B 4W4NA 1OAUL 2ZOKA 2C1PA 1B90A 4IRSB 1OGTA 4PV8A 1SYVB 1JHKH 1VERA 4JHAH 2XG5A 1OQOA 5CIPB 3RVXC 3V6FA 3PWLB 4DN3H 4ZFGH 2HYMA 4G6KH 5D7LA 4QOKE 4R4ND 1LEGB 1JF1A 4RGNB 5H37H 3RFZC 4NN7C 1PFCA 3SGJA 3ORJA 4FXKB 3TCXA 1BFVH 2EKJA 1R3HB 4PJ7A 5FFLA 4UZGA 2VQUA 3T0DA 3G6DL 1JPGB 2DF3A 4HFWB 1U8MA 3HI6H 4JKKA 4TTGA 4ONHB 1F4YH 3BXNB 3F12A 4PJCA 4I3GA 1WZ1L 4Z8FH 1YJDL 1RJLA 1E28B 3VXSE 3X13A 2W07A 1SBSL 4KK9C 2VR5A 3G08A 4NBZB 4UOW0 4HUUA 2FDBP 5INDB 4MDIB 5IHLB 1R5IB 1PGRB 1P4IH 3VWKB 2AJZA 5C86A 1OM3L 4WTWA 2OQJB 1FNSH 15C8H 2IALB 2X4RA 3QFJD 3EO1B 4C4KT 4L4VE 5DJXA 4NKIL 5IESL 1MFCH 1YMMA 5TPWH 5BRZD 2E8YA 1OWWA 3VWKD 2Y6SC 4R4BB 4D9LH 1H3XA 4LMQE 2Y9RT 3LQZA 3JTTA 2Q20A 4JY4B 4OCWL 5CBEB 3QAZB 3LQZB 2CKBA 5F9OH 3SGEH 2ARJA 1NKOA 4APQB 3IDXL 4KJWD 4J7RA 4LARH 1XF3B 5I8EB 5J57B 3OKLB 5C0ND 5JXEC 1IAKA 2X7LA 3ULVH 4ODUB 4N9GA 5ICXB 3M8OL 3Q6GL 5ITFA 5DFTA 5HI3D 2W9LA 3P77A 4KJYB 5DA4A 3RWJA 5KSVB 3F6IA 2WSKA 2E8ZA 5DWUL 1IQWL 1M05A 5C0AB 3PDOA 2IPUG 3CXHJ 4XBEH 2F58H 5IW3A 5A2KH 2A83A 4F37F 1RZIB 4LLMB 1FZMB 1KLFA 4ZUSB 1WAAA 3U2SB 1AP2A 4NO5B 1MFCL 5I8KL 1A7QH 1A6AA 1RUAL 1U3YA 1JFQH 3WXVL 5EZOL 1IC4H 4WUKL 3B43A 1NANH 4JFEA 1X5IA 4FZ8L 5DUPL 4FQIH 1MCBA 3T2PA 4K94L 1JRHI 1OM3H 3VXMB 5IP4A 4WFGE 5E6YA 1CFTA 1FJ1A 3FONB 4KK6D 4YIQA 4RMSA 3OGCB 5F1OB 2R2BA 1HHKA 4RGMC 1S7UB 4KUCF 3R4DA 2CUMA 4J3XA 3WLBA 4L3CB 4H88H 1AGCB 4ZNEE 4NC0B 3QO0A 4EI5C 4P2RE 2V7NB 2YUZA 3TYGL 3HG1D 3MMEB 1AR1C 1HHHB 2YUVA 2DQFB 1FNSL 1BJMA 5C08B 3DGGB 1S78D 2BMKB 1K8DA 4P99A 4YBQD 2ZOLB 1HWGB 3NTCH 1Y0LB 2MCPH 3B8SA 5JPNA 2OTUB 2HJKA 1NBQA 4HLZH 3WHXA 8FABB 3VXPA 4HWZB 2XPGA 1G7HA 5B8CC 4QOKD 5I76B 2VWEC 4MZ3A 4P2YA 4D2NA 3S5LB 4OM1L 2PXYD 3V0WL 4KI5D 4WI2A 1MAKA 1X7QB 4M7KL 3PNWB 3FKUS 1K2DB 2F8VA 4JM2F 4TQEH 5DD1H 1PJ9A 3ARXA 1S7VA 4N0UB 3FT2A 1JNNH 1PG7L 4PD4K 2V9TA 4HUVB 3RNKB 3VI3E 5K9OB 3GRWH 4ODSH 2VLKB 3WUWG 4MNGA 5C0BA 1GIGH 1MRDH 5J7CC 1CTNA 2JKXA 3BH9B 1KTRL 1DLFH 4G8GD 1NGQH 2JELH 4NC1E 5AWNL 5J6GA 3TWCL 3K8LA 1YPZA 5EU4B 1A7QL 5BS0D 1BLNB 2PW2B 3WXVH 1CN4A 1U3HA 2VLRD 2XXCB 3GBLA 3L1OH 2VH5L 1KLGA 1QRNB 5I15H 3S3PA 2Q8BL 1V3LA 2WUBL 3QCVH 4JFFD 2AEPH 1V3JA 2AXFA 1QTYT 2Q6WB 3LS5H 4UTBL 2R0KL 4OZFB 1JMXA 4PTUA 4X6DE 3RGVB 1CI5A 1OGAA 1UYWH 1N7ML 1RV6X 1YYLH 2YPLA 3SGDH 5DJXB 3VDBA 4TUOA 2I9TA 1MI5E 4NKDB 4Y4HA 1XGYH 3IKCA 3PWUB 4NNPL 5L88H 3LN4B 2F5AH 3WS6A 1IKFH 3S35L 5DFVC 1DLFL 5HHNA 4U1NA 5D7KE 5CD5D 1KFAL 4QXTA 5MEND 2VDOH 3SE3C 4OCYH 4K3EH 1NCNA 3CVIH 2QKIB 2Q8BH 3VXMD 5HYQB 3CFJB 4PJXA 4G9FE 3VH8B 3LKRA 4I0KA 4DFIA 1FFPB 4WTZA 4YAQA 2BSSA 5CEZL 4OGYH 2XWJB 2DQHL 2OL3A 2R29L 2XIDA 4WHYH 3EHBD 2DLEA 3GSUA 4XCYB 5CZKA 4XTRD 1E4JA 4WWKA 4I0PC 3R0NA 3TESA 1Z0MA 4PB0L 2IPKB 1GGTA 2WINB 1KCVL 4E9LA 2VH5H 4X6CA 2OSLB 4U05A 5I1CL 5JHLL 1DZBA 5ICZB 1HKLH 3E2HC 2ITCA 4UV7L 1FO0H 1MJUL 2R23B 4OZFH 4HJGB 3ZT6A 1OB1A 4PTUB 4FXGA 3T0XA 1QSEB 3EJJX 3LEXA 1ZS8A 4GAJL 2DYPA 5KSVA 4M1DL 3UZEA 4NUGH 4ZXBB 5D5MF 4YHML 4KJPC 4XNUH 5JA9A 2IQ9L 2JCCB 4Q9CA 1UACH 4XCFH 1AO7A 1P4BL 2EDYA 3QUKB 3KLAB 2X40A 4ZUUB 3KGRA 2AJYL 1BOYA 3AGVA 2OTUA 1ZEAH 3KPLA 5J6HB 1JMZA 5IBLC 4LNRA 5IBLD 3CDYA 3O3BA 2HWZH 1BZ9B 5BZDA 5CJOH 1FNEB 3HMXL 2AXGA 5K33A 4LSQH 4AH2B 1EMTL 1YMHA 1FYTE 1FNAA 3EO1A 3AXLB 4L3EE 3WHE0 4U1SB 3QT2A 1MCHA 3BZ4B 4QHUA 4L3CA 5FF6A 1FIEA 5BS0E 4Y19A 1IKNC 2OP4L 4LAQH 5ISZA 1CFBA 3ZL4H 4KAQL 4YEFA 2VDLL 1HQ4B 2A9ML 2GAZB 5EIIA 4M6ML 4LVHC 4U2ZA 3V4VL 4IRZL 3FOLA 4YHLH 1FPTH 1NCDH 5T3XH 4QRUA 1UADC 2LFGA 3PGCB 5EFIA 1KJ2A 3WHXB 1WSST 4K94H 5ACZB 3U9UA 2IPTL 4OGAD 4OLWH 