1JOIA

Structure of pseudomonas fluorescens holo azurin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
b'AECKVTVDSTDQMSFNTKAIEIDKSCKTFTVELTHSGSLPKNVMGHNWVLSSAADMPGIASDGMAAGIDKNYLKEGDTRVIAHTKIIGAGEKDSVTFDVSKLAAGTDYAFFCSFPGHISMMKGTVTVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Crystallization and preliminary crystallographic studies of the crystals of the azurin Pseudomonas fluorescens.
pubmed doi rcsb
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1997-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1joiA00
4NB7A 3BQVA 1KYAA 4GYBA 2FNWA 2BO0A 1PLBA 1JZGA 3WNIA 3JTBA 5I6NA 1AAJA 3ERXA 3HEIB 2VN3A 3FPYA 1A3ZA 2EIJB 3RYMA 3WI9A 2R7EA 2HXAA 1ZPUA 1NPNA 2EILB 1ZDQA 1AIZA 2EINB 2YAEA 3HB3B 3MBWB 2XX1A 5LDUA 3T6XA 1SFHA 2PPCA 1ET7A 1NIEA 1TKWA 4TXVB 4DPCX 4BWUA 1MZYA 2EIKB 3GXUB 3D12B 1OCZB 3NJLA 4BWTA 4PCYA 1PCSA 4WTQA 1JZHA 2IWFA 1OF0A 4KNUA 1E67A 5I6LA 5A7EA 2YAMA 2FTAA 2IDQA 2QPEB 1I53A 4Q89A 3SBPA 4A2FA 1AZRA 5B1JA 4KOCA 4A2DA 4M4RB 3X2QB 4YVNA 2FT8A 5F7AA 3MX0B 1NWOA 1BEXA 3ABLB 2GC7C 1J9QA 2GIMA 1FWXA 3T6WA 3FU9A 1X9UA 2ZOOA 1M57B 3ASNB 1J9TA 4G7SB 4GP8B 2I7SA 1ETJA 2R7EB 1JZEA 3NJJA 1ILUA 4CSZA 1FFTB 3DIVA 2AZUA 3FQ1A 5B1KA 5PAZA 4HZ1A 1FA4A 3IEAA 3WG7B 4AI7A 2YQBA 5B1BB 2GB2A 1PNDA 1ZIBA 3EH4B 3AG4B 2HX8A 1JXFA 1BXVA 1AG6A 1E65A 3V9CA 1WS7A 3CVDA 3L45A 2P80A 3UAAA 5I5MA 1KCBA 3FQYA 1PF3A 3QQXA 4F2EA 3UABA 3WIAA 3OM3B 2I7OA 1ZIAA 3ZIYA 2TSAA 2UXGA 3T6VA 2YAPA 3NSFA 2BHFA 2IDSA 1PZCA 2Y69B 2FT6A 4F2FA 2HRGA 1JOIA 2XVBA 3FYEB 1L9SA 1MDAA 4P5SA 2I85A 4G7RB 1SHXA 1XB6A 3WKPA 4DP7X 2H3XC 3QJSB 2YXVA 2IDUA 4KNSA 1WA0X 5PCYA 1SNRA 3PAZA 2Q9OA 4HCGA 4YSAA 1KGYE 1NICA 3PAVA 1AS6A 1WS8A 1CC3A 2FJSA 2N0MA 1ADWA 1E5YA 2UXFA 1PZBA 2WO3B 1BYPA 2VM4A 2B3IA 2ZWNA 2UXVA 1L9TA 4UANA 4YSSA 3FU7A 2EIMB 4AKQA 3H4HA 3IN0A 2YAOA 1V54B 3KW7A 1KBVA 4DP2X 5I6KA 2DYSB 2CBPA 2W8CA 4JHVA 4DPAX 3NP3A 3NJFA 4CSPA 4E9WA 4F7KA 1JZIA 1KCWA 2IWEA 4X4KA 3S8GB 1AS7A 2HLEB 2H5UA 3T9WA 1EHKB 3QJVB 2UXTA 4W9ZA 1PNCA 2FT7A 3S3CB 3ABMB 1RZPA 3ASOB 4YSRA 2XUWA 1AQ8A 1BAWA 2RACA 1WAEA 2AANA 3EH5B 1NINA 1V55B 4A2HA 1ASQA 1DZ0A 2PP7A 2XX0A 3NP4A 1BXUA 1NIBA 2JKWA 4YL4A 5D4IA 4FAAB 3TASA 1IBZA 1ZV2A 2VSMB 2IDFA 2XV0A 3FSZA 1M56B 1M9WA 3S3DB 1SFDA 4G71B 3AY2A 2CUAA 5I5JA 3PXLA 1TU2A 2P80D 1PAZA 1IBYA 3NSDA 3FU7B 1OCOB 2X87A 2B08A 1IKOP 3FT0A 4DPBX 4G7QB 1OE2A 3X1BA 1AANA 1NIAA 1GYCA 2IH9A 1NZRA 4DP9X 4KO6A 5B1JC 6PAZA 1OE3A 1PLCA 1W8EA 3FSAA 3H56A 1E30A 1XB8A 1JVLA 2YXWA 2H47C 1GS8A 1MG2C 3NJHA 2Y1AA 3NJGA 5TK2A 3TBBA 2BZCA 4E9QA 3JT2A 3FYIB 4HIPA 2XV2A 3V9EA 2DWSA 9PCYA 1J9SA 4BXSV 1X9RA 1QNIA 2FQGA 1GR7A 2JXMA 2PCYA 2UX7A 1L9OA 1OV8A 2AFNA 3ZBMA 4DP6X 5TK4A 3DTUB 3DKHA 2GC4C 1F56A 2J57A 3N2JA 1A4CA 5EHFA 2VSKB 2OV0A 1A4AA 1ASPA 4BXVA 2E86A 1NTDA 1AZNA 4AZUA 1DYZA 2FWLB 2MRYA 3NT0A 3CG8A 1JZJA 4A66A 4DP1X 5I5IA 5I6OA 3UACA 2BP0A 3AG1B 1B3IA 5AZUA 2YAQA 4GXFA 1HFUA 2BWDA 2CJ3A 2NRDA 2W88A 4E9VA 1SF3A 4AX3A 1CYWA 2DY2A 1IUZA 1E5ZA 2FQEA 4HHGA 4YSDA 1L9PA 3IE9A 1BXAA 3WNJA 2XWZA 3ABKB 5E9NA 1RCYA 4GY4A 1GY1A 4HCFA 3QJQB 4K9JA 4L0PB 4A67A 2QPDB 1AZBA 4A68A 1AOZA 1HAUA 5D4JA 5I6PA 4DP8X 1HAWA 4ENZA 2GI0A 4YSCA 3PAUA 1CYXA 3PPSA 4MFHA 3SBRA 4YSPA 1AR1B 4JHUA 2BW4A 2XYBA 3X1NA 2PCFA 5B1AB 5I26A 7PAZA 1RZQA 2BP8B 3FU8A 4PAZA 1ET5A 2UX6A 3X1GA 1WA1X 2QDWA 3NSCA 2OJ1A 3ZX1A 2J55A 3S8FB 2GHZA 3QJUB 4KOBA 3AG3B 5B3SB 1AZCA 1OE1A 2BP0B 1SJMA 3AG2B 3TU6A 4QKTA 3QJTB 2ZONA 1QHQA 1GS6X 1KDIA 1OCCB 3N55A 1BQ5A 2QT6A 4M3HA 2DV6A 5I6MA 1MZZA 4P5RA 4KO5A 3PLYA 4A2GA 1YLBB 1W6WA 5B7MA 7PCYA 4E9SA 5AKRA 3FSWA 3X1EA 4HALA 3U25A 3IN2A 3NSYA 3TBCA 1MG3C 4KNTA 1A4BA 1ET8A 2A3TA 2FQFA 4YSQA 5D4HA 1NWPA 6PCYA 1J9RA 2Q5BA 1ASOA 2YAFA 2PPEA 1URIA 4E9YA 3CDZB 3UAEA 1BYOA 3EHBB 1SHWA 3FPXA 5B7FA 1NDTA 2GSMB 4UF7C 4E9TA 2ZXWB 3QPKA 2BWIA 1NPJA 1VLXA 3UGEA 8PAZA 3H4FA 1BQKA 1KDJA 3NJNA 1PY0A 3EH3B 1PZAA 2MTAA 2WSDA 2TSBA 2HRHA 1N68A 1JXDA 2VMJA 4G70B 2WO2B 1A65A 4HAKA 3C75A 4FA7B 1PLAA 4KO7A 4BDVA 1CURA 3AW5A 3EF4A 1EZLA 3FQ2A 5I28A 2JFCA 1W6LA 1L9RA 2VW4A 2AZAA 2YARA 4DP0X 1QLEB 1L9QA 4A2EA 3X1FA 5F7BA 2DYRB 1ID2A 2IDTA 2HX9A 2PPAA 5IY5B 2BP8A 2GBAA 3CVCA 3KW8A 3NJKA 3AZUA 3T6ZA 4G72B 1GY2A 4YSUA 2HZHA 4NAJA 1CUOA 1ZDSA 1PMYA 2XXFA 4YSTA 4E9RA 4Q8BA 3CZUB 2AVFA 1SDDA 2PP9A 1J5DA 1KV7A 2BW5A 1J5CA 4W1TA 3NJIA 4YSOA 4HHWA 2PLTA 3OMIB 1R1CA 2J5WA 3GDCA 1AS8A 3SQRA 3S3BB 2XLLA 2IAAC 2J56A 1AZUA 1JVOA 2FQDA 1ILSA 4E9XA 3FSVA 5FC9A 1GW0A 4N4YB 3WKQA 4AKOA 1NIDA 2CAKA 1JXGA 1SF5A 4BDVB 4BK5C 2IWKA 3SBQA 1JERA 1RKRA 2YAHA 3T71A 2CCWA 4GP5B 3ABGA 1AACA 4JKNA 1TEGA 3FS9A 4WKXA 3IBOA 1TEFA 3PCYA 1XMEB 2VM3A 4UAHA 1UATA 5B7EA 4YSEA 3CDZA 1IC0A 2PP8A 4RH4A 2XU9A 3BVDB 2PPFA 3QJRB 1JZFA 4QLWA 3OMAB 1XB3A 2XV3A 3CVBA 1V10A 4GP4B 1OCRB 4EF3A 4NERA 4HCIA 2OCCB 3GYRA 1WA2X 5ANHA 3G5WA 3OQRA 1GSKA 1SDDB 2VW7A 3TA4D 2XXGA 2HX7A 3ZDWA 4BWWA 1A8ZA 2BZ7A 4KO9A 4DP5X 4N8UA 3NJMA 3UADA 2LLNA 2CALA 2X88A 4YVUA 2DWTA 2QDVA 4DP4X 1N70A 3NYKA 4AKPA 2PPDA 1BQRA 1GS7A 1T5KA 5AFAA 3OMNB 1AG0A 2IH8A 2VW6A 4ZK8A 1NIFA 3OD3A 1KBWA 1OOWA
