1JOIA

Structure of pseudomonas fluorescens holo azurin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECKVTVDSTDQMSFNTKAIEIDKSCKTFTVELTHSGSLPKNVMGHNWVLSSAADMPGIASDGMAAGIDKNYLKEGDTRVIAHTKIIGAGEKDSVTFDVSKLAAGTDYAFFCSFPGHISMMKGTVTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords AZURIN
publication title Crystallization and preliminary crystallographic studies of the crystals of the azurin Pseudomonas fluorescens.
pubmed doi rcsb
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1997-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1joiA00
2H5UA 4BWUA 4YSTA 4Q8BA 1J9RA 1MZYA 3PXLA 1SFDA 3L45A 1MG2C 1JZHA 2YXVA 2XXFA 4DPCX 4DPAX 2I7SA 4X4KA 3S8GB 4UF7C 4AZUA 3FU9A 1OE3A 1AS6A 1B3IA 1SDDA 3CDZB 1AR1B 1J9SA 4BWTA 1BXVA 1T5KA 3NJLA 4WKXA 3N2JA 2P80A 5ANHA 1JXGA 2GI0A 2X87A 2XUWA 2EIJB 1MG3C 3NSCA 4AKQA 2DWTA 2HLEB 2J56A 1JVLA 5F7BA 1BAWA 1PLCA 3RYMA 2DYRB 5A7EA 1IUZA 4E9QA 4WTQA 1EZLA 2WO3B 1DZ0A 3OM3B 4KO9A 1NINA 2BP0B 3IEAA 1UATA 2VW6A 1KCBA 5I6LA 1AAJA 1OCCB 2Y1AA 4YSDA 1NIFA 2VMJA 1E5YA 1JOIA 2FJSA 5TK2A 4ENZA 3OD3A 3NSYA 4PCYA 4HCFA 3FQ2A 3X1GA 2XU9A 2IAAC 1L9SA 2FQFA 5F7AA 2DYSB 3X1FA 2BP8B 2N0MA 1OCZB 2HX9A 1GY2A 3JT2A 4DPBX 4DP4X 2HXAA 2YAMA 1AACA 3CVDA 3SBQA 2XV0A 2IDQA 1PZBA 1N70A 1W6WA 2AZUA 1RKRA 2YARA 1MZZA 3FYEB 4UANA 3S3DB 3UABA 4YSEA 5I6MA 2WO2B 4A2GA 1NTDA 3FSVA 4NERA 4G70B 1BYOA 1GS7A 2QPEB 2UXGA 1ZDQA 3CDZA 5D4IA 1YLBB 1PLBA 1NWPA 1E67A 3IN0A 3FQYA 4F2FA 2BZ7A 1IKOP 4YVUA 3AW5A 3NYKA 5B7MA 4M3HA 4A68A 1SHWA 1AZBA 3T6VA 2WSDA 3H4HA 1NICA 4YSUA 1FFTB 3S8FB 2FQGA 4HIPA 4NAJA 4HAKA 1JZFA 1OCRB 1AS7A 1ASPA 4YSAA 1VLXA 4E9VA 1IBYA 1X9RA 1KYAA 3WKQA 3SBPA 5D4JA 1JVOA 2H47C 1AZNA 5FC9A 2XXGA 3FPXA 3OMNB 3ZBMA 1HFUA 2BP0A 2IDFA 3UAAA 1HAUA 2CCWA 1SF3A 4GY4A 2BWDA 5B1AB 2P80D 5I5IA 1M56B 1BQKA 1V54B 1F56A 1AOZA 4N8UA 2PLTA 1GYCA 2BP8A 4KNSA 1KDJA 1NIDA 2I7OA 4P5SA 1JXDA 2VN3A 3PAUA 1BQRA 1KCWA 3QJQB 1SFHA 1JZIA 1FA4A 2PCYA 