3P9MA 2DKSA 4AG4L 4JY4A 3P73A 1YYMH 3BEVA 5C71A 4U6TA 4NQSB 4XP1L 3PWPE 4GW1A 4JR9H 3RHWF 5C0EB 1T2QL 2JTDA 5KBNC 3A0OA 4P23B 2B39A 5TF1H 1H3PL 4JRXA 5C0IB 5ICXA 3S7GA 3QNZB 5EO9B 1MHCB 4F7TB 2C7UB 3Q5YA 2Q76B 1WQVT 1CL7L 4MJ6B 5C92A 4JFPA 4YHZL 3RZWA 1FNLA 5E8PA 1FFNA 4YHLL 4MGXA 5J12B 2B4CH 4MXWL 4U1NB 2XKUA 4JPKL 3CH8A 4NUJA 5IUSA 3F7VB 2RIKA 3QIUB 4O4YL 4NN6B 1LDPL 4JQVC 2UV3A 4EBQL 1H15A 5IVZB 1NLBH 2NZ9C 3BQUD 3WV0A 3F6LA 3IXAA 4PJCB 5EUOB 5M95B 2XNAB 4UTBH 2APFA 4Q6YA 2A1WH 2QSQA 2B20A 3LQAH 4LGRB 1VFAB 1A47A 4X9HA 3WKMH 1EEYB 5E2VH 5KTEL 4KHXL 1ZLVK 4HGMA 2GJ6D 2OI9C 5DR5L 4WGVB 5DDHA 3UYRL 1T2XA 4FQLH 4P2QA 1EJOH 4XZUB 1T1WA 1RZJC 1F11A 4L5FL 3LD8C 5D6DC 3ZE0E 2VDMH 1QFWI 5HGAB 1ZHBA 4IOIB 5DLMH 3ALPA 4JFQA 4P5TA 1T5WB 3FO1B 3JTTB 5LXGL 1XF3A 5I8EA 3HR6A 1JHLH 1N64L 4G8GA 4OB5H 3Q3GB 1RFDL 5DUML 4UV4H 1QSFE 4M43H 3IJHA 1JTOA 1A6ZB 1CGUA 2CIKA 2ESVE 3HI5L 4JPIA 4AT6B 4MD0B 1M71B 1S7XB 3VXNA 1UFUA 5IMLA 2X4TA 3ZDYF 5T33L 3U0TA 5DMYA 2DWDA 1MREH 3O6FA 2F9BT 2VXTL 4JEGB 5KANG 2DWDB 3O6FB 2F53D 1DUZB 5AD0A 1FYTD 4IBLT 2ICWA 4YHKH 4R8WL 3B5GA 2IANB 1P6AB 4L4VB 2ZCHH 2Z93A 3NFPA 1F6FB 1G6RL 4GW5A 1EVTC 1QYGH 3NFSH 1AE6L 5BRZE 5B39A 4UDUB 5CP3A 3N1QC 5HGBA 1F00I 2ENSA 5D7LB 5K9KB 3TV3H 3BMVA 1QPPA 2AJ3B 2FD6H 5IMKA 4U7SA 2A9NL 1ZMYA 1T1XA 1D6EB 3EYVB 2BX5A 4XVTH 4BK5A 4DQOH 1BHGA 3MRJA 3FTGA 2DD8H 4JPVL 4H0HB 4XWOD 4XPBL 1Z6JT 5HD8D 1IBGL 1U8IB 2R1WB 4JHWH 3AAZA 5E2WL 1ZOXA 4LCWE 3OB0K 3IDNA 1Q9OA 2D03L 3MFFA 3PWPD 4D3CH 4L1HA 4YQXL 3HNTH 1IGFH 3GMMB 1PW3A 4ZD3L 25C8L 3IXTA 4WWKD 3LZFH 1HZHH 4PJDB 4NQCA 3QULA 5I16B 2JB6B 2NY0C 3BZEB 1ZHKA 4OD1H 5D9SB 4MQXD 5BMFH 5F9AC 4WW2B 3PP3H 5C2BL 5HXMA 4HFUL 3L5JA 4NO2B 4MCZB 1C12B 3PNWA 1JZ8A 2GCYB 1MJJA 3WFCL 4I18B 4AYFA 1VFMA 5BVPL 3WUWA 2P8MA 1GGBH 4KY1H 3RKDD 3DBXA 2VLLA 1IC1A 3T3PF 2DM2A 4XPBH 5IJKC 1H3GA 5GGUA 5J9PA 3CMGA 4JN1H 3OAZH 2X89A 3HG1E 3OJ2C 2OSLA 3D69A 2XWJA 1QR1B 3QEQA 1LMKA 4H1LA 3MJ7B 3MV7D 4JY6A 3JV4A 2AJUL 3F7QA 4HUWA 2OJEB 5CZVL 3ARBA 5FB8A 2XWTB 4Y4HD 4KJWC 5DJAA 2ZUYA 4ALAH 2GJ6E 1D6EA 3EYVA 1A6WH 1OD7A 3MRHA 4O2CA 1OGAD 1RVFL 3RWFA 3NFSL 1EGJH 1P1ZB 1CCZA 4CADA 4Z5RB 4CVUA 1MNUL 4HMEA 1K4CB 4TYUA 4LVHB 4KQ3H 1O7VA 4LVOB 1JPTH 4RWYH 5CD3B 4QGYA 3VXMA 5IR1B 2XZQH 3MGOA 2YD8A 3IJSA 4JPWH 4DEPB 3MBED 3D25A 1PKOA 5C0JA 2RJMA 1GJIA 1DP0A 4ZXBA 4DVBA 2J2ZA 2VIRA 3Q5OA 2QQKL 3SE8H 2ORBL 4YDLB 3JBG7 2EDJA 4YHOL 4ZFFB 4X7TA 3WIHA 4OZHA 1EHLH 5EZIL 3CFKB 5TDPA 3NFNB 1TVHB 4MZ2A 5FA4A 4DGIL 1RUQH 3LIZH 4U6YA 1AD0A 3NA4A 3HE6B 4UIKL 4HAFA 4ZSOE 4FN0A 2VDKL 2YK1L 1QLRA 3U83A 1QEWB 5DR5H 1S9VB 3C60D 3CAFA 4TRPH 5K9OA 2BJMH 3PIQA 5HHQB 4WJ5A 4YBQC 3GSOA 3VFVA 2OZ4A 2DLFH 4P46D 1P9MC 3O3DA 3MOBL 1ZHLA 5J12C 1B2WL 1J8HE 1MNUH 1U92B 1MELA 2M2DA 5D70L 1AD9B 1N8ZB 4OCRL 3SKNA 5IOPA 5MENE 1JBJA 3T2OA 3WIHL 2EECA 4OF0A 1HINH 2HLAA 2R2HA 4KKNA 4JM2B 3ROLB 5BVJB 1YEIL 1Q0YL 5D1ZB 9CGTA 5MHSE 4KRPD 4BYHA 4AMKH 1MAJA 4IDJL 2J88L 3D85B 2VZVA 1TCRA 3C5SA 5C7XH 4G9FD 5L6YH 3HZMA 4KZDH 1NEZG 1J86A 5EC2B 1EEQA 3B9KA 2OR7A 4ZXBD 5GJTL 1NC4B 3DXAE 1KACB 4Y1AE 3SKOB 3VCLA 3DMMA 1HHHA 4OJFH 1MIMH 2OLDA 5T3ZH 4YLQT 4P3CH 4OZFA 1MHHB 5I1KH 1RIUH 1EFXB 1ZVSA 4OQTL 4C4KO 2VC2L 5MEQB 4XMPL 2CK2A 4Z7VB 1HSBB 2OP4H 1YNLL 5CEYB 1U93A 2DQGL 1DEEA 4IRJA 5D1XA 1ACYL 3MACH 3VH8A 2OZ4L 5IFJA 3VD4A 5IEHB 5HGDA 1JHTA 3S3SA 2IADA 3GKZA 3O4OB 5HHNB 3OKKA 4Z7VE 3VXUA 5ESVB 5MEPB 2F8OA 3K1KC 1FIGL 4FFWD 4OF7A 5D7JD 1MJJB 2X9XA 3K4AA 3STBA 4IDJH 4YWGL 5CEZE 4HX1B 5CSGA 5DA0B 3FQXB 4BH8A 2KPNA 2R0ZL 3HE7A 2Z31A 1EXUA 5C08D 