1JOIA

Structure of pseudomonas fluorescens holo azurin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECKVTVDSTDQMSFNTKAIEIDKSCKTFTVELTHSGSLPKNVMGHNWVLSSAADMPGIASDGMAAGIDKNYLKEGDTRVIAHTKIIGAGEKDSVTFDVSKLAAGTDYAFFCSFPGHISMMKGTVTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and preliminary crystallographic studies of the crystals of the azurin Pseudomonas fluorescens.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords AZURIN
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1997-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1joiA00
1ZIBA 1SF5A 4YSOA 1B3IA 2XXGA 1JXGA 3BQVA 3FT0A 3N55A 4F2EA 1BXVA 3FYEB 3ZBMA 2GB2A 3PAUA 4G70B 3ZIYA 2FJSA 1A4CA 1OCRB 2FTAA 2VMJA 3EH4B 3HB3B 2Q5BA 4YVUA 1SHWA 1TEGA 2FT7A 1WA1X 4A2FA 1J5CA 4Q8BA 5AFAA 1SDDA 5B1JC 4EF3A 4BDVA 1T5KA 3FU9A 1SFHA 2QT6A 2WO3B 4A2GA 3UAAA 1NINA 2X88A 4E9XA 3RYMA 2LLNA 3CVCA 1CC3A 2HX7A 2EILB 7PCYA 7PAZA 1J9SA 4A2DA 3NJGA 2BP0A 3BVDB 4HZ1A 3FPYA 3NSYA 4K9JA 2CAKA 3X1BA 4DP1X 3QJVB 5I6NA 2AZAA 3NJHA 4KNUA 2I7OA 1E65A 1NWPA 4AKOA 5FC9A 4GY4A 3TBBA 2CALA 4KOBA 2ZOOA 2BO0A 3DKHA 5B7EA 1SDDB 5I5JA 1V55B 2J55A 3T6ZA 4HAKA 1QLEB 4DP8X 3NSCA 4AKPA 4F2FA 1WA0X 2NRDA 2PP9A 1I53A 1NIFA 4HCFA 4G71B 1SFDA 2FNWA 3ZDWA 1ZPUA 1ADWA 2BP8B 4P5SA 3ASOB 1PNDA 2VSKB 1AG6A 2YAMA 3IEAA 2PPAA 5B1JA 1QNIA 4HCIA 2TSBA 4E9YA 2XLLA 1SJMA 4YSRA 1HAWA 5D4JA 1JZEA 4A67A 2VW6A 4YSUA 4M3HA 2UXGA 4WTQA 3FQYA 4HALA 3AG1B 1BQKA 1QHQA 3IE9A 2AANA 2XYBA 4TXVB 2PPCA 3SQRA 2FQDA 1X9UA 3QJSB 2PPEA 5I6LA 2XXFA 2VN3A 4BXVA 2VW4A 1RZQA 2YQBA 3X1NA 1NDTA 1NIBA 3X1EA 2AFNA 4BDVB 2JXMA 2DY2A 2PP8A 3FSVA 2EINB 3NYKA 2BWDA 3QPKA 2PCYA 2IDQA 4CSZA 4BK5C 1KYAA 4KOCA 3FU7B 4AX3A 1GS8A 1KCBA 1OV8A 2CJ3A 2GBAA 1DYZA 3GDCA 1AZCA 1AR1B 3PPSA 1A4AA 1A3ZA 1JXDA 1PLBA 3OMIB 2J57A 3H4HA 2Q9OA 3SBRA 3OMNB 2H5UA 1BAWA 3QJTB 9PCYA 4DPAX 3CVDA 2CUAA 3IBOA 3WNJA 4W1TA 1E5ZA 2OCCB 1V10A 2Y1AA 1L9RA 2VM4A 4KNTA 1L9TA 1BYPA 1AANA 2AVFA 2BP8A 3WKQA 3X2QB 3OD3A 2FT8A 3V9EA 2WSDA 3FYIB 1V54B 2DWSA 4DP7X 1ZIAA 1WA2X 4YSTA 1JVOA 2IDTA 4JKNA 3X1FA 2EIMB 2IDSA 1J9RA 2XUWA 5TK2A 3IN0A 1ID2A 2CBPA 1AZNA 1ET7A 4PAZA 4HHWA 2UXFA 4YSQA 2MRYA 1IBZA 1GSKA 1M9WA 4GXFA 4E9QA 3DTUB 4ZK8A 3TASA 1MG2C 1PAZA 3T9WA 1XB3A 1PNCA 3UABA 4QKTA 4G72B 1FFTB 1PZAA 3AG3B 5I26A 2DYSB 1FA4A 1MG3C 4HIPA 3AG4B 1J9QA 3TBCA 1A8ZA 1AZUA 5ANHA 2H47C 3T6XA 1BXAA 1N70A 1ZDQA 2PPFA 2HX8A 2YAPA 1W6WA 1FWXA 4DP6X 4E9SA 2BWIA 3EHBB 4N4YB 2XX1A 3ABGA 1JERA 4KNSA 3TA4D 1NICA 1SF3A 5B7FA 3NJLA 2YAOA 2QDVA 1EZLA 1F56A 2HXAA 3WKPA 5A7EA 1GS7A 4BWTA 1SNRA 4KO7A 1KBWA 4AZUA 1NIAA 2BZCA 5AZUA 1EHKB 2IH9A 4NB7A 4E9RA 3PXLA 2GC7C 4F7KA 3GYRA 3NSFA 5I5IA 2A3TA 1ASQA 1L9OA 1L9SA 2EIKB 4NERA 4AKQA 4DP4X 4GP8B 3MX0B 2I85A 2QPDB 1MZZA 5B3SB 4JHVA 3QJUB 4YVNA 3C75A 2XV0A 2PLTA 1OF0A 1JZHA 3UGEA 1BYOA 2CCWA 2HRHA 1ILUA 1XMEB 2HZHA 4BWUA 3HEIB 3FQ2A 4DP0X 2OV0A 2WO2B 1YLBB 4A68A 3T71A 1KGYE 2PCFA 3GXUB 2IDFA 2R7EA 1M56B 1ET8A 2ZONA 5I6PA 2DV6A 4GYBA 2OJ1A 3IN2A 3V9CA 2ZWNA 1RKRA 2YAFA 3H56A 5D4IA 1KCWA 2BW5A 2IWEA 3AY2A 2EIJB 1OE1A 4GP4B 1GY2A 5EHFA 2YAQA 2UXTA 1DZ0A 3AW5A 2JKWA 2J56A 2HLEB 3EH5B 1CYWA 1AS6A 1UATA 3NJIA 3JTBA 3MBWB 4FAAB 4DPCX 4YSCA 3FPXA 1J5DA 1AQ8A 4YSAA 1PZCA 1AZRA 4RH4A 2JFCA 3NJJA 1PMYA 3QJRB 5D4HA 1ASOA 1KDJA 1WS8A 1M57B 3UAEA 3PAVA 5I28A 3NP3A 3UADA 1PZBA 2IH8A 2MTAA 2HRGA 1CUOA 2FQFA 4YL4A 1GYCA 3NT0A 1HAUA 1J9TA 2FWLB 1MDAA 4Q89A 4A2EA 4BWWA 2P80D 1CYXA 3NJFA 1E5YA 4NAJA 1BEXA 2VSMB 4YSDA 3KW7A 1TU2A 3AZUA 1WAEA 5B7MA 3FSAA 1TKWA 2N0MA 1JZIA 1SHXA 3WIAA 2PP7A 4ENZA 1TEFA 1BXUA 1ASPA 1OCZB 3QQXA 5I6MA 1PLAA 4QLWA 2IDUA 1GW0A 1OCCB 2UXVA 1JOIA 1PLCA 2Y69B 2YXVA 4KO9A 3ABKB 4HHGA 2H3XC 2VW7A 3G5WA 4P5RA 4A66A 2P80A 4AI7A 3NJMA 2GI0A 2GHZA 3S3BB 3T6VA 3TU6A 2XWZA 3WNIA 1IC0A 4PCYA 3SBPA 2UX6A 4DP2X 1NIDA 1RZPA 3NP4A 2BHFA 1IUZA 5AKRA 4CSPA 1ILSA 5F7BA 1OE2A 2RACA 2YAHA 3H4FA 1W8EA 2GSMB 1AS8A 2IAAC 1HFUA 1XB8A 2W88A 1NWOA 2ZXWB 4YSSA 3FU7A 3EF4A 1AZBA 2BZ7A 1MZYA 3CDZB 3JT2A 4X4KA 4BXSV 1JXFA 1KBVA 1ZDSA 5B1AB 3S3DB 1AOZA 2R7EB 1PCSA 3OQRA 3WI9A 3FU8A 1NZRA 3CDZA 1L9QA 4N8UA 1URIA 3PCYA 4W9ZA 1OE3A 2GIMA 2XV2A 4E9WA 2I7SA 5I6KA 4M4RB 2B08A 1AACA 3T6WA 8PAZA 4FA7B 1PY0A 4G7QB 3X1GA 3ABMB 1KV7A 3S8GB 1JZGA 1RCYA 5B1KA 2IWKA 2XV3A 1E67A 2QPEB 2XVBA 1AG0A 1GY1A 3FS9A 4L0PB 1BQRA 1X9RA 3OMAB 3EH3B 3DIVA 3AG2B 2DYRB 5B1BB 5TK4A 4E9VA 1AIZA 3OM3B 4UF7C 1NTDA 2GC4C 1IKOP 2FT6A 1A4BA 2W8CA 3CVBA 4JHUA 5PCYA 3ASNB 1CURA 1OCOB 1NPNA 3ERXA 4YSPA 2DWTA 4UAHA 2BW4A 2PPDA 3UACA 4WKXA 3FSZA 3NSDA 2X87A 2XX0A 3ZX1A 5I5MA 2FQEA 4DP9X 3S8FB 3D12B 5LDUA 1VLXA 3PLYA 3FQ1A 4DP5X 6PCYA 3QJQB 3U25A 1OOWA 1AAJA 2IWFA 3NJNA 1R1CA 4G7RB 1WS7A 4GP5B 2YARA 1XB6A 5I6OA 1JZFA 2BP0B 2QDWA 3ABLB 4E9TA 2UX7A 1JZJA 1ETJA 3CZUB 4KO6A 2YAEA 1JVLA 4YSEA 3KW8A 1ZV2A 1ET5A 4DPBX 2YXWA 4KO5A 3S3CB 2HX9A 5E9NA 2FQGA 4A2HA 1PF3A 1A65A 2VM3A 5PAZA 1N68A 2TSAA 2XU9A 3PAZA 5IY5B 4UANA 2J5WA 1KDIA 3N2JA 1L9PA 1IBYA 3WG7B 1E30A 4G7SB 3CG8A 1AS7A 3SBQA 1W6LA 4HCGA 1GS6X 2B3IA 3L45A 2E86A 6PAZA 1NPJA 3NJKA 2AZUA 5F7AA 3FSWA 1GR7A 1BQ5A 4MFHA 1NIEA
