3KNBB

Crystal structure of the titin c-terminus in complex with obscurin-like 1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
96
structure length
96
Chain Sequence
QGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Titin
publication title Molecular basis of the head-to-tail assembly of giant muscle proteins obscurin-like 1 and titin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/structural protein
total genus 16
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3knbB00
4IEFB 2FR4B 4LDEB 3WL9B 3M17B 2H26B 1M6OA 3PDDA 4TOYH 2WUBL 4Z6AT 3INUH 3X13A 2B39A 1W8OA 2VQUA 2B4CL 4NJ9H 3VWJD 4L5FL 1L7IL 4JVWA 5CJOL 5DRZA 2ZUVA 3WLWD 3VI4E 4BKLB 4QY8B 4HWUA 1LEIB 1TJIL 4EXPX 1AR2A 4JLRB 3FFCB 3OJMB 2FJHB 1QPPA 1VDGA 2ADGA 3OJ2C 2X1WL 4ZUWB 2F9BT 2G5BB 4QNPE 4OF3A 4JRYE 2B0SL 3K8LA 4YPGB 4MJ6A 3F7VA 2V9QA 2HT2D 3CFEB 3T2OA 3LQMA 5EUKA 2X4SA 1EEYB 1L9MA 3VDAA 3KG5A 4OLEA 3KPSA 3BP4B 1P2CB 2E8ZA 1GZQB 2Q7YA 3U7AA 1XGRA 4FMKA 5JXEC 1XZ0A 1P7KA 1AD0B 1MIEL 1BQLH 3K1DA 5MP6H 3L5IA 1Q72L 4D0DB 2CO6B 1JYXA 4UOJA 1BZ9A 3QG7L 3ZT7A 1XCTB 1P5VA 5IB4A 3AC0A 2YPVH 5AD0A 3I9GL 2DICA 4MS8C 3QUYD 1I8KA 1I3VA 1MIML 3IAQA 4PJGA 2N7BA 4C56B 2YEZB 4LF3A 1F97A 1E4KC 3KPLA 5IWLA 1I1FA 4HEME 3QISA 2P24A 5DJ8B 1FLRL 1PKQE 3DBXB 1TIUA 3EOBB 5CGTA 1KB9K 5KS9E 3F65A 3O0RL 4BFBD 2OXHA 2JIXD 2ZWLT 2BJMH 1J1XH 3LDBB 2D2OA 2C1OB 2IPKA 1CK0H 5DMKB 4U1KB 2D4DA 4CVXB 3SJVA 1BQHA 1X7QA 4K94L 2QV2A 3NIGF 1N6UA 3L3OA 1DQJB 1HHHA 1XGQB 2MWCA 4WV1C 5HI4C 4ZFZB 2BMKB 2DQUH 3ARGA 4X6DB 4G7YH 1T6WA 3MRRA 4JFDA 1I7RB 5FF6B 2YD4A 3DROB 5I66A 1EBAA 4OV5A 4BFEA 4M93B 2EKJA 3GJEA 1M4KA 1T03L 2FGWL 4Z77A 2ZG1A 1J1PL 2WWKT 4LPXA 5EC1A 5GGSA 4NUGL 4GLRI 3LB6C 4MD5A 3X3GL 3T4AB 3WKNA 4UT6H 4UOW0 1U3ZA 2AV1A 4E41A 2B1HH 1J8HE 1MQKL 1X5YA 3PHQB 1AJ7L 4OUUB 2HFEA 1NKOA 1NDMA 4PB0L 1FSKB 5E5MA 2YBRB 2KZ1B 3QJHA 4XAWH 3FN0L 1BLNA 5CILL 1WGOA 5GISH 4CVWA 3HUJB 3KYOA 4DKFL 4OGYH 2HT3C 3Q0HA 4IRZL 2N4IA 3SGDI 4PGDA 5HDQH 1X5JA 4MB4A 4CUCA 5JUEH 5IFJA 3O45A 4JFQB 1K6QL 4K8RH 1FVEA 4DGIL 4XBGA 3VFWB 4PP1C 1I9JH 3X17A 3M07A 4DKEL 1U95A 5J9PA 5SV3A 4R9HA 1OAQL 3P9LB 4ZNEA 3QI9C 3VXNB 5IHBA 3L3DA 4POZD 2AXGB 4LPCA 3OR7B 2OTWA 3GMRA 1MH5B 5IB5A 1S7UB 1N64L 3U7WH 2GSIA 4XC3L 1CFQB 3ULUH 5HHMD 4KHTH 1MI5E 5DJ2A 3UDWA 1MQ8A 3MV7B 5TE7H 2QLVB 5I9QC 1F4YL 4FTVA 4Y4HD 2P7TB 3VFVB 1X5LA 2QQNL 3BGMA 4WHDA 3CH8A 4HWBA 4HIEB 1H5BA 4HC1A 3MJ9L 1YMHA 1IQDA 2YS4A 3IETB 4OAWB 4QRSA 5DI8A 3RU8L 1ZLSL 1IFHL 1UM6L 3R8QA 5ADOH 2GAZB 4G9FE 2NYYD 3MA9L 1A7PL 2ZSVB 2D7TH 5GSRB 5IEHA 3LHPL 1QO3A 3QIUB 3ARFA 4WEMB 3E3QC 4K3DL 1CFBA 3MJ8A 3S3JA 3HS0A 5ACMA 1ZLUK 3W9DA 2ARJQ 1EJOH 5ALBH 1EV2E 4FQIH 4NQED 4M5YH 5I1CH 1DBBH 3MC0A 4JZNB 4GRLB 4S10A 4H1LB 1N6QL 4RFOL 4LL9A 1ZLWH 2GTZA 1R3KB 1QP1A 2XTLA 4QTIH 3F7QA 3FT4A 3QULB 1L4IA 3RAJL 5D93B 3REVB 1O0VA 3BHBB 4KJPD 5J12C 5HGAA 1BBDL 2HRPL 4G43B 2VDLL 2M8XA 5GJSL 2FJGB 4YHLL 1ZGLP 3TYGL 3FFDA 2Y06H 3GBMH 5EC2B 3TA3C 3R4DA 4ONOA 3ZE2F 2BDNH 4W4OA 4ZS7H 3EYSH 2VE6B 4JO3H 5FA3A 3FT2A 4ERSL 5BVPL 4NO2A 5TPWL 5TF0A 4I18C 5ISZE 3FOMB 2EH7H 3KPRB 3PG2A 5F88B 3UTZA 4OIBA 1JYVA 5HVWA 5GGUA 4FN0A 1KCUH 2PO6D 2PW2B 4RMUA 1KJ2L 2Z8VC 3LIZL 2O5XL 2H2SD 4DOHE 4HLZG 4KC3B 2DQDH 3HC0A 4P46C 3HR5A 2C3VB 1DQTA 1QYGH 5GIRA 5D2LA 1EBPA 1LP9F 5DJXA 4ALAL 1BD2A 5GGVH 2ADJB 2BVOB 4OZHF 3QEGL 3LZFH 4P9HL 3TN0A 1DBJL 1JCKA 2ZCKL 3IB4A 4PJIF 3IDMA 3L5WA 4WUUE 1I3RA 4UNTA 3RTQB 3LCYA 3SE9H 2G75A 4FXLA 5E6IC 3TBWA 5KVGL 3NA4A 4V1DA 3BPLC 2EDLA 1G7MB 5I8EA 1FZOB 2VO5A 5AUMA 4FXGA 5HI5D 2FYYB 2K3TA 3RVUC 1SYSB 1ZMYA 2UVFA 1HSAB 4ONHB 4DWHA 3QUMH 4OZ4B 4Z7NE 1FL5A 1LO5B 4P4KA 1QBLL 1ZA3A 4TNVF 3VCLB 4NQCE 1RUAH 5KVEH 2IGFL 4P9MH 5HI3C 4HIIB 2HRLA 1MRDL 3LSOB 3HI1B 5CSZA 1BZ7B 3EDFA 5E08H 3W82A 5MHSD 3PGCA 4BZ1L 3JSSA 2EDJA 2Q1EA 4QNPF 1XF3B 4FQJL 5KSUA 5L9DH 2WQRA 3EYUH 3GMQA 3IDIB 1UB5A 2P8PA 3X3FH 3UTTA 2CR6A 3BP6B 3O6LH 1KNOB 3OJDA 5HPMA 1Q9WA 5F9OL 4DGYL 4RMRA 3GRWL 5EDXA 5E2UH 1ZS8A 1SBSL 3BUTA 1CDBA 2JLLA 3FAXA 1OAYH 1GAFL 3HG1E 4N8PA 1EEQA 4KVCL 1JUFB 1KJ2B 1QG3A 4M6NL 1RFDH 5C07B 4EBQH 4F2MA 4F7MA 4JFYB 3ZHDA 2L0DA 3EO9L 3V0WH 5CP7B 3MLWL 3QNXA 3RL2B 4P2RB 2GITB 1TCRA 5IBTL 3IXAA 4HUWA 5K93A 4PJ8C 4F7TB 2DQCH 3RVVC 5HHOE 3RWGA 4JHWL 5KS9F 2FD6H 4RAUB 2XWJB 5TE6H 2P4AB 2BSRA 2W07A 3BKMH 4WFHD 5ECJE 1MCRA 5HBBA 4F9LA 2VL5A 5D7IA 1A4JA 3MRPB 2FX8H 2X4PB 3R1GL 3RWFA 1A3LH 2DIBA 4M43L 3RQ3A 3DXAA 4XWOC 4F37F 4WFEE 5CEXB 4YR6A 1RZFL 1Q8MA 3MRLA 4PG2C 1P9MC 3FRPG 2HFGH 2IALA 2XACC 4NQSA 4MZ2A 1IT9L 1OL0A 2P8MA 3BIAX 4ZQKA 4PRHD 3V5KB 4FXKA 3C5SB 2OJZL 3DRQB 3S5LB 1U0QA 4RFNC 2VH5H 4YBLB 2WLYA 4GS7C 4N0YL 4NO0D 1YEHH 4KDVA 1CVRA 3TZVC 1F3DH 1JGDB 4K55A 4L4VD 3B9AA 3KLHC 2MQ3A 3CLFL 1I1RA 4OFIA 3Q5YA 5BRZE 4PRNA 1HYRC 2Y36L 1IKNC 2CRIA 2XZZA 4UQ2B 1MRFL 3GIZL 4O2FB 1QLEL 4POYA 2CLVB 1U3YA 1X6NA 4PJ9D 1R5IA 3D48R 4JRWA 3OKLA 1LE9B 4MX7A 4ZFGH 5D8JL 3B2UC 4LGRB 5CJ5A 2IFGA 1H3VA 5GS3A 2X4QA 4DN4L 2XA8L 1DLHB 4WTXA 3TBVB 4U1HB 3HNVL 3UTSB 5ESVB 3MLXL 4JPIB 43C9B 4XCYA 4DVBB 4QOKE 1ZT4B 