1B0WA 1WAAF 2OMNA 3O81A 2H8PB 3NPSC 4V2CB 3UTOA 4XNZC 3TBVA 3GMMA 3C09C 3E3QE 3ILPB 4QYOA 3VJ6B 4AENA 4PGBA 4Z0BH 5EOQL 3NA9L 5HHQA 3EYFB 4PJHB 5IM7B 1OTSC 1DDHA 2BDNH 1IVLA 4FQHB 4LHUB 3R0MA 5GRUH 1QBMH 3BPLC 5ALBL 3P0VL 2X4TB 1NBYB 4K07A 1RK0A 1G7QA 5B38B 3NH7H 1FLRH 1X6NA 1AXTL 2CKBB 1LEKB 5M7QA 4FFZL 4HS8L 2AGJH 1UZ8A 4H8WH 1HKLL 3WEXB 5FHBL 5E8EA 1T4KA 4QXUH 1XR8A 1ZLSH 2Y36H 5C0IA 4NOBA 1RK1A 1Q0XH 1S9XA 2MQ3A 3RGVD 4POYA 1RUKL 4PTTA 4RAUA 2W9EL 3CK0L 4L9LB 4HUVA 3HA0A 3BKJH 2DYPB 2HG5B 4Z7UF 1JWSA 1GOFA 4DCQB 4YDIH 2MKWA 4GQ9L 4FFVC 5IB3A 4GRLD 4U1GC 4F57L 4K71C 1TJGH 4RCAA 1MI5B 1G9NL 3PV7A 1MCQA 1B6UA 4GRMB 5IROA 2KZWA 5AYQA 1U6AL 2OM5A 3FQRA 4Z7OF 4U1IB 4WRLA 2ZUSA 4MDJB 2DLGA 3EJZC 4GSDH 4NQVA 1AI1L 4IJ3C 5C09A 2BHUA 2AJZB 5T5NF 3TA3C 4NQED 3EDKA 2YMXH 4WNQA 2CLRB 3K3QA 1FRGH 3PHOA 2DQUL 2ZOLA 2FR4B 1LD9A 2VXUL 3SDXF 4NT6A 4F8QA 1FVEB 3BZEA 4U1SA 4OIBA 3QDGD 2FSEA 3TIEB 3MMEA 1EIBA 4I2XA 4FQQA 2PXYB 3OKOA 1BD2B 1YEJL 3MFFB 3ZTJG 2CJUL 1YEKH 1LO5A 1H5BB 1EZVY 1MIEL 4P2OD 3RA7L 4LQFH 1IJ9A 2KZ1B 1X5FA 1KPUA 1Q9LB 3N9GL 5GGUB 3GHEH 4QRTA 1IKFL 5CSZA 5DHYB 5FOJA 3RGVC 4NM8H 2A9MH 2ADJB 5FGBA 4G7VH 2IAMC 1E4WH 1BJ1J 4JGJA 3MRQB 1MFBH 5L2JA 2X4SB 3L7FB 3MRLB 3TPKA 4DZ8A 3JXAA 4L9LC 5DURD 1WCQA 3RWEB 4FQXB 5HJ3B 3P0YH 1DQQA 1CWVA 1L0XA 3F7VA 2GJZA 4J3OC 4G42B 3Q5TA 1UM4L 2GJZB 4YFEA 4XAKE 2NY7L 1EAPB 3RAJL 4JDTL 3ZKMC 1DLHB 1INQB 5C08E 4ONFL 5IT2H 5D5MB 1A1NB 2RCSL 3MXVH 4X6CB 3OB8A 1UXSB 3QBTB 4N68A 4LCWA 4HXAH 1ZKAA 3D39E 2D03H 4P57B 4S1QH 3CZFB 3U0WH 1WICA 1U8JA 5E2WH 1BIHA 1XH3A 2CKBL 1U8MB 4KMTL 3WKNA 4NWTL 3MQIA 3FTGB 5SX5K 3MA9H 1H0DA 2D3VA 1G9ML 5I15L 4QO1A 5BJTB 2X1PA 2DIAA 4TSAH 4Z0XB 1NMBH 4N90D 1BD2A 1T7YA 1ZT4B 2EDRA 1MEXH 4RGOL 1R24A 2YD9A 4JZOA 1VFAA 1JGLH 2ZZUT 2YPKB 5DEFB 1NAML 3BPNC 5DJDA 4AIZB 2NTSP 2HTKD 4PGEB 5LCVL 3ZT7A 1T7XA 3GMOA 3KPOA 4QRRB 1IC5H 1FVEA 1INEL 4QGTA 1R5VB 2R4RL 4XNMB 2P5WE 3T4AA 3GMOB 1JYVA 1I8LA 4RMQA 5DDHB 3CSGA 5KSAB 4LSSH 2DJ4A 4AEFA 2FZ3A 2ZCLH 2HAZA 3CD4A 4JFYB 4RMTA 1G7HB 1U8NB 5JHDD 3SGJC 2X4UB 4PR5B 1X5HA 1VCAA 4YR6A 5GHWH 1IQDA 1JV5A 4ZFOA 4NNXA 2B7DT 3B6SB 4F7PA 1NEZB 5HDOA 4JREB 4C56A 4JDTH 3HRZA 4Y7MA 1XFPA 4LCWD 3K8MA 4B7IA 3TFKD 4NQEE 3QH3A 3RZCB 3QI9D 2K3TA 3QPQC 4F7CA 3OG6B 1YNLH 4DGYL 1IFHH 5ENWA 3L95A 2JJTC 3CFCL 4NZUL 3MRGA 1CFTB 1FJ1B 3GHBL 5KZCB 4FQHA 4LHUA 2NY5C 4WHTB 1J0JA 3T0EE 1NCBH 3C6LB 5F3BA 3V6OE 5TGBA 3KDMA 3NZ8B 5IT2L 4JFHE 1W0WB 2P43B 4MNGE 5C0BE 1INQA 1ULVA 1GGYA 1AGDA 1IGJB 3IAQA 1AY1H 4E0RB 4ZO9A 3BH8B 3BKML 4EN3C 3QUKA 2AERT 4KVNH 1U3ZA 2EKSB 2QR0A 3MRNB 4M6NL 3ARSA 4PJCF 1G6RA 5J3HC 3UPRA 5EU5B 3NIGE 4KI5F 5T1MB 5J11B 1KCLA 3T4AB 4XB7A 5C0JB 3LKOA 1SJXA 1J5OL 1HXMB 1NGZB 3LEVL 4NQDB 1W0YT 3Q2CA 1A14H 1EGJA 3VFSB 1KT2B 3GSVB 2R4SH 3RJQB 2IADB 1NGQL 2JELL 5L2KD 1F3DJ 3DIFB 4K3HA 5HVWA 1Q9OB 4Y5VB 4CVZA 1NDMB 2Z91A 5J06A 4YFLI 4OF5A 5T1LD 1U3JA 3ULSB 1HZHL 4Z7UE 5E6ZA 5H35A 1GC1H 4Y8AA 5KOMC 3X14B 3U46B 3CFEB 4HWBH 4ZFOL 1ODAA 3MOAH 2XN9D 1WTLA 1VGKB 4HEME 4PJHA 5IM7A 4DAGH 4DEPC 3PL6C 4LHUD 2V5YA 1B6DA 4KRLB 4QF1B 3H9SA 5DVKA 4OUUA 2K1MA 3EO0A 1FVDB 1U91A 5D7JB 2H9GA 3KPNB 5KG9A 1KC5L 4L4VA 4OCWH 3VXOB 1OF2B 4GG6E 4BELD 1JVKA 5FGSA 3QUMB 5GRVL 2W0LA 5HYJD 5GRZA 3L3GA 3IETA 4I1NB 2FBJL 3TBYA 1TLKA 1FZJA 4WEBL 3KPSD 1QUNA 3FB5A 4JCLA 1A6VH 1BF2A 1I7UB 4HLZG 4GBXB 2R56L 3T4YB 4R90H 4JRYA 4JVUA 2Y07L 4CAGA 2CIKB 2ADJA 4MQSB 3D0VB 1A9EA 1XGPA 4CU6A 1J0IA 3MLYL 4OCSH 2W92A 1AQKH 2QADC 4FQJH 1OP3K 1VGEL 4CN6A 3RPIA 1JK8B 4KHTH 1G6VK 3U0PA 5CJ5A 1B0GB 3MNZB 3O2VL 1D5XA 