1NIAA 2UXVA 1WAEA 1J5DA 2XX1A 3FPYA 3T9WA 2IH8A 1MDAA 4QLWA 4E9SA 2YQBA 1XB6A 1EHKB 1AANA 2H3XC 3FU8A 2B08A 1IBZA 3ABGA 4JHUA 3KW7A 1CUOA 5AZUA 2OJ1A 1ZIBA 2VW7A 4M4RB 4F2EA 3ASOB 5PAZA 1L9QA 4KO5A 2JXMA 2XWZA 3TA4D 1A3ZA 1ILSA 1GS8A 2A3TA 3EH5B 1IC0A 1JZJA 1NIEA 1X9UA 2AZAA 2EIKB 1AG6A 2IDTA 3PPSA 1J9TA 2X88A 3ABMB 4RH4A 5I6NA 4KO6A 5B7EA 1GSKA 3CZUB 3G5WA 3X1BA 3ZIYA 3ZDWA 2W8CA 3V9CA 6PAZA 1QNIA 2VM3A 1A65A 1BQ5A 2YAFA 1SNRA 1J5CA 1GW0A 4GP4B 1A4CA 3MBWB 4A2HA 2EINB 3NJGA 2CUAA 2FWLB 4GP5B 3GYRA 1ETJA 3TBCA 2W88A 4G7SB 1N68A 4E9XA 1A4AA 1WA2X 4KOCA 1PAZA 3D12B 3IN2A 2XV3A 3EF4A 5B1KA 1KGYE 3NP4A 1ZPUA 3PCYA 2BZCA 3NSFA 1ZIAA 3NJIA 1W6LA 1E65A 4DP2X 2HX7A 2PPFA 4DP1X 1ASQA 5I26A 1OCOB 2VW4A 2BWIA 2VM4A 3QQXA 2OCCB 2FT7A 4E9WA 4ZK8A 4CSPA 2FNWA 3NT0A 2J5WA 2LLNA 3PAZA 1R1CA 1W8EA 3NP3A 3SBRA 3OMIB 2AANA 3X1EA 3DIVA 1PNDA 1PF3A 1TU2A 3NJHA 1V10A 1PY0A 5I28A 1NIBA 2E86A 3QJVB 1RZPA 2GC7C 1A4BA 1XB3A 3GXUB 2IWFA 2IWEA 2CALA 1I53A 1M57B 3DTUB 1L9RA 2IDUA 4YSRA 1HAWA 1SHXA 4E9TA 2YAPA 5LDUA 3AG2B 2AVFA 1PMYA 1WS7A 1CC3A 1PNCA 1ET7A 5E9NA 2R7EB 3OQRA 4DP9X 2TSAA 3SQRA 1WA1X 4A67A 1PCSA 3DKHA 1NDTA 1FWXA 4HHGA 2JFCA 5B1JA 3OMAB 1ID2A 3BVDB 5B1BB 1KV7A 4GP8B 4PAZA 2HRGA 3UAEA 1M9WA 4BXVA 4FA7B 2J57A 3FQ1A 2MRYA 2DWSA 3X2QB 3EH3B 1SJMA 3TASA 3FU7B 2GB2A 4QKTA 4A2FA 4KNUA 4YVNA 2XLLA 3NJKA 2TSBA 1XB8A 3QJRB 4DP5X 2ZWNA 5D4HA 1CYXA 1KBVA 4DP7X 5I5JA 4G7QB 4UAHA 1BXUA 4YSOA 2MTAA 1GS6X 3CVBA 2FT6A 3NJJA 1SF5A 1AZUA 3AZUA 4JKNA 3WKPA 4BWWA 4GXFA 2BO0A 3H4FA 1PZAA 2XV2A 3MX0B 3NJMA 3HEIB 4BDVB 1PZCA 3BQVA 1BXAA 3FS9A 2YAHA 2PP9A 2Q9OA 3NSDA 2EIMB 3QJUB 3UADA 1L9PA 4HALA 1ET8A 4MFHA 1A8ZA 3FYIB 4GYBA 4YSSA 3PLYA 1L9OA 2GC4C 5I6KA 3FT0A 2IH9A 2QDWA 3ABKB 2R7EA 1GY1A 2DY2A 2BHFA 4Q89A 1ASOA 3NJNA 4AKPA 2XVBA 3QPKA 1NZRA 1NPJA 4YSPA 2CJ3A 3FSAA 1ZDSA 4YSQA 5AFAA 4JHVA 4KOBA 4KO7A 5I6OA 2IDSA 1KDIA 1OE2A 3PAVA 1NPNA 4YL4A 1V55B 2ZOOA 4CSZA 1AZCA 4BXSV 4YSCA 