chains in the Genus database with same CATH superfamily
4KY2A 5TQ0L 4JJ5B 2H1PL 3TEWA 4HAGA 5FO7A 2Z35A 3AGWA 3KXFE 3K74B 1Y7VA 2FEJA 4WQOA 2NQCA 4FFWC 4MB5A 1AHWC 5DSCA 3CDCA 5LJYH 2KI6A 5L4IA 4N0UB 3OR7B 1A4CA 4NZFA 3MLWL 5TE4H 5BVPL 2DM3A 1IX2A 1YPZE 1WA1X 4D9LH 4X6DE 4MNQB 3VXMD 3KGUA 3N44F 1IC5L 3MN8A 4Q6YA 5J06A 4TVPH 4U6XA 1AI1H 5D7SL 1EWHA 1ETZB 5DFAA 5EH1A 1FE8L 5EZPA 1TZOA 4PR5B 2DBLH 3IWUA 1ZVSA 2XIIA 2L7UA 4J4PC 5F6IB 3P3RA 3ATDA 2JCCE 1W16A 2VZOA 4WFFE 1Z9MA 2DQGL 4AIXA 3U4AA 1TZHB 5GRYA 3ATBA 4KJYB 3FU3A 4K7FB 4WEBL 1U8NA 1CK0H 1KXTA 1XGRB 3DHPA 4R4ND 3V0VA 4M3JA 4N2NA 3CPLA 4YWGH 3MV9E 2J3SA 4DZBB 2HKHL 4KXZI 4AMKL 3B9EA 5C0AB 1O5DT 4AKPA 4R4FL 2FR4A 2WZ6A 1PYWA 2PP9A 1NFIB 3MAWA 3QFJE 3QFJD 5AOJA 3VXSB 3ALWA 4ODTH 2FNWA 3V6ZA 1J5OL 1ADWA 3WCYA 4F80A 3VFWB 1TQTA 4D8OA 4OKDA 1URZA 4UOQA 4KMTL 1AGFB 5ITFA 5B1JA 3EYUL 1OAKL 1WHPA 2DQCH 2Z91A 3US1A 1SJMA 5CSZA 3D06A 5DK3A 1WGVA 5D4JA 3MREA 1FVEA 2IFGA 4HALA 4NZUL 3B6SA 3DSFH 4HK3J 4EI5B 3UCQA 3HN8A 5DD0H 2V2WA 3BUQA 1SJXA 3O3EA 2CJSA 4PGDB 2AQNA 4ZG1A 2VN3A 3ZTNL 1FFOB 3B9KA 4WUKL 5AENA 2EVIA 4GQZA 2D31B 2WLZA 2UWEA 3IDGB 3X1NA 4PG9B 2V2TA 3SGEI 3PWNA 2P24A 5E6YA 4QAWA 2ICWI 4F33A 2XWRA 3DHUA 2VH5L 4CAGA 5ID1B 2PTTA 5CJOH 1GGBL 2R1YA 1MCOH 2X70B 3E6FB 4KOCA 4PUBH 2R0KH 3AY4A 3VB9A 1SVCP 3H42L 2XN2A 3ARGB 1KCBA 4KK6C 3KPPB 4NKIL 5I76B 1IBFA 3GDCA 5SX4H 3PPSA 3LXUX 3O6FA 3TONA 4Q97A 4MJ6A 3DRQA 5DZPA 1MIEH 4LP4A 3CUPB 3L3KA 2APXA 4KI5E 4XWGL 3DPDA 1BAWA 2AQ2A 3GJEB 4DCQA 1UC6A 4WGKA 3VFPB 4JFEA 4BFIA 3P3UA 5I76A 4TVUA 2G30A 1E90A 2VLLB 3O6FB 4GMSL 1GXEA 5DMGC 1C16B 3HVDA 4F7PA 2VITA 2FIRT 4H5SA 3F85A 1I7UA 2V7NA 1RZJL 1SUJA 5F7WC 1L3WA 1Q1PA 2DMGA 4JO3H 4P2RE 2AK1L 1XFPA 1KWGA 5IFAL 3P1VA 1H6UA 5EOQH 2ZWLT 4PGZA 5IB3B 4XVJH 2YC1A 3LZNA 1J9RA 3QUMA 2OTUB 4D9RD 3FT1A 2MQCA 4FQ1L 3PHQA 1WRFA 4V1DB 2N56A 3L1GA 1CF8H 1O5PA 3WLWD 4MWFB 4E9QA 5I18H 3IDYC 2BXZA 4UIMB 4JRYA 4JDEA 1GGTA 2HA1A 4Y4HC 5CD3B 1E42A 2HVJB 3AG3B 5DUPH 2ZD0A 4AEHL 3ULVL 4GSXA 2MCPL 1KY6A 3WAJA 3H3KA 1AZUA 3ARUA 3Q8BA 4ILDA 1ZJBA 4MWFA 3L1OL 1OXYA 3DV6B 4HX1B 4AH2B 1OGAA 2EABA 4XBGA 5H4YA 3FU6A 1Z0NA 1DZBA 5BZWA 4GRWH 2XX1A 1S9VA 2X4OA 2AV7A 1A0QL 1NL0H 2P48B 4ERSH 4OZHB 2MNJB 3AM8C 3RAJH 3VYOA 3FBQA 4XTRC 3M45A 4Q6IC 5F0MB 2J44A 2J25A 4UTAL 5F7UA 5IB2A 3LKSA 4Z7QF 1F56A 4HPYH 3ULUE 4AGMA 1QI3A 4KO7A 1KBWA 1NGWB 4FG2A 5KVFL 2X4TA 1LEGB 5IBLC 4NFBA 5AYUH 5ETUA 4NZJA 1L3NA 3F12A 3L5WB 4NKMB 5DMGD 4WUUB 3MBED 3MRQA 3I74A 4XPAH 4ES8A 1QPPA 1OD9A 2X3AA 2NXYD 4HJTA 5DDHA 4ZQTA 3R06A 4X99B 4TQEH 1QX1A 3OXSB 1XSJA 4N2LA 4PJ5D 4DP4X 4JJOA 4GP8B 1Y6NR 3VVWA 1BBJA 1L7IH 4M6NH 4R90L 2Z31B 3BP4A 3BKMH 3D25B 1F42A 1N59A 4WO0A 1CD8A 4K23L 4M9OA 2JB5H 3MV8E 2VDNH 5BZDA 3EYSH 4X6FB 4HF5H 2Y5TB 2IQ9H 1AI1L 2OM5A 2R2HB 5D7SH 3D39A 1KXVA 1ET8A 2DV6A 1VPOL 2NLJA 5ANMB 4AVJA 2NNAA 3JBG7 3MRFB 5DHVA 3UZQA 2VXSL 3H6JA 5SX4I 4YPGA 1QSFB 3QI9D 5DVLA 3QRFM 1PJ9A 1FIGL 2HFGH 5DJXB 1UENA 4GKNA 4PTTA 3BC9A 5FYKD 5GGRA 5EF2A 1AS6A 2J8UB 2NLJB 3UBGA 3FL7A 2BNRE 4XMKL 4GW4A 2YGQA 1KLGA 2GFBA 4OF0A 1U0QA 4HWZA 4KXCA 1FAIL 4N2GA 4N5ED 4RH4A 4AGOA 1DVXA 1WE5A 1PMYA 4NO0B 5BPPA 1JTOA 1IEBB 4ZW7A 1BA9A 3N9GH 4OBRA 4CADA 5E9DE 1CD1A 4JRXE 3DTDA 1RK1B 1NFDB 4MKTA 4WCYL 4BK4A 4GUPB 2Q87A 3QXVA 2LABA 3NFPB 2H6PA 2Y3AA 3TCXA 3LN5A 4JRFA 4G6JL 1YN6A 4UTBH 1TTBA 4DZBA 2F8IA 4RX4D 1UUSA 1C5CH 3QR0A 1KYFA 3QEUA 1MXDA 3M1OA 1BSIA 4NNPH 2AJZB 4GS7B 1EO8H 5DMIH 5HHMB 4HWNA 4KKLD 1ROCA 4B5EA 4DVBA 4M7LT 4Y4KB 4OB5L 3Q6FA 4L3AA 3TV3L 2VLKB 3L7FB 3DURA 4F2ME 4PV9B 1N7MH 1E9OA 3MCYA 3UPAA 4LKCA 1K5NA 3ULSA 5FWQA 1DVZA 5TD4A 4CC4A 2IQ9L 1FZKB 2E7DA 2IALA 4PJXF 4AL8H 3NIFE 4XOCA 5DMYA 1ADQH 4KK5D 3DX6B 3F8UB 2CNYA 1TSHA 5KVGH 3PNWA 3DVGB 2XVKA 2YMXL 5IP4A 3V7MA 2OL3A 3B9AA 4HYTB 4NN7C 2AJYL 2JXMB 3X17A 1TYJA 2P43B 3NDYE 4FZEL 3MCLH 1T20A 1HOCA 4WU5A 3P3YA 2OSLB 4XMLH 5K93A 3FUNA 3F3HA 3LNDA 3QNFA 1RZGA 5JUEH 1HZLA 5D5MF 2WANA 4X7SH 5T3ZD 1J8HD 4BXSV 2VXVH 3SYOA 4H1LB 1TVBB 1NGWA 1AXIB 4HC1L 5E4AA 2VWEC 3GIVB 2C4FT 2FWUA 1MRFL 1ITBB 4PW3A 4UDTA 3CN3A 4AM0B 2H9GA 4ZUSB 1JMXA 1I7TA 2HFTA 4PJEF 2G5BB 1KC5L 5IVXB 1NOLA 3P4OA 3IGFA 5TPWL 3H2PA 4PJ8B 5HJDA 3V6OC 1QKZH 1QYGL 4JO8A 1EHAA 5KSVB 5JDSB 2VDMH 2AABL 4X6DF 1FZOB 1UA3A 1KB5L 1PKQB 2WZ0A 7FABL 5F1KC 5FA4A 4GINA 4ELKA 1WICA 4AV4A 1EDQA 2BWQA 1AGBB 5BRZB 4HEME 4JUSA 1JF1A 2ERJC 2FECI 4E0RA 2IWKA 2JCCF 2BVQB 3DX2A 4MGXA 1Z5LA 4M1GL 5FA4B 4ELKB 4YIQB 3W9DA 4Z7VA 5D2LF 1J7VR 5EBGA 2G0LA 3DIVA 5F9OH 2OTPA 3O2DA 4JRLA 4KUCD 4JKMA 3KL3A 1EBPA 4NLAA 2HT2D 4PVNA 1ZPLA 1RU9H 4WTWA 4QO1B 3GEFA 5DHVB 5EWIH 3UZQB 4I4WB 3PHQB 1F1AA 4JFPB 4P2OC 3BKCH 1A6VL 4ZO8A 2FT6A 3E80A 3EJUA 4CMMB 3QYNA 3QB7C 3EJYD 4OD2B 3O4OB 3B7UX 3D85A 4ZO6A 4P05A 5GGRB 1QQDB 3OR6A 3QRGH 4F3FA 2WUCL 3UBXG 2YHGA 4I3RL 3ISRA 2KS0A 5EIQA 1OPOA 1JPTH 3O0RH 5KUMA 2W91A 1X5GA 4JKLA 4PLOB 3NCFB 4U1SB 4X7SL 3SE4A 1KTJA 2WAQA 3FH5A 1P4BL 4U31A 4BQ8A 4ZNEA 3K71B 5K9QG 1KTLA 1P69B 2IWFA 1WEJL 3WXVL 4A7GA 4ZOEA 3O3DA 1W8OA 1S78D 