3KNBB

Crystal structure of the titin c-terminus in complex with obscurin-like 1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
96
structure length
96
Chain Sequence
QGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/structural protein
molecule keywords Titin
publication title Molecular basis of the head-to-tail assembly of giant muscle proteins obscurin-like 1 and titin.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3knbB00
2IGFH 3HNSH 3VMNA 2PR4L 4JRYB 3SGDH 1MNUL 5D4QA 3KLHC 5D7JC 3D85A 1QLRA 5DMYA 1NC4B 4OFDA 4I3GA 1HWGB 4P4RB 1HINL 2SEBA 1BLNA 4HKJA 5GS3A 3NH7L 1EMTL 2QHRH 5EU4A 3PHQA 5BXFA 5JUEH 4NJ9L 1Z9OA 3VDBA 1YY8A 2W65A 5DWUH 4D3CL 5F70A 3BRGC 3HNVH 2HVKB 3G04A 2NY4B 3UZQA 1MLBA 2LU3A 4XVUD 1MCCA 3GJEB 3MGOA 3L3DA 4IRJA 1R5VA 5L2KE 5FUOL 4BH8B 5L7XL 2Q3ZA 3SGKA 1T5WB 1HSBB 3FJTA 1TVHB 3PWLB 4HAGA 3QUYD 2BSED 5BCAA 3LB6C 4WHYH 1M4KA 1TZHA 4ODUB 2W1NA 1CYGA 4LMQI 4NKQB 2ICWI 5F9DC 4NZRH 3U0PA 3D18B 2Q8BH 3PABB 2ITCB 5GS2D 5D8JH 3IXAA 3ZT7A 1YN6A 5JQ6L 2VXSL 3DXAE 1BJ1H 3S3PA 5IB4A 4DVBB 1TJIL 2VDMH 3ARFA 2MFNA 5DJAA 5B39A 1QTYT 1KN2L 2ZUVA 4M7JH 1UYWL 3MRJB 3M8OH 3S98A 4HXBL 4DOHE 4E0RB 3FOMA 4BQ8A 5ACZA 1OP9A 3EYOB 2ZZUT 1QSEA 3MRKA 4YR6A 2NZ9C 4APQD 1Q0XH 1X5ZA 3X12A 2ESVE 4LEXL 1ZA6B 1YEKL 3KJ6L 4Y5VB 5EBWA 1G9NH 1UEMA 4Q9CA 4J3OC 2IC2A 5E2WH 1IILE 3CFEA 1MLCB 3CSGA 2AK4E 1SJHA 3GMOB 4F58H 5IEKB 4I77L 3KPSB 1AHWB 1KEMH 4ODTH 3TCXA 4CJ1A 4ZSOE 4QTIL 3QIBC 1CT8A 1ZANH 1AP2B 2QQLL 1ED3B 5E8EA 2F53D 5C0FA 3CDGA 4LPUA 5IR1B 2E7HA 5ELIA 1EK3A 2H6PA 4YDJA 1JYWA 4XCCL 2AXJA 5DJ6B 1ZT7B 4X6BB 1U8HB 3WXVL 5GRXG 3SJVB 1U8QA 3LKPA 1PYWA 3MV8B 2OL3A 3QIUC 2K1MA 1JPFB 3DRQA 4RGOL 1IJ9A 4PJ9A 4YDIL 2EEBA 3D39A 1OTTC 2Z35A 4DUVA 1YZZA 1A14H 4H25B 4DFIA 4MMZC 2OL3L 4M61B 4RAVB 4KVNL 1A5FL 3SE8L 1X5FA 1NGZB 1I9JH 1OD7A 3QNYA 4Z7WF 2R4SH 4MS8D 4PS4L 5JNYA 2UZIH 5IW6B 1NKRA 4D9LH 4WHCA 1ZLWK 3HPJA 4HUVB 4XNQB 5D7KE 4MAYD 4HG4K 5BO1L 1E6JH 2J12B 1INQB 3GMQB 3FN3A 4Y19D 5EWIL 2APVA 3U9UB 1HH6B 4TOYL 1I3VA 3MRFA 4LLAA 1UM4H 2R8SL 4HWNA 3VXMD 5K9KB 1V3JA 5IROA 5DS8A 2ITDA 1G0DA 1MCLA 1CZ8H 2ZJSH 4Z7VF 4L9LA 4KAQH 3G6JA 5GRVL 1KJ2H 2VAJA 5K9QI 4MD0A 4X5XB 1MH5A 2YS4A 2KQNA 3QEGH 2G9HA 5IMMA 5KSAB 5FB8B 3GSQB 4OLZH 1S7WB 1MFBL 3GJFA 3L5WA 1MJJA 1N59B 1XR8A 1YNKH 1QBBA 1CFVL 1PD6A 4KK9D 3R8QA 3MQIA 3TWCL 2JCCA 4NM4L 3VXQA 1S7SA 3K4AA 1QBML 4MCZA 1F8TL 4LRIA 1NMCC 3BT2H 1N2RA 5C09D 1MAKA 1BQSA 2KH2B 1DUYB 2JJTA 2Q3AA 3L6FB 4JO3L 2ERJB 1WFUA 4X4ZA 5D6DC 3R06B 3SCMC 2YR3A 4N0FB 3RWFA 3QCVH 1FVDA 3OB0K 5GSRA 4C54A 1Z6JT 3MV7B 3OB8A 5EOCJ 1FPTL 3P73B 4H5SA 4J8RB 1JI1A 4PTUB 4YBLB 1W0WB 4NQED 3VXTA 4ZUSA 4PRAB 1P4IH 2G60L 3LKOA 3T0EB 3DURB 3DJ9A 4PLKD 4MWFA 5F1SA 3QUZB 4EUPB 1T0NA 5C0AA 2QEJA 4FQXC 5DD3L 3D1MC 4LGPB 3GMPA 2O5YL 3JTTA 1YMME 3PJSB 4JZJB 4XPAL 1FFRA 2DQDL 1HSAA 3S37H 2DLHA 2XN9A 4R8WH 5AG8A 4I0CC 2CLRA 4NYLA 5J89A 1KJMB 1RSFA 1XGTB 5EB9A 5H37H 4TUKH 4PRIE 1CGTA 1LE9A 1S8DA 2ZKHH 2VLMD 5C8JA 3HKFA 1NFDF 2RAMA 2D03L 1OWWA 1JYVA 2X4NA 2H2SC 4Y5YA 5E8OB 2EE6A 4PJ5B 4OLUH 4FABH 2FECL 5ICZA 4GUPB 3VWKD 3C5JB 1LO4L 1LO3L 4F2MB 1XF5B 4M62H 3VI4F 5F7EH 4HGMA 4LSPL 1MELA 3QZWA 3OKDA 1A7NH 1IQWL 5KS9A 1ULVA 5F3HA 1QBAA 3T65A 5J7CC 1R5IA 3MMEB 4OZIE 1AQDB 5FV2A 1QQDA 5IJKA 1WIPA 4M1DH 4PJCF 1DVFC 4X5LA 1UB5B 3KDMB 4GAJL 1P7KB 2VO5A 5ITFA 5GGUB 4P2RE 5DEFB 1J8KA 4K7FA 3UCRA 4YE4L 5C0RH 1BF2A 1XCTA 3B9KB 4G43A 2VL5A 3O3EB 4UINH 1AGCA 1QRNA 5ALBL 2MQCA 5BV7H 3NA9H 2DIJA 2IH1A 5MP6L 1T20A 1BF8A 2BXYA 5TDOB 5HI5C 2IALB 2X4RA 1L9MA 2NXYD 3R0MA 4R0LC 1D6EB 2R4RL 4PV8B 3I50H 4Y2DD 1YPZE 1YJDC 3QNXA 4P9ML 3GUTA 5T1KA 4RMUA 2HRLA 4S2SA 2GJ6E 5J6HB 1GGUA 2W92A 1JGEB 3NACL 5DHVH 43C9A 3UTQB 3HI5L 3BWAB 3RWGB 3MV8E 3X14B 4IDLA 3ZYOA 1ITCA 4PY7A 2OTWB 4PJFA 5FM5O 4EXKA 5HVGB 4ZS6D 1KEGL 1DN0A 4X5WB 4P48A 4S1SH 2DLIA 4UT9L 1UC6A 3SGDI 4UIKH 4BQ9A 4K23H 1X7QB 4KKCD 4IRSB 1CLZL 4NQCE 1U8JB 2R9HD 3BPLB 2HMIC 4J1UB 5I1GH 3C6SB 3C6LC 4P5TB 2Q76B 1JHKL 1DLFL 5TF0A 4BH7B 4NQUA 5JMRA 2VXQH 5I6XC 3WKMH 3FTGB 1FYTE 2VDNH 2X4SB 3N0PB 1DR9A 1AXSB 5J1AA 5C0CE 5EPMA 3CJJA 4M7ZB 4JAMB 3CZFA 3LN5B 3MLWH 1HHJB 3IFLH 1IAIM 1ZEAL 1BQHB 3UX9B 1NEUA 3CDFA 3TCLA 2P47B 3NPSB 1MAMH 4LSSH 2CO6B 2JE8A 3PWJA 4LLVB 4NKIH 2JJSC 3JSSA 2VIRA 2AV7A 4YUEL 1AE6L 6FABH 3O41A 3PIQB 4LLQA 3T4AA 3WXWH 1WC7A 4R2GD 4BK4A 4Y8AA 5DQDH 3T2NH 4PJDE 4KQ3L 1G7QA 4JPIA 3D5OF 4U33A 4HWUA 3Q5OA 4JN1H 3DUUB 4WO4B 1RFDH 3LKRB 2DQUL 3UTZA 3O4LE 5KTEH 5F72S 2K9UA 2A74A 4XP9L 5JPNB 5KW9H 4OD3L 1MEXL 1HQRA 3DPBA 3MJ9H 3H9SD 5D72H 1OOAA 2EIZB 1YUHA 3BP6B 4NKMB 5DDHA 1OPGL 4NHUA 4R7DA 4LFHD 3UO1H 1AR2A 3RTQC 3EYQC 3HS0A 4XPGL 4RFEA 3WHE1 2PXYC 3ES6A 5IB1A 3OX8B 4U1IB 1NGYB 2OXHA 1WGOA 1Z0NA 5I18H 1RULH 4TSAL 2CKBA 4M6MH 3S4SA 4XVTH 1DBMH 1CL7H 3T0EE 3N06B 1NQBA 4JPKL 1T1XB 3VFOB 3MUZ1 2BVPA 3G5VA 2C1OA 4NZUH 1EDQA 3MGTA 4Y4HB 3VXUD 4KHTH 4Z76A 5K59F 3KHQA 1HWHB 5HVFB 1X4XA 1CICB 4CMHB 2ZUUA 1A6AB 3BUTA 1OAUH 3O9WC 4Q2ZA 3VXRD 1F3JA 4IDJL 4G7VL 3BIBX 1JPGA 4FFWD 1XGPB 1RK1B 5LGJB 2FH6A 