4E9RA 1BEXA 3FU7A 2PPDA 1J9QA 1AQ8A 2PP7A 3FSZA 2JKWA 1TEGA 2YAOA 2PPCA 2XX0A 2Y69B 5TK4A 4G71B 4KNTA 1NWOA 1WA0X 2QDVA 1OOWA 3HB3B 3WIAA 1CURA 1L9TA 3WNJA 3AG3B 1BYPA 3WNIA 2CBPA 3GDCA 3NJFA 2UXTA 3V9EA 1AIZA 4F7KA 1XMEB 3AG1B 4BDVA 2VSMB 5AKRA 3JTBA 3IBOA 2GSMB 2YAQA 4DP6X 9PCYA 4A66A 2UX7A 4G72B 3UACA 2ZXWB 1RZQA 1CYWA 1QHQA 5I5MA 3T71A 2BW4A 2FT8A 1WS8A 3ASNB 3ZX1A 4AX3A 8PAZA 3C75A 3QJSB 1TKWA 4P5RA 3AG4B 3X1NA 3KW8A 1ILUA 2XYBA 4HZ1A 4TXVB 3T6XA 4A2DA 1ZV2A 3T6ZA 1PLAA 2GHZA 4N4YB 4K9JA 1OE1A 1JERA 2YAEA 3U25A 2NRDA 4AI7A 1E30A 1URIA 3CG8A 4AKOA 2QT6A 2UX6A 1TEFA 2HZHA 2ZONA 4EF3A 3WI9A 1ADWA 2I85A 5PCYA 3EH4B 1AZRA 2FTAA 2J55A 3TU6A 5B3SB 4G7RB 2CAKA 2OV0A 3CVCA 2HRHA 1KBWA 4DP0X 2YXWA 3AY2A 1SDDB 3IE9A 3EHBB 7PCYA 6PCYA 5EHFA 4E9YA 3UGEA 2PPEA 1OV8A 4FAAB 5IY5B 4DP8X 2PPAA 1E5ZA 2QPDB 1JXFA 4L0PB 2UXFA 1AG0A 5B7FA 3ERXA 4W9ZA 2AFNA 4HHWA 3QJTB 4W1TA 5B1JC 5I6PA 1JZEA 2FQEA 2PCFA 2HX8A 2PP8A 2B3IA 3S3BB 2DV6A 1AS8A 2VSKB 1QLEB 2FQDA 3TBBA 4BK5C 2IWKA 4HCGA 1JZGA 1DYZA 4HCIA 4A2EA 2Q5BA 1OF0A 4NB7A 3S3CB 1ET5A 1GR7A 2EILB 3N55A 2RACA 1RCYA 3WG7B 2GBAA 7PAZA 3FSWA 3H56A 2GIMA 3ABLB 2BW5A 3T6WA
chains in the Genus database with same CATH superfamily
1UB6A 5DMGD 5C08D 5IUSA 1VEOA 2O61A 4FERA 1D6EA 3IFLL 4LSTL 3SDCC 3G6JB 4FNPA 3MDJA 1SYSB 3E8VA 5DEJA 4JB9L 3IJYA 1L4IA 1ZXKA 3SE9H 4IGBD 1G9HA 3QCVH 5HDLA 3QPXH 1OANA 1FGNL 5IOPA 2VN7A 1T03H 1IGCL 3RIAK 3C6EA 3LEYL 2FL5A 5DC2A 1E27B 4L8SC 3MR9A 1BX2B 2ATKB 3N2JA 3EJYC 1CLYH 2D73A 1E42A 1FYHB 2GI0A 3U9UB 1QNZL 4OR1A 4XOBA 3VWKD 4S11A 2YKKA 1UWEL 1IGTA 1JVKA 2OSXA 3GXIA 2NXYB 1RZ7L 4X5XA 1ZJAA 2JIXD 1MG3C 3BZ4A 1QBMH 4L4TE 4PV8B 1ERNA 4K9EC 1BD2B 3B6SA 1PLCA 3U0TB 4AWJC 3NCEB 4YDVA 2DYRB 3UAJD 3K6OA 4Y0GA 3FOLB 5D7EA 4C4BA 4A2LA 2ZP0T 4FD0A 1KB5L 4ZO7A 3EDDA 2ZOTA 3DK0A 1NOLA 4HCRA 3S35X 5GS0L 1MQKH 1UATA 3N0PB 4ODWA 3WJLA 2WB1A 4H88H 3D06A 4X6EB 3GM8A 1QLRA 1JOIA 1UVQB 3FH7A 3QO0B 1AJ7L 5FHBH 1M1XA 