3RWIB 4GP5B 4G80A 2L7EA 3VA6A 5K9JL 4FMVA 5D2NC 1MW1A 2WJ5A 1JZJA 1X6NA 2YAEA 3GSVB 1JPGB 1SJHA 4X7TB 2O72A 1BD2B 5JOPE 2HLAB 4ZSOA 4YHPA 4ZQKA 1MHEB 3FRPB 3AC0A 4X6DB 1QSEE 4YFEA 4R0LC 5EZIL 4Y16D 5C0AA 3QPQD 4CGUB 1F4AA 4I89A 3GSVA 1AS7A 4X0KA 4WWNA 4NIYE 3GSUA 4YX2L 1SXAA 2ZX5A 4P2RB 2B3IA 4Q58C 4TKWA 2NR6D 4XXCA 3NJKA 3QR1A 3VXOA 5F7AA 5IW1A 1CF1A 1A2YA 1WQVT 2NW3A 2OYMA 1PDKB 2SEBB 4XCCH 4M6ML 3B3BA 1MCPL 2IAND 2MH4A 3DI3B 5J6HB 4ONFH 4P48A 3CH1B 5GGTL 4PV1C 3DVGA 4RGND 4E5XB 3HNSL 5DZ9A 5C9JB 5C8JA 1BQUA 2PXYA 1YNLH 1NGYB 1BXVA 2IOOA 3CJJA 1BQSA 4NT6B 4K8RC 5CO1A 4H40A 1TZIB 3HB3B 1HZHH 3BKML 3D4CA 1J8SA 1HU8A 2PNDA 3L16A 1VB9A 2X10A 4WO4B 4CBPA 3BKYL 4QTIH 1MREH 1J5CA 1LWRA 2PXYB 3TGXA 5SX5H 3OKMB 4L3EA 4FHKA 3Q2CA 4Z3JA 2XKNB 5BRZD 1J48A 1BQHB 2NY4D 2E59A 4H1LA 4NQCA 2EEDA 4CU6A 1CR9L 4Y7MA 4WI3A 2HX7A 2AMGA 1K2DB 2EILB 5C0JA 1EHNA 4I0PA 5E1AB 1S7UA 1C5CL 2AEQH 2OZ4L 5K9JH 5C7XH 4MMZB 5LQBH 3QXDA 1P7HL 2LFEA 3RGVA 4Y5YC 4NQCB 4KNUA 3FH8A 4DETA 3DC0A 2JNZA 2P8PB 7CGTA 3DKHA 1V3KA 4X7FC 1MCLA 4OB5H 3BWAA 1AQDB 1TR7A 3QG7H 3MLVH 5I1HL 1FGVH 1XF3B 4ZOBA 5H94A 4PYHA 5DJ6A 3AACA 4RBPH 1OPGL 1R0AL 1T5XA 1MLBA 3M8OL 3MBEB 5GGUB 5A2CA 1ADQL 2WC7A 4K15A 3NA9H 4Y1TA 1MVUA 4ZPTB 4OM1L 3JZ7A 4ZNCD 5DFWH 2XA3A 1CZ8H 3D33A 5DK0B 1QHOA 3G7TA 3T8XA 4JY4B 4N1CA 5GRZA 3VI4E 1MFCH 1NLDL 2F53E 2J1XA 3LTVA 3QQ9C 2AXGB 3DUUB 1SDAB 2F9BT 5D2NB 5E6RB 4R96B 4Z7OB 1MNUH 1X9UA 3BDYH 4A6YB 5CEZL 3R4DA 1B2YA 4PN6A 1B0WA 4AL8C 3VXRE 3HG1B 2X4PA 5D93C 4M56A 4N0YH 1HKLH 2A2QT 5DEFA 3MOQA 1NIBA 4G42A 1R46A 2Q8AH 3MRGB 4HKXB 4LPCA 2VDRH 5E6ID 1X5YA 1X3DA 3X1EA 2JXMA 3PWPD 5LN4A 3V0WL 2PCYA 5F44A 1C12B 2K9UA 2YD2A 3QQ3B 1LJMA 2WQVA 1M7IB 2OFQA 4L4TB 4OJAA 1DUZB 4NZRH 3ZE2B 5ADOL 5B38A 1U3NA 1LDPH 1FORL 3MRGA 1A6PA 4YC2C 4LFHG 4AYID 2QSCH 4J3OD 4WW2A 2E9WA 4C4KO 5CHNB 3WNLA 1PLBA 4OM0L 3VI4B 1GJIA 4OZIE 4B97A 2JJSA 3GINA 2WP3O 1PL3A 1CLYH 1TDQA 2ZKWA 1BM3L 2N4IA 1N0XH 1N5AA 2AS5M 2VXUH 3ZDYE 3RWDA 2CUAA 4F9LA 5JUEL 1GHFL 3GD1C 4FLSA 2OCCB 1EJFA 5DUJA 2X4QA 5E4EB 1QUNA 1JWMA 1MJ8L 1M6OA 1LEIA 1IC1A 4F15B 1DVQA 5AVUB 5EZLB 3THMH 3UYRL 3ZT6A 3ZO9A 1N64H 1E4WH 1JBJA 2X1PA 3CXDL 3VDBA 3SYCA 4XN4A 4AQAB 3MJ8B 1QFUH 4GEIA 5IB1B 3CHXA 3TVMA 2QGCA 4PJXA 4UQEA 1MRDL 3FT3B 5C08A 3V5DB 1N59B 4F8LA 3FFCB 5I73C 3PYCA 3X1FA 4Z7VB 1NGYA 2ED7A 5DJ8A 1A9VA 5F89B 2CBPA 2XBTA 4N8CL 4BE5A 4OZGE 1BZ7B 5F7KC 2VGLM 1RIHH 2CKBA 3ZYJA 3E7JA 2X6UA 2BK8A 3QZLA 5EEVA 1ZGLB 5E4OA 3MLXL 4MMZC 4JR9L 4ZXBD 3UIZA 1QA9B 3NOIA 4JFWA 5DJ8B 4UU9B 4ZMVA 5BRZE 3OJDA 1I3GL 1FQ9C 2IANB 4MJ5A 5I26A 3T0AA 2DYSB 4OW6A 4QMEA 3RWFA 4HW6A 1O9VA 1QATA 1YAIA 3IPFA 3U2SA 1BMWA 3RP1A 3IGAA 1IB5A 3MI6A 4IBTA 2IC2A 2BCMA 2IVFC 4P23A 3HG5A 4Z7UF 2OMVB 4DP6X 4L5FE 2C7UB 3EHBB 4TRPH 4EMZA 4L4VD 4L4VB 2BSED 4GRLD 4YHMH 2EH7H 3JUYA 4YHLL 3IGLA 5HI5D 1LDSA 4G8GA 2WO4A 1WZ1L 5GSVA 1RY7B 3GM0A 3AB0C 4TULL 1AO7E 3HAEB 2CSPA 3NRFA 3UPCA 4ZMPA 1VFUA 1CE6B 1KWKA 3GSNB 3MFFB 4JN1H 3QNXB 4R7DB 5ICUA 4PM1A 4C8XA 4GSUA 1WC7B 4MJ6B 2F68X 3CXHK 1X5ZA 4QNPE 4HK0A 4F7KA 2XXMB 3RVTD 1X5XA 4G8GB 5T3XH 2AEWA 1R3JB 2F5BL 3P0GB 4JM4L 4GS7C 2ZJSL 3VRLE 4YXKL 5IROC 4AKQA 3DO4A 4XPTH 3UYPA 3A6BH 3HR5A 1A6TB 1AP2B 1PY4A 2WZ5A 4EUPH 4XXCC 3FTGA 4OJFH 3ETBJ 1RLWA 3EJQA 4OAWA 4YVNA 1U92A 3J27A 1NBYB 5LGKA 4ISVB 3PJSB 4M8RA 3WHXB 3P30L 4R0LB 1HH9B 4ODUA 4UQDA 4AQOA 3B4NA 1D7FA 1NCAL 2JIXD 3HEIB 3NIGB 4WFGD 4TLSA 2NNFA 5KANG 3MLRH 5C0CB 4AMKH 3Q3GA 1DE4A 3WL9B 5C9KA 1KN4L 1M56B 2QQKL 3I85A 1JMZA 3P9MA 5F88A 5D1XA 2FUQA 5T5NF 2F54B 1NKGA 2C3WA 1RFDH 1W0WB 3BZFA 3FQWA 3SBWC 5JQHC 5IQLA 2HFFA 3FT2B 5JW4R 3VXUA 5H35B 4XC1L 2CM5A 4DHLA 3D34A 2EIJB 2VDPB 3POCA 1JNLL 1NFAA 1I9JH 5FO8B 2BH0A 3Q05A 2A83B 3O4LA 3TP4A 2CO6A 3N1PC 2NNXA 3RKDC 4QT5B 4DPCX 5CGMA 4DQOL 2A73A 2HVBA 5DRZA 5JW4Q 5I6XC 1XAUA 3NCXA 2EXWD 3A24A 3O4OC 3ULUC 2GPZA 5FHBL 1G0XA 1HHHB 1Z5HA 4GRMB 3H7LA 3JXAA 5DD3H 1GZPA 1NAML 4P2OB 3RZCC 1BMZA 1MDAA 1CYXA 2XVLA 3FTSA 4KX7A 1BEXA 1CZ8L 1F6AA 1QSEB 4LDEB 4WJ5B 4R7XA 5B7MA 5HYJA 2DWXA 5F7HA 3LNFA 4Y9BA 3S3PA 2FBRA 1UTDA 2CGZA 4B5ZA 3PIQA 1MH5B 1NQBA 3J07A 5T1MA 2FIKB 2H26B 4ENZA 4PJBE 1SMAA 3ARBC 2ZF8A 3LY6A 3G5VA 3UTTB 2F7OA 2IDUA 1U58A 2ZP8A 4ZPTA 5EBLB 5HYJB 4V2CB 5CMAB 1HSAB 2WWMD 3QCUL 5DMKB 2R23B 4A55A 1IC5H 1TNNA 1UH3A 2X1XR 3IFNH 2FGZA 4K5OA 5HGGS 5KTEH 2G3ZA 2ALAA 3DX3A 3TM6A 3QJXA 4K2UL 4HV8B 1C7TA 4RGMB 5A16A 1ZWIA 1MEXL 1TJHL 5CMAA 4NQDA 4AJWA 1D9KD 3ZZ1A 1VEPA 5BUAA 1AKPA 2OKMA 3RNQB 1RZPA 1D9KC 4WKZA 4K5LA 4KRPD 4P3CH 2H1PH 2ICWB 2DJUA 3AROA 1IM3D 2X1QA 3GXNA 1BZ9B 4JG9A 1FFPB 4JL1A 5DLLA 3EBAA 2YRLA 4AYFA 1BBDL 3ESOA 5EORH 4JPWH 5AW3B 3IRCA 3AS1A 3JWNG 1CTNA 4FQLL 3H9HB 2WLYA 1HQ4B 3G5XB 1OGAE 2XQBL 5ALBH 2V5SA 3LH9A 3TBSA 3W38A 1TQCC 1DL7H 3NIFB 3UEQA 5D1QC 3UERA 2WBJB 2DBLL 4M02A 5B1AB 3BW9A 4FQCL 1XIWD 4TVPL 2Z1PA 1E4WL 1MWOA 3CXDH 2VITB 3WI9A 4MDIA 1GA2A 1JK9A 4Y1AE 3WFDL 4DOHB 3S36X 5KSAD 3KWWB 4F24A 4NPJA 2WBJA 1UFUA 2BY0A 5IEHB 2NZ9D 3MJGX 3VGDA 4K73A 2WQAA 4WFFD 3UC2A 4FYSA 1GZHA 4OCSL 3EF7A 1FFNB 4YDIH 5DWUL 3HHMA 3OF6D 