1JOIA

Structure of pseudomonas fluorescens holo azurin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECKVTVDSTDQMSFNTKAIEIDKSCKTFTVELTHSGSLPKNVMGHNWVLSSAADMPGIASDGMAAGIDKNYLKEGDTRVIAHTKIIGAGEKDSVTFDVSKLAAGTDYAFFCSFPGHISMMKGTVTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Crystallization and preliminary crystallographic studies of the crystals of the azurin Pseudomonas fluorescens.
pubmed doi rcsb
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1997-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1joiA00
2FNWA 1JXGA 3PLYA 1AQ8A 1B3IA 2YAFA 1F56A 1NZRA 1OCZB 4E9RA 1E5YA 3OM3B 4F2EA 3S8FB 2Y1AA 3SBPA 3WKQA 3TA4D 5I5IA 2TSAA 4KO7A 1XB6A 1XMEB 4TXVB 2GC7C 4YSPA 1VLXA 1OCOB 3ASNB 3CDZA 4G7QB 3FS9A 1J9QA 3NP3A 1NIFA 2GB2A 1NPNA 1SHWA 3TU6A 2JXMA 2YAMA 3OMNB 4DP8X 1NIDA 1CURA 3FSAA 3FQYA 2BO0A 2BP0B 1BXUA 1URIA 2Q9OA 4KO5A 2ZXWB 3UAEA 4YSTA 3C75A 3T6VA 1OE3A 3NJKA 1NTDA 4GYBA 3CVCA 2XV3A 3V9CA 1MZYA 1TU2A 3HB3B 3MBWB 5I5JA 5I6LA 4AZUA 1A4CA 1AAJA 3ABKB 4P5SA 3ZIYA 1N68A 1EHKB 1IBZA 4BWWA 1PCSA 4A68A 1AZCA 4M3HA 3TASA 4HAKA 3KW7A 2XV0A 2YAQA 2PPEA 3NJHA 3T71A 3IE9A 3PXLA 2DYSB 4DP7X 1AOZA 3T6XA 1JZGA 3EH5B 2BZ7A 3FU7A 2J5WA 2YXWA 4Q8BA 2H47C 3AW5A 3NJMA 4YVNA 1DYZA 1AZRA 1HAUA 2HLEB 2XUWA 1WA1X 1MZZA 2CUAA 2W88A 3DIVA 2PP8A 4A2HA 1AG6A 1JOIA 4G7RB 3CVDA 1ILUA 1TKWA 1GS8A 1WA2X 3FPYA 1KYAA 1A4BA 3H4FA 2X88A 1N70A 3WI9A 1JZEA 2XX1A 3NJNA 2IDUA 1L9OA 1BQRA 4YL4A 1AR1B 4AX3A 1ZPUA 3S3BB 2GI0A 4QLWA 3U25A 2N0MA 1E65A 3N55A 5PAZA 3UGEA 1GR7A 1OE1A 2HX7A 3H4HA 2BHFA 1M56B 2HXAA 4HCIA 3X1FA 4DP1X 3PCYA 4E9TA 1L9SA 4QKTA 4G70B 2BZCA 1AS7A 3WNIA 4DP0X 2H3XC 2BW5A 3BQVA 1AZUA 5F7BA 5B1JC 2BWIA 2PCYA 4YSAA 3HEIB 2PCFA 4CSPA 1J9TA 1ZDSA 2AANA 2P80A 2ZWNA 4W9ZA 3NYKA 3OMAB 1NIAA 2GHZA 2PP9A 1V10A 1ET8A 1SFHA 1NIBA 3FQ1A 3NSFA 4KOCA 2Q5BA 4KOBA 1M9WA 3IEAA 1BYOA 1FWXA 1JVOA 2DWSA 2CBPA 3S3CB 1JXFA 4AKPA 1PLBA 2I85A 2QPDB 1J5DA 3AZUA 3FT0A 4G71B 5EHFA 3SBQA 3T6ZA 4BDVB 3IN0A 2DWTA 1QNIA 1GY2A 1DZ0A 3T6WA 1BXAA 3QJRB 1W6WA 1PNCA 1W6LA 1CUOA 3D12B 5D4IA 2HRGA 4ENZA 2YQBA 2FQFA 1E67A 1PLCA 4UAHA 2EIKB 1AS6A 2XX0A 4BK5C 4GP5B 1GSKA 4EF3A 2I7OA 2DYRB 1ASQA 2IAAC 1SNRA 2CALA 1NPJA 4MFHA 4E9XA 3S8GB 5B1AB 4PAZA 2B08A 1L9RA 6PCYA 3PAZA 2BP8A 3AG2B 2J55A 1KCBA 3EHBB 2VW7A 2FQEA 3ABGA 4G7SB 4KO6A 1PNDA 1PZCA 1OOWA 2RACA 3CDZB 4YSOA 5I6NA 1KDJA 1CYXA 2XV2A 3V9EA 2WO3B 3NSYA 4KNSA 1SF5A 2I7SA 3ABMB 5AZUA 2BP0A 1TEGA 4DP6X 2VN3A 6PAZA 2VM4A 1PF3A 1A4AA 1KCWA 1IUZA 1BAWA 4BWUA 4M4RB 1PAZA 1ZIBA 3QJVB 3CG8A 1GS6X 4HCFA 4NERA 2GBAA 5B1KA 1E30A 4YSQA 3UABA 1W8EA 3T9WA 1GYCA 1L9QA 1I53A 2IWEA 2R7EB 4JHUA 3NJFA 1KGYE 1KBVA 4E9WA 4WTQA 2EIMB 2FTAA 3GYRA 1AS8A 2XU9A 3G5WA 3QJUB 5B1JA 3TBCA 1NINA 4E9YA 4BWTA 2OJ1A 3WG7B 3IBOA 2FT6A 1GY1A 4N8UA 2GC4C 3FU7B 3PAVA 2QT6A 5TK2A 2JFCA 1SHXA 2H5UA 2X87A 2UX6A 4YSCA 4HHWA 1JZJA 5I6PA 2PLTA 3ZX1A 2IH9A 1JXDA 4A66A 5PCYA 2EILB 3KW8A 3UADA 2VW4A 3EH3B 2DY2A 4HALA 1E5ZA 4HCGA 3DTUB 3FU9A 4UF7C 1KBWA 1QLEB 4HZ1A 2A3TA 3OMIB 5B3SB 1RKRA 3L45A 5I6OA 1J9SA 4GP4B 3X1NA 2EINB 4KNTA 3X2QB 4AKQA 3TBBA 3EH4B 1AANA 2XWZA 3FPXA 2VW6A 4UANA 4L0PB 2OV0A 1MG2C 1BQ5A 4N4YB 1IKOP 4BXVA 4DPBX 1JZIA 2YXVA 1BYPA 3SQRA 1FA4A 5D4HA 2HX8A 1L9PA 4FAAB 4YSRA 1X9RA 3ZDWA 1AZNA 1SJMA 2UXFA 2HZHA 3NT0A 1JERA 2QDVA 2Y69B 4A2GA 2XLLA 2IDQA 2XXFA 3WIAA 2MRYA 2B3IA 4BDVA 5B7FA 2FQGA 1IC0A 1SDDB 2UXVA 2VMJA 5LDUA 3PAUA 4A2FA 3FSVA 3FYIB 4NAJA 1M57B 8PAZA 2LLNA 5I26A 2GIMA 4DPAX 3CZUB 1ILSA 3FSZA 2XVBA 2CJ3A 1ASPA 2VSMB 3RYMA 3QJTB 2YAPA 2YARA 4F2FA 4AI7A 1L9TA 3QQXA 1NDTA 1PZAA 3AG4B 1OV8A 4X4KA 1ETJA 3QJQB 3QPKA 1JZHA 5FC9A 7PCYA 3ASOB 4W1TA 4HHGA 1ET7A 2AZAA 2FT7A 1V55B 2IDFA 2CAKA 3OQRA 4YSDA 3X1BA 1WAEA 3CVBA 2BP8B 3AG1B 1ID2A 4RH4A 1RZPA 3WNJA 1MDAA 1NICA 1TEFA 2TSBA 1WA0X 3FYEB 4DP5X 5AKRA 2FQDA 1ZV2A 4KNUA 2XYBA 2VSKB 3GXUB 3NJJA 2GSMB 3FQ2A 3FSWA 1NIEA 3FU8A 4JKNA 2OCCB 1V54B 5ANHA 7PAZA 5D4JA 4DP9X 3NSDA 5F7AA 1AG0A 4CSZA 1HFUA 5IY5B 2YAOA 2UXTA 1OF0A 4K9JA 1CYWA 2BWDA 1XB8A 1YLBB 4E9SA 4GY4A 5E9NA 1ASOA 2J56A 2R7EA 4P5RA 3IN2A 2HX9A 4GXFA 2IH8A 1EZLA 1OE2A 1IBYA 2PP7A 4DPCX 1X9UA 1ZIAA 1OCRB 2HRHA 2MTAA 2ZONA 3NP4A 3PPSA 2QDWA 3DKHA 1ET5A 1J9RA 1BEXA 4A2DA 2XXGA 4A2EA 1ZDQA 2IDTA 2EIJB 3WKPA 1JZFA 3X1GA 1RCYA 1UATA 2BW4A 1A65A 4E9VA 4E9QA 3ERXA 2PPAA 2DV6A 1HAWA 5I6MA 2IDSA 3NSCA 1JVLA 2PPCA 2IWFA 1NWOA 1RZQA 2P80D 2FJSA 3JT2A 3NJGA 1QHQA 3S3DB 1KV7A 5I28A 3UACA 2W8CA 4A67A 4DP2X 9PCYA 1WS8A 1NWPA 2PPFA 2AFNA 5A7EA 5AFAA 4KO9A 1A3ZA 1PZBA 2WO2B 3GDCA 1PMYA 4YSUA 1A8ZA 5I6KA 4BXSV 1FFTB 2UXGA 1AZBA 2FWLB 1WS7A 3BVDB 1J5CA 2YAEA 1ADWA 5B7MA 2UX7A 3MX0B 1BQKA 4FA7B 1KDIA 3NJIA 4WKXA 5I5MA 4DP4X 2CCWA 3UAAA 4G72B 5B1BB 2VM3A 1SFDA 3X1EA 1MG3C 1SF3A 2YAHA 1OCCB 4ZK8A 1GW0A 2E86A 5TK4A 4HIPA 1T5KA 1PLAA 4Q89A 3OD3A 3NJLA 4AKOA 2NRDA 4PCYA 1XB3A 3N2JA 4YVUA 1R1CA 2AZUA 4F7KA 3H56A 4YSSA 4JHVA 1AACA 2J57A 3AY2A 3ABLB 2WSDA 1PY0A 2QPEB 5B7EA 4YSEA 3ZBMA 1BXVA 1SDDA 2IWKA 2JKWA 2FT8A 1CC3A 2AVFA 3QJSB 1AIZA 4GP8B 3SBRA 1GS7A 3JTBA 2PPDA 2ZOOA 3EF4A 4NB7A 3AG3B
