3KNBB

Crystal structure of the titin c-terminus in complex with obscurin-like 1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
96
structure length
96
Chain Sequence
b'QGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Titin
publication title Molecular basis of the head-to-tail assembly of giant muscle proteins obscurin-like 1 and titin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/structural protein
total genus 16
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3knbB00
3AAZB 4CVUA 2HT4C 2GI7A 4RAVB 5DZNA 2Z91A 4XMLH 4EOWL 4K9EC 4KXZI 5D2NC 4PJ9A 3VMPA 4OD2B 4W70A 4H20H 5H35B 1B9ZA 1ES0B 4X4MA 5TH2B 3TJHD 1B2WH 3C08L 1L7IL 4G9DA 3TO4A 3HI1A 1DUYB 4E41D 3GDBA 1BZQK 1MCFA 5K9JL 1RZFL 4Y2OA 1JIBA 1U92A 2G75A 1T20B 3CVHB 4JR9L 4HHAB 4XP4L 4LF3B 4TOYL 5D7KE 4GUPA 2X89D 5INCA 3FZUC 5IV2A 2DQGH 1Q9OB 1G7JB 2FB4H 3X13A 1XMWA 3I6LD 3EOTH 3VGAB 3LV3B 4QRUB 5CUSH 4U1NA 1CBVH 1EGJL 1RZ7L 2PO6A 2Q3ZA 3HKFA 1PBYA 4OUOA 2Y9RT 3DX8B 5IWLC 3ARDC 3BDXA 4NQCA 5HPOA 3C9NA 2VR5A 4OKVA 2W9LA 5KAQF 2VDLL 1YNKH 2X09A 3JV6B 4H88L 3WN5C 3S4SB 1FO0L 1GPOH 4HJJL 3NVQA 2GJ6A 2PNDA 1OSPH 4LGSB 4GRLC 3R06B 2A6DB 1XGRB 5DD3H 4XRCA 3S5LG 1QEWB 4ZAKB 3PNWB 35C8H 1VGEL 2H1PH 4OB5L 2HFGL 4QNPE 5HYQA 2IBBA 3HNTH 4MLSA 1K4DB 3CMOL 4OCNC 2IAND 2V2WA 5JOPE 4L29B 4ODTL 5FXCH 1BBJA 2VABB 4OZFG 4BKLA 4DGVL 4NM8L 4GW1A 2PYED 2NY3B 1RUKH 2NMSA 1MWAB 3MV11 3BO8B 4R26H 4XXDB 3QQ3A 1LE9B 1WVZA 4HBCL 3ABZA 3D69A 1I8LA 1EEUA 1UJ3B 3BH9B 1CI5A 1MI5E 1QR4A 3H42L 4AMKH 3QXDB 3O2DL 1R5VB 2J2ZA 4UQ2A 5EO9A 5FYJL 1C5CL 5C92A 1INQA 4DN4H 1YY9D 4G6JH 1MJJA 2Z91B 1I7RA 1XIWA 3P4NA 3TF7C 2I9LA 3P9WB 5FHBH 3KAAA 4J3XA 3V0VA 1ERNA 1UKQA 1YEKH 2F19H 4XNXH 4OGAD 2R0ZL 4G9DB 4LLVA 4LAJH 1KJ2A 2CH8A 4P2OB 3HI1B 5KVMC 4I77L 4MA8H 3L95B 4PJEA 3W11C 4HH8A 1BZ7A 5D5ME 3ARFA 3QIBD 4YHOH 4OLXL 3SDYL 2IFFL 2OL3A 4KI5F 2P7TB 4BZ1H 2VWEC 4J2XA 1LNUA 1OD9A 3O9WD 1YEIL 2G75B 1OM3L 2HTLC 4U1GC 2VC2L 3K46A 1AE6H 5TQ0L 4P46A 1WZMA 3H3PH 4OM0L 4TUKL 5IROA 4LHUA 1U8IB 5INCB 3T09A 1UWGL 3RWIB 3VA2C 4ACPA 2OJZH 3QNXA 1U3HC 5KANI 4Z7WB 1A7PH 3MV9D 2VDML 4Z7NF 2PO6B 3RI5F 1WIOA 3KPTA 4G3YL 3ULUH 3UP1A 1U2CA 3OR6A 4GMTH 3PWPA 2W92A 2Z31D 2PTVA 1WBXA 2GY5A 4OZHF 4Y19D 3MODH 3MRJA 2YXMA 3BIKB 4KK9D 2GT9B 5IVZA 3SOBL 3BQUA 3HA0A 3T1WA 3V0AC 3O3DB 1AIFA 3MC0A 4OD3L 5I16A 1XZ0A 2GJ6B 2I5YL 3KHOA 1CDGA 4CW1A 1MHPH 3ZE0F 4K3HA 3DO3A 2XKUA 4KAQH 3RX5A 1D5ZA 1KLUA 3EYQD 2AK4D 2BDNH 2ZUUA 2Q76B 3GSNA 4QCIA 4U1LA 5D72H 4MA1C 5A16A 1B90A 5L0QB 5F7FA 5IJVA 4LSSL 2V2WB 2HN7B 3LSOA 1YDPA 1BBJB 2VISA 3D85D 2FJFA 4GQ9H 4BKLB 4GW1B 4JQXC 5GGQL 2FJGA 3O8XC 2X4PB 3KJ6H 3MRKB 4K7PH 1D5MA 5GJTL 3IAPA 3QQ3B 3TCLA 3D69B 4WV1C 4G6KL 3S8WA 4HGWA 4HK0A 4UQ2B 5EO9B 3X12A 4NO0A 1L7TL 1ZANH 3WS3B 3LH2H 3I02A 3HPLB 5FHAL 1MJJB 1BQSA 1UCBL 5EZLA 5I1IL 1BEYL 1AKJA 1XIWB 2HLAA 2VLKD 3P4NB 4J1UB 3O2WL 3C60A 4OCWH 1VFUA 2FYYA 1A3LH 4APQD 2BVOB 1LEIA 1BVLA 4NOBA 2JE8A 5CS7A 2VYRE 5L2KD 1P7KA 2D4FA 3P4OA 4RGNC 1JHLL 2LU4A 4KROC 1EVUA 4XMLL 5E6ZA 4HC1A 5CD5C 3T4AB 3Q6FA 2NY7H 3P4MB 1UXSB 2WWKO 1ZHNA 5T33L 2NY2D 2OTWA 1JZ6A 1UA6L 4C55A 4XB7A 2NTFA 3NFSH 2GAZB 1VFAA 2ARJQ 1LNUB 1B2WL 3QAZB 1TNMA 2NXYB 2D7OA 5EC2A 1T5XB 1RY7B 4HKBA 1YZZA 1G7LA 3TBWA 4GAFB 2OK0L 5F7NC 4LHUB 4UILH 4LSDA 4M62H 3QNXB 3D6GA 3UTTA 3L5HA 1MFDH 5J12C 3C5ZC 4XP1H 2RBLA 3DMMD 4YC2C 4JKMA 5F89A 5GZOD 5I0DA 1I9IL 5A2KH 4XCFL 1JF1A 4DJMA 3RGVC 3LS4L 4GSDH 1N6UA 4LSVH 4HG4K 2YA0A 1EHLH 3GIVA 2FB4L 1X6LA 3S4SG 3O11A 4BH8B 5CKAA 3OR6B 5EBMA 3PWPB 1WBXB 1OAQH 1P5VA 2YRPA 3WIHL 5BXFA 43C9A 5IHZB 3MRJB 1CVRA 1Q9KB 1KFAH 2OBGA 3WSQL 4PJFA 1AIFB 2Y6SD 3NCFB 3CJJA 5IM7A 4IMKA 5CCKL 1DVFD 2EICA 1BHGA 1YNKL 1D5ZB 3QA3B 4FXGA 1MCNA 3FAXA 4PUBH 3GSNB 5C0CA 1GPOL 4OFKA 4H8WC 4U1LB 4P2YA 1CLZH 5C07A 4LAQH 3UC0H 5F7UA 5IJVB 1KG0A 2FBJH 3MRLA 4RFOH 5JO5A 2FJGB 35C8L 4HGMA 4OQTH 2H1PL 1DP0A 1SEQH 3IDNA 4O51B 3HNTL 3EBAA 5T1MA 3KJ4B 4HGWB 4HK0B 2BHUA 4OM1H 3MNWB 4NO0B 3W82A 1NGPH 3VFSA 4NKOB 1FL5B 4Q9RH 4LFHD 3RUGE 1RUKL 2DWDA 4ONFH 3T3PF 4B5EA 1CD1A 1EUTA 4R0LB 5EZLB 3RWEA 2VO5A 3LIZH 2X5PA 3C60B 4M6OH 2FYYB 3QFJE 5CEZE 4JO2H 5CP7B 3LS5L 1CTNA 2DLGA 1LEIB 1BVLB 2DD8H 3B8YA 4MQXD 2HJKA 3P4OB 4R97C 2VKXA 3Q6FB 5EO0A 1ZHNB 1G9NL 1YEKL 2J88L 5KVFH 4Y4FA 4XNXL 5E4IA 3K4ZA 2HT3C 1MCRA 1TJGH 2X4SB 4XZUA 5EU7C 1BBDL 5EC2B 4BK5A 1G7LB 4F9PC 4FXKA 4P5TC 4LEXH 4HIXL 1G7IA 1FLRL 1J11A 4YHOL 1HQRB 1NCWL 3FOMA 3ULSB 3UTTB 1ONQA 3MGAA 4R9HA 3F65A 3FB5A 5D4QA 5E6IA 5C0IA 4NN5C 3V4PH 4OUUA 2AXJA 4MVBC 3ZKXB 1JF1B 4YX2L 3RKDD 5L2JB 5F6HI 4WFFD 1KIUA 1A7RH 5M94B 3O11B 4GW5A 1A7PL 4MNQD 1OT2A 2DL9A 3B5TA 3ARED 3HZKA 3VXSE 5D96C 1MFBL 4IOIB 5BXFB 1LO4H 4RWHA 3T0BA 5AZ2H 4JFXB 3HC0A 3OAUH 3H2WA 5ERWA 3GI9H 4PJFB 2OTPA 3QUYD 4HWEH 2FECI 3WFBH 4JKWA 1RMFL 2HVKA 3ARBD 3MODL 4QXUL 4DCQA 4K8RD 4JY6B 3GK8L 3L5JA 4FXGB 1OB1A 2YD5A 4CU8A 5C0CB 3S9DB 4PB9H 2FRGP 2QADB 5C0EB 1MHPL 4XPAH 4N8VA 3LB6D 1WK0A 2BK8A 1MRFH 2HRLA 1UT9A 3Q0HA 2J5LB 3VWKB 5C07B 4Y5XB 4HQQH 1KG0B 5JO5B 4YFEA 3S88H 3P30H 3WKMH 1FCCA 