1UJTA 1XR8A 4WUKH 5ECGA 3E2HB 3PWLA 4OCMC 4UDUA 4WSGA 3GTTA 3QEUB 1H19A 2EE6A 3LKRA 5IQMA 3HE7A 3NG5A 1MN4A 5LXGH 5MEOA 1CGSL 1S4IA 3MV7A 4U7KA 3HHSB 5TK4A 2NMSA 3RTQD 3RBGA 4QNPF 4Q52A 5EU4B 1MJ8H 2DQCL 4PUBL 4DO5A 3O2DL 1QSFE 1Z9SA 1JPSL 2VUYA 1DVFC 1FH5H 1HIML 3HUJA 1BFVL 4DZ8B 4I85A 3D39E 3JWNE 4NT6A 5CR1A 7FABH 4FQ2L 4X6EB 4F7EA 1RURH 3KLHC 2ZX7A 3NN8A 1H0DA 2ADIB 2JIXB 5ICZA 4WKXA 4WSKA 1Z9SB 2AV1B 4HT1L 4LHUD 1DJHA 1MJJA 2FQEA 3NVQA 1L9MA 1NSNL 5GRXG 2X2YA 2I27N 4QRUB 6PCYA 3UBHA 4YR6B 4NAQA 1KB9J 1HI6A 1QFHA 3NJNA 4G6MH 1J0YA 4QTHB 2L4OA 1QPXA 2W1NA 5FA3A 5AW8B 3CFDA 1N2RA 1DQVA 3BP7A 3S98A 5GGSA 4RQQB 2DJSA 3AWGA 5E9DA 4G6AC 2YD0A 4OUUA 2NY6D 1USQA 2O6CA 4KZ0A 4TUJB 4XO9A 3V0EA 1F4YL 1XL4A 4K3DH 3PL6C 3IE4A 3MZTA 3BP7B 3QWRA 3EOTH 2XKUA 3QHFL 3WG7B 1IM9B 1R3JA 3VMNA 2XPGB 2WKOF 3W82A 1J10A 2B14A 3RWJA 1WZ1H 1X5MA 4YH6A 5KAQF 3VSTA 3I6GB 4MCZA 1T6VN 5GS2H 1IAKA 5AW4B 3CZFA 3QGVA 1D5MA 1BQLH 1VADA 4AVKA 3ZTDC 1JF1B 5IY5B 5HI3D 4W68A 1N12A 5KBKA 5MENB 2D03H 4E36A 3INUL 3HMWH 1NIEA 4LF3B 5FCUH 1LP9A 4ECNA 1YEKL 3R7RA 5HHNA 2X4RB 3CC5A 5I2IA 2E7CA 1WBZA 2WZPA 1GPOL 3QDMB 2ICWA 5CJXA 2W5PA 1U8KB 4KHXH 2OL3H 5I6XB 2HTKD 4I4WA 4CDGC 3SSGA 2VMJA 4G5AA 4JO5A 2Q5BA 4N1EA 1PAMA 4LVOC 2PYEE 1LL1A 2FT7A 3QQDA 5F7EL 4A2FA 2IADB 2NUTA 1SDDA 4HHAB 4PJFE 4XPHH 2DYPD 4P5MB 3FU9A 1RH8A 3BP5B 5DXWA 5MEPA 3HFML 1KJ3L 3TF7C 4GUCA 5E8EA 3CVCA 4LZKA 1R3IH 4NKOB 5HGDA 5DD5L 3CZLA 1BVKA 1WZAA 4YGVA 1J0ZA 5HHVH 4WHYG 4OFYD 1X5HA 3CLEL 1TZGL 2QGDA 4J3TA 4KU1A 3GXMA 3EJYC 3BXNB 1XGYL 3S35L 1YY8A 3F64A 3P4MA 3V55A 1XQ4A 4GSDL 5FC9A 5FUOL 1PBYA 5DGRA 32C2A 3BPCA 2XVGA 5EV7A 4A7GF 4TNFA 2JI3A 2ICEA 4XBMA 3KPRB 3M6DA 3P0YH 4UUJB 4B9ZA 3VX0A 4LNRA 4OJYA 3HI6L 4BSVA 3QH3A 2G0KA 4LNVA 2VXVL 1FN4A 4PJHF 1MHEA 4OVUA 1HZKA 3ASOB 3NZHH 1MEXH 1OB1B 1TJHH 2ESVD 3CMOL 3LRMA 3V95A 3IEAA 3MV7B 4HEMA 2NZIA 4JANB 1M7DA 2ADFL 1WIUA 2DS4A 3DJSA 3DRTA 4JZOA 4MMXA 5DI8A 4B41A 2OSXA 3W57A 5DFTA 5DJDA 2NT0A 2VL5A 3S3SA 4UNVA 4M3HA 3MRMA 4QRAA 3GI9L 1BQKA 1T20B 1QHQA 2CKBB 4M8QB 4TXVB 3RDTB 3BIBX 2P5EB 1KCRH 1IT9H 3L3GA 5I9QB 3TT3L 4DGUA 5DI8B 1E7UA 2A77L 1VEMA 3B83A 4U6YA 4JREB 3FQTA 2AFNA 4R2GC 2QLYA 5E8OB 1M2VA 2FAUA 1F45A 2ORBH 3B3IB 1E40A 2DLHA 2KYIA 2B5IB 3WXVH 3BAEH 2QR0B 4G3YL 3SDDD 4P2OD 3ZDXE 5K1NA 5EWIL 3Q43A 4OF6A 1G1YA 4ZUSA 1N2RB 1EO5A 4AIEA 1GIGH 5DHVH 3UTSA 2RFXA 2Q3AA 1R3LA 1IQWH 1I1FB 2GBAA 4O51A 1DYZA 4AUJA 3B8SA 2AKRA 1GZQA 2OZNA 2UUDH 4MHHG 5FLUA 2WUCH 2Y1ZA 4H4NA 5DJCA 4AJ0A 4DCQB 1T1XB 3U9WA 3FCUB 4LBEA 2RFXB 2EUZA 2P7TB 1L6XA 3UO8B 3QUGA 2IH1A 4FQLH 3UH8A 4Q4IA 4WCYH 2J6EH 4XT1C 1JG9A 2FX8H 2UZPA 4D9QE 3FO0L 3Q01A 5DQJA 4XVTH 5C0AE 5MERA 5DK2A 3FYIB 4LRIC 4RFOH 1UZ6E 3OF6A 5KUKA 3TFKD 2QQLH 2XWEA 4NNPL 3EO0B 3LZFH 2OR8A 1U92B 3AADB 4MAYA 4N2FA 4RZCA 4FMKA 2BX5A 2F1EA 5D70L 3WUWG 4Y16C 1FV1B 5DVMA 3ILDA 4HHWA 1ODAA 2QZ5A 3FNKA 4GT0A 4R26L 1Q9KA 3BUTA 3UL4A 1X9LA 5KN5A 4QTIL 3HS0C 1LK3L 3N43B 4DJMA 4G6ML 4OZ4A 5D1QA 5J0BA 1EBAA 4KTYA 1G0DA 1OAJA 1O7SA 3AG4B 4C56A 4JFHD 2WBXA 5HGDB 4OLEA 1QRND 1ZDQA 4WK0B 2R69A 2XZAL 5J12C 2CRZA 4ZX6A 4YGVB 5IROD 3QIUA 4GNKB 2GW5A 1U8QA 2BM3A 1ETZA 2E8ZA 1LO4H 1DLHB 2NSQA 1S7XB 5CSGA 3TZVC 3BCDA 3ZN6A 3B1TA 4NQXA 3V2AR 3DTXA 4ETQA 2F61A 2PYFB 3TZVD 3FQUA 4BUHA 3I02A 2YAOA 2EC9T 2EDWA 1LWHA 3NK4A 1T1YB 4LU5H 4L8SC 3WKPA 1Y0LB 5IHBA 4L5FL 1EHKB 4GG6B 3LCYA 5FM5M 1PLGH 4QRTB 4Z7UB 1TQVA 2GC7C 3C60A 3GYRA 3NSFA 2DLEA 2VMCA 3BO8A 4OCYH 2NY5C 3GMQA 2EDBA 1GC1C 1IKFL 1FL5B 4M00A 3ES6B 5SWSA 3FCGA 3CSBA 3NRPA 5I82A 4F7CB 4E0RB 3QI9B 5TQ2L 2I85A 2QPDB 5E2VH 1DBAL 1UM4H 4OGYH 1YYLH 2XV0A 4L8DA 1NBCA 3DJZA 4KZEL 4JFUA 1NGQL 1JZHA 3MA7B 3LS4H 4QOKD 4AQAA 2R23A 4DK3A 5HYFA 1KGCD 1ZLWH 3DNKA 4PJXB 5FGBC 5C08B 3RJOA 5I8KH 2IO5A 4LHUB 4ZS6C 5IG7A 3VMPA 2CLZB 3ETSA 4ODVH 2XACC 4XB8A 5KVGE 4AEIH 4PV8B 4PI2A 5D7EA 2IF7A 2ZWNA 3VGGA 1BQHG 2A4CA 1BZ7A 1PZ3A 1RVFH 2XOTA 4HGMA 5DVPA 5HGBA 3S88H 3LVTA 1EZUA 3C87A 2VR3A 3PGCA 2ZOWA 4P9MH 2EDNA 2ZNXA 4XBEH 3O3BA 2XWDA 3VXRA 1V05A 5C71A 4KKAC 1BP3B 1DEEB 2KMWA 3B34A 5FECB 4P5MA 2BOCB 3HNTL 4PS7A 2B59A 4WO4C 3SKJH 4NGHH 2R1YB 4MDJA 4JRWA 1EAPA 1NOFA 3BD4A 4FNPA 3O2WH 5DZAA 2FATH 3FCTB 3ZHKA 4B27A 4DNLA 1ZLSH 4IRJA 3P77A 5GSRB 3UAEA 4A6YH 4RX4A 5JR1L 1AC6A 3DX7A 4GQQA 4PSPA 2FQFA 2WTRB 4GQPH 4Q9CA 3BIAX 3L4UA 4R84A 3UDWA 4OZIA 1SBBA 2V4LA 5EEXA 1E5YA 2QADC 3CK0L 1F3JA 4YSDA 3B7YA 1U8CB 3SDYL 3CLFL 5BJTB 5IVZB 1LO2H 3BCFA 2GK2A 4DGYL 1IO4C 1S6NA 1KEMH 2ZCLH 1QTPA 4NUMA 3WFHA 4NI6A 5D7JC 3AREB 1F4HA 2BMKA 2YN3A 1KIRB 3FN9A 1E3XA 3LKNB 3VFSA 3IJSA 3DUUA 3TPUB 1DJSA 1Q4NX 1OB1A 3DA0A 4KO9A 3GS7A 4G9FB 2YXMA 4DEWA 1ZANL 4F58H 2DOCA 2VB5A 3RGBA 2IAMB 4PJXE 5C08E 5IT2L 5F3HA 3WEOA 3PP4H 5DEFB 1B0RB 2P80A 4XN1A 1E9OB 2HTLD 3NJMA 3FB8B 2P5PA 1ZRUA 4WW1B 3S3BB 1V7NL 3LD8C 1NCWL 4DK5A 3FSOA 4G9FA 5GZOC 1DTUA 4KC3B 5HYSB 1C12A 3FOLB 4RETB 2IPTL 5A7BA 2D2OA 1RPQA 1YO4A 2BHFA 2J1ZA 3PV7A 2R1XB 3HMXL 2NXZD 3TA3A 3LIZA 1CICC 2H0JA 4R6UA 3VNYA 5IQ7L 3HUJF 4NRZB 1B0GA 3LKOA 5A6MA 5JPMA 3VFUA 3BLKA 4F37K 1MJJB 1RIUL 3DYPA 