1XGYH 3ARBB 8FABB 5AZ2H 1D9KC 3UMTA 1QFWH 1U8IA 3O2VH 3B4NA 1MFEL 1SEQH 3HMXA 3IJYA 2P5EA 3CU7A 3HRZB 3VMPA 4Z7UA 4G42A 2X05A 3V2AR 4WEBH 3RWIB 3MBEC 1PY9A 1BZ9B 1SYSB 3MRPA 3QDME 4OB5H 5D1QB 2D0HA 5CINL 1NUFA 5GGVH 2R1YA 4XCNB 1H3GA 2VWEC 3SE3C 4HHAA 4ETYA 1RIVH 3KXFA 1INEH 4HUMB 3CSYB 3DX9B 5B38G 4KY1L 5E5UB 1E4WH 4ODXA 3KWWA 5JIHA 2GSGA 4ENEC 4PJ7B 4JRWA 1J8HD 2JJUA 2IAMC 4HT1L 3IAQA 2P1YA 1ZT4A 3F7VB 3L1OL 1TETL 2B8OT 4JKLA 3IJSA 3RX5A 4XXDB 3OJDB 5IW3A 2KZWA 2P24A 5KOMC 3F58L 5CJOH 5DRZB 3MUGA 2VDKL 1IM3B 4M93C 3ZDYE 2ZCKH 1YA5A 1GZPB 3KLSA 4Y16D 1J1PH 2Z93B 4ZDHA 1WISA 2DQEL 2Z8SA 3BIAX 4DKDC 2DWDB 4AMKL 1VFMA 4LHUB 3EO0A 3W9DB 1LD9B 1QD0A 4XVJH 3RFZC 1Q72H 3NABH 4X4MA 4BKLB 3SDDB 3VFPA 5E9DD 4G6KH 5GZNC 2WW8A 3FO9A 1BVZA 2F58H 5JA8B 4NDMB 4JKKA 2EH7L 3EJZC 5FYLH 1XMWA 4N9GA 4PRNB 4OD1L 4EI5C 4FQXA 1MIML 1CGYA 1AO7A 4I0PC 1ES0B 3D9AH 4AQOA 1CTOA 1JNHB 3TGXA 2I60H 3MFFB 3D2UD 3FT3B 25C8H 4NWUL 4JDVB 3L7EA 1BM3L 1UJTA 4RRPA 3P77A 2EH8L 5J4MA 5CAYB 3GEWB 4XAKD 4L8DA 1HOCA 4WWKC 4GLRI 1X6LA 2A0LC 4AT6B 5ADOH 1OB1B 5LCVH 3Q3GA 5GSVA 4XBGA 4OFPA 3DROA 3UTSE 3DI3B 1E4XI 4YQXH 5FHBH 3KPNB 1KB5B 4UT6H 4ERSH 3P11L 3A0OA 3UYPA 2DQGL 2ZUQB 2YPLE 4XMPH 5EIIA 4TPRH 3EW3B 3MRRA 5J6GB 2GAZA 3QUXB 1NCDL 4AEHH 3RRQA 3HG1B 4LSUH 3KYOA 4KJPC 3BEVB 4IRZL 1CXFA 4L8CB 3WSQH 4QOKE 4XBPB 1VCAA 3V52L 5FO7B 3RNKB 2HN7B 3MLUL 2A77L 1BFOA 1JGUL 1MPAL 4KRPB 4HBCH 5HYJD 5HY9A 2BK8A 2H26B 3ARYA 5CEZD 1GH7A 2D9QB 4LLMA 4CU6A 3ARZA 3OZ9H 4R0LA 4O2CB 5B39G 4DKFH 4ETQA 1Q9KB 5FO8A 3TIEB 5GGVY 3GSRB 2BNRB 1NMAL 1DQDH 3C60B 5C07B 2AXFA 4ODHH 3LSOB 4RGNB 5GS1B 5CD3A 3K8MA 4ZTPL 3PHOB 1LO2L 4J4PD 4L29A 2RFXB 1A7RH 4LVOB 1J5OH 2A6IA 2H9GB 2YUWA 4UT7L 5CZXC 5ESVB 4RFOH 1AGFB 4HMCA 2ATKA 3GRWL 5E00B 5GGSB 5KVDH 4YX2L 3N85L 4H1LA 5DJZB 3T0BA 4BJLA 1B0GA 3UBXG 2RIKA 1MWAH 2PTVA 3RU8L 5GJTL 4F7PA 2HFGH 4RMVA 1N6QL 4KDTA 2FYYA 3P4LA 2J88L 3SDAA 2MHAA 3OKOB 2NX5D 2V5TA 2Y36H 3PHSA 3KYKL 4JKWA 4G80A 2VDRL 2VDQH 3K8KA 4TULL 5CKGA 1A6UH 3WDHA 4M4PA 4ONHA 3REVA 2XNAA 4P9HH 4LSQH 4B7LA 4FG6C 1GIGH 1EEQA 1MI5E 3T04D 1IGFH 4JY6B 4A6YB 4LPXA 3VFNA 2XV6B 3FN0H 1F3RB 1Z5LA 2CLVB 1X4ZA 3MV9A 1FAKT 2IQAB 4WFEE 5DEGA 5T33L 1E6OH 5IKCB 2Y1VA 5MENA 1MCWM 4R4FL 4HUWA 2NR6D 3FFCA 4YFLF 3TV3H 3FONA 3QDJE 4YIQB 4G6JH 1I7UB 3WIHL 4MNHB 4JCLA 4U6HA 4OCLC 4IS6B 5ANMB 3J7HA 4LEOA 2FHBA 4Z5RA 3FB7B 4S1RL 3AUVA 3MRGB 3ZE2E 4BK5A 4P3CH 3WBDA 2GTWA 4D9QE 5EUOA 3CXHK 1QEWA 4PJ7E 4JY4A 2OR7A 1XIWB 3W0WA 3RVWD 1ZK9A 1A3LL 2FNBA 1URLA 4FFZL 4JG0L 3GSUB 3QXAB 4M43L 1QHPA 2MSPA 1LO5B 3F12B 1JWMB 1KLGB 4KK6C 1S78D 4LVHC 4G8FB 2AERT 4OFKA 2AEIT 5ISZA 4NZTL 5I17B 3QPQD 2BNQE 5IMKB 1G7MB 4PJBB 4EZMA 3RTQA 1JTOA 4HWZB 5EOQH 4QNPF 2PXYA 1KN4L 1U93B 2GJZA 4LSDA 1A7OH 2DQCH 4OF3A 2Z4QB 4LCIH 4HQQH 1QHOA 3GHEH 1KV3A 3C5ZD 1CI5A 1RHHA 4NO0D 3HC4L 5GGQL 2AW2A 4L3EA 5INCA 1MCKA 1QA9B 1W8OA 3ULVE 4ELMF 3H9YA 2ED8A 3OMZA 4HS3A 4XXCA 5J8OA 4KROB 1YEIL 1FORH 3WFEH 3HFML 5AUMA 5B8CC 5CJ8A 4EOWH 1RZGB 1VSCA 5HHOA 2BDNL 4UOW0 3QUYC 1H3VA 1XGRB 1YEGL 3KGRA 3MUJA 4YEFA 4HBQA 3O9WA 2VH5L 4OSUL 4KJQD 4MXQD 1UACL 3LIZH 4DW2L 5D6CA 4PRPD 4V1DD 4HIEA 5MEQA 4L4TB 5FYKE 5IVXB 4K9EL 4EDWH 3O2DL 1I7TA 2DM7A 1A2YA 1N6VA 2Y6SD 2X70B 1RZ7L 1N8ZB 2MWCA 2FWOA 3GDBA 3RPIA 4GKNB 1GGTA 3F8UB 4QHLB 5CP3A 1U2HA 1MJ8L 4XP6H 4M5YL 4U1KB 3MBEA 1CGSH 4HX1A 5CSZA 5LKNA 3U9PL 3HUJB 2JB5H 3K8LA 4APQC 4EDXA 3PDGA 1X5IA 1EEYA 3FT2A 1C5BH 3G6AB 5HGDA 3CXDL 3JWOL 5B22A 3LEYL 3QXWA 2P5WD 4WUUE 2F8VA 3N1PC 3G5XA 4ORZC 3IS1X 2BC4B 4JZNB 3DMMB 4U1LA 3QPXH 4GKZA 5J1SC 2EYSB 1P53A 1RVFL 3SQOH 3WS6C 4OLYH 5E70A 2ADFL 4QT5A 3RVXC 4JPVL 2I5YH 1EERB 4HWBA 3RZCD 3BKML 4FQHB 4JREB 3RI5F 5L2JB 2IAMA 5I9QB 2DMCA 2GSIB 3MLYL 3RIFF 4YHKH 2CK2A 3CDYA 1JN6B 3P9MA 4NCC1 5FHAH 2W0PA 4J3TA 1QUNA 1S7TB 2FJFB 3RGVD 3RNQB 2BNRE 1CDYA 4OGZA 3HHRB 5JO5A 3TYGH 1PQZA 1I7ZA 3UTPD 3OWEA 3G08A 2CD0A 2CIIB 3LVEA 3D0VA 3BP5A 1XR9B 4C56D 1RPQA 4WHTB 5F7HA 5C2BH 3BQUB 1CGVA 3ZYZA 1NANH 4WVRA 4YHIB 3QCTH 5DC9B 5FYJE 3I2CL 3QCUL 4LQFH 3RUGB 1U58A 1DZBA 1N26A 2DKUA 2HFFB 3HMWH 4MS8C 3CSPA 1QRKA 1N7MH 1W72B 1MCDA 2ZG2A 2AEPL 4MA1C 5T1LA 4I0PA 4N8VB 4QHMB 4AEIH 4YXHH 1EJOH 1HXMA 3U36A 3PP3H 4MAYC 4S1QL 4JFQA 2DLFH 2D7PA 1NLBH 4N5ED 5AD0B 4WWKA 4I2XB 3BPCB 5F88A 2DOCA 4PJAF 5J13B 1BFSA 4MJID 3RI5K 3F7RA 2VXUH 3TBTA 3D85B 1QLRB 4J3VA 3RIFK 4RX4A 4MQ7A 4XAWL 2SEBB 1BLNB 4QRSA 4HKJB 4FTVE 5EU4B 3PHQB 5BXFB 2J8UE 1AKJA 4C4KO 1YY8B 2W65B 5F6IB 2H1PH 4WFHE 2AEQH 4GSDH 5CUSH 4YDVA 3G04B 1OSPH 4LSRL 1MLBB 2XT1B 5TJWK 1NCBH 4M6NH 1VACA 4P5KA 5HPMA 5DRXA 3A6CH 3MGOB 3L3DB 4IRJB 1DANU 1NC2D 1R5VB 4NQDB 1IGJA 4XP5L 1SMAA 4PP2A 4KK9C 2D31A 1JGVH 1TZHB 3L3GA 1QSFD 3I6LE 3U0PB 4F37F 4C58B 5F6HI 5HHMB 5DJYA 2AK1H 3SKOA 4IIQA 3IXAB 1YN6B 2DIBA 1GGBH 1EFXD 2DJSA 5FIEA 5IB4B 4NZRL 3ARFB 5DJAB 1I1AD 1JZ4A 3QFJE 5C0BA 3FOMB 5ACZB 1IM9D 5EU6D 1QSEB 3MRKB 4YR6B 3MLXH 5I1KH 1UB6A 2J6EH 4M7JL 4PJBE 3X12B 3M8OL 2QV2A 3ARPA 5EBWB 1IL1B 2P7TA 4PLKC 1FLRH 4TTDD 1CFNA 4KUCF 4NNPH 1T7XA 1FBIH 1RQ5A 3E6FA 