chains in the Genus database with same CATH superfamily
5IROC 2BIPA 4X6FB 3D09A 3P4OB 5C3LD 2BO0A 2LABA 4DUXA 3VD1A 3SDXA 2NZ1A 5J3HC 5L2KB 3JXAA 4JGNA 3U0WH 4CVWA 3TA3D 1NJ9A 4YWGH 2XTLA 4OTXL 1IAKB 5GS1A 1MJ7H 3RA7L 3UYPA 5AB2A 3QWOB 2DIAA 5A2KH 3OLEA 3ULSA 4H8WH 4PRIE 1GCYA 4OGZA 4PJ8B 5EV7A 3MOBH 3SDCB 5BV7C 1HDMA 2H3NB 4AENA 4N3TA 2J1WA 3NJLA 4NENA 2D31B 1CXKA 2NX5B 3FTSA 3JWDC 1JHTA 4PCYA 4B9KC 2EEAA 4H20L 1NBVL 4MYWB 5DQDL 5AG9A 5E8EA 2Y2TA 3SYAA 2YAMA 5JHLA 1J86A 4O2FB 2DWYA 2EXSA 2YLHA 3ELQA 3QIBD 4ZO8A 2E9BA 4Z7VB 4WK2B 1IGTA 4PVNA 2OCJA 4BCYA 2NR6A 4XMKH 5CUSL 3ZDZF 1ADQA 4Y89A 2PF6A 2QQNL 3MX0B 1FPTL 1Z3GH 5F71A 3WN5C 2G5UA 4OQ1A 5CWSA 2WSPA 3ELAT 2AXGA 3MLZH 3WXWL 2E6PA 3RU8L 4YC2B 2COQA 2ZCZA 1FH2A 1XR9B 3NPSB 1AP2A 1BMWA 3EYOB 1YMME 5AW5B 3WIIL 3NJJA 5KSBB 4JPKL 1T3FB 4N8CL 5ANMA 3T8VA 1LL1A 5DEGB 5PAZA 4H1LA 5E6RB 5LBSL 3VCLA 4UDTA 5FF6A 5EUOF 1DEEB 2OTUA 1IQWH 2HA1A 3VVWA 3TT3H 4Z5RA 4PVBA 1RUKL 2G0KA 1WS7A 4QHKI 1F11A 4FLHA 3P11L 5JYMA 5F7MC 3D18B 3D0LB 3U7YL 3QVAA 1N4XL 4KJWD 4F2EA 1EJOL 2BSED 5FV1L 1SGKA 3GJEA 4LCUB 2UXGA 2R23B 1K8DB 4N2FA 5GGRB 1G84A 2KHAA 4KZEL 5IESL 1H15A 4LSTL 1R5VA 1Y0LB 4YHLL 2IPKA 3OHXB 1TO4A 4P46C 3ARGD 3QNYA 4RZCB 2VDNB 1TPXC 5T3ZL 5EN2B 1U8IA 4XB3A 5IGXL 3PIQA 1WA0X 3X3FL 3MZGB 1MFBH 3MGTB 5IMLB 1E6OL 4Z7WE 4XCFH 2CR6A 1A3LL 2UXFA 2DJMA 1IFGA 2R1YA 3DVNA 1H8OA 1X5YA 4TNGA 4I3RH 5FA4A 4DOHB 5FHBL 3HE6B 3HTLX 1V27A 4LPCA 4XAKD 3VACA 1EK3A 3SQBA 5T33H 5AUMB 2ODIA 5I1HL 3FTVA 2J88H 1ZHBA 4RMUA 5KAQG 3QUHA 4BH7B 4DERA 2QQQA 2JI2A 2H32H 1DSFH 2ZWYA 3F01A 4U7MA 3OZKA 4ZOBA 5DRWB 3SO3C 4M7LT 5HYJB 2XUWA 2X4QB 3HBZA 1UD3A 4URKA 5K33A 4NXKA 2P49B 5HYQB 3D25B 3OKNB 4IK7A 5T1KA 3KCPA 4PREB 2GUOB 2E9GA 1DJHA 1X9QA 2UZYA 4CNIB 2Y07H 1MW2A 4PI0A 2L7JA 2F7IA 2JJTA 3IWVA 4GIOA 5F89A 4PJXE 2B2XL 4EXKA 4PJ5B 1A1NB 4L3FA 1I1AC 2OQJA 4OZFG 4PJDB 4UT9H 1SVCP 4ZW6A 1A6ZA 1SFDA 3LEYL 4EN3D 3RE0A 1T0PB 2Z93A 1G4RA 4PD4K 1LJMA 4NRYA 4GSXA 2X87A 2B08A 4HXBH 5E2JA 2FX7H 3WELA 4OKVA 32C2A 1OKEA 1EDHA 3MCKA 3LKRB 2QHLA 1MAKA 1SYSB 2JKNA 4IMKC 2J1YA 2OX5B 4LCWE 2YD8A 1AGDB 5KS9E 3EFDL 4RAUB 4NP4H 4K94C 3FB6A 1CFQB 2AEWA 4KK9D 4YBQC 1D5ZA 3BPLB 1SN5A 3QUZC 4QWWC 3HRZC 5BRPA 2XWBA 1YJDL 2KDYA 4GQZA 4PJEF 5I1GL 5T1DL 3TL5A 4P2QD 3RY6A 4XXDB 4AL8C 5FW8A 3GKZA 3LAFA 2R8SH 2WXIA 4DKEH 4P48A 3LZFH 1IE4A 5T5FA 2YGOA 4FQCH 1HILB 5ESAA 4Y19D 1T6BX 1OP3H 2X3AA 1RK0A 4HK0A 2YBRA 3CSTA 3D30A 4DPRA 5DJ8B 4BYHA 4M8RA 5F8RC 1TUPA 1G6RA 5CN2A 4P3DA 4FA6A 5EHFA 1E42A 5B3NA 3SE6A 1A4AA 1R3JA 3T2NH 1XT5A 4CGTA 2AITA 3WY1A 3VFSA 2H7WA 4HHAA 5IW3A 1UB5B 3NA9L 3N9GH 4HX1B 5KOMC 2APFA 1IIKA 2IH3B 1MOEA 5I6OA 4FMFA 3EJQA 5DUPL 4DP1X 1MFEH 3UACA 5I5IA 1ITCA 3DRQA 4WHTB 4MD0A 3UTSD 4EI6B 3L3OA 3STZA 2DD8L 2NRDA 1KG0B 4JHAH 3DBXA 2O5ZL 1SF3A 5A16A 5TE7H 5E2WL 4TULL 4NT6A 1IILE 3DSNB 3WNJA 4PJHA 4K3EL 3A5VA 3D8MA 3O6FB 4J3BA 1ZLDA 1JHKL 4HCRH 4NUPA 1EZVX 1AOZA 1JN6B 4DEPB 3QIWB 1I8KB 5DJAA 4FJZA 3HMWH 3O6LL 1BFTA 3RWGA 2G5BB 2EDYA 2R0KL 1KB5L 3MRHA 4PWIA 4KI5F 2F8VA 3BZ5A 1F6LL 3MUUA 5CF3A 1F86A 4LHQB 4L3CA 5TGBA 2XYBA 3JTSA 2X7LA 5J5EA 2X9WA 2ZUTA 1OAYL 3U30C 1QFHA 5I16B 5ALCH 3TBWB 1DP0A 4S1RH 2AQSA 3HZVA 4RCAA 2YBGA 1NLBL 2QPSA 3IVKA 5D7HA 1ML0A 4U7SA 2OJ1A 1DBAL 3MV8E 5ABAA 5D55A 2VR3A 5GGQH 5CO1A 5JOEA 1DJYA 1EMTH 1RJLB 4CC4A 3U36B 1TJHH 5IJVA 4C56E 1S7VA 3FL7A 5ADPH 3RKDD 3GRWL 5GIRA 3GJFA 3V7MA 1U42A 2K6ZA 5FUZH 2G9HA 4GFXA 2J43A 5AVWB 4L1LA 2ZP0T 2JLLA 5CSGA 4I9WE 2C9UA 4KKBD 4A6YA 2HJFB 3WUWB 3CFNA 4WZ9A 3GXTA 4XPHL 5D5ME 4RAHA 1EPFA 1UWXK 4JZJB 4EUPA 3HZYB 3VWKA 5JXAH 4K2UL 5DJDB 5DMJB 2W0FA 1RY7B 2UUDH 4YDMA 3RIFK 2B5IB 4UNTA 3WMPA 2A3TA 5D4HA 2K45A 2QKIB 4NCDA 2DQUH 5C08D 1OM3H 1QMUA 3EKCA 4YAQB 3OGCB 1H9DA 1MPAH 4OGYH 3FO1A 2F74B 4BBWA 3BX7C 1YPZB 1N3NB 2XFXA 1FYTD 4YBHA 1OPGH 2BWIA 1HOCB 4EI5A 1BZ9B 1X5KA 3QI9C 2XQ0A 4N2CA 3C5XA 2WLMA 2J72A 5DMGD 1PZAA 1ZWIB 3RX8A 1CDUA 3I9AA 1UXSA 1PFOA 1N68A 2NNCA 1GHFL 1I8LC 2XRAL 4P8QA 3WO3B 4OUUB 4ZAKC 3APDA 6FABH 1SXNA 2IGFH 4GQ9H 2YPLA 5ES4B 1LEGB 3KAAA 4P4KD 2X53A 2FIKB 3DECA 1CZ8L 1JGLH 4AM0A 3ZZ1A 5IVNA 2J8OA 4DGVL 2WZPD 2KQNA 4F15C 4PRPE 4IQHA 2ZXEB 4MB4A 1GC1L 4QYOA 3OKMA 2F08A 3FTXA 4A2EA 3Q13A 4FFYL 1CXIA 1R75A 5DMKA 2WLLA 2VIRA 4E5XB 5MENB 2QGDA 5GRXG 2WBJC 3L4WA 2N4IA 3HR6A 2G2PA 1MI5D 3K6NA 1PKQE 1Q94A 2Q87A 1Q9KA 1IEAA 2YD5A 1ZTXH 5EPMA 4R7NB 1MREH 3SDDC 3ZZSA 5KTEH 4L9LC 2B1OA 1FL5B 4K71B 4HZAA 5DU7A 3ZGHA 5L4FA 1U30A 3LS4H 4R96B 1NC2D 3F6JA 2J56A 4Y9CA 1ZJAA 1BJ1J 1GW0A 3UG3A 5IJBC 3CHXA 5E03A 2IQ9L 1JXGA 3NN8A 1PD1A 3B8SA 1UQSB 2BCKB 3L95A 4GB9A 3AWFA 3QNZA 1NMBH 4ES9A 3Q2CA 1CGWA 5BUGA 2NZ9C 1HYSC 4GP5B 4DZ8B 4N2EA 3WJMA 3HZMB 3CDGB 3CN4A 3IBOA 5JR1L 4P9HL 5E6IA 3GMQA 2EACA 1L6XA 1Q4NX 2X6MA 1GXEA 3FH8A 1G5AA 4TUOB 5KJ4A 1ZLWH 4DGWC 3QJHA 3H9HB 2B8OT 4XPGH 1U41A 4NKDA 4R0LC 2Y7QA 1JZFA 1TJIL 4ODHH 1XB3A 4DK3A 5F1KC 2KS0A 3IJEA 2W9DH 3D9AH 1U8MB 5I15L 3V6OC 1E90A 1M6OA 3EJPA 3VFUB 1O0VA 5D2NA 3V0VA 4PJ9D 4WFGD 2Y5QA 1HXYB 1S5IH 3GS0A 3V0EA 3BWUC 2VJ8A 2P8MA 