4Y4FD 1TETL 5EA0L 5ABZA 4EN3C 1M7XA 5BW7A 3L9RA 4XP6L 5C0JB 1EZSA 4X7DC 2BZ7A 5GGVH 5JXEC 1J11A 2EDLA 4LSTL 3VNZA 3HZMA 3IGUA 4A6YL 1T0OA 3NSJA 4AM0A 1FZMA 1H3UA 2IV9A 2AJXL 3AQYA 3P4OB 4MB4A 2Y7SA 1FBIH 3KPMA 4UV7L 2PUQT 4KRPB 1L0XA 4OCNC 3TXAA 5KSUA 5CCHE 1RZ7H 5CCGE 1HHHA 1IGTA 3GBEA 4NQEE 3LH2H 4BQCA 4F7CA 3GLDA 3PCYA 4HUNB 5SV4A 1R3KA 5DJ6B 4E9WA 2B08A 2Q86B 1C8PA 2ERJB 4P4KA 4B0MB 1E6OH 4XRCB 3TPKA 4WF7A 1E5CA 1X7QB 2C1OB 4DGWC 2YPVH 3N85L 5FW6A 4PJ9D 1N8OE 4N0YL 4YIQA 1XTMA 2EDFA 3IDJB 3T2LA 1R47A 3JTTA 1QLEL 1MUJB 3MLUH 4PS4H 2N7AA 3LQAH 2ATKA 2QTVA 2MWCA 2CLZA 4JN1L 1G1OA 2DYRB 4MAYB 3WXWL 1XBRA 5DU7A 1PJWA 4O2CA 4PWIA 3TEYA 2CO1A 4N0UA 2GIXA 4UF7C 3O3AA 1LDPL 4GW1B 1TQSA 3GBNL 1ZS8A 5ACMA 5E2TL 2GC4C 1HYSD 4OFQA 5IFJA 3Q2WA 2OZ4H 4KXAA 2D0GA 5PCYA 3Q6GL 3GMOA 3NIDB 3O8XB 1AGEA 5A2AA 3OVUB 2K3TA 2PYEB 3PL6D 1EAOA 3QQDB 3US9A 2PYED 2GEEA 1EJ8A 4NFDA 2Y07H 4H8HA 4FOMA 1G1KA 4DP9X 1XF5A 2DW5A 1SQ2N 3F58L 3HPJB 4IRSB 1YEIH 5TGBB 3QG7L 1VEOA 1B6UA 5DEJA 3QJQB 2WGXA 2CIKA 3L7EB 4FQJH 4JCMA 2UZXA 4K3GA 1AAJA 5EBWB 4FLQA 3UBFA 3T4AC 3BAXA 4A7TA 2K4WA 1RU9L 4H8UA 2ZYIA 2O4EA 4N0CD 2P46B 1YEFL 3GB7B 3PABA 4AZ8B 1WZMA 3PFQA 2Y1YA 3FQUB 1CD1B 3CU1A 1I3VA 4FXLA 3ZYIA 4AJYV 4OI8A 2HKFH 1INEL 5HPMA 3ULVE 4OM0H 1A3RL 1YMMD 2YUWA 2CHNA 2HKHH 2Z8VC 3PAZA 5HHMD 1JNNL 2PWHA 1KDIA 4DOHE 4ODHH 1A7OH 1FG9C 2BJMH 3WS3B 2YPVL 2E9IA 3N85H 5EG6C 1AMYA 1MCQA 5SWSB 4HLZG 2YSSB 1DCEA 2B1AH 1A2YB 4HG4J 1C7SA 3GS4A 1S9YA 3T2OA 3E38A 2WB1A 4C4KT 4IMLB 1WUNT 3WMSA 5HHXH 3AQDA 3KYMA 1T89C 1I31A 1M7DB 4MFHA 4AMWA 4HKJB 4K94C 5ESAA 5HDOA 5CZXC 4HPOH 1JGUL 1O7DC 3PRZA 1AE6L 2Z65C 2NXYB 4OLVH 1DQML 1QASA 3QZPA 2ZCKL 3RGVC 1RZKH 2MQ0A 3FHEA 3FYEB 4X83A 5KG9A 2EIBA 2WIIB 5E2VL 4IU3A 4LVNC 2EYRA 1YYLL 5F9AC 3F6JA 2J5LB 1IKNC 2WVVA 4LRNH 3F65A 3B2UC 3QZWA 4GFXA 4GQ9L 2X88A 5IK3B 4E9XA 1QZ1A 2E0PA 4H2CA 2WIIA 4M8UA 4IRZA 3NZ8A 5FDWB 2APTA 2XWTA 2F2HA 1CLOH 3LEVH 1T0NA 2C4XA 4KDWA 2B59B 5K1JA 4Q6KA 1J9SA 4QYOA 4Y19A 4ODXB 4F2MB 3BVDB 3L3KB 3C9NA 1N64L 3IAPA 5KJRH 3D07A 2WW8A 3GTVA 4IIQA 3FUJA 4P9ML 4NFCA 1P7QA 4AYDC 4AXWA 2B8OT 2ZP0T 4FX5A 4GY4A 5I17A 2ZOOA 2X0WA 3CBJB 2D3LA 4QYOB 5G2NA 4ZBJA 3W1ZA 4APXB 4BFKA 4N8CH 3MRDA 1XF2B 1K4DB 1NA8A 5AVWB 4RGOL 5LHDA 3ZPDA 3PG2A 3M17A 2YEZA 1CR9H 3ULAB 4IU2B 3CN0A 2X2UA 1PZSA 1YJDL 1J12A 5ICXA 3ZMRA 3JV4B 1VA9A 3HS8A 5I1DA 5KVEE 3IJSB 2BVQA 2OXGA 5DJZB 3BVVA 3WELA 4FQIH 4PJCA 4LARH 3FN0H 1BVLB 3W9DB 4QRQB 3M86A 4R8WL 4YSRA 1TCRA 2R4SL 3ZE1E 3BUBA 3LRKA 3QULB 2VTFA 4OLWH 4DKFH 5FGCE 5A3IC 1EA9C 3OPZH 1MIML 1NBVH 2AXGA 4A6YA 2Q76B 4X6BB 5T33L 1RZKL 4AYFB 5D2NA 3AJ7A 3KYKH 1M1XA 2VUKA 4KHTL 5EF0A 5TFSH 1XF4B 4K3JH 4P2AA 3QWNA 5HYSA 5JW3H 3NPZB 3F5WB 2BFVL 4HJUA 2XIDA 2RA1A 1NJ9B 3TLRA 1BXXA 1QEXA 5E6IA 2PP8A 2FGWH 3PWPA 1SOKA 4QIRA 3EOBB 3BPOB 5C0BB 4M9PA 4DWHA 3D08A 1LO3H 1KCLA 1WZKA 4ZUTB 2I60H 4Y4HB 2BZDA 4LEXH 5D7IE 4ZPVA 4AX3A 3INOA 3QCTL 4JPKH 4LK4A 2DEYX 3ZK0A 5BW7C 1TQBB 2BOBB 4OZIF 2ZOKB 5KYXB 4I9WE 2XNAB 2ZNWA 1LHZA 1A3ZA 3K5SA 3UPRB 4XMWA 1T2XA 5KOMC 3KPLA 4LGRB 3HAEH 3SBRA 3G6AA 3F62A 3QJTB 5DC2A 4EDXB 4YDKH 2Z4TA 2YA1A 3UTPD 4ANUA 3GUTB 3GSOB 4PJ5B 4I13B 3OZ9H 2EUXA 4HUUA 4Y9FA 4S0HA 3WEBA 3VACA 3GSWB 1NFIA 2A4ZA 1QI5A 4DSYA 1IL1B 1KV3A 1KLFA 4EUPA 2Y5EA 4G43B 5CEYA 1NCCL 2HT2C 5HD8C 1ITCA 1MQKL 3MJ7A 3X2QB 1RJLA 2E4FA 4CBZA 2UYLA 1NM4A 3S34H 1ZXKA 3HBZA 4LNRB 3OR7A 3MV8B 2O5XH 2QPUA 3EZJB 2X9ZA 4KI5F 3D1MC 5TPWH 1OF2B 5HHQA 4L0ZA 3BH9B 3QEQE 1FNSL 2XUWA 4G6KH 2JB5L 4OLWL 4PP2B 2DWYA 3DHJA 3F83A 3DMMD 3KEHA 1WSST 5DA0B 4KVCL 2YZ1A 4E5XA 2OULB 4PJAA 3OLGA 1UWEL 3QUHA 3FRUA 3APDA 4AUUA 1XBDA 1FL6B 3QUXB 2WKOA 2W0FB 3N42B 4YDJB 2XA8H 4GKNB 1IC4L 4IIQC 2VXSH 4PTTB 3SJVA 1FFTB 5F9OL 2I69A 4IBVA 5B8CB 1DBMH 5J6GB 1FGNH 3GSRB 4OH2A 3GLEA 1PS3A 1Z66A 5K69A 3CFNA 1ORQB 3NTCL 3NA4A 2PYEA 4HJ1A 5I74C 1MCEA 1QOKA 5D8JL 3C5ZC 3C6EA 3K6DA 5EIIG 3SE8H 1FJ1A 1TLKA 5LNEA 2R0LH 2BS9A 4PJEB 2JKSA 3VD4A 4RBPK 5EN2B 4KDVA 2FJFB 5B7FA 2LOEA 8FABB 3VXMB 4JFDB 4MTMA 5G55A 1PVHA 1UB5A 2EC9U 1IAOB 3ELAT 3V4VH 3ZHLA 2Y07L 4B9JA 1DSFL 3L3HA 4S0TD 2WBJD 2IH9A 2NR6C 3MRPA 4NB7A 4OZFH 2IGLA 4U7MA 2A74B 3H55A 4J2XA 4FXGB 3V0GA 4PJCF 5E8DH 2WXPA 1R3IL 3WDIA 3DIFA 1ASQA 1QVOB 4MDRA 4WI8A 2CPCA 3BFQG 4L4VE 35C8L 1MLBB 1M2OA 4QRRE 5AB1A 1MZZA 2ZKHL 3LMJH 2BLFA 5ELIA 2BSSB 2Z31D 1KT2B 4LKCB 5IMOB 3WHE1 5MERB 4HT1H 3MJ9H 3OC8A 5EZIH 4ZI8A 5JZ7C 4PY7B 3TEXA 5C07A 4WEMB 1KGYE 4QF1B 4RIRA 3OKLB 4XVUD 3KPSA 3ABZA 3QCVL 1JRHL 2CR6A 2YPLB 4N2OA 3C60C 4FEIA 4XX5A 5JIMA 3MTXA 2DQIL 5EO9A 5FYKL 2ETWA 4BSWB 3BWUF 3CUPA 5HDBB 4QF1A 2PWGA 3T4AA 2V9UA 3WDHA 1RIVL 4XMLL 1CYWA 2BIOA 4R5XA 1FYTD 3VFUB 3T09A 3WE6B 5C1MB 1AE6H 1ZVYA 2BOBA 3BFWA 3EFFA 4KKCD 3FPXA 4NX0A 4OLVL 1S9VB 2X4OB 3N40F 3TBYB 3WS6A 4DESA 3VGHA 3VD0A 4ZYKB 3JYBA 4F7PB 3VXME 5F7NC 5DRZB 4KV5E 1ZY9A 3UADA 3WFBL 3QIUC 2HRGA 1CLZH 5HYJD 5HVHB 1UJ3B 2PW1B 1SJEB 5DZOA 1IAMA 5I1JH 3QH3B 4RDQG 1FC2D 3WGVB 1J9TA 3EYOA 3KPMB 5LXGL 2FR4B 1CGSH 3PNRB 2MPAH 2LW3A 4XCFH 3V0AC 3RIFF 2EECA 3HLKA 5TDPB 5E08L 2EDEA 3KDMA 