chains in the Genus database with same CATH superfamily
3BDYH 3MRIA 3L6FB 2CH8A 1XZ0B 5K33A 5CZXD 5GISH 5GRXG 3CLWA 4R83A 3T0ED 2X4UB 2KYIA 3DA0A 4ENEC 3UMNA 1QSVA 1G7HA 3S8FB 2Y1AA 4N0FB 2CK2A 4ZMVA 5TDNA 2R2EB 1EJ6A 5C86A 3KR3L 1YYLL 3ZL4L 1OCOB 2Y9RT 1QSZA 3OR7A 4BKTC 5CINH 4PUBL 2GB2A 3BUDA 3WELA 4YK4B 2AS5M 4J3XA 1SHWA 2AQTA 2B4CC 4O2CA 5KYYA 4QHUA 1FYTE 3AAZA 4NIKB 3IXAB 4H26B 4PPTA 3L3KA 4CW1A 2D2OA 3FSAA 3L3HB 3KL3A 5KS9E 2NX5E 2DW5A 3A23A 5LGKA 1G7QB 1XGQA 3EBGA 2CJUL 3VSUA 2XBDA 2B5IB 4E68A 3T0EB 4FRWA 3VGDA 3QULB 4KQ3H 5E5MB 5C08A 2ITCB 2G3ZA 3QJFA 3IYLW 1J05B 5E0FA 5T1LD 5FM5O 3SDAC 3U4AA 3ETSA 4PJBE 2XWEA 4BWWA 2XZAH 1BD2A 4AV0A 1B0GB 2FUTA 3CMOH 4YDJB 3HBPA 3GHBH 1IM3A 1WGVA 2QJDA 3RAJH 3LIZL 2VNCA 5LGJB 1IGML 4LVEA 1OGTA 1I3VA 1WZ1L 3NJVA 4P2RD 1G94A 3WGUB 4F91B 5JHDD 1CO1A 5JW4Q 2AEIT 1KPUB 1HCFX 1A6WL 3IDUA 5D1ZI 1CBVH 4OLXL 4UB0L 3WIIH 1JTTA 1IGFL 3RVUD 4JJ5B 3WEAA 2VN7A 4YNYB 4Y9EA 4P46A 5L88H 3S34H 3QXAB 3OAYK 5DD1H 4MCZA 4W6YB 4YZFF 2WKLA 5I1AA 4LLVB 4XBMA 5T1LB 4ES8A 3QORA 3TBYA 3BHBA 5CZXC 4LIQE 3V7AE 1OAYH 3VDAA 3S96B 2B5IC 1S7VB 3D8MA 2Q86B 1TO5A 4KFZC 3T0EC 1DBMH 3TIDB 3D18A 3FCTB 1VZHA 2BSSB 4WHCA 3L16A 4QRPD 4H7VA 3GO1L 3MJWA 5DK2B 1M56B 5IEHB 5CN2A 1OGPA 4R3SA 4P2RB 5JHDB 1QUNA 1UB6B 3NABH 2X4SB 4GPVA 2R29H 3V5KA 4BSVB 4NNXA 1HXMA 2O5ZH 4YHIB 3SE3C 3TPUB 3VWJD 1ZHBA 5F9WB 1JUFA 4NQTA 4W93A 3CQFA 4WCYL 1R3HA 2FO4B 4I2XA 1IL1B 4KX7A 3TTYA 1ZANH 2APTA 3ZE1F 5BUGA 3BAWA 1HIMH 2KZBA 5E5RB 5LN4A 2KBGA 2AANA 3LOWA 5T3XD 3D87B 3QJXA 1QQDA 3NYKA 2ZWLT 3FT3B 1XF2B 1DO6A 1KMGA 3UBHA 1MNNA 2K0RA 4KOBA 4DO5A 3FOLB 3D5OF 4QRPB 1BFVL 2HN7A 4KTEH 3MRCB 1KUMA 2YS4A 4BELD 3CC5A 2EDLA 1YG9A 3FT0A 2NPLX 1MKFA 2OR7A 3NTCH 4OJCA 4KRMB 1A6AA 4PJ7A 4AYSA 2AK4E 3FQRA 3FT2B 1EXUA 2E0PA 4AM0B 1ORQA 5HHOA 1BCIA 5L9DL 3VWJB 4AYID 3D12B 3TPKA 3LN9A 4QD2E 3WFBH 2CG9X 1SBSL 2Z6FA 1NKGA 3MROB 1E7VA 5H94B 4Z7WE 3TEZA 4M61A 1XF3A 1VKXA 5AYUH 4HLZG 3RVUC 4D0DB 5D1ZD 5IR1B 1YNKH 5TH2B 5F9WC 3U0WL 5EZOH 4ZMLA 1BQUA 1TZGL 2BINA 4XCYA 1C16B 5HHQB 2YSSA 2ZP8A 3DX1A 5SWZB 2B08A 1N9PA 5KJRH 5DD5L 2VDNL 4FQJH 4PBWD 3WTYA 5IHZA 4YDVA 4ZRGA 3NUKA 5HHPA 4GO6B 5HYJD 2N3JA 5JO5B 4PRPB 5AZEH 1FZKB 2VJ8A 2CPCA 4HEPA 4GKNA 4TSBL 2X3CA 2F58L 5C7XL 5FFLA 5I6NA 2FE0A 5FGRA 3VCLA 5LNDA 3WUWA 2BVQA 1F1DA 2CDGA 3Q9QA 5C07D 4AH2B 1S3KL 2I9TA 1F5WA 4GFXA 4XX1E 1W0WA 3C60D 4L37A 2VM4A 2DIJA 2LAAA 2OR9L 5D1ZB 1HZHH 3VWJC 3SGDH 4U2YA 2CDEA 3HS0A 2F8VA 3M1BA 4RA0C 1FAIH 1LMIA 2GT9A 3EO9L 2BS9A 1JDDA 2GTQA 3OHMB 4L1DA 2PYFA 5ACZA 5IVNA 5HYJB 4MJID 4FFVD 4LLQA 1WAAE 1KGYE 2B2XH 3VM5A 4WTQA 1MWOA 3OZKA 5L7XH 5GS0C 1WPCA 4L1LA 4ADIA 4DGVL 4PD4K 2XRAH 2YMOA 4Y16A 2VDMH 1L3NA 4ACTA 4HKZA 4XOEA 5C7XH 5SWQB 3DGDA 5C07B 5LCVA 4LLUB 1BZ8A 4QY8A 4S0HA 3AREA 3SGKC 3IFLH 5F7LB 4W9DC 3QZBA 3C60B 2HP4A 5I9QB 3RTQA 1GOHA 1IGIL 4G43A 4OCYH 5EOTA 2WNXA 2ZTBA 2JFCA 4K3DL 5E8PB 4A1RA 4TUJB 4ZMTA 2I26N 2OYLA 1KF9B 2ICEB 4NNYA 5I6PA 4K7FA 3LKSB 1IM9A 5EO1B 3ZX1A 2A6IA 4JQVA 3FU0A 4PJFE 5SWSD 4LO9A 1ZLUK 4UQCA 5KAQG 1JMZA 4XCCH 5D1ZC 3FU9A 4MJIB 4LPVA 2R27A 4TNEA 4ACPA 2ERJC 2R4SL 2WTRA 2WWKO 4WO0A 5EO9A 4XO3A 1JPFA 2HVKA 3FTYA 2OM5A 5BMFH 1FGVL 3HR5A 4ODSH 4DGYL 3LPFA 2VLKD 1UUNA 5T1MA 2DKMA 2Y06H 2BPBA 4W70A 3DHPA 5D55A 3VQ1C 1NGWB 3Q9PA 3OX8A 5C09D 2YXVA 4J2QA 1BYPA 1UB5B 4M03A 1WD8A 4N2BA 3G5XB 4O4YL 3C2AL 1Q72L 1QVOB 4K0OA 4HF5L 4UQAA 2QKIB 3C60C 3BWZA 3JVFC 5CJ8A 5CU9A 4PJGE 4EZJA 3RI5F 4H1LB 4ANXA 1UT2A 4MB4A 4LSUH 4ZYKA 2A74C 3BVTA 5C2BL 4ESKA 2ICEC 1I1CA 3G6JE 4Z7UA 3O2WL 3CN3A 4XMUA 4R7DA 5MP6H 3KPRE 4CC4C 3RVXC 3QYNA 4B9GA 3EF7A 1ZA3A 3PWUA 2VLKB 4FFVC 3BP6A 4W9HC 5J4MA 1NFDA 3BGMA 4F7PA 4GRWB 2ZE0A 1UXSA 1J10A 5ITFA 3WIHL 1OF2B 4LXFA 2PWGA 5D5MF 5K1VA 3S37L 1XCWA 1WZAA 2VQ1B 3OPZH 2EUWA 2AP2A 2J4WH 1CS6A 2VR8A 3F7KA 5FYLE 2EVHA 1SM3L 2B9AA 3ULSA 1AE6L 3ARBA 1ULVA 2DI9A 5E6IA 1INQB 4ZQTA 1PZAA 4LQ1A 1FL3B 1MFVA 5GSRA 3G6DH 4DCQB 1BIIB 2QKIC 4Y19E 1FN4B 3L9YA 3MGAA 3DV4A 4U0RB 1CQKA 3TA3A 1DVFA 2E7MA 4WJ5A 4PJIA 5GGQH 5CILH 2CAKA 3VGAB 2X2JA 1Y1UA 2F53A 3TF7C 3KWTA 4EE2A 2JXMB 3OKEB 1ODUA 1VFBB 4OCXH 3ZO0A 4YHLL 4R5VA 2WLNA 4HT1L 1LE9B 1F3JB 1H8SA 1NAKH 2FQDA 4IS6B 2LAGB 2BERA 5HVFB 1UM4L 3X12A 2F7RA 4TRPL 3WAJA 4PSPA 4LP8A 2F19H 4XXWA 1JNNL 3M8OL 1TSRA 4WI0A 4G6ML 4LOEA 2GK2A 1IE5A 3GSVB 1KFAL 3MJ6A 1RHHB 4G6JL 4AYFB 2WZ5A 4UYPA 1ETZB 5DD6A 4EDWL 4IRSA 4LEBA 1CLYL 1ADQA 4V1DD 4S2SA 3WD5L 2VLRE 2WUCL 4OF7A 3QIUA 2YKKA 2EP6A 2NYKA 3SGEI 2KDGA 1FFPA 1NGPH 4UOZA 3MJ9A 4D9QD 3T8XB 5IB4B 4MBOA 1R3LB 2J6EA 3C5JA 3D4CA 4O2EA 2JCCA 4UNVA 2OZ4L 1EANA 4QO1A 1FNEA 3E6HB 5JXEA 1M6OA 4GSQA 2UZXA 5IBUG 4AGPA 4KBPA 2MPAL 3MUHL 4M6AA 3QUMH 3KEHA 4U0RC 1HSBA 5DI8A 3CZEA 3RX9A 1ZT1B 3QRBA 2AAVA 3DSFH 5DJDB 3SYOA 1AZZC 3VGAC 5KN5B 1WBXB 4P57A 4JFFE 4XPGL 1IJNA 1N3NA 5DQ9A 5AG8A 2P52A 2AXHA 1S9YA 3LB6D 2IDSA 5I8KL 3TGXA 4V1DB 3P4MB 4E41A 4WNQB 1D7BA 3FXIC 3FTXA 2XPZA 1SUHA 4FFYH 3HLAA 1QMUA 3L4YA 5CHNB 3ZZ1A 3N1MC 5EF2A 3VFWB 2Z34A 3LTVA 3UG4A 5FF6A 5D6DA 3V0VB 4HJJL 4G5ZH 5JQ6L 43CAB 