5GRJH 3VGHA 1DDHA 1NMAL 3LN4A 1CDYA 1JFQL 4I3SL 1K5NA 1FGNL 4LCUB 5BQ7A 1OP5H 3HAEH 3QDME 4YEFA 4OQTL 1OGAB 1DBMH 3U0WH 3FQTA 4XMPH 1M71B 5B3JF 1WZKA 3GMOA 4IOIB 4AM0A 4E0RA 2E6QA 4PREB 1J05B 1HZHL 3UO1H 3K0WA 3C08H 1EAPA 4UILL 3QIWB 1DQLL 3SN6N 2FCBA 2VXVH 1JPST 3BEWA 5HDOA 5L88H 2GJZB 4O9HH 3L1OL 1JRHL 3ROOB 1N2RA 4WFFE 3C5JA 3WIFB 4Q9CA 1AI1H 4NC2B 3T0EE 1QLFB 2CO7B 2EDKA 4OFPA 2ZCLH 3DX8B 4O4YL 3RZCC 4IIQC 3WS6A 1ZLVH 1IEBB 5HYJB 1T2XA 5DD6A 3MYZA 4BH8A 4H0IA 2OTUA 4G8IB 1MAML 5CMAB 1I9RH 1FHGA 4OF0A 3WE6B 1X4XA 1A2YB 2X7LA 3T3ME 3J8F7 4KY1L 2APXA 4RGNE 3PP4L 4M5ZL 4OLUH 4P2QE 5C0BB 5HTSA 3QWRD 2EIZA 5J13C 5FHAL 2KH2B 1ADQA 4K8RC 5DWUH 3IJSA 3WJJA 4NRXA 1R5WB 3HCVB 5FUOH 3BMWA 1F3RB 1J7VR 1U9KA 4LVOB 2OL3L 1R3IH 1NCDL 5GS1A 3TJEL 4NFBA 4YHYC 2WINB 3TIDA 1QLRB 4FHBD 1UB6A 1HI6B 4M03A 5T1LA 4U6YB 1IZKA 1WCBB 1H0DA 4LSPH 3ULUC 1S9WB 5CZKA 2V5TA 4S1DD 4RCAA 3ZKMC 1KSRA 4UT7H 4BFIB 1MREL 3RDTD 3IDJA 1G6RL 1C8PA 1DP0A 3HNSH 1JPFA 1VPOL 1LO4L 4PJAF 1DSFL 1IC4L 2AJUH 1A4KB 1T3FB 2YMXH 3IF1B 2XT1B 2PCPA 1NANH 3LRSB 4OLXH 4PGEA 3NCEB 1HSBA 4WTZA 1OQOA 5JHDB 1F58H 5JA8B 4M7JL 3L3JB 3QHZH 3JV4B 4DZBB 4JDZB 4LDOB 5BS0E 2JE8A 3KJ6L 3RNKB 3CFBA 1QFWI 1LO0L 1RI8A 2R0KL 4GW4B 5HDBE 1I85A 2XN9B 3OAUH 4KU1A 4TSCL 4KKAC 3BN9C 4CBPA 1G1YA 3PWLA 4U3XA 4W4NA 4QRRE 4F8QA 1S78D 2FZ3A 2XZQH 4I0PC 3EBAA 4JRYD 4LSTL 5D96B 4J12A 4ESKA 2QADD 5I1DA 4H1LG 5CINL 1TXKA 4F57L 5D7JA 3KXFE 2VDML 5KSAC 1MLCA 5EOQL 3HZVB 2B5IC 5B8CB 4ZTPH 1IAIM 4O58L 2M2DA 2OX5A 3P73B 1BQUA 3UTPE 5IESH 2DQEL 2PYFA 1LDPL 1CLZL 3QDGE 4MCYB 3ARDB 1XIWA 1ZVYA 2A83A 2XA3A 4JRXD 4XP6H 1WWAX 1NBVL 3ZHKA 5DEZA 3U79A 5TQ2L 2ITCA 4N5ED 5F9AC 2OL3B 4F7CA 2E5EA 4Z7NF 3VXRE 4M48H 4W68A 2BHZA 3ME0A 5T5FL 1ES0A 2ZSWA 2QSVA 2KKQA 1FPTH 2R1XB 3KWWA 2BVQA 4UMGA 3LN5B 4KAQH 1MCDA 3G08B 1P4LA 4YIQB 3I6KB 5IB2B 4CW1B 4HF5L 3ARVA 3CVHL 5DJAB 5D1QC 1UJ3B 3V5DA 1G6RB 1FDLH 1AGBA 2F54B 3SCMD 3BE1H 5ALCL 5BO1H 4GRWH 1CFVH 3V9FA 1LK2B 3OKOB 4DZ8B 1JGUH 2ZUQB 3EDEA 4NSKA 3GSVB 4JPKH 1R0AH 4FOMA 3Q6GH 4LLVA 4APQC 1MFEL 4LQFH 1RZ7L 4WDIA 1LK3L 4BZ2L 4QCIB 1NJ9A 1N5YL 3S34L 3BGFC 4XGZA 1MCWM 4EXKA 2OMBA 3O4LB 1J0KA 4WY7H 4YO0B 1NGQL 5F1IA 3EYOB 1RUKL 4MA1B 1FVCB 4U6VH 3PV6A 1ZVSB 4PJXB 1WBXA 5DS8B 3RFZC 4JM2C 1ZEAH 3MR9A 3KDMB 3KJ4B 5B4MD 3CH1B 1A6VH 1RVFL 4M1CD 3B9KD 4G7VH 43CAA 3MRCA 1E4WL 3ROLA 4LCWE 2X4TA 4XMLH 1MHHB 4XXCC 3I3BA 2JIXA 4CMMA 3KPTA 5LBSL 3N1MC 1L9NA 1S5HA 4GG8A 4PRPD 1B4JH 1CXKA 4N0FB 4G5ZL 2BOBB 4PJHB 4L3CA 3PWVA 5KANG 2V9TA 2YD1A 2AJZA 4MZ3A 3THMH 2IH3B 5IVXE 4JKPH 4PLJD 3RWIA 3FO1A 4GH7B 2A9NH 3I50L 4OF5A 4HWBH 1KG0B 4D8PA 2IQ9H 4JHAL 4MXWL 5JPNA 3SKJL 1QOKA 2XXCB 1A1NB 3LEVH 1T7XA 5J6GA 1OPGH 3DYMA 1FNGB 1MI5D 3ZDZF 2AP2A 5I74C 1CICC 5I75B 1JGLH 3A6BL 2C1PB 3QEUA 5F89B 2Z0BA 4YC2C 4KI1A 4LKXA 5SX5H 5A40E 1HNFA 4HH9A 5KAQF 2PYEE 1VSCA 3CVHB 1T83C 3MUY1 4I3RH 4XCNB 2EO9A 2J7LA 3RKDD 4G9FD 1HINH 3N1FC 5BJTA 4L8CB 4KJQD 4K2UH 1U8HA 3IT8D 1YC7A 3MA7A 35C8L 3WNMA 1MF2L 3P4MA 4HJ0D 2YD3A 1NCCL 5GHWL 5EH1A 2BNUB 4YXHH 3G5XA 5E7BA 1C1EH 5D1XB 3EUUA 4H0GA 1KTRL 3QUZB 1JV5B 2ZJSL 2Z91B 4LKCB 3S35H 4LEXL 1MJ7H 4X98A 1OT1A 3VG0H 5HHVL 5F6HJ 3L7FA 4HMCA 4GSDL 1YQVH 1EPFA 2XG5A 3C8KB 1FNFA 1KEML 1B4RA 2VZ3A 3OXRB 3WLBA 3S5LG 3G04B 4LLYA 3TO4C 3EO0A 5HY9B 2X9YA 5FCUL 4P3DB 1U3HB 4WI9A 2Z31D 5EIQA 1Q0XH 2NW3A 4Y4HA 1IC7H 1AC6A 4Z7QE 4Z7VE 4Y16D 1W2KT 2PW1B 4NNYB 4ZUUB 2WBJA 1A0QH 3BVNA 4R26H 1T7VA 3NN8B 4YHPB 3EJJX 1F4XL 4TULH 2MCPL 1OAXH 2P5WE 3VD4A 2QKIA 2W0PA 2FJFA 1RAMA 4YWGL 3SDDD 1EUTA 3L5HA 4OD3L 4XB7A 1X5ZA 5GRVK 5FYLE 5MEQB 1KYOJ 2AEIT 3LKRB 4OLWL 1MCPH 5ISZD 4Y0GA 5FKAA 4D3CL 4M7ZC 5E6YA 2IADA 5GRUL 4S11A 4QWWD 3U46A 1WC7A 5FGCB 4XPHH 2BNRE 3D0LA 4NUJA 4ZOAA 5I8OL 4YAQA 3S9DB 3SY0A 1WIOA 3NOIA 4G6MH 2C3GA 3H9HA 1FNEA 3KLDA 4JG1L 5DJCA 4Y4KD 3TFKC 1AO7E 1BVKA 1KJ3H 5DK2A 4WUUD 1P1ZB 4ZO9A 1JHTA 5EA0L 1KEGL 5IBLC 1OT2A 4WHTB 4LIQE 2OK0H 5IW6A 4L29B 4NWUH 3TNMA 4LSDA 4OIAA 2VDQH 3U9UB 5DJ6B 1NAKL 3SHSA 2FL5A 3DGGA 4QRPE 1MFNA 2DL9A 1MFBH 1S7SB 2BRRH 3HC3L 2V2TB 1FYTE 4JFHE 5I1AA 4WWKD 1AFVL 2GUOA 4NQCD 4NZRL 1OAZL 1DANU 5IGXH 4WV1B 2DF3A 2OBGA 4ODBD 4OCWL 2ITDB 1GGTA 5HDBF 5ELIA 2C3XA 2PO6A 5L7XH 4QXUH 1ITBB 3DX6A 3GSWB 2ZNXA 5FIEA 1IAOB 4HUXA 2BNQB 4YHKL 4R2GD 3AY4A 4WO4D 5A2JH 5AWNL 2GHWB 3FFCE 5T3ZL 4FABH 3RP1A 2VLJE 4D9LL 3AUVA 4IRJC 4ZPVA 3V8OA 1QACA 1FFRA 4M6OH 4HJJL 1OVZA 4P59L 3OZ9L 4MDIA 4YDLC 5E4IA 1CG9A 3MUJA 2EDRA 4PS4H 4PJEB 5HYSB 4DAGL 1ZLUH 3C60C 1ETZA 2WW8A 2GTWA 5C08B 4K9EC 3SO3C 4KHXH 1YYLL 5T1DH 3SKOA 3BKYL 4JR9H 4NQXA 3ARED 2DD8H 5D2NA 3OSKA 4ZXBA 3D5OF 2J1KA 4Z5RA 3DX7A 1NGYA 1V3MA 5I1GH 3GSRB 2EH8H 3WNOA 5HHOD 2EXWC 4NC0B 1HIMH 2PXYC 1ROWA 5CZVL 5I30L 2GJJA 1ITCA 4U1NB 3HFMH 1GPOH 5FO9B 4FP8L 1OWWA 4NDMA 4X99A 3G6DL 4MJIB 3QI9B 3GDBA 2KQMA 3IDUA 4OCYH 4QEGA 4WFED 3IFNL 4K07A 1BFOA 3RNQB 3B9VA 1KENH 1FZMA 2AJYH 3E6FB 1IZJA 3ZMRA 3EHBD 5CCKH 1U93B 3BWAB 2VXTH 5FA4A 3OKDA 4QTHA 4ZOBA 4MDJB 3O8XC 4Y8DC 4X6DE 3B2VH 1AE6H 3BO8B 5I17B 3MGTB 1XMWA 2DQHH 2RJMA 4ONFH 5HHNA 