4NJAL 5IFHH 1UXMA 3D87B 4L3CA 4XRCA 3LZFL 3G6JB 3FN3A 3IMTA 4IBQA 4FQ2H 3VAEA 3VH8G 1ESOA 1I75A 5LAXA 1PLCA 4Z7NB 4XPHL 3QQ4A 2YR3A 3KXFA 1S2EA 5L6YL 1MAKA 2BVUA 1FNGA 1O7VA 3ZKMD 4X8JA 5HHPA 4HIJA 3VGAC 1BV8A 3W0WA 2VLRD 4XNYL 1UACL 1AGDB 3N1GC 5KVEL 3O3EB 1R75A 5DHEA 4ZAKA 1YEKH 1G9MC 3K8MA 4DP2X 1ZOXA 1YJDH 4Z7WE 1EEQA 1QSVA 4GSRA 4NOFA 3TV8A 5TH2A 2P24B 5AKRA 2B7DT 3EFOB 4QCIA 1UOLA 2AJUL 1E5BA 3K1DA 4R8WH 3RWFB 2ZCZA 3QJZA 3PGCB 3IJHA 5A2BA 2V9TA 1K8IB 2DKSA 4NKOA 4W6YB 3K2UH 1J8HB 2PCFB 1TJGH 1FC1A 4DEUA 3DARA 5KSAA 2COVD 5C0DB 4K3JL 4P46B 4M1GH 3RVTC 3MROB 4DVRH 3BE1L 1JXJA 3S3DB 2EIZA 2NY2B 1ULVA 5DD1L 3CFUA 2BSRA 3MUGA 4U1GB 2R2CA 4JVUA 4NWUL 5F1NA 4HH9A 1HXYA 3TL5A 2RAMA 5FYKE 3INUH 5GS2D 4M48L 1E2ZA 1GGBH 4LKXB 4LL1A 2GUOA 1N9PA 4OTXH 1JGLH 1XCWA 3DVIA 4LVEA 4MJJA 1AQKH 1BBDH 5LGJA 5IKCB 1CFSB 2X7LA 3BX7C 2VJ0A 3TJPA 4MNGE 1CFNB 1UT2A 1U8CA 4P59H 5BJTA 2W9DL 3F04A 5DO2C 1E27B 1F90L 2X4UA 3BRGC 3F00A 2VJ8A 1I85C 3WY3A 2GJZA 3NCJH 4XWGH 4PWGA 1KXQA 1E4HA 3C60D 5IB4A 2JWYA 3KYMB 5HHQB 1H3VA 1OB0A 3REVA 4LCCC 2LU7A 3ZU8A 3MV7D 4JFOB 3VU2A 4AW7A 2YPLA 4GH7B 5AYTA 3FO2B 2FVNA 1P5UB 2NCEA 3OM3B 3QG6B 5DGQA 2A9NH 3C5JA 3DXAB 2IAMA 1TQWA 4JHWH 5T8IA 3DVFA 3V8CA 3V6BR 2XN0A 2K8MA 5DYFA 1DJIA 2C9VA 5JIIA 2ESVE 2LE9A 5E0FA 1GGYA 4XR8C 1M2VB 2DD8L 3K91A 1CLCA 5FS5A 2X87A 3OKOB 1KPVA 3OMZA 4U3XA 4XBGB 4HJJH 2LU5A 1T89A 3TBVB 1WPCA 3QEQB 4DF9A 1KEGH 3H9SE 1GKOA 4GAAA 3NZ8B 5GS3A 1H8SA 5FDWA 4BFNA 1CXKA 2AJSL 4Z76B 3LRSA 1R1CA 3WAKA 4M7ZB 5FF6A 1MWAH 1TTRA 2EJ1A 2Z91B 1FFRA 1R4XA 5IR1B 1WFNA 3IFOB 4HC1A 1M05B 4YSEA 3GDBA 1HS6A 2JVUA 3CN1A 4DIXA 2E7BA 1CL7I 3A4FA 1OT4A 4I18C 1Y07A 4QHLB 2DM4A 3I9IA 4ABQA 2P9RA 2DMKA 5DVKA 3SODB 4DN3H 4YHLH 1M05A 4PWEA 4P8QA 3FT4B 2YKKA 5IV2B 25C8L 4HKBB 3ZKMC 2IBZX 4HCGA 4MA3A 1V27A 2BNQD 1J05A 3BISA 1D5MB 1VADB 5JR1H 3EOAB 3FSWA 3FTXA 3OG6B 4P99A 1Y6KR 5HDLA 2YGVA 2VDOH 1YDPB 1ORSB 1U2CA 1EO7A 5H4ZA 4PGBB 5F7YC 5FGCB 5C07D 1LD9B 1OSPH 5C0ND 2VN6A 3EJPA 5J3HD 3DRQB 2ZCLL 1EHLL 2DTMH 1NCGA 3V4VA 5L88L 3MGAA 3MRBA 3MPCA 5DJAA 3ZIYA 1PD6A 5JTWA 1JZ5A 5F3BB 2ZTBA 4OZGF 3QZWG 1TETH 4B9KC 4JY5L 1CLZL 2H9GB 4ZZKA 3R18A 2D7NA 4PJIE 4XN9A 1PLGL 2RALA 3LQZB 5DJAB 2V5RA 4MRBA 1E4XI 5KSBF 1R5WB 2NNCA 4QJ4B 2AJXH 3HPJA 3U82B 1NBZA 2CD0A 4W9IC 3SY0A 1TU2B 2QSCL 3X1BA 3P4MB 4TQHA 1T1ZA 1CL7H 1CGTA 4LSDA 3IXTA 2XZCL 1AR2A 1NGXA 3FO1A 4UIKL 1KBKA 2AXHA 5F9WB 1EMTH 1YYMH 4J6RH 3US0A 4Y16A 3MYZA 4FXKB 4HAKA 5C0AD 3SDXA 1EXUB 4DO6A 4H26B 1DVFA 1PPIA 5JNYA 2D9QB 4QOKE 1ZPUA 3BN9D 1ZKAA 2EEFA 1IGML 3DGGA 1FN4B 3CFJA 3ETBF 4LT7A 4Y4KA 3W0WD 2WN3A 1PNDA 2QV2A 5HGAA 3MV8A 4U6VH 2KDGA 4JFOA 2FJUB 1QNIA 4HCIA 2D4DA 3IJYB 4EOWH 3VXTA 1FSKC 2YOAA 5GRUH 2Z64C 3LB6D 3LPGA 4HPHA 1EANA 5A2LH 3FQYA 5EPMB 2GJ6D 4J7RA 5E1QA 2C9SA 2I07A 3GXFA 3FRUB 1K3ZA 2YA0A 4F5CA 5EEYA 1RUMH 2VW4A 1G9NC 1VGEH 5F70A 3CZKA 4X9HA 4B9YA 2A9MH 3BE1H 2BNRA 2UVFA 3TF4A 5ICZB 1NUGA 3FSVA 4UILH 2EINB 1TTUA 2GUYA 3MRCB 4ZFZB 2D0HA 2FYYB 2X09A 3OHXC 5D7HA 4EKXA 4P5TD 1X7SA 4YK4B 3U83A 4X42A 3S88L 3DYMA 2G9HB 4L1TA 1Q0EA 4IRJB 5GSRA 1A4KA 4ZMZA 4FQXC 4LDCA 4OKVA 1XF1A 3ARFD 4N5EC 2FATL 1B4JL 2MIZA 2Z8WC 1HESA 4JFXA 4NGHL 2BP5M 3NCJL 4K71B 1MW2A 3BVNB 1JHTB 1P7QB 5IT2H 4ONHA 2DICA 4YFDB 4MVBD 1WT5A 1TLMA 4ZMQA 5AALA 3TN0C 5T1LB 2B1HH 1C1EH 1AGBA 3ZL4H 1BAFH 3VFRB 3BWUC 1B9ZA 4LDLB 1JYVA 2AVFA 4I1RA 5LGJB 5GGUA 4IGBD 4F8OA 2D7OA 1J5HA 4XAWL 3A6BL 3OD3A 3SE9L 3I9GH 5D55A 4LCWA 2CXKA 2OBGA 2DKUA 2JELL 4MS8C 2JMRA 2IDTA 2PO6B 1P1ZB 3LZRA 5I8EB 3V4PL 4UZSA 5HHOA 2HTKC 3KLHD 4KJWC 4CNIB 1QLRB 3QUYB 3TYGH 5TK2A 3BKYH 1C5DA 4KJWD 4PAZA 4GI8A 4GAGH 4PJ5E 1IE5A 4GRLB 1CI3M 2IGFL 3T0EB 1HHGA 3DTUB 3NPSB 3TASA 5C0EB 1DBBL 2A6KA 1U8HB 1I9EA 3D69A 3QIWC 4XPGL 5CJQH 4I0PB 5E1AA 4KXBA 4OT1L 5D71L 4H0HB 5TGBA 5INDA 4MNGB 3TA3D 3TA3B 5DJ0A 4ORGB 4XNMA 4XNXL 4E41E 5EOTA 4MBOA 1J9QA 3TH3T 1K4CA 4PR5A 3V0HA 1XGZA 2EXYD 1BXAA 3DX9B 1JVKA 3ENEA 4FNUA 1E4JA 1BLNA 2YAPA 1W6WA 5CEZE 4ZJ9A 4FERA 4WNJA 4CMHB 3X13B 3OLIA 3DX4A 4NJ9L 5FPIA 1JERA 1F11A 4TNVK 4QRPA 5IIEB 5EZOH 4TV3A 3D8MA 3NJLA 1OK0A 2XCMC 1HINH 5DEGA 4HIQA 4X4XA 5AKVA 1EX0A 2O6EA 1K3IA 2WLIA 4OCXL 2QMKA 3DURB 4Y19E 2H32H 2HXAA 2NCMA 1PG7X 1MFNA 1NFDE 3ZW3A 4BWTA 3KJ6H 2BZCA 1CU4L 5AD0B 2X89D 3UPRA 2QGEA 3PIQB 4GO8A 3A4EA 1JPST 5TQ0H 1YEDB 2P26A 4QRTA 2Q86A 5HBBA 4JVPA 1CLOL 2OL3B 4LSVH 5I30H 2FLBT 3IU3A 3T2QA 3KDMB 2ZYHA 1TVHB 4KVNL 5IV2A 5CLTA 4BYHA 1E3ZA 4LARL 3N6YA 3OAYK 5DQDH 2G3XA 5FUZH 3L6FB 5A6IA 4QI3A 4NNXB 1VGKA 4JDZA 1M71A 1OGTB 3A6CH 1U93B 2OMYA 4FLOA 2GKIA 4JFTA 4GW5A 5F2FA 5T5FL 2V7HB 4XHQA 1HKLL 1OT2A 2HZHA 1Q1JH 3UJIH 2ZOUA 4PGDA 4Q9QL 5TFSL 1HWGB 3VXRD 2CBQA 1MHHA 4NM4L 2ZONA 4NCC1 1M6UA 1PU0A 3CZSA 1RKRA 2YAFA 2EDYA 3Q2NA 5EU7E 4KTGA 2IANE 3QUZC 3B37A 1WIOA 3T3ME 3SDDB 1A21A 4EVNB 1D5XB 1FL6A 1OGPA 3C6LB 5IM7A 5LGHL 3MUHL 1A7PL 1UATA 3NJIA 4TSBH 2WXJA 4NXSA 4B9FA 4HJ0D 1G87A 3KPPA 4WLCA 2R2EB 2CIKB 2OYPA 5B39B 1ZK9A 1YMMA 5FFGA 2N59A 1YNLL 4P2QD 1KCVL 5CBAA 1AZRA 1AQ8A 1NBVL 4QHMA 2YA2A 5JZ7D 2LV4A 3OJ2C 3TJEH 1ZA3A 