5CEYA 4ZX6A 3JSSA 4KXDA 4N2HA 1JVKA 5EZOH 1LTXA 2A9MH 3BZEA 2GVYA 4WWPA 1VDGA 2CALA 3ARFC 3HE7A 3KHQA 4H0IA 4FJYA 3GIZL 1N70A 1YQVL 2EDOA 1AQHA 3QFJA 5HHNB 3QG6A 3UYRL 4LLVA 3U9PH 1KIRB 4QEGA 3N44B 1GGIH 4OF6A 5IHUH 4GINA 4KJQC 2V8MA 1EJFA 1T2QH 3I9GH 1IO4C 2ED8A 3ESVF 3CH1B 4K94H 2YWYA 4Q6IC 3BYTA 3KPRE 3KH3A 2XWJB 3RJDA 4AZ8A 3HG1A 1EEQA 3GMNB 4XMUA 5ICUA 2DMCA 3WNKA 4ATTA 2YAEA 3D3VA 5TF0A 3FT2B 4WNQB 2ISDA 2EYSB 4AL8H 2XX1A 1J9CT 4JY5H 4KXCA 2F7OA 4OF7A 4WUUD 4LIQH 3QCTH 1MUJB 1NIEA 5D70L 1UCTA 1JWSB 4UILL 1D5BA 4MJ6A 5ESQB 4ELMF 4IIQB 4QYAA 1PCSA 2FEEL 1ED3A 3B6SA 4TQEL 4TTDC 1H6TA 5L2KE 2QHRH 4MJJA 4N1HB 5CN3A 1IE5A 1IGIH 2FX9H 4HIHA 3CX5J 1TQTA 3MPCA 1I8IB 2V5RA 3OV6A 4FTDA 1IKNA 2H32A 4FG0A 3T8MA 1OF2B 5MP6L 4OF0A 1HWWA 2Y23A 4O58L 3VFOB 3T1FA 2FO4B 3RKPA 1IZJA 2OJZH 4TVPH 3X2QB 1NGZA 1I4FB 1SLUA 3QJFA 2NX5E 3IDUA 4BD4A 3ABLB 1N59B 1V8HA 4F33A 3U7AA 2VDLL 2BRQA 3RJQB 5E9AA 4HUWA 1PYWA 2EE6A 4FGMA 2VZUA 5IBLC 4UT9A 5LKNA 1UXLA 5FYKL 3PWVA 2C3XA 4AK1A 3FFCA 2ZUXA 2WGNB 5CP7A 5CHNB 2EEDA 2MCAA 5TDPA 2N7SA 3CFTA 4LVOC 1E8WA 4RDQG 3F58L 3OXSA 2XXMB 2YWZA 3QQ9D 3HFML 1I9JH 4APQB 2A83B 3ULVD 3C5ZA 3PAYA 4LSQH 3TYFA 4NJAH 1J1PH 5D72L 5KSBE 4NRXB 3OVUB 5KOVC 1QPPA 3QDGB 4AEEA 3PWPE 1SLXA 1MHPL 3P4LA 4AQAB 4M56A 1UOKA 3QIUD 1F4YH 3P30H 4KJPC 1DJXA 1CE6A 1HEZA 2BMKA 3OB0K 3GHBH 2AJ3A 3TLRA 1I7TA 1YNTB 2Y69B 3NCJH 4ZX5A 5KSAC 1RXLA 4O5LH 2X38A 1MCLA 2BPBA 5E6YA 1WC7A 3C60A 3VQ2C 5C0JB 5FO7B 1BM3H 3CZFB 1FCCA 3CZKA 3JQOB 5AW2B 1RMFL 3PAZA 2QL1A 2WANA 2JTYA 4KKRA 1KGYE 1NICA 5E00A 4YSAA 1CC3A 2HPOA 1ZLSL 2VMDA 5JDJA 4Q9RL 1BYPA 5GRZA 1W91A 1XL4A 5DC0A 3U83A 3O8XC 1JTOA 1OARL 3AGWA 2FGWH 5IMOA 1DUYA 3PL6C 3O9WA 4G6AD 2YZ1A 1GAFL 2BFVH 4EOWH 3BAKA 1FNGB 2QQKH 3ZR5A 4B53A 3LPPA 2NY3B 1I9IL 1HL4A 1UM6H 3PDOB 1WEJL 2W8CA 3QH3B 4HGKC 4ZOEA 4D2NA 5E1AA 5I1DA 3KPMA 5ICXA 1GJUA 3GSNH 5K9KB 1QP1A 5M7QA 4KVCH 4LDLB 2B20A 1I8MA 4FI7A 1QSFD 3RURA 1QLFA 2H5UA 4XVUD 2CNZA 4ZUSA 5DYOA 5F44A 3K1KC 1QSZA 4MNGA 4Y9EA 1DO6A 3PUUA 4QR7A 4YSRA 1KCVL 2VAJA 3WJJC 5EZJB 1BAWA 4Y8AA 3FNKA 4DO4A 1IMHC 1WAPA 2X10A 3KLAA 4GG6A 4HCRA 1LP9B 4AUYA 3FB7A 5DHMC 1U6AH 2JKWA 4APXA 3TWCH 4F2MB 1E27A 1CFMA 1H6UA 1QRNA 3WKMH 3DHJA 3DUSA 4P2OB 1NPUA 4Y2DC 1U4EA 2AJSL 3VB9A 3L4UA 4JN1L 3WSQL 5HYJE 5AZEH 3IJSB 3MRNB 4JFEA 3GEWB 2Y7LA 2XZCH 2KUTA 1TU2A 4AYDC 4P23C 3GXNA 3LRHA 4LLUA 3RDJA 1QQDA 1RURH 3FU7B 5IROA 5IMKB 4JO3H 5GRVL 4OFYA 1PS3A 5TF1L 3FZUD 1HKFA 2DMBA 1XGPA 4PRID 4CA4A 2EIZB 4M7JH 3DMMD 1OANA 4PJ5E 4ANKA 4X8JA 1E28B 3ZRSA 4ORGB 4PJDE 4XCYB 4BFIB 2O26U 3B1TA 4FCHA 1XX9C 1UENA 3NRFA 4YGAB 1QBML 4OCNC 3PQYA 2EYTA 3FK3A 4NHCH 5GS0L 4X4YB 2VR9A 1A7OL 4NYLB 4O02L 1AGFB 3ZE1E 1KN2H 3C5JB 5DS1A 1YJDC 1HE7A 2AS5M 2HJLA 5LAXA 5TE4L 4F37K 3W9EB 3F85A 4H5SB 2VRKA 5CJBA 5I1KH 5SV4A 3O3DA 4IRSB 5H37G 3TZVC 2HPTA 4OLYH 3IU4L 2JXMA 2PCYA 3B5GA 3G5ZA 4LOUC 3LD8C 5AW4B 1BVKB 2H1XA 1Q9LB 5CP3H 4HUCA 3ZY7A 4PWJA 1XF3B 4MD5A 4GIAA 5L9DH 1U2YA 4NNPH 4ILDA 3WFBL 3H9ZA 5C0RL 2CR3A 2FWLB 1F1AA 3C6LD 4B9YA 2JWYA 1UH4A 4HD5A 5IOKA 4FFZH 1AKJD 1XAKA 3DIFA 4JLRB 4Q74A 5E94B 3KLHD 2MPAH 5ECGA 5I24A 3CXDL 2BOBA 1FVDB 3WAJA 1DDTA 5EG6C 3BESR 3STLA 3O45A 2FQEA 4L4VB 1YEIH 5H94B 4MCMA 4YSDA 3U9UA 3RZCD 4TNWK 4R5XA 1YNLH 2AEQH 6CGTA 4GEIA 5KUKA 4OIIH 1KTCA 1KXTB 3PABA 4A67A 2CHDA 4JMXA 5K5YA 2CHNA 4EDWH 3BO8A 4JKWA 2PYFB 3VG0H 4NZUH 3K71A 4X6CF 4K3DH 3KL0A 4JR9H 2D73A 2ITEA 4HWZB 3LMJH 5K59F 3TF4A 1LNUA 4GI8A 1QKZH 4JHUA 3AREA 5DUML 2ZUVA 3M1OA 4OCMC 5CLXA 2BW4A 3TNNA 1MFVA 4K7FA 2F6AA 3U0TA 2IC2A 3MUGA 1UC6A 4M1GH 4D0BB 1G1CA 2HT3C 4H0HB 3MA7B 4ZSOA 5LG1A 2XG4B 4B7LA 1IVTA 2ZD0A 1WA1X 4CMHB 4HEME 1YEDA 3VO0A 4JJ5B 2C3GA 4M61A 3RIAK 3V4PB 4GKSA 4QKTA 2OJEB 3QJTB 4XX1G 3IK2A 1FRGL 5HGDA 3UTZA 4JDTL 2AVGA 3EDJA 3FQRA 1X7TA 1ETZA 1BECA 4OTXH 3EYUL 3X13B 3RA7H 2FNBA 5L7XL 4XE5B 4N22A 3LSOB 1MZZA 4PGCA 1XBDA 4KVNL 3F62A 1W6WA 7PCYA 1LVEA 2CPUA 4IMLA 4JBSA 2ARWA 2FDBP 4KK5C 4HGWA 4NQVB 4Z7UA 4ZO6A 2QJDA 4LCCC 3IMWA 2FL5B 1ZANL 4MNHB 4HC1L 1PDKB 3BKJL 4H20H 4IBVA 1NBVH 1NCJA 1VFMA 5DQDH 1XWVA 4UT7L 3V5KA 3H7BA 1HL5A 4JRYD 5IB3B 5HJDA 4NO2A 4JVUA 2PPEA 3ATBA 3PHSA 5IWLC 4OD2B 2FWOA 3RBGA 4ZMZA 15C8L 5CUSH 4QAMB 4U1SB 5KJRL 5DJ0A 5L88L 2QQNH 3W0WB 5ERWB 1FPTH 3WFHA 5F3FA 4KUZL 3WXWH 5D6DA 3OL2A 3BEWA 4DAGL 2YUWA 1KY7A 2QV2A 2ZPKL 3RU8H 3Q8AA 1JPST 3TESA 4JRXA 4EIUA 2Y3AA 3WIIH 3KBEA 5AW3B 2VQ4A 4RESB 4JPKH 2HAZA 3FO9A 2BNRA 3SYCA 2DIJA 5C0AA 4N8CH 4U6TA 4YHNB 5I6MA 4UUJB 4K8RC 1PQZB 3PXJA 2FBRA 2GAZB 3QXAB 2HH0H 5BOZG 1MAJA 5LBSH 4D0DB 4IMKA 3K3QA 1U91B 2FWSA 2WINA 3BQUD 1SXCA 1QVOB 5C0FB 4MJID 2VZ1A 2XA8L 3F7QA 4XVOA 4B3VA 1RUKH 4L8CA 5FX3A 1ZVSA 3HPJB 3P11H 3TVMB 1YRKA 2CIIB 3G5YA 1GC1C 1MCHA 3ROLA 1ID2A 3PWUA 3HRZA 2R29L 4G9FA 2HX9A 3U7YH 1N4XH 4M03A 1KN4L 2NY2C 1ZJBA 4G72B 1BZOA 1EJOH 1ZS8A 4G8EA 2KZKA 2AC0A 1PD6A 5EO9A 1HEHC 4RAVB 4KZEH 2OKMA 2LHAA 4HZLB 4LSTH 1GPOL 5IESH 5JOPE 4YHLH 2JQMA 3RWEB 1J5CA 3CPUA 3VW3L 5T3ZH 1PVHA 4AGMA 5IGXH 3UJTL 1U8CB 1FJ1B 3CFDB 2EDXA 3X3FH 4ABWA 1ZGLB 3PE9A 1UVQB 1E6OH 2VUYA 