3V2AR 2C1PB 1LO2H 3IKKA 4WCYH 3DGGA 1FL5A 2EYTA 4KKCD 3B3IB 4MNQD 4PJBB 3S96A 4WUKH 3TNNA 5TDPB 3C8KB 4JKPL 4IDLA 4HIIA 2Q8AL 5E6ID 4QT5B 4IRJB 5D1XB 3OXSA 2ZNWA 1QD0A 3T2NL 1KENH 3ZSSA 1WK0A 4I48A 5I30L 2V2XB 3EOTH 1YMMD 4GRWB 1BQUA 3MA7B 1JYWA 1NFDF 4BUHA 4GO6B 2K7QA 4CVZB 5F9JB 5FDWB 5JMOC 3QUYB 1CXIA 5MHSD 5J4MA 2ZUWA 1YC7A 4OT1L 4OZHF 1DBKL 2AK4B 2X4QB 2YXFA 5JHDA 1WUNT 4JFHD 3BPCB 3QEQE 1TQCB 1OF2A 4J1UA 2VZ3A 4XNYL 3HE7B 1WEJL 2HVKA 4M03A 3AS2A 1MF2L 1JTTA 1FG2A 4ZNEA 3TBWB 4D9RD 3O8XA 3MRKA 2H1PH 1RZ8A 4NDMA 1QHPA 2LVEA 3RWIB 3N1FC 5IOPB 3HC4H 2K9UA 3QULB 4OZHE 2BNRD 1Z9OA 3KPMA 5E7FA 1S7WA 3WFDL 4L4TA 4TUJB 2HT2C 2UUDH 4G80A 4KJYA 2PXYA 3OKOB 4BSWB 1BZQK 4JFDA 5J0BA 3RVTC 4JJ5B 4NZRL 4EQ3A 1HN1A 1VADA 2VDPH 1BM3H 2YUXA 4E42B 4MVBD 3EHBC 1U3HD 2VLRA 1ZT1A 2UWEA 3IF1B 4N0FB 5CEZD 1NFKA 5KAQG 4X4MA 1GH7A 3DRQA 1FL3A 4JZJC 4LDOB 3NPSB 3IKCB 3HZKB 1I7ZA 2XZCH 3EYUL 1B0RB 1I1AB 5C09E 4Z78A 4ONOA 2H32H 4ORGB 5JOFA 4JDZA 5L88L 3F5WA 1N6VA 4QKXB 2W0FB 1LVEA 3SQBA 2DL2A 3HZVA 3L6FB 1KCSL 3BZ4A 1VACA 4NQXA 4WU7B 1Q1JL 4J4PD 1XGUB 2Y7QB 1TPXC 4KVNL 5A2LH 3U4EA 4U6VH 1OTTD 2QSTA 4Y2DB 1PEWA 5KS9E 4DQOL 3U9PL 2DRUA 1VFOA 1JGUH 1T89A 5DFWH 4P9ML 3FFCD 2G75A 3EYOB 5IB5A 3FQNA 5DMKB 2GIYA 2WBJB 2L0DA 4PJAA 2OX5A 2YMXL 3MLRL 4QXGH 43C9B 3S9DB 1Q72H 4UU9B 1ORQB 1NUNB 2NW3B 5GS1C 4X4ZA 1WTGT 3CLFH 1NBYA 3AFLA 3VFWB 1F58L 2X44D 3MYJA 2EH8L 2HT3D 1B4JH 4JFOA 1FV1A 3U4BH 5FV1L 3O0RL 3ARDD 4ESKA 3FT4A 4F15C 1DFBL 3IDYC 4ZTOL 1VFUA 1E4XH 2XA3A 1CLCA 2Z9TA 3FMGH 1A1MB 3TO4D 1B88A 2QQKH 4JRYB 3KPSA 5JMRA 2VNCA 2ADFL 5E2VL 1R3KB 4R3SB 3V4UL 4YK4C 4LU5L 4NQDE 3V0WH 4X6BA 1B0RA 2IQ9H 5IKCB 1JPTL 4KROB 3H0TA 3NA9H 2QEJA 3G6JE 1TCMA 5AG9A 3BFOA 4I3RL 3QDGE 4RSVA 4OBSA 2MCPL 5EDXA 4Q9QH 1DBAH 1MJ8L 3GO1L 3NH7L 5LVEA 3B9DA 3L3HA 3LHPL 5LBSH 2Y06L 3MJ7A 1QFWH 1YEEH 5E8PB 4IMKA 1DBMH 1KB5B 2CR3A 1FCGA 5JDSB 2GITA 4OFKA 3WBDA 4AK1A 3RHWK 3S88L 3DI3B 32C2B 1OP9A 4XBGA 2IH1B 5F7YC 1K4DA 3EOAB 5D2NA 5CEXA 1BZ7A 2IH1A 3FB8B 5D6CB 1CGSL 1IEAA 2XFXA 2JLLA 2R2BB 2VERN 2CKNA 4M8QA 1DQMH 3SKJL 1R0AH 2FSEB 5EOCH 1KJVB 4YDLC 5IGXL 2VXSH 4LK4A 5IBTH 1QR4A 3EJYD 1CICC 3ARDA 5HGHB 1I9IL 1NCWH 1GCFA 1GGUA 3VWKA 3ZSTA 1X5KA 1TTUA 1CLZH 2J6EA 4WNQB 3O6MH 3D3VB 2NY1C 5SWZD 4YPJA 5E56A 3BRFA 4P59H 2VXQH 5BQ7A 3PGCA 5IROC 3ZTJH 1PX3A 4ODHL 3MOBH 3SDDD 4YHIA 3ZE2F 3MLSH 3TN0B 3DJ9A 2FLRT 2GSGB 3VFUA 3V0AC 1XF2A 5I9QC 4MHHI 4E41A 1M05B 1ZANH 4ODXB 4OQTH 3TIDB 4XWGL 2DQHH 1OWRM 1UQSA 3R1GH 4XP1H 4TNVK 4JRYD 1D9KC 4PLJC 4X9IA 5F7EH 4UT6L 3GSXB 2VB5A 3WD5L 5JPMB 1U8KA 1A3RH 2GW5A 5IBTL 4KDTA 3QSKB 2W65A 3QNYB 5CIPA 5EOCL 3CFCH 4OSUL 3U7AA 5F96H 4PS4L 4PUBH 1H3PH 1Q9KA 2DD8L 1R3HA 4PJ7B 1IGMH 1DBML 2CIIB 4YXKL 3AU1A 3MGTB 3UTQA 3BQUB 1HOCB 3ZDZE 2FEEI 4P2QD 1TVBA 5FUCE 5DHVH 3KYMA 3OF6A 2NY3C 2P5WD 5ALCL 4MD4B 4UQ3B 4P5KA 3MUZ1 12E8L 1YY9C 1GGCL 1T83C 2YD2A 1UWGL 4MCYA 2VSDA 3ZHDA 1ROWA 1R5IA 3FHAA 3VXRE 4M4RA 5E99H 4YXLL 4JZNB 1EEYA 4LSVH 3DSFL 1ZTXH 1AH1A 5IFAH 5TDNA 4ELMB 1IM3B 4QHKJ 4JB9L 5ITBL 1LO3L 1Y0LA 3CSPA 3NIFE 4NQCB 3LPWA 3LRSA 1P5UA 4H26A 5AUMB 5H8DA 2C4FU 2D4DA 2XRAL 4MAUL 4XP5H 5CMAB 3UYRH 4YDJA 2R2EB 4M7LL 4K2UL 3RDTA 1RI8A 1NMBL 1ZHNB 3M1BA 3MYJB 5JQ6H 3QG7H 4Z0XA 5TDOB 3OAUL 3KYKL 2CK0H 2PO6D 4IRJC 5D1XC 5CGTA 4LSQL 3W39B 1OAZL 4MQ7A 3SJVA 1WGOA 1BQHB 2D4FA 5HDQH 1R3IH 4TSCL 4JLRA 4WGWB 4P4KC 4QT5A 1INEH 3GSQB 3RWHA 2ICEA 3GIZL 1T0NB 1O5DT 4HS6B 5F3HB 4DAGL 2A6KB 3RDTC 1CDCA 3DV6A 1BVKA 3BE1L 3DO7B 4TQEL 4M5YH 4AL8L 4RGOH 1FFPA 3ARFC 1I75A 2VDNL 3WFZA 4B0MM 3MXVL 1KJ3H 5ICYA 