1NWPA 3O3DB 3MBED 4L48A 4AQAA 4JZJA 1A3ZA 2QGCA 1ND0B 3EXJA 1F6LL 3JVGC 2Z64C 4EIBA 2WP3O 1AGCA 3VQ2C 1A8ZA 3IGKA 4ODWB 5EN2B 4LE8A 2LV4A 1FO0B 4Q52A 3QGVA 4ELKA 3C08L 4FOMA 2FWLB 2OJZL 5G2NA 3KCPA 2AABL 3WO4B 2I24N 2D0GA 1U58B 3JV6A 5I1DA 2FJHA 3S0PA 4HJGB 4JFOB 3BJLA 4FXLA 5IJVA 3ZTEA 4AZ8A 3KLLA 1ZT7A 4YHNA 2NRDA 3EJZD 2R0KL 4I48A 1U8IB 2Z35B 3NESA 2B1AH 1NSNL 4QXUL 1HEZA 1CN4A 1QP1A 1HWGB 1SMOA 5EPMB 4PWKA 3S7GA 1A0QH 2VB5A 4I85A 2VJXA 3EOBB 1ETB1 4WTZA 3V7AG 1BX2B 3R06A 4QRQA 4YSEA 1GXEA 1P5UB 5DEGB 2Q8AH 4L4TA 4Z1PA 4U3SB 5JOFA 3MCKB 4HCRL 1MRCH 3KPLA 1NMCB 1H5BB 4NB7A 1MCKA 5F7NC 3DK0A 3VXRA 2OTWA 5I6XB 5EOQH 4TUOA 5D2NB 2Z4QB 4PWEA 3MLVL 3HB3D 3LB6C 3T8MA 5EBLB 1N26A 1PPIA 2Q76A 2WXPA 3GPSA 3LEVL 4Y1SA 1M7DA 2TSAA 4KH9A 4XCNA 5TE7H 3WO4C 4DVBA 5I5IA 3TS8A 4HXBH 2GC7C 4YSPA 4YFEA 2VJ0A 1D7DA 1FV1B 2XIBA 2YK1L 4FNTA 5J57B 3ZE1B 2NZ1A 3MVSA 2X6VA 1KCSL 4B9JA 4PLNC 4MJ6B 3T1WA 1MHCA 3IPFA 4EBQH 3QO0A 1IGYA 3MBEC 3PNRB 1GPOH 3GSRA 1MJUH 1QFUL 2KQMA 4KQ0A 1NDMA 4QTFA 3V79C 2GAZA 3V6BR 3F5WB 2FR4B 4IRJA 4HIXH 1CXLA 3MRRB 3QDGE 1OSYA 4JX0A 2XV3A 3KPPB 3LZQA 5CR8A 3HB3B 5JW5B 1NGQL 1RUAL 3ML9A 1AAJA 1NMCC 1H5BC 1S9WB 3BMWA 4NQCD 4H8WH 1ZVHA 5JHLH 2VERA 4PJXF 4C58B 1IBZA 3DURA 1ED3A 1PCSA 3C8DA 4OZFG 3SDCD 1BP3B 5I6XC 5D2NC 5DS2A 4WY7H 4JK0D 1A7RL 4PGBB 3S4SG 2CUHA 3SQOL 1SLWA 4PJHA 2W38A 3T6XA 4BCZA 3EJZC 4JPIA 4HBCL 1KNOA 2R4RL 4X2UA 3T4AA 1HAUA 4ZJ9A 4N0YH 5C0CD 1IC7L 3O8XA 1WA1X 2VUOA 1F45A 4BCYA 5CZRA 2PTTB 2X1XR 4YGAB 3CSPA 4FDWA 2E27H 4LPXA 3KVQA 5C3LD 1JGIA 1J8KA 1G7PA 5SV4A 3RPBA 5CN1A 4F5CE 5I30L 3QWRD 3Q01A 2FGZA 1TLMA 3UDWA 4C4KT 1X44A 1E8XA 1AQDA 1OEZW 3GK8H 3OG4B 3SHSA 3FTSA 2VC2B 3GSOB 1HOCB 4XX1G 3SDCB 2H6PA 5IROA 3BX7C 4ICXA 4B60A 4BFGA 4S1RH 2OYKA 4PRIE 3HB3C 2H26A 5IJKC 3EYVB 5EO0B 3JWNC 4N0UE 1F11B 4WK4B 3GTNA 3ZE2F 1EDYA 4HU2A 1IQWH 3CVHL 3EW3B 5C0CB 4DH2A 1JG9A 3NIDF 4MZRA 4Z6AT 3FQNA 5FUOL 1QR1B 4ODUB 4OI8A 3BYYA 3ILQD 3SDYH 2C9XA 5F7FA 1N19A 2L3BA 3THML 3BP4A 3MFFB 1SLXA 3ROOA 4BBWA 2EIEA 2XZQL 2Z8VC 2PWEA 3G5ZB 1JK9B 3RB7A 1IBGH 3EJQA 5M94B 3ULVH 2DTMH 2ZCHH 3GSQA 2V33A 2XDHA 3N1FC 2IGLA 3PDGA 1LO4H 1M71B 1MCHA 1D5IH 1OAQH 3S3CB 3CLFL 1QEWB 3BYTA 5F9JA 1ZHLB 1H15B 3SDCC 2HKFH 3SKNB 4CN4A 5DO2D 1G4MA 1JS4A 2EICA 4DETA 4ZUSA 3QCTL 1EO8L 3OXSB 4KTYA 5BO1H 3QFDA 1IBHA 4DW2H 1E67A 4PGCB 4WUUA 3QA3A 3NAAL 2DKSA 2UYLB 1JGEB 3L6FA 4OM1L 1JP5A 3Q6GH 2JWYA 3X3FL 4LASH 4PWGA 5CS7A 4MNGB 4GLRH 2L7EA 3K80A 4OB5L 3MUUA 3N1QC 2GJRA 3ZTNL 5JPMB 1PZUB 4N0FA 1WK0A 1XIWD 2DQGH 2R2EA 3GB7B 2OMUB 2X6AA 4UILL 3QR2A 3W1ZA 2J55A 4N3TA 3KPNB 1FNFA 1QBML 1YY8B 1SJEB 2ZX6A 1AJ7L 4FYTA 1BZ9B 1P84J 2FQEA 3ABGA 3TXAA 5C08E 1OOWA 1X5AA 5FIEA 3GKWH 4M5TA 4NI6A 3IXAA 3IJEB 4K3JL 3D69B 3CDGB 25C8L 3WXWH 3T09A 4ODHH 1TEGA 1XGZA 3FC8A 4XP9L 1BD2E 3QR0A 3TCLA 1JZ5A 1G7QA 1FNGA 2C9AA 4HWUA 1B4JL 2X0VA 1BAWA 2X3AA 3GI8L 4FHBD 3ILQC 4UOJA 2VUKA 3T0EA 3QULA 3B56A 3PGFL 1V7NH 3HC4L 2ZF9A 4HCFA 4MD0A 4AVIA 1XIWB 1J05A 1LMKA 4L4VE 5JUEH 3H9SD 1Q9WA 2CM6A 4KUZL 3GMNB 3QXDA 4LL9A 1C1EL 5CEYB 1M3IA 1T7VA 3QRGH 5CWSB 1KBKA 2IWEA 4FFZH 2DLEA 3W0WD 1XH1A 3BT0A 4NQEB 4P07A 3UO8B 4DWHA 5KVDL 4YDJA 1BFOB 1CR9H 4JKKA 3MV7E 5JPMC 1UZGA 1SYVA 2DLTA 3SE3A 1YJDH 2VXQA 1UOVA 1MRFH 1HDMB 1KT2B 4ISVA 3F3HA 2FX8H 3BLPX 4LLWA 4ZFOL 5TK2A 3K0WA 2W65B 4JJ5A 1TYRA 2GSGA 1JRHL 3E8VA 2ADGB 4YNYA 1MNUH 1Z9NA 1J1OH 2F5BH 3QXAA 4CVXA 3QK0A 5ESQB 4M1DL 3HFFA 5E4IA 5IGXL 4LLVA 5T1LA 2EILB 1Q0EA 2WCPA 5CP7B 2PF6A 3KWUA 5CIPA 1T0OA 1TIUA 2DIBA 1UFUA 1K72A 3W0WB 4ZMQA 4Y0GA 3L3GB 3TIDA 5IHWA 1RKRA 1TVBA 1J9SA 1F3DJ 1E8WA 1OXYA 2BSSA 1XIWC 4I2XE 5IB5B 1DQDH 2DWEA 5AVXB 5GIRB 1MCPL 1DSWA 3PNWA 3ZKXC 5IEHA 3L48A 3PFUA 1UJTA 3BGFB 1E9PA 1LO2L 4NSKA 4ZFFB 3B9KB 5JHDA 1SBBA 4FQQA 3O3AB 3RWDB 1Y07A 3VXNA 5I1CH 1YEEH 2G60L 1EBAA 3HPLA 4AT6A 4NKIL 3UJJH 1BWWA 2E75C 4YHIA 5LG6A 1FC1A 3K6IA 3SQRA 2QHRL 5B4MD 1F6AB 3BUQA 3DROA 2YGNA 1OO2A 4PJ7E 5E7FA 4AYDC 3ISWA 4NT6A 1RZ8B 2MOVA 5IVXB 4GI6A 4MNQA 4W9IC 5HHOE 3V4UL 4JBSA 4GEIA 2ZUQB 1XF2A 4HUCA 1K4CA 3LXCA 2MNJB 3LAFA 3V5HB 3ARFA 2FO1A 1SXZA 5F1IB 2F74A 4BFOA 2Y2WA 3HJ0A 5JTWA 4JFXB 3OJMB 4JY6A 2IFFH 5TE6H 3LQAH 2NT0A 1E40A 1RIUH 5AAMC 4PY8J 3B8SA 5L0QB 3ALXA 1IAIL 4JFZL 1QABA 5HVGB 1U30A 3FT2A 5HDBF 4UV7L 2MNWA 3CXFA 3VWJA 1XSIA 4LGSB 2VMJA 4GAAA 3BGFC 3MLXL 3FF8A 4RETB 1KXTA 5AYQA 2OX5B 3FSZA 3OKKA 3GBML 1RUML 3VD2A 4JO4L 3ULUH 4NJAH 2YAPA 2Z7ZA 4F2FA 2AXWA 1KWKA 3D52A 4I3GA 2O5YL 4OFVA 1MAKA 2PUQT 4XRCB 3I9GH 5F7DB 4NBZB 4O5LL 1C5BH 3TZVC 3BAYA 3RWFA 1GC1L 3UTOA 2H3NB 4AUYA 2ICCA 3OMZA 2WWMD 2D2CC 5GS1B 3GIVA 1M2VA 1FP5A 4BGLA 1K8DB 1U8MA 5LB1A 4AGQA 4RH4A 1P4IL 4ZX4A 2HLFD 4FI8A 2CHWA 3MNWA 4FL4B 5F1NA 1X5HA 5L0QC 1IKFL 3WNKA 2OL3B 2JKNA 1S46A 5D1ZA 5B38B 3GRWH 1EO5A 2BNQD 3BRDA 3IXTB 2Y1YA 4JG0L 4OD3H 3FB8B 5DD0H 3K71A 5E00A 5JDSA 5B4MC 5IY5B 3E0GA 2R8SL 4B7IA 1XB8A 5LXGL 3POCA 4MB3A 2J56A 5TQ0H 4DERA 3E80A 1B9KA 3QIBB 2IH8A 4HUKB 5AB2A 1I3RB 2IMNA 4UQBA 1AXTH 1CXFA 4PVBA 5DVPA 3CFNA 4I18B 4KH2A 4WI2A 3N9GL 2F1BA 4CAGA 3PPSA 1HE7A 1MCFA 