1W15A 1A3LH 1YEJL 4GRWH 3WHE1 2EAEA 1M71A 2ADIB 3EBGA 3L4TA 1RH8A 5FHBH 1DN0A 3H9SD 4NQCA 5ITFA 1EHNA 1YEHL 4Q58C 5EUOA 5D1QB 4PJBF 1TEGA 3ZDXE 5I1HH 2XKUA 1EUUA 1NDGA 4FCAA 3EFOB 4HP5A 1AQDB 4R97C 2HRPL 3VFVB 1IC0A 4P9HC 4UM9A 3L9EA 1DQIA 1X4YA 2AQRA 5D1ZC 4NERA 2VO8A 2CJTA 4J3OC 4X99A 3UFIA 2FJGB 4HPHA 3CDCA 4KO9A 3KL5A 2JJWA 2X4TA 3CLFL 3BSGA 5FUCE 3ULUL 1RK7A 4XNZB 3M17B 3GB7B 1NMAL 1J8RA 1DLHB 2VT0A 3MV8D 3KPSB 4MX7A 1S9KC 2B2XH 1RL1A 3D34A 4B3EA 1KLUB 3LEYH 2PPDA 4C56D 3DJZA 1WGVA 1UA7A 1J05A 1ORQB 1GSMA 1FAIL 4ZK8A 5CGBA 3QHZL 1P9MA 4GW4B 2ALAA 1KYAA 1P5UB 4AVKA 5DQJB 3NIGF 3LEXA 3I50L 3CZLA 4I9WD 4MNQA 3TF7C 5DJYA 4P59L 3OKOA 5D71L 1BBJB 5C09D 3FPYA 3Q2VA 4J12A 5E5MA 3ETTA 5J11B 3P77A 3SJVE 3GFUA 3EFDH 3SO5A 2FSEB 2H45A 4D8OA 1UZ6F 4MWFA 5I1GH 1YJDH 1JK8B 5T1DH 3QZMA 5IVOA 2P5WB 3T6XA 1AGBB 2PYEB 3HC3L 1K9TA 2HTLC 2Q3AA 5IVXE 2FSDA 2COVD 3GXUB 3D12B 3QP3A 4HG4K 1JZHA 4UI2A 1JGEA 1INQA 4IU3A 1UA6L 2X4PB 3GSNA 4G11A 5I6LA 2K9FB 4ZMTA 3SPJA 4EZJA 3T4AC 1ONQB 4TNVK 5FUCC 2PTVA 4A2FA 4KRNA 5MERA 2BSRB 2C9PA 2GJPA 3UDWA 1S9WB 1I8UA 3QI9A 3CSGA 2W9EL 4OZGA 4WI9A 1NANI 1NCNA 3KYNB 3NA9H 4MA1C 2VO5A 5EOQL 5E51A 3ROOA 4Y5XC 1FORL 5DUPH 4ZT1A 4G8FB 5E1HB 1NEZG 4ZAKA 4CL7A 4FL4C 2R7EB 2DQIL 4WU7B 3OKLB 2DD8H 3II1A 3KPLA 1FFRA 1T04B 3KJ4C 4FRWA 4NXSA 4QRFA 5E2WH 2CO2A 4TULH 1VADA 2I07B 4AI7A 5ISZA 4K3EH 5TPWL 3SDAC 3FHEA 3TIDB 1JHKH 3EH1A 5SWQA 3MC0A 3DX6A 3MRJB 1YC8A 3Q3GB 3SCMA 1IBDA 3IDYB 3IJHA 3PWLB 4LHUG 3GIVA 5EU4A 2R2EB 3BP7B 4FNUA 1Z9OA 3EYQD 4I0KA 3L45A 3O6LH 4V1DE 3MRPA 2A99A 4LGRB 1TITA 2WBJA 2R0KH 1KB5H 3FQXB 3NABL 1K4DA 1PF3A 2K7QA 2WCGA 3EJYD 1E7UA 4K15A 4N0UA 4QJ4B 3E1F1 4IOSA 1BFOB 1DSYA 4IS6A 1KJ2B 2X0VA 5C7ZA 4E36A 5JXEA 1OAYH 5C0BE 4Y1AB 3JV5A 3S48A 1YUHA 1DVQA 2VN6A 4L9LA 4MJHA 2YPKB 3EHBC 3ECUA 1FSKC 1SXBA 1E2ZA 1NLBH 1L9SA 3CD4A 4PV9B 4QHLB 3FF7A 1SY6L 1DBAH 4KDVA 1F1GA 1OGAB 3WKPA 2KLRA 4NEHB 4G6ML 2DQFB 4S0TD 5HHPB 3QDGE 4GO8A 4NKIL 1CICD 4MVBC 5I8EA 3FQNA 2DYPB 4BFBD 2VJXA 3GRWH 5CP3A 2FCBA 5I1LB 3NEXA 5CJ5A 4WDIA 1G9NL 4ZQKB 2IADB 1K5NB 3ULVF 3WS3B 2JJSC 3DROA 5SWSB 5HYEA 4JO1L 1MVUB 3V2AR 2IJ0C 4UIMA 2J5LB 2CU9A 1X4ZA 3L3GA 4QHKJ 4XPHH 1S9VA 3ZZQA 4OD3L 2IPUG 4K2UH 5IM7B 1NGYA 4FFZA 4RNRA 3JWNG 2Z8VC 3VJ6A 4PH8A 2Z91B 4WW2C 3T9WA 2O6DA 3AM8A 3E6HB 2BWQA 3HUJB 2PUQT 3V6OA 3TBTA 3GDBA 1N10A 3PWNA 2E46A 3GMPB 3K8MA 4JM4L 3EH5B 5E2UL 3S96B 1U92B 2O4EA 5EEWA 4Z23A 3CU7A 5H2BA 1E4XI 3P0YL 1NIBA 1FNAA 1T22A 2YPVL 3ARFA 1IBZA 4K3JL 3INUL 4HIJA 3S5ZA 5JQ6L 1XGUB 2VSMB 2IALA 1LHZA 1U8QA 4DH2A 2AW2A 4U1NB 4NNYB 2OK0L 2VDML 1AO7A 2WLJA 3GXFA 1GHFH 2XRAH 1BOYA 4Z3IA 5JW5B 1H6FA 2UWEF 1BREA 4AV0A 1OD7A 4IGBC 4ZMVA 2L7EA 1WE5A 2AXHA 3LN4B 3KLKA 1D6VL 3EOTL 1J0KA 3DXAE 1AGEA 1CZ8H 3ZKMD 2V7HA 3DO4A 1JV2A 1SEBA 2GITA 4DGVH 4F2ME 1NCAL 3LTVA 4X9BA 4IYKA 3SZKC 5D7SL 1ZE3C 1TFHA 1GC1H 3NIDF 1IBFA 4J8RA 1CFVL 1S9YB 2NDFA 3CH8A 4FFYH 5CZXD 4DGYL 1R33A 4KHTL 4U6HA 2B1AL 5L2KD 1TQSA 2FECI 3KEDA 3DUUB 3NQKA 4OR1A 4NQEE 4ZPTB 1J0ZA 2P52A 4FG2A 1JZ2A 2EO9A 5ACZA 2W0PA 3E8VA 5EBWB 4JZOA 2AEPL 4DGUA 1HZHL 2ENSA 5FKPA 2X44D 5E1QA 3NJGA 5A3ID 5GS0C 3WU1A 3PG2A 2XV2A 4PJ8D 4X6DA 5DWUL 3SDCD 2DWSA 3TYGL 3T77B 4MMXC 1OSYA 3KNBA 4N85A 2G60L 2NX5D 3IPFA 3OJDA 4QRTB 5CZKA 1OTTC 5C6PB 3CX5K 1ZHKB 5BZXA 1RP8A 2BNUA 1D5IL 3QORB 5BZDA 1NL0L 1A25A 3HRPA 3TPUB 4GOSA 5FYJL 3VI4A 2X9YA 2NSMA 3UPCA 3VTAA 2IQ9H 4G8GB 2NY4C 3WL9A 4N8VB 3IU3A 1S8DB 5HP5A 1HJCA 1R24B 4YUEL 5IHZB 43C9B 4AEIL 4BSVB 4F57L 1A21A 4NN6B 5LGYA 5JR1H 3BN9C 4P9HH 4PY8I 3GHEL 4PEEA 1BVLB 3FCSA 4HXAL 1LEKA 1XGTA 2E8ZA 3BLPX 2Y1YA 1TJIH 4AG4L 4LEOA 2PW1A 1G7PB 3LKQB 4F7TA 1S5HA 3F6LA 4J3OH 3REVB 1GRWA 5I15H 3ABKB 8FABB 1EBAA 2A74B 4HCFA 1JF1A 4L0PB 5LBSA 4ZBJA 1NC4B 2FYYB 4N0CC 4NUJB 1NAML 1P1ZA 2Q7YA 2QTVA 3HKZA 3B37A 3PPSA 3CQPA 2IDCA 3HPLA 1TTRA 1ZHLA 1R3LB 1EXGA 2VL4A 3GIZH 1YQVH 4P4RB 5K39B 1EAOA 1B0GA 3UGXA 2GBTA 2O30A 5F0MB 4OU3A 2EH7L 2PW2B 1R17A 4I3SL 1TF4A 3UAJA 4R9HA 2CXGA 3UYRH 4DUVA 5KSAA 2L7QA 4DTGL 3WEAA 3GTNA 4Y4HB 5DFVC 4PB9L 3SKOA 1IC7H 4NSKB 2EUVA 4MAZA 2VLKB 3ZX1A 1RIHL 4JFYB 4PCKA 1I85C 1U2CA 3GMOB 4XR8C 3TS8A 2A6JB 2VLRA 1I9RL 3BYYA 5DJZA 2W60B 1IT9L 1OY3B 4N9OB 3CFCL 3O8XA 3DK2A 2J3SA 3I3EA 3PL6A 4BKSC 2NW2A 2QMJA 3HE6D 1ZKAA 1YLBB 5D70H 5DEFA 4JG1L 1CG9A 4UILH 3DV6B 4Y1TA 1KIUA 3TN0B 1A7NL 5CGMA 4TQEH 3VH8B 5CD5C 2MIZA 5DUJA 4M00A 1TYJA 3JVGC 4OUOA 3E1ZA 1T66D 1DLFL 1WFUA 4GLRH 4X9IA 1WBYB 5FOJA 3WJJA 1D9KA 3CDZB 1LK2B 1XQ4A 4ZTEA 5MP6H 1AC6A 3UO1L 5HYJD 5IQ9A 4O58H 3RGVC 2RHEA 2A9AA 1HHHB 1XD0A 1IBHA 3FH5A 2EKSA 2MPVA 3L08A 1UADC 1RAMA 2R0WL 2ZCKL 4KROC 1E0OB 1HSAA 2Q86A 4Y4FC 3W5MA 1FL3B 4NLAA 2NXZB 5F2FA 2VDLH 2WP3T 4JKPL 2EJ1A 2QEJA 1SDAB 3WEXB 3UMNA 4PJ5D 2OMVB 4XCNA 2V3DA 4P23A 4LCYA 3UBGA 4OZ4A 3NZUA 5FYKH 3A47A 3T0WA 4WI4A 5JHDA 3AW5A 3WDHA 1SXAA 4KGLA 3VNYA 3W0WE 2D0HA 3F58H 2QSCH 1UH3A 4LF3B 4PJXF 4Z3JA 2VW4A 4PP1C 3OR7A 4JJHA 3HFMH 1B2WL 1MHCA 3UJJH 1U3ZA 2WTOA 2NNRA 3C2SA 4JO5A 5J7CC 4IBZA 3MRRA 3VNZA 4M3JA 2J7LA 2IPUK 4WI2A 5DA0B 5D72H 1YN6B 4LL4A 