1X7QA 5DQDH 3BMVA 4F57H 4X4XA 3LEYL 1U2HA 3SJVA 4PP2A 3EFDL 4X6DE 4S2SA 5I8CA 5GZND 1NCNA 1UQSA 5T1MB 2VE6A 1DZBA 5DLMH 2DWDB 4AH2A 4XP6H 3KLAB 4K7PL 4XX1G 1FZMA 3V5DA 1MJUH 3RWEB 2DKUA 1J1OH 3OMZA 3JSSA 2ZG1A 2D7PA 3OKMA 3VFOB 5J11C 1YEJL 2NCMA 3IFLL 4DW2H 1ZANL 4GRWF 2H9GA 1FHGA 1M7DA 3N0PB 5EIIA 3AS1A 2YD9A 3D87B 5D2LA 4HXAH 2D7NA 3MMEB 4O00A 4J4PC 2F58H 2DQHH 4OCWL 1OGAE 5EO0B 4LHUG 2F54E 1HWHB 1EEZA 1A3LL 1UGNA 4F33A 1INEL 3P9MB 1CLCA 5F96L 5FGSA 1KTKE 2EDNA 4IRJC 3U4BH 3U7WH 3HB3C 5FYKH 4PTTA 4FXKB 3ZDYE 3L1OH 2FJHA 1ZWIA 1HH6A 5FGCE 4HAFA 1KEMH 3AM8A 5F1NA 1G7IB 4NC2B 1HN1A 3VJ6A 4U6VH 3FOMB 4X99A 5L8JB 1ONQB 1RQ5A 1EUUA 4LSRL 4XNMA 1PSKH 3LAFA 4QHKJ 2NY6B 5E6IB 5C0IB 2JCCA 4OUUB 3WUZA 1JGVH 4OZGA 1IKNC 3OPZL 3SDCA 4P4RA 4IRSC 1RIUH 4UILL 3PDDA 5CLWA 1UCTA 2YK1H 1YMMB 2AJ3B 5CEYB 4KK8D 1WZKA 2X4RA 3F5WA 1Z9LA 3MV8A 4FFVC 2GSIA 4LRIA 5IJKA 3QWOA 1N8ZA 4ELME 5FCUH 3HC0B 5GS0D 5J8OA 1EHLL 2BXZA 3LKNA 2LV4A 3JUZA 4RX4D 1SQ2N 5CEXA 5TE6L 4Y4HC 2CUHA 4AYFA 3BRGC 4M9PA 5FV2A 2HVKB 1X3DA 2ZJSH 1KFAL 2XTJE 1I8IA 3I85A 1OB1B 3VG9C 4M1CC 2UV3A 4CMMA 3ZHDA 3C6LC 3W0WE 5EC1A 4HF5H 3WL9A 1AXIB 1C1EH 4MJIA 4ZPTA 1LK2A 5F7EL 1JMZA 1CD9B 1KJVA 3SDDD 4X4XB 5JOPD 1IEAA 3SJVB 2ZCKH 1A22B 1N6VA 4I2XE 4U3CA 2APWA 2YBRA 4RRPA 5GXBB 1UQSB 1CLZL 1YNTA 4LAQL 2C4FU 3UC0L 2VE6B 2FBJL 4RFOL 2R1XA 2VAAA 5FYLH 4HWBA 4G7VL 1MI5D 4RGNE 5DVNA 4OQTL 3BYTA 2OXHA 1MCBA 4C56D 1FZMB 4S1DD 3V5DB 3QB7C 1AHWA 4OIIL 5D1ZC 4PRPE 1OLLA 1PGRB 4OZ4A 3OKMB 2WNGA 2NNAA 4OM1L 2DM4A 1E6OL 2G2RA 1NGPL 2IWGA 2XNAA 3KPSA 1G1CA 3F6IA 3FQNA 1G9MH 5D2NA 4CJ0A 2C1OA 2H9GB 1M7DB 3T77A 1KGCD 3RTQB 1EFXD 2J8UB 5D2LB 5SWSA 1U95A 3LIZL 1FORL 4MA7H 3INUH 2ICES 3FN0H 4JO2L 1P84J 2DD8L 5DVLA 1BX2A 1CICD 4XVTH 1YEGL 2EZ0C 4POYA 2FJHB 1ZWIB 1HH6B 4XBPA 2BVUA 4I8DA 4S0SD 4LK4A 5DA4A 5F1NB 2C3HA 4X99B 5KVFL 4M1DH 2ZUXA 4HD9A 3TWCH 1FPTH 1TJGL 1HSAA 5C71A 2JCCB 3HZVA 2D03H 3Q6GL 4OZGB 5LGHL 2QQQA 3SDCB 1S9XA 2H2PC 5EBLA 5FB8A 4Q58C 2AV7A 4XPTH 5EU6B 3W2DH 4S0TD 2X4RB 3F5WB 1Q0YH 3LKQB 3MV8B 2B20A 1ZK9A 3SGEH 1KF9B 5JIPA 2GSIB 4FZEH 5JUEL 3GSUA 3QWOB 5IWLA 3ARDA 2XYCA 4WFED 4MS8D 3C09C 3C5SB 5MEOA 2IPTL 3QH3A 1N8ZB 4ZO9A 4D94A 3LKNB 4HMDA 3MCLL 4R4FL 1SYSA 5JDSA 3SEPA 5CEXB 3AC0A 4JJ5B 5C0DA 3WN5A 3GB7A 2GW5A 4M7LH 3V9FA 4CDGC 1HHIA 4TSBH 1VGKA 1GGYA 5HYSA 4GRLA 5D93B 1QRNA 1I8IB 4GKNA 5AZ2L 5HHMD 5KANG 3AY4C 3VXSA 4ZFOL 4HWEL 1YJDC 4CMMB 4K94C 4MD0A 4DN3H 1NAMH 5EC1B 1QSVA 3WL9B 4QHLA 2NR6D 4OCYH 5E2VH 2FX8H 3BD3A 3KXFA 3ARVA 4MJIB 1LK2B 1KJVB 3OR7A 4NKMA 1NMBL 2QV2A 2P49B 1UACH 2CMRH 2H32A 1IEAB 4PB9L 1J0YA 4X7SH 2YBRB 3IGAA 1YNTB 1MLCB 3L7EA 2R1XB 2VAAB 2YD2A 3P30L 4F57L 1G6RA 5EOCH 4MZ2A 1AO7D 4TVPH 2V7NB 1AHWB 4U0RB 1GZQA 2EEDA 4OZ4B 2OJEA 3LKPA 4ZUTA 1DLFH 3QFDB 2XNAB 1T0MB 5CJQH 2H6PA 1VESA 4GFTB 1OQXA 5EU7E 3FQNB 4JRYA 5D2NB 5DLML 2FX7L 3T77B 3DOSA 4X9HA 5SWSB 1MJUL 1U95B 1J1OL 4QOKD 5SX5H 4POZC 1T1ZA 2WK2A 5DXWA 3U4EA 3EKCA 4DW2L 1JHTA 3VW3H 4KU1A 4Y2DD 5I9QB 2UVFA 3BE1H 1A9EA 5FUZH 4HXAL 4W81A 4LPUA 2F58L 4JRWA 1A3RL 1MRDH 2DQHL 1PX3A 1HCFX 4U05A 5CGTA 2EDRA 3BXNA 4JM2D 1BLNB 4M02A 2D9CA 1HSAB 2YC1A 1IFHH 1PLGH 4KV5F 3STBA 3U7WL 5I76B 1U3HA 3HZVB 1DR9A 4YXLL 1QBBA 4LGRB 1KEML 2C3VA 1VADA 2R4RL 4AIZA 1U58A 5DA0B 1S9XB 5EBLB 4U6VL 4QRRA 5FB8B 4RBPK 5IB3B 2A6IB 2AJZA 2C4XA 2OMBA 3ARGC 4NQVA 4YHIB 4ZTOH 4F7MA 1JGVL 5IW3A 2RIKA 25C8H 4JRXA 3ARDB 2VN7A 4YZFF 1RIUL 4XHJD 5I30L 5MEOB 2DBJA 2IH1A 1MIML 2YK1L 2XY1A 2B1HL 2P5EE 1NBVH 3EDKA 4M00A 1X9QA 5JDSB 3MFGB 1SYSB 3EOYG 3FRUA 3SDXE 5C0DB 3CFDA 4N8VG 5KSUA 3MUGB 4ZTPL 1HHIB 1ZHLB 1JI1A 1VGKB 1FNAA 3RDTC 1QRNB 2XXCB 5IG7B 4GKNB 3KPNA 3O4LD 4UB0H 1P7QD 5DFTA 1TVHB 4U3HA 3AS0A 4PRAA 2UWEA 4GW4B 2NXZC 2XXMB 4QHLB 3KXFB 5I18L 2APVA 4NKMB 4P4KA 5A40E 5A1AA 4R8WH 2H32B 4Z7VB 1HIML 4JQXA 3S35L 1I75A 5E0QA 5C0JA 3IGAB 2AXGA 3WJLC 1HILA 3L7EB 3NFPA 2A77H 1KN2L 1IQWH 4OF0A 5C08E 1PKQA 2Y23A 4I18C 1GZQB 2R1WA 2E27H 2OJEB 4ZUTB 5HYJE 2VDNH 4KK6D 5DJDA 1DBKH 4JRYB 5FYLL 3BPCB 3QFJD 4GBXC 1CQYA 4I2XA 4ZUSA 4JHZA 3CXHJ 1U41A 1UM6H 4AL8L 3OXSA 2C4FT 1JHTB 2AEPH 4PRPA 1DBAH 1CFSA 4XI5D 1A9EB 4ZO8A 3T65B 4OLUH 3INUL 3MRNA 4Q74A 1DQDL 4WUUA 4U1GB 2DJ4A 1MQKH 1U8QA 3QUXC 4J6RL 3SE8L 2WSKA 4C59B 4RAHA 2ADJA 1RFDH 4BZ2H 1U3HB 3C5ZA 2VIRA 3GJFH 4PRHE 5EU4B 3Q1SH 1HXYB 2C3VB 5E00A 1VADB 3OKLA 3ZMRA 5C3LD 1U58B 4QRSA 1KV3A 3HAEB 4QRRB 4UIMA 2AJZB 1EAJA 1EO7A 4XNZC 3CU7A 2EH7H 4F7MB 4PJDB 5GGTH 1DBMH 4PJ7A 4JRXB 1AP2B 5ANME 1B0GA 2GK0B 5ID0A 3O6MH 4Z7UA 4YEFA 4TSAH 3TYGH 2IG2H 1UWXK 3W2DL 3FRUB 3DNKA 4IJ3C 1Q0YL 4LIQL 4NCC1 4Z7QF 3ARUA 5EA0H 3BDYH 3FJTA 5A2JH 4TNVK 7FABH 4PLOB 2JIXD 3GGWA 3QWRA 1UM5H 3M17A 3O3UN 3KPNB 4WFGE 5HGHA 5TDNA 5IVXB 3HNSH 4FQLH 1FV1B 2VXUL 4PRAB 2LU3A 2UWEB 2HLFC 4RRPG 1LD9B 2EDHA 1VHPA 2EO1A 4F7PB 2J8HA 5DWUL 4P4KB 1JPTH 1V3MA 5HI5D 3D3VA 1QOKA 3ETBF 3QIUD 5C0JB 4X80H 4OCYL 2AXGB 5E2VL 2FX8L 1Y18A 3NFPB 4ZMAT 5KJRH 3O4OB 1T1YA 3BX7C 5B8CB 1TVBB 4WO4C 1DN2A 1PKQB 4NIKB 4ZOAA 1RU9H 3SE9H 3BSZL 2DLIA 1RAMA 1W8NA 4YBQC 1NBQA 5IB5B 