2X9XA 4KKCC 5ESAB 2ADFH 1PJ9A 3VMPA 4X6BB 4J1UB 4AL8L 2YWZA 3TIEB 5TDNA 4ENEC 3MBXH 3IYLW 3VXUB 3RY4A 4X4YA 4U31A 3P3YA 4EN3A 2C3WA 2YSSA 1HH6B 5BRZD 4KV5F 5IOPA 2VUOA 5EWIL 1JI1A 4IRSA 1Q9KB 4XP1L 1HHIB 3QH3B 3QWOA 5L6YL 1FBIH 2WMPA 4UAOC 1KIRB 3MRNA 5FFLA 4BSJA 5FOBB 5F7DA 5F1NA 1AGCA 1MUJB 5D70H 4RAVB 3CC5B 2P48B 3HUJE 1OTUC 3NFPA 1NGXA 4UZGA 5JZ7D 2RGSA 5KVFH 4JKWA 4FQXC 4TNVK 1NCBL 4NP4L 3K4AA 4QOKD 1T2QH 2ICEB 4OCXH 5IFHL 4R4BA 5DA0B 3L3IA 4M61B 5GSVA 4RGMC 3QDMD 2DAVA 3MXWH 5J12B 3S4SB 4EDWH 1NL0L 1T0MA 4ZO7A 4QXTA 3ILQC 3UJIH 3T2NL 4PRHA 3TV3H 3WEXA 4QRQA 4OLZH 5C6WH 5FO8A 1ULVA 3TA3B 3QXAB 1FO0L 1XR8B 5I76A 5SWQA 5IT2L 5GS0H 5DEFA 4L4VA 2P42B 4WFFD 3NFNB 3MV7E 2NXZC 2R2BA 1EAJA 2HFTA 1F8TH 2ICWJ 4I77L 5I1HL 3BPNC 3T0ED 3MRFB 3UBXI 1AXSB 4XVSL 4PJ9A 4MCZB 1MAJA 4D9RD 2ZUUA 4P46B 3BW9A 2R69L 5E9DE 2X89D 1G7LB 3SBWC 3CDYA 2HJFB 4LCYB 2MNUA 5CD5C 1OGTB 5HHPA 1LQSR 4RGND 5DRNB 1UENA 1RMFH 2JJSC 4GW1A 3U48A 4TOYL 3SDAD 2DMKA 3INUL 1L6XA 2A6KA 3ZE0E 4PG9B 4NJ9L 2VITB 1FZKB 4TVPH 1EO7A 4XCFH 2CIIB 3TESA 3FMGH 4AENA 5E6IB 3BPLB 3UDWC 5JW4R 3B8YA 4F37K 4Z7OE 5DRXA 3W9EB 4EI5D 3HHRB 3GM8A 4MAYD 3V4PL 3TYFB 4DFHA 1T5WA 3QPXL 4R4NC 1G9MH 4PJ5D 1L0XA 4PJDA 2ZPKH 3P2TA 5H94B 1NAMB 1G0YR 1W0YT 2CSPA 3MMEB 5DTFA 3O6FB 4Z7QF 3GIVA 3D87B 1I9EA 1BQLL 4PJCB 5MP6L 4AT6B 3O2DA 3C9NA 3FOLB 1X5AA 4XNYH 2IPUG 4ODHH 1JWUB 4P3CL 4JHZA 3CDGA 4Z7UE 3SDYH 1TITA 3CPLB 4QO1A 2XY2A 5BS0D 4B53A 4D9QE 3U4BL 4KROD 5C2UB 4L3AA 3U9PL 1G9NH 3QG6A 3QWRA 4UT9H 1KCLA 4QRRD 3NIDE 4PUBH 4PGZA 2DDQH 1RZKH 4KUZH 1LP9A 2O5YH 3DVNA 5SWZB 1J0YA 1PG7X 1J1XL 2IANB 3QIBD 3C8DA 2CKBA 3NZHH 1BJMA 3KXFD 1CK0L 4OZHA 3VFOA 4X5LA 3S37X 1PLGL 4IOFC 3VRIB 1LO2H 4PJIA 5DZNA 1U8QB 2EDEA 2VXQH 3VFMA 2DQUL 2YR3A 4G7YL 3T04D 4JG0H 4U7SA 3UTPD 4ELMB 2DBJA 3OWEA 1JK8A 4KZEL 4NNXB 5CHNB 2EDQA 3QDGD 4W4OC 5D71L 3GMMB 2GSGB 3OKEA 5DSCB 1AY1H 3CU1A 4I9WE 3H9ZA 3S8WA 3UYRH 4MB3A 4UT6L 2J8UB 1N7ML 5EO1A 5HGBA 1CE6B 5D1ZD 1RZGB 1E0OB 3DUHA 5ID1B 2VC2H 3QFDB 1OTTC 5C0FB 4ZAKC 4XAWL 4XPGH 5GISL 4DQOL 2IEPA 4QGTA 5FM8A 4XMKH 5D4QA 3FTGA 4JRYA 4G8GE 1Z2KA 5IQ9B 4M4RA 3GBNH 5CUSH 3ZYIA 5F7WC 3H9SA 5BMFH 4GS7B 3A6OA 5SWSE 5JUEL 3QUKB 1O7VA 3TZVB 4K8RL 4CN4A 3M45A 1KPUA 1A3RL 4KKBC 4M02A 2LQRA 5D9SA 1WFTA 3KPNB 3RA7L 5E24E 4OB5H 4WEBH 1RZIB 3HMXA 4UDUA 3RL1A 4GMSL 5DUPH 3H0TB 5F9JB 5JLZB 2E7LA 4LSUH 3MRDB 2A73A 2LU7A 5GRXG 2I07B 2CR3A 4JRXA 3HKFA 4D0CB 5MENB 4NFCA 5C0GB 5C07E 2H6PA 1TJHH 5HSFA 4UIMA 2VLKD 3T3PE 4NNPH 5GS2H 3RWDB 3DI3B 1PKQA 3AM8C 5KS9A 1IAIH 1KLUA 2VZUA 1CIDA 3O2WH 2CMRH 1KIQA 3F12A 1H3XA 4GFTB 4LCWD 4LHJB 3MACH 1JMZA 4G6FB 3VXMB 2MQ0A 2Q87A 4F7EA 4QHNA 4FFWC 5IKCA 1NEZB 2CRMA 5ADOL 2DKUA 4G80B 2H32A 1X5KA 5IMKA 2YUZA 5MEPB 2D7TL 3VGBA 3MLPA 4NHCL 3WHE1 3LS5L 4JDTH 3B3IB 4NM8L 3SCMA 5F96H 2H45A 2BY0A 5KSVA 2BY1A 3PF2A 3VRJA 3AU1A 3VWJB 4GXVH 4ODSL 1RUQH 2AKRB 1EJOL 3MRMA 1WIPA 1BX2B 2M1KA 4M5YL 5I1CL 1DBBL 4X6DF 1UZ8B 2E6JA 2Z4QA 1QFOA 3FB6B 4WW2C 3GHBL 3TCLB 3RZCB 4IIQB 1G7HB 1AQDA 5HYSG 3L5XH 1A7RH 3IKCA 4QHMB 3KYAA 1HYSC 4HUUA 2HH0H 3ARQA 1MLBB 5EBGA 4DVRH 4KQ4L 4X8XA 5DFVC 3UAJD 2DM3A 1S7QA 3QZWG 1WBYB 5L2KB 4OT1H 3EYQD 3B9KA 5J13B 4P5KB 4Z0XA 1UACH 4M4PA 3SGEH 3GBML 3RVTD 4NT6B 3MJ7A 4PRPA 3HUJF 4ZS7L 1IGYB 3EYSL 3HRPA 4M3JA 4RDQG 1TQCC 2R1WA 4YHYB 1EUUA 3BKJH 4XVJL 2O61B 3KPQA 1P7HL 2MMXA 1IEAB 2QR0B 2JB5H 3FQXB 1TJGH 4U1GC 3LEYL 1MFAL 3VFTB 2JCCE 2I5YL 3BH9A 4QHLA 3WIIH 3MLRH 1EJ6A 2BXYA 4ZDHA 1VGKA 2DQDL 4WCYH 4NRZB 5ILTH 5DHYB 5IIEB 3ULSB 3WUWB 1FE8H 3MLYL 3WFBH 1OGAE 5LKNA 1MI5A 5H8DA 1CU4L 5GGVL 1G7PB 4X7SH 3MOBL 4JPWH 4AH2A 1E27A 4X5XA 5EOTB 4PPTA 4HW6A 1OM3L 2AQ3A 1Z5LA 4KMTH 1PZ5B 3U36B 5KTEL 2V5YA 3RVXD 4U1JA 4HS3B 3SE9L 3GMNB 1OY3B 3SPVB 3GSQA 4JFFE 3ZKSD 5I18H 4HIJB 2P44B 4NZTH 4P48A 5EPMB 1FQ9C 1ND0B 4NOFA 3W2DL 4I0PB 5CJQH 5DZOA 1JPSH 1CCZA 5HYJE 5EBWB 1M05B 3QUML 4S2SB 3V5HA 3FN3A 3FB7A 1XGPB 5GGTA 4ETYA 5KSAB 1EERB 2Y72A 1K4CB 3K2UL 2BNRD 4YXKH 2B5IB 4DTGL 1H3TA 1RUAL 3P4LA 5C2BL 1ZWIA 3F7YB 3ZE0F 4F9PA 4P9ML 1T1XB 3PWPA 5LGJB 5C0BE 5ITFB 1RK0A 4PY8I 3S36X 5E08L 2ZOKB 4ODVL 2VDKH 4HZLA 3VI3F 3ARZA 3LPGA 1MCQA 1P4IH 1IARB 5BXFA 1AO7D 4MA3A 3A6CH 4XNQA 4XAKD 1XR9B 3DGCR 2DLFH 2CXGA 2Z31A 3X3FL 3WS6C 5F7KC 1OP3H 4HPYL 1K3IA 2BC4A 5GS0C 4PJAA 4P4RB 3HNTH 5EU6B 2OTPA 4XTRD 4X5WB 1OAYL 2BXZA 4QRPD 2NY0C 3SDDA 5DF0A 1IL1B 5IM7B 5HHMB 4KDWA 5EBLB 4HHAA 5EZJA 1RFDL 4HKXA 1FYTD 2R39A 4JFHD 5ISZA 3EJZC 1JNHB 1JPTH 3HZYB 5D1QB 3VH8A 3Q6FA 1BP3B 4Z78A 3BX7C 1F6AA 2D03H 5JHDE 2A0LC 2E7CA 1OSPH 4Q2ZA 4HJGB 5GS1C 2BZDA 3BH8B 2XN9E 1A8JH 4OI9A 5D7KE 1BWWA 2IQAA 4APQB 1IAKB 3T09A 4LCIH 1H8SA 2DWEA 3FFCD 3BKML 3BPOC 4HUKB 4URTB 3GSNA 1GOGA 4PLKC 1KXTB 2AI0H 2FX8L 1I3GH 1L7TH 1TZHA 1A3LL 4H8WH 3BGFB 1RJYA 3LY6A 2EDHA 3VWKD 4QXGH 4WUUA 3TT1L 3TWCH 2UYLB 4NQEB 4DGVL 2IG2H 5HYQA 1LEKB 2HFGL 3O3EA 1AKJD 2AEQH 4JM2B 5BZWB 2VIRB 3QUMB 3G6JE 4FQQB 2RHEA 3EYVB 4J7RA 3KYKH 1A9BB 4R3SB 4QRTB 3ELAT 3HPJB 2BSTA 3K46A 2VH5L 4OGXL 2YZ1A 1T0NA 3PGDB 1YN7A 1I85C 4OCRH 1CYGA 4O02H 5DGQA 3OHXA 