1M7DB 3O3BA 4WTZG 4TL5A 5CINL 5C8JB 3FF8A 3Q7JA 3HG4A 4XC3L 5GHWL 1MHPH 2WTPA 2KZ1B 2W5PA 1VZIA 2ZXQA 4HULB 2MMXA 3GZPA 2W38A 4QT5A 4NUGL 3IFNL 3DX4A 3QPXL 4B9FA 3W38A 4FI6A 2VLJE 2OMNA 5KS9F 3GK8L 2ZNWA 3QK0A 4LKXB 1JFQL 4HKXB 3LKOB 4NBXB 3TZVA 4LMQI 4ZFOB 5IG7A 2ZWLT 1N5AB 2BY1A 1CDGA 1RMFH 1YDPB 3ZIMA 1JPGB 5JW4Q 2XJKA 1AZZC 2K1MA 4NQDB 3CHRA 3E8UH 1ZLSH 4AIXA 4Z3HA 1WZAA 5GISL 1OGTB 1B88A 3EYFB 4Q9RH 3QYCA 4E0RB 3QO1A 5HI4C 2JB6B 4L5FL 3KH4A 1N18A 3UBXG 1OARH 2IV9A 3BAJA 3ETSA 4XZUA 5L0QB 3IXTB 1YYCA 2OSYA 1GAFH 4GXUM 2VDPB 2CCLA 1I3UA 2R2BA 4EBQL 4PJFB 1I9IH 4MHHG 5FEBA 1RZJL 1VCBC 1WEJH 2ZAHA 3SIKA 5K9JL 2J12B 3K6SA 2VB5A 2Y22A 1Z2KA 2Q1EA 4PJGB 1Q1PA 3H85A 4CN6A 3NCXA 1YG9A 4H2CA 5GGSA 2XV3A 2ZWZA 2X4UA 1KCVH 4XTRC 4I13B 4H8VA 4M6AA 2OMXB 3O6FD 4TYUA 2AGJL 4YHOL 5CEZE 2LGNA 5LGJA 1A8ZA 2BZ7A 2VDKB 5GRYA 3TFBA 1HCYA 4N8UA 2XG5A 1ZLVK 1K2DB 3HLKA 1NM4A 3QIWD 2ILLA 3VVVA 1JK9A 1MCQA 5IQLA 1W72B 5C3TA 1NFIB 3ULUC 2Q6WA 5EO0A 6TAAA 3PGCB 4YVUA 4BZ2L 2AJSH 3G08B 1KB5A 5HHMB 1PX8A 4JN1H 5CU9A 2RFXB 3WSQH 1GTFA 3UZEC 4HLZG 3V0FA 4I2XB 1M1XA 3RPBA 4QRSB 1ZE3H 2WWMC 4IU2B 1W80A 1MLCB 3LKNB 5TF1H 3U48A 1HL8A 2X70A 4PJCF 1HCZA 4G80B 1G7HB 4HAGA 2Z8SA 4DN4L 4NKOB 1GYAA 4TQIA 4KV5F 3ZQWA 3D6GA 4AQZA 4U6VL 4AWJC 1FP5A 3MJ7B 3FTGB 1ND0A 4LZKA 1KYDA 1ZPUA 4NGHL 1QBMH 2ICWB 3GRWA 3VXTB 4XX5A 3ARGA 1CDYA 2BVQB 1TZAA 5GS0H 1A7OH 1VZGA 4O02H 5HHVL 3CSBA 3ARZA 5TE4H 4D8PA 4MXQD 1Z32X 3MLTB 5I71B 2VISB 1BZ7B 4N2BA 5KYNA 1OAXL 4EJ1C 1QHOA 3L2MA 2E9JA 4YR6B 1SJEB 1XGYL 2A9CA 4JFOA 3IU4H 4WGWB 5E7FA 1M2VB 3BKCL 1JGUL 5E08H 1BX2A 2P3YA 2DQMA 3VSQA 1ZVNA 1I53A 3DVFA 5IWLA 3BFWA 4F7EB 2P5WE 3R4DA 2P26A 2BP3A 3VWJC 1FVCB 3IDXL 4UQ2A 1WTLA 5D5MF 3WFBH 1F6AA 5E4AA 1CXLA 5C0RH 2ETWA 4M4RB 1DL7L 4ZODA 1PZSA 4ISVB 3IWUA 3EJCA 1YNKL 3T0AA 1FI8C 5F0LB 4EIBA 1A4JB 1ETA1 3KYKL 3AMKA 3VXMB 4Z7OB 5HYFA 1M57B 1RHHB 2XV6B 4JFSA 4GP8B 4PGEB 5HGGS 1IB5A 1XGRB 3RG1C 3BP6A 5BXFA 4UM8B 3CXDH 3VM5A 4Z3EA 2EVGA 2X3BA 1KTDB 1TYRA 2M83A 4HZ1A 5D7LB 2XNAB 4KDTC 4CMMB 2EH8L 4MD4B 4CW1A 2J25A 3DTDA 5D6CA 2WZAA 3ZOAA 1IJNA 5DRZB 2B39A 5E0FA 4IJ3B 4BFOA 5FGBC 3T4YB 1S7SB 5DVLA 4NO0B 3UAAA 4QTHA 4OZHE 1X7QA 1CXEA 3H2WA 2X2YA 3HKFA 3WE6A 3WYRA 4DF9A 5DUMH 3MHZA 4ZXBB 4XN1A 5MEND 1BLNB 2C1PB 1PY9A 3QFDA 2IAMB 3QUKB 4RA0C 2YMOA 2J73A 5D96C 4FZEL 3D85B 1OTUC 4NC0B 5DEJA 2FT6A 2WQVA 4R90L 1VKXA 4FA8A 1N8ZB 1J8KA 3BWAB 3GSUA 3D4YA 4GKZA 4WU5A 1JYNA 2O6CA 3V9FA 3ZE0B 1P5VA 1UWXH 2JE8A 2Q9OA 3AROA 3IRPX 5H4ZA 4C47A 1FRGH 5AOIA 4BSWB 5G4MA 4EZLA 1O6SB 4JDTH 5ID1B 1JRHI 1M2OA 2AQ3A 4QRQB 4Y1AE 3EYUH 4UANA 1CFSB 4OZIB 5L7XH 3F12B 5EEZA 5BMFL 4JKKA 5JA9A 4Y19A 4FXTA 4KVNH 4GXUN 5JQIB 1J18A 1G9NC 4HJ0C 4XP1L 3IDIB 4Z6AT 7TAAA 1KBVA 2DL9A 3ESUF 5AOJA 2NDGA 4GPVA 1ZANH 3NP3A 4HC1H 3SY0B 5IW1A 5J57B 1QASA 3T1WA 1FLRL 1M42A 3BKJH 4M6NL 1TQVA 4KX9A 4UT7H 1J8SA 1WUNT 3IGFA 3ZT7A 1A2YA 4ONGH 3QS3A 4X7CC 1EZUA 1AQ8A 2DZEA 5CGYC 2WJ5A 3QNFA 5HHQA 2WLIB 2CDGB 1T7XA 4JGMA 5JHAA 15C8H 4NI6A 3UTSA 2LW3A 5KJRH 5GZOC 5L88H 5DTFA 4KUZH 4MDJA 4FXKB 5LNEA 5I74C 4DAGH 4FQ1L 2ZPKH 4OV5A 3HUJE 3S3DB 3DURB 3MSPA 2R2HA 2WMPB 4D9QD 1ZVHA 4CVXA 2P80D 3T8XA 3IB4A 1JV5A 3V8OA 1A6AB 2MQ3A 3MO1A 3SKUD 3LPGA 2E75C 3C2AL 4N9GA 4R2GB 2CA3A 3I75A 4ODUA 2PCFB 4TM9A 3ILPB 1BD2A 1AANA 4RGNE 4U6XA 2VL5A 4LGSB 4B9JA 3VFNA 3Q43A 2XA8H 2VMCA 3WKYA 4TRPL 5B1JC 5LGKA 3CMOL 5B4MD 2R29H 2BSDA 3I85A 3WLBB 2QR0B 4KRPC 2BFGA 1KN4H 2VABA 2YK1L 3ATAA 1D3CA 3L4XA 5IUCA 1B4LA 4E68A 1IC4L 2Y1AA 2QVFB 4OZFH 1A6PA 3TBBA 1KPVB 2BZCA 2V17L 1GPOH 1D6EA 2MNJB 4MCYA 5HD8D 2FGZA 3V4UL 3LJ3A 1J9SA 2RR3A 3VW3H 2X4OB 5C1MB 4ICXA 3UJTH 3HN8A 1WH0A 3B9DA 3DETC 3T4AA 4AIZB 4KKLC 1L9OA 4JFFB 4O51B 3G5XB 5FCSH 3RJOA 3O2VL 5HYSB 1YEJH 2C5DC 5DJXA 2CO6B 2APVA 4ZO7A 5KBLA 3FONA 1ASPA 1NTDA 1QA9A 4NDMB 4YFEA 1HYRC 4L3EB 4MCZB 4MRBA 4HKJB 3S4SB 1PFCA 1YEHH 4R4FL 5DZNA 3RL2A 3DX7B 1DE4A 1RUAL 2F5AL 3MA9L 3RDTC 3RTQB 3ZTJG 4A66A 3ZTEA 3CLEL 3EW3B 4F8NA 2WLHA 3IXAB 4GG8B 2HRPH 4F7MB 2ZG3A 4BFJA 2ZSWA 3V0WL 4E9VA 4HA1A 4NN7C 1P7QB 4AX3A 4U4IA 1JL8A 2DY2A 4RGNC 1FYTA 1H3GA 3SDAA 2Z1KA 3FQ4A 3HB3C 3F5WB 3TCTA 2A7BA 3OPZH 1X5MA 1D5XA 1PJWA 3T3ME 3DUHA 4NIYE 5DUBA 1ZA3A 1AZBA 1QTPA 3VD2A 3CLFH 3ULUH 3W57A 1HL9A 4APQD 4MA7H 3VXNA 5EU6B 2D3VA 3BVWA 3QAZB 1NMAH 2VN4A 4Z7VF 5DHVH 5INCA 3W82A 4P4KA 2AABL 3M88A 4MFHA 1JWUA 2UZXA 4I0PB 5KYXB 2NY5L 3SKMA 1SEQL 4PRBA 4XPAL 4X83A 4UNUA 4X6BB 3QDGD 5IFJB 3K74B 4QRPB 3TJHC 4Y5YC 3HNVH 1FAIH 1MCWM 3QHZH 3ZU8A 3LZOA 3ZLQC 5JW4N 3X1GA 5E56A 1HQRA 1H5BB 2G2RB 2VAAB 3S88L 4P59H 5KSBF 5D71H 4PJBA 1O9VA 3L9YA 3PHQA 4KOBA 1UM5H 3BPOB 2YOCA 2V9QA 2E6QA 3N91A 3RNQB 2YUXA 1PPIA 2JJSA 3FB5A 3GBEA 5CKAA 4R5TA 1DQJB 25C8L 3WTVA 3ARDB 3HC3H 4UMSA 2VLKE 5JORB 4FADA 3OSVA 3SODB 2HFFA 1NC2A 1YC7A 2AQ1A 5BO1L 2AEIT 4U1JA 1L4IA 2NY3D 3HAEG 2AQ2A 4YZWA 4A39A 3TBCA 4WW2A 4U3CA 1RZ7L 1UA6H 2NQCA 2VUOA 3NZSA 1YEFL 1HH9B 3N0AA 3OPUA 5L8LB 3CHOA 4XGZB 4BQ8A 2LVCA 4CADA 4HJJL 3BPNB 3DVGA 4M5ZL 3V0IA 3HA0A 3L3DB 4P3CL 4KK6D 3SPVB 4E9TA 3PNWB 3HS0C 4P2YA 2W9EH 3T6ZA 