1KIRB 3JWDH 1UZ6E 4EDWL 4X4YB 4ZUSB 3G5XB 5EOCL 4TVPL 3CFIC 2A9ML 3KS0J 4EUPA 4F3FB 3I84A 4X5XA 2I60L 4LLWA 2V5YA 4WNQA 4HX1B 4KROB 1DLFL 4YXHH 1TQBC 1OGAD 1A6UH 5AWNH 2F54D 4MNGE 1CFSB 2CXGA 3GI8H 5BW7C 1E6JH 4BQ6A 4QT5A 5JPNA 1TLKA 4POUB 4PJHA 3X11A 1A1OB 3MRNB 4MB5A 3WDIA 1FBIH 4Y1AE 3H9YA 1XF1A 4WUUB 1B6UA 3CFJA 3HI6H 4F9PA 1U8QB 1J8HD 4P5TA 5GRVL 2HKHL 4YUEL 2VDPH 2EDDA 3VW3L 5DRWA 1HEZA 4XPHH 2ADJB 3BE1L 3FB8B 1TXKA 3VFTB 5LGJA 3DUUA 4WEUD 3C5ZB 2VIRB 4YQXH 5DMIH 1MRDL 5E94A 3V7AE 5E00B 3OKLB 1D5XB 4IOFD 1VDGA 1WAAF 1TTUA 5FIEA 4AEIL 2LFGA 2VJXA 5EB9A 4UIMB 2DF3A 5IBTH 1IFHL 1F02I 1PLGL 1H3PH 3NTCH 4MD5A 4PJGA 3BEVA 4PJ7B 5DO2D 4W4OC 1B0GB 2BY0A 3U0TA 5HYSG 4Z7UB 4RGOH 3CFBA 1DUZA 3BEWA 1GGUA 3OJ2C 4LVHC 4WEBH 4XBEH 3DRTA 3KPPA 3MLYL 1JNHB 5BZWA 1OAXL 1G0DA 5E5UB 3T2NH 5DC9B 4HMCA 2R2HA 3LRSB 2ITCB 3M17B 4MXVE 1EHNA 1I3GH 5TDNB 5HGHB 3RVUC 2XTJD 3O8XD 4ENED 2E9BA 2P5EA 1ODAA 3FN9A 2EC9U 3W0WD 3LKOA 1HDMA 2R4SH 1ZLSH 4UB0L 3D3VB 4R2GD 4HUUB 4K3DH 1BVZA 4EVNA 5BOPA 3MRDA 5KN5A 1VPOH 3EJZC 5C0RH 2J6EL 2HFFB 2OXGA 2Y72A 4DK3A 4I3GA 1C7TA 1KXVC 3QDGA 4NRYB 1T2JA 3LVEA 1T1YB 4WGWB 3IRPX 3ZE2F 1CYGA 1BPVA 4UTAH 3QCVH 2ENYA 4OZIA 1UKSA 3EO1A 4RGND 5IMKB 1ZVSA 1I8KA 1Z5LA 1A4JA 2VXSH 3THMH 1DDHA 4Y4KB 4JFHE 3WJJC 3RVWC 2ZG3A 4HPYL 4KQ4H 4QTIL 1IQWL 3Q48A 1QA9A 1IAOA 5KBNC 4EUPB 4X5XB 2OZ4L 3X17A 3UYRH 4LLWB 1O7SA 1BGXL 2ED7A 4R97B 2YRZA 2YUWA 1IEBA 4I48A 4UDTA 5C08A 3DUSB 5D1XC 5EULV 4YXKH 4HS8H 5CBAA 4EN3D 3MBEC 4QT5B 5F7WC 5HYJA 4PJHB 4IRJA 3RWJA 3ES6B 1G9NC 3KS0H 1F3DJ 3CFJB 4OV5A 3RGVD 3DVIA 1OCWH 3T04D 4PG9B 2NY0B 3NABH 5DRWB 4IIQB 4S10A 5LGJB 3ZTJH 1SMAA 1CE1H 4OLUL 4XP5H 1SVCP 3F7VB 4HFUH 4OLEA 4M5ZH 2W38A 1OTUC 2OQJA 4HGKC 1GC1H 1MQKL 3U46A 4PJBE 1TNNA 5FCSH 3V6ZA 4U4BA 3MRCA 4XP9L 4LLQA 1OAZH 1RFDL 5DEZA 4BZ2L 4MD5B 5HGAA 5MENE 4JANA 5GGUA 3VFRB 5CJOH 3U0TB 3FO2A 1NCCL 4PPTA 4OF3A 2B4CH 3BEWB 3BW9B 2V6HA 5IQ9A 3DRTB 3V0WH 2HWZH 3PP3K 5BZWB 3ARWA 3CLFL 3TC9A 2IQAA 4Y4HA 3O6ML 1E0OB 1JBJA 3TYGL 1F4WL 2IG2L 2Y25A 5LG1A 5EA0L 1FL6A 2YD4A 3BDYL 3PXJA 4KZDL 3C6LA 4JKPL 1OP3H 3KG5A 3LKOB 1UM5L 1HDMB 5D7LB 1NGYB 3D9AH 5FYJE 4EVNB 1NLDH 4FQLL 2CO7B 1P84K 1NCUA 4XCEA 3SKUD 1FCGA 2WMPA 4E9LA 3QDGB 5FF6A 3QNZA 1TITA 1YEHH 4Z7WF 4NQDB 3EO1B 4ZAKD 4JO1H 5E9DE 1ZVSB 1Z5LB 2YD3A 4DKEL 1QRKA 5CSZB 1A4JB 3HMXH 5D1ZA 4KUCF 2Q8AH 2YWYA 1QA9B 1IAOB 5C2BH 4I5BA 3OWEA 3GKWH 4YHPB 4WW1B 1RU9L 3SE9L 1IEBB 3GHEL 4I48B 4UDTB 2P8MB 4GKOA 2IH3A 3JWDL 5D7JD 1DBJH 5CBAB 1N3NA 3NZHL 5KSAC 4P3CL 2DDQH 1H3GA 1KCVL 1OP5H 1MFEL 1FNEB 1KOAA 2E9WA 2VXQH 4IRJB 5DVOA 3RWJB 1BWWA 2VDKL 5F6IB 4OV5B 4YXHL 2Y06H 4LSTL 4PG2A 3TV3H 3WXWL 4JN1H 1CXFA 2X9XA 3WDJA 1TVDA 3U36A 2FZ3A 4LRNL 2JTDA 2XZQL 3OV6A 4L3EE 3GI8L 1NSNH 1E6JL 4NUGL 5EOQL 4WWKB 3FT3A 1QHOA 4FMFA 1MHEA 4JQIH 1NANH 4ODHH 4XAWH 3GSOB 4XAKD 3U46B 3OKNA 4P2OD 1JNJA 2X9WA 4BSJA 3V6ZB 2KZ1B 1F3DH 2DQCH 3MRCB 5EZIH 4LLQB 4XPHL 4HAGA 3SQBA 3QG6A 3OAZH 4YQXL 4WHCA 4UINH 3PE9A 5DMIL 3R8BB 4DFHA 3OHXA 1A9BB 3QUKA 3R4DA 1JRHH 5GGUB 2DQJL 3FO2B 1WZ1H 3O3BA 4P23A 3UROR 3P4LA 3FQUA 5BS0E 3QUMH 5I73C 4HKJB 5IQ9B 5T3XH 1PYWB 1A6WH 1DBBH 1H3PL 5DD6A 1YA5A 1TJHL 2IQAB 1HSBB 1WFOA 3MLUH 1KN4L 4RISL 4P99A 5DR5H 4B53A 3DVGB 1FFOA 3AY4A 3VG9B 1NFIA 1S9YB 5LQBH 1HK6A 2ZCHH 1BQLH 1QZ1A 3C6LB 5IBUB 2HMIC 4FTVA 1CIDA 3PDOA 2W59A 3BN9C 1KEGH 5CJ8A 4XMKH 5IBLD 3GHBL 2ATPA 2O5YH 4JG1L 2CKNA 4XCEB 5GSVA 5L6YH 1S9KC 5GRJH 4PJAA 4CN4A 4NKIH 3QNZB 1D6VH 1IILE 2R4SL 3A67L 4K3DL 4EUPG 4WHTB 2NW3B 5ILTL 5EBWA 3MZGB 5TJWK 5GS0H 2F8XC 4J4PD 2XA8L 3K81A 2FR4A 1NGWB 1OHQA 2P42B 2EC9T 3K1KC 5D1ZB 4EKXA 2F53B 2LU7A 4KJWC 3O6FC 4UTAL 1MAMH 4JAMA 3O6KH 3T8XA 4PGEA 2ZNXA 2VXSL 1P53A 2IH3B 2Z8SA 4I0PA 4LSPH 3U9PL 3HZYA 2VZTA 3V8OA 4KQ4L 2C3GA 1MHHA 5IB1A 4P59H 1N3NB 3BP4A 3NIGF 4GRWH 5CLTA 1RZJL 3UYRL 2FEEL 2FHBA 1ZGLP 1H3UA 4WCYL 3MLWL 3MJ7B 5DQJA 3LN4A 4IRSD 1QSZA 1NCBL 3U36B 1LP9E 3CFCH 4YXKL 4N8CH 3I9GL 5TDPA 3IVKA 2BSTA 1IGMH 3EOAA 1MHEB 4WEMB 2UYLA 2HAZA 3OKOB 4L3CA 5BMFH 1DFBH 1NC4B 3V4VH 4PRHD 3M1BA 3MJGX 3NABL 4ODUA 5ALCL 2BCKB 1A6TB 5HDQH 8FABA 3W9DA 3UBXA 1CE1L 1J0KA 1S8DA 1EGJA 3QUKB 2N7BA 4HFUL 4OCMC 3ARGA 4I0KA 4H25A 4M5ZL 5C0NC 4P23B 3MUY1 1ZEAH 5JW4Q 4P2RE 3C09B 4HV8A 4JFPB 4YHLH 3CUPA 1PVHA 3K7UA 2ICWI 4NUJB 5DD6B 4P3DA 3R1GH 1X5KA 5C3TA 3CK0H 2RB8A 5CJOL 2DLTA 5BVJA 2ZWLT 1FO0A 5MENA 3RDTA 2HWZL 4PJ5B 3O0RL 3KPLB 1NFIB 4D8PB 4CMHC 3CXHK 4GAYA 4FXLA 3WNKA 4RMQA 4D9RD 5T3ZH 1G7QB 2JJVA 1J1PL 3E3QE 5DJ2A 5JW3H 4MGXA 3VXRA 4DTGL 3SKNA 5GSVB 3E1F1 3VXTA 5IHLB 4OF5A 2X4UA 2J4WL 2FEDC 4NO2B 4PJAB 4ZS7H 1I1AA 4NN6B 5E8OB 1NJ9A 3WJLA 4Q6IC 4NJAH 4V1DA 4XC1L 4IEFB 2AXFA 1NLDL 3GEWB 4MD4A 3EO9H 2R0WH 3QPQC 2FR4B 4I18A 3O2DA 5TF1H 3TO2B 3RZCC 3TA3B 3TP4A 5DUBA 3NFNB 3FTGA 4ZXBC 5INDA 1IVLA 4W6WB 3VD7A 2FL5A 4CVWA 4LARH 1GHFH 4GBXA 4X0KB 4PGEB 3MREA 5GPRA 4I0PB 2W9DL 5IF0B 2MHAA 4LKCB 4PJFF 1YC8A 3UJIH 2Q8AL 1MHHB 1W0YT 4NNYB 4LSQL 1CTOA 3VMNA 3BP4B 4K8RL 4ALAH 5CIPA 1DQML 4X5WA 1RURH 2MTPA 3GKWL 2IBGA 2EDLA 4YDVA 3LN4B 2FX9H 1F4HA 4Y1AD 