4YHML 3CFEB 1SJHB 1FNSL 4G6AD 3MREA 1IGCH 2EECA 5EBLA 1UEYA 2BSSA 4ZAKD 2G2RA 1CT8B 4F58L 3P0VL 5E8EB 3HE7D 1CIUA 5C0FB 4ODTL 5EULV 2H6PB 4YDJB 1ZANL 2Q1EA 1UZ8A 4M1GH 3S36H 2AI0H 1C1EL 4FXKA 1U91A 3E8UH 2R2HA 1A6PA 1U8QB 3VWKC 2DL2A 1HCVA 1K2DA 3LKPB 4F37K 4TRPL 3UJJH 1FDLH 1PYWB 2OL3B 4GG6B 3OR6A 3LOWA 4NN7C 3DRQB 4P59L 2PYEA 4E41E 4GAFB 1EZVX 4PJ9B 5HHXH 3AMKA 4EUPH 2Z9TA 5I74B 2Z35B 2ZUYA 3PXJA 2Y4SA 4JHAH 3ZZ1A 5GRZA 4GBXD 2ZUXA 1WUNT 2R0LL 2DLTA 4GMSL 5JNYB 1CK0L 1K9TA 3QNYB 1BWMA 3MUY1 3MGAA 1TDQA 1YQVH 3EFDH 3HPJB 4RA0C 2R4SL 5K9JL 4HH8A 2ENSA 5JW5A 1H8SA 3V0VA 2VLRD 4D9LL 3QR2A 3TJHD 1FAIH 1KNOA 1NEZA 2NXYC 1BFVL 1E6JL 5F44A 3RAJL 3H3PL 4GKSA 3OAZK 4JJHA 3WDIA 5DMGD 4Y2DC 4LPCA 5DS8B 2ITDB 4Z7WA 4ONGH 5C6WH 5GQBA 4L9LB 3G6JB 1UM4L 1CLYL 1KENH 1T80A 1TITA 1JWUA 2EDQA 2Z0BA 1N5AA 4MD0B 2C3WA 4GAYA 3C8DA 1MH5B 3P2TA 4KAQL 5IMMB 4N1HB 2XY1A 5HJ3A 1HHIA 1FYHB 3GJFB 2CLZA 2ADGA 3L5WB 3BKJL 1MJJB 4ZS6C 4JRXD 3QEGL 4CL7A 3I6KA 1MFDL 4K8RH 1A9BA 2FZ3A 1XR8B 4OV5A 1MFCH 4OQTA 4KKCC 4W6WB 3RUGE 4Z7VA 2QL1A 2JCCB 1IKFH 2R9HC 1S7SB 1T7YA 3IDXH 3VXQB 5CJXC 5SWSD 1YNKL 4MCZB 3EYUH 3VU2A 4MZ3A 1N2RB 2O26U 5LWYH 5TH2A 4OQTL 1HHHA 3BXNA 4WI7A 3TN0D 4Y89A 3Q5TA 1V8HA 3RWFB 3CAFA 3QQ3A 1FVDB 5GSRB 5CD5D 3TLRA 4CKVX 1T03L 5JLZA 1MCIA 4IEFB 3VD9A 4H5SB 1MF2L 3MPCA 4NGHH 2AJSH 4ZUSB 3VXTB 4HV8A 3LKOB 5I1JH 3ZDZE 4MWFB 2BJML 5KBNC 1T0NB 5C0AB 3GIZH 1BECA 3JUYA 1CFQA 3JTTB 3GMPB 5BS0D 1NGWA 3UYRH 2VE6A 2J3SA 4X83A 4APQA 4G9FE 4X98A 1HSAB 4U1MA 1Y6MR 2XN9B 4NFBA 4LVNC 4YK4C 2CLRB 4NYLB 4R2GC 4WW1A 4XRCA 1H15B 2VLJA 3F5WB 4PRBA 1LE5B 3S37L 1E4XL 2NYYD 4DTGL 1LE9B 4R8WL 1GHFH 2F5AL 5C8JB 4X8JA 3RDTA 2X4NB 4Y5YB 3P3YA 3BD5A 4TUKL 4F80A 5ICZB 1O0VA 1PEZA 2ZKHL 3H3KA 3MUHL 3EOAB 1FGNH 4JE4B 2J8OA 3LDBB 1BZQK 3I3BA 3QZWB 3OKDB 1KSRA 5KS9B 5F3HB 3T65B 1R5IB 4PJHB 3IDNA 4CNIA 4M62L 5GIRA 2R39A 3D3VD 1NGQH 1A7NL 1QQDB 2PW2A 4JFYA 3FQTA 3WL9A 3AS2A 1NFDA 4H88H 3SPVA 2WBWB 4NNYA 4YDKL 5ITFB 3CGTA 4K7FB 5GISH 2GHWB 4R4ND 4M1DL 1XCTB 4G43B 2XG5A 1A7BA 2VL5B 4XT1C 1VPOL 3B2VH 5LAXA 3VG9C 1AGCB 1QRNB 1FGVH 2HWZH 1F90H 1T7WA 2IH1B 5D2NC 1T20B 5C0RL 2AKRA 1LNUA 2X4RB 4UINL 3TH4T 1JGDA 2CRMA 4OLWH 2Y23A 3MC0A 3NA9L 4XI5D 2WUBL 2W0KA 2EE9A 3QHTC 4FQ2H 4PJCA 2VQUA 3QNXB 3LPWA 2QSQA 5F1OB 5T1KB 3GUTB 4S2SB 4WDIA 4Z8FL 4JFFD 4FFWC 1T2JA 1RZFH 1FG2A 3AXLA 1IC7H 3GIVA 4HMDA 3BW9B 1NH6A 3I50L 4Y19A 1JUFA 1EX0A 2QLVB 5T3XH 4FMKA 2A9NH 1T2QL 1TNNA 2GKIA 4GS7C 1P9MC 4P3DA 5I0DA 4PY7B 4H1LG 4PJFB 3GM8A 5EUKA 3EFFA 3D39E 1KTLA 5FGBC 4AENB 1I9IH 3NCEB 3V6BR 1LK3L 1MJUL 5I1AA 1KJ3L 4MMXC 1ZHKB 5FUCE 3DSFH 2VZ1A 1J7VR 3S35H 3PWUA 3MTRA 3U0WL 4K23L 4YHLH 3GBLA 3TP4A 4UNVA 5I1GL 2AJYL 3RVTD 3T4YA 5GRUL 2HJLA 3HZVA 3V5DA 1RZIB 3NAAL 5KSBE 3ARXA 5FGSA 1WZLA 5EPMB 2VXQL 4HKBA 2NY1D 2E7MA 3HC0A 2F53E 3CZFB 2VDNL 5SX4I 1EEUA 3DV4A 2WBJC 5ETUA 3TCLB 2P43B 4X6CE 4Y16C 4U49A 2B4CC 3G6JE 4MJ2A 2W0FA 3PWJB 3T2OA 2AGJH 3T8XA 2OTPA 3F7YA 5I1EH 2VIRB 4KV5E 3VXOA 2AV7B 1CXIA 2DMBA 5GS0L 4RIRA 3QEQD 4KHXH 3ZT6A 4LSSL 2NMSA 2EKSA 4LLQB 3T4AB 1WC7B 2XPGA 4DN3H 1I75A 3CFBA 5JOFA 1OARH 4LCCA 1G7QB 4JPIB 5JZ7D 4DWHA 4PJIE 6FABL 3W9EA 5K9QG 1TVBA 3LZFL 3WXWL 5D93C 3O6LL 4MDJB 1O5DT 2VQ1A 2WWKO 5DQDL 2Z31D 3UTZB 1B4JH 2JCCE 3U6RA 12E8L 2MCG1 1X5YA 2A74B 3BH9A 5D5MA 1AXIB 1HQRB 4CVZA 1X4YA 4CDGC 3BKYL 1RFDL 5DQJA 1LP9F 3Q48A 3QG7H 1KYOK 5KTEL 1YUHB 1S7QA 3KS0H 4Q0XL 5DDHB 4YZFE 1J86A 4NHUB 2BFVH 4I48A 4R7DB 1R3HA 4KFZC 5D72L 3JBG7 3HS0B 4N8CH 4ZUWA 3VWKA 3ES6B 5IB1B 1T1YA 4JQXA 3SKNA 5IBLD 1HH9A 1CBVH 1X5XA 3MA7A 1CLOH 3UO1L 1UKQA 2CKBB 3S4SB 2XRAH 1CU4L 4H0GA 5ESAA 3TBVA 4AJ0A 1RULL 4Y7MA 3FN9A 4XVTL 5DMKB 2BVPB 3SDXF 1DBML 3ULUH 3G5VB 2C1OB 3MGTB 3QBTB 4XX1G 3EGSB 1V05A 2YSSA 1KGCD 1RAMA 1I8MA 4OKVA 4NOFA 2XN9E 5E1AA 4XNUL 4ORGA 3TF7C 1D5MA 3RQ3A 1CGXA 1K8DA 4Q2ZB 2HVJA 1BX2A 2DD8H 5JR1H 4U6YB 1F3JB 3BO8A 1JPGB 3I6GA 3WJLC 1KB5H 1AC0A 1BGXH 4BFIA 4C83A 1OF2A 1OAUL 2X6MA 1TZIA 1K85A 4G8GB 3IJYB 2P5EB 1VKXA 2DQHH 4W81A 4Z7UB 4G42B 4Y2DA 5AZ2L 3EDJA 4WTZG 3MRPB 2OK0H 3VWJD 3K1DA 4W6YB 4NQEE 1OAKL 1YYLH 2R1YB 4XCYA 1I3GH 2J8HA 2K3TA 4HHAB 5HDQL 5GGTA 3WE6A 3KXFB 3QUKA 3NCYS 2OTUA 1I1CA 4I9WD 2H3NA 4MHHI 1UJ3C 3TO2A 1WBZA 1FVEA 4ODXB 1INEL 1AD0A 5I8CA 4POUB 1NCWL 5GGTL 3RPKA 2GSGB 3S37X 2A1WL 2V5SA 4U3XA 1MY5A 5I1IL 1ZT4B 3KPRD 3UJTH 1UM6H 3U82B 1QBLL 1NMCB 2VLME 3IFOA 2CXKA 2P24B 2UWEE 4KVCH 3STBA 4JY5L 3MUGB 1A7QH 2J5LC 4GXUM 5TGBA 3SCMB 1W2KT 4O2FA 4ZDHB 1YNLL 3QSKB 1RUKL 1WAAE 5FK9A 3OR7A 3EO0B 1S9VA 3EUUA 2BERA 2ZCKL 5FA4A 5J9PA 2MNUA 3VFPB 5TE4H 3FO9B 3M07A 3OPZL 5L2KD 3ZTNH 4QRQA 3PL6C 5T1MA 4PJFE 4XVJL 1YC8A 4N9GB 3NABL 3GNMH 1QFUL 1YEDA 4HJJH 2NR6C 4FQXB 3H0TA 1ODAA 2DYPD 1IKNA 5FYLL 5E56A 4DAGH 3KPMA 3D87B 4BZ2H 1C7SA 5FGCB 3DXAD 3L7EB 4PB9H 3P77B 1U8OA 3BH8A 5IFHH 3D9AL 1TZGL 4L8DB 25C8L 3BUYA 3Q3GB 4XBGB 3WN5A 3DROB 4J6RH 1R3JA 3RWHA 2X9XA 4A6YH 3RVWC 1WFNA 5E24E 2ESVD 5ADOL 1V3LA 2FIKA 4PTTA 3MOBL 4XPTH 5EIIB 4NQTA 1GC1H 1W8NA 3H6JA 1SY6A 3MRRB 2O5ZL 1S78C 4OTXH 4Z7NF 4ODSH 4MNQA 