3TIDA 2VXVL 4CRPA 1U95B 4WHCA 3U48A 5BV7B 1OSZB 2F54D 1LE5B 5JIPA 1BGXH 1NANI 4ZUSA 4KROD 5E8NB 5IJVA 3U4BL 2XI9A 4CVXA 4X9FA 2APTA 5DI8B 3EDFA 4JG0H 3BVNB 4RRPA 5L2KE 2BVUA 4TVPE 1QKZL 4L1DA 5JW4Q 3ULUH 2D7TL 2FJGA 4UUJB 2AJVH 1XCQA 5TE4L 1T0MA 4H1LG 4RZCA 2HVJA 5D72H 1OB1B 4AT6A 2QL1A 1WZMA 2VUYA 2Z92B 1CLOL 3GJFB 2O5XL 1WT5C 1J1PH 3VG0H 2UY7A 3CDGA 2V9RA 2E9BA 1R3JB 1ES0B 3GJFK 4ONGL 3LS4L 2H32A 3B9AA 1QRNA 3LD8B 4XGZA 1T2QH 2DQFA 3DUUA 3GGWA 2GQHA 2WBJD 5F7KC 5T5FH 3MODH 4WFHD 5F9WB 3W82A 5LBSL 4MNQB 2O5YH 4U1LA 3O9WD 3OKDA 3V5DB 3ULSA 3K2MC 2Y7QA 1T1ZA 2DTSA 5HYJE 5I2IA 1C08B 2VQTA 3OKYA 4GKZA 1M6OA 3KPSE 1EAJA 3SBWC 3CH1A 4EIGB 4L8SA 2MCG1 3FRUB 2W0FA 2H2PC 4ZFFA 3BGMA 3UBXG 5CLWA 4LU5H 3WNMA 5I30H 4JGMA 3QUYC 4JO2L 5I18L 4UT7H 1S9KC 3V8CA 1KCKA 4GXUN 4MQXC 1NCBL 3I6KB 4L8CB 1UCBH 2ED9A 1DBBH 3CUPA 3ILQC 3UX9B 2C3VA 1HQ4A 2IPKA 2VLJA 3ARTA 4BSVA 3MJ8B 3VGEA 1KCRH 5C9JA 1WAAE 4JZJA 4Y5XB 2ICWJ 1VA9A 4HKXA 2J8UA 2WANA 3AS1A 5DGRA 4P23C 3T08A 1IL1B 2DQJH 3H9SB 5FM8A 5BCAA 3SDYH 1IAIH 4BZ2H 5EBMA 3VW3H 1KPVA 4BSWA 2R0LL 2DM4A 2PTUA 3OMZA 4MYWB 4FABH 1ND0B 1OARH 3DTXB 3IDIB 1PD6A 3PP4H 4X5WB 5KSUB 3IVKB 4K8RD 4B53A 1AJ7H 4QOKA 4LSPH 5CSBA 4YUEH 1L0QA 3T77B 4OB5L 4E42A 2R8SL 2FO4A 4YHMH 1AO7B 1BX2A 2ZCLL 5AYUL 4FXGB 3CMOL 3BN9D 4KMLB 3ULUD 3B2VH 4JFFB 1MCKA 2ADIA 3WLWD 3MZGB 3WDJA 3GK8H 1HQRB 1A4JA 5I1LA 1PZ5B 4GLRI 1S9WB 4LOUC 3HE7D 1H8OA 5IKCA 5MI0C 3O45B 4OLYH 3HG1A 1S9WA 1GPOL 1OLLA 2PTTA 4M62L 5HHOD 4PREA 3CH1B 4GS7C 1JGLL 4CJ1A 4ORGA 1VHPA 5D7JC 2BSED 2BNQE 4OM1H 1MI5A 3NVQA 2BNRE 2EC8A 3GUTB 3G08B 2EIZA 2DQIL 2H3NA 3V6ZA 4LLWA 4Z0BL 5EOQH 2GSIB 1XGQB 4P5MB 5ECJE 4JKWA 5F7WC 3WS3A 1SQ2N 3H9HB 4YAQB 3P9WB 2EDEA 2KUTA 4GKOA 4YUEL 5BZDB 4D0DA 4AEIH 2I26N 4LEOA 1AXSB 1WLHA 1CD0A 3WJJC 3X3FH 1CE6A 1N6QL 1K3ZA 3FO9A 3DHJA 4XP6L 4PJAB 2XQYK 3MLZL 5JR1H 4X6DA 4RFOH 4NFDA 3KJ4C 4OLZL 4N8VG 1NUGA 4Y0GA 1NL0H 1NDGB 5LWYL 2QQNL 4OI8A 1RK0B 4LLDB 1IARB 4WO4A 7FABH 4PLKD 4L8BA 1MAMH 2RQ8A 1QSEE 1K2DA 5F21B 1RUMH 1I7UA 1BQHG 3NCYP 1BBDH 3GM8A 3FT3A 1MWAL 5E00B 5HHPB 4LPWA 4IMKC 3RY6A 1U9KA 4ZO8A 1CG9B 2FJHB 4OZGF 3Q48A 1FRGL 4AEIL 1CG9A 2FJHA 4ZS7L 3X11B 2GTZA 4QHMA 5TFSH 2FH8A 5F6HJ 2VMFA 5DYOA 4JDVA 5CHNB 2VITB 4RIRA 5IIEB 1LO4L 4QRRD 1RUPH 4O2CB 4CVXB 1NL0L 3LZFL 3IU3A 5F8QC 3BEWB 2BOBB 2WV3A 3RZCC 1RIUL 3I6LE 4G6FD 1CXKA 2PXYC 3MCLL 1OP3H 1T1YA 4RRPG 3OGCA 4LRIC 1ZT7B 3W2DH 4LEOB 2HFGL 4NM4H 4Z7VF 3FONA 3MLVL 1MLCB 1ZWIA 1GRWA 4WUUE 3ULVC 4HZAA 1YJDH 2D2OA 3G6AB 3VFSA 1SBSH 5JW3H 1HILB 3S88H 4CNIA 5IW1A 4F3FA 2GTWB 2A6JA 4NQDD 4R4BA 2VLJB 3SE8L 1URLA 2XQBH 4JFED 5INDA 3IFLH 2E7HA 3L3DA 4IMLB 5L9DH 3PWVA 1R5VA 4XNMA 1K85A 2HJKB 3D25B 3T3PE 4JPWL 3DWTA 3LRSB 2WBWB 2NY6B 1HXMA 4O2FB 1ZLUH 43CAB 3GBML 5TH2B 4MD0A 2JCCF 3VXPB 1QLEL 4MA7H 1M6OB 1QNZL 3H3PH 1X5XA 2E9WA 2NMSA 3ULUF 1OTTC 1FVCA 1PG7H 4X4XB 3BT2L 5FUZL 4OM0L 4FFZH 3PG2A 1JWUB 1EPFA 5LJYH 4AEEA 5LGKA 4QHLB 4IRSA 3TYFA 5JW3L 1D5IL 3STLA 2W65B 3P4MB 4F7TA 2X4PA 1NFDE 4OIIL 4QTIL 3CCHA 2IGFH 3NN8A 1M7IA 2I25N 2C3XA 1F5WA 3QXUA 1GL4B 1T04A 2LTQB 2CIIA 4DTGL 1UWGH 4I2XE 4XC3L 4GAYA 1AC6A 4F2MB 4FQ2L 3OAYK 3ET9F 4WUUA 1X5ZA 5SWZE 1TJHL 2Z8SA 4XCNB 1C1EL 5FYJL 1A22B 3CX2A 4Z76A 1Z2KA 5LQBL 5GGVH 1S7TB 5D8JH 3AB0B 2JIXB 3UCRA 5DC0A 3C8DA 1NLDL 3PWJB 1LO0H 2R1XB 3BKYL 4NJ9H 5I1EH 3FQWB 1QFUH 2WWKT 3FB5B 1KXVC 5GJTH 3A6CL 1D5ZA 2I07A 4XXDA 4MJ4A 4A6YA 1Y6NR 4Y19E 2YPKA 1P7KA 2ZG1A 4XXDB 1RHHB 4A6YB 2IBGA 2F54B 3FN3A 3WN5C 3PWPA 1RZGB 3O4LB 1W72H 4AEHL 1FZKA 1X3DA 3OKNB 2VLJD 3EJZD 1ZGLB 4V1DB 3DROA 