2YBRA 1K4CA 2DL2A 4TSAL 3DGGB 2Y5QA 1WD9A 4IRSA 1VADB 4Q6YA 3TL5A 1D5XB 3BESR 3ILPA 3L4ZA 2CO2A 2AJVL 3TWCH 1J18A 2GTZA 2N0MA 2VXQH 3IT8D 3MLZH 4KTEL 1LO0L 3P0YH 1GY2A 5J1TC 4H8WC 4LHUD 2HKFL 2XVKA 4GI8A 5BRPA 2EC9T 1OQXA 5D2LE 5CKAA 3EYQC 4JN2A 4XODA 5CZXC 1U8CB 3TNNA 2B4CC 3WHE1 2MOVA 3I6KA 4HETA 5F72S 2ZUUA 5I76A 1RK1A 1XF3A 5DS2A 1CJYA 4HKZB 4ZFZA 2IADA 2UXGA 1QA9A 3QIWC 1PLBA 4Y5VB 4MAZA 3KBEA 4L3ED 4LPUA 1A9BA 1XSIA 2GITB 4JZJA 4NZRH 5HVGB 1TVHB 3BAKA 3JYCA 4G8IA 4B6ZA 2BMKB 2H0EA 4XBPB 5E9DD 4HJ1A 5DO2C 1E5AA 5EU3A 3B56A 4QKXB 2VOTA 4R2GB 2FWOA 2Q7YB 3TJPA 4ZX3A 5HY9B 1J12A 2IF7A 5C6PB 4DAGL 2WQXA 5I6XB 3O0RH 1HFUA 2DF3A 3LQAL 1C8QA 3STLB 3MA9L 1J8SA 1JGVH 4MMXB 1GZPA 3HCVB 8CGTA 2CCWA 1VFAA 5T1KB 2B1AL 1U95B 2G5BB 4N26A 3NABL 1I8IA 1SJHA 2VDOH 4GOSA 3U4KA 5CP7A 4RZCB 4ODVL 3HE7B 3ARFA 3QDME 5KVDE 4XNUL 1EAPB 1F56A 2DQMA 4XNZC 2PLTA 4K8RD 2BP8A 3N43B 4GQ9H 3WJJA 3NA9H 1WBYB 4N5ED 1ZCRA 3WTTA 1HXKA 2NW2A 5C97A 2APXA 2LLGA 3R8BB 4Q52A 4BRVA 1D9KC 3WELA 5KS9A 3M17B 4WV1C 2AK1H 2VDRL 3LEXB 4FCAA 1JN6A 3FQTB 4ELMA 5FO9B 4Y9FA 3MLXH 1MAMH 1WAEA 1FAIL 1HL4A 4I4WA 4K55A 3TCLA 3TVMD 4G7YL 2YQBA 3DYPA 6TAAA 1FG2A 3QUZC 4GAAA 4PJBE 4R97C 2C1PA 3BGFB 3KW7A 4XNMB 5AZUA 3QCTL 1CXHA 4FFZH 4HXAH 1WCBB 2FHBA 5I30L 4XCNA 4MKTA 3IDIB 5PAZA 2YGOA 3K2UL 3ARGB 3M7OA 4X8XA 1S5IH 1XGTA 3UYRH 4YWGH 2JXMA 1SXCA 4C56D 3KGSA 1NM4A 4LCWA 4WHTB 5H35A 1RJZB 2EDTA 3ARBA 1D7FA 4AT6B 2CPUA 5HSFA 4YDKL 2LW3A 2Z31B 2WSKA 4WNJA 4AQ1C 3FQRB 1DQQA 4ISVB 1ES0A 4WWKB 2X88A 3DRTA 3R06A 4JY5H 4U1LB 3X1BA 4PRAB 3C5XA 3G5ZB 1HU8A 4N25A 6PAZA 1LM8V 4YX2H 2IBZY 3ILEA 2EH7H 4UNTA 5E0QA 1OTTD 3BWUC 1LWJA 1WO2A 2K6WA 2KYIA 3I02B 4KKRA 4A2HA 4J6RH 4QRFA 4L29A 5MI0C 5BV7H 3VXRD 1MCFA 4NIYE 2YWYA 3GJFH 1A4AA 2EDYA 1QFWL 1EBPA 1PAZA 4K15A 5TE4H 3V95A 2BX5A 3PHOB 3O4OB 1AO7B 2ROXA 1ADQL 2WTRA 3VQ2C 1YMME 1UD8A 3WIFA 1Z9SA 1N6QL 1ZGLA 1Q72L 4LCIH 3ZUNC 4OZIA 4OAWB 2ZTBA 1ZIAA 4X0KA 3AGWA 5A7