4LLUA 1CXEA 4I0CC 5C07A 4EI6A 2X42A 3BUBA 3WEXA 4U1NB 3SPJA 5CCGE 1FZJB 3QXUA 4IU3A 1UQSB 1IT9H 4A2EA 1EHNA 2WVVA 2BWQA 1RCYA 3VRJB 2BNQB 1EAQA 1DANU 2A74A 4FMKA 4LCUB 4Z3HA 2PPAA 1D6VL 5C3IA 1PJ9A 4FL4C 5D7KD 2PPCA 3LKSA 5EO1A 1LQSR 4HIIB 1DLHB 4CC4A 1EERB 3GRBA 3P3YA 4XAKE 4HMDA 3DX3A 5L2KD 4XAWH 3NFPB 2JH2A 4A6YL 1CDBA 2CKBL 1VEMA 3N85L 1KPRB 3FTWA 1IAMA 2AKRB 4QJ4B 1JF1B 5EIIG 2WMPB 1LHZA 4I0PD 4ALAL 3L8QA 2N0KA 3KLAA 5K59F 5FDWB 1KLFB 5K1NA 2WWMC 4S1SL 4MXWH 3BWUF 2VWEC 3OAUH 1NCAL 1NGWA 3MV9D 3VWKD 1OT4A 3AGWA 3WN5B 7FABL 2HLFC 1CCZA 5ETUA 4I18C 5HP5A 3BAIA 1JZDC 3GTVA 4LIQL 3CHQA 1MPAH 3K8MA 4XPTH 5SWSA 2OMWB 4NOBA 2YPVH 1WV7T 5L2KB 1WFIA 2XTJE 2XQYG 2XJKA 4LF3A 3KPMB 3BKCL 4ZK8A 3WY4A 3T08A 1Y6MR 3DJTA 3OD3A 3GIZH 4I0PB 4Q89A 1PKQE 4EZLA 4Y4HA 2C26A 4IIZA 3SKOB 3W82A 4FXKB 4K5MA 1IAKB 3N2JA 4LRNL 1OTTD 5HTSA 5GRZA 3UTQB 2YWYA 4HEMA 3QZWG 2YPKA 4U05A 4NAQA 4TPRL 5FWQA 1C08B 3V7MA 5ABZA 3VWKB 4Z7QB 3BIKB 3OAZH 1N6UA 5C09A 3CFJB 5TPWL 2Y2TA 3O6FB 1QZNA 2JKWA 4ZX6A 1E0OB 4PV1C 3DOIA 5JW4M 2VQ1A 2C9VA 1YPZA 4PJIE 4RX4A 3VD9A 3SZ6A 5HHME 3UTPD 1BMGA 4X6FA 1A7BA 1ZWIB 3WN5C 2F53E 1ZPLA 2HJKB 5H37H 3O4LD 1NA8A 1P7QB 5DHYB 4EEEA 3VVVA 1INQA 2ENJA 2WKOA 3SYAA 4GXUN 2R2CA 3P54A 5D7IF 2HFGH 1N2RB 5KW9H 2Q1EA 2AW2A 5FAAA 1HL5A 2VMFA 3SO5A 2X1OA 1FCGA 1CF8H 3MLRL 1CD1B 5KTEL 4I0PC 2JXMA 5EZJB 3OKEA 4MD5A 3QCUH 3IETA 4M9PA 3AT8A 4FXKC 5MEOB 3CX2A 3UOAB 3X13A 4IS6A 1CURA 5FOJA 5FGBC 4ZUUA 1YNTB 1BXUA 1OAUL 1ONQB 4UU9B 2JCCE 5DMYA 3INUH 5DUJA 1NGZB 2EE6A 3FZUD 4B0MB 3VWKC 3GSVA 1NCJA 3O4LB 1RHHA 2J1ZA 4Z9KB 4AYFA 2A9ML 1ETZA 5E9AA 1HWWA 2D0HA 1S7RB 1Q1JL 4NO2B 4ZMWA 1U8NA 5E8NA 1NDGB 4MSWB 5DUBA 3VRIB 4LL1A 4MMYB 5I8OL 5JQIB 4TVPE 1N68A 3KWWA 1AR1D 5DJ2A 4M6NL 3T8XA 1NCDH 3BJ91 5IB4A 5JIHA 1R3LA 2GJZA 2BNRD 3S8WA 3E6HA 1CFNA 1HXKA 4OJEH 4WUKH 2QQLL 1EVUA 2YXWA 4NPKA 3AW5A 4E41E 3FTGA 1KXHA 1JYVA 1D5MB 4N2OA 1OTTC 2IH1A 3L5XL 3HAEB 1LYQA 1MEXL 3W5NA 1A9BB 1ZT1A 1MZZA 2W0PA 3CZFB 5DJDA 2ED8A 2PP8A 3PWNA 4PSRA 5KN5A 3CHPA 1ILUA 4XN9A 1U93B 5DZPA 7TAAA 1CG9A 1NCBH 1X5MA 2WZPA 2X88A 5IW6B 1EH9A 1IAOB 5I74C 1BSIA 3MJ8B 3NJNA 4GAJH 1QA9B 3OKNA 3CFCL 3TCXA 3W39B 1AR1B 4FS0A 2P46B 5KSBE 2BNRB 2FL5B 4TMPA 4R9HA 1MAMH 3LPWA 3BFOA 3SDXE 1IC4L 3V0VA 5GS2D 3ZLQC 2YC1B 3O3DA 4I9XA 4OGXL 1PU0A 2ED7A 3KLDA 1ND0A 4RFOL 1GTFA 4NKDB 4DTGL 3CZGA 3ZYJA 3QQ3A 5EN2A 4NUMA 3HKFA 1VGEH 3IK2A 3MXWH 4M02A 2EVGA 1T1WA 2CZNA 2WW8A 5KVFH 5E2TL 5B1JC 4Z8FL 1U6AH 1D5XA 1MY5A 1J8HB 4DPRA 2IQAB 4N87A 3LVEA 3RX8A 3BMVA 2VDRL 3ZUNC 4F93B 4B9FA 5TJWK 3P0VH 3FZUC 3CFTA 4JFOA 2D8KA 2EVJA 5CP3H 4L4TE 5J1AA 1FG9C 1SFHA 4K5PA 4YQXH 4NZUH 1CTOA 4TYUA 1LK2A 3MBEA 4LHQB 1AR1C 3A4FA 1HKLH 3VXRE 1UT1A 2QHLA 4HHAA 3EOBA 1GY2A 3CFBB 4XPBH 1VSCA 1BVKA 3ZHNA 1RK1B 4JCLA 4U3SA 1FORH 1OM3L 3MCKA 1NL0H 3FKUS 4P59L 2QVMA 3TN0D 3NRQA 2CBOA 3MSPA 4M5YL 1GJUA 5EUOB 5I1JL 3K72B 2G4EA 2UVFA 2VO5A 2FWSA 3KM2A 4LMQI 1L5GB 1YEIH 4BK5C 2X53A 5D2NA 3RRQA 4PV9A 4J8RB 1S9VB 5ANMA 1MQ8A 5C0BD 4ANKA 5LJYH 4QJ3B 3GRGA 3TX4A 6PCYA 5KANI 1TTAA 2BP8A 3FFOA 1FV1A 2AXGA 5FYKH 4G6KL 5EOCJ 3QEQD 2ZJSH 3V4VH 5A2FA 4G7SB 2E7CA 1DR9A 3MA9H 1HWHB 2HRLA 1E4JA 4JG5A 4KXZI 3MV8E 3CDZB 4WFEE 4MJ6A 3WYRA 2E9JA 5I1LB 1CL7H 2FJGB 1NM9A 2Z8RA 3OKMB 3VUAA 1HEJC 4HPOH 5FYLL 3ABMB 1KCVH 2Y7LA 3EYUL 1HX0A 3TN0B 1X7QA 2HSIA 4Z95L 4IKIA 3R8BB 2ICWI 4PRHB 4B96A 1Y18B 3QS2A 2LFEA 2FR4A 3AC0A 1O7DC 4XC1H 4PJHE 4JO3H 3VD4A 2SEBB 2M26A 3GJFK 4M6ML 3MRRA 4FI7A 2WB1A 2DQTL 3T0BA 5IJKA 2GJJA 3MLYL 4NERA 1NMBL 5C0BB 4AVJA 4MQSB 5B1KA 1S9WA 1DQJB 1SLUA 2J2ZB 3TC9A 3K6SA 4BFRA 1TU2B 2HLAB 3B7RL 3QEQB 4B5EA 1MH5B 5A2AA 2DWYA 4HEPG 4PGBA 2FTAA 1Z9MA 5D1QD 1M7UA 1FE8H 5GJTH 3Q2WA 3ZRSA 2WQ8A 4L1TA 2YUVA 5EBGA 1D7FA 5DJZA 4BH8B 4UQ9A 4A7TA 4EAEA 4P5KA 1UM5L 1ZHNA 4D9LH 2BCKB 2WBWB 3K8KA 4JRXD 5LUMA 2YXMA 5DA4A 3PAVA 4JN2A 4TS6A 4U1GC 5BCAA 3GUTB 3BLBA 3KPSA 5BQ7B 2PTTA 3D1MC 2H5UA 1E5CA 1IFHH 1MLCA 3PQYE 1JZ2A 4UOQA 1WBZB 1UM6L 4F7EB 1QLEL 1NGXB 3TN0C 1J48A 4NQXB 1F4WH 4BJLA 4NQCA 4PJ5A 3HUJA 3SDCA 1YECL 3SY6A 3VFOB 1KTLB 3B1TA 1QSEB 1ZTMA 2A5UA 1GKOA 4CJ1A 1JPST 3A21A 2AQSA 4XZUB 3CPLB 4GMTH 1ZHKB 2UV3A 5FGSA 3TH3T 5FKAB 3RI5K 1CLCA 2FLBT 3RVTC 2DQFA 1D7CA 1LK3H 4FQLH 4JRXB 1Q94A 2EDYA 4NO0A 4ONHB 2ADFL 1SXCA 4EIGB 4PJDE 5C0JB 3SYQA 4YZWA 4IMLB 2P5ED 1KBPA 1L3WA 3ROLB 2DDQH 1CGVA 1JN6B 1SZNA 4DGUA 1YN7B 5ICYB 1L9PA 2DQMA 1RULH 2AJSH 2Y7QA 1LTXA 3EJTA 4A55A 3TEXA 1A1OB 5DWUH 4JFHD 1OP3H 3WKYA 1S7XA 5BOJA 2KKQA 3OKDB 2K1MA 3FAWA 1NKOA 1WBYB 4OF6A 4PJ6A 1WVZA 1U8PB 3G5ZA 3BW9B 5IQNA 1J0KA 2B15A 1J88A 4OZ4B 5E2WL 3MLSH 4RMSA 2Y69B 1MCOL 3NFSH 3QE5A 4WUUE 2EKSB 2IDQA 1QO3A 3TYGL 4WSGA 3SE9H 2IH3A 2PABA 4OJDH 3MOAL 4GIOA 1TG8A 3ZK0A 2ODHA 5D1QC 5DURD 3EH2A 2P5EB 2A2QT 2RIKA 1FI8C 2FDBP 3F85A 1SDDB 4N1CA 4JHWH 2GIXA 4AVKA 4G83A 3ZDZE 1PD6A 4N2EA 1O6SA 2ZSWB 5T8IA 3P73A 1T1ZB 1UZ6E 3EBHA 4KJWD 4HBQA 4UM8B 2ICWB 1FLRH 1TZIB 2O6EA 2YARA 3G6AB 1F4XL 2XKSA 4AI7A 1LWJA 1E6OL 4N2FA 4N1HB 3AG4B 3SD5A 1BXXA 3DBSA 2GK0B 3QJQB 2I60H 3VI3F 4MS8D 2VDNB 4OCWH 5HYQB 1MXDA 