4QLRA 1WWBX 1MVFA 5JIKA 2N7AA 3ALXA 1OL0A 3ARVA 3RVUC 5MEPA 3IDNB 5SV3A 5T3ZL 3UTSE 3T1WA 4ZDHB 1CL7H 4KZEH 1BOGB 2P5ED 4WWID 5FA4B 4IRSD 4WENB 4WFED 2R69H 2EDKA 3DETD 5DD0H 3SCMD 4K7PX 1E0OB 2VXVH 3U6RA 2NY2D 1JNLH 1CVSC 3BKYH 4NJ9L 5E2TH 1Q38A 5BV7H 2BSSB 3EO9L 5J9PB 1N6QH 1V7NL 4LL9A 1ZLWH 1AHWB 2VDPL 4HHAB 4R7DB 4F33B 1ZANL 3T65B 5GGSB 1VKXB 2J4WH 1C5DA 1CGVA 1NC2D 2MPAL 4FQXA 4HJ0D 4X8XA 4YPGB 5E4EC 4JQVA 4LSTL 1ZVYA 4D94A 4NHCL 5HYIA 5EUOF 1FORH 5IWLC 4BFBD 1J18A 2E5EA 3Q0HA 3BD5A 4K71B 2IGFL 4WY7H 4YFDB 4XCEA 1LO0L 2Y5TB 3ZYJA 2OJZL 2H1PL 2XN9A 4JFEE 2O5ZH 5IQ9B 2C9AA 4E0RA 4PFEA 1HHIB 1FGNH 2AGJL 4Q2ZA 1NGWA 1I9IH 5D93B 3NIGF 5E94A 2NZIA 3V6FB 5EO9A 3TVMB 2VE6B 4LRNH 1D9KA 3L5WA 1OOAA 3WL9A 4LHUG 1JWSB 2LAGB 1ONQA 3ZKSD 4NWTH 1LEKA 1QACA 1NCCL 5F6IB 3IVKA 1PSKL 4RFNC 1WCBA 4L5FH 2YRLA 1S9XB 4PYGA 3DO3A 4R0LB 4WW1A 1I8MA 1A8JH 2BSRA 5FIEA 3KPLB 3MJGX 4I9WD 3HUJE 4WO4C 4XMLL 4X5XB 5K9KA 5ALBH 4O2FA 5I9QB 3VWKC 43CAA 5DJZB 5DJYB 3W5MA 3BAEH 1VB9A 5KSBB 4AJ0A 3F5WB 3PGFL 1J05B 3OAUH 2EDQA 3UC0L 1I1CA 3LMJH 3QHFH 3MPCA 4HDIA 3ZE1F 2VDQH 5DSCA 4LRNL 4Y19B 4Y4FD 5D2NC 1OT2A 4QHUB 1MEXL 2XQBL 3KPRB 1F2QA 1NQBA 2X4QA 3NPZB 4IHOA 5DD6A 1P5VA 3TF7C 2Y23A 1JGDA 5D7SH 3KXFD 3SDYL 4FQCH 5D7IF 3V79C 2X05A 1OW0C 3S37L 4DOHB 4JVWA 3MGTA 3UXFA 2DQGH 3QDMD 4L3EB 4PJBE 4D9LL 4G8FB 4XCCH 3VWJD 5J3HD 2Y1VA 1Q72L 5TPWL 4K94C 4X0KA 3GKWL 4BH7A 4W6XB 1G7QB 4WI5A 4PP1C 4H5SB 4HIXH 4FNLL 5HVGB 4JFOB 4HPOH 4H20H 1KPVB 5EC2A 3BIBX 4NZTL 3ULVL 2YD1A 2YPLD 1D6VL 4N0RA 2P5EE 2XOTA 5D1ZC 1D5MB 2VR4A 1IGTB 3BDYL 2F54A 4S1SL 4OI9A 3STZB 3G5VA 3FO2A 5F7FA 1NLBL 1RIVH 4X6BB 3LV3B 3RTQD 1GGBL 4LIQE 2VIRB 1MCCA 4HF5H 4OCRH 1JN6A 4UINL 1GHFL 4YH6A 2NY0B 2P46B 1Z3GL 1Y18A 5EUKA 2NX5A 2V5RA 3BGMB 5B4MC 3NGBC 4JRXD 1U8PA 1HIMH 1A0QH 1J12A 5ADOL 1S7QB 2N7BA 1IGJA 1V3KA 4XVUD 5F7LB 5FGRA 4PBXA 1BGXL 2IQAA 2QADD 2Y36L 4NZJA 5CJQL 3GBNH 3HE6A 3ZYOA 4DKFL 4PRAB 4KI5C 1I8LC 4RX4A 4HQQL 4EKXA 4LCYA 4D0DB 4RFEA 2WBJC 3AREB 2WBJA 2NCMA 5DUMH 1NAKL 3BN3B 3VGBA 1XIWC 4JQIH 2ZG2A 1S5HA 1SY6A 3CU7A 3VXUE 2FL5A 1P84J 3TJHC 2I27N 1ZAGA 3I3DA 3GNML 4ZODA 5IFAL 3F62A 3B9KC 1F4WH 5K9QG 4Z8FL 2HT4C 1M7DB 2GT9B 2VXTH 2Q7YB 5T3XL 5TQ2H 1KCRL 5T1KB 3CSYA 4DK6A 2FB4H 3KVQA 5DC4B 3QQNA 2BNQD 2OR9L 4GW4A 1RPQA 4PRHA 5CGYD 1S9YB 1HHJB 2YRZA 4HS3A 4GW4B 2PUQT 3IB4A 3QJHB 5F88B 4UBDC 1UCBL 2PYEB 3JUZA 1DTUA 2N4IA 3OZ9L 3HB3C 4LVOC 3RTQA 2DI9A 2A6DB 3VW3L 2CO7B 3RTQB 3B9EA 4E41E 1BQSA 4UV4L 1I7ZB 3Q1SL 4KKBC 1FFNB 1RUKH 4W68A 3VXTB 4LASH 4Q0XL 3T3ME 3MBXH 5E70A 3ZTNH 1Q1JH 4P46B 3HMXH 1PX4A 1F90H 3B9VA 2NLJA 3QIWB 4WWKB 2UWEB 1WWAX 2PKDA 3KPQA 3S96B 1FP5A 4OSUH 5CILL 2IMNA 4ZMAT 2BRRH 1FLRL 5J6HA 4OCXH 4K7PH 1D7FA 2ITDA 4J4PA 1RJZB 4ZUWA 5I73C 4OCMC 1AKJD 3CPLB 4YIQB 5E2TL 3MO1A 1J1OH 3QIWD 4MXQD 1IC7L 3AREC 3DLQR 3BOVA 1Y18B 4MD5B 4XWOC 4KWUA 2PO6B 4XPFH 4JQIL 5ID1A 2H3NB 1QQDB 5E5MA 4N0YL 5FUOL 4WW2C 1WITA 3HE7C 5EPMA 3V4PL 5DMGD 5IR1A 1P7KB 2ZJSL 3MBEB 3JWNC 3RWGB 1IM3A 1JFQL 1QZ1A 2VR9A 1KN4H 4PJDA 1HHGB 4QRRE 5C70A 1I1FA 2AEIT 4NN6C 2BNQA 4NZDA 4OUOA 4DVBB 4EXPX 1UWXK 4P3DB 1IM9A 2DBLL 3HB3D 1IGFL 2ZPKH 1FNEA 1UWEL 2KL6A 4LLDA 3TBTB 2W1NA 3QCUH 3TNMB 2B4CL 5F93C 2OL3L 2LU3A 2XKSA 3EO0B 3AMKA 2FX8H 2VDRL 4UAOC 3NAAL 5FYJH 4XPFL 4OJFL 2IPTH 4WUUD 1JL8A 3HRZB 3MR9A 4PRDB 4LFHD 3NN8B 4D0BA 2CO6B 3STLB 2QADB 3EJYC 2JCCE 2DQIH 4PJHF 4N1HB 1NSNL 1RMFH 3QUZA 4WI4A 1XF4B 3MUGB 3HR5A 4N8CH 4P57A 4MA3A 1A3LL 2R15A 3H9SE 4FG6C 5E95B 1FE8L 1LEIA 4YC2C 1QSEA 1V05A 4NZRH 1PG7X 1XGTA 3GI9L 3U2SA 1VDGA 3L3KB 4YGVB 