4EJ1C 3BP5B 1HQRB 4WWKA 4MYWB 4WVRA 5FECB 4FS0A 4NQCA 3MLZH 5EN2A 4TYUA 8FABA 3L6FA 3MZGB 3MREB 4NZUH 5IHUH 2QSCL 2P5EB 4JKMA 1CXHA 5D7JC 2NZ9C 2DIJA 3UZVB 5J11C 2AJXL 4ZFGL 1RHHA 3HZMB 4WO4A 5F21B 5M94B 1E28A 2I60L 4Y19B 2MCG1 3I84A 3UROR 2BOCA 4M7KH 2NR6D 5FGSA 3V6ZB 5I74B 1CICB 3MLTB 1UVQB 2F54E 4YC2B 3NCBB 5GRJL 4Q58C 1XIWC 4JJ5A 3EDDA 4F15C 2ZCHH 1XT5A 2C5DC 3BAEL 2HLAB 5IROA 2LE9A 4IMLA 2IAMC 4G9DA 1CGSH 1EFXB 1DBML 3VFUA 4ODTH 2BVEA 1YPZE 1WZ1L 3EOTH 2FWOB 2JJTA 3AREA 3UO1L 3U2SB 3C08L 2VXUL 1UKQA 2VXVL 3TO2A 3O4LE 2JB6A 4O9HL 1JWMB 3TH2T 1KGCE 3T3PF 4MJ2A 4HMEA 4QHUB 1A5FL 1ZT7A 1LE5B 3MRJA 1AI1L 3ZTJH 2ZCLL 1EK3A 2FIKB 3WXVL 3NAAL 2FO4B 4ZYKB 1S7WA 3F58H 3QDHA 1I9RL 4PJBB 3FO2B 5EFIA 3DX9A 5FDWB 2X41A 4R96A 4C83B 4ELKB 3IAGC 3TO4B 2JK5B 5EUOE 4WJ5A 2G60L 1A6AB 3VG9C 2PTVA 4HFWB 1MCBA 3TJHD 1UH4A 4EDXB 2YC1A 1JHLH 5DWUL 1DBKL 1JRHI 1MY5A 5FUOL 1BHGA 2VABB 1CGVA 4MJ5B 2EDBA 2G9HA 1KJVB 5F6IB 1E6OL 2AXFA 4X7TA 5BRZA 3MV7D 3WJLA 1A9EB 4NN7C 3LKSA 4X4XB 3BESR 4LSPL 3D25B 3MNWB 3BIBX 2AERT 1N5AB 4YNYA 4GBXC 4K9EL 3QPQD 3STLB 1ZA6B 5HJ3A 4UT7L 4YXLH 3WS3B 1CQKA 1DVFC 5KG9A 3HNSL 5E9DD 1CD9B 2ZG3A 1QPXA 1N3NA 4OLXL 3VFNA 1J5OL 2HMID 1NEZG 3DHJA 1KTDA 2AJSH 4OGZA 1TVBB 3T1FB 3QHZL 3QIUD 5C8JA 4QOKA 4GXUN 1TENA 1LNUB 3ZDXE 3KNBA 5CJXA 4QT5A 2FSEB 3C6LC 3U0TA 2UVEA 3OAUL 5GRYA 4PY7A 5GZNC 3QDMA 2SEBA 3QB7C 1A02N 4L8DA 4GRLD 3A67H 5MERA 4JFEB 5DC9B 5HHQB 3K7UA 2XZQL 5KJRL 4RMSA 1FZJA 1OHQA 4HK0B 5DQ9A 3VE0A 1ORSA 3O2DH 2EXYD 2MSPA 5JHLH 4Q9QL 1SEBB 1KIPB 5JORA 3GSXB 1FNHA 3HI5H 4PB9H 4RX4D 2VISB 4WI3A 5E5RB 3V0VB 1HILA 4RA0C 3BSZH 3GKZA 4JO4H 5HGGS 3RJQB 4C59B 4ONGH 3C87A 2YUVA 1LILA 2R2HB 4S1SL 5IESL 3BEVB 2NY2C 5C0ND 1A7QH 3EKCA 3V6FA 3LQAC 5F93C 3ARBD 3ETBF 2V5MA 3D6GA 2XWBB 2QQQA 1V3KA 5E0QA 4NO0B 2X89A 3GFUA 4XP6L 4ZSOE 3SE8H 4D9QD 5J1TC 2CKBH 4IRJB 4OLVH 1NMCC 5DMYA 4NHUA 1I7TA 3MROA 3MYJA 4M48L 3WXWH 1NBYA 1YEIH 4YDLB 1RHFA 3H3BC 5K9OB 4OKDA 5I1LA 4DK3A 2KQNA 1KB5A 4HSQA 4QF1B 4DEPC 5GGRB 3DO7B 3C60B 2QEJA 5ANME 5JW4N 4U6TA 3WSQH 1M6OB 2KL6A 2V7HA 3JUYA 4XBPB 3IU4H 4ZUTA 3SO3B 1KELL 4MAYA 1AIFA 4NCC1 4Z18A 3SOBH 2V2XA 1RK1A 3ORJA 2WBJC 4PJ5A 4PP2A 3WUWG 4LLUB 3CSYB 1FDLL 5BO1L 3BE1L 3QHFH 4ZFFB 1MHEA 1CFVL 5E4EC 1YMME 2ZOLA 3CIQA 4FQCH 4OJFH 3RTQD 2HVJA 3PIQA 4JPKL 2PXYB 1R0AL 3Q6GL 1CGXA 3F7VB 3D3VB 4LQFL 2IBZX 5I16A 1U58A 2GK0A 4K71C 1CFSA 3JTSA 1JF1A 1HDMB 4WY7L 3QCVL 1G7IB 4J8RA 5E8EB 4JANA 3LPWA 2RAMA 2Z93A 1T89A 2YUWA 2BCKA 1FH5H 2J2ZA 4KRLB 1BZ9B 3O8XB 2R0LL 4AIZB 1A6VL 3VFGH 4QRRA 4P5MA 1IBGL 4XMLL 3T77B 1KT2B 2B2XL 2EZ0D 3HMXH 1OARL 1OD7A 4I5BB 1JF5A 4PJGB 3OAYH 3QIBA 5H2BA 5JW4Q 2BNQE 4NJAH 2RFXA 4PJ7E 4XNUL 1R5VB 3P4NA 4CU8A 3IFOA 4ZFOA 1D5XA 1KB9J 5E8PB 1D6VL 3THML 3QDGA 2GYSA 4OFDA 1FCGA 4UAOB 4N1CA 3M1BA 4FQ2H 4X7FC 2A9NL 2IPKB 1CDIA 3V52H 2DMCA 2IQ9L 4PJEE 1X7QB 3LEVL 2OR9H 2XKSA 1TVHB 4OGAC 5E8OB 3CFJA 4LSRH 5C08E 5C07D 1KYOK 3ET9F 5C0EA 1XAUA 2XNAA 4FQXB 1I7UB 2H32H 3IGAA 4KK5D 4P2RD 5D1ZA 3ZDYE 5I73C 4M00A 4EUPH 4XPTH 4O2EA 5ICZB 3UCRA 4LARL 1FAKT 2CGRH 4I3RL 4N0UB 1K8IA 1VESA 4L1DA 2VZVA 2AV1B 3HRZB 4HIHA 1HINL 5I8CA 3CZFA 4PGBA 4U7KA 5KOMC 4LQ1A 5CZXD 4QHKI 2HFEB 2YRLA 4I2XA 1NDMB 2W9DL 4K2UL 4UQ3A 1AR1C 2AAVA 3MOAL 2WIIA 1UWXK 2J6EA 1WT5A 1C1EL 1GOHA 5JO5A 3MUGB 5EIVA 1WQVT 1HHJB 5I19L 2NXZB 4H8WC 3S35L 4AYFA 4U1MB 3BPNB 4OM0H 5FYKL 3GI8L 1MJ7L 4MWFA 4K3EH 4ZXBC 4EVNA 3OKMA 1JWSA 3D9AH 4JQVA 1AGFB 1YQVL 2QADB 4JB9H 4Q9RL 1HXMB 4JVPA 1I7ZA 1EGJA 2NW2A 3ZE1E 1PZUB 5K9JH 4RWHA 1JHKH 1UEYA 3VXUE 2ADIA 4JY4B 2VLKA 3QQ9D 4OFYD 4JDVB 4NRYA 3X14A 1GGYA 4YHNA 5JDJA 3L7EB 1A0QL 5IB5B 1DFBL 1MEXL 4LCWA 3I85A 4TULL 4PJXF 3MNZB 1ZHBA 5FOJA 2YOCA 1TVDA 4NC1C 5DMIH 3MCKB 4L9LC 3CXDH 5I6XB 1MCPL 1OAKL 4R7NA 3FB8A 5GZOC 3IDGB 1WFNA 4LVNC 4RZCA 1NFIA 4H20H 1SJVA 4JQXC 4LCCB 1VFUA 5CEYA 1UZ6E 4JZJC 1J11A 4PJHF 4RFEA 2B1AL 3RWJA 4P2OC 4FQHA 2QHLA 4EN3C 4EQ3A 4JAMA 1OGAD 4KPHL 2J12B 4IRSC 1U8NB 3SKUD 3HS0B 4NQVA 1S9VA 2X4UA 3QIWD 5JOFB 1KJ3L 3GK8H 3SKMA 3G9AB 3QEHB 4MD4A 4BSWA 1UM4H 4LFHG 4JFFD 5GGTH 4M6MH 4UIKL 1RJZA 2OK0L 4IBLT 2FX9H 3HLAA 3T8XB 3OL2A 1AGEA 1H3PH 4K7PY 2CDEA 1HHGA 5SV4A 5HYJD 3DRTA 5ICXB 4MGXA 1H8OA 5JW3H 1INQB 2VDNH 3TH3T 4LLQA 1J8HB 5JR1L 1U8OA 3OB0K 2BRRL 3D1MC 1NMBH 5HGAB 2X1QA 2W0FB 3FJTA 5C0JA 3L95A 2HLFC 3S96A 4UOW1 5IGXL 1CFTA 3ZDXF 2I9LA 4ZOCA 5C0BD 3TPUA 4MAUL 1EDQA 2LVCA 4HPOH 1KCVL 1CLYH 3MRBA 3HB3D 4RGOH 5E2TL 4WI6A 5LGKA 5K59E 2DLHA 4MXVE 3PWNA 5IMMB 1HKLL 5IFAL 4BK4A 3BP7B 1BEYH 3VXPA 4FQLH 4RBPK 1ZTXH 5J06A 2V2WA 4M6OL 3IFPA 5ERWB 2XTJC 4W6YB 3KLAA 3KPMB 4XCCH 3GMPA 4PS4L 3H7BA 4ZAKB 3KS0J 1BD2B 5IB1B 4PJCE 3MO1A 4R4FL 4KRNA 2R56H 1CI5A 3ARSA 4EOWH 3LKPB 3CX5K 2MFNA 4H25A 2QTEA 4RISH 3BDXA 3SGJA 3GSNH 1JN6B 2FBJL 1ZE3C 1QSEB 5TGBB 1ORQA 3I02A 4LVHC 5JHDD 1YA5A 2I26N 4KMQA 4RQQA 3WNKA 1INEH 5I1GL 4GRMA 3DECA 2BNRA 2YD2A 5DD3H 2EH8L 3ES6A 5ID0B 1UXSB 2XN9D 2AGJL 3X11A 5D7KD 3L3KA 3HFML 1GPOL 2Z92B 3D39B 2VWEC 3G5ZB 4G9FB 1A6ZA 1UQSA 4ETQB 1AGDA 4JHBA 2DQIH 5SWZE 4OCYL 1AQKH 1M7DA 