4ZTEA 1SJEA 2FT7A 1BZ9A 2E9WA 2ITDB 3OLDA 5EZIL 3AROA 4AV5A 1TF4A 5DURB 4AUUA 4MCNA 2Z7YA 2JCWA 3WNJA 1FAKT 3IJEA 4K7PL 4YDZA 1THCA 3KWVA 3CDGA 2X4NB 1IJ9A 2DEWX 4P4KD 3RUGA 2GSMB 3EJYD 4ZG1A 1A6UH 1XGPB 1PY4A 3GFUA 4RMVA 1I7ZA 4LL4A 1ZGLB 2PO6D 1V54B 2XXCB 1O9WA 1BM7A 3FMGL 3GSNA 4HK0A 4XMKH 2BNUB 2H7WA 3S35X 3UEQA 3DO3A 1XIWA 4ABWA 4IBWA 2UXTA 4PMEA 2CUIA 2AJYL 3LN4A 5CEYA 3FB7B 3MREA 3MCYA 3F6IA 2CU9A 4YPJA 4DFHA 3GD1C 3IPEA 1IBYA 4G6FD 4NN6B 1CGUA 1V05A 1CFBA 3BUIA 1KT2A 1UXWA 3B3IA 4GFTB 3QUYB 2OP4L 4P4KB 5F6HI 1AI1L 2QV2A 4P2AA 1LO5A 3VXSE 3MU3A 1B2WL 1ZLWH 1ZDQA 2VN6A 4KI5C 3S88L 2PO6B 2WQRA 2BW4A 2WGNB 1MCNA 4IBVA 1PDKB 2VAAB 4JLRB 1PSKH 1O7SA 3WNMA 3PP4L 4R4BB 1UWEH 3SYPA 4Z7NF 1QHOA 3H9SA 4KJWC 4DUXA 4F7TA 4MNHB 4FNLH 2UY7A 3PHSA 1E3ZA 4H0IA 4W81A 5CP7A 2P80D 5AAMA 3UYPB 2K6WA 4NZTL 4B9PA 3W0WA 3FTZA 3UAFA 1LEKA 3T2PA 3VSQA 3WV0A 5K9JH 2DQJH 1DQMH 4J3OC 1QHQA 5I28A 1IIKA 4G6FB 3H8NA 4L29B 5GIRA 4X4YB 3DX9A 1MHEA 4MS8C 3MOBH 3QDJB 4DESA 3LQZA 1PZBA 2XWJB 4ZFFA 4MNQE 4ZXBB 3N6YA 3RWDA 1HNFA 1MFCL 5D2LA 3GHEL 5ERWB 4NIYE 1LWHA 1H8OA 2VDLH 3FB5A 4NN6C 4PEEA 2J1WA 3PDDA 1JAEA 1ZS8B 3C09C 3CDYA 3GMPB 5FW8A 4DOHB 1F6AA 1OALA 3DRQB 5C6PB 2O5XL 3NGBB 3TZVA 5KYXB 2PXYB 2HG0A 3EJYC 2EABA 4LCWD 1K3ZA 1YEFL 1RZ8A 5IVXA 2PO6C 5FCUH 2BVPA 2ZSVB 3WSQH 1OP9A 5TK4A 3APCA 4Y7MA 2XV6B 5JLZB 5EEXA 1CI3M 2VDQL 3U7WL 4W68A 3V5HA 4OUOA 4AKOA 5F1IA 4OM0L 2ALWA 4OF0A 4JFXA 5IOPA 3FO2B 2Z93A 2W9LA 1TVHA 3ABZA 1S78D 3VGHA 4IU2A 1KPVB 4UUJB 4UNIA 4LVOB 2Y6SC 2E59A 1UCTA 4NN7B 1Q9LA 1TYJA 5JIIA 2AQQA 2RCSL 5KAQF 2FEJA 4LCWB 2FNWA 4AQOA 3ZVVA 1F41A 1RUPL 4LDOB 4AE0A 1SXNA 1IBDA 3D0VA 5EZPA 4TSCH 1A6PA 4XRCA 5F8QC 5FKPB 2F08A 2KMWA 1NAML 3BAJA 1UD4A 4FLOA 5C0GB 1V3JA 4RA3A 1KTCA 1CDYA 3ASNB 4JFTA 1EGJA 1P2CA 4XWOD 1G7JB 1T5XB 3I9PA 1UCBH 2G9HB 5DR5L 4M48L 4IBYA 1H3WM 1AMXA 1RUQH 4L1SA 5H4ZA 2DQCH 3AMLA 4LPTA 4FA8A 1E9QA 1CD0A 4LB8A 1P7HL 2X10A 1ADQH 2GBTA 3N43B 2OL3A 2FATL 1XD0A 3KLSA 4JDTL 2CHDA 5B38A 4MQTB 3DJRA 4LVOC 2VXTH 4NN7C 2IOOA 4LAQL 3FB8A 1F00I 3U4EA 2F2HA 4JRFA 4GBXD 1J8SA 1N5YH 4FNUA 1PL3A 1REIA 2VDKH 4FP8H 4PI0A 5D6CB 4M3HA 1Z3RA 4JB9L 3RWCB 4AK2A 5J0BA 3IF1A 4XX5A 5GZOA 4ANUA 3BAEL 4AXWA 1T89A 3ZE0F 1ROCA 4XMLL 2OTPA 2VISA 3GGWA 1UWFA 4I18A 5TQ2L 1XXFC 1AZRA 3BVUA 2XTSA 1Q38A 2WQXA 2D4FA 4E5XB 4WGWB 1JGLH 1CZ8L 1KGCD 4LCCB 3VRLE 2W88A 3GS7A 3DIVA 5I1IL 3ECBA 4ZDHA 3EOAB 3VFMB 2BNQA 1RZ7H 4JDVB 5TGBB 2W1NA 4KAQL 4BSWB 4NWUL 1JBJA 2YGVA 1NEZA 3DLQR 4GBXB 4HIIA 5DJYB 4OCNC 4GSDH 5IB1A 5TDPB 3SEPA 3CLEL 1LP9F 4QXTA 2XWBA 3T3PE 5BVJB 4R7VA 5MERB 4YDIL 1KPRA 3CUPB 4JG9A 5FHAL 3NDYE 4PJCF 2WMPA 3WE1A 1EPFA 4HXAH 1N7MH 4PP2B 5SWSE 2WXJA 5FDWA 4GSRA 1Z3GH 2HVJB 3WKML 5CM1A 4XWOC 1GH7A 2OMYA 3N42F 2GY7B 4U1SB 3JWOH 4KVCH 2N7SA 3I2CH 3CIAA 5DJ0A 4DP0X 2H3XC 3S36L 3ZKXB 3BQVA 1KN4H 3P4NB 4IIQC 1A6TB 2ZXEB 4IJTA 2X6UA 4PJEF 3VGEA 3R7RA 1BWMA 3Q8AA 3RU8H 4LCCC 1J5IA 1WLHA 2Y7MA 2CA3A 5KJ4A 1JFQL 5C09E 3UAJD 1WWBX 2NW3B 4XCFH 1FH5L 4X8XA 1T4WA 3MTXA 2J7LA 1DQTA 4I0PA 4QHLB 4GBXC 5AYTA 1CU4H 1GGYA 1YPZE 3KS0J 2B16A 1T21A 4FXKA 4N90D 3ES6A 4Z0BL 4JKWA 1VFUA 1OP5K 1QNIA 3DX8B 2Z3FA 3MV9A 5T1KD 4KKNA 3VWKA 1N67A 4QWWD 3O6MH 4QRSB 1HK6A 5HDWA 3ET9F 1A64A 1N8ZB 4QCIB 3VNYA 3CFIC 2VABA 4A2LA 2H4EA 3FHQA 3NCJH 4PWHA 1KCRH 3QG6B 5IVZB 4BZ2A 1TJIH 4KQ4H 3ZGHA 3L2NA 2HJKA 2XX0A 4LSPL 5KS9F 5KVEE 1MIMH 3AITA 1CVSC 2DYRB 5I17A 1SNRA 3C8KA 5E9DD 5T5FA 3VFSB 2YBRA 3HCVB 3VNZA 4JVWA 4PS7A 2WXNA 3LHAA 2E8ZA 3VXOA 4NCC1 4AOFA 2Q0ZX 1P1VA 2VW7A 2XG4A 2A0LD 3K2MC 5I1HL 5E1IA 1HVXA 3EFFB 3UTZA 1NCOA 1CD1A 1DDHB 3FL7A 4JKPL 5T1KB 1XSKA 5EZJA 1DQLL 1B6DA 4DN4H 1UZ8B 4NHCL 1B0IA 4X8CA 2BIIA 3DI2B 4UIKH 5DHDA 1F3DH 4XH2A 5EBWB 4UU9A 3IDGB 2XZZA 4G3YL 4NHUA 1KCUH 4XOCA 3KVPA 5FW6A 4J2XA 1IUZA 4NC0B 4KTGA 5E9DB 1D5BB 2WBKA 2QLYA 1C5CH 4MSWA 3VRIA 1OSPH 1E30A 3ARZA 1ZLSH 4YUEH 2Y36L 4XO5A 3WTXA 3UAJC 2D03H 2Y6TE 2R0ZH 3IFPB 4ZD3L 4YX2L 4MCMA 4F57H 1AS8A 2QGBA 5I82A 5CCHE 2NY7H 2FX9H 2FX7L 1R3JA 5B1JA 1D5MA 4PGJA 4AY0A 5IMMA 4POYA 4RDQG 3V52L 1BW8A 3HAEA 3NK3A 1XR9A 1JDCA 1F8TH 3CZFA 4ZSOA 4HPYH 1X5LA 3JWDH 3NQIA 4RGOH 5LCVL 3VI3B 4ZO9A 4QWWC 3WIIL 2KDYA 4GQ9L 3LN5B 4GUPB 4X6DB 4S1QH 5IW6A 3KL0A 1M1XA 4JEGB 1A4KA 1QFWM 4AMKL 1JXDA 1YY9D 1PKOA 3OZ9L 1QA9A 3Q0HA 1SUJA 3AFLA 3BIAX 3ULVF 3P9LA 1MCWM 1ZK5A 1FF5A 3OHXB 4OCSL 4OU3A 4HA1A 2FL5A 4GOSA 3N40F 3ZR6A 4ADGA 4F58L 1L7IH 4PRAB 2ADIB 4GP4B 3F01A 4NQUA 3ZGIA 4U6TA 4HKBA 2ZD0A 1IARB 3FQUB 1LWRA 1DTUA 3R0MA 1F90H 3FPXA 1GGBL 2YD9A 3O6KH 3CVHB 4NKDA 5IQ7L 5DMKA 2A0LC 1XHHA 4ODXA 1JRHI 5EV7A 1NBYB 2W9DH 4BXVA 5AW8B 4BK5A 2YHGA 4X7CC 1QNZH 1T2QH 4GKZA 3CXDL 1GOGA 3O6LH 5D4HA 2IQAA 2HJFB 3REVB 3VG0L 3S98A 2B4CH 2OYPA 4Z7WF 4F15B 3CFEA 4A7UA 2HJLB 3VE0A 2YKLH 2IBZX 5FA3A 2ZUUA 3VACA 4WI9A 5DS8B 1F3RB 3JTTB 1I85C 2QKSA 1O9VA 2RR3A 1A2YB 3TYFB 1HNYA 3HC3L 4IKKA 3BVWA 4RWYH 1G7LA 4YFDB 4NLAA 1JNHB 2JB6B 3CFBA 1BQHA 1U95B 2O5NA 3MRQB 5ANME 4JM4H 5DFAA 3RWHB 3DOSA 2CSPA 4HDIA 3ZDXE 3IFNL 1RK1A 2A9CA 3I6GB 3KCWA 4JFWA 2LOEA 3Q43A 3WHE1 1M57B 