1DBJL 1RUQL 4N0YH 2DDQL 5TDPB 3IVKB 3NIFE 4NJ9L 2BSTB 5FM5M 3EOAB 2UYLB 4PS4H 4YHZH 3BKML 4L3CB 4MSWA 2Y06L 2FHCA 3M1BB 4YDJB 4ODUB 1NSNL 3MRBA 4MCZA 3ULUE 3VGBA 1TIUA 4B41A 1S8DB 3BPLB 5H2BB 1LEKA 4EIGB 4JQIL 4XAWL 4H25B 2NY4C 4UUJA 4JFEE 2CDEA 4HV8B 4PV8A 3CUPB 3LN9A 1I3RA 2VNCA 2AKRB 4NHCL 3B5HA 2P24A 4UINL 4HZLA 1ZHBB 4HWZA 4JFYA 4LU5L 1JRHL 1KULA 5IBUG 4DKFH 2Z9TA 4WW2C 5BVJB 3HRZA 2XWTB 3RDTB 1YEDA 4JPKL 1DBBL 4JFFB 1CLOH 3QJFB 5HDBE 3Q3GA 2I07A 1V7NH 2CKBH 4PR5A 1JI2A 4GAYB 4PJDE 2BP3A 3WCYA 3SQOH 2NXZB 3STLA 2AGJH 2XZCL 2R8SH 2LABA 1ED3A 5DR5L 3VXRB 2ADGA 4N0UA 4WTXA 1MCLA 2X4UB 5F8QC 1JWSA 4HEPG 2FLBT 4PRNA 1I1AB 2FGWH 1NJ9B 3GKZA 1T21B 2XPGA 3MBXH 4V1DB 1KEGL 2CDGA 4X7FC 4XMKL 1FH5H 3QO0A 5IVXE 4R90H 3GMNB 1NMCB 4WO4A 1MY5A 3VFGL 1FSKC 1NGZB 2R0LH 4NKIL 2QADD 2MOVA 4K7FA 3L3DA 1D6VL 5DUBB 3FTGB 4S1SL 4UBDC 3HE7B 3VWKD 4JFHD 4X9IA 4D3CH 4GBXB 2ICWA 3KR3L 4JCLA 3NCBB 5GS0L 4UIKH 1AQDB 1S7SA 2BNQE 2XQBL 3I75B 4LCIH 1AD0B 1KB5H 5DJ8B 2CJUH 4F9LC 3MPCA 5TGBA 3VH8B 2MHAB 1AQKH 1MAML 5CIPB 4X5WB 4FABH 1L0XA 4F8QA 3O6KL 5BW7A 4Z76B 3L3GA 4YDVB 5KSBE 4MAUL 1MFCH 1P4LB 3RVVD 3BT2H 4P59L 1HHHA 1SMOA 2L0DA 4BFGA 2CIKA 5HVHC 1CL7H 1QBML 1UXWA 4U1IB 5EO1A 3QP3A 5LJYH 2GIYA 4MSWB 3TFKC 1KNOA 3OJMB 3MRBB 2WBJC 4N8CL 4F58H 3MJ9H 1B3JA 1LEKB 3L6FB 4F7CB 5BMFL 1DFBL 2WIIA 4UUJB 4W4OA 2CDEB 3RWFB 1K5NA 3BWAB 2E5EA 4NC1C 4RIRA 3WFHA 1AJ7H 1I3RB 4FQXC 2P24B 4HZLB 4Z9KB 3WIHA 4HWZB 1ZE3C 5E2WH 1MHCB 5H94A 3UPRB 3PWUA 1Z2KA 2EDWA 3HG1E 1QQDB 1U8HB 3QXVA 4U7MA 1NL0L 4GKSA 3AB0C 2J8UF 1D6EB 2IPUK 3HRZB 2P4AB 4HUKB 4PRIA 5BV7B 5D2LF 5IMOA 3P11H 1MQ8A 3CX5J 4MMXC 5DZOA 1YMMD 4PR5B 3MXWL 1SBSH 3BP5A 5EBGA 4Z8FL 3QI9C 3UAJD 4LQ1A 5ISZE 1ED3B 4ZPVA 2ADGB 4Q97A 3M07A 3ROOA 4N0UB 2QR0A 2CRYA 1E4XH 4YK4B 4XTRC 5I1JH 2CRZA 1JWSB 5ESVA 5DHXB 4PRNB 3KPQA 2ARWA 2HJFB 2XPGB 4L4VE 2CDGB 5JW3L 2JCCF 5GRZA 3QO0B 3MRPA 4OZGF 3D39E 1YMHA 4WO4B 5I8OH 2V5MA 1FFNB 2CSPA 5I17B 5E9DD 4K7FB 4ZS7L 3L3DB 4JJHA 4M7JH 5FA4A 1CGXA 2Q8BL 3R0NA 3WJJA 4CADA 2ICWB 2P46B 1HKLH 3EYOA 4G8GE 2BOBA 4JLRA 1MUJA 1S7SB 5CD3A 4OD1H 3FO9A 5TGBB 2B2XL 3QUXD 5A3IC 4LARL 3GMPA 1TQBB 1GHFL 1AR1C 5F8RC 2R39A 2OS7A 4WI5A 3I6GA 1JN6A 5I8KH 5I1KH 1MAKA 1GSMA 1HHHB 3FFDA 3LEVH 2ARJA 1T7YA 1VFMA 4L3ED 1ROWA 2IQ9H 4NZRH 3IDYC 3RTQD 1K6QL 4G8FA 1WISA 4NGHL 4MJ5A 1KNOB 3OSKA 1WEJH 4ZOEA 3MV7E 4GAJH 4UV4L 2QHRH 5EUOE 4N0YL 2J7LA 4NQXA 4JO4H 4YHZL 4R7DA 5ADPH 3RWHA 4GXUM 3ZSSA 4DQOH 1HH9A 4OF6A 3MLXL 4ODXA 4KGJA 3HI5H 4RIRB 4YIQA 2DRUA 5BS0D 1OARH 3TYFA 5D9SA 4LVHB 4XPFL 1GIGH 1QBLH 3RVTD 5H94B 2PKDA 1RUML 2FWOA 1W72H 3T0VA 3K0WA 4OZFH 1EERB 4MXQD 1EPFA 2VXTL 4O4YH 4PRIB 2EYTB 4HCRH 3TJHC 5J1SC 4KPHH 4X8JA 4DK6A 3O2VL 4PJIB 4U6HA 1SYVA 1TMCB 3FT4A 4K2UL 5EU6D 4JHWH 1IEHA 3BP5B 3UTSE 2EE6A 3BHBA 2VL5A 5J9PA 1UB6A 2FCBA 2ZKHL 3P77A 3ROOB 4L8BB 2QR0B 1HZHH 5I15H 3FT2A 3FQTB 1OSZA 3OAYH 2VLJB 2UY7A 5ESVB 3SQOL 2EDJA 3ZO0A 3KPQB 3VU2A 3F7RA 3MRPB 3D1MC 1PW3A 1YMHB 3FB7A 5EIVA 1LE5B 3CSPA 2JELH 2M1KA 4BFIB 5JW4M 1A1MA 4OAWA 3LKRB 3H9SB 2EXWC 5D7LE 5FA4B 5T1LA 4U6XA 3MA9H 2D9QB 4CADB 3VA6A 1FH5L 1SJHA 2BOBB 4JLRB 1MUJB 4JEGB 3E8UL 5GGSY 1TZHA 1J7VR 3FO9B 2R0LL 4C54A 2WW8A 4PJXB 4ZSOA 2CUIA 1CGSH 1IKFH 1L6XA 3OB0H 3GMPB 4D3CL 4ZYKA 3VRLE 4D0BA 4UIKL 3KYOB 5KSAA 5FYKE 4PGBB 2VXVH 1KB5L 3I6GB 5ITBH 2WUCH 2V2TB 1AQKL 1JN6B 3IRZA 5DEFB 5D8JL 3SE3C 2BNQA 3L3OA 3CZFA 2ARJB 2B0SH 2JK5A 3MXVH 3X3FL 2J8OA 4PIRF 3L5WB 4YBHA 1OL0A 4G8FB 5B21A 2XN9A 3VXQB 3BN3B 1TJIL 3DV6A 4Z7VF 1LVEA 1NFDB 4I3SH 3QEQE 2ZUYA 1OPGL 4NQXB 3GBNH 4O9HL 1P4IH 1J9CT 4JFOA 4FFYH 2W60A 4R7DB 2WANA 4CUCA 3RWHB 3TNMA 1HH9B 3HN3A 4ODXB 1A7QH 3VGGA 4PP1C 3RVUD 1YY9C 4OJFH 2FNBA 3LEXB 5D9SB 4GAGH 4P2RD 2Z35A 5ACLA 4QHMA 4QTHA 2FWOB 5DD1L 1X5YA 2OX5A 3V4UH 5DJCB 4XNQA 3OQ3B 4IDJL 4AY0A 4YHNB 4OGAC 1I9RH 4A6YL 2NYYD 1AJ7L 4X8JB 1G7HA 2X70A 4U6HB 3EJZD 1SYVB 3FT4B 2R1YA 4MX7B 1SM3L 5E2WL 3NOIA 5FYJU 4N9OB 3QIBC 4ZFZA 3BHBB 1E28A 4GG6E 3QHTC 1OGTA 1MCWW 1NMAH 3P77B 1JFQH 3H7BB 3P11L 5FOBA 3O9WC 1A47A 3B3IA 3V5HA 1AY1H 4XNUH 1OSZB 2K3TA 1SBSL 2QQKL 3IETA 2DOCA 3VRJA 1N5AA 4BYHA 2W65A 1CXLA 3HPJA 4FNLL 4FQCL 1BM3H 3IAQA 2A83A 3KPRA 2ZUVA 4UU9A 3CVHH 3NPZB 4QWWD 2DKMA 1P4BH 3FB7B 5T1DL 2DIAA 3DHJA 1E4XL 1P9MC 4ZO6A 1H8SA 3SE4C 1HWGB 4OAWB 3TT3H 4OQTA 5D1XD 5T1LB 3FFCA 4U6XB 3ZYJA 4G9FE 3MBED 1F58L 3O6FA 4GOSA 4PY8J 2Z31C 4H1LA 3VRIA 2DKSA 5I8OL 1TZHB 4KK9C 3BMWA 4ZSOB 2NX5A 4LSUH 4NO5A 2XWBA 2X6MA 4M7JL 4PJCE 5FEBA 2R2EA 1GAFL 3HUJB 3RY5A 3KYNA 3NAAH 3VFVA 1HKLL 2BMKA 4ELKB 2YPLE 3WKNA 3JWDC 5KSAB 3LHPH 5GQBA 3PWVB 5JPMA 2G5RA 2ADIA 1OAYL 3QDJB 1FAKT 1IM9A 3EYQC 5IVXF 4HKZA 3L3OB 2JK5B 2ORBH 1FG2A 2X7LA 5CWSA 1LO0H 2UWEF 3N85L 5E1AA 5EPMB 1XT5A 4DGYH 1SVZA 4BK4A 1OF2A 3N1PC 1MCJA 2XZAL 4OLZH 3BYYA 2XN9B 4HWUA 4QYOA 5F88B 1ZTXH 5I1KL 2WP3T 4HJ0D 5IHBA 1KYOK 3PWNB 3PGFH 1YEEH 4XPBL 2IQ9L 2GTWB 4JFOB 3ULUD 3QZWA 2X41A 1F5WA 3VE0A 3RRQA 1R5IA 3TNMB 1JL8A 4NQEB 2A6JA 3S37X 2CIIA 1KT2B 1MWAH 4JFED 5DC0A 1FYHB 4W6YB 5SWQA 4QHMB 3SKJH 5DHYA 3OX8A 4Q7DA 