3CMOL 1R5WA 2AK4D 3QPQC 3KYOB 4TPRL 2NY3B 3OKEA 1DJSA 2BHZA 4F7TA 2WNGA 3RY5A 1WWCA 2B1AH 1TQBC 4AEHL 3B8SA 1J87A 4N9OB 4HEPG 1MCWW 5DXWA 3TH2T 1IGTA 3C5ZC 1BFOB 3DTXA 1EHLL 1B0RA 4ESKA 4MLIA 1OAXH 5D1XA 1QSZA 5HY9B 1Y6NR 3HE6A 5D2NA 5JW3H 2HTLD 2CGRL 4LLMB 1FG9C 1NSNH 4R0LB 2UYLA 4ETQB 4BELD 4NUJA 1IEHA 5FO8B 5I19L 3B83A 1BJ1J 3WO4C 3HR5A 2LVEA 3GMMA 4U1NA 4YFEA 1ADQH 1K8IA 4KJQC 2AXFB 5ILTL 4MXQC 4DKFL 4MZ2A 4X7SH 3OHXA 2XZAH 4L29B 1J0KA 2OYPA 1DQDL 1DQLH 2V7NA 4YWGL 3LKSA 4ONFL 5I1LA 2YD5A 2Y6SC 2A6IB 3M1BA 2YD3A 4MXVE 3CU1A 2ATKB 5D7KD 2XIDA 4KZDL 1A7RL 4H1LB 4F3FA 2EDOA 5E0QA 4CVUA 3TA3A 1J5OL 4KMTH 1B0GB 1ZLUK 1RZ8A 1ONQA 3E3QE 1NGPH 4K94C 4RFOL 5FGBA 5E2UH 5KVDL 1D5BA 4F7PB 1PBYA 3CLEH 3U0TB 1A6ZA 4K3GA 3HRPA 4FQLH 3TBYA 2VABA 2FYYB 1BZ7A 3IFNL 5D1ZA 3HI6L 5I8OL 3SDAB 2MHAB 1ZGLA 4ZQKA 2C7UA 1NKOA 2H45A 4M48H 4LSVH 4G80B 4DN4L 3F6LA 5GGSY 1BQLL 5I6XB 3NTCH 4ONHB 3RZCC 3L7FA 4F8TA 5HDOA 2XNAB 3REVB 2Y36L 1HILA 3H9SE 2BNUA 2VDQL 2EDBA 3VFNB 4KPHH 3BGMA 3SO3C 2EDYA 5IBUG 1Z5LB 3MV9B 1IGFL 3RGVC 4N0UA 2BVUA 1JGLH 3E0GA 2E8YA 2WBJA 2XKNA 3BRFA 2GK0A 4Y16A 1ZAGA 5MENB 3VXNA 4HUWB 5BZWA 3NFSH 2FO1A 4FQJH 3FFCB 5EZJA 4ZUUA 4RISH 3FONB 4OZGB 2WIMA 4DGIL 2YD2A 5E9DA 3GKZA 3PV6A 3OKLA 4TTGA 3A6OA 3B2UD 5MEOA 5FXCH 1V7ML 4LEOB 2E5EA 4TVPH 3VXUE 4Z5RB 1IZJA 2F19H 4OGAD 5DLMH 2GTWB 2N4IA 1TVDA 5EUOB 3VGHA 1HHGA 4UDTA 1BVLA 1QEWB 4JY4B 1RUPL 3W0WB 2VXTL 1MVUA 1PKQA 5AWNH 3D2UA 2IFGA 3V6OE 1JZ6A 4P3CL 4PY8I 5EORL 1WVZA 3AS0A 4N5EC 4NM8L 2V17L 1BAFH 3DECA 1UGNA 5ISZB 2R15A 2Q8AH 1MCOH 4RAUA 4RZCB 3KYAA 5AEAA 1ZLSL 4L3AA 4O4YH 3RTQB 4G6FD 5DJCA 3DARA 2Q20A 2GFBA 2PXYB 4X4ME 2GJZB 4I13B 5KVGL 2YA0A 4ZNEA 1T1ZA 4PRID 1G6RA 4MQXD 1WZ1H 1ZE3C 4XCEA 5F97E 4KWUA 1P7HL 1G9NC 3LH2H 1RHHB 4UAOC 5EOQL 1A7OL 2DQCL 4L3EB 1W72H 4PJXE 5INCB 4NQVA 1BREA 4HS3B 1AO7E 2E9JA 3SE9L 1G6RL 3FMGL 4WI3A 3U83A 4LRNL 5AUMB 5FGCE 1GJIA 1SJVA 4P2QA 3JV6A 2ZPKL 2BMKA 3NH7H 1J8HE 4HKXA 4JRYA 1FORL 3O9WB 1ZHBA 4XVSH 4NJ9H 3VE0A 5HYJA 4EOWL 1LEGA 3WJLA 4FA8A 5I71C 4WI4A 3RVVD 2PF6A 4JFOA 5D6CB 5MEQB 4HIEB 1MQKH 2ED7A 1I7TB 4QYOA 1A2YB 5FO9A 5A43C 1V3KA 4AG4H 4HF5H 4ELMA 1I1AC 2FWOB 3RPIB 5DO2D 5FUOH 1I8LC 5L7XH 1OM3L 3MBEB 4P2OD 3RWDA 5CSZB 4F15C 2MCPH 2YBRA 1J1OH 1FJ1B 2FEEI 1ZWIA 4U6XA 3KPSD 4LASH 4NWTH 4EDXB 1EEYB 2X10A 3FT2B 4M6OH 4XP6L 4LMQE 4TQEH 5HGDB 1CGSL 1T21A 2QQKL 2ICEA 1KIRA 3G5XB 2VXSH 4TTDC 4ODUA 2GYSA 1A47A 1N3NA 4U1LB 1C5BL 1TJIH 4NOBA 4MAUH 5BRZE 1KN2H 2GJ6D 4QT5B 1UYWH 4X7DC 2VZUA 1HKLL 1DL7L 3SJVD 3QPXL 1SYVA 5HGBA 1EVUA 4XAKE 2IAMB 4ZAKC 1NCTA 3MV8D 2ZSWA 5CFHA 4JLRA 2I5YL 4LEXH 3DGCR 3P9MB 2VLKA 4E0RA 3T0DA 1YEKH 3HE7C 3EYOA 5CIPA 4M9PA 1EFQA 3G6DH 3GSNA 5JO5B 4PLOB 1KYOJ 3BDYH 1ZGLM 2Q7NA 1PQZB 1I7ZB 1JZ2A 4XNXL 3G08B 4I77H 1R24A 1H0DA 3QDGA 3D0VB 3BP5B 3MROA 1S3KH 3OAUL 3UTTA 3JWDH 1SJEB 3IFPA 3E6HA 3PL6A 5FA3A 1FYTD 4GBXC 3ME0A 1U58B 2EDTA 4XCCH 5C0CD 3WXVH 5I73B 3QCTL 2PO6A 4K3JL 5T3ZL 3WLWD 4K3HA 5T1LB 4I0PB 3OKNB 2D7QA 4JKPL 2NPLX 1EVTC 1HXMB 3OAYH 3U36B 2AJ3A 3HI1A 1N7ML 2ZSVA 4JFQB 4KXZI 4JFDE 4YDIH 3GO1H 3BP7A 3TJHC 4WWKB 4AEIL 4YXHL 5CEZE 5F88B 1C16A 4WY7H 4XNZB 2FHFA 2OL3H 2R1WA 4KVNH 1A5FH 1M7DA 1NLBL 3IETA 2I9TA 5DMGC 3TBTB 3RY6A 2BY0A 5IM7A 4MQ7B 5JHDA 3PDOB 4QRSB 4X9HA 1NAMA 4X7FC 3HPLA 4JM4L 1AKJB 3W5MA 3BISA 5IFJA 5BO1H 1V7NH 1C08A 4NUGL 4YDVB 4M9OA 2IPTH 1A6WH 2CMRH 4JO1L 1JWSA 4WJ5A 4NBZB 4P5KB 1VACB 5HPMB 2H1PL 4YXLH 4FOMA 5DRXB 4TOYH 1INQA 2R8SH 4GSDL 5CUSL 4PJAA 1G0XA 4OZIF 1Q9OA 2XXMB 3X17A 1A8JH 3GKWL 3LS4L 1IGJB 3KPPA 4PP2B 2DTMH 5H2BA 5HYQA 2PTTA 2D31B 4JFZL 3L3GB 3MV7D 1FCGA 3PWPE 2WANA 5DJYB 3CZJA 3SKOB 4IIQB 4G7YL 1JGVL 4YFDB 3EOTL 3EO9L 5FOBA 1KCUL 1MFBH 4O02L 3TN0C 3FO0L 3T0ED 3RL1A 5CD5C 3QUZD 2BY1A 5ACLA 2YUVA 5C0BB 5SWZA 4RDQF 4Q9QL 1CFVH 3MNWB 3ZE0E 1YPZF 3GJFH 3TWCH 4PRPA 2R23A 3ECBA 3LAFA 1F11A 1A0QH 2P7TB 3BD4A 2YWZA 3MLXL 4Y1AE 1CFNB 3I9GH 3WKNA 3E6FB 1S7RA 4LLWA 1BBDL 1IAIH 2Z92A 1JZ7A 4NBYB 3VD7A 4JFEA 1FLRL 4L3EE 3ZYIA 3MREB 5BV7C 1DUYA 4PJ5D 4XP1L 4MQSB 5EBLB 3V8CA 3ZDXE 2BSSB 1AI1H 4D2NA 4N0FA 2G2RB 3ARTA 2YN3A 2NYYC 2G60H 5HHOE 2MTPA 2VN4A 3E2HC 1UZ8B 3JTSA 4FXKB 1U91B 1IGIH 2R2HB 2O5YH 1K2DB 4NFCA 3WNLA 5C9JA 5A2JH 1D3CA 1LILA 4XPAH 3OR6B 1TTGA 4RMQA 1AXTH 3S36L 2MKWA 3ZTJH 2PYEB 3S7GA 4NN5C 3E8UL 5HHPA 1UCTA 1G1CA 3UJJL 3RGVA 3N9GL 1ZGLP 4K8RD 1D5XA 5JW4R 1NL0H 4HJ0D 2BRQA 5HHXL 2D03H 4JHAL 5DR5H 2DI7A 1LO3H 3DIFA 3PP3K 1H5BC 4WUKH 4R4NC 3QWOA 2WUCH 4ZUTA 5H94A 4QXWA 5JW5B 1IQWH 3V0VB 4R26H 5F9JA 3X3GL 3EFDL 1MREH 3E1F1 1KNOB 3ISWA 1NEZB 1YNTB 3RJQB 1L0QA 2OI9B 3N1MC 1U3HA 4PJDF 4GKSB 1Z0MA 5EU7E 4GAJH 1FE8L 5A3ID 4Z7WB 5IGXL 3PGCA 5D7LA 2C3HA 4YE4H 2WSKA 5F7DA 1OTSD 3BDBA 3PGDA 3BJ91 2VXVH 5SX5H 1AC6A 4BQ6A 4V1DE 1JWUB 4X4YA 1N5AB 5ALBH 4ZO7A 2XTLA 4GAYB 4ONGL 2FLRT 4IRSD 5D7IE 1UG9A 1KENL 5F71A 5HJ3B 4PRHE 1HHIB 1CN4A 2CLZB 3RWJA 2ADGB 4P5TD 3I6KB 1T3FB 3SGJC 2FZ3B 1FNHA 5TDOA 4P9MH 4OV5B 1Y18A 3CFDA 1DBBH 4KDVA 4MJ6A 2A73A 5IVOA 3AM8C 2P5WE 4Z7VB 5E94A 3NACH 4ONOA 5EO0A 1F6AA 1EO5A 