5B39G 5KOVC 5K93A 5EUOA 1MJ7H 2ZICA 2XPGB 4PCSA 1L5GA 1VCBC 2WXGA 5F0MB 3DMMC 1G0DA 2VXSH 1HI6A 1OV8A 3BKML 1YY9C 1UA6L 3B9VA 1IAII 2JELL 2APXA 2B20A 2DWDB 5EBMB 3F7QA 1UH4A 2YQ2A 4KRPD 2WN2A 1G7IA 2WYTA 3LNIA 3MXVH 2QSCL 3X1BA 3VJ6B 5KSVA 3QP3A 2YMTA 3CXHK 1TEFA 3OKMA 5GGSB 1Z9SB 1MHHA 1MQKL 4IGBD 3VGGA 2BHZA 4JPWL 2VSKB 1J1XL 3UPRA 5I1EL 1UEYA 2YQ3A 1NM4A 3F04A 1JWSB 4DVRL 1FDLL 2SEBA 3LV3B 2BP5M 4Q14A 4LLDB 3H42L 5F7AA 3EFDH 3SB3A 2B59B 4ELMB 5C0BA 3KPQB 4QRTA 2B8OT 4YXKH 4TNVK 3TJPA 1FZOB 1GYVA 3GMOB 5FO9B 2J2ZA 4TF4A 5T5NF 1BLNB 2F5AH 3KPSE 3I3BA 2Y5QA 4KRPB 2E8YA 3W9EA 1MH5A 1PFCA 2DJUA 1FC2D 1DQKA 2HX9A 2V9UA 4FZ8H 2ATKA 4TLSA 1W72L 3MJ9L 3MODL 3IJSA 3MUGA 4HS6B 4XR8C 3LIZA 5F3HB 4NQCE 4P9HL 4PJ5E 4FQXA 4IGBB 1UACH 3HUJE 1DSFH 4NO3B 4Z5RA 1NEUA 4DN3H 5DT1H 4BUGA 5BS0E 1HYSD 1MJJA 4GAGL 3GUTA 1OAZL 5BQ7A 1A65A 4MD4A 2HKHH 1KY7A 2YMXH 4TVPL 1QI3A 4F7EA 3F65A 4CRPA 3DHUA 1NGXA 6CGTA 1S5HB 3LPPA 4NQXA 3AGVA 2GUOA 4PIRF 2LGNA 1CLZH 2VLJA 2Y7SA 3CCHB 4N3UA 4Q58C 5I1GH 1KTLA 1CDGA 2OK0L 1RU9L 1ZXKA 2DJ4A 2EIDA 2NSXA 5D1QA 1I9RH 4XZUA 3CPLA 1TETL 3G6JF 3BZ5A 3HBGA 4XGZB 1ZV5A 1IMHC 1ZD6A 4KRPC 2V9QA 3QS3A 1PZ5A 4KK5D 5AG9A 3RHWF 5C0JA 4UM9D 4KHXH 3SGJC 4BXSV 4G8GA 1JN6A 4PS8A 4G8FB 5FO7B 3HG1D 4IGBC 3SCMD 5ICYA 4KZ0A 4DQOH 2ZKWA 4GO8A 3ULUF 4MKMA 3OKDA 1T0MA 1WBYA 1SFDA 2NW2B 1DBBL 4YHOL 4JGUA 4TULL 3WEMA 1HHGB 3CVIH 2HG5A 1DQQB 4QRUA 4K5OA 1RSFA 4CMMB 2XN9E 5HVHB 1SOKA 1PLGH 2ZG3A 4NUQA 1MW2A 1WO2A 4AL8C 1X5XA 2AZUA 1L6XA 4ZOAA 4HKXA 3MRJB 5FXCH 5KBNC 1BM3L 4JHVA 5GGSY 5IF0B 3O3BA 4QKXB 2P5EA 5T3XH 3V55A 1SVCP 2QPEB 1SDDA 1ZLVK 3EJUA 3W3BA 3FQ4A 4I89A 3HG1B 2GTWB 2FJFB 3SCMB 5EA0L 4MX7A 1X5ZA 1DVYA 3AS1A 1HYSC 4UM8A 1QR4A 1E2WA 2F68X 3PLYA 5BQDA 1A3LL 1TZIA 5EC1A 3G6AA 2CLRB 1OCZB 1G43A 2W0FB 4RIRA 4X9IA 1VZIA 3WKQA 3RUGE 4L2LA 1N0XH 3NA9L 4KO7A 2NT1A 3FCSA 3QO1B 3P0GB 4PRNB 3UTTE 1FYTD 3NP3A 5EG6C 4L3CA 4PLKC 4PG2C 2VGLM 3T3MF 4JDZA 4YWGL 5HVHC 4N22A 4DP8X 5FOBB 4X6EA 5BZZA 2NX5D 3BWAA 3H7LA 5DUML 1A66A 2X4NA 4ZTOH 3G9VA 2GBVA 3EJPA 1JNLL 2OMVA 5DZAA 4KK5C 3RIFF 5IBUB 2J1KA 4AEEA 2AVGA 2OBGA 4J23A 1ZGLA 1QRNE 1TCMA 2P5PA 3CVCA 3RWJB 1VPOH 2BNUA 3SCMC 4RAUB 3LDBC 1A4CA 3ZIYA 2J1XA 4YH6A 3FB7A 2DLFH 4FTDA 2WCGA 4FNSA 2RFXB 4Y89A 1FYTB 2FCBA 3AXHA 2F7IA 3KW7A 3O2VL 4JAMB 1JK8B 3MMEB 4Z78A 5CCKH 3PXLA 1SEQH 3MQIA 4FLSA 1GC1C 2IIJA 4WEEA 3LEXB 4LVHB 5FHBH 2NX5B 5KS9B 3H9SE 2W0LA 3BQUD 2EC9T 1YDPA 1Q8MA 1BJ8A 1XGYL 3LNFA 4NWTH 1CICD 2WVTA 1MWAA 1SYSA 4LHJB 1JOIA 1O7VA 2VAAA 3FPYA 1NGYB 5L4MA 3GM8A 4J3TA 4LLMB 3MJ7B 3KYKH 4I3SL 5I71B 3ZN6A 4PJBB 4J6IA 4HJUA 3FW6A 3FT4A 3LY6A 3OF6A 3ZW3A 1BQRA 4MNHA 5E8DL 4HQQL 3BUTA 2NMSA 5AWNL 5D2LE 3PV6A 4U1IB 1RQ5A 5GGTH 1K2DA 4A6YB 2CKBB 3LHPL 2BY2A 4KZEL 4Y5YA 2VL5A 3RBGA 5DVLA 1TJHL 4HUXB 3IFOB 2HX7A 3H4HA 2BSBA 3I3DA 3BQUB 1A4JB 2L7JA 1B6UA 4BFIA 2VKWA 3FFDB 3CFQA 3I6KB 3BH9A 1CICB 2NZIA 4G70B 4HUMB 5C0EA 4H1LH 3WIFA 1IGJA 5BZXA 3SE4C 4GI9A 5J7CC 5EOCH 3RY5A 43C9A 5F7BA 2IADA 4G9FA 4LVHC 1N4XH 1II4E 2R1XA 3GMPA 5BUAA 3F58L 4XO8A 4XPFL 1OCWL 3VG9B 5AUMB 3HZMA 4ZX3A 1T5WA 2P80A 4XVTH 1LNUB 1IBFA 3K6NA 3OAWA 6FABL 1XSOA 4RMRA 2CXGA 3RGBA 5DC9B 1KYFA 5KVMC 2AEQL 2V5MA 5JLZA 3NSFA 3VD0A 1TTFA 4NZDA 1T83A 1AIFB 5GRWA 4GRWH 1H0DB 1RJZA 2AK4D 1B4TA 2C7FA 5JR1H 5D71H 2DLIA 3FO2A 1XZWA 4G71B 2OXHB 1FL6A 4BK4A 3O11B 3POHA 4GMSH 3V0HA 4C57C 4IK6A 1RZFH 3L4UA 4ZOEA 2IPUG 3MC0A 3K8LA 3D50A 4UUJA 1LO0L 5L2JB 2BOCA 5D93B 4ALAC 1PNCA 5I8CB 2D3JA 5CZKA 5BVPL 3TIEA 1MAJA 3TNMB 3WIHA 3WUZA 2CMRL 3BQUC 4JRYD 4UAHA 2EVIA 3IMSA 4GRLC 3U2IA 4UV4H 3E8UL 4LCWA 3TWYA 1RIHH 1CICC 3CXHJ 4PGEB 3GHPA 3ESOA 4GP5B 1FFQA 1X6LA 4M62L 5IEKA 2JK5A 4HWNA 1KTJA 1I8AA 3KMDA 1FPTH 5C0GA 4OT1H 4UBDD 3PAZA 2AK4B 1KGXA 1D5ZB 1URZA 1KIQA 1G7JA 1T5XA 2VR3A 4JPKH 3LPOA 4EVNA 3MRMA 3OPUA 1PZCA 2G9HA 4JE0A 1CE1H 4Z7WB 2DQHH 1OGAE 4OZFB 3QZNA 3OL2A 2VXUH 2ZPKH 1VDGA 2I7SA 4N0RA 4JY5H 3S4SB 1FZMB 4YE4L 4MDJB 1INEL 2DB8A 2GKIA 1DZBA 1SPDA 4M43L 3FUKA 5I75C 2AI0L 4OZGF 2JLPA 1TQTA 5LQBH 1MCRA 2HTKD 1M05A 4JPVH 4JO2H 5D93C 1WWAX 4UT6A 3HZVA 3ELAT 2B1HL 3GBNL 3SDDD 5I0YA 1DBAH 5LAXB 5H35B 4D9RD 4XXDB 4JN1H 5ACMA 4FADA 4LNVA 2GI7A 2F54E 5BXFA 1YSOA 4GW1B 5D6CA 5F9DC 2X5PA 1CK0H 4EN2A 5INDA 4U6YA 2OZ4A 4ZUTA 3ARGD 1V8HA 3UERA 4U6VH 2PNDA 4DKDC 4X7TB 4JR9L 4IIQA 2IPTH 2FB4L 5HSFA 4QAMB 1HCVA 3WG7B 4E5XA 5CEZD 3DX6B 2I9LB 4N8UA 1HL4A 1P1ZA 2GC4C 5K9OB 2VXQL 3GJEB 3BOVA 3EOAA 3MLWH 2AJUH 4XN4A 3IU3B 3VFPB 4NP4H 5TGBA 5HDRA 1GGCH 2IQ9L 5HDOA 4YSCA 3R1GL 2Y22A 1EEUA 1JZJA 3SDDB 4C4KO 4TVSa 2D7MA 4HOWA 3JWNG 1T7YA 3R0NA 5DJYA 2CNZA 2HCZX 1BZ7B 3AJ7A 5DRZA 4J1UB 4JO5A 1ZA6A 3SOBL 1JF5A 2AJZA 5MENA 2A7BA 2EH7L 4AENB 3ARGB 4K8RL 4QUOA 5HHXL 1A9EA 3UC0H 4UBDC 1MIEL 1FO0H 2V2TB 4PP2A 1NCWL 3QHFL 3P4OA 1ETA1 1A3RH 1UJ3B 2HVJA 4FHKA 3D4YA 4H5SB 2A6KA 4LBEB 4L0PB 3ARSA 4X5XA 1BQ5A 4MA7H 4OGAD 4WTWA 3RWIB 3WENA 1IKOP 2Q87A 2JKJA 4PJFB 1QLFA 3LXBA 1TQCB 2X2YA 2NXYD 3N41B 2HT3D 4POZC 1VHPA 4JPQA 4JJHA 4HP5A 2VDRB 5LLIC 2D73A 4RAVA 4J6RH 1S7QB 3ZYZA 3T2QA 4LU5L 1DN0B 1SJMA 