4X9GA 4APQC 4XNQB 2BNRA 1AXTH 1G7HB 2J1KA 4MQ7A 2X70B 1QFUH 4XPGL 3DYOA 1GIGL 1QBLL 2R1YB 4GMSH 5F9WC 1ZLWH 2VQ1A 1W72L 2NY2C 4ZFZB 1E28B 1ADQL 1IGFH 4ZFOA 1OGTB 4J3WA 4O4YL 3RA7H 4KPHL 4E0RA 3WXVL 3V5HB 4FFWD 4TVSa 1MCDA 2ZCLL 5EORL 3VXMB 4GXUN 3IETB 2PF6A 3F7YA 4JHWL 3VRJB 1N5AB 1UM4H 1TTFA 2W65B 3HPJB 3T2OA 3ESUF 4PJ8A 4X8XA 4KVCL 2R9HD 1A6VH 3DMMC 2A83B 3KPRB 3WLBA 5C0AE 1QFOA 4LLUA 4Q6IA 1HZHL 5I15L 3B6SA 4TVPE 3V79C 1IGTA 5J57B 1EJOL 5HPMA 3EYFA 1Z9OA 4X6FB 3FFCB 3RZCA 4ZXBA 4PJ7F 5HXMA 2PYFB 1N0XH 4F8TA 4H1LB 3CPLA 2EYSA 5C0BA 4Z7UF 4B7LA 3BRDA 1PY4A 2NX5B 3FKUS 2XWBB 1IBGH 3I6KA 4JY5L 2R2EB 3WNMA 1RZKH 2Y6SC 3MA9L 1KJMA 1J0ZA 3QR2A 4NT6A 2GCYA 5JPMB 1H3TA 1NKRA 1DVFC 3JXAA 2K7QA 5GGRB 3GMRA 1CGSL 1RZJC 3MOBL 4HKZB 5E1AB 1FG2B 1XH3A 2X7LB 4KK5D 4ZUVA 1NCDH 3L7FA 4H26A 1CE6A 2VMFA 5JW4N 1OF2B 2VXVL 2IADA 1HXMA 5BVPH 4K23H 2WUCL 1J12A 5MEQA 3PQYB 4QYOB 1S9WA 1IGCH 4N90E 3CMGA 4HIEA 3ALPA 1T3FA 1BFVH 3AXLA 4HW6A 3MXVL 1FAIH 6FABL 3NN8A 3CFEA 3GJEA 3VE0B 3T0EB 3ZDXE 1R5IB 2P5WE 3D2UA 2A6JB 3QCTH 1CGYA 2CIIB 2VKWA 2Z8WC 2KDGA 3I50H 4E41E 2NY1B 2BY1A 2AJSH 1F45A 4KMLB 4P2QE 4OF8A 5CFHA 2Z92A 1P4IL 3IKCA 5SWQB 3B9KA 5HDLA 2HMID 3QNYB 2LVCA 1XCQB 5DHYB 1FZJB 4MQSB 5IT2H 3VWJD 4LQFL 4WY7H 2CDFB 1UB5A 4Z78A 3HG1D 2PN5A 2BNRB 3BN9D 5I1AA 4MQXC 4O2EA 1WBZA 4FQ2H 4WW2A 3VG0L 3ZDZE 4GAGL 3G04A 1R24A 3K80A 1UZ8B 1MH5A 1ZKAA 1HYSD 4CMHB 3V4UL 2UUDH 5LKNA 3I6LE 3MLTA 2OR7A 4XCNA 4PJHF 3DXAE 5ISZD 4OGXH 3OKDA 1FNHA 4RA0C 4OGYH 4HUWA 4PJ8B 1X5AA 3H0TA 1VKXB 4KJWD 4LCUA 4U6YA 3WLBB 4LLUB 2PXYC 4YNYA 1R3IL 3B6SB 4L4VD 3WV0A 4XNUL 1DL7H 4QXGH 5CILH 3EYFB 4YGAB 1S5IH 3D39D 2H8PA 1FGNL 4KKCD 3RKDC 3X14A 4DZ8A 1U3JA 2YD1A 4X6BB 1R3HA 3V6OC 4YDLB 3GMMA 5DHVH 1CFQA 1P4BL 3AREC 3CPLB 5BRZE 5C0BB 1BMGA 5DURD 5C7XL 4G8GD 3OF6D 3I6KB 3TT3L 2VLME 2O5XL 1N5YH 5J1AA 4HXBH 4F9LA 3QUYC 4Y0GA 4MDJA 1WWAX 3JBG7 3MNVA 4KXZH 2HFEA 4F37K 4NT6B 5SWZE 2GCYB 2YWZA 3ARBC 3QDMA 5EG6C 4K8RC 4QGTA 3CDGA 4C83A 5I1HL 4KTDH 3GMRB 5F7YC 1CU4L 1XH3B 3NAAL 4Y4KD 4YBLB 1DQJA 3P0VH 4ZUVB 2G5BA 3L7FB 3LHPL 1CE6B 4N0CD 5EZOL 2IADB 1HXMB 4XCYA 4HZAA 2AJXL 3G5YB 4HIHA 2YZ1A 2NTSP 3MLPA 4HIEB 2EKJA 3WNOA 2YPLA 3AXLB 1B4JL 3QQ4A 4IOSD 2QEJA 1DANU 1SBBA 3JTTB 1GOGA 1LO0L 3MV7D 2WBJA 3CFEB 2PR4L 4TNVF 3GJEB 5GZNC 5MI0C 3T2PA 3HHRB 4WDIA 1H3VA 4OLZL 3TN0A 5E8EA 3OKEA 1RIHH 3D2UB 5C09B 3N9GH 1YEEL 3IKCB 2AABL 2NY0D 3B9KB 3IJHA 2MPAL 4FQXA 1KIQA 2BERA 4LCWA 4KRPD 1UB5B 5E8NA 4R96B 1IAKA 1QSEA 2YN3A 2B1AH 2BJMH 1MH5B 3LQZA 1MCOL 1WFTA 4JHAH 3KPOA 3RY4A 3MLTB 1SJEA 2A1WH 3QI9A 4XCNB 3BUYB 3UTSD 1AXTL 1EH9A 2W0KA 1ZGLB 4HC1H 4TSCL 1X5XA 4HUWB 3WO4C 2PUQT 3V7MA 5H37G 3TPUA 4LCUB 3SPVA 4DOHE 4U6YB 5DGRA 2Y7QA 2GUOB 4YNYB 3VI3F 3TVMA 4H1LG 5GGVY 5F9OH 3CLEH 4MJ4A 2ICEB 1UM4L 4CNIA 2H8PB 4BSWA 4HULB 1FSKB 4NZUH 2G60H 1QKZH 4XMPL 4DZ8B 3RPIA 1T22A 1A6ZB 1A6VL 4KK8C 3MRHA 5J13B 3PP4H 1R3HB 4KTEH 2H2SD 2JJWA 3WD5H 3GMMB 1CLYL 2PW1A 4X9BA 5D7LD 4BUGA 1N2RB 1JPSH 1MFAH 5JIIA 5JOFA 4Q0XH 5J1TC 1KC5L 4IS6B 3NGBC 1P7HL 5TE4H 4N1EA 2V9RA 2YUXA 5JIKA 1YN6A 3W9EA 3H9HA 5GS0C 5J1AB 3NH7L 4MDJB 3TBTA 1IGYB 1WTGT 3HFMH 1U93A 3MNVB 1N0XL 4JPIA 2DN7A 2HFEB 1YYMH 4HG4J 4NQDD 3QDMB 5F9JA 3CDGB 3P73B 4C83B 3G9AB 5FYKD 1JGLH 4OLYH 3DJ9A 2P48B 3BZ4A 2XACC 1DQJB 4KI5E 3M8OL 5HVHB 1UEYA 2X42A 4P5MB 1WIUA 2E8ZA 3ILPA 3MUZ1 1IL1A 1JCKA 4HBQA 3SDDC 1H5BA 4MA3A 3QQ4B 2ESVA 5FO8B 3G6JA 4KDTC 2J3SA 5JW5B 3QEQD 4Z7NE 2QSTA 4WDIB 4XVSL 5JXAH 5D6DC 5BVPL 4OV6F 2JJSC 1L0QA 1RULH 3TN0B 5E8EB 3QG7H 1PEWA 3LPGA 4M7ZC 1BFVL 1FAIL 3E6HA 4S1DC 4JN2A 4K3EH 3HC3H 2EDQA 4OFDA 1FLTX 1BF2A 2WAHA 1CF8H 1KIQB 5B3JF 4LCWB 1ZT4B 3KWWB 4WWKD 3RNKB 1UC6A 4OZHE 2C7UA 4AIXA 1CVSC 5E8NB 4QXWA 3MGOA 1IAKB 1QSEB 4N9GA 2AJSL 1BIHA 3ARRA 3QIWD 5GS3A 4YHML 1GVIA 1S9VB 1WLHA 5IQ7L 3ZE0E 1FFPB 4F15C 3KPOB 4E41A 2GTZB 5IT2L 1MF2L 3OBAA 1SJEB 2CK0H 1CICC 3QQ9D 1XGTA 2YR3A 4FQ2L 5IMMB 3D0VA 3G6AB 1F97A 4L9LC 5F71A 1KCLA 1CK0H 3TPUB 2X89A 5FO9A 3SPVB 4XXCC 2PETA 4C4KO 2J6EA 3D18A 2Z8VC 3IDJA 1X5ZA 3LD8B 3TVMB 3RU8H 4LPWA 4XGZA 5FM4A 2HVJB 4BSWB 4O2FA 4HDIA 1KCRH 5C6PB 3EHBD 3TCXA 1T22B 3S37H 5GIRA 3MRHB 4M93C 2QQNH 4ESKA 1PD6A 4GS7C 1QSFE 2PW1B 1G1YA 1Q72H 2W07A 4C58B 5DRXB 1DL7L 1PZ5A 4QXGL 4G9FD 5CILL 15C8H 1K3IA 2Z4QA 2F74A 3WHXA 1S5IL 4LKXA 1YN6B 4MS8C 3H9HB 4LPCA 4ONGL 3TBTB 2OZ4A 1U93B 1Q1JL 1YY8A 5I19H 1XGUA 1WV7T 4WTWA 3KYMA 3A6CH 5EN2B 5F9JB 4FQPA 5DJAA 3VFWA 4AT6A 4O2CA 1D5BA 3MV01 4PB0H 3CVIH 3EYVA 3SE3A 2F53D 4M61A 3MUJA 4M3JA 2O5ZH 4PBWD 1JGEB 1IL1B 4KTDL 1H5BB 2IANA 4HS6B 4MA3B 5JA8B 2ESVB 4KVNH 2PYEA 3G6JB 3P0VL 1NLBH 3S36X 3P9LB 1CFTA 4LBEA 4P3WA 1JGUH 4PJAF 3QXWA 2R0KL 1E4WL 4QXTA 5IK3A 3OJVC 2XA3A 4M03A 3CH1B 3MACH 1I1CA 3E6HB 4JN2B 1XF2B 3ZKND 1M05A 4S11A 4RCAA 1IAIL 3QHZL 3TM6A 5CJXC 5E24E 1RIHL 2I25N 1KCKA 1SEBA 4BM7A 4N9GB 2VLRE 5JLZB 1DANT 1NC4D 4EZMA 3N9GL 2ZP0T 3RY6C 3SO5A 1CWVA 1MCQA 4FFZH 3MX0A 5FECA 4R4BA 4NNXA 4I3RH 3KGRA 4HUVB 2E6JA 1P1ZB 3WIFB 5I66A 5HY9B 3CXDL 4NP4L 4QRPE 3DGCR 4Y2DC 3VDBA 3QIBA 2DB8A 1XGTB 1T2QH 