4XC3L 4L4VA 4WU5B 5J6HA 5TH2B 3U4BH 1IKFL 3IDXL 1NC2A 1HHHB 3BXNB 3PUCA 2UZYB 3RVTC 1R0AL 3S3JA 3BE1L 1C7TA 3QUYB 3QQ3B 5LWYL 5F8RC 2E9IA 2CH8A 1QSFA 2NY1C 4P2YA 4NP4L 4QOKD 5JLZB 3ZHDA 1CLZH 1TPXC 5JW4N 4X7EC 4L8SC 4HV8B 4LCWE 1UKSA 2AEWA 5DZOA 1JHKH 3RX7A 4P23D 1DLFH 1A4KA 4NGHL 1I8LA 1CFQB 3NZHH 4AM0A 4DGVL 4HFUL 5ESQA 4BFBD 1NGWB 3I3EA 4C56E 2X1OA 4R90H 1OCWH 2CRZA 1IM9A 2F54E 2VE6B 5EU6A 5I1JL 2CO7B 4APQB 4JQIH 4U1MB 3BAEL 3AY4A 4F9LA 1WSST 1FV1A 4M7KH 2ARWA 4WW1B 4MD5A 1XEDA 4XRCB 3GI8H 4PRBB 5JZ7C 2J7LA 1ZEAH 2CUHA 3OSKA 2WLYA 1PZUB 5IMLA 4X8JB 3RDTB 2Z31C 2VR9A 5DD0L 4L1HA 1D6VL 2X4QA 5TF1L 3ROOA 5T3XD 4ZAKA 3LEXB 1AE6H 4HAFA 1CR9H 4D9RD 3DI2B 3HE7A 5DVKA 4OZFA 3JV0A 2EICA 3IDNB 3PXHA 4PJ8D 4CNIB 3N1QC 5LBSH 5GIRB 4CDHA 5E6IA 4G9DA 4M6AA 2FR4A 1WT5C 3IYLW 4JFYB 2PW2B 4YDLC 5E99L 2X9YA 5CJBA 3FQTB 5IBLC 3WL9B 1NFDB 3SPVB 3ZDYF 4NNYB 3TM6A 1VEPA 1PY4A 1NGQL 1AGEB 4OD3H 2PTUA 1OP3K 5B3JE 1MCJA 4WTXA 2KUTA 2B39A 5FUZL 4H88L 5LAXB 3V5HA 1EV2E 3MRDA 4FMFA 4GBXA 4JVWA 3LMJL 4PJGF 5GISL 1MI5D 4C55A 1KBGH 5BZDA 2AKRB 1LNUB 3B2VL 4YBHA 1JGDB 4GW5A 4HPOH 4ZXBA 4MA1B 1MJ7L 1OLZA 1PG7W 4YHZH 5LGKA 4Y5XC 3WMSA 5HDLA 3PQYA 4PJCB 4TSAH 1HYSD 1TIUA 2IANA 2Z8WC 4OLWL 4WDIB 5FYKU 5AZEL 3AU1A 1FG2B 3AXLB 1JV5A 3GIVB 2VLRA 4Y19B 4FQ2L 1JUFB 5EU3B 5D1QD 1DANT 3BPNC 5GHWL 3QDJD 4KH2A 4F57H 5FCSH 3VGEA 2VISB 1IC7L 3VXMB 4P3DB 1L0YA 5T3XL 4LGSB 5EUKB 3EFFB 4ZOEA 5L6YL 1KTLB 1K3IA 3LS5H 5DFVD 4D9QD 1AIFA 2N1KA 3NOIA 1CICA 4JCMA 4OT1H 1YEHL 5I1AB 2RJMA 3FO2A 4JQVC 2YA2A 3QP3A 3X11B 1I9IL 3PWUB 3O6MH 1MFEH 3O8XD 1KCVH 3DSFL 4GRLC 3TEUA 2RHEA 4NKOA 3T4YB 2HJLB 3ARED 2ZG3A 3HZVB 4X9BA 2BNQD 3V5DB 4YHLL 4KTYA 3GBNH 4DZBA 4J2XA 3W81A 4HKBB 2C4FU 3HMXH 5SWSA 3HC0B 4AEFA 4QRRA 4FP8H 5DJ2A 5JDSA 5C09B 2ZOLA 3WFHA 5E8DH 3DV4B 1FZMA 5KSUA 4Z7WE 5ETUB 3S36X 7CGTA 3TN0A 4F8QA 2XTJB 2W0FB 3F7YB 3ZHLA 3ULVD 3S34H 3VXOB 3MA9H 5J12C 3NPZB 3SO5A 4DGYH 4RIRB 4PGEA 2HP4A 2AGJL 1P4BL 2EKSB 4IMKC 3IGAA 2XPGB 3CFBB 4KHXL 5JOFB 4LCCB 3K7UA 3F58H 3W9EB 1TVBB 2VDKH 3QISA 4O2EA 4J7RA 1VFUA 5BS0A 2DQEH 5A2KH 1NLDH 4AMKH 4Z7VE 1RY7B 3U6RB 3BH9B 5AAMA 4HS6A 4CVZB 2ATPA 1U3YA 3DGGA 4UI2A 1IAII 4QXGH 5DQJB 5HPOA 3BDXA 1S7QB 2EH7H 4KU1A 4RFNC 5L9DL 2HJFA 4AIOA 3OV6A 4I48B 1R3HB 4PJEE 1A6TB 1MHHA 5F7UA 3VXSA 2OX5A 2CIKA 1MIMH 2XZQH 3VWKB 4YXKL 1T1YB 3SKNB 4QO1A 4WUUD 2HRPL 2XI9A 1KACB 1HH9B 3MA7B 4NN7B 3KYNA 1BM3H 4NZDA 3P4NA 4M7LH 5ESAB 1LEKA 1JL8A 3U7WL 2B1HH 1CBVL 3MYZA 1LP9A 2XRAL 1BVKA 5JXEA 1HIML 3BSZL 4JRXE 4PBWD 4XMLL 1I8MB 4OKVB 4ZFOA 3OQ3B 5E1AB 2DQGH 3ULUL 4ORGB 1WCQA 2YZ1A 1D5MB 3ARDD 4ISVA 1FO0A 2VLJE 1K8DB 3GSVA 2UV3A 2HVJB 2BNRD 1BX2B 3BO8B 4TYUA 3I6GB 4KRLB 5C1MB 2P42B 1G7HA 1KCSL 4RMRA 4BFIB 5KZCB 2QQQA 4P9HC 1WTLA 2HTLC 1OF2B 5AYQA 4IRZH 2R56L 4OI7A 5JR1L 1TZIB 1P6AB 5IWLC 4YGVA 1VKXB 3SDXA 1BGXL 4X6DE 3V52H 4Y2DB 1CGUA 3QB7C 5FYJD 2BOBA 1CD0A 1L7TH 4Q6YA 2A77H 4GKOA 2D9CA 1IGYA 1JGUH 2DQHL 2C1PA 2F5BH 1Z9MA 2JB6A 2UVFA 5FDWA 4R4BA 1ND0A 4XCYB 3WE6B 4A2LA 4TNWF 3O3DA 2OK0L 3QUKB 2OTUB 1F5WA 1NUGA 3QWQB 2H3NB 3TO2B 1WBZB 1NBVL 1FVEB 3SGJA 4ZS7H 2DN7A 4U2ZA 4PGDB 1AD0B 1NMAH 3RWCA 3GHBL 5I8CB 3T08A 2BVQA 4JM2D 4S0TD 2FBJH 4IHOA 4ZTPH 3AM8A 3QWRA 3BN9D 4WI2A 1NFIA 3VMOA 1YJDH 3IFOB 3ULVF 3UJTL 3ZKXC 5MEPA 4YX2H 5TGBB 4WFHD 1GOFA 4O2FB 3WUZA 3X13A 1MCSA 2F74A 4TVSa 2VNCA 3OR7B 5FK9B 5IQ7L 2A9ML 2WWMD 1S9VB 4UUJA 3RU8H 5GJTH 1FNLA 4XPFL 4MA8H 5FA4B 5J9PB 4J3SA 2MQ0A 3B8YA 4H1LH 1KTDB 4QRQB 2E6PA 5T1MB 1TJHH 1DQJA 2KQMA 1JZ3A 3MLSL 4HD9A 3BEWA 2G75A 3KYKH 1YEDB 4HPYH 5BVJA 5I75B 4TULH 3TVMA 3H0TB 4PG2C 1BEYH 4WEUD 2HYMA 2I27N 5E8PA 3GNML 3KPMB 3QEQA 1XIWD 4NZJA 5L0QC 2IPUK 2EXWD 4HJJL 4TNWK 1U8OB 3BH8B 2ZP0T 4LP5A 4WI5A 3B2UC 4R2GB 4DAGL 5HBBA 1Q1JL 1GCFA 2Q6WB 4OGAC 4UU9A 1OWRM 2AQ3A 3BUYB 5T33H 4LK4A 3WN5B 1R3JB 4NFDA 3RWHB 4R4FH 2OZ4A 2Z31A 5T5FH 5E2JA 3MOAH 1QVOA 1BD2E 2FIKB 4PTTB 3PG2A 4HW6A 4J6RL 4JFFE 5LJYH 3MZTA 2FRGP 5B4MD 4A6YL 4MNQB 3T77A 3S5LA 3WJJA 1R5WB 1IC4H 2GTZA 3I3DA 4XPTL 3O3AA 4Q7DA 2XTJE 1GC1L 4JFPA 4S1RH 3OKEB 5DJ8A 3KHOA 4F7TB 1F4AA 4OTXL 2NY6C 2J4WL 1WT5A 2NY5L 2WBKA 2HFTA 4ACPA 1BJMA 4FFZH 4MQXC 1IGTB 1ZT1A 2X40A 2UY6A 4OV6F 5F1NA 1OT2A 1IVLA 2B1AL 4MA7L 5CEYA 3DTXB 4D8PA 4EJ1C 1B0RB 1NUNB 3VG9B 2PUQT 5D1XB 1QLEL 3QUMA 5DI8A 3UP1A 1U2CA 2Y7QA 3K74B 3HE6B 5D2NB 3U7AA 3LEVL 5EA0H 1GGCL 4ZO8A 1FH5H 5BW7A 3IF1A 3QYCA 5D5ME 5DA0B 2UYLB 1VADB 4LARL 1CIDA 5JW3L 3QUML 3HR5B 4O5LH 1G7MA 3GMMB 1PX4A 3F7PC 4U1NB 5A2IH 3LPFA 1K8IB 3VXRB 1NSNL 5EIVA 3OHXB 4KRMB 3BIKA 5FOJA 3C09C 5B21A 2V7NB 3B9AA 3LKSB 3MO1A 4HCRA 5I1LB 5L8LB 4DEPB 4X7SL 1YEIH 5BMFH 3M1BB 3OKKA 4UQ2A 3HFMH 5DO2C 4JM2F 1DQLL 4F3FB 4P2OC 3TA3B 2BDNH 2IMMA 3BWUC 4B53A 1YEGH 4BQCA 3TFKD 1RZ8B 3WIIH 5DJ0A 2VH5H 4TVPD 4OSUH 1D5BB 1AHWC 1AJ7H 2JIXD 1AFVL 3ALXA 1A6ZB 1UACH 3EHBD 3IDIA 5DVOA 3MV11 2J8UF 4NNXA 2VABB 1BZ7B 5D1ZB 1F4HA 4FNLL 5E2UL 3MX0A 3LQAL 5I30L 1ZGLB 3CLEL 4ZQKB 2C7UB 4EQ3A 4FQLL 2HT3D 3MLRH 5DRNA 4GRLA 4L4TA 1MJ8H 3L7FB 4H8WL 4FQ1L 2XFXA 1H3WM 1HILB 2BNUB 1TQCB 1WK0A 