4I1NB 1UCBH 1AO7A 5GGVY 5EO0A 1J18A 4WWID 5CCKL 1UXWA 2XWTB 4HCRA 4X80H 3QEQB 3L5JA 5TF1H 4HAFA 2GT9A 3G5VB 1XF1A 1VFBA 2YPKB 3O3BB 1NGZB 3B2VL 2UZXB 5IK3A 3PXJA 5DQJB 3ALPA 3ARDD 4QRPA 4U6XA 4EEEA 3CU7A 2P8PB 4F7PB 4Q6IC 4U05A 2FR4A 3WL9A 4KTDL 1RIVH 2H26A 4L8SA 5I1KH 2AABH 4FMFA 1JPGB 4BKLA 1FJ1B 3UC0H 1U91B 4WGVB 4AEIH 1LEIA 1UKSA 4WW2B 5D70L 4JLRA 1JTOA 4JGMA 2FJHA 3JV5A 1U8MB 4HKJB 5LQBL 1G7JB 1FCCA 4ZUWA 5BW7A 1QR1A 2G5BA 3NFSH 5CD3B 5KVFL 4YPGA 3ARXA 5EOCJ 3CFEA 2C9AA 4WHYG 3RWGB 3SKNB 2F54D 3FRPA 1EEYA 1T2QL 4OCXL 2NXYC 3BP4A 1P2CA 1T6VN 5F7YC 4HKZA 4Q97A 1GZQA 4DOHB 3ILPB 3FL7A 4IM8A 2NY3C 4EDWL 5F3HA 1FNAA 1ZHNB 4D0DA 3M8OH 3TV3L 1JP5A 3K8KA 5C7XH 4PJEF 1OD9A 4KXZI 4NWTH 5D7LA 4CJ1A 1S7XA 4RAHA 5F72S 5DO2D 1XCTA 2D0HA 3BD3A 5T33H 1RUPH 1S7VB 4Y4KB 3BZEA 5EO9B 1DBAH 1TQCB 3O4LD 4S1QH 5GS0L 2D7NA 5MENE 1JI2A 4C56A 2YEZA 2P8MB 3ZDYF 1GCFA 5DUBB 4FXKB 3GKWH 4HUVB 3DTXB 4U1GB 4KJYB 5DJ8A 3DBXA 3EOBA 3T0BA 5AYUH 1OAUH 3OJVC 3UJTH 3BXNB 3WHE0 3RGVD 1QNZH 4EIGB 5KOVC 3RI5F 3VXME 3RZWA 3WBDA 4BH7B 1YEGH 2C1OA 4PRNB 5DMKA 3ZL4L 4YHIA 4U1KA 1KLFA 4CVXA 2VDOH 4Z0BH 3VFPB 1TQBC 2JKXA 1ED3B 4FZEH 2CUHA 1DQJA 1XGQA 2E7LC 4ZFZA 2BMKA 1YECH 4WUKH 4X6DA 1XF2B 1FV1B 1LDSA 1I7RA 4C4KT 5FF6A 3DROA 1PY9A 4XCFL 1NKRA 3NCJH 5D6DA 5M95B 1IQWH 3FMGL 1IGMH 1FL6B 1UEMA 2R2EB 3EJYD 4WNQB 4P0DA 2HTLD 3T4AA 1Q94A 4H5SB 1DDHB 3ZE1F 2ZPKL 4NBXB 4FFVD 4ZS6C 2D7OA 2CH8A 1ZHKA 3PHQA 3DSFL 4OUUA 5ACZB 4KTYA 1IGCH 1BBJB 3GNMH 2YBRA 3HG1B 5JXAH 1KTLB 3HUJA 1X4YA 1LO3H 4XHJC 4F3FB 4XNYL 1VB9A 4ODHL 1YEEH 4S1RH 4G6AC 3N9GL 3D85B 3P30L 4JREC 3SDYL 3RUGB 5JMOC 4JFQA 5HHOB 5D1XD 3WKMH 2RCSH 3ESVF 3VFWA 3BQUC 1WF5A 3JWDH 3ZSTA 3QUZD 4Q7DA 3UMTA 5DD6B 5INDB 5FO7B 1HQ4B 1TNNA 1BM3L 3TGXA 1ZSDB 3IFLH 3FZUD 5L8LB 2DDQL 3ULUE 3P9LA 2B8OT 1T1YB 2DJ4A 3BZFA 3VXNA 2AXGA 4YHMH 3OR7A 1PSKH 2NY0B 2F19H 3FN9A 1MH5A 3KHQA 1S7UA 3NZHL 3RWHB 5CIPH 1CFQA 1S3KH 2XV6B 3WD5H 3MV7A 1SYVB 5J1AB 2P7TA 3VFVA 1DTUA 1QFHA 2CD0A 1KC5L 1D5IL 2EYRB 4XWGL 3KPOB 2W92A 5IMLB 5IV2B 1VENA 4KKNA 3IETA 4OAWA 4Y4FA 1KB5H 3FKUS 1JE6A 5B22A 3NABL 3BPOB 2GAZA 1AC0A 2Y25A 1VADB 1R3HB 2HVKB 2ZSVA 1CXEA 5GSRA 4HK3J 3QIUA 5TJWK 4JN2B 3CVIL 2A6JB 2JTDA 2DMBA 4LSSH 5JXED 3PL6C 1I8MB 1HH9B 4JZNA 4GRLA 2XOTA 2D3VA 3KGRA 4H1LA 3QRFM 2R4SH 5A16B 4XMKL 5F7NC 4RMTA 1GZPB 1R3KA 3GBNL 5CUSL 4I3GA 4YDJB 3CFBB 4AIOA 3QULA 4MXVF 5BMFL 5E03A 2CUMA 4RX4A 1IILE 4DKAA 4MS8D 2KDGA 5GGRY 3WO4C 1YMMD 2O26U 3PDOB 3REVA 1G9EA 2R29H 1V3JA 3BHBA 1F6FB 1UWEH 1WWWX 1QSFB 5I1DB 4G43A 4HQQL 4HUNB 2ATKB 2FJGA 1RJCA 5D7JB 3WHXB 5J11B 3QUXB 4AEHL 4J6RH 5BV7H 1E4XH 1U8KB 5EC2A 1PYWB 5A2IH 4PV8B 2VE6A 5CJBA 1WZLA 5HGHB 4OIIL 3QNYB 5IR1B 1TJHL 1W72L 2GEEA 4NNPL 3KPRA 5DHXB 5F88A 1IM3B 4LLAA 5HI4D 1MPAH 2YD9A 4CADA 1IAIL 2PW2A 2CMRL 3VGAC 3MCLH 4LOUC 4GKZB 1X6LA 4OUOA 1QTYT 2IAMB 1KCSL 2C3VA 2BNQD 1B88A 5I15H 4Z8FH 3PNWB 2DI7A 1IAMA 4NBYB 4OF7A 4TSAL 4B7LA 3LB6D 3LS4H 1DJSA 4RGNB 3MJ9A 2ADJA 4ISVB 2EC9T 4JDTL 3SDAB 2BVOA 5F96L 4P2QB 1ES0B 4GXVL 1RUQL 3H9YA 3TP4A 1YEKH 4XP9L 3RTQA 1P4LB 4ELMF 1J86A 1G7MA 1FZOA 1PBYA 4YBQC 5CBEB 1CVSC 4X6FB 4J3UA 5C08D 3L5XL 1A7RL 3LMJL 2HT3D 5EG6C 2FYYA 2OZ4H 2RB8A 4UTBL 1SYSA 3VD9A 1HSAA 4JY5L 2XRAH 4GQ9H 4ONHA 2R15A 2DQJH 3LQAL 2J8UF 2ESVB 3MRIB 3VCLA 2V5RA 4PP1D 3VG9B 4TRPH 3ISWA 1MJUH 4HIIA 4TNWF 3HE6C 4RWYL 4XGZB 2FRGP 4U0RC 2EYTB 1A6PA 1UACL 3HI1A 3QI9D 4OZIE 1BZ7A 4MNHB 2APTA 5CP3A 1QZ1A 1KFAH 4Y5YC 3GHEH 3KYMB 3Q5TA 1NLDL 4R7DB 4Y19E 1EGJH 3IDIA 2JB5L 5ACLA 3B5HA 4NN7B 1TJGL 3BP6A 4GAJL 1MVFA 1KNOA 5EU7E 3UTQB 1S9XB 1KUMA 4GBXB 2A6IB 3WIIL 4EKXA 3GO1L 1X3DA 1W72B 4WCYL 1DVFB 2I9TB 4K3JL 5ILTL 5L0QC 1HE7A 2YD6A 2YN5A 3KXFB 5LCVH 1FE8L 3WFBL 4M3KB 1JUFA 3VXUD 1KJ2A 4X7SL 2AJZB 1L6ZA 4JPWL 4IOSD 5CP7A 3P9MB 3RL2A 5D7SH 4P2RA 2GITA 4KMTL 4OD1L 1MWAL 1QVOB 5T3ZD 2FX7H 4F7TA 3C6LB 2DTML 2IFFH 1Z6JT 4YUEH 1CL7H 4XVUC 2DQTH 1IMHC 3DUSB 4RAUA 1CT8B 2XWJA 1MAKA 2GIYA 3BUYB 4I48B 3DVIA 4R90H 4PRDB 3ARYA 5CJQL 5CEZH 1JPSL 3CJJA 5C09B 3MRPA 5DK0B 1FC2D 2X4PA 1T7ZA 5CEXA 1FAIH 3VXRB 2CKNA 2WBKA 1EMTH 3V6OA 2FNBA 3FONB 3VH8G 4YXKL 1SBBA 4GQPH 3MFFB 5C9JB 2OSLB 3MLSL 2J4WH 4PIRF 1H15B 2NY2B 1PG7L 4GAFB 3V5KA 3C5SA 2XZCH 3DRQA 3S5LA 1P4IL 3TA3D 4KRPC 3A6CL 2X4RB 4KWUA 4UV7L 1I8LA 3Q48A 2IJ0C 3GB7B 1JGDA 2E8YA 2KZWA 4OFYA 2WNGA 4UQ2A 4O2FA 2CLVA 4X6EB 3HNTL 1QR4A 4HLZH 1JF6A 1LE9A 3CLEL 1RZJH 5JIPA 4P46D 2EO1A 4CNIB 3GRWA 3EFDL 3U0PA 3MZTA 2DJUA 2VN4A 1DLHA 2WBJB 5TFSL 3TBVA 4U1HA 3UTSA 5ESVA 1SEQL 4JPIA 3QAZC 5DQDL 4DVBA 1F13A 1ZT4A 4OKVB 3VXSE 5E4EB 4NZDA 4LPYA 4GKSB 5E94B 3VXOB 3BI9X 4UTAH 1I1AC 4LCUA 5E6ID 2XPGB 1KN4H 1TLKA 4LCIL 3N1GC 2DL2A 3O9WB 1MWAB 4JFEE 5FKPB 1M71A 2AI0L 4K71B 1I3GL 4IOIA 4N1HB 4TSBH 3B8SA 4PREA 1J05A 3IDNB 4H8WL 4JE4B 3D0LB 5J3HC 3QIWA 3P11L 5FYLL 5IVXB 3SY0B 2GJZA 5IW3A 3BDBA 4HXAH 3VDBA 3ROOA 3G5YB 2E7MA 4FFYH 1WTLA 3WIFA 1UWXH 2F58H 1FNEB 1N8ZA 1JYWA 4KDTC 1U41A 1QLFA 2DI9A 4LP4A 3KYKL 3DX8A 5HI3D 2AQ2A 5DD1L 2WWMC 1IEBA 1IGIH 5FYJL 4G8IA 3WFHB 5CMAA 1F42A 4O02L 3WE6A 1A2YA 3RY6C 