1DCLA 1QFWI 3D0VB 2BJML 2FEEI 5IKCA 2EEBA 4G6FB 3O9WA 1MNUH 5DDHA 4JHAL 5CJ5A 4FP8H 3V6OE 5BO1L 1K9TA 1BD2E 4MNQE 3ZTNL 4UI2A 4JM2C 5FO9B 3UX9B 3IDJB 4HH9B 3QCUH 4XVUC 2A0LD 3MV9A 5C0AD 3CC5B 2OR8A 4PJ5D 3IDGB 5KOMC 3ZYZA 4O2FB 5DD5L 4HDIB 1P9MA 4AK1A 5I1LA 3KDMA 4OCXL 3BOVA 5A3ID 5GIRB 3SE4A 2Z0BA 3L3HB 2BNUA 3T3PE 2HH0L 2ADFH 4R7NA 5I1EL 1KCSL 2Z4QB 2F74B 3WHXB 4LKXB 2Z31A 4XHJC 1U8LA 4Y19A 4G5ZL 3RBSA 1HHJA 4XCCH 5C8JA 12E8H 1T0NA 1QO3B 1Y0LB 5FYKU 3SHSA 1NCAL 3B83A 1YY8B 5D7IB 4JFDB 4JDTH 3MOQA 1U6AH 2QTEA 5DJYA 4O2CB 1WC7A 3KVQA 1N4XH 4LHJB 1CDBA 4K55A 3S96B 3W5NA 4DKDC 5E5RB 4R4NC 1XR9B 2AK4A 3S6CA 3EYVB 3TA3D 1FN4B 4M61B 1U8JA 2QSQA 3U9UA 4LDEB 4AQ1B 2FLRT 5E08L 1D5IH 2DQTH 1FIEA 2EEAA 5D1QD 1I9JH 2IANB 1JGLL 4RMUA 4OLYL 3D85A 2PYEB 2E7HA 4ODWA 5F44A 4PTUA 4UV7H 5K9QI 2Y07L 1JZ8A 1CFTB 3H9ZA 4I4WB 4F2MB 3BDBA 1GGIH 4QO1A 4NWTL 5IK3B 5H8DA 3B9AA 4N1CA 2RJMA 2VR9A 5ALBH 1JTTA 2P5WD 2DQEL 1A14H 5T3XE 5T1KD 1M05B 1T89C 3UO1H 3MRQB 4IRZH 4WTZG 5JXAL 4JZOA 4P2QD 4KK6C 2VLKA 4HWBH 4FN0A 3JVGC 1JNNL 4R6UA 2JLLA 5E2JA 5D70H 1KPRA 2YSSA 4APQA 1RZIA 2MCG1 5EZJB 3EOBA 5L2KA 5DJZB 3P0GB 1CF8L 4M6MH 5HHXL 5FECB 4R4BB 4K9EH 4NNXB 5BZDA 3RWCA 2FD6H 1SJXA 4JY4A 3QIBB 5E7BA 5I6XC 4NQEE 1IGIH 4XI5C 3MGTB 5IKCB 4OZHA 2IAMC 3DXAD 3G5VA 3U0WH 1U91A 3TT1H 2BFVH 1RZ8A 2EXWD 5CHNA 3RZWA 4FQHA 1TCRB 1JGDA 3DMMA 1BVKA 3MV9B 3PUCA 4QRTA 1JPFA 4KKAD 4NKQB 3TBYA 1U3YA 4LCYB 1PG7X 3VXUE 4J12A 4JFFD 2W0FB 1ZT7A 3KDMB 1M1SA 4G42B 3Q5OA 1CCZA 3PWJA 2BNUB 1T7VA 3DSNA 3RU8L 4EDXA 2CD0A 4R7NB 1O0VA 4HLJA 2Z31B 1BFOB 5BRZD 4PREA 4Y19B 5C8JB 4S1QL 1T0NB 2D3VA 2H3NA 3OGOE 4L1DA 2VLMD 1YPZA 5E8PB 4GRWE 1U8OA 4GXVL 1RUAH 2X4QA 5I71C 15C8L 4KHTL 2DYPD 1AC0A 5KS9A 4XWGH 1WC7B 4WENB 5SWZD 5IW1A 3NCYS 1DVFA 2WINA 3QRGL 2LTQC 2AK4B 4I1NB 5I19L 1OAUL 1CFVH 3HE7D 3U9UB 3IU3A 1A2YA 2JJTA 5HYEA 4BA8A 4C56E 1A5FH 3CGTA 4LPYA 1F4YH 5AUMA 5DGQA 4ZUWA 2PTUA 4PP1D 5HI5C 5E56A 3MLZH 4PLKD 3GZKA 4ODWB 3CVIL 4M1GH 1ITCA 5ACMA 3OZ9L 3EYUH 1DQQA 3QIUC 4L5FL 5TFSH 2FATH 3PF2A 2QLVB 3OGCA 3F8UB 4PJ9B 2Q1EA 2XKNA 1KGCE 1IZJA 2WLZA 4HUXA 1NAKH 1X5HA 1Y6NR 3L5XH 2H32H 1CDJA 1NBZA 4KVNL 3TO4B 2E9JA 1NLBL 1C8PA 4E42A 1JGUL 4JZOB 4NWUL 2VLKB 3WIIH 4W4NA 3U7AA 4YHKH 1L4IA 3PQYE 1KPRB 2YSSB 3MACL 1RZIB 1F2QA 1U92B 2P8PA 4YWGH 3O3EA 5GGRY 2VTFA 4TULH 3EOBB 3DV4A 1MFNA 4BFBD 5L2KB 4GUPB 3RWCB 4M4RA 5F9WB 3T0EE 5IV2B 2IALA 4JY4B 3EDEA 5T3ZE 3X13B 4M48H 4UT6H 3B2VH 1L0YA 1QLEH 3LMJL 1A0QL 1BECA 4U1NB 4AEFA 1FNGA 43CAA 2CQVA 4MWFA 3G5VB 1F2XK 1EXUA 5CHNB 1RZ8B 1RJCA 5DFVD 5HYIA 4FQHB 2DAVA 4WFEE 4BQ8A 1JGDB 4QRTB 4NQCB 1JPFB 3TBYB 3EUUA 1MNUL 3C9NB 4OKVB 4YLQT 1RUPH 4IOFC 4M9OA 3K2MC 1ZT7B 4Y5VC 4F7TA 4CN6A 1M71A 1JNLH 3HC4L 2B5IC 3TJEH 4X6CA 1IAIM 3PWJB 4EDXB 3S7GA 3HNVH 5DO2C 3V6OA 3OKYA 4MNQA 3HAEH 3AREA 1MPAH 4UZGA 5HHME 5I8EA 1OOAA 1AFVL 4PREB 4XRCB 2RCSH 5FFLA 1KENH 4LVOC 1QYGH 1YPZB 2VH5L 5HYQB 1U8OB 3QUYA 1ACYH 1JMXA 1PFCA 4TRPH 1UG9A 1FRGH 4YAQA 2AEQH 5KS9B 4YR6A 3ARBA 4XCCL 5SX4I 5IW1B 12E8L 1DVFB 4YHYB 3HE6D 2XTJC 4ENEC 4PJIF 1HYRC 3NPSC 5J6HA 2FH6A 1LEGA 2Q20A 4JDTL 1MY7A 4L4TE 4UOW1 2CO6B 3HMWL 1A2YB 3IU3B 3QWQB 2ERJB 4KI5D 1LMKA 3BPNB 1AO7E 1N4XL 1INQB 2D7TH 4Z95H 3UYOD 4R2GC 2YEZA 1OVZA 5DFWH 1S78C 5J6GA 3R8QA 1DQQB 3V52H 1I7RB 3U48A 2IBZY 2AVGA 2I9LB 3BD5A 1D5IL 2DQTL 2XKNB 3V0VB 3LQAH 1F6LL 3F58L 2GSGA 3B5GA 4N0RA 1NBZB 4LLVB 1KJ2B 3CFKA 4QOKE 4PJEB 4E42B 1BZ7B 4KQ3H 3ARFB 1MCEA 3EJYC 1VEOA 3QEHA 4H20L 2OL3B 5ALBL 1IE5A 4LVNB 2P8PB 3O3EB 3DV4B 1A14L 1EHXA 4F7EA 2HJLA 4YPGA 4P46B 4PJXF 2W0PA 5AG9A 3DX6A 1JPGA 5C9JA 4EN3C 5C09E 4EI5C 2E7MA 4QEGA 5TPWH 1FNGB 4M6ML 1T5WA 43CAB 3BRFA 4MWFB 3MROA 1EXUB 2DQGL 1FYTE 3A6BH 3HS0A 2FECL 2APXA 3EOTL 3QISA 3RAJH 5CUSL 3KLDA 1V3JA 5HHOE 1CBVL 3S36H 1U42A 2IF7A 1GZPA 1IC7H 2UVEA 5IVZB 3C2AH 4YE4H 4F7TB 1M71B 2BFVL 1NFDF 3NIDF 3BQUB 5DYOA 3KLHD 4L8CA 2EYRA 4X6CB 5I16B 1XZ0B 4CW1B 1A7NH 1M7IA 1ETZA 2RGSA 3B8SA 3O4LE 1QSFD 5I8EB 1WCQA 1WCBA 5DJ6A 2HTKD 2QL1A 1KLUB 1U3ZA 2ITDA 1B6DA 2VLJD 3TZVD 2DQFA 3DWTA 4QCIB 4L3AA 3QUYB 4RX4A 1OSPL 5A16B 3AMKA 2N56A 5M95B 3LSOB 3BKYH 1WICA 1YDPB 2VISB 3ARBB 4YR6B 2FJFB 5DD3L 3S3SA 2AEIT 4P2CG 3UMTA 5LAXA 5CZKA 1D5MB 2MQCA 3H9SD 1LEGB 1BFTA 3TCLB 3RIAK 1J87A 5E7FA 3X12B 3IYLW 1UWEH 3L3IA 2AI0H 4XWGL 3VCLA 4RBPH 2ZSVA 2G9HA 3I02B 1V5JA 3IAGC 2YEZB 3SDDA 2DQUH 5J6GB 3PL6D 4R26L 4W6XB 1AKJB 2HLAB 4KV5E 4LDLB 4RFEA 4KDTA 1BQHA 4AMKL 3D0LA 5MI0B 2XOTA 1JYXA 3ULVF 1II4E 2JJSA 1T80A 3MLZL 4DN4L 1P7KB 3SCMD 1LWRA 3CFKB 4G6JL 4PLNC 1MI5A 3VDCA 4ZQKA 4ZAKC 3EYUL 5TFSL 4C56A 2GKIA 1NC2D 3B43A 5CINH 5FHBL 1PKOA 1XFPA 2VDRH 2OTWB 1R5WA 2NTFB 2F19L 4YZFE 3RX8A 3ALXA 3TH2T 1VFAB 2E7BA 4MA8L 4HKBB 3L3KA 4YPGB 1EFXA 2NY3C 2VLRD 4HT1H 3TBWB 1V7MH 2F5BH 5DJXA 1KLGA 2FBOJ 3DX6B 3SGDI 3HUJF 4YHKL 5D7JC 5HGGS 5C9JB 3IDMA 1UJ3C 4M6NH 5D5MA 4BZ1L 4EUPH 5KVDH 4H0HB 3IDXH 5F89B 4M7LT 5FV1L 2PXYD 4QRPD 1CICA 4X9FA 1AE6L 4PLJD 5IMLA 1T5WB 3H3PL 3OB8A 3MROB 2OJZL 4L9LA 4KJPD 5KZCD 4MAYD 1R0AH 3N1MC 3GIVB 1BZ9A 3HS0B 3WO4B 4P57A 2RFXA 