3NTCL 2L4OA 3BGMB 4CAGA 3JWOH 3LEYH 5CP3H 1YECL 4N0UB 2OP4L 4N8PA 2WBJB 2C4XA 5HHQA 2GK0B 2VRAA 4Y16B 1OGAE 4I3RL 2NY0B 3VXNB 5CHNA 5BZWB 3ZKQD 2ADFH 5EZJB 2UUDH 4ZUUB 1JGLL 3FQXA 4U0RC 3V6FA 3QAZB 4PIRF 4O51A 4UV4L 1JVKA 4WWID 3O3BA 5E9DB 3NFSL 3PV6B 2E7BA 3BN3B 4FQJL 3OKLB 5L2KA 4IMKA 2M1KA 4RISL 1FN4A 5CLTA 5MEOB 4QHNA 4FQCH 3L9RA 1RJYA 4HWBH 1Y6KR 4LDLB 3QNZA 3P9WB 1KGCE 2XWJA 3WLWC 4ZPVA 1HHGB 1BVLB 4FHBD 3GM0A 4HUKB 1MVUB 1PKQB 2F19L 1UWEH 3D2UB 5DLML 3DXAA 3RNQA 1YMHA 1QYGH 4MHHG 2IG2L 3OKMA 4NC1C 5IV2A 2KPNA 3I2CH 3QCUH 5F96L 4RAUB 5LG1A 4G9FD 1J05A 1UENA 5DJCB 1UKTA 5D2LE 2AEPH 2GFBB 4IRJD 1LMKA 1T1ZB 5FYLE 1G6RB 5E4EC 2HFFA 1G0YR 4O4YL 3J8F7 4XCEB 4S1QH 5ADPL 2A38A 2XQBL 2AK4A 4NQVB 4QRUA 1WZ1L 3VGDA 3SDCA 4MVBD 4I9WE 4ZTOH 5AD0A 1W72L 4NT6A 4P2QB 3WIFA 3JV6B 4XAWH 1GXEA 2BMKB 2A6DA 4HKXB 3QI9A 4OF7A 3X3FH 5F7FA 1I9RL 4D0BA 1ZHBB 3KPRE 1VGKA 4HFWA 3VE0B 5HYJB 4AY0A 1KPUA 1LEGB 1ZVYA 2XWTA 1QSED 4JFOB 4LSRH 2BSRA 1LGVA 4XVSL 3FQWA 4QYOB 5FO9B 3T0EC 4ELMB 1ERNA 3TC9A 3QUZC 1MQKL 1WF5A 3BESR 5E5MA 1N6UA 4JGJA 5CS7A 3RWDB 1IE5A 4XP5H 2YBRB 4AG4L 4HF5L 4M02A 1QZ1A 1ZWIB 4Z6AT 4U6XB 4WW2F 3DVIA 1T0MB 1MY7A 4OZHE 4PBVC 4NQDA 1T21B 4WTWA 2MCPL 1J1OL 2ICEB 1KIRB 4OBRA 5F93C 4NWTL 4LASL 1N3NB 3IRZA 4M6OL 4TQEL 4BSVA 4ALAL 2BVEA 1NGXB 4NSKA 4ODWA 2LU7A 1BQHG 4WCYH 2X4UA 3MBXL 4X9GA 3QDAA 1SYVB 1RURH 5HGBB 4MAUL 3CSBA 3WFBL 2ZSWB 4JLRB 3V95A 2VLKB 2E9WA 2FBOJ 3D39D 5CIPB 1VHPA 2NX5B 2QR0A 4NO5A 5KG9A 3GSNB 5CILH 2J5LB 4YHMH 1P7QA 2XYCA 1IL1A 2JJVA 1FSKC 3IDYC 1FNSH 1R24B 1H0DB 2YRLA 3QDGB 3G6DL 3MROB 5CBEA 3QO1A 3BDYL 3UTTB 3BKCL 5FV1L 3K0WA 3RWEA 1LQSR 3P0VH 3IFPB 3E6HB 3PL6B 5DFTA 5FA3B 4K8RC 3OG4B 1S3KL 4HJ0C 4MJ4A 4LDEB 3EZ8A 3JWDL 4R96A 3FHQA 4K3DH 1JTTA 1C1EH 1T83C 4Z95L 2PO6B 1IBGH 3WUWA 3PNWA 2NY2C 4TRPH 1NBZA 4Y4KA 1XF3A 2P45B 3FL7A 2AJ3B 3HI1B 3UDWA 4P59H 3MCG1 2ZSVB 5EZIH 3HLAA 2EXYC 1ZLWH 2EYTA 3BP7B 1T22A 2VZTA 4GG6A 1C16B 3OJVC 3TZVD 5SWQA 5TE7H 5D96B 3BMWA 2R0LH 4HXAL 5J56B 2R1WB 4P46C 1XT5A 2EZ0D 3GO1L 3O6KL 1C12A 4GMSH 1M7DB 1CK0H 3IETB 3DUSA 2I9TB 4PREA 4KUZH 5A3IC 4WY7L 5IM7B 35C8H 5JHDB 1XH3A 3B6SA 2NCMA 5HDBF 4OFIA 1NAMB 5EH1A 1OTSC 2FGZA 2HLFD 3HPLB 3VD3A 5K9JH 1TCMA 5IFJB 1YMMA 1C08B 3SE4A 4IRSC 5DZNA 3V4VL 3BPLC 1S9XA 2CDGA 1JWSB 4WJ5B 1BFVH 1V7NL 3RAJH 3ARSA 3H3PH 4P5TC 4PJAB 4J23A 3MCLL 4FZ8L 2IPTL 1Q9OB 1A6WL 2CMRL 3ARVA 1X5GA 1AY1L 2DKMA 3KPPB 4YXLL 5H2BB 3IU3A 1CLYH 5HYQB 2PTTB 5DT1H 4N0RA 2W9EH 1NCAH 3DVGA 4MQTB 3QHZL 2DTML 4MNGA 4DJMA 2EC8A 2GITA 3BHBA 1S7VA 3BI9X 5FOBB 4AIZA 3TO4A 3BKJH 3RL1B 1RZKL 3WO4B 1MFDH 1TFHA 4FQPA 4OZIA 5SWZB 2XQYK 3R0NA 4YHNA 1A9EA 1DTUA 4HIIA 3OB0H 4K71C 3L95A 4PRPB 5CZKA 2R23B 4EIZC 3ECBB 4P2RA 2XN9D 4KK8D 1F11B 4QRPE 1I1FA 1DQTA 3VFTA 5HSFA 4P23C 4KI5E 3EJYD 4UTBL 2E6JA 4IM8A 4OQTH 5I1CL 1G7IA 3QG6A 2FX9L 5LQBL 1S7RB 4P2OA 4I18C 4LLWB 1A0QL 2DQJH 2Z92B 5DF0A 3NFNA 4JFEB 4NBXB 4IMLA 1MRCL 3I9GL 1F4WH 1T03H 5J3HD 1S9WA 1IAIL 4FQQA 1RZJC 4LHUG 4K7PY 1MF2H 1NCCH 4DVRH 1QLFA 2EDLA 4P2QE 1NUDA 4KTEL 1Q9WA 2CSPA 5GJSL 3U30C 3NIGE 1AI1L 4CVXA 1OVZA 1V5JA 2BJMH 2GJ6A 4JRYE 1JMXA 3KS0J 3JTSB 5C9JB 4OM0H 3KPOA 4HUXA 5C0DA 3L3HA 2PN5A 3ZT5A 2WP3O 3LV3A 5CWSA 3ARGA 1IGIL 5KSBF 3SO3B 4GLRH 1C5DA 4RWYH 2R0ZH 5DD6A 4ELME 5HHPB 5IB5A 1MRFH 2P44B 3RGVB 4PJ8C 1AXTL 1OAZL 1QRND 1YEEH 1E4XH 4DTGH 1EUUA 2XA3A 1D5XB 4EQ2A 2F5AH 1CDHA 1KCKA 4NQCA 1EGJA 1M05A 3TBSA 4DUWA 1H15A 5ECJE 3F5WA 2OR9L 4HC1A 4X6CF 5IT2L 1LE5A 1QR1A 4CMHC 3DIFB 4WENB 1NL0L 3V0WH 4K07A 3NGBC 3QWOB 2W60B 4ZUTB 4KV5F 5H94B 2MMXA 5DR5L 5T1KD 1EGJL 1HQ4A 2VKXA 1FYTA 4A2MA 3EIFA 5F9JB 4WUKL 3K4DA 2F8OA 4HC1L 3EOAA 3HAEA 4X7TA 2WUCL 5FKPA 1WJ3A 2Q86A 3WNNA 1B4RA 1U3HB 4R26L 3NFPA 4ZO6A 4OUOA 4PJIF 4PJHA 4HK3J 1MREL 4YDKH 3C08H 1HYSC 4NO3A 3PGCB 5D7LB 1KIPA 5F7DB 3PGDB 3VFUA 1VPOH 1FQ9C 4X4YB 3STZA 5D1QC 3UPRA 2V2XA 1KXQE 2VXVL 4XP4H 4NHCL 2WZPD 4J3WA 2BHYA 3RWJB 1SHMA 2OLDA 3MODH 2WUBH 4HDIB 4PJDA 3KPSE 1T2XA 1MFNA 3ELAT 5DFVC 1Y18B 3CFDB 4Z8FH 4MJ6B 4KI1A 2A73B 5HD8D 4U6VL 5E94B 3O4LA 3PWNA 4TN9A 4WGWB 3Q2CA 5EO0B 1T2QH 2E6QA 2VR5A 4JPWL 1DBBL 1F6AB 1J12A 3NCCB 4L4VB 3O8XC 1WV7T 4YO0B 3BW9A 1NC2B 3AREC 4NQSA 3SJVE 2QHLA 2H2PD 2ZUSA 3U4BL 1Z3GL 3HCVA 5D7JA 1QSFB 3DYMA 5GZOD 1LK3H 1GYAA 1MJUH 5I71B 3TPUA 1KJ3H 2APXA 3DX7A 2OSLA 4OGXL 4U1SA 1SBSH 4AENA 5DMJB 1U8MA 5DRWA 1RV6X 3U0WH 4U1GB 4CN1A 2YD9A 1A4KB 1Q9LA 1ZHKA 4KMLB 1CS6A 4D0DA 2AJYH 2R69L 5GRUH 4AM0B 3ULVC 2DBLH 1NDGA 5ESQB 1IM9B 1UA6L 5EU6B 2EDHA 3T0XA 3NAAH 4Z0XA 2NTSP 2XZZA 1U36A 3NZHL 1ZVSA 2DM4A 1FV1B 1CDJA 4R90L 1OCWL 4MD5B 3INUL 4UB0H 1KC5H 1RZIA 5EFIA 1ACYH 4JQIL 2BXZA 4ZOCA 4FFYL 1KPRA 2IFFL 5IMLB 2V6HA 4M7KL 4Y88A 3GI8L 1UFUA 5DUMH 2X4QB 3ROOB 2XKUA 5GS0H 2ZUQC 4ZAKB 1H8NA 4NC1E 3RHWF 3S5LG 2X4TA 1R3LA 3HE7B 1P5VA 1N4XH 5IVNA 4OZFB 3QDMA 3K1KC 4KKLD 3GMRA 2DQIL 3U1SH 3WV0A 5E6IB 1CR9L 4G9DB 3LZFH 2H41A 2FR4B 3O6LH 2W9LA 2UWEF 3B3IA 5LBSL 12E8H 1OTUD 3EYVA 1P2CA 1N64L 4WV1C 4BSWA 1K4CA 3G9VA 1WBYA 1WAAF 4MDJA 2CUIA 3BKYH 5IHUL 4XCFL 3CK0L 3V5HB 