5C70A 2PYEB 4IS6B 3MPCA 4C4KO 3MLZL 4HCRH 4PLOB 5C0BA 2IBGA 5IHUL 4NZUL 2BVPB 1OWRM 4XPFL 3JWDC 3STZB 3HCVA 1R5WA 1BOGB 1QRNB 2E6PA 3FO9B 2FEDC 5SWZD 5ITBH 5JQHC 1IE5A 2F74B 4LIQL 2IAND 4F8TA 3CCHB 3QFJB 2MKWA 3TT3H 3Q3GA 2VJXA 4FG6C 2WINA 1QLRA 2VUYA 1PFCA 1HI6A 4BQ8A 5F1SA 4GUPB 5DJZB 4U6YA 2NX5A 1WCBA 1J1OH 4MMZC 1FLTX 5I73B 1T4KB 4JY6B 1S9WA 2FB4L 4IDJL 4PJ8D 1NQBA 4M1DH 3RVVD 4TPRH 1KPRA 2Q20A 2AVGA 3SGKA 5FM4A 4BFIA 2GY7B 1OLZA 3O6KH 4ZPVB 4FQ1L 1CGSL 25C8H 1A4KA 3D3VE 1T3FA 3IF1A 3EOTL 3LRSA 5D5MB 3KPSE 4MDIB 1CD0A 3IAPA 4L4TB 5JHDA 4Z7VB 3ARUA 4XWOD 3L3JA 4OQTA 4D94A 1RIHH 4DZBA 4JDZA 5F7EH 3PGFH 3EDJA 2P5WB 4GW4A 1QA9B 1X9QA 2XN9A 3QXVA 4KK8C 1F90H 2ZUSA 1MY7A 2QHRH 3UPRB 1Q0YH 1PY4A 4JCMA 1NUDA 1JGEB 1LEGB 1YJDC 5JQ6H 3HI6L 4PJGE 3SQOH 4I4WB 4HV8B 4MVBC 4WEUD 1EXUB 3TZVD 1CBVH 4HBCL 3HZVA 4LASL 3KLHD 3L9RB 5B8CA 3KLSA 4JPVH 2W0KA 3P73A 4U1IB 4K7FB 2M26A 2YK1H 4MCYA 1MCWW 2VMFA 4AG4L 5LXGH 3ARDA 4JM2F 4Y88A 2VLMD 4L9LB 2L7JA 5F9DC 2VSDA 3B2UD 5FA4B 3VFSB 4QTHB 1T22B 5MEND 2XFXB 5BV7C 4HFUL 4XNMB 2OL3A 4G8EA 4LVNB 1I8IB 1DL7L 4RBPH 5E1AB 4JZJB 1MVUB 1FFQA 1G7QB 4OF6A 4P2OB 2R1XA 4N0UE 4X4YB 4G6FD 3VXMD 3LN5A 4EN3B 5C0RL 4R0LC 3TVMC 4YIQA 5E8DL 2YD7A 1FYTB 3I6KA 4E41E 4CW1A 3OXSB 3I75B 3QWOB 5DJAA 1SJHB 1UJ3A 2DIAA 1G6RA 2AJSL 2B4CH 2VR4A 1F4WL 1L7IH 2F54A 5CJOH 4XNZB 4PTUB 1LK2A 3OKOA 1TJIH 5T1KA 4TUJA 3CFDB 3GSVA 5DR5H 2X70B 1WITA 1WICA 5IMOB 2VLJB 2EIEA 3S36L 3K4DA 3RZCD 3LAFA 4QCIA 3EOAB 1YN6A 4HEPG 5GQBA 3VWKB 3O4LA 3W11C 1C5DB 1EX0A 2CDGB 2DM7A 4WHCA 1MIEH 3EYOA 1PG7W 1X5XA 1NANI 3Q2CA 4NGHL 1AKJB 1ZVSA 4PJXA 4ONGL 3E6HB 2QL1A 3KDMA 4LP5A 3UBXB 5DMGC 4MA7H 1CQYA 3CH1A 3PWJB 5L2KD 4OZFB 4KK9C 1A7QL 5JPMB 3O41B 4HGWB 4MQXC 3BD5A 4K8RD 1MHHA 3I9GH 2BK8A 5IHLB 1MIMH 3W81A 1NFDB 1WT5C 4PJFB 4N0FA 2CDFB 4OTXL 5HDLA 4OLVL 4YDIL 4PJBF 1FIGH 1WTGT 2PTTB 2BOBA 4PJHA 4K3HA 5F97E 2IF7A 3WXWL 2CQVA 4ORGB 1YEIL 2I25N 3ULUD 2XTJB 3K81A 1UGNA 5F71A 3ZKMD 1YUHB 1T80A 2YPLB 1KG0A 2BFVL 3WSQL 3JV6B 1A1NA 3CMGA 3IU4L 3OKKB 4GW1B 4LGSB 1FNGA 2VLRB 1RUMH 1VFAB 1YNKH 1U8JB 5L2JB 2C1PA 3QHFL 5F7LB 4LVHB 4XP5L 5F89A 5I2IA 2IPTH 2DQGL 5J7CC 5D72L 1T03H 1RY7B 2FGWH 2YN3A 4FQCL 2EYSB 3CVHA 4TTDC 1HNGA 4XPBL 4BUHA 4KKAD 1CLOH 3BN9D 4L9DA 4XCNA 3X3GH 1P7QA 3MLUL 3KYNB 2CPCA 2J8HA 4I0PD 1MQKH 4H1LH 4L8CA 1AJ7H 1GC1H 3CDFA 1NSNL 4PB0H 3P0GB 5FYKE 3O4OC 2BNUA 3FN0H 3H3KA 5KSAD 5D1XA 5CILH 1X5HA 3QUZA 1JV5A 1FH5L 2Z91A 4LKCA 4IRZH 3RI5K 3T0AA 1VKXB 4LPUA 3HMXL 1GSMA 3V8CA 1FORL 3WDIA 1K6QH 3C8KA 4DGIH 4Q6IB 5I71C 3MCG1 4NJAL 3OXRA 4R97C 3G04A 3ZT6A 4DKEH 2OJEB 5ENWB 2EIBA 5HY9A 4P3DA 1U3HA 4N90E 1OAQH 3PJSB 2E9WA 3DVNB 2PW1A 1FFOB 4NNYA 4FQ2L 5EU6D 1N64H 4YHPA 2C7UB 4X9IA 3V52L 1KIUA 4XC3H 5E1HB 3JWNC 3OBAA 3VFOB 5CFHA 5D2LE 3DARA 2UUDK 4PJIB 1BD2E 1OOAA 1F4YH 4XCEB 3DVGA 4AZ8A 3DLQR 5MEQA 3LKRA 3OGOE 2ZUWA 2CLRB 3C2AH 5D1QD 1RZJC 5DMJB 4C58B 1QSEE 1CDUA 2MPAH 2NXYB 4XPTL 5DD0L 2YD5A 4O51B 5I1IL 3RU8H 1MOEA 2CGRL 2Y07L 5JXEA 1UM6H 2HJLB 2EDFA 3I6GB 2NY3B 5E9DB 1DR9A 3MA9H 1A7PH 1XFPA 4APQD 4M8QB 3D39E 1WIUA 3WFCL 3FB5B 1C16B 4OCSL 1N0LA 2FIRT 4AEFA 3PE9A 2W1NA 3OGCB 2NLJB 1P1ZA 4ZOEA 3TC9A 4KQ3H 3RPKA 1SQ2N 2ENSA 1N6QH 1E4KA 4RFOH 1IKFL 3QEQE 1T21B 4AIXA 3OKNB 4JM2D 4K3GA 4WHTA 4L29A 3H9SB 1CWVA 3D9AL 2AW2A 1YDPB 2OMNA 5DJ6A 3U9UA 1IGTB 5FGBC 1A6UH 5AAMA 2DWDB 1S7SA 2EE3A 5D9SB 5C0CA 1B2WL 1JHKL 5CP3H 3R0NA 4Z7WB 2V2TA 4OF8A 4PJDF 1TQBB 2HRPH 2VDLH 4WIQA 4YHLH 4WV1A 4X7DC 2ITDA 4PBXA 4J3OC 1J0HA 5E6ZA 3ARBB 2P5ED 3ZKQD 5BVPH 4ERSH 5IEKB 3GJFH 1IAOA 4EQ2A 1ONQA 4Z7UB 5DMIL 4M7LL 3HMWH 2H6PB 2BNQA 3GGWB 1BF8A 4UINL 3CXDL 3NIFF 4Y19D 4LEOB 4CN6A 4G42B 1CICD 1A7NL 4J3XA 2EDWA 2FECL 3H3PL 2DBLL 4HS8L 3S3SA 2V6HA 2YA0A 3UEZA 4PJEA 5HYSA 5IMKB 1BREA 2HFFB 2E27L 4XH2B 3NA9L 1EFXD 4L8SC 4EUPB 1RD6A 5C08A 4XB8A 5I1JL 3LQZA 3DXAE 2ICCA 3BZ4B 4BFGA 3QEGH 4CKVX 2AS5M 1NDGB 4JREB 4LFHD 5H37G 5KVGH 1RU9L 3QZWA 1UM4L 3GSRA 4OSUH 2NY5C 2Q6WB 3BQUB 5GRZA 3QT2A 5DJ0B 3OR6B 4U1NA 2FX9L 5FO9A 3MBEC 2H1PL 5DEGB 4MJIA 3QI9A 1BVZA 4Y5XC 1MCLA 1BAFH 2VDNL 1INDH 4N8VB 3RNQA 2R0ZH 1C5CH 2A77L 2EC8A 1P84K 3QA3B 1ZANH 3E6FA 5IHZB 1U93A 2GJ6B 2Y6SC 3BWAA 3TO4D 4HBQA 1FYHB 1OTSC 5DC4B 2OQJB 3U6RB 1QFPA 4MDJA 1T04B 4NYLB 3BO8A 4HPOL 3VI4F 1V3LA 5I17A 4G8GB 3HR6A 4XT1C 4FFZL 5E95B 4RGOL 1UM5L 4HD9A 4UUJB 5ESAA 1S5IH 4X6BA 4J1UA 5SWSB 4MNQA 3TIEA 3QCUH 3SDXB 1CN4A 1NCUA 3VXUA 3WFZA 2FDBP 4ODWB 1HH6A 4FQLL 2VDPL 1Q9KA 2LU4A 1HHIA 3QH3A 1GAFH 1KIRA 3MV9B 3PL6B 4KVCH 1YEFH 2CUIA 3L3GB 4MHHG 4YE4H 1MUJA 4GMTH 4RAVA 2R56L 3MLWH 3CC5A 4EOWL 1XH3B 3AVEA 1R3JB 3SE4C 4MQ7B 3QDAA 5IBTH 5J6HB 4YEEA 1CIUA 3P4OB 3ULVH 2H8PB 3DURB 3TFKD 1D5MB 4TVSa 2ICEA 3RUGE 4TNWK 1KJMB 3B6SB 3FQWB 4M61A 2B4CC 4HG4K 4QXWA 4GO6B 4TUOB 2R1YB 3S4SA 2DI8A 4JFED 4M6AA 3CK0H 4M43H 2DQIL 2J88H 5A2FA 3BKCL 4GKNB 3TA3A 4NM4H 3QXAA 1UCBL 1XR8A 3Q5OA 2VTFA 2Y7QB 1U8LB 1YEJH 7FABL 3PWPB 1EVTC 3NFNA 1IT9H 4PRAB 5TF1L 3G6AB 3D18B 2O93L 4DN3H 1ZKAA 3Q1SL 2OJZH 3MRFA 1AXSA 2QQLH 2P8LA 4Y2DC 3VGAB 4MA3B 4U6HB 1BF2A 