1M57B 1WISA 3HZVB 1YNTB 4M61B 3EFDH 1RPUA 1GC1H 1MREL 2ODHA 2E6JA 4RRPG 1AXSA 4YL4A 3QNYB 4ZSOE 5LAPA 1P84J 4HUCA 1REIA 2XYCA 4LASL 2EE9A 3TFKC 5G4NA 3B6SB 4H5SB 2WNXA 1G9EA 1J9CT 1ZE3C 2EYSB 1OARL 1A3RH 3QC6X 5JHBA 3AREA 1TKWA 5IVZA 4MX7B 5IKCA 5L8LB 3S2AA 2N0MA 2UVEA 1WWBX 4HSCX 2PP7A 4ES9A 1TEFA 3AAZA 1TVDA 4UM9D 1DANT 2NXZB 2E27H 1VFOA 4O9HL 4ZMTA 2V33A 2JKRM 4PJ8D 3BMWA 1Q0XL 1GZHC 1IEAA 4V1DA 5DHYA 1OHZA 1LE9B 2JKIS 2KPWA 5I1KH 3TVMC 5K1VA 1T4KA 2K70A 2H3XC 3G5WA 4HK3N 4NQSB 2I9LB 2P5WD 3ZHDA 1MFBH 1RUPH 1IBGL 3G6DL 2C7UA 2QVTA 2HT4D 4LSPH 3AFLA 1OPGH 2P49B 2ZYRA 1BJ1J 1D5BB 5FYJL 3SBPA 4NS0A 2KL6A 1K4CB 4IDJL 4CILA 2NY5H 4ATTA 2ESVB 4NRXA 1IM3B 1BECA 2HKFL 3LZQA 3H4FA 3MGTA 4MQXC 3U7YH 2JJSC 2Q8BH 3VG0H 2CMRL 4BA8A 2K6YA 1G6RB 4ZUVA 3RPIA 1EUTA 1KLUA 5EN3A 1B4TA 1MI5D 4KK9C 3G5ZB 4F7TB 3ARZA 4ZFFB 3ESNA 1A7OL 4AV0A 1U4EA 3UZVA 3U7WH 2HB0A 4ANKA 5IHLB 3SJVD 4BZ2H 5CIPB 1CDYA 2NY6B 1WWWX 3DXAE 1PCSA 2KDYA 4APQD 1BIHA 1RZFL 2IXQB 2ICEC 4W9LC 1MHPL 4JQVC 1L9QA 2R4SH 3MMEA 4OLYL 1KTBA 3FHQA 2H7WA 5LNDA 2X2HA 1SOSA 1XGUA 4QHLA 4PP1D 4AG4H 2V3EA 2LR4A 4IJ3C 5ACZA 1WWAX 5CR8A 5EZLA 3ZGIA 4L1BA 3T6WA 2R0LL 1JPFB 4ADJA 4Z3EA 1YC8A 3GC3A 1CF8L 1F2XK 3QHFH 1JNHB 43CAB 4O02A 4J3OH 4YHZL 2APVA 2EKSA 1ETB1 2JJUA 1B4JH 1FO0L 4FTVE 3VFVB 3R8BB 1TZ8A 2XV3A 2AQTA 4H8WH 5E0QA 1BQHA 2AQPA 3U0TA 2HT3D 4I48B 4U1MA 2X4NB 2ZICA 2JK5A 4JAMA 1WFUA 2RBLA 2XN9A 4P9HH 3IB4A 1ZHKA 4HIEB 1GW6A 3ZL4L 5LBGA 4HV8A 5IFJB 4PFEA 4LEXL 5I1AA 2YO3A 2CO7A 4NXKA 2ZP9A 4FNTA 4P2RD 5J56B 4QRBA 2JI1A 2CDFB 3EJRA 4OQ1A 5AAPA 3RVWD 1NPNA 3QIWA 5A2IH 4OR1A 1FI8C 4Z7WB 1TTAA 4OQTL 5E8NA 2VDQL 4YHIA 4G80B 5C3TA 3S8FB 2XG5A 2IGTA 5L9DH 2ZXEB 3D12B 4ZDHB 5CGBA 4YHOL 5EBWA 2QKIA 3ARSA 3DOHA 1GGCL 4WJ5A 4QXWA 2VR4A 2Q7AA 3VD9A 1D7CA 1QEWB 1ZEAL 4G8EB 3K4ZA 3NFSH 3TWCH 4G7YH 1TJXA 2XTJB 4XODA 5DK0A 3IXAA 3LRLA 1W72A 3KWVA 3SHSA 4ODWB 1R3HA 2YD8A 1JYNA 1XGYH 3QNXA 5C2UB 4MQSB 5D2LE 4S1SH 5JOEA 2V3DA 2CU9A 2EE0A 2H8PB 3S3CB 5AVXB 5LBVA 1QBBA 3TO4B 3TZVA 15C8L 3ZKXB 1OAXL 4X5RA 2VYRE 1HXYB 3FMGL 3ZKND 1FRGH 4F57L 2JJVA 1A1NB 3CFCL 2V2WB 1UGNA 3A4DA 5AZ2H 1NMAH 5DRWB 1IQDA 3RB5A 4MZ3A 1IZKA 3OZ9L 3IMRA 4PJ5A 3U6RA 1BQ5A 5MEOB 2XQYG 2I5YH 1VIWA 4OZGA 1E8XA 2OXHA 2A9DA 4URKA 3F7RA 2CK0H 4M5YH 4LHJB 4LIQL 1N18A 5T3XL 4K8RH 4UTAA 1RJCA 3LHPH 3P9MB 4NCDA 2EEAA 2JJWA 3H42H 4IKNA 4JO3L 4Y5XA 3T0VA 4DUVA 2XKNA 1FVCB 4JZNB 1UA6L 4XVOA 5D5ME 1WBXB 3EH4B 1R17A 3T0BA 3LS4L 4P06A 2BJML 4UBDD 2JJTA 4FQ1H 2ZKXA 5LWYL 4P23D 4Q8BA 2PKDA 5CU9A 5HTSA 1JDDA 1NINA 1D5IH 1AYOA 3MRCA 3C6LA 4ZFZA 5DJ2B 2VXTL 3ZE1F 1F3DH 4M5TA 1HI6B 1T04B 2Z9TA 3D4GA 4M93C 4GAJH 1BX2A 2X0VA 1AXTH 4AEHH 4KPHL 3L3JA 3TBVA 3V4PB 2F1BA 4DFHA 4AXWB 2KH2B 4K9EC 4RMSA 2GSGB 4WI0A 4AKOA 2XKSA 1E65A 3U9UA 3ECVA 3LN4A 5IMLB 3MRPB 3MBXL 3U1SH 1G5GA 3C12A 2BO0A 1JPFA 3F7YA 4QRSA 3JWOH 4M3KB 5AAWC 1V55B 3MUJA 2OTUA 4O02B 3GMRB 2Y23A 2VISB 3CZNA 2R0ZL 3NSCA 3VFNB 1ZT7A 4FI6A 1GMEA 5E8PB 4XNAA 3U9PH 3QE5A 2AQSA 4KDTA 4UT9H 3SO3C 4G83A 2F19H 1SFDA 4PRDA 1YUHB 4N6RB 5DVOA 4YEEA 4RZCB 2WWKO 3F7YB 5EU6D 1XDTT 1A7QH 4B0MM 1YEGH 4AC4A 1KN2H 4MA1B 4LCWB 5BXFA 1Z3RA 5ERWA 2VAAB 1DN2A 1QWHA 1ZSDB 1A6UL 2XLLA 3U4BL 2VLJD 4ZW3A 3IFLL 2MCAA 2ATAA 1HAWA 2PMZA 4N85A 1T7YA 4MBRA 4UB0H 1JZEA 5BQ7B 1FYTA 2WXQA 1C5DB 3MRIA 3SCMD 1IZJA 4QCIB 4WI6A 5LCVH 1YDPA 1WTGT 3O9WC 4B7IA 4EN3D 2YPLE 2ICCA 5ITBL 1OO2A 2XXFA 3S35X 5DS8B 1DBKH 3QFDA 3QAZB 2CDGA 1NCIA 1QRNB 2BRQA 5E2WH 3MLSL 4JG0H 1DUZA 4IRSD 4WW2C 1WITA 2NUTB 4XZ4A 5E6IB 4DUWA 4K5PA 5HVFB 2HG5A 4OFKA 2ESVA 4WWKB 3RFZB 4P46A 3UOAB 1U8IA 1CFMA 4BCYA 2EH8L 3AT8A 2O93L 3SKOA 5B21A 3U2IA 4TOYH 1I1YB 5HYIA 2GK0B 3PDDA 1KIPB 4OLYH 5IOPA 4FG6D 1NBYA 3ARBA 3BUYA 4WWKA 4WV1C 5J3HC 4ZNEE 3AU0A 5C0NC 5IQ9B 3ARVA 3RDJA 1BD2E 4Y4FA 1JD9A 1GAFH 3FUKA 5DTFB 2MHAA 2NX5D 4AZ8A 3VFGH 2Q9OA 4GXVL 5CLXA 2XWCA 2DD8H 2NSXA 2FRGP 2W95A 3L5HA 1UWGL 1TXKA 3KPLB 4YWGL 4H8WL 4LB8A 3SDCC 4B9IA 3IF1A 2VDNL 3O2VL 1ZHNA 4QLRA 3LNGA 2X44D 1E4XL 1KYOJ 3RILA 1NUFA 1BYPA 4NKQB 3FT3A 4QEGA 3V5DA 4UINL 5J13C 1RJYB 3GSXA 2P5WB 4I3SH 4LPUA 1DSYA 2A99A 4QGYA 5AAMA 1PZ5A 2DYPB 3OBAA 3IMSA 4WFEE 3CFMA 3I84A 3F7PC 4Y1AD 4ZMOA 2AXFA 3K8KA 3R4RA 1YEGL 5AVTB 5TDNA 5JW5A 1KN2L 3D52A 5EUOA 4ABWA 1UM5L 4QD2E 1U9KA 5IMKB 2G3NA 4GW5B 2IDSA 4AV5A 5JHLA 2OA9A 2R2BA 3IN0A 4NPYB 4CMHC 2BCKA 4DGIL 2A9AA 2EADA 2BP3A 2UXFA 5AVYB 1UD4A 3FC8A 3FO9A 3FQRA 4FS0A 3BYYA 3IDIB 4PJ9A 4F27A 3SPJA 2APWA 3FKUS 4H25A 25C8H 1I1AB 3O3BB 4Y5YA 2K7PA 5D1XC 3GRBA 1ZEAH 1E6JH 1RVFL 2W0FA 4L1DA 4ODSL 4X50A 4X4MA 3AXLB 4AYEC 1ZT4A 4JY6A 1XSOA 3EDDA 3QRLA 4DK6A 2PPFA 4NP4L 3ZYZA 3DK2A 4RWYL 5AG9A 1A6WH 2CLVA 4PRNA 3B2DC 5EOCH 1CS6A 4N4YB 1ZLDA 3J7HA 3W5MA 2FWOB 3F84A 4KNSA 1LK2A 2DQUH 3O6FD 4JQXC 3BSZH 1UM4L 4POYA 4HDIB 3BMVA 1EK3A 3IJEA 1WGOA 2Q3ZA 1JFHA 3CFCH 4Y1AA 4ZMWA 5GS0D 3GFUA 4H44C 3W5NA 1S9KC 1CD9B 3HOGA 3UYPB 2XJKA 5J6HA 5CJ8A 4JDVA 1TJIL 3FTGB 4E9RA 4ODVL 4C56D 4XMTA 3MC0A 3PXLA 1FDLH 1KCSL 2ED6A 2K8QA 5GGTH 3QDME 1BCIA 4WKZB 1X5KA 3BGFC 3LDBC 3SN6N 2WQXA 2ADGB 1DQTA 1JGLL 3FB7A 