3MV9E 2HTKC 4JREB 2UZIL 2HZHA 5C92A 4ZW7A 2XY2A 1JHLH 4I13B 3KPRD 4XNXL 1PS3A 3SDDC 3TT1L 2A4CA 4QHLA 2YRLA 4Y4FD 2WBJD 3RGVB 2FAUA 3ZTJG 2XKUA 1C7TA 3HPJB 4NRYB 3ZTDC 5B7FA 3QUKB 2IF7A 1NJ9B 3H2WA 3OR6B 4P2CG 3DX8A 3ARGC 5E2UL 3BFWA 5EU6E 1VADA 4HS3B 1U3YA 1U8OB 1CT8B 1D5RA 3O41B 4PJGB 1N8ZA 4QCIA 5FYLD 2NXYB 2M1KA 4A2FA 1UJ3C 1UD5A 8PAZA 1KYUA 2MOQA 3UTSE 1XEUA 1I9JL 3QG6A 5IVZA 1UYWL 2XQBH 5EEUA 3DIDA 3G6JB 3UAJA 2ZUVA 3BPCA 1EJOH 4Y19D 3SGEH 3NZHH 3KPRB 1TQCC 2ADJA 3QQXA 3VFSA 35C8H 2Q7YA 2WBJB 3B2VL 4GQZA 1Y1DA 1WWCA 3PHQB 4QF1B 2EADA 7PCYA 1EHLH 5GS0L 5CUSH 1FHGA 3AADB 3RX5A 1ET7A 4JREC 4I7ZC 2IDFA 2H9GA 3VYOA 1I31A 3ZKQD 4KKLD 3CVBA 4IK7A 1DDHA 2A73B 1H6EA 3LNEA 1MDAA 4LSVH 4TL5A 1UZ8A 2VOTA 5CMAB 4HUWA 1AZVA 5IW3A 4OGQC 3K2IA 4YC2C 5IW1B 5JORB 3D3VA 3JWNH 3H9HA 1JD7A 1EFXD 4OGAC 2OCCB 5M95B 1XGUB 2VLRD 1E4XH 2CGZA 1P5VA 4R4FH 2L7QA 1ODAA 3JXAA 3K5RA 2X70B 5E9DA 1Q9OB 2NXYC 1HE8A 2HT3C 1QLRB 3K4AA 5C9JB 3VFUB 1TQSA 4ZSOE 1YMME 1C8QA 2ROXA 2YD2A 4WW2B 3B7UX 1HT6A 4R90L 3W37A 2UZYB 3IFPA 2OQJA 2ARJB 2BY1A 3QQDA 3GS4A 1JFHA 1DN2A 4Y4FC 3WTTA 2WBJC 5C8JB 1ZIAA 3EOTH 4NC2B 1SY6H 2HRHA 2OSLB 1MELA 4JFFD 1G7MA 1E4KC 3VH8G 4KK8C 1UXMA 2DBLH 3U4BH 1EFXB 1PEWA 4C59B 3HI6H 4F58H 5IHBA 2VC2H 4DGIL 4XNMA 5FCSH 2VLRB 2V3DA 2DV6A 3PL6A 1I85A 1Z5LB 4K5NA 3NIGF 3VU1A 4K3EL 2IWFA 4J3WA 2APSA 4KROB 4PLJD 1BBDH 3O3EA 3EJSA 1NWOA 2CRZA 1HJBC 3DWTA 4PJ7F 1FVCB 2B0SL 2EJ1A 2NUPB 4PRAA 3ZY7A 3UACA 2DLGA 2FECL 1XGTB 1SDAB 1PG7X 5E6ZA 2YD0A 15C8L 4HU8A 2GYSA 4KO9A 3I84A 4WW2C 1T7XA 4JFFB 5F97E 4QOKA 4PB0H 5AOJA 4I88A 4KKLC 3IMTA 4XNQA 4K94L 3DMMA 1X5GA 2KZKA 4OQ1A 5DDHB 2HJFA 1QSFD 2Z8SA 1BHGA 4X5WB 4HYTB 5IT2L 3TWCH 2BY0A 2EEXA 2WZAA 4G72B 5LBSA 2J71A 3DX7A 3U83A 1VENA 3X17A 1YEKL 4EDXA 2GTZB 4JG1L 4U7KA 4DJMA 3BKYL 2PETA 4CL7A 2ZG1A 3HG5A 5EU3A 4R7XA 1XB3A 5IJDC 3GXPA 2Y07L 4J3BA 5GRJL 2WUBH 3G3LA 2JB6A 3RNKA 1XCQB 1U95A 4N86A 3UPAA 3AU1B 3MRQA 3RWHA 1MRDL 5CEXA 5E24E 4FQ1H 3ZOAA 2NY6B 1KEML 3FUMA 4BKSC 1KXVC 4X9GA 3HHSA 4DHLA 4M8VA 5HHNB 4W4OC 1A25A 2XPGA 1I8LC 1KC5L 2NY3B 2APBA 2YAFA 4XVJH 4O2FB 2YZ8A 1MUJB 1UWGH 4G42B 1UOKA 2KPWA 3HNSH 3GNML 4GQRA 1L7TH 3VMNA 3B1UA 2AEPL 3DO7A 2K6ZA 2DWDA 5EBMA 4D0CB 5IFHL 5LNGA 3BE1L 2YPLE 4NZRL 4WV1B 2EDJA 3SE8H 2V2XA 3QWOB 5IJBC 4APQA 3G9AB 5CKAA 2VT0A 3BO8A 4M1GH 4RRPA 4GUOA 4ANVA 3ESNA 3IB4A 4WI8A 1AC0A 1Z9SA 3U46B 3PG2A 3K3QA 4BQ6A 3MUZ1 2GEEA 4Y2OB 4FLQA 5KVEL 4KO5A 4OF3A 2CGRH 3QDGD 5FECA 4D3CL 5A6IA 2R23B 1JWSA 3LV3A 3KNBA 4FZEH 4GYBA 1HHHB 4LEOA 4ZFZB 4V11A 4LLDA 3ATDA 1G4RA 2P5WA 2V5TA 2BJML 4YAQB 1YN6A 3IJHB 5I5JA 1CGTA 2B59A 2DQIH 3MKKA 3KPQA 4QLRA 4NXKA 2KHAA 4OLYH 5EU7E 4JFQA 1IKNA 4YLQT 1EHKB 1SOSA 2G75A 4ETYA 5I8EA 1NLBH 4FQ2L 3GBEA 1DBJH 4NQQA 4RGMC 4HS6A 2O61B 2ZX7A 3RKDC 3K0YA 2ZUSA 3B6SB 3MYJA 4YVNA 1CXKA 5DS1A 1HH6A 2AQNA 2E5EA 4OCRH 2VLJE 5EIIB 2J6WA 1JZ3A 4WV1C 3LS4L 1H6FA 5ICZB 3QDGB 5AVYB 1I7TB 4X5PA 1RZJL 4ZFOA 3KS0H 5B38G 4QYOB 5D1QE 4A2HA 2C9UA 1ZVSB 1FGNH 1ZCRA 3RDTD 3A67H 3I50H 2VZVA 1AQMA 2YGQA 4Z7UF 5FYJL 3UYRL 4E42B 2F1EA 1NBZA 3UPCA 3FO0L 1QKZH 1S5HA 1T20B 3FUHA 3FH8A 5J13B 3SY0B 4PRID 3GXDA 2W9EL 3G5VB 4JM0A 5HD8D 1INDL 3CCHA 3MRHA 3MRKA 4G8GE 4PLOB 4XAWL 5FB8B 3CE1A 5IESL 2B3RA 4A37A 1NFDF 1T04B 4X99A 3U25A 3G04A 4NDMA 3IKCA 4NBYB 3UGEA 2AQ2A 3PE9A 1NBQA 4Y9CA 3BZDA 4ZMNA 1NLDH 4NKQB 4W9KC 4X5LA 1BVNP 1MFDL 4PQXA 3T65B 5ID1B 2EH8L 3PUCA 4R8WL 4LMQE 3WO3B 5ADOH 1DEEA 3K2UH 1QFWL 3T2NL 4MQ7B 1K4DA 2ALAA 5HGAA 5DJCB 3RDTB 4M7KH 4F2ME 3RZCD 3QZWB 5TTRA 4WHDA 4AJVA 2X3BA 5ADPH 4Q9QH 2WZ6A 4B97A 2V3FA 2BFGA 3LH2H 1NEZG 4UTAA 2P28B 5DQJA 3NG5A 1J9TA 3P11H 4PRIB 4XP4H 1WFJA 2NW2A 3KM1A 2YEVB 4N0UB 5CBAA 3DUUB 3KYMA 1HINH 1HHGA 4FYSA 2F18A 4HFUL 1DQQA 4PG2A 3U6XS 3IDIB 2VDQB 4HZAA 4KRLB 3WFDL 4KNQA 1GGIL 2WC7A 5ILTH 2QQNL 3Q6FB 2E6JA 4Z7IA 5J13C 2IALA 2ZAIA 2ZX9A 1MCBA 3IGAB 3FQWB 1SOXA 4U3HA 1SLVA 1VJSA 3EHBD 3MRJA 2ZWYA 5DJ6B 4OJAA 4LARL 4XN2A 4PTTA 5HDQH 4UM9A 2ZNXA 5IF0A 5K1JA 4ILDA 4K7PY 5D70H 4N5ED 3HOGA 3HMXH 4H8HA 3RZCB 3H54A 3UP6A 1TQBC 4AC2A 1KN2H 2FSDA 4HC1A 4KI5E 2DOCA 2JCCF 3RB5A 1JPSH 4KVNL 5DRNA 3RDTC 1EGJH 2CLRA 5CO1A 2OA9A 3QJOA 3GSUB 3PXJA 5B1AB 3RNQB 3V10A 1FJ1A 2D7TL 2WJ5A 4XWGL 2D7OA 5C08D 4IKNA 1G7HB 5HD8C 5IK3B 3U1SL 3EHBB 4PRNA 3L1OH 4HWBA 5CJOH 2EE9A 5TDNB 4R26L 4GUQA 1IQDA 3MACL 1PNDA 2FSEA 4KVPA 2OL3H 3GI9H 4DO6A 5FA4A 4QYAA 2R56L 1BD2D 1CF8L 2A9NH 3HC0A 4EUPA 2EUZA 3GMMA 3BSHA 2DMBA 2ZAHA 4KHTL 4JJOA 1IM3D 4O2CB 4QHUB 3AAZB 2O26U 4GSUA 5HY9A 1JYNA 4NFCA 3L3KB 2JB5H 4L8CA 1KCWA 2GITA 5D7JC 2NY0D 2NOYA 3KDMA 3RZCC 2GBUA 3QJVB 4L4VD 3NPZB 1YAZA 4RAUA 4DFIA 3RBSA 1XGQB 4K3GA 3ZO9A 1U8LB 3CHSA 4QDGA 4RVBA 4P46D 2YEZA 5C08B 3MV7D 1Z66A 4OQTH 2HPTA 2RFXA 1UHVA 3QJFB 1FYTA 5IHUL 1KBVA 2HYMA 4JAMA 2K7PA 1JK8A 3GYRA 3II1A 3SE4A 4U6HA 4JFUA 1BD2B 2XU9A 4X0NA 4X9FA 3ZHFA 2NX5A 2V7NA 1CD8A 4BA0A 5HYEA 1IM3B 3EHBC 1GY1A 4P3CL 4AC4A 4MBRA 2WVSA 3FB6A 2V3EA 4HIEB 1OGTB 4XPHL 1CFTB 2Q8BL 5HGBA 1A02N 2VKXA 4PJ8D 5KG9A 2NY0B 4N5EC 3QH3A 1I3GH 3DARA 4MAUL 2UX6A 4WNSA 4DZ8A 