3EYSH 2BSTA 3X13B 4BFGA 1E4KC 1U8HA 2VDQL 2BNUB 1X5GA 3JWOL 4MDJA 1N4XH 1CBVL 2D7OA 4O58H 3VFGL 1Z0NA 4JHZA 2CDFB 2XV6B 2EYRA 5JLZB 1R24B 4JZOB 5TDNB 4N5EC 2VLME 1IGTA 4OGXH 5E24E 1EHLL 2EIEA 2BSRB 4G7YH 2HWZL 3BMWA 3T0EC 4OIAA 3G5XB 1EZVX 3HNVL 1JF6A 4J23A 4DK3A 1LEGA 1YC8A 1YUHB 3RPKA 2HG5A 3HI6L 3OHXA 1QQDA 5E5MB 2WIIA 1EVUA 4LLQB 4J3WA 1A2YA 4YE4H 2PNDA 4HFWA 4MQ7B 3O0RH 3V7AE 3LB6D 3L3IB 4OF3A 2EH8H 4KK6C 1I8MB 5ISZE 1I4FB 4R8WH 3BYYA 4R0LC 4RISL 5EB9A 2WZPD 1EJOL 3DX7A 3G5YA 3BD4A 3RUGF 5CZXD 2J4WL 1JYXA 3RWHB 1G7IA 3KXFB 1UXWA 4PJIB 5DMJB 1JGDB 3TBSA 1OLZA 5IF0A 2X2YA 4ZXBC 2WUCH 4FQ1L 4C56D 5C0FA 1BPVA 1CFNB 3PE9A 1TZHA 5ITBH 1FVCB 2O5ZL 3EZ8A 4F58H 2EDWA 2BVEA 3O4LD 2G9HA 1UJ3B 1A3LH 2ICWB 1KJ2B 1MHPL 4ERSH 1MCEA 1RJCA 1P2CA 3RNQB 5E1AB 2J7LA 4PP2B 4LSSL 3LN5B 2F15A 4ODTH 1V7MH 3E2HB 2HFGH 3RX5A 2DKUA 5FYKH 2XT1B 2BSTB 2MPAH 1SHMA 4Q7DA 1AGDB 2VOTA 3BW9B 4D3CL 1T5XB 2HFFA 2D7MA 3B2UD 4LVNC 2J8UE 2V2WB 4G5ZH 1JPST 3C6LD 3TGXA 3WE6A 5GSVB 2J5LC 3C5JA 4L4TE 4XBGB 4KRPC 4G9DA 1FN4A 2BOCB 2V5MA 3V6OC 5IHBA 3MV8B 4Z76B 3JUYA 5CFHA 4MD4A 1RHFA 1AHWC 2VLKE 1S7RB 2JE8A 4HAGA 2F5BL 1ONQB 1ITBB 3REVA 3SY0B 5GS1B 2X9YA 4Y4FA 3SY0A 3IGAA 1ACYH 4LVEA 5FM5M 5DMIH 2VISB 3AM8C 1I1RA 2AI0H 2GJ6B 3UP1A 5ID0B 3SPVA 2QHRH 1UB6A 3ZKND 4HV8A 5KOVC 2CLVB 2RAMA 1MCWM 4UDUA 1A7BA 1XGQA 4AEHH 4JHWL 3CZJA 4P9HL 1S7SB 1GSMA 4X98B 5IEKB 5ACLA 4MWFA 5D7LE 3RQ3A 4F7EA 5HYSA 1G1YA 5AEAA 1UKSA 3K4DA 1CFNA 5EUKB 4YX2H 3QCTL 3SO5A 1IQWH 5CUSL 5F9DC 3WFBL 4ZQKB 5ESAA 1DVFC 4CW1A 3QIUD 4AM0A 3PQYD 2BY2A 1OSZA 3G6AA 3LVEA 3VFTA 2Z31B 1NC2A 4PRPB 1CK0L 1KJVA 3DX7B 3K4ZA 3LMJL 3QHFL 1H5BA 1EDQA 2DI8A 1NCTA 4RAHA 1RZJH 1ZGLM 4Z7UB 1IAKB 3HFML 4ZYKB 2VLMD 3FQNB 2MJWA 1JF5A 2P5EB 1KIPA 1F3DH 1KENL 1OTSD 3QNXA 4WU5B 4JRWA 3N50A 1CYGA 2P5EA 1Q0XL 3V0VB 3K81A 4I9WE 2BOCA 3RDTD 1CLYH 1PKQA 4QTHB 2ADFH 5F6IC 5EBMB 1R3LA 4H5SA 5T1DL 4JJ5A 3TZVD 1HYSC 3D48R 4JDVB 4YDIL 3T8XB 2OTWA 1LP9E 1KB5L 3S97C 2IF7A 4H8WC 4K3JL 3BP5B 2A6IA 2HN7B 1T3FA 1A1OA 4PY7A 4YEEA 4POUB 1VGEH 5D93C 4DGIH 3H3PL 3GSNB 1NBZB 1BFSA 35C8H 5ADOH 4U6HA 2EXYC 3DI2B 4Z95L 4C56E 3LN4A 1JUFB 5IEKA 4OLUL 1MCOL 5EO1A 3W0WB 3GI9H 1JUFA 1NJ9B 4M02A 4LCUB 2AK4D 3ISWA 3C08L 2DIJA 3C5ZD 1CLYL 2CRYA 4P4KA 3QUYA 3QDME 5E08L 4QNPF 3NCCB 1D5BA 1K3IA 2CMRH 2W9DL 2A77H 1FORL 3IS0X 1UM6H 1NEUA 1N26A 3QXVA 5BJTA 1IAII 4L8SC 5E99L 4XRCA 2HKHL 3IFOA 3HAEH 5D7IE 2NNAB 4U7MA 3ARGB 5C0DA 3QIBB 4OGYL 1RURH 4IS6A 5D2LB 2EDDA 3QPXH 4JAMA 4K23H 4NKMB 1QSFB 2YRPA 4M48L 4JE4B 3WJJA 3AUVA 4U3CA 4YWGH 4L3EA 3BHBA 4UU9A 4YO0A 2FHBA 5T3ZE 1CR9H 3ARGC 4HKJA 2VLKD 4QRPD 3VRLE 1F4HA 4NQEB 4E41B 4Y5VA 1KFAH 3FCTB 4U3XA 2HH0H 4QWWC 2E7LC 3OX8B 3SO3B 4PGDA 2YC1B 4ZD3H 4JN1L 5E9DA 3T0EA 4PRHB 1S7VB 1AY1L 1A14L 3FT3B 3IFPA 2W38A 4HIJB 3Q6GH 2DMKA 4EZMA 3ULUC 3KPSB 4G3YH 5ETUB 2W91A 1UM4H 3SKJH 1R0AL 5ETUA 2ZSWB 1J9CT 5D70H 1MCWW 3T1FA 5DRWA 3N9GH 1N0XL 4B41A 4FXKA 4RGNE 1N3NB 4EDXB 2FECI 3CFIC 3PDOB 1KELH 4KVCL 1ZGLP 4KDVA 1V7ML 2EEAA 4EUPG 4OCLC 2JJTA 3KYAA 5IVOA 3UMTA 4AMKL 5E08H 3KWWA 2O5YL 3E8UH 4X6CE 5E8DL 4OLUH 1MPAL 1GZPA 4P5MA 4HUWB 5B3NA 4FQ2H 4BQCA 4NRXA 3DX6B 1HH6B 3KJ4B 1ZV5A 4HBQA 3PHOB 3HMXA 4UNUA 4JAMB 4DN3L 1P4IL 1S3KL 2KQNA 2VE6A 1N5AA 1A7NL 2D31B 4IOFC 3GJFA 1OSPL 3SJVD 1KYOK 1VACB 4G8IA 4GRLA 1IC5L 4PGCB 4M3KB 3SKOA 2FGWH 4XMKH 3MV9A 2EDBA 4NHUB 3TA3A 1CT8A 4K2UH 3OR7B 5JW5B 1ETZA 5B8CB 1I9EA 1KJMB 5I19H 4PG9A 3DVIA 4M7KH 2X1QA 1RHHA 5AWNH 1QYGL 1MJ8H 2FBJH 2OTPA 3H42H 2VZ1A 2ADGB 4RAVB 4ZFZA 4O02H 3LQAC 5HDQL 1C7SA 2BY3A 5ELIA 3T0WA 