3MRDB 4GOSA 4Q0XH 3CFKA 4GBXB 3CVHA 1V3MA 3QIBA 1SMOA 5BZDB 4HULB 1KXTB 4GW5B 4ZXBB 15C8H 4Z77A 4MD4A 3BP4A 3NIFE 3THMH 5I66A 3ARDC 1KBGL 2VDLH 3ZKMC 1KLFA 2FB4L 3PQYB 5ITBH 3UPAA 4PPTA 2IANB 3MV7E 4HPOL 3LKNA 4RBPK 1CU4H 3AU1B 3Q5YA 1JV5B 1OL0A 2VLRB 4YHZL 5KJRL 2D7TL 3QIUA 1ZKAA 3ESUF 2GCYA 1RUQH 4XWGH 4LVOC 1QACA 4E42A 1J0IA 4P46A 1XGUB 5DJDA 1K3ZA 4PJGA 5D9SA 5JIIA 1FL3A 4HH9A 4R7NA 5DMKA 4W4OC 4XNUH 4F57L 2NQCA 2HLAA 2CKBL 3EGSA 3U4EA 4F33A 1AIFB 3CFCL 5BOPA 5C0JB 4KK5D 3FO2B 3LS5L 1X9QA 4U6YA 4OT1L 4M3JA 4RAHA 4U2YA 3TT1L 1TJGH 5C70A 1RUML 4PJ5E 4NKOB 3BZDA 3O6ML 1G9MC 3HC3L 3RL2A 1AGBA 3UTSA 4G8GA 4JM2C 5DHXB 4DZBB 1KCVL 3TT3L 3BN9C 5SWSB 1JF5A 1OAKH 4QRRB 2OJZL 2YPLA 5HDQH 5DJ2B 2VZ3A 3D6GA 5JDSB 2ZOLB 3GBNL 1CTNA 3WFHB 1FZMB 3DHMA 3V5KA 3HMXL 5F1IA 5KSUB 4Y0GA 3TN0B 1F58H 5D7LE 5HTSA 1MCRA 4FP8L 3DBXA 3B9EA 1QFPA 5C3TA 3P4OA 1CXKA 4BZ1H 2WWMC 5E8DL 1VFAA 1NCWH 5GGTH 3UC0H 1AO7D 2WQRA 5A2LH 4PGEB 1HYRC 2A1WH 5I1IH 3TBWA 4LU5H 3P30L 2QADB 3IGAB 3S34L 3MA9L 1QBLH 2L7UA 1M1SA 4PB0L 4DGYL 5TDPA 4P23A 4JY5H 5DJXA 3VCLA 3DRTA 4MLSA 5I0ZA 4O2EB 4I18A 5BS0B 4MXVF 1YNLH 3ZE1E 1XIWC 2GIYA 1RUKH 1U8PA 5BV7B 2CJUL 2EXWC 2XACC 2PCPA 5I1HL 3O45A 4HS6B 3QIWD 5D6DA 1L7IL 3SCMA 2ATPB 2NW3A 3DGGB 1A6VL 1NLDL 2Z8VC 3OPZH 1D5ZA 5HVHB 4GW1A 4Q6IC 3MYJA 2HJFB 3L3KA 5DUBA 4G8IA 2DDQL 1QFUH 3E2HB 1MHHB 2NY3D 4QXGL 3HZKA 3VXSB 2CIKB 1SVZA 5DYOA 4B41A 5B4MC 3D48R 3KYNB 4PR5A 5IJVB 3P4NB 4OUUA 2XZQL 4N8VG 3CC5A 5BRZD 3IDMB 1TZGH 1LEKB 2FLBT 4OAWA 4PJ8A 1X6NA 1MCNA 3D3VB 3JV4A 1LP9B 4POYA 3IDUA 2OXGA 1BVKB 2F15A 3DETD 4KDWA 4M7LL 1MSPA 3FT4A 1GRWA 1JZ5A 2GUOA 2B1HL 2CRYA 3L3IA 2VZVA 1QFOA 4ZFOB 1EBPA 3MOBH 4M7LT 4OI8A 4ISVB 1FO0B 3GSVB 4Y2OA 4BQBA 2O5ZH 2YRZA 3BZ4A 3CMOH 3I75A 2IBBA 1G7HB 4PRDB 1MI5A 4EVNB 2IH3A 3P4MA 4P3WA 1CQKA 2DMKA 3U48A 1KUMA 2HH0H 1EEZA 4K3EH 2MJWA 3BD3A 4QHKJ 4YGVB 3SDXB 1PVHA 1P84J 4HS8L 2MQ3A 4PD4K 2BOBB 4Q74A 4U3HA 4LKXA 4W70A 2W91A 1IGYB 1RJLA 2C1PB 1ZLVK 1DVFA 2JB6B 1EHLH 3EYFA 1J11A 2GY5A 3KLAA 5FDWB 4R4BB 4RMSA 1ND0B 3H7BA 1L7TL 1CF8H 3QDJA 5K33A 5DD1L 1G1YA 3HA0A 3O3DB 5C86A 2CGRH 2F5BL 2HMID 2D4FA 2HA1A 3SDAD 5HYSA 1I3UA 4JFDD 4YHOH 5I19H 1UH2A 5EN2A 3TFKC 1JPSL 4L3CA 2C9AA 3RWCB 3M45A 2BVQB 5ILTH 7FABL 1C8PA 2R0WH 5KAQF 3EHBC 4IHOB 1F02I 4LPYA 3L5XL 2IBZY 5I9QC 1JPST 3SBWC 4ZS7L 1NFIB 1MQ8A 4QXUH 4YWGH 3MRLA 4ONFH 4WW2C 4PJXF 2FBJL 4L4JA 3MV9D 2HT3C 1II4E 5MEPB 4KZDH 4XWOD 1UWXK 4R9HA 2P8MA 2IANE 3AREA 4WI9A 5T3XE 5MEND 2BNQA 4YLQT 1YJDL 3X13B 1F45A 2F74B 3FFCD 5DVMA 4UUJB 2BCKA 3S88L 4D9RE 1I85C 3B5GA 1TPXB 3IFNH 5EOCL 2E3VA 2OM5A 3HI6H 4OF5A 4R3SA 1ZA3A 4ZFZA 5I8OH 3U0TA 4MA8L 1DQJB 3V4PL 1P1ZA 1RIHH 3CVIL 3BEWB 3SEPA 2G75B 2OMBA 4DN4H 5BVJB 5MHSD 2VN7A 3H9HA 3TVMB 1BQLH 3R1GL 3WUWG 3C6LA 4JB9H 5IQ9A 2AABH 3PWPD 1BQUA 1OP5K 1TJHL 5E8PB 1G6VK 1X5JA 3QEQB 3W0WD 2H32A 4HPYL 1VB9A 1M7XA 1BEYL 1ZXQA 2YUZA 3FB6A 1NCUA 5IMOA 4UU9B 1XF4A 4FQIH 3IXTA 3WFCH 5IK3A 3TESA 5IP4A 5GRWA 2Z31B 4GW4A 1UCBL 1QVOB 3NIDE 2BY3A 2PXYD 2PYFA 5DGQA 4X8XA 2FECI 4DGIH 4Y1AD 3DHJA 1CQYA 5DVNA 3UROR 5C0IA 2QQNL 5T5FL 2JJSA 1J18A 2HAZA 3MOAL 2B4CH 3S5LB 3T77B 5F6IC 1CCZA 1V7MH 3EAKA 4OZGA 2GTZB 3CD4A 3O3AB 1CFSA 4LSTL 4JFPB 4L3ED 4LPTA 5DJ8B 2E27H 1F6FB 1IC4L 2L7JA 4YDLB 2VLLA 1RUPH 2ZG1A 2JKXA 4WEMB 4WUUA 4IRJC 2VXTH 4YAQA 4PV9A 4UV7L 3WNOA 2A6JA 1ZT1B 1MHCA 2VSDA 4WV1A 3SGKC 5F1NB 5EORH 5FGRA 5HHOD 5H35A 2LU4A 5CEYB 3O6FD 5DMIH 4D8PB 4NM8H 2V17H 5FCUL 3QUMB 4WGVB 5DI8B 3MXVL 5IVZA 2Y7QB 4MVBC 1ZLSH 1J1XH 1U0QA 5T1DL 3IF1B 4L9DA 3EZJB 3WLBA 2VTFA 1BJ8A 2RBLA 5KVGH 4RZCA 4ZODA 3ARDA 3W2DH 5EA0L 1FH5L 2OBGA 3ZKSD 4P2CG 2EIBA 2FX8L 1W0VA 3BIKB 4O5LL 2IEPA 3BPNB 1EAPA 1IAOA 3MO1B 4HKZA 3D69A 1HKFA 3SE9H 1G6RH 1FC1A 1SQ2N 3C9NA 3ZLQC 3O4OC 3FMGH 3DYPA 3OKKB 4UQ2B 4LRNH 4OCSH 3T0VA 4UIMA 2C4FT 1XZ0A 5TQ2L 2APFA 2ZPKH 3OXSA 4XVUC 4JO2L 1EO8L 2P8LA 5BMFL 5DJ0B 3VRIA 3ULUE 5GPRA 3STLA 1Q0YL 2XZCL 1DQQA 4O9HL 3CH1A 3IDIB 5JOPE 4NNXB 2N7AA 3WIIL 2X89A 1AJ7L 1NJ9A 3CDCA 2DI9A 3W5NA 5DRNB 3CIQA 4GRLB 4CU7A 1ZHNA 4U1HA 1D9KA 3ZTJG 1OM3H 1Q38A 5C08A 3BZFA 3JVGC 4JM2A 2XFXB 1PDKA 3MLRL 4LL9A 4PRHD 2YMXH 5IFAH 5I74C 1TTFA 4FTVA 3HG1E 2QQKH 1FJ1A 1MCBA 3EDFA 2J8UA 3A67L 1VFBA 2KZ1B 5HHQB 3MJ7A 4JZOA 3SE3A 2QSVA 5CHNB 5FUCC 1HDMA 4PYGA 5HHVH 4KKNA 1HKLH 1DL7H 2BOCA 4DQOH 3FQXB 3V6FB 4O51B 4JFHE 3O3BB 1X5LA 2NLJA 4NN6C 5F7LB 5L2KB 3KNBA 1FN4B 1G7LA 1CE1H 4QHNB 2QBWA 3L9RB 5F21B 1FFPA 1RJYB 2B5IB 3HAEG 1BOGA 3QNZB 2KL6A 2XWJB 1L4IA 1PGRB 3QZWG 4ZPVB 4FQCL 1JTPA 3BYYA 5F3BA 5E7BA 4HWBL 4XNXH 3DXAB 5IROC 1YMHB 5CIPH 4LCWD 4ZD3L 1GGIH 5C07E 3OAUH 5D70L 4L9LC 3CFJA 4RGNE 4XB7A 1JNLL 3GSNH 3OKMB 3TZVC 1UWEL 5IV2B 4NQXA 3MLTA 3G5ZA 1AKJD 3QFJA 3ZDXF 4DOHB 4RFNB 3IKKA 4Q6IA 4GRWF 4P99A 1NBQA 3QXVA 2F54D 1QYGL 2VL4A 3ET9F 2D7MA 1J05B 1SJEA 1T66D 1Z2KA 4K3JH 5T3ZH 4JKPH 2ED9A 2HLFC 4B50A 4OCRH 4EI5A 4XH2A 3OGCA 2ARJA 4TNVF 4BFEA 2AK4B 3OKNA 3QXDA 5JA9A 1JNNL 2LV4A 4QRUB 1WQVT 3PP4L 5BVPH 1B9ZA 3SDCB 1GOGA 4Z78B 4NT6B 2JJTC 3WIFB 3A6BH 2A6DB 3LD8B 3QI9B 