4L4VB 4CU7A 4LLMA 3MJ7A 2EXTA 3L3IA 4PJBA 4C56E 2IH9A 1E6JH 4P46B 3ETTA 3MV7B 4MCZB 2NY1D 4P5TA 4YHZL 4QHKI 2WB7A 4G9FE 5EWIH 3QORB 4G8IA 1KSRA 3BHBB 1I9IH 5JOPE 2ENPA 2YWZA 5F71A 1KBGL 4OGYL 5LGHH 1EEZA 3GSXA 4DAGL 2XWZA 4W9CC 4GRLA 3W2DL 3FFDA 4NLHA 2OV0A 1OGSA 4H13C 5FGCE 5A2KH 1KFGA 1DVTA 4R3SB 3QZMA 1LO3H 4FKKA 1RZKH 4AYBA 3WMPA 4CVWA 1QUNB 4QGTA 4XC3L 3HVNA 3DPBB 1RK7A 2A1WL 4QTIL 3V5KB 2DQDH 3NH7L 1BFTA 3ZDYE 4NNXB 1HXMB 5F88A 3SOTA 1YYML 1QATA 1ZHBB 2Z4TA 4KTDL 4U1LB 1IBBA 4WEUD 1AYRA 1K6QL 4I2XB 1EJ8A 2NY1B 3S2CA 3L5JA 1RSYA 2AV1B 4H0LC 4ETQA 1QQDB 1AIFA 1FLTX 3C5ZD 1DJZA 4YO0B 2OXHA 3TO2B 3C87A 3O11A 4N9GA 1FVEB 1QYGH 2HN7B 1OAXH 1LM8V 4H2CA 3CC5B 2FQGA 1L4IA 2C9QA 1FFRA 1IC0A 1I4FA 5I8CA 2FH6A 4B95C 4PJ7B 5C6TL 3TNMA 3FQRB 5LDUA 2BDNH 2JJTA 4JQIA 1ORQB 5T5FH 2W94A 5HHOB 3LYRA 4ODTL 2RTTA 3UZQA 4L5FE 3NACH 1OSZB 3BKJL 1ASPA 4PJ8C 2AGJL 4KPHH 5D7SH 1T03H 4M61B 3A6BH 4TKWA 3B5HA 1XF3B 4PJHF 1VKXB 1G5AA 1L9TA 4XP5H 1DJYA 2OTUA 5DTFA 2OMZA 5E2VL 4CC0A 2WLLA 3QR1A 3QWQB 3C5ZB 5FC9A 4UYQA 3DTXB 4XCYB 2FBRA 2NY1C 2YSSB 1BQHG 3RGHA 5JW4R 1BREA 4POUB 3AG1B 2MPVA 5IHZB 4YDVB 2D7NA 5HHPB 4ZUWB 4OZFA 3TM6A 1AGEA 2BSTB 1AXIB 3ARXA 2MCPH 3M07A 1FZMA 4GKNB 4JUSA 4JRYA 1CMOA 5AW1B 3VCLB 4Y16D 4ATWA 2BVQB 1U0QA 2CDGB 3U7YH 4XMXA 4F37K 1QBAA 3ARED 4TQ8A 1DP0A 1W0WB 1BMWA 3QXVA 1KB5A 4AYGA 3NEOA 2YAOA 2V5RA 5FK9A 1A3QA 1ZTXH 2CDEB 1YLBB 1LEGA 1UASA 2DN7A 3GSNL 3M1BB 2CA4A 3BP5A 4OIBA 4GW1A 1IM9D 3HAEH 2GT9B 1M53A 5BPPA 4XT1C 4G7YL 2PYFB 2PR4L 4XNYL 2EDOA 1OW0A 5ACZB 4R7LA 4X7TA 1RZIB 2ZKYA 4C55A 1R5WA 1WFMA 3VSTA 3C5ZC 1DANT 3PFQA 3B2DC 3C9NA 5F9OH 5M7QA 1PIGA 2I9LA 3C8HA 2X4QB 2DL9A 1BEYH 2E46A 5F9AC 3GJEA 1JPEA 5MENE 2HMID 4IBQA 4Y16B 5KVGE 5IQMA 2IDTA 4HKZB 4XBGA 4FG6D 2DI8A 4N25A 5E4EC 4QY8B 3AREB 4WGVB 2FLRT 2ILLA 3ZL1A 3I3EA 3CMGA 4XAKD 3RTLA 2YJQA 3SDDA 4FNPA 5CD3B 3MKGA 4G43B 5EOTB 5I1KH 4LQFL 4WNJA 4M3KB 3RHWK 1YEHH 3FQTB 3Q5OA 2YXFA 4NNYB 1T2JA 5IB2A 2Y3NA 3MLZH 4XB7A 1IM9B 4KGLA 1DFBL 4NM4L 2GEQA 3QDHA 4PJXA 2P9RA 2Z65C 2V2TA 1JIBA 1WS8A 4GQPH 2AFNA 3SQBA 2HA1A 2KZ1B 1R33A 1UJ3A 3TP4A 1E8ZA 3EG9A 1FIGH 2HVKB 4N8CH 4EN3D 3DHMA 1W2KT 4LBEA 4YSUA 3QPQD 4EOWL 2CO6A 4BFNA 1A1NB 3RWIA 4JE4B 1KJ3H 5JYLA 4IQHA 4I77H 4PJFA 3GLEA 3BVDB 4IKJA 4LVNB 2WD0A 3UFIA 5I73C 2XTJD 3OX8B 4IDJL 5GS2H 4Y4KD 4Y16C 2BK8A 1S7QA 2YLKA 2M2DA 3AREC 3CFDA 2XNAA 4CBZA 5CZVH 3D85A 4JZNB 3V4PL 3CIQA 4YDMA 3IGUA 3IRZA 2TRHA 1ZT4A 3QBTB 4FQIL 3U9UA 2AITA 4AW7A 1Z32X 4RDQF 2QQQA 1G9NL 4ORGB 4WFFE 3C6LD 4EN3B 4AIOA 4R7DB 1NJ9A 3QISA 1RERA 1MRDH 1HZLA 4OTXH 3TA3D 3FULA 5AKSA 3KXFA 5B7EA 3WFCL 1ZA3B 1QI4A 5HPMA 3BP6B 1UWXH 4LCYB 3QJSB 3O41A 4LBAA 5HHMD 1Z5HA 1RPUA 3NZ8A 3BGMB 1X5JA 2F53D 2XTJB 3JTBA 3TBSA 4F7PB 2VYRE 1UXSB 3EF4A 2ZUYA 2HMIC 5ITFB 4Y4KB 4JFDA 1T1YA 4J3UA 4OD2A 3KR3H 1YYLH 4FG6C 4NQVA 3ZL4H 1PKQB 4J3SA 2H0PA 1E5YA 1N5AB 4PUBH 3B5GA 4Y4FA 3NSXA 2DD8L 1QEXA 3ULSB 2CK0L 3RIFK 3PHQA 3D3VE 4QF1A 1VLXA 2DZEA 2I60L 5AB0A 4PJAE 2VLLA 4WU7B 4ZNEE 1E4KA 5GSRB 1DJHA 5C9KA 3QIUD 4UI2A 4FNRA 3H3BC 3RPIA 3DV4B 5IHHA 3TA3B 1F02I 4WJ5B 1C5DB 2CJUH 4PJIB 3WU1A 1OT2A 5HHMB 2BO0A 1WGOA 2F53B 2Q9OA 4EN3C 1UFGA 3AY4C 3IMRA 2FBJL 3QPQC 1Q0XL 3SKJL 1AD0A 3IGFA 2X0UA 3MLPA 4Y19A 4YDKL 4R4ND 4XI5D 2X70A 4TVPD 1U8JA 1KG0A 4WI0B 3BEVA 2XTJC 1KOAA 2CQVA 4LOVA 4Y4KC 3L3OB 3LIZH 4PWFA 5DD6B 1HC1A 1IGMH 5CD5D 3HNTL 5HVWA 4G1MB 1AZCA 1WZ1H 2Q2LA 2Z0BA 1BJMA 4E41D 3QIUB 2UZYA 1A6WH 2DMGA 5IM7A 1FVDA 5IFJA 1QRKA 4OLXH 4UB0H 1W72B 3B7SA 1IGFH 1YEJL 3GZQA 3C5JB 2JCCB 3H0TB 4QO1B 1DYZA 2XQ0A 2K8QA 4Y1AA 1FNEB 4X9BA 1AD9A 3PV7A 4PW9A 3C6LC 1RIVL 1M6OB 1U8CA 2UZXB 2DQEH 4IJ3B 5FPIA 2KPNA 3EKCA 2X1PA 2H41A 1HSBB 4FXGC 3TA3C 1WHOA 4RNRA 2VLRA 1TKWA 3OJVC 1ES0B 4HIHB 3ZTCC 4J3OG 4QOKE 1N3NB 3FBKA 3OAZK 3P9WB 4OZHA 4YL4A 3GO1H 2P26A 4N24A 5L8KB 3RWGA 1S9YB 2X89A 4U4BA 4UZGA 2LTQB 4E41B 4QLWA 3FDWA 1E90A 4N1EA 5GHWL 3V5DA 3GXNA 1KXVA 3L3OC 3CSYB 4LGRB 3ARUA 5ID0A 3LQMA 4TNGA 4KXAA 4WCYH 4JFFA 5AOKA 4AGOA 4N85A 3PCYA 1SHMA 3QIUC 4MDIB 3AQZA 4AQAB 4GW5B 4JZJB 4GNKB 4RGNE 4BV1A 1AGCB 2D3VA 3NCYS 4WLCA 4RMTA 4KJYA 1KGJA 1CTMA 2YJLA 2KERA 1XO8A 1BQLL 4LCIL 4ANWA 5KSBB 1TJXA 4H0HB 4IJ3C 1BFVH 4L4TD 2E47A 3SDXB 1JCKA 5DHVB 4NEHB 2F6AA 2G5UA 3GLDA 3HC2A 3KCPB 3CFKB 1U21A 4R4NC 2GTZA 1EV2E 3PJNA 4XI5C 1NIBA 5J1SC 3JV6B 3MRFA 2FJHB 3MHZA 3VXRD 4JHAL 5I1DB 3S35L 1U36A 4O02A 5L9DH 1JVOA 4KXZH 1PLBA 4AZ8B 5AAWC 2WLHA 4HJEA 5CD5C 3BSGA 1ZT7B 1SBSH 3CBRA 4K71B 4YHNB 1JPTL 2LTQC 2JI3A 4I48B 3E38A 4K55A 2XWTA 1W0VB 1HEZB 3QJRB 5CF3A 3D2UD 4LNRA 3CX5K 3EYQD 3E1F1 3D51A 1MCIA 3U0WH 1TZGH 1QSFA 2KH2B 4B3VA 1PLCA 4L4TB 2C4XA 3HRZB 5HJBA 1KXQA 2VDNH 5DD5H 5JOFB 4JZJC 1GA2A 4QI3A 4EF3A 3B4NA 1BMZA 1HTYA 1MUJA 4BZ2L 5T3ZE 1AGDA 1U8KA 1TNMA 5CSGA 4TSBH 2OTWB 2F58H 1R3KA 2JI2A 4IRJD 3MGTB 2ARWA 3VXRB 4KDVA 4TUOB 1U2CA 1XR8A 2FEEL 3QC6X 4WFED 3MV8D 1BAFL 3GXIA 2X9WA 3U9PL 1I8UA 2FIKA 2Q76B 3NMEA 4FE9A 4DKEL 1S3KH 3CAFA 4XCNB 1Y0LA 4IKLA 1VEOA 2P5WE 1TVDA 2X12A 1CF1A 3VFRB 2OR9H 4BFKA 5MEPA 5KEZA 3PDOB 3P1VA 5B3NA 3LZFL 5E1GA