4UT6L 1BD2D 5EBMB 4XXCA 3KYKH 43C9B 1GZPB 3SY0A 4WIQA 4P2OC 3DVNA 2EDFA 5DYOB 3ULUL 4L8CB 3JWOH 2EYRB 2DS4A 3BH8A 2V5RA 4GMTL 1M7IB 2YN5A 4L4JA 5IM7B 3DO7A 5ACZA 5DJ6B 4MXWH 1QFPA 4MDIA 1MJ8H 3TJEL 4JPVH 4LMQI 3S34H 3GIZH 4OSUH 3VFMA 4OF7A 2H45A 3HNVL 4CAGA 1WWWX 1S7TA 3ULVD 3VGHA 1MPAL 4KAQL 3MRLB 1QFHA 2C3WA 2BDNL 5LAXB 2WZPD 3WE6A 5DRNA 1J1XH 5D72L 4TTGA 3IDNB 3I3DA 1ACYL 4G6MH 1XF3A 1RZKC 1H3XA 1Q0XH 1FRGL 2P1YA 1KBGH 2AEQL 4Y8DC 3L3IB 3VCLB 3VFSB 4GQ9L 4DVRH 2ZSVB 2G9HB 3MJ6A 3KJ6L 3SDDB 3ZTJG 4LFHG 1CD1B 5IBLC 3V5KA 1X44A 1CN4A 1BQHB 3D0LB 1PG7H 3B2UD 2R2BA 1DSFH 2D7TL 1KPUA 4Z95L 3LH2L 4PY7A 1UWXH 2HJKB 4M7ZB 3L3JA 3QDJD 4OFIA 4FZ8H 2KKQA 1TCMA 1AO7A 4UAOB 3LZFH 3S3PA 5T3XD 4UQ3A 3LQAL 5GRUH 4JCMA 1HI6A 4Y4FB 3MYJA 5CJXA 1RZGA 5B4MD 4XZUB 2Y5EA 2PW2A 3DGGA 3GRWH 1J8HE 1S7VA 1EFXB 4GH7B 4KQ3L 4Z7QE 2NY7L 3BKCH 3C5JA 2D4DA 4NRXA 4QOKA 4LVEA 4F15B 3IDMB 3NFSL 1NEZA 5D5MB 1QACA 1T6WA 5K9QG 3FB5B 4Y2DA 4HEME 4NQED 1T04A 3UZEA 1CG9A 4ZNEE 4QHUA 4KDVA 4J8RA 3RHWK 4EXKA 4G8IA 4M62L 2IGFH 1MFDL 4P57B 4XP1L 4GW5B 5FUCE 3NCEB 5JHDE 4JM2A 3HZKB 4IHOA 1CDHA 3MLVH 3SY0B 4ZDHA 2I26N 3DVNB 4GSDL 4LSVL 3A6BL 5ERWB 3VXUD 3BH8B 3DHMA 2XWJA 1T1WA 1U8PA 1OAQL 2Y5TA 3N1FC 4NQUA 3T4YA 5ACZB 3QAZC 4UTBH 4WUKH 4DCQB 1LDSA 2A9NH 4FQIH 3U4AA 5F7MC 1IC7L 4MDIB 4YE4L 3VXMD 2Z93A 3IDIA 5L9DH 2MMXA 4EXPX 4N8VB 4W68A 2I27N 5F70A 2V7HA 5LBSH 2QSCH 1X7QB 1C08A 4L8SC 4PUBL 3WE6B 4O02H 5DRNB 4PRDA 3O4LA 1P7QA 3WFCH 4PP2B 4S2SB 5I1CH 5I8CB 1KB5A 1XF3B 3V2AR 1NDGA 1A3QA 3BKYL 3ZHKA 2CR3A 3GUTA 2V2XA 4AH2B 3V5KB 1SEQL 4B0MM 4OI8A 2X4OA 5D7IE 1TFHA 1EEYA 4JGMA 5I2IA 2EDKA 2ED9A 2GJJA 5EU3A 1UWEL 4LP4A 2AI0L 2R2BB 1FNSH 1KPUB 4Q9RL 4NBZB 1WAAE 4ONFL 4PY7B 5EIIB 3L3JB 4JG0H 4KZEH 3T1FA 1ORQA 4M6OL 4N5UA 3VD3A 3RUGA 1S3KH 1FVDA 1EEZB 4UQ3B 1T89A 4F33B 1HI6B 3MYJB 4EQ3A 3JVGA 5AYUH 3QFJA 2PW2B 4AEHH 3PQYD 4NQSA 4PTTB 2JB6A 1E27A 5JIHA 1RHHA 1E4JA 1I1FA 3MOAH 2A38A 3NACH 4O58H 5FK9A 3UTZA 1JZ2A 1OD7A 1S7WA 3VJ6B 1HCVA 1CXIA 4A6YA 1W8OA 2HG5A 4LCCC 5HJ3A 2GK2A 4XNMB 5K93A 3T0ED 3UZQA 3OAYK 2N4IA 1JZ5A 5T3ZD 1AGFA 5ETUA 4Q6YA 1CG9B 1CQKA 3DBXA 4LEXL 1V7ML 4U1JA 2NY1D 4J8RB 4P4RB 4HPOH 4G8IB 4R0LC 2DI7A 4JM4H 3C60C 4M6NL 1J5OH 3IDXL 4JM2B 3CSYA 3V4PL 2V17H 4ZDHB 4X7TA 5JDJA 5HHVH 1JJUA 3IT8D 2R56H 1A7RL 1TQCB 5K9KA 2EKSA 4D0CA 5FA3A 1T1WB 3ZE2E 3QJHA 1U8PB 2Y5TB 3QRFM 5DK2A 3LRHA 3T4YB 2MKWA 1LO4L 2VB5A 4NRZA 4EJ1C 3DETD 5DZLA 3OAUL 5CGMA 3GI9L 3IDIB 5DEGA 4GQPH 4Y16D 3WFBL 1VEMA 2YS4A 3ARXA 1FC1A 4D9QE 3SDAD 2V7HB 4ZPTB 4AEEA 1H8NA 4KJQD 1MJ8L 2JIXA 3ZKXC 3AROA 1OTSD 4OSUL 1KIPA 4XPAL 4DEPB 1MRFL 5ESAA 2BVEA 5C86A 4QY8A 1BQHG 1NDGB 2P8LA 4HQQL 4Z6AT 3S88L 3WKML 3MLRH 4L4TD 5DQDL 1HHGA 2HYMA 3IDUA 3GUTB 2V2XB 2BSRA 4DUVA 5J89A 4GRMA 1YJDH 2X4OB 3BUTA 4DGIH 4JO3H 2NNAB 3QIUA 5EU3B 2G2RB 3KPSB 4DVRL 1FZOA 2C1OB 4X6DA 2YA1A 1WQVT 3PP3H 2VITA 4XP6L 5J7CC 1F8TH 5TE7H 5MEPA 5HHNA 4ZFGH 1NGQH 3T1FB 4U1SA 2L7JA 3RUGB 1JZ4A 2QSVA 1FVDB 1JE6A 1PG7L 4JQVC 2QADC 1LO2H 1DSFL 1BX2B 3D25A 3VWKC 3WFDH 4Y5XC 5CGYD 3QFJB 1ZA3A 4NQSB 3F12A 4XBPB 1RHHB 4ODBD 1I1FB 5FK9B 3UTZB 5FKAA 1S7WB 4A6YB 2HG5B 5C2UB 2PTTA 1EV2E 3U4BL 1OGAA 4EOWH 2F54A 4X4ME 5I6XB 4XVUD 4XAKE 5E1HB 5FYKL 3GRWL 5ETUB 3L1OL 5C09D 4U1JB 1W72A 4LLAA 1ADQA 4OFYD 2FIRT 4OZFA 2DL2A 3UCRA 3OXRA 5AEAA 3C08H 3RVVC 1VB9A 2AV7B 1J8HA 4UOW0 3VGFA 4I0CC 4U31A 1PSKL 2A2QT 4Z7OF 1FYTD 3CSYB 3GSUB 3IXAA 5HHOD 3PGDA 3VXOA 3QH3B 2VZSA 5K9KB 1A4KA 1U9KA 2EKSB 4XP4H 4JR9H 2KBGA 4ZNEA 5FA3B 2V5SA 1A7BA 3WN5B 4Z7WE 3GB7B 2A73A 2D0FA 3MLVL 3TPKA 5BOZG 2YXFA 5HYSB 4GRLB 1Q9LA 5FCUL 3REWA 4DVBA 3VXSB 3VI4F 4R4ND 4MD0B 5ICYA 3HZMA 4PD4K 2RAMA 4LOUC 5J06A 1RZ7H 1XF5A 4ELMA 5E95B 4UTBL 4WUKL 2ZJSL 5HI4D 3OR7B 2JIXB 4M8QA 5E6YA 1X5IA 5L9DL 1KIPB 5LWYH 2GJ6E 3O8XA 4HF5L 4DAGH 2LTQB 4QY8B 1T4KA 3IXTA 3KNBA 4WHYG 1C1EL 4H88H 2N7AA 3FO1A 2Y1VA 2QSCL 3H3BC 4HJJH 1G6RB 2FSEA 4Z5RA 4WV1A 1HHGB 3UAJC 3W0WA 3WNLA 4GRMB 2V9QA 2ZCKL 4X98A 3WFCL 5I1CL 3T2QA 3AMLA 4NDMA 3LKPB 3QIUB 3HLAA 2EDEA 2H6PB 1VGEH 3EDFA 4I9WE 4OB5H 2VOTA 2HFGH 1FZOB 4X6DB 5F1IA 2VITB 2LQRA 3FMGH 1VEPA 5E03A 1BF8A 4Y5YC 3CMOH 3O3AA 1T7WA 5IW6A 1IMHC 4ODTH 1OTTD 2L7UA 1T1ZB 3U4EB 2ICWJ 3ORJA 1FNSL 1OAKH 3BZEA 1G9ML 3O81A 1G7MA 4U0QB 4JG0L 1ZA3B 4HBCH 3F12B 4MA7L 3O2DH 4N0FA 2AS5M 5E2TH 3MA7A 3FN0L 1B4RA 1WAAA 2IAMD 8CGTA 1R6VA 5J4MA 3BXNB 2PTTB 3J7HA 2I9TA 4XVTL 1OGAB 2YC1B 3LPWA 2F54B 2APBA 5HDOA 2MKLC 1X4ZA 4AEHL 1QPXA 4NHUA 5GS2H 3EO0A 1W2KT 3K74B 4XX1E 4EN3A 4TUJA 5DD0H 4AIZB 2DTSA 3MOAL 3OXRB 5EUKA 4M1DL 3TWCL 1FPTL 4XNYH 3RGVA 2AJYH 5CIPH 5FGCB 1RI8A 4NQVB 3U79A 2D03L 1ND0A 1JZ7A 5E8DH 4OD2A 2IFFH 3RTQC 2AQ2A 3VXOB 2IH1B 5TH2A 1KB9K 4XT1C 4XPTL 1G6VK 1DUYA 1J5OL 3G6JF 3H8NA 2VC2H 2DM7A 3CFDB 5GHWH 5KSUB 4OM0H 2A73B 4FZEL 4F37F 4BELD 1UWGH 1X5FA 3LKSA 4U33A 1QG3A 2F8OA 1Q9LB 3PIQA 1T20A 1UFUA 4KKBD 5C0FA 4LVOB 5ICYB 4HLZG 5HHPA 4M7LL 4D9RE 2EE2A 3PWPE 3RVTC 1XF5B 4ELMB 4MA1B 4G3YH 4TSBL 4ZO7A 3U6RA 4QF1A 3I3EA 5GS1C 4M8QB 1JHKH 5TF0A 5GGVH 1XGPA 2BVYA 4MXQC 4RNRA 2Q3AA 