4IBLT 2AJVH 1DBAH 2Z8RA 4ZTOL 5LVEA 4D0BB 4JM4H 1VGKB 4HFWB 2FJGA 5CJQH 1KPUB 3PDOA 2XWTB 2R2EA 4NUGH 3X3FL 5JW4M 4EXPX 2BSRB 3VJ6A 4JO1H 3ALWA 3FQWB 1T1WA 4E41A 3VGFA 2CDEA 4FZEL 1FHGA 3MRBA 5E5MB 3VXPA 2RB8A 3QQ9D 3GKWH 3LS4H 2QTEA 4D94A 1T04A 1EH9A 1LHZA 4AZ8A 4JFZH 5K9OA 2CK0L 4DKEL 5SX4H 5ANME 1HZHH 3UZVB 2ZWLT 4G7YH 3EJYC 1Q94A 3BZEA 3EOTH 3EO9H 4PYHA 5EBGA 1KCUH 2COQA 4O02H 5D7IF 4BSVB 1AH1A 3FO0H 3FFDA 4NSKB 2FJHA 4ODWB 4TNVK 5B38A 4Y5YC 4NPYA 4HK0A 2X4UB 2JIXA 4Q9QH 5J3HC 4JJ5A 5L8KB 3SBWA 1G84A 2PYED 3LDBC 4WCYL 3ARWA 1U92A 3QHFL 1OY3B 1RURL 2YUXA 4WW2A 3MNWA 2QR0B 4NO5B 1A1MA 2GI7A 5KG9B 3DX6B 4LAJH 3WD5H 5EDXA 1P7QB 1BBDH 4ZFFA 5IJKC 4WRLA 4X80L 2AJZA 4XP1H 3KYMA 3PGFL 2BVYA 3V4UL 5CILL 5CBEB 5F7WC 3QO1B 1ZS8A 4K7PL 5FKAA 5ERWA 4QKXB 3RWEB 4NC0B 1MHPL 4K94H 2ADIA 3BVNA 2V5MA 3QULA 5MI0C 32C2A 4R96B 1DQML 3WUWB 3PNWB 1HCFX 1NBZB 4Y4KB 4XC1H 5L0QB 1LDPL 1XF3B 4HGWA 3CCHA 3GMLA 4K3DL 5BJTA 1IBGL 5F8QC 4I3SL 4RMWA 3HLAB 2DKSA 2EYTB 3FRUA 2WINA 2V7HA 1T22B 5SWQB 4L4TE 3N9GH 5IVXE 3S4SG 4CN6A 2YPKA 3QRFM 5EZIL 3LRSA 1C12B 5EC2A 3DUSB 4XNYL 3AFLA 1ORSA 4PREB 1J0HA 5TE7L 1XH3B 3B6SB 3OAZH 4JEGB 3PE9A 5TQ0H 3HUJE 3WHE0 4AEEA 1KXVC 4KUZL 5F7NC 35C8L 3DYOA 2I9LA 2IF7A 2HKFL 1YMMB 4PD4J 3WYRA 5J06A 3X3GH 5DHYB 4RWHA 1RUAL 4G9FA 2FATH 4XHJD 1S9XB 2CDGB 5DD5L 2NY6B 4G6FB 3SGEI 4HZAA 2XY2A 3EJJX 4PRIB 1FE8H 4M00A 4TVPE 1YNTA 2YPVL 5IGXH 1FL6A 4KQ4H 4YC2C 3IU3B 5HD8C 3KJ4B 2EO1A 5B3JF 3HB3D 2ZCHL 3DVGB 3EBAA 3VRJA 3ZKND 4MNGB 3OF6A 2GITB 1KIUA 1X5KA 5DT1L 3BHBB 1S7VB 4XPBL 1FRGL 2W9EL 1NCAL 4AIZB 4J3XA 3TO4B 1JZ8A 5BQ7A 2H2PC 1LVEA 4OZIB 2NXZB 5GZOC 4YFLI 4YHNB 1A9EB 4MYWB 4HIIB 5KANI 3L95B 1QNZL 2A6KA 1T3FA 3C09B 1SM3L 4P2RB 5TFSL 2I24N 5KVMC 3AGVA 4M1CD 4Q97A 5F9WB 1I1FB 3VFTB 4XC3H 1KB9J 2VLJD 1G7IB 3QG6B 4P2OB 1R0AH 4EI6A 1EHXA 3BE1H 3RDTD 3NFNB 1JHTA 4WU5A 4O58L 4IMLB 3RVXD 4JR9H 5B8CA 3UBXA 5GGRA 3WFDH 1S9WB 4M5ZL 4NP4H 5FM4A 4DK6A 1M7IA 1AQKL 4FQQB 2DQJL 3U4AA 2APWA 3RVUD 3QUYA 5F89B 4DFHA 1QLFB 1YPZB 4I2XE 1F4WL 5JXAH 4YHPA 1Q9WB 2RCSL 3QJFA 3EOYG 1FZOB 3SKJH 4CVXB 3T2PA 2GJ6B 1NCCL 4DVRL 4LNVA 1F3DH 5JDJA 5HGHA 4DGVH 4HFUH 3V9FA 3ETBF 3JVGA 2AXGA 3KPOB 4HUXB 5C0DB 1ZSDA 3L3HB 3VRLE 1JP5A 2QSCH 3LV3B 5CWSB 3BAEH 3ARGB 1DDHA 5FDYA 1C5DB 4OM0L 5DD6B 5IB5B 4KKLC 3E3QC 1S7UA 1PG7L 4RRPG 3IU4L 2EDWA 1HK6A 1MFAL 4NQCB 4RWYL 2R0ZL 3QFDA 4G5ZL 1M05B 3T3PE 3TBSB 1MRFL 3NCFB 3VA6A 5DD0H 1OTUC 3W39A 1D6VH 1QR1B 1YEEL 5TF1H 2BX5A 2ZUWA 3AB0C 4U0RB 4NQDE 1T5XA 1J0ZA 3KPTA 1DBJL 3EDKA 4Z9KB 3WS6A 1HQ4B 1PLGH 2LAAA 1FYTB 4UILL 5DURB 3V0WL 1IC1A 5HHME 5CKAA 5KSBA 2D7OA 3HAEB 3LEXA 4GG8A 4X7TB 5C0CB 4JHWL 5FKPB 5ABDE 2FCBA 3UAJD 2Q86B 3U46A 2F53A 5E99H 2FD6H 3NFPB 4QCIA 4W4NA 2FO4A 5EIQA 1OAYL 2EKJA 1FC2D 3MRNA 2C26A 4NO3B 4P4KD 4OZFH 2KDGA 2XOTA 3K2UL 4XPHH 1G7PA 5E2VL 5ICYA 4X6CA 1KIPB 3QXTA 5HGAA 1QSEE 3VFUB 4G3YH 3UTOA 2ORBH 5FUZH 3STZB 3TZVA 3GZKA 3C08L 3UPRB 2V2XB 1AGEA 3LMJH 5DUPH 2ICWJ 5DZLA 3ARRA 4PGBA 3GK8L 5HYSG 1F6LL 1KFAH 1YN7A 3IKCA 4PJEF 1DUZA 4CBPA 1MJ7H 5INDA 4PJDB 2O93L 4XP4L 4N90E 5E4EB 5EOTA 4PJIA 4UOW1 5AZEH 1F97A 3MODL 5C9KA 4BYHA 3O4LB 4KK5C 3PWNB 1BD2D 3V6OC 4MAYA 5GHWH 5F9OH 5IF0A 3PWVA 2WIIA 4N1EA 3K2MC 2IPUG 4XB8A 5GS0D 1E4JA 5EU3A 5I8KH 1RK0A 4Z7QE 4OJFL 1UXSA 4NQSB 1DN2A 2H8PA 5L6YH 2XTJD 2VISA 1NDMA 4RMTA 3VXMA 4GG6E 3HCVB 5D7JB 4P0DA 4MB5A 4FFVD 1YEHH 4DCQA 1FNEA 3TPUB 1XGQB 3DX7B 2OSLB 1VEOA 4U1SB 1U8MB 5DRWB 4JG1H 5C0ND 1J0JA 5D71H 1U95A 4K7PX 1Q9LB 5KVFL 4D0DB 1A4JA 1SBSL 3CLFL 3IJHA 3X11A 1NDGB 3TH3T 3DVNA 2B2XL 4X6DF 3N1FC 4Z0XB 1JHLL 3WFZA 3MJGX 4LLDA 2DBLL 3VH8A 1ZVSB 3O3UN 4YH6A 1UZ6E 3MNZA 3V6ZA 1WWAX 5EFIB 4MDIA 3VGAC 4M03A 1IZKA 4QGTA 5DFWH 1A7PL 1KPRB 4UB0L 1KC5L 5C09A 2OMNA 1ACYL 1U3ZA 2YKLL 1OAQH 2CPCA 3QIWC 1A02N 1AD9A 1I1YA 4MNGE 4OLXL 2Q7YB 3LQMA 1P4BH 2BHUA 2DAVA 4LCUA 5DUML 3DSNA 2X4TB 1R3LB 3WNPA 4JHZA 4OM1L 2R2CA 3QDMB 4WI8A 3B43A 3GMRB 2NY3C 1JK8A 2DICA 3SN6N 4NQEA 5IIEA 1N4XL 1FSKB 3IDYB 3B3IB 4P49A 3MLZH 3EYVB 3U1SL 1AR1D 1P2CB 3WCYA 1S7XA 4BSWB 1K4CB 1WBYB 1I7RA 2LAGB 4OIAA 2LTQC 3T0AA 1T0PB 3CFKB 5L9DH 1HHKA 3CVHB 3VFMA 5KN5A 2YRPA 3DETC 2R1XA 5KZCD 5CGYD 3QIBB 4Z77B 4MD4B 3BP4B 4YXKH 2NY2B 2HRPH 5I66B 3MRIA 4OFYD 1A6TA 3ZYJA 2UWEA 3MACL 3LKNB 15C8L 1OGAD 2DB8A 3THML 3U7WH 3QIUB 2VDLL 3DWTA 1WAAA 3NCJL 2V2TA 1I9EA 2GCYB 5ITBL 1M6OA 1JYXA 4E5XB 4E42B 1NMBH 1UH3A 2N56A 4P46B 3HR6A 1HIMH 5DJDB 4UOJA 3BSZH 4H20L 4PJGB 5D9SB 5E03A 1H3XA 4XMLH 1FL3B 5C0AE 4QWWD 2D2OA 4JVUA 1RUQL 4HH9B 4MGXA 4XWGL 4R7NB 4M8QA 1T6VN 2P48B 1MOEA 2HLAB 2CR3A 3U4EB 4F33B 5B3NA 1JFQH 3RA7H 2NY7L 3VA2C 1KCSH 3K3QA 4KDTC 2R56H 3RP1A 1FL5A 3SDAC 1FO0H 1FNFA 1OHQA 2HKHL 1DP0A 4ZYKA 3UXFA 4CVWA 4DK3A 3RL2B 1AGBB 3UTSB 1H9VA 3DX8A 1KLUA 1CDIA 4OCYL 5CJ5A 4OIIL 3RKDD 3VFGH 3MNVA 1WBXA 1TJGL 2YZ8A 4EN3D 1H8OA 1FIGH 4HLZG 2YPLB 2VUYA 5KS9E 4PJHE 1JF6A 5FYLD 4DZ8A 3V5KB 2GK2A 4J4PC 5F1IB 4XWOC 1JF1A 2FDBP 3UZEA 3DBXB 2FL5A 1B6UA 1NBVH 2YOCA 3P4OB 5D5MF 4U7KA 4LGRB 3GHBH 1PG7X 1VFAB 4OFVA 4UDUA 3CNKA 2HJKA 5F7YC