5FM4A 1KJVA 4MBOA 4ORZC 3SKNA 1QG3A 5EOQH 1M4KA 1W9XA 5E5RB 4A2MA 1FORH 2A6IA 2E7HA 2X4NB 4P2OD 4DFHA 1JXDA 2RCSL 2XBDA 3QQ3A 2DQIH 3ZKSD 4IGBA 3QR1A 4M3KB 1BOGA 5EC2B 3U2SA 4O2CB 4OBRA 4X7TB 1PLAA 4D3CH 5C0DB 5ETUA 1J5IA 4ZO9A 5FOBB 2NUPA 3S34L 3TEWA 5TPWH 2I32A 4NO3A 4UYPA 1L9RA 1XF2B 1FZMB 3P3YA 3PFQA 4U0RB 5KVGE 4HWUA 3OB0H 2DQGL 1T5XB 2HVBA 3DV4B 1R5WA 3AXLB 4NZRL 1AMYA 2W07B 2VRQA 4D0CA 4UZSA 3FO0L 2HFEB 2BP8A 3A4DA 4Z77B 4ZFFA 3AZUA 3RAJL 3X11B 1XCTB 4RA3A 3VGAB 1LQBC 4HKZA 4AYEC 4RWHA 3Q06A 2LU5A 3Q5YA 2XVKA 5SWZA 2ZP8A 4O02A 1AGCA 2SEBB 3VRLE 3AS0A 5DF0A 5C0GB 4MMXA 4FQ2L 3BXNA 1U3HC 4J4PD 4PJDF 3PJSB 4QHUB 1XCXA 1SY6H 1ZV9A 5FO8A 3NJIA 4M93C 1CB4A 4LP8A 1G7MA 3KD4A 1YY8A 3K8LA 4IRSD 3OMIB 5HDQL 3HG5A 3S3BB 2IAAC 5F72S 4NKIH 2QADC 4F7PA 3US9A 5HJ3A 1GZQB 3KPQA 3QDJB 2ITCA 2CAKA 1G9NH 4M7ZB 5DD6B 3TBSB 4ABQA 4DEUA 4JO1H 1NOLA 1CF8L 3SBQA 5HY9B 2X9XA 5I76B 4P5KB 4PGDB 5DS8B 5EEUA 4JKNA 4MAYB 2DIBA 4WKXA 4OD3H 3LN5B 1XMEB 2YRPA 3VI3E 3L5XL 1NLDL 2ZXDA 2A73B 1HI6B 1RZJC 5DI8A 1EEYA 2APSA 3LDBB 5FGCB 3CE1A 5HVGB 3NZ8A 4U3SB 3TO4C 4MS8D 4ZUTA 2ZOKA 2VOTA 3T0EB 2G4GA 2UV3A 1E9OB 4L4VD 1A9EB 2C26A 2QGCA 2CDFA 4JM4H 4N90E 5E2UH 1WA2X 1CFTB 2XXCB 1U8HA 1MHHA 3CBJB 4PBWD 4PJFE 4U0QB 2XPGB 3WLWD 5L2JA 3VXOB 5J6HA 1TMQA 2FJHB 3P0YH 3QT2A 4X9GA 2P4AB 2LVEA 3I02B 2YPVH 4K3JH 5JQ6H 1UUNA 1OWWA 5GS3A 5A2AA 4AYMC 2EABA 5F9OL 2ZKHL 4YDLB 3BFOA 2OK0H 2VDMH 2R69L 4LLDA 4C4KT 3IDNA 3X12B 1BMGA 1OLLA 4NJ9L 1W16A 1OQXA 2G4EA 5IB5A 2VW6A 1D6VH 3EOTH 4PRDB 4NCC2 2BSCA 4GNKB 2FNWA 1NCAH 3M1BB 4ETQA 5D7SH 2XKNB 3JTTA 3JTBA 2MFNA 1CFVH 4PJ7A 3QIUA 3GGWA 4DGYH 4KHTH 4WI6A 2B1AH 4WWKB 3BP5B 1PD0A 3DPBB 2HXAA 4S1QL 5I8KL 5FB8B 4E41A 1CQYA 4Q6YA 2GCYA 2YD3A 3IS1X 4GRMB 1IM3A 4I2XE 2ZIDA 2WTRB 4LKCA 1FV1B 1SFHA 2AEPH 3MV9B 3EO1A 3UTOA 4ZPVA 1HZHH 4YJZL 1YAZA 3KYAA 4TXVB 3EYVB 2F53E 4BWUA 5DWUH 3TYGH 5DRNA 3S3SA 5BS0E 3JVGA 4RGMC 5DD0L 3ML9A 1LD9B 2G60H 2VXSL 1OF0A 5E8OA 3RGBA 5IMMA 1T1WB 4HC1A 5SX5K 3RWCB 1FE8L 4WFED 3MJ9L 5T1MB 5EOTA 4OFPA 2R9HD 2H4EA 1D5IH 1NL0H 5I1AA 3P2BA 1T5WA 2FEJA 2CHWA 4JHWL 3MRLA 5FYJH 1MFDL 1VGEL 4CSTA 4QJ3B 3APFA 3FCTA 4AVHA 3VE0B 4Y88A 1SJHA 4RQQB 4YUEH 1QNZL 1JUFB 2FT8A 4AEIH 2VZTA 4NPYA 4F57H 4I48A 2EC9T 3QXWA 3VRIB 3W0WD 4FABL 1WZKA 2ENYA 4JY4A 2ZOOA 2NLJA 5AL0A 4R4BA 1WJ3A 2NY0C 3SDXB 1A0QL 2JJVA 3GHEH 4LPWA 4JJOA 4U1IA 2BRRL 2YJLA 4UTBL 5AYUL 4HXAH 4KKNA 1FZOB 5IKCB 4AG4H 1P4LA 1KF9B 4C8XA 5JO5A 1A6VL 4ZMNA 2DWEB 5EIVA 3HCVB 3MNVA 4M8VA 1PNDA 1BXVA 4AENB 5LAPA 5IOPA 2AJXL 3CFUA 3IBEA 3VXME 4NENB 1JHTB 1NAMH 3CSYA 1BZ8A 5E8EB 4RFNB 3TVMD 4JREB 4PB0L 4DCQA 1KCLA 3LPFA 2R29A 1YPZF 3CWGA 1J7VR 5D7LE 2H8PA 1NCHA 1O7SA 2I7OA 2EH7H 5DO8A 3DMMA 4I3SH 3RVVC 4DTGH 3RFZC 4OZFA 3VMPA 1TTFA 3QUYB 2HRGA 3G6AA 4PB9H 3IT8D 3UIZA 2FRGP 1SHXA 4DP7X 1AYRA 1RIHH 2H3XC 3QJSB 2I5YL 3R7QA 2CO1A 3O3AA 5C3IA 5ILTL 5I18L 3FKUS 1I9RH 2MQ0A 2NW3A 5C0CA 3F05A 1G7JA 2F54E 3C09B 2CUMA 3ALPA 3CFCH 1XCQB 1VFAB 3HNTL 3HG2A 4BFEA 2MCMA 3VCLB 5FF6B 4F91B 2WC7A 2ZOUA 4JG1H 1RIUL 4X0KA 3KW7A 5FA3A 4RMTA 1IBBA 1F4XL 2R15A 4FQIL 2ATPA 4Z5RB 5CEZD 5D1QD 1A7NH 4DPAX 1PX3A 3ZE0E 2XIBA 1YMHA 1PEZA 4GW1B 1JZIA 4WVRA 3JBG7 1DLFH 1WAAA 5C0EB 1CXHA 2UXTA 3SEPA 4B41A 5GSRA 1IGCL 4OZIE 3OLGA 2DDQL 2RACA 3GJEB 5D93C 3UO1H 1OAKH 3I84A 3FBQA 5G4OA 3U0PB 1E5AA 4XH2A 3B2XA 1H15B 2DKMA 4JFHE 3BW9A 1A22B 1FZKA 1OPOA 1R5VB 4A38A 1KXHA 3H53A 2IPKB 4E2OA 3NP4A 2BNQE 2R0WH 2ZCKH 1JF6A 3QNYB 2GHWB 3R8BB 3PIQB 3CSFA 5I8CA 5DHVA 3FSZA 3KPSD 3VXUA 2CLVA 5JW3L 3RVXD 3UZEA 3A23A 2BERA 2VWEE 2EXWC 3EG9A 2R1YB 2O1AA 3QUXC 2M8XA 3DVNB 3NFSL 3MLPA 3EXJA 5CSZA 4RZKA 5FA4B 4CBPA 3IMBA 3QB7C 3RY4A 3ET9F 3AU0A 2IBGA 2K8QA 5SV3A 3SQBB 4DT2A 1UJ3C 2PWDA 4N5UA 2R2CA 4UWQB 4PFEA 1GA2A 5DJ2A 1F97A 5CJOL 1NZRA 3HJ0A 1B2WH 3ARPA 2YA0A 5B38G 3II3A 4HW6A 4JM2C 5HXMA 4KO6A 5D7JC 1HTYA 4IKNA 3LN9A 4JE0A 3ECWA 3MRQA 4HWBA 4XBGA 2CIKA 1JYWA 1W8EA 3H56A 3RVWC 4Z3FA 5CINH 4KQ3L 3WHXB 3BH4A 5F6HI 3UOAB 3U9WA 4AC2A 5GHWH 5I9QC 1UASA 4K07A 4ADIA 4QLRA 1GS8A 4ZUUA 4EMZA 5G2NA 2P5WD 3IFNH 4NUGH 3KCPB 3IF1A 3QWRD 2PYED 3QPXH 3FYIB 2ARJB 1JS4A 4NHUB 1J48A 1KJMB 4RMRA 1U3NA 3GK8H 4L18A 1DJWA 1JFQH 5F89B 4PWGA 3VTMA 4NRZA 1MW0A 2FQGA 3ILQC 3DHUA 1MCWW 2OQJB 2RGSA 1ACCA 1F58L 3N44F 3CFKA 2WUBL 3IFPA 3VWJA 5GISH 4QXVA 4QOKA 4YZFE 1IU1A 4GRLC 3FO2A 4JAMA 3D39E 4HUUA 4TQPA 2DLHA 1CT8A 1Q72L 1WHPA 3II2A 4L5FH 3T65A 2Q2EB 1AZNA 32C2B 4AZUA 5JPNC 3INOA 1EAJA 3F3HA 3MCKB 4OLUL 3ZTDC 1KENL 1VJSA 2PCPB 2MOVA 5ITBL 4UTCA 4EBQH 4JRYA 1RZJH 5D1XB 4EEEA 3MNWA 1EHAA 2J8UE 2X6CA 3FB6B 4GXFA 4O9HL 1TVBB 3BVXA 3LH8A 3JV6A 4UNVA 1L0YA 1YN7A 2VITA 2XWBB 4KDTA 4LLYA 2AQTA 1U21A 2CSPA 2Z4QB 4PJAE 2Y06L 4QPEA 2OL3B 4L3EE 1NFDA 2OMTB 4FNPA 1F3RB 1FGVL 2AGJH 4YHOH 1GH7A 5ENWA 5FGBA 1T4KA 1F02I 2IBBA 3LV3B 3L5HA 3L3IA 3TPKA 5TDNB 4LSRL 3HMXA 2CLZA 4I4WA 4LOVA 4F9LC 3QZWG 2F1AA 1CYXA 4BK5A 2NSQA 2YBRB 4FEMA 4HMDA 4JQXC 4BZ2H 5HPOA 3L13A 2CO7B 4FS0A 4I1NB 1J10A 5AAWC 1G6RB 3BQUA 4HF5L 2NY5C 4MJIA 4ZX3A 3LKSB 1J1OL 4Y1AD 2OS7A 2P8PA 3RVUD 2RA1A 3VFSB 