4DWHA 1CVRA 2OXHA 1G7MA 2V6HA 5GS3A 2APVA 2VABA 4JO1L 2W9EH 2VZTA 3VRIB 4LGPB 2WWMC 4PJGB 3FQUB 1IGIH 3QHZL 3MLVH 2AXGB 1TZHB 4PY8J 4Q6IC 3MNVA 5CP7A 4LSPL 2MHAA 3MCG1 4G8GB 3PP4L 3G5YB 4XMKL 4JANB 5ILTH 4EI6A 4QNPE 1KTLA 3CMOH 5C2UB 4PRIE 3C6SB 3VXQA 4DGVL 1YN7A 5JXAL 1QLRB 3ZE2E 4OCYL 4D9QE 1NUDA 4PLKC 5LGHL 3PWNB 4KVCH 4P9HH 4P9HC 1KIPB 3QNXB 5E94B 1F6LL 3K7UA 3P0GB 4KKCC 3C5ZB 5D2NE 1IT9H 4LPUA 4JM2D 4JHBA 2LU7A 4PLNC 4N0CD 1U8PB 2BP3A 2Z93B 3NFPB 5I75C 5C0RH 3QIBD 4XWGH 1NGYB 3QUZD 4M9PA 3O3UN 2RFXA 2NY5L 4MB3A 2CDFA 4K8RH 3BPOB 1WFTA 1MH5A 1PLGL 3VU2A 2X1OA 3LS5L 4HJJH 3V9FA 1T66D 5IB1A 2QR0B 2Q6WA 3LSOA 4MJIE 5SX4I 3JWOC 5C0NC 5JXED 3VMNA 1UJ3C 1BM3L 1HCFX 1YDPB 4APQC 2XKNB 3QAZC 1UH4A 5DVOA 1ACZA 4XVJH 4ZPVA 3HAEB 4UIMB 1MIML 4RGND 3W39A 2XWBB 4P49A 3RIFF 4FZEH 3UBXA 3GMQA 4WTXA 1PDKA 1BOGA 1MAML 1NDMA 4U33A 3A6BH 1L7IH 3JSSA 1RY7B 2YWYA 4PJIF 4ZFOB 2FYYA 3WN5A 3DBXB 1JWUA 4ZOCA 1KBGL 4ENED 3S35X 5DQJB 1KSRA 1LK2B 3SDCA 3MRCA 4GRWF 4MMXC 2UWEF 4NO0A 2J6EL 1JZ2A 5C8JB 5D8JL 1BVLA 1JRHL 3RU8H 5EUOE 3T04D 4EIZC 2Z35B 4MA8H 3IS1X 5BZWB 4F9PC 1JV5B 3VFTB 2P8MB 5AAWA 1YEGH 3BIKA 4GS7B 3WDHA 5E2JA 3BO8A 5HSFA 3FN0H 4LDEB 3SQOL 1JYNA 1T20A 5C0AD 3KDMB 5FKAA 2FHFA 2IBBA 1T21B 1K4CA 1RJYB 2CGRH 1I9JL 4DUXA 3VGAC 5IESH 2IAMB 4NGHH 2UZIL 3OKLA 1BP3B 3LPFA 3HR5B 2F8XC 5FUOH 1CQKA 4NZUH 1SYVA 4IRSC 3ZHKA 3WUZA 5ISZD 1XH3B 3RKDC 4TVPL 4PBVC 1YPZB 3WL9B 3QXAB 3EZJB 4YBLC 3UTSB 3PHQA 2L7JA 4YHKL 2H32B 3P4OA 5EOCJ 4ZAKA 1ZGLA 1JK8A 1A7PL 2DJSA 5CMAA 1F3JB 1N4XL 2C1OB 1CBVH 1AJ7L 3HZYA 3EOTL 3ES6A 5FHBH 5F7DA 2A74B 2AK1H 2G5BA 4P4KB 4PJAE 3UPCA 2EZ0D 4X7TB 1P7QD 4WEUD 1I3GH 5I71B 1LK3H 2AJSL 3GMNB 4X4YA 4N5UA 2IPUK 4AZ8A 5GRJH 2Z0BA 1MY5A 3FOMA 4PRID 5T1MA 3D87B 2YD4A 2AJ3A 3FOMB 3QDJD 4KC3B 1J8HB 4XVSH 4IJ3B 1F90L 1S7SA 3ZYZA 1Q9WB 2IJ0C 3ULVF 4X80L 5EBLB 2GSGA 4XPGL 3VFUB 3SDDB 4PJ9D 4YXLH 4BQBA 4ONHA 4PR5A 3K46A 5DJ8B 4NRZA 3UAJD 4MQTB 4J3TA 3W11D 1U95A 1KNOB 4JY5H 3A67L 4M8QB 4OUUB 4ZTPL 2DICA 3UDWC 4Y5YC 4GRLB 4PGCA 4BFIB 5BW7C 2UUDK 3SDCB 3PGDA 3QCTH 2X4PB 2LV4A 2APWA 4UDTA 4G43B 4RWHA 3OJDA 1AHWA 2CDEB 4UDTB 5DTFB 2Z8WC 1AFVH 5FUCC 5F9WC 3RY4A 4ELMF 1YEGL 1XR9A 3ZKMD 4GKSB 5LWYH 2HTLD 2W0PA 3P4LA 4X7DC 5C0CD 1CLZL 1ND0A 4JFDB 4QRQA 5D1QB 3GMLB 4ODWB 5D96C 1NUFA 4QY8B 5K59E 2LABA 5KTEH 5CD5C 2DL9A 1DQQB 2X10A 4FOMA 4HPYH 5EA0L 5I1IH 2X1XR 5IB1B 2V2WA 4L4VD 2F74A 2WNGA 2IAND 3TH2T 4U6HB 2W9DH 2E7BA 25C8H 3BJLA 4OZ4A 4DCQA 4P5TC 4HK3N 3TN0C 1I3RA 1TJIL 5JOFB 5GGRA 5HJ3A 4O51B 4OLVH 1AR2A 4S2SB 2AJVL 4Z78B 4M93B 4AH2A 3TO4A 5DZLA 4GRMA 1NCAH 2WUCL 3FB8A 1A6PA 3QDHA 3C6LA 5HDBF 5ERWB 3S36L 2E7LA 3DUSB 3WSQH 1H0DB 3QRGL 5DQJA 3ARDB 1I1YA 3BYTA 3OXSB 3KXFA 4I3SL 1KXQE 1DEEB 3QQ4B 5BRZA 5FDYA 3F7YB 1J88A 2COQA 5JUEH 1I7TB 1UVQA 2FR4A 4RFEB 3AS0A 3L1OL 1NMCC 1AXTH 5JW4M 3DETC 4M43L 3GB7A 3TV3L 5EORH 4GQ9H 3QQ9C 5TH2A 3I6GB 2YZ1A 1XGRB 5F89B 4PRPA 4PJ8C 5EZIH 2X4UA 2V2TA 3MLTB 3B5TA 4X9GA 4YHNB 2AK4E 4WFGD 5LCVH 5ICZA 2CRIA 3MREA 4PJDE 4FG6D 2YA1A 4KQ3L 4N8VA 5FAAA 3ILPA 2XZZA 3D0LA 3MLUL 2HLAB 2MOVA 2R2HB 4HSQA 5JW4R 1OVZA 1HSAB 1H3UA 2YUWA 1T22A 1MCSA 1FFRA 4X7CC 3S5LA 5IF0B 3DX8A 5A2IH 5CJBA 2P48B 4JB9H 4WEBH 5F7HA 5A2FA 4EXKA 5CBAB 1F3JA 4LPYA 3BWAA 4QF1A 3EYQC 1CIUA 3GSOB 4HK0A 4N1CA 2OTWB 5F1KC 1XZ0B 3EFDH 3CIQA 2P8PB 3JV5A 1U3HB 4HG4J 1O7SA 1A4KB 4XMPH 1BFTA 5D71H 2BXYA 1G7PB 5IQ7H 2FATL 3W9DA 4WFFE 4KY1L 4RMWA 2ITDB 3CXHK 4KI5E 1GZPB 5JUEL 5E5RB 1ZSDA 5SWQB 4MS8D 1AXSA 4LCYB 1D9KB 3JTSA 1XGPB 2NY3D 5M94B 3ZKQD 4OGAC 4OD1L 5KSBE 1KT2A 3GSVA 4ODHH