3UBXG 4OZFG 1D6EB 4P46A 4KJWC 4F58L 1XGYL 2Z35B 2Q86B 1G7LA 2IMMA 3ARPA 2HJFA 4LCYA 4P23C 1OGTA 5DFWH 4TVPE 3GIZH 4IRJD 1YNTB 5DRNA 2DTSA 1Z3GH 12E8H 5I1KL 2E3VA 2UZIL 2AABL 4DUXA 2VITA 1FZKA 3O11B 4WI4A 1OW0A 3UC0L 2CIIA 3TCXA 4U1SB 5E6IA 4DN4H 2XA8H 3C60D 1BZQK 3W9EA 2EE2A 3HNVH 3DV6B 3GZKA 3MLXH 3TYFA 1MJJB 2ID5A 4Z76B 1NMAH 1YNLH 5H94A 1NAMA 1DZBA 1S8DB 2JCCB 5DJYB 1FGNH 3MMEA 4Y4FC 3O6FA 2V7NA 3SO5A 4OQTH 1MCJA 3RIFK 1JMXA 2O5ZH 5DHVH 2EXWD 2PXYD 4PJCA 2VAAB 1HZHH 3D3VD 3HE6B 1QSFE 1RURH 3EW3B 2ERJC 3FOLA 4LAJH 5EU4B 5I8KH 1YEDB 1DQLH 3O3DB 4NWTL 3WN5C 1T20B 3UYPA 5T33L 3BDYL 2JF1A 5K9KB 2YKLL 4S1QL 3LKNB 4Y5YB 3CPLA 3V4VH 4YQXH 4JFFB 1QQDB 4O4YH 1GC1C 1T5XB 5F7FA 3U4EB 3O8XD 5LG1A 3NZ8B 4MB5A 3ARTA 2R9HC 1D5BB 1A1MB 2YRPA 3FCTB 4KKCD 3MSPA 1G0DA 2IANA 2F53B 1AHWB 3LKQB 2FO1A 3RWCB 4M5ZH 3RWEB 4ENED 2VAJA 4OCNC 3VRIA 4LLWB 2VDOL 3KVQA 5FHAH 1U8QA 4ZUVB 4RIRB 4OI7A 4YDVB 1X5IA 4ELMA 4JKLA 4OCLC 2XQBL 5SX4H 3KR3L 1CF8L 1RHHB 3S35X 4NNXA 5CHNA 2OL3H 3GMMA 2GSGA 3NCJL 1NCDH 1IGML 1U6AH 4LAQH 4KK6C 5IG7B 2BVYA 3FT3B 2BOCB 5C0IB 5EORL 1XGUB 4C57C 1WJ3A 4DUWA 4UI2A 4I0KA 1OTUD 1P69B 4JFZH 4XP4L 4YK4B 4GW5B 2J8UA 2LABA 1VA9A 2WP3O 4FQXD 3W5NA 3MUZ1 5IB3A 1HKFA 1NC2B 2NZIA 1MREH 4IDLA 1RZGA 5ID1A 1VPOH 1IGCL 1LO4H 1ZHLB 3LEXB 3DETC 3OX8B 4PG2A 3GNML 3QFDA 4H0HB 5FV2A 4E5XB 1BFVL 2ESVE 3CFIC 5I1EH 1U8PB 5C0FA 1GGBL 2BSSB 5IW1B 5EIIA 1TPXC 3R8BB 3V79C 1UFUA 4Z95L 3ILQD 5T1MB 4WW2F 3QXDB 3CXHK 1D9KC 4P2YA 1BFSA 2R0KH 1LO0H 4QRUB 3V2AR 4KRPB 2CLZB 1GL4B 1PEWA 3QUKA 3TZVA 2X4NA 1W8NA 3AXLB 3ZKNC 3KPNA 2NXZD 4ZO6A 1IKNA 5F7UA 4PYHA 2HN7B 4NQDB 3S98A 1RZIA 1IGFL 5EFIB 1MCEA 4N1EA 3DX9B 4P57B 4JGJA 3H0TA 5F9JA 4F57H 1DUZB 3EO1A 4YHML 5JMRA 2VDMH 1A14H 3MRDA 3FHAA 4BQ6A 2X09A 1NGPL 4LU5H 2A74B 1QEWB 2I07A 1S3KL 4YHOL 4D0CA 5MENA 1RJLA 3PQYA 5C0GA 3WYRA 5CD5D 3P0YL 1LDPH 1YY8B 1CLZH 3G6JB 2GFBA 5E2WL 3RWDA 3QAZB 4OFVA 5CGYC 2A9ML 2ATPB 5HVHC 1DQDL 1LD9B 3FQUB 3IDYB 1I1AB 3VXMA 1NEZA 5TQ2H 4G80A 5MEPA 3TPKA 5B3NA 1ZK9A 4R4ND 5C09E 2XI9A 1MNUH 3B3IA 3B9EA 1S7RB 3MX0A 4LSVH 4F33A 3DHMA 3VWJA 4JQIH 5H35A 4YPJA 2AKRA 4I8DA 1BX2A 4LSSL 3VD7A 1CD1B 1YJDL 1UZ8A 3BPCB 3FB6A 3VFNB 2H3NB 5DYOB 3TCLA 3CVHH 2R4SL 4JFOB 3RZCA 4IIQA 1G7HA 1WWCA 1IRAY 5A43C 5HYFA 4QT5B 4QHMA 5AYQA 4X7CC 1Y6KR 1PX3A 3DWTA 1NCWL 1MLBA 2XKUA 1II4E 3MV8B 2R29L 3IVKB 1EEZB 3VJ6A 3HZKA 1FZJB 4XPAL 15C8L 1N5YH 3VE0B 1UC6A 5KSBB 1WBYA 5IF0B 1YPZB 2DS4A 2NMSA 3SDCC 5L2KA 3S34H 4P5KA 1VGEL 1UKTA 3V6OC 5BV7L 1HILB 3NBNA 3C8HA 4NT6A 5LGHH 4YLQT 1J8HD 1RUKH 5C0AB 1U3JA 1IGYA 3QUYA 1F3JB 5FYKD 3IS1X 2EDDA 4IOFD 2O61A 4CVUA 4N8VG 1IEAA 2QR0A 4HLJA 5C9KA 1E6JL 1CD8A 1MPAL 3FQXA 1F2QA 5CIPB 3VFTA 5HVGB 4ZTOL 1NCNA 5F3BB 4ORZC 3RGVB 4N0CC 3LVEA 4J3VA 4NRZA 5DHYA 4Z8FL 5IIEA 5I15L 4LNRB 4Y5VB 3ULSA 4G5ZH 3WUWA 2WSKA 5EBMB 5EUOB 3W5MA 1D7FA 1OB1B 1G7PA 5KZCB 2AJ3B 4WFGE 4N90D 5IVZA 5EOTA 4R6UA 5BCAA 2DQFB 3EGSB 2MHAA 2R23B 3U82B 3C6SB 1PZ5A 3U36A 4GAGH 4JHAH 4JO1H 4HS3A 3SKJH 3GMNA 1B0WA 3SPVA 4BQCA 3NTCL 4UBDC 4G8FA 2DOCA 2V2XB 4HIJA 4AQ1B 1OTTD 4ZAKD 1BD2D 1Y0LB 4HC1H 1MCOL 2C3HA 5EPMA 1T66C 1ND0A 1IAII 3MRHB 2ARWA 4I0PA 2OZ4L 4LNVA 5EBWA 2VLLB 1M05A 4OM1H 5ESQB 5EU7C 1QSED 4S2SA 6FABL 1PQZB 1CS6A 1XGPA 3OG4B 4AQOA 2VXSH 5KSAA 1K4CA 4KKBD 4YGAB 4P5TC 5FHBL 1XGTA 4TRPL 1VHPA 3F7YA 4NIKB 3ULVC 1T1XA 5LGJA 3D39D 4E9LA 5ITFA 1EHNA 35C8H 4CMHC 1MF2H 1WWBX 1NCCH 2ZOKA 4JANB 1QRNE 2Z93B 4CVZB 3AB0C 1KFAL 4NN5B 1SY6L 1XR9A 2ZJSH 3QFJE 5F8RC 3UZEA 5BV7B 3QEQD 2VKWA 2BERA 2DLEA 4GSDH 4G3YL 4LGPB 4J4PC 3REWB 4P4RA 1WLHA 3DMMC 2WQ8A 5EU6A 5FXCH 4X5WA 5TDOB 4HIXL 4KGJA 2Q8BH 1K4DB 5JNYB 5DRWA 4KI5C 4R0LB 5FCUH 3TVMB 4FFWD 1IL1A 4U1LB 4ODUB 5IM7A 4J23A 5EBLA 1D5XB 3P0VH 5D5ME 5D1QA 3C5ZC 3CSGA 5D7SL 4L4TE 2MCPH 1F4XH 4HT1L 2HG5A 4YWGH 4HJGA 2IFFL 3QDJB 3BH8A 3MFGB 4OLWH 1NCAL 4APQA 1IAKA 4R90L 4ZSOB 5CBAB 4LHQB 2OYPA 2DYPB 3SGKC 1HYSD 5CWSB 3T3MF 5DJDB 1ODAA 1PGRB 3O3AB 4U49A 5DFVD 4B7IA 2UYLA 4NQEA 4YHZH 3F6LA 1LEKA 1W0VB 2J4WL 2JJUA 5FYJE 5ANMB 2NPLX 4JM2A 5BZWA 2VIRA 1KACB 4FQQA 4L3EB 2HAZA 3EYVA 4JG1H 4R3SA 1A9BA 3NIGE 1DEEB 4QRTA 1HOCB 3HPJA 4JFPB 5ETUB 3PGDA 5JO5B 1IM9B 4E42B 4NC1E 4NPYB 1KEGH 5EA0H 5CGMA 1PEZA 2VR5A 5HYIA 1ZLVK 1YMMB 2LTQC 3BP5A 4CRPA 1HQRA 1VEOA 5FECA 1CFNB 1Z0MA 1JNLL 5EU5B 3O2VL 4U2ZA 1J10A 5D96C 1UWGH 3GUTB 1B9ZA 2DKMA 3LKOB 2WZPD 3RKPA 3HE7C 3MREA 1N4XL 2P5EA 2DLIA 1MHCB 1G6VK 3TM6A 1B90A 2FH8A 1I4FB 2XG4A 1RZJL 3HZMA 1AFVH 3BIKB 2D0GA 4NZRH 3BZDA 1OAZH 5J89A 3EYFB 1C12A 4OCWH 1I1YB 2ZKHH 3V6ZA 2ILLA 3TH4T 1CICA 2W59A 3MLTA 1UVQA 1FN4B 3B9DA 1AP2A 2E9IA 4NKDB 1HK6A 3JVGA 4KZDH 5AWNH 5FAAA 5T3ZH 4JFXB 1T83A 4WFHE 4WI7A 2AEPH 5KN5B 4D9LH 5MEOB 4R7NB 3NGBC 5TH2B 3ECBB 3FB8B 1EFXA 2EKSB 1CDCA 4PJ7B 1FGVH 3FHQA 4HWZB 2FATH 2FWOA 5AZ2L 4P59H 5CEYB 3U2SA 3VXQB 4JM4H 3O4OB 1JWMA 1JZ4A 3MRQB 4JAMB 4QHUA 2R0WL 3MV01 4KGLA 1V7MH 2F58L 3HG1D 4BJLA 1LE5A 1JTPA 2A1WL 4LHUB 5C0DB 3BKYH 5HD8C 2FIKA 1QFUH 1TZIB 5HGDB 1IGIL 3N06B 2FO4A 4ZYKA 1NFDE 3D85D 4PJBA 3FO2A 5I71B 4PJFE 5I30H 