3RGHA 1AHWC 2YA1A 5EBMA 4WV1C 1U2HA 4HHAB 5JOFA 1SY6A 2LLLA 3QR2A 1OGAD 4LPUA 4IBUA 2P9RA 4DN4H 4FMKA 1AZCA 3CVHB 3DRQB 3JWNE 5AVYB 4U6VH 2EXYD 4UOW1 1KFAL 3DBXB 1OCCB 4NGHH 1KB9K 5A16B 2DYPD 2EDMA 2QT6A 3ML8A 4NT6B 1KIQA 2CA4A 4PJHB 3VFWB 4JB9L 2RJMA 5HHVH 5SWSD 1CD0A 4A2GA 4YH6A 4DKDC 1BF2A 2ZAIA 1CO1A 3DDGA 3V6FA 2YSSA 5DJAB 5DSCA 5KJ7E 1D5MA 1OAXH 3FU5A 4NUQA 3MRHB 2X4RA 4M43L 4FE9A 4Q7DA 3BKCH 1JGUH 2CRMA 3H9SA 4G1EA 1NGXA 1YNTF 3FUKA 4L3CB 1FZJB 5IEKA 3JTSB 2CBMA 2O5YL 4P0DA 5IF0A 1MRFL 3Q6FA 2YFOA 3ARBC 4X7EC 3IDXH 1D2PA 1TQBB 4YLCA 5F9WB 3KPPA 3KVQA 3NFNA 5GZOA 3HZVB 1DL7H 2P5PA 1KYUA 3R7RA 2EP6A 2R1WA 1YNKH 2LV4A 4UCFA 3FCBA 4JFQB 3WMQA 4A7GA 3KVDD 4PJCA 3KYKH 1BQKA 2PO6C 2VSCA 2YPVA 3EH3B 4TLSA 2O61B 4EKJA 3ZO0A 1S7VB 3VGHA 2A0LC 1D7DA 1CFBA 4G70B 5HVHC 2WO2B 4X7DC 4WENB 3GJFB 3MLYL 4XMPL 1U8KA 5H4YA 3TBVB 3HOGA 2G9HB 2EH8H 4YHPB 4U33A 3FTYA 5E70A 3ZYOA 4A6YB 1Y6MR 3SGEI 3O6ML 2Y1ZA 3JWNC 3RUGA 2HG5A 4EUPB 5C0IB 2HFTA 1F5WA 4GAGL 1FO0A 1KT2B 2W0FB 3AQYA 1F4HA 1Z9PA 3GINA 1KCRL 2YN5A 3VSUA 4TN9A 5IY5B 2NCMA 3GSRA 1SYVA 1GZHA 1G1OA 2GW5A 3CXHJ 3L54A 2H9GB 1LP9F 2FIRT 2J8HA 1X5LA 1VENA 5DZLA 5ESVA 1EFXD 2EE9A 1BJ1H 5BZWB 5C09A 4KFMA 3BPOC 3FO1B 4FZEH 3T0XA 3WXVL 4X5RA 2AVFA 4R90H 2XFXB 3SB3A 4XWOD 3V52L 4Z8FL 1O7VA 4EI5B 3BP4A 5HGAB 5T1JA 2I27N 3WIFB 1ES0A 4JFVA 5I19L 2WBWB 1BA9A 3CZJA 3EOBB 5E2VL 1UXSB 2JK5A 2DWDA 2EDNA 3ISYA 1MCRA 3QORD 4LCIL 1JVOA 5CBEB 3FSVA 3VDAA 2YPLB 1QPKA 1QX1A 2ZX9A 4PR5A 2NTFA 4G8GD 5BMFH 4AM0B 1ORSA 1RKRA 4JDEA 4XP1H 3U6XA 1AIFA 4V11A 3RDTA 2BSTA 1MJ8L 1A7QL 3DTXB 5DHYA 5F96L 5JPMB 1F4WL 3O6KL 3AVEA 2CLRA 4QYOB 3OKMB 3P2TA 1FLRH 4M6NH 2WLLB 2PTUA 2VIRB 4YK4B 4LLMA 3ZN6A 4ODXA 5EF2A 3MBEB 4MSWA 1F2QA 1Q94B 3OG6B 5AB9A 1IEAB 5EPMB 2H2SD 2P7TA 3LNHA 4GP4B 5LO7A 3QUGA 3QEUA 4JANA 5BJTB 4XMXA 4ODWA 4YDJB 2XWRA 4GBXB 1NC4D 1YEEL 1CE1L 4EDXA 1NAMA 4JRFA 4CU8A 5FGCE 1CLZL 4FQ1H 2DWTA 4C4BA 3L6FB 2L7UA 4YHZL 3OR6A 5I0XA 5HI3D 3T0EE 3MV01 3RWFA 2CQVA 1KFGA 3NJXA 1JPTL 4NFBA 5KVFE 3U4EB 2FAUA 2KLTA 4HT1L 4OJEH 2YMXL 4FHJA 4JFPA 3L95B 3C2AH 3GTVA 3QNZB 4HJIA 3H42L 3IDMA 3OAWA 4AQEA 4I85A 1IM9B 4YDZA 5B21A 3BN3B 4Y4HD 2WVVB 4Q56A 2APTA 2VLKD 2NY1B 3WD5L 4AYGA 5E6IB 2VN3A 3GMQB 3QUML 4LSVL 4TRPH 2XN9B 3CMOH 1ZLWK 1DVFB 4LSDA 1Y18B 2H3KA 4PJIA 3V7AG 3PUCA 2Y7QB 1NA8A 4Y2OA 3IJEB 2YK1H 4CU6A 3OAZK 3CDYA 2NYKA 1CFNA 1M6OB 2YEZA 1IC4H 5DO2C 3RL1A 2V17H 3QQDA 2OR8A 2P42B 4N24A 3FJTA 3QS2A 2P8MB 4QF1A 3QZNA 4W9LC 5CEYB 1ZLEA 3BZEB 3TN0D 1KBGL 1DUZA 3HE7B 3IFOB 4XNXL 4JG0L 2BM3A 2CBQA 3FQUA 3CHSA 4GO9A 2VM9A 1JWMB 5D7IA 4W4NA 5CR1A 3O2VH 3IFLL 3EBIA 2LR4A 4HUXB 4LLVB 2ZUUA 5GZND 4XN5A 2GKIA 4HPOL 1A7RL 1J0HA 5FYLE 4XPTL 3V4VL 4LDOB 4NFDA 4F27A 3VXSE 4R4FH 4X5LA 2C1OA 1RUAH 2F5AH 3MA9H 4HKBB 3CLEH 3I6LE 3QQ4B 2NXZD 2ZF8A 1LO0L 3BIKA 2XY2A 1QSEE 3V0WH 3ZXAC 3B7RL 2E59A 1UA3A 3QRGL 2KZBA 4X8CA 3CFMA 3VXPB 1AXTL 2UY6B 2WV3A 3U6XS 2LLGA 3Q2LA 1D5BB 4MJ6B 4GAAA 2FATL 4LAJH 4TUKL 3SDXE 2GJZA 1HWGB 3MUHL 4LQFL 1RZKC 2X1XR 4KTGA 2KERA 1D7CA 2AABH 2FEDD 1QAWA 4QIRA 2NY5H 2XCMC 1SEQH 4XPAH 4F8LA 1EDQA 2H32B 4N0FA 2Z3FA 4OFDA 5CD3B 2KLSA 1BHGA 3X14B 3T6VA 5BVPL 1U3HA 1NGZB 3QJFB 3AC0A 4YDKL 3U1QA 2EDTA 5I1EL 3S88H 4FYTA 2X2JA 1EERB 4KKPA 3U4BL 3H6JA 2DI8A 1PYWB 3WTXA 1LDPL 1E5YA 4NQDD 5C07A 3PWVB 1JXJA 1ZSHA 2CMRL 2VM4A 2ZWNA 4UQDA 3POHA 2E6JA 2H3NA 1YA5A 4PY7A 3TOPA 4BHUI 1H9VA 5TDPB 2D31A 4DFIA 25C8H 2ZUQB 3C12A 5EU7E 4OSUL 1DVTA 4GKNA 5TDOA 1TQCB 4N90D 3PHOA 2X42A 1QLEL 2EE2A 5BO1H 4AW4A 5H8DA 4O2FA 1C5DB 1XTLA 1AKPA 2E27L 2WLYA 3C5ZB 1RZ7H 4Z7VA 3TYFB 4MDIA 1YEFH 5E6UB 3TO4A 3QJVB 4XVJL 3MRDB 4DNLA 3S3CB 5ANME 1JF5A 1ERNA 3D0AA 3UAFA 4HJJH 2QV4A 3MX0A 4M5ZH 3P9MA 4XCFL 4AOFA 2BMKB 4QXTB 5AG8A 1DZ0A 4P3CH 5BRZA 4WKZB 1XR9A 3MUY1 5F70A 5GS1C 5T1LA 4NQUA 4YL4A 3K6FA 3WTYA 2C9RA 1WC7B 4Q4IA 3GT6A 1QBAA 4HEPG 4QRRA 4S2SB 5E00B 5DEGA 2VDQL 4BZ2A 1XZ0A 2J1XA 2RCSH 5HHMD 1UACH 4TNEA 4F5CA 3QRLA 2ICEC 4XXCA 5IQMA 1DEEA 1IBYA 3MRIA 4PWEA 5F93C 4WO4C 3S34H 4BELD 2VKWA 2WKGA 3M7FB 1Q9OB 3UP6A 5IMOB 1DUYB 1S9XB 3O9WB 1MJJB 4L37A 3L4CA 4JCMA 3E3QE 2XWTA 3WNOA 2TRYA 2XBZA 3QFGA 4JFZL 2DQGH 2Y6SC 5ICXB 2DMHA 4H88L 3N1GC 1HH6B 4H40A 4QRAA 1I8MB 2NR6C 1F8TL 2P5EB 1QLFB 4NZRH 1DDHA 4LCUA 1H0DB 2XOTA 3FO0H 1K8DA 5DYOB 1JVLA 4MNGB 1BAFL 1XH3A 3RAJH 3UEQA 2DEWX 3OHXA 5IQOA 1JZ8A 4ES8A 5EN2A 5TK2A 2Z7YA 4DWHA 2ERJC 3JT2A 3KLAB 4GG6B 4FQ2H 2D2CC 2V8LA 4ANVA 4LLAA 1C12A 4APXB 5KYWB 1AXSB 1E27B 2PXYB 3DO7A 4JGUA 3S0PA 5HDQH 2QQLL 1QNIA 2BP5M 4J7RA 4JVWA 4GJTB 3WGUB 2WK2A 3FTZA 4PN6A 4JFEB 4I1RA 1TU2B 3LQMA 2IANA 3V95A 3FN9A 1QQDB 2V3EA 4ZFGL 3MLXL 4N6QA 1CF8H 4IRJC 1E50A 3ZKNC 4IOIB 1XDTT 4BQ6A 1OHZA 1U8JB 1B6UA 1I1YA 1XGPB 4UDUB 3RNKA 1MCPH 4B97A 5K1JA 5DRWA 2B16A 4RWYL 4N3UA 3L5XH 1NLDH 3VXMD 3KS0H 3L2NA 1ZLVH 2X4QA 1HFUA 2Q8BL 2CJ3A 5HYQA 4WO0A 3DYPA 2JKRM 3N1FC 3E3QC 3PQYB 1KXQA 4PREA 1IUZA 1L9PA 1BXAA 2GT9A 4L8DB 2FLRT 5BV7B 5D7LD 4AW7A 4GUQA 4P5TC 3SGDI 4GSQA 4GY4A 4DVBB 4V2BA 2HJLB 4JCWA 4FLSA 4DP8X 3O3DB 3LQZA 2WB1A 4XI5D 4NO0D 4XHJC 2KPWA 