4RAVB 4R83A 2WXKA 3IRZA 4JFZL 1D2PA 2CLRB 3WJMB 1PZ2A 3MX0B 3EUUA 4M5ZH 4KITB 5IMOA 5JOPD 4I8DA 3ZR5A 2H1XA 2N1KA 2VLRE 2WMPA 3DMMC 3D0VA 4X98B 1MFDL 2FEDC 4GKLA 1LE9A 1MFEL 5CCKH 2PO6A 5GHWH 3QG6A 5DS8A 1NLBL 5JOFA 1D5IL 1TJGL 3T0WA 1S7QA 2R7EA 1WV7T 1AFVH 4MMZA 1MFUA 1C5BL 4GYBA 3RTQC 1UEYA 3UAJD 3ESMA 2NY0B 1TJMA 1A7BA 1U30A 4ZFQA 2C3XA 3C09C 1HQRB 3QXAA 1BMGA 2BW5A 3O6ML 3FQ4A 5K39B 2E7HA 4NN5C 4AENB 2DEXX 4JLRB 2WXMA 3VG9B 3AW5A 4FL4C 3JV6B 4MAUL 3G5YB 3LVEA 5D1ZI 1CGYA 4E41B 4KFZC 5DS2A 4GRMA 1Q8MA 1WK0A 3QJHA 1ZLVH 5I8OL 1PZCA 2ZOLA 3AITA 5IB5A 4HXBH 1SJEA 1W15A 4IEFB 1E3FA 3PPEA 1MWAL 1NEZG 2KPNA 3BPCB 4OZHE 3VXSA 1G6VK 5FYKH 3HNVH 3KGSA 3UC0L 1OAKH 1I9RL 1H15B 3EO1B 1JL8A 2C1OA 3AZUA 4ZXBB 4JDEB 5AB0A 4KY1L 3QPXL 5AD0A 1QBMH 3CSPA 1CTOA 2W0KA 3RUGF 2VOTA 4RGNC 4RNRA 3ARDB 4N87A 3LXAA 2HLFD 5HHVL 3ARDD 4Y8AA 2ENYA 4NZUH 4WV1A 4AQ1B 3ROLA 2RTTA 5D6CA 2GYSA 3H9ZA 3NCYP 5EPMA 5KYWB 1RZIB 1YQ2A 2E3VA 3CWGA 3KBFA 4LU5L 2YXVA 2IPKB 3U1SL 4MHHI 3VW3L 2A6IA 2WPGA 3KEDA 1ZVSB 4PVLA 4D0DB 3T5WA 1OAZL 3DBXB 4NKDA 4L4TA 3QUXD 4XMZA 4YX2H 4P4RB 4D9RE 3PWNB 4IGBC 4IGBA 4UQ3A 4NO2A 1AGDA 1KENH 3B9DA 3BIKB 5AB2A 5IGXL 4LOFA 1IFRA 2C7FA 2R59A 4Y5VC 4PJFA 1NANI 1L0QA 1E4KC 1CLVA 3MKKA 1AD0A 5BRZA 4NHCH 2WLKA 4M5SA 3BYTA 2VWEE 3PGFH 3AVEA 4U0RB 3FU7A 1L0YA 3OQ3B 3ZY7A 3S5ZA 3WNPA 1AGFA 2FZ3B 1TNMA 2VZSA 4GQRA 3Q06A 4BV1A 4DGVH 1OCWH 4Q9BA 5IB1A 2NSMA 1OSEA 5D1ZD 5EO0A 3BQUB 3VRLF 5L8JB 1YECL 3GRWL 3SO3B 2YRPA 1ZA3B 3BVXA 3OQRA 3Q1SH 5F8QC 1F00I 2Y5TA 4G8GE 2MQ3A 4D7PA 4XCCL 3BGFB 5H37H 4EOWL 2XG4B 4FFYH 2IPUK 4HEPG 4KTDL 1C08B 1MJUL 1RUQH 5HI4D 4MA8L 2NR6A 4DW2H 2KBGA 4M43H 4UAOB 1MLCA 1RMFH 1THCA 1EXHA 1MI5B 4YHNB 1KIRA 5SX5K 2EE2A 5L88H 2BIHA 1Q9OA 4YAQB 2DN7A 5MENE 1F4XL 1RV6X 1CFVL 2VRQA 2WXRA 3EJTA 2JQZA 4KTEL 4LMQE 3ZZQA 4HCRL 4Z7NF 4X80L 6TAAA 4NBZB 5B1BB 5F88B 4H1LG 3SKNA 3U6XA 2JJTC 4NPYA 4JO4H 5F96H 4N68A 4RIRB 5IREA 4IYKA 5L0QB 3WIHA 1BLNB 2AMUA 1MFAL 5IBTL 3HG2A 3MJWA 1N4XH 4XP4H 4Y5XC 2AJYH 3JV6A 5KSBA 3EXLA 3D5OF 4FZEH 2WY3B 3BAWA 2PPDA 2RH0A 3KPRA 3HKZA 2BVOA 2OMWB 5FA3B 3L3DA 4KKZA 1KCVH 2B39A 3NK3A 4PRPB 5TF1H 5D72H 4HQQH 3FFCE 5JIKA 5HDWA 4G8FB 1TJIH 3CFTA 4FLHA 5HDQH 2GJ6E 3WO4C 1FGVL 2ITCB 1LO5B 1CPUA 4S2SB 3W39B 4KK8D 4MJ4A 4OKVB 1G6RA 3WFHB 2AJVH 4RFEB 4YXKH 2D73A 4H88L 2YS4A 2FYVA 3LRSB 4PBVC 4D94A 1EH9A 5I23A 2C9AA 3S97C 1KJ2H 1XAKA 4X9IA 2W07A 2Z6FA 3E6HA 1ET5A 4XNQB 1RK7A 3VH8B 1SEQH 2F18A 1NGZB 2DQFB 1QD0A 2WNGA 3AUWB 3GO1L 4HU2A 1MFDH 3D25A 3H3PH 4JFFB 3VRJB 1U93A 2OMYB 2YUVA 3FB8A 4A37A 1DBBH 1IBYA 2H1LM 3D3VA 3WDJA 4ALAC 5B39G 4FQHA 4HH8A 5HYJE 5SWSD 4G1EA 2R4RH 4P23C 4TL4A 5DYOB 4V11A 2XJLA 1EEYB 1KPRA 1JZ6A 1CT8B 1EVTC 1VPOH 4KMQA 1WBZB 4AM0Q 4WHTA 1PX4A 4PJBA 1AQMA 2YUXA 2CG9X 4P46C 1S3KH 4NZ8A 2A83A 3O4LB 3ZGHA 5ESQA 3ULUH 3HZKB 2FX9H 2IDCA 2A7BA 4FTVB 4JM2B 1JF6A 4EI0A 1WCBB 4V1DE 1I1FA 3DGCR 5BZXA 1KYOK 3RNQA 3SE9H 2PO6D 2W0PA 3BQVA 5IB2B 2KZKA 3LAFA 1UYWL 5E95B 5B38B 1DANU 3KVPA 5JOFB 1M7UA 4RMUA 3PXHA 1LWJA 1BPVA 5KW9H 1DP0A 2ZX9A 1N4XL 3SGJC 5I1LB 4F91B 5EULV 2WXGA 4NQDE 5E70A 3VG0L 1LVEA 4LSQL 5I8CB 3GUFA 3GKWL 2QELA 4JM2C 3L2NA 3QAQA 3O9WB 4D8PB 4I7ZC 4BA0A 5HP5A 5FB8A 4PS8A 1QLFA 1PYWB 2DZEA 2MTPA 4JB9H 5HDQL 3ET9F 2BY1A 2UZXB 3VXSD 1W0YT 5T1MB 5ISZD 1NBZB 3M1BA 2N3JA 3NJGA 4P4KB 3QCTH 4JPKL 5JPNC 1MCKA 1XR9A 4XX1G 3WEXB 5HYQA 1OP5H 4KRNA 3T1WA 5KBNC 1VFBA 3LIUA 4IJ3B 4Z77B 4Y4FC 4NO3B 5AW6B 1ZMYA 4WTZG 4MNQE 4JQVA 5E00A 1YN7A 1DBJL 4MYWB 3KNBA 3KPQA 2ZG1A 2HRPH 2GTWA 2X12A 3SDXB 1T4KB 2ZUXA 4K2UH 4MQ7A 1ZT1A 1Z32X 2WYTA 5KJ7E 4QXTA 5IBLD 3DO7A 2NY3C 3FQNA 3DDGA 5D71H 2QHRL 4XB3A 3KG5A 2CA3A 2R0WH 3FB6A 3QIUB 2NDFA 4OF5A 5EU4A 2MOVA 3JYCA 2AEPL 3K71A 1DDHA 1XGRA 5F1OB 5ICYA 4NO5A 4HSQA 1HQ4A 2PXYD 2XZCH 2QFRA 5GJSH 3VYNA 5BNXD 4YSUA 3QWRD 2UXGA 5T5NG 4PREB 3IPBA 3QHZL 3QORB 3RDTD 2XN9E 1EPFA 3IDIA 1F97A 1SN5A 2G5UA 4H8QA 5C09A 4E41D 2PPEA 1RZGB 1DDHB 5J6SA 2VLJA 2I26N 2OMWA 3BPLB 1RAMA 3QEQD 4M4RA 1A1OA 4FQCH 1YN6B 4JHAL 1ODUA 3NJXA 3HN5A 3EYFB 3V5HA 5JORB 5F9DC 1THAA 4YN3A 2PCXA 4NPKA 4AYGA 4CL7A 1JS4A 1T7XA 3L3OC 1NFDF 3MLYL 1KJ2B 4MZRA 1ZVNA 3O8XD 1DQMH 3FU7B 1KJVB 4KK6D 4ZS7H 5T1JA 1LLAA 1IVLA 4QAMB 2VLKA 2SEBA 4O2EA 1H8OA 3X14A 4M6OH 3H4HA 4NM8L 1FUNA 4HLEA 4HWBA 1HXMB 5I17B 1JHTA 3OMNB 2ENPA 2Z3FA 1FHGA 5C0IA 3EG9A 2Y7QB 4C58B 3IBOA 5AB9A 3G6JF 1T03H 1PCXA 3OB0H 2XPGA 2XZQH 1L9TA 4UILL 2DM2A 5D7KD 1G1CA 3IVKA 1AHKA 1S7WB 2QQKH 3LS5L 2BVPB 4QHKI 1SYSB 5J7CC 5A2FA 1I8LA 5JQ6H 2A6JA 1CCZA 2JIXA 4LLAA 4R97C 4FADA 1ZS2A 4N90D 3NTCH 2ZCKH 5I1DB 1ED3B 1QWUA 4PGCB 4L8CA 2Z92A 1V7MH 1VFAB 4ELME 4K8RL 5ISZB 5HPOA 1NMCC 2ZPKH 1CBJA 2I9LA 3DX1A 4L9LC 4L2LA 2G4GA 5GPRA 2VRKA 4KKLC 4DEPC 5C3IA 1EDYA 3BT2L 3QEGL 5AEAA 1MWAB 3RAJL 5IHUL 1B3JA 2A6KB 4C83A 2BS71 1AKJB 2F58L 1WC7A 3LQMA 3QUZB 3T0EA 5BQ7A 2B1HL 5E03A 5LDSA 3HBQA 4IRZL 2W65A 4G72B 4O5LL 1JGDA 1F3JB 1LEGA 5HDBF 1FA4A 4MSWB 1D7DA 5EFIA 3L5WA 3P9WB 5E7BA 3T6XA 2H47C 4J4PA 4J39A 5D7LA 1RIVH 3M1BB 3JV0A 3PU7A 3FOMA 5KVDH 1ZA6B 1JGEB 4S1DD 1T1YA 1CICD 1HL9A