4R97B 5CZVH 4C83A 4ELKA 4PGJA 4HS6B 3TO4A 3STBA 2JK5A 4H88H 1HHGB 3G6DH 1A6AA 3JTTB 4UNVA 4HFWA 2BHUA 4DW2H 4EDXA 1M7XA 1U8OB 2H2PC 5GS0D 2XTJE 2RR3A 2X5PA 1MHPH 5ITBL 2YPLE 1H3WM 2L7UA 2VABA 2NY0D 4XVTH 4MJ5A 2F8VA 4EI6B 4LK4A 1KJVA 2DN7A 2VLRE 3EJZD 3VRLE 1T0PB 1A9EA 5I9QB 4X4XA 3LN9A 1VFOA 3D25A 3IDXL 3MNWA 1N5AA 3MRBB 2A0LD 3STLA 1R24B 1ZA6A 4AL8H 2W38A 4TPRL 3WS3A 3T0DA 4GG6B 1RIUH 4DJMA 1TETH 25C8L 2VDRH 1A22B 5IWLC 4WTWA 2VWEE 4FZ8H 3KPPB 1U8IB 5EWIH 4TVPD 4PLKD 2NY5L 5EZOH 4XP1H 5C86A 3R06B 3KS0H 1TVBA 3V0AC 3T1FA 4O5LL 1LNUA 3PGFL 4OV6F 4MHHI 1NAMH 3QRGL 2FSEA 3ZE2E 4X0KB 1F90L 1NUFA 1AD9B 1FFNB 3EIFA 3CX5J 1CGUA 5TDPB 4JFEA 2QHRL 4BYHA 4ZUSB 5HHQA 3ARGC 4NP4H 4HK0A 1GXEA 5INCB 3F5WB 1XCQB 3SQOL 1EFQA 1KIPA 1I9IL 1DQQB 1SEBA 3GSXA 4LRIA 4PRBB 3PDGA 2VISA 3QQ4B 1EHLL 3PV7A 3CD4A 3V0VA 1GJIA 1CBVL 2X4OA 5FM5O 5E00B 4JPVL 5IVXF 2R2HA 4MNGA 2YK1L 4WW1B 1QSFD 3BEVA 2JELH 1WBZB 2IBZY 4X6CB 4MA8L 5D7JD 2NZ9D 5LXGL 4MD0B 2XWBA 3QUXD 4OZHE 5IT2H 3ZO0A 1IC5L 1Q9LB 4NO0A 4PJIE 3MNVB 5T3XH 2ZZUT 2F5AL 4I77H 5I1HH 4I18B 4I0CC 4IRJA 4LBEB 3NACL 4XVSH 3V4UH 5FCSH 3IJYB 4MXQC 3L3HB 2P45B 3MTRA 5GJTH 1XIWD 5K9OA 1MELA 1K8DA 4QF1A 1ADQH 5GGRA 3DO7A 3C60A 1U3HC 2IAMD 2Q76B 4L8SB 4XBPA 2XKNB 3HPLB 3T1WA 3VFRB 2Y5TB 4LLUA 3CSYA 1MCIA 5JW5A 3QO1B 2EECA 3N85H 4HKBB 1UH3A 2Q7NA 4P2QD 4ZFFA 1H8NA 1C08A 2C4XA 1BGXH 2D31B 2F5BH 5DR5L 4Y1AB 5E7FA 5EOCH 2VYRE 3N1PC 1Z0NA 3V4PH 2PXYA 2FHBA 4MSWB 1QR1B 3QPXH 3D3VA 5SX5K 1R3LB 3MBEB 3H9SE 1V7NH 4Y5XB 1SJEA 3SEPA 5IJVB 4HKZB 1SM3H 1JZ8A 4XI5C 1H5BC 5KW9H 1HDMA 4QYOB 4UDTB 5CSBA 3HA0A 1G7IA 1HN1A 5D5MF 5E8EA 5F3HB 1UH2A 3OB8A 4Z7WE 2ESVD 4HK3N 4Z7VF 1XF5B 2NQCA 4HDIB 5D7LB 4N9GB 1FL3B 1S7XB 3O8XA 1NFKA 4MA7L 4P3CH 4AIZA 3WNNA 1OSZB 2ZUTA 1BJ1H 3ARFC 3BZEB 3T77A 1KT2A 3W0WB 4JRXE 3U4BH 4I5BA 2YPVL 1XEDA 4MLIA 3U9PH 4BUGA 1MSPA 4LLMB 1R5VA 3CUPB 1FIGL 4GXUM 1FO0B 2CK2A 5E8PA 4GBXD 1BMGA 2ORBH 1BECA 1BQSA 3T08A 2ZP0T 2BJML 4YHIB 1DVFD 1PLGH 5GS2D 4R8WH 1RZ8B 1TVHA 5E8OA 3X12B 1RUML 4UNUA 1X44A 1YNKL 4KZEH 2BY3A 4FQXA 1I7UA 3DOSA 4HX1B 5D71H 2IPTL 1A7BA 3NCFB 4PJ8B 3BJLA 4GAYB 5ICZA 4OLYH 3C6LD 1DE4B 1J87A 3RDTA 4N0UA 3TBSB 1CLOL 3I6LE 1Q94B 5GZND 5EU3B 1Z9SA 3P77A 3HRZA 3W39A 1N7MH 2NTFB 1ZHKB 2FLRT 5C09D 2N1KA 4HH8A 1GC1L 4PFEA 2B1HL 3GSOB 5A3IC 3S88H 3UYOD 3VXRD 3IU3B 3RVWC 1FG2B 2GY5A 3TNNB 1ZV5A 1F2XK 1DN2A 2GJ6E 3MUGA 4DQOH 1HHJA 2W60A 4U1MA 4X8JB 4OGYL 4Y2DB 2NY2D 1TFHA 4PRPE 3TN0C 5JW4M 1AGFA 1C5BH 4RFNB 1HXMA 5E8NB 5HDQL 2OXGA 3LRGA 4OFKA 1A3RH 1G0XA 3SBWA 3SDXE 4P23B 4HAGA 3RA7H 2OLDA 4JY4A 5FV1L 2ICWB 1A7OH 1SMAA 1I9JL 2JJSA 3BZFB 3OPZH 4GMSH 1ZT1B 4JDVA 1UCTA 5B21A 3ZSSA 2XY1A 3L7EA 5B3JE 3D2UB 4MQSB 3QXTA 2HKFH 3MNZA 2HT4C 4AMKH 3MV9E 4P4KC 2UWEB 2EDOA 5F1OB 4F80A 3MCKA 3U7WL 5DVLA 3ULUL 4KHTL 1NFDF 1VACA 2NNAA 5TE7L 4ZPTB 2CIKB 3C2AL 4BM7A 2WBJD 3LRHA 4PJFF 3IDGA 4DUVA 5DD5H 2DB8A 2MPAL 4K7PH 1JNJA 4LCCA 4Y4FB 1RPQA 32C2B 3S3PA 2EC9U 4ZO8A 3LV3B 3NPSC 4NHCH 3O9WD 2ERJB 3LS5H 4NM8H 3FQNB 3WN5B 1U8NA 4WFGD 5CS7A 2OP4H 4ODSH 5FUCC 4PGCB 2AK4B 2V9RA 1T1WB 5JOFA 2HTKC 3HC4H 1VEMA 3VRLF 3QEHA 3AS3A 5ALBL 1NC4B 1GRWA 1Q9OB 3GHBH 4FQIL 3PWPE 4KQ3L 2FH6A 1FP5A 4JZOB 4PY8J 2FHFA 1J12A 5J4MA 3T8XA 1BIIB 4X4ME 4QTIL 2WV3A 5ICXA 4LHUG 1INQA 1A6UL 1J8HA 3WCYA 4KQ4H 1GGCH 2NY1C 4MQTB 1JZ6A 1Z9LA 4TUKH 3TBYB 3BGAA 2PYED 2W0FA 4YBHA 4PJAE 4F9LC 1U42A 4IMKA 4Y89A 1UT9A 4B0MM 2Y06L 4XX1E 3O3UN 4XVJH 1QRND 3HMWL 2BDNL 3IXTB 4LDLB 4JO3L 3EFFB 3QFJD 4OGAD 4OI8A 2J3SA 5IMMA 3LEYH 4CADB 1MFAH 2PUQT 3BP7A 2EH7L 2I5YH 1ZGLM 1KCUL 5ERWA 1K2DA 4P99A 4YX2H 3KPMA 3MLYH 4NN6C 4ZAKA 1CU4H 5IB1A 1TPXB 3QO0B 1QYGL 3MOBH 3LKPA 4DKDC 1OM3H 5KTEH 5GGQH 1JN6A 1D9KB 1DN0B 1QSEA 4L4TD 5TGBA 1OW0C 1WSST 3LZFL 5BVJB 3T2PA 1AR1D 5F8QC 1WFOA 4OSUL 4KTEH 2P5WD 4TTGA 1YY9C 3PWUB 5ID0A 1UXSA 5DURB 1BVLB 3W2DH 4D0BB 3SQBA 5EZLB 2Z92A 3D39A 3G5ZA 5FYLD 2FECI 4G9FA 5E5UB 4ZXBD 3RPIB 4ETQA 1BAFL 1T2JA 4LLDA 2W65B 1INDL 4MLSA 3O6FC 3K2UH 2R0ZL 1C5CL 3MRKA 3K74B 4DTGH 1UG9A 2F53E 1ZANL 3U1SH 5C2BH 1D3CA 3T0WA 2XWTA 3DV4B 4DCQB 3QEQA 2XQYG 5FYJD 3TBTB 3G5VA 5KVEL 2YPKA 1NGZA 3O3BA 3AM8A 4OD2B 4ODVH 3U4AA 3QHTC 3FAWA 2YXMA 5DQJA 1FIEA 3S4SG 5HVHB 4Z7OF 1S5IL 3WO3B 3GMLB 3WIHA 3VXTB 2W9EH 2C4FU 4F7PA 3QCUL 3MGOB 5L9DL 4KKLC 3MODH 3EYUL 4HPYH 1KN2H 2IWGA 3GJFB 1XF4B 5F1KC 3O6LL 5GZOD 2A6DB 9CGTA 4Y16A 4Z7WF 4HGMA 2PETA 5E2UL 5FK9B 1JPGA 3FQRB 1FJ1A 1QBMH 1U91A 4P2OD 5D6CB 1QHPA 4O2CB 1YEFL 4WW2A 4YE4L 4GMTL 4EN3D 4PTTB 1U8MA 4HKJA 4EBQL 1G7JA 1REIA 4IRSD 4M8VA 3V0WL 5CD3A 4Z7UF 3WJJC 1ZGLA 5HYEA 1NGWB 3ULVL 3SKNA 1WAAE 2IH1A 2G2RB 2DQCL 5CJ8A 2P47B 1P4BH 3ILPA 2WK2A 3NVQA 5JA9A 4NQTA 2FD6L 3NIDF 5TE6L 4WU5B 1ZHNA 3D0VB 3CK0L 3SDCB 2ARJB 2VLJD 4NQDE 5J56B 1DQMH 2J88L 3DUUB 4PR5B 1T1ZB 4NM4L 1N0XH 1S7TB 2QSTA 4XRCB 3TT1H 1S7VA 4Y4KA 5AAWA 4DGVH 5EO9A 4Y7MA 1YEJL 4Q74A 1G9MC 4A6YA 5E70A 2HLFD 5DUBA 3T2QA 4DN3L 4HUVA 4LMQE 3DTXA 4KJYA 3ZDZE 1A1OB 2QQLL 3IS0X 4OGXH 1J0JA 1PKOA 3BXNA 3GEWB 5MI0C 3PHOB 5DT1H 1YEHL 2VNCA 2VQ1A 4XZUB 4BH7A 4OZGB 2NY4C