5F9OH 3D51A 3QA3A 4RMWA 2R69H 4ZXBD 5EU3B 3R06B 1HSBA 1N64L 5B1AB 4NJ9H 1K4CA 5KG9B 2IAMD 1SYSA 2CDEB 3RFZA 2R27A 4MB3A 2L4OA 4D9LL 1CU4L 3MRFA 3D85D 1TXKA 3WN5B 2FR4A 3QG7L 4RAUA 4UU9A 3L5WA 4TKWA 2H2PD 2Z1PA 1A5FL 1GS6X 1KCSL 3X17A 1DQDL 4XO4A 4S1QH 5I8KH 3HC0A 4XXDA 1BQ5A 3FRPB 1AVAA 3IDJB 4OH2A 3O45B 5DQ9A 1CBJA 1KXVC 1EO5A 1Y6NR 4M3HA 2L8AA 3VXRA 4FMVA 3PABB 2IPTL 4YOKA 5B7MA 1FDLL 3REWA 3J27A 1EFQA 3A0OA 3BO8B 3FSWA 1YY9D 2TAAA 4FNTA 3R8QA 1ECYA 1PLGL 3RX7A 3TFKC 2BSSB 1LXMA 2MQCA 3D05A 1CF1A 5DD0H 3U25A 4ENED 2VXSH 3NSYA 3LXBA 1FE8H 5IW6B 3MJ9H 1LNUB 4IOFC 2IVFC 1TVDA 4P9ML 3VQLA 1KB3A 3TNNB 4OLEA 4K7FB 1URIA 4PJHE 3U0TB 3MUGB 1TNNA 4JHWH 1PL3A 3MVSA 4KKCC 4P57A 5JDSA 1MFDH 1VGEH 1R47A 2M1KA 4FTVA 1HS6A 4P46B 2IH3A 1RLBA 1NDTA 2EC9U 1VAHA 1QNZH 1TPXB 2YR3A 3B7UX 2R1XA 3EIFA 2WZ6A 5A2FA 1NPJA 3CJJA 3O4LA 4FABH 4X5WB 1PY0A 4M61B 3TBYA 1A0QH 2MTAA 4A04A 4Z3GA 5DD5L 3B2MA 1EZSA 2BRRH 5HGDB 3QUXA 4UTBH 5AYUH 3NCCB 3O6FA 4JUSA 4ZMQA 3IGLA 2DLEA 2QZ5A 3C75A 1ETZB 1FFPA 1YECL 2A4EA 2VDKL 1BG1A 3RWHB 1SLWA 1A6VH 1JN6A 1X5IA 1C16B 2BS9A 2VGLM 1EZLA 3KPTA 4XPFL 4CVUA 1W72L 1YMMB 1E9PA 2F2HA 4R2GD 4IMLB 5JTWA 4HGWB 4JM2A 2AZAA 2AJXH 5D7JA 4NBZB 5HJBA 4UV4L 4XE0A 3L3HB 3HBGA 2BVOB 3HUJF 5DHXB 3GO1L 2V2TA 3S35L 3Q8CA 4ETYA 5J6GA 5D1ZI 1ZMYA 5CCKL 1VZHA 2DEYX 3V5KB 4PB0H 3H7BB 3SO3B 5J9PB 3CVCA 4XRCA 1OEZW 1ID5I 4FF9A 4NO2B 5HHXL 5KVDL 2FWOB 3RBSA 4QCIA 3L3OC 1EGJL 4GQ9L 3BWZA 1IGJA 4ZJ9A 3U36A 3K80A 2AV7A 4OLZL 4N2IA 2IFFL 3KGRA 3K46A 5IZ7A 4TS6A 5INDB 1HHJA 2I5YH 3Q5TA 4S1SL 1KGJA 5LN4A 1W0WA 5ILTH 1I1AB 5I18H 2KYIA 3BEWB 5BW7C 5L4JA 4JCLA 4JRXB 4JFFD 2BVYA 4TVSa 2HJFA 3FO9B 3WUWA 1P6WA 3MTXA 3OAYK 3BCFA 1BSIA 4XPBL 5JPNA 2IO5A 2VSDA 1M05B 2WZ5A 4JZJA 4R3SB 3HNTH 4Z7WB 1P53A 4TSBL 5EIIB 1FNEA 2AAAA 1RIUH 3O2WL 4L3ED 2WINB 1OALA 1EVTC 3VA2C 3GRBA 1F4XH 4FQIH 3VD0A 2OAAA 3VD3A 3RTQD 3MRCB 3ARBD 1URLA 4YAQA 3QUZB 1WICA 2PP8A 3PWUB 4G9FB 1OGSA 3HRZB 3W11D 4ZW8A 3BEVA 2WLNA 4HJUA 2YPLE 3MKGA 3OLIA 3OAUL 2HJKB 1IGCH 3OMAB 5E6ZA 1ZS8B 4AEHL 1FHGA 4G8EB 1YPZA 4FERA 1P7QD 5E8DL 1N3NA 3LHAA 4AQ1C 3LHPH 1V10A 2DDQH 4DETA 3HJEA 5EO9B 5KSVB 1BZ9A 3W2DL 3NZHL 4JS7A 4NZTL 2DRUA 1ZWIA 2HX7A 3KJ6L 3KBFA 3LPWA 3FN3A 3V0DA 4POYA 4F9LA 4UZUA 4G8IB 5KANI 1YEGL 5EU6D 3O4OC 4PM1A 2DOCA 2QPFA 4FYRA 1PAMA 4HOWA 5JW3H 3GM0A 3I2CL 4I0PD 5CMAA 3RB7A 3UEZA 3VWKC 4J3WA 1M71B 2CXKA 3NFSH 5F3BA 4QRPD 3AB0C 1NSNL 4FNSA 5J13C 4Z7AA 1AHWA 4NQCB 1TZOA 5CFHA 4G59C 4KQ4L 3G7TA 4U1HB 3TO2A 5CJOH 3WNIA 1E3XA 5MENA 1S5IL 3B5HA 5EA0L 3RYMA 4R7NA 4UM9B 2NY7L 2A9ML 2WYTA 4J27A 4LHUA 1ZDQA 4KQ3H 1AIZA 4ZNEA 3EJZD 3GBDA 3VGDA 3P9LB 4LCWB 5CIPB 1UD8A 2PPCA 1PJ9A 4OCXL 1OHQA 1DJZA 3EBAA 5DZJA 2EICA 3MLUL 4X99B 3VQ1C 1MZYA 1V7NL 3ARDD 4L4TA 4WEMB 2X4TB 1U58A 2ITDA 4YBLC 4HLZH 4R96A 3VSVA 4AH2A 4NO5B 2DLFL 4WTQA 2HKHH 4MX7B 2W59A 2W91A 3RILA 4ZQTA 3SOBL 2IDQA 3LXCA 1F58H 3A4AA 2WUBH 4MDRA 3TH4T 1AR1C 4UV7L 3U30B 3C8KB 1J05B 2ZXBA 5D2NE 4GMSH 3WFCL 1GIGL 1IFRA 2RH0A 2ZICA 4G43B 1Q72H 1S7XA 2GK0A 4YDIL 4A2DA 7FABL 5AW9B 1T1XA 2A4ZA 1KENH 1QFWI 4OLUH 4Y5VC 1MQKL 2PO6A 1DBJL 2VERN 3CN0A 3H9HA 3OKOB 5ITBH 2GC7C 1J9QA 5AOKA 3P77B 4X4MA 1ETJA 4L2YA 3QFJE 4DZBA 1I75A 4O9HH 1J0YA 1MCSA 4YE0A 2DMKA 3VFUA 4MWFB 1HXYA 2AZUA 4Z1PA 2Y06H 1MQ8A 1GGUA 2YQBA 5B1BB 1Z3RA 1GYUA 5HJGA 4H13C 3ECBB 5E8PA 4PGBA 1FGVH 5CJXA 3HFFA 1G43A 1E65A 4LP5A 1PZ5B 4W4OC 4K23L 3MLVL 4LSRH 1EAPA 1Q38A 3HG1E 2P80A 5MI0C 3AQXA 1W0YT 4IU3B 5C0ND 3GSNB 3ZSTA 2XBTA 5HHNA 4RFEB 1KCBA 3CXHK 4XBMA 3D3VE 1IL1B 3GXPA 2DEXX 5IREA 1ZOXA 1UKTA 2K0RA 2NNFA 3WIAA 4H25B 4HF5H 3N1MC 5MERB 4LEBA 4NZJA 1F42A 1S78D 1J1OH 5FS5A 2ITFA 3ZRCC 4ELKA 2AAVA 3P2DA 12E8L 1IAIL 3QI9B 4WI0A 4EI0A 4OZGB 4QGYA 3B2UC 3GMNA 3P9WB 3ROOB 4UBDD 5D2NC 2Z0BA 2ED7A 3FT2A 4WNQA 2EYSA 3PAVA 4ZAKB 3BT2L 2N0MA 2DICA 1ADWA 3KPLB 1EVUA 1KFAH 1MUJA 4K7PX 5GRWA 4FZ8L 3MYZA 1BJ8A 3MJWA 4IEFA 1JWSA 2YOAA 3QDJD 3ZHFA 1VADB 2GY7B 3CZEA 3KHOA 3VGEA 4JB9H 1G0XA 4F15B 5SWQB 2BX5A 3DX6B 4DP2X 3IJHB 5I8OL 3GIVB 4FG6D 5FFLA 2DYSB 3GSWA 5HDRA 1I31A 4JHVA 1P4IL 2BVPB 2O5XL 4MAYD 3BPCA 3MRPB 4E9WA 4JFDA 2WBJB 2NXYC 4M1CD 2JH2A 1FN4B 2CM5A 2JKIS 4N0UB 3FFCE 5HI5C 3VFOA 2BIHA 1XXDC 2BSBA 3BAXA 3TCXA 4WW1B 5FW6A 2O5YH 1RHFA 1I4FA 4IS6B 1MRFH 4KC3B 2MCPL 3SDDB 3T0ED 2OMWA 2JMRA 4XMZA 1RP9A 1MFCL 3ATFA 1DJSA 2EQDA 1N59A 2HG0A 1L7TL 4L9LB 5DVMA 3I6KA 1T1YA 3BDYL 5JIHA 2V3FA 4FAAB 2CUIA 3PGFL 2WKOF 5GQBA 2KKQA 5HGHA 4AYFA 2NPLX 1H3TA 1I8AA 1UM6L 5CHNA 1XEUA 2FH6A 1QI3A 3ZRFC 3FQNB 2GJ6A 2VMEA 2CGRL 1DBML 2D2OA 2K6YA 2R69A 3MLYH 4XMPH 3UYOD 3W9DA 1EHXA 2R4SL 4BE5A 1MWAB 3NSDA 5DYFA 4PJFF 4HFWA 4APQA 3DROB 2A83A 3EO0A 4UIMB 5KN5B 1XIWC 2N7AA 3F64A 3O6MH 1T0NA 4PJGF 2QSQA 1IKNC 3I9IA 3LQAL 3IPBA 4GAGH 4NRXA 3T5WA 2NTSP 4PP2A 2A6DB 1LDSA 4XNDA 5C71A 5T3XL 1QOKA 4RNRB 1XV8A 4AQAA 4R0LB 3E6FA 3VJ6B 3ESPA 1KCRH 3GMMA 1CGXA 3HLAA 3LH2L 1G5GA 2ED6A 4N28A 4MMZC 4PRPB 1E30A 1MFAL 4WWKD 3TBTB 4K5PA 4BH8B 4UAOC 1MJUL 2GK2A 4PVLA 1TNMA 3MV9D 1TCRB 1AFVL 3WXVH 2OCFD 1WDAA 5ABDE 4HIPA 1FF5A 1ZPLA 5H2BB 1OK0A