5JHLH 1D9KD 4DN3L 1NAML 2XTJB 3O8XB 1O5DT 2KZWA 4OGZA 3NIGE 3NPSB 3IXTB 3KNBB 3FO1B 1HILB 1KELH 4Z5RB 2FSEB 5BV7H 4WV1B 2C26A 5IJKC 2I5YH 1UACL 1I3UA 2CMRL 3DX8A 3QYCA 2CK2A 1F6FB 4X7DC 4X7SL 3VD9A 1ZLVK 2R1WB 3VD5A 4NDMB 1FL3A 4Z77A 3JV6A 3HLAB 5DJDB 4ZG1A 3UPAA 4KHXH 3MLRL 5GRWA 4CBPA 4I2XB 1TZGH 1CGTA 3R06A 5IW6B 4V2BA 4DGIL 3BP6A 3OXSB 4FQJH 4RGNB 1QEWA 4ZAKA 5ECJE 5GGQH 5DK3A 1ZV5A 3PNWA 5CJQL 1XAUA 1F4XH 3BZEB 4TTDD 5BJTA 4PRPB 5GJTH 1G7MB 2AJUH 4M3KB 5TE7L 5E99H 4NFCA 1K4DA 4G6KH 3W81A 4N0FB 2F8VA 3MA7B 1M4KA 1EK3A 3JZ7A 5FHAH 3SGKC 2DLHA 1TENA 2I9TB 4RSVA 5D7IF 5D7JA 1Z0MA 5FUZL 3O2WH 4NHUB 5J12B 1UJ3A 3EO0B 5K59F 4EN3B 3BGAA 4YC2B 3QXDA 2IC2A 2E3VA 4J3OC 4QRSB 5EUKB 4U2YA 3C87A 4EI6A 3RGVB 1JHLH 5I1GH 4MHHI 1Q38A 1ND0B 5T33H 5JHDD 1UA6H 5ID0B 1WBYA 3QUZD 2VAJA 2BX5A 4P2OA 3UTTE 3L95A 2AW2A 3DECA 2OK0H 4ZTOL 4NN7C 5I9QC 25C8L 3LKSB 3GGWB 1RV6X 4ZFFA 2P7TA 3JV5A 4K71C 3PIQB 2OTUA 4PGCA 1NBVL 4G6FD 4FQ1H 1I9IH 5C0FB 3UEZA 2H26A 1REIA 5HHPB 4XCFH 3MO1A 4BQCA 1U8IA 1IAII 1YECH 3IFOA 4ONOA 5EH1A 3RWIA 1ULVA 4G7YH 3LS4H 3U6RB 4QF1B 4RWYH 1UKTA 3SDXA 3H6JA 4XC3H 4Z7WA 1GL4B 1XGPB 2IBZX 4RNRB 5GRXG 2QBWA 3QO1A 2NYYC 3Q5TA 4PJFE 4MB4A 5DMGD 1S78D 3WIHH 1EA9C 3QPXH 1Y18B 4D9LH 5JXED 3WSQH 2RR3A 4R8WL 3FOLA 3LQMA 5C0CE 3E3QC 5JOEA 5LWYL 4DAGL 3BIKA 1NUDA 5CCKH 2GT9A 3LCYA 1FL3B 4Z77B 5C07E 5DRZA 1PY9A 2A77L 3EJYD 3O3DA 4JFDD 1WGOA 1AD9A 4QWWC 2GQHA 1WFUA 3RFZC 2E27L 2YMXH 3BP6B 5B22A 4LDOB 4ONHA 4WNQB 4J4PA 2VDNL 3IF1A 1DBKL 2Q76A 2AJVH 5BJTB 2YKLH 4EI5D 3FMGL 2IFGA 5JPNB 1K3ZA 3X11B 1UM6L 2HN7A 1RK1A 4PRBA 3TH3T 4P5TB 2X4PA 3GSRA 1OAKL 2AEPL 3MRKA 3PGCA 1HEZB 1DBAL 5IEKA 5D7JB 5KSVA 3DUUB 1BIIA 2GFBA 5E94B 3EZ8A 3LS5H 5E2TL 4NN5B 3WS3A 1IKNA 3HPLA 1WFNA 4EI6B 1GH7A 2BHYA 4IRSA 1IAMA 4J1UA 1EIBA 4PJGB 3Q1SL 3BEVB 5DD0L 5ITFA 2BVOA 1G9NH 1GGCH 2J88H 5TQ2H 1WBYB 5D96B 3CFBB 2FH8A 5DT1H 2QHLA 1DUZB 4OKDA 4AZ8A 1BBDH 4HJ0C 4PRHA 4XNYL 2AJYL 3DIFA 2EDTA 3KPPB 2GEEA 2ZUWA 3T4AA 3GMQA 2EH7L 3DYPA 3P4MA 5ID1A 4HIXH 1UXSA 5GGTL 1GYAA 1DBML 1FLRH 3ULUC 5E8DL 1NCWH 1ZLUK 4ZFFB 2R2HB 2VSCA 1X6NA 2GAZA 3S35X 2OTUB 4PGCB 4EBQH 5LVEA 2FDBP 4TSAL 1YMME 1T5XA 3AS3A 5ANMA 5GHWL 2H26B 3MO1B 3IFOB 3UTPD 4YX2H 2P5EB 7FABL 4JE4B 2X9YA 4URTB 3FHQA 1I7UA 1SY6H 3SDXB 4D9QD 4YFLI 3QO1B 3HNSL 2Q86A 1ITBB 3MRDB 5DHVA 3VFNA 5KN5B 2BVTA 1MFBH 4L8SA 5F7KC 1SJVA 5KTEH 3QXTA 1GJIA 1JHKL 5GGVL 1JPTL 4BH8A 1A6AA 3FB6A 5EIQA 3FOLB 3ROLA 5JHLL 4WJ5A 1RMFH 4OZIB 3UBXI 4FFWC 5IHZA 4QXUH 1Q9KA 1I8KB 1JYNA 4X80L 4FS0A 4Z0XA 3GK8H 1DDHB 5DRZB 4DZBA 9CGTA 5KJRL 1KELL 5BV7L 5J11B 2R9HC 2D0GA 1MCSA 1AD9B 3ZKMD 3CNKA 4LGPB 1RK0A 3RBGA 3SJVE 1G9EA 2NY3D 3SKMA 1KACB 4ONHB 3IF1B 3QA3A 2EE3A 5C08B 3LEYH 3MR9A 4R3SA 4KHXL 4M7KH 3RGHA 3ULVH 5CZXD 1BJ8A 1TZGL 3EFDH 3QULA 5HYJB 2MQ0A 3LQAC 4Z0BH 4P4KC 5FGRA 1RK1B 3GFUA 4FQJL 4PRBB 1F4XL 3GSRB 3VXPA 5AWNL 1A6UL 3PGCB 2XQYK 1YPZF 2AJUL 4O51A 5IEKB 5KSVB 1T7ZA 1BIIB 1YQVH 4PJ9D 5E99L 4UNVA 2J8UE 3O4OC 4LCCA 4NFBA 2GFBB 5D2LE 3U83A 5B8CC 1YEJH 3IFLH 1FBIL 3MNWA 2OQJB 4NKOA 4MNGA 5KS9F 3HI6L 1FL5A 3TO4D 1FGVH 4HUMB 1IC4H 2C9AA 2VDPL 3H3KA 3KLSA 1A02N 4IRSB 4R0LA 5J56B 4Y1AA 3QQNA 4KK5C 5CP7A 5HGAB 5HVWA 4MLIA 4JANB 4U6TA 5ITFB 1INEH 4D2NA 1XF4A 3UYPA 5F96H 4PRHB 5IHUH 1T83C 5JNYA 2OR9H 3DIFB 5IBTL 5I1GL 3GMQB 1FZKA 5ID1B 3NTCL 2JCCE 4Y4HB 2OYPA 4OZGE 1JTPA 4LSRH 4RGOL 2X4SA 1H9VA 4PJEF 4WEBL 2PO6D 4XBEL 4NCC2 5ANMB 5EU6E 3OPZH 1FL6B 3TESA 3HRPA 3MV8E 3RVXD 2O26U 3T2NL 4NFDA 1HQRA 4KUCD 4OFPA 1EBPA 1I7UB 3ULSA 3VWJC 2Y36H 4WI2A 4NQCD 1I3GL 4FQ1L 2Q7NA 4LNRA 3ZE1F 3AUVA 2Q86B 5DHVB 3VFNB 3AVEA 1MCHA 4L8SB 1C12A 2EO9A 1YECL 1J0HA 2X4TA 5KOVC 1HYSC 4G7YL 5L2JA 1ZAGA 4RWYL 5DS8A 5FF6B 2GJ6D 1N59A 4XC3L 5TE6H 1ZLSL 1A6AB 1S7RA 3FB6B 3ARZA 3ROLB 1WITA 4WJ5B 1JTOA 1B88A 1Y6KR 1VPOL 3ZT6A 5C0RL 4FA8A 4IOIA 2BRRH 4Z0XB 1HQ4A 3QPXL 4D9LL 4JFXA 4DZBB 1C5DA 4MNHA 4MJIE 6CGTA 3EYSH 3QCVL 4OBSA 1IZKA 4I9WD 2B39A 4I5BB 1RK0B 1S7QA 5D6CA 2DMBA 3SKMB 5F7EH 4JY6A 1X4XA 4KRMB 3THML 4KKCC 4J3VA 3V95A 4R3SB 3MR9B 4JQVA 4X6CF 5C0EA 1N7MH 3QULB 3RNQA 3GM0A 1M6OA 2DWEA 3VWKA 4Y5XA 4D0DA 5HYFA 2YMXL 4GLRI 1HHKA 1CXHA 4G7VH 2AJVL 3BD4A 4RFNC 3VXPB 3T3MF 5H37H 2BY3A 1XIWD 3KPSE 2FZ3B 4HS8L 4OIIH 5D2NE 2WM0A 2YKLL 3FT3B 4H1LH 4LCCB 1P2CA 2WBKA 5SWSE 4FG6D 1E6OH 4WI3A 5I75C 3HTLX 4MNGB 3OKNB 2ZUQC 4CN1A 1JV5A 1OCWL 3KLAA 4NZTH 1CDUA 3ARFD 1FORH 1ZHKA 4WRLA 4Y1AB 2KPNA 4LMQE 4Y4KC 3QG6B 3VFOA 4XP5L 1RJYA 3OHXB 4OTXH 4N0CC 5LXGH 5A2LH 1GC1L 1FG9C 2NXYD 1XF4B 5JA9A 3O3BB 3FQUB 2WQ8A 3BISA 4P46D 5JNYB 1OAZL 1YEGH 3MMEA 4LHUD 1MIEH 1JWUA 1FZKB 2RHEA 3TBSA 3HCVA 4PJBA 3DYMA 4LASH 5IFJA 1GGCL 5TQ2L 1YNLH 3P9MA 3EAKA 5DT1L 4J3TA 2B4CL 3V0WL 3GBLA 3Q6GH 1FFOB 3P40A 5LGHH 2NY0C 2WWKT 3JWOC 4IIQC 4FTVB 4KRPC 3TIDA 2O93L 3PDOB 4P9MH 1KYOJ 3PWPD 4EBQL 2W91A 4LNRB 5JUEH 2ATPB 1C12B 1MVUA 2X4TB 3BQUD 1CGVA 2IPTH 1YMMA 2AJ3A 5DS8B 1SY6L 1H8OA 5CEYA 3C2SA 1N59B 4R4FH 1T7XA 3MCLH 5F7HA 1S7RB 1QRNE 3D9AL 3WDHA 5EBWB 5KTEL 1P6AB 1A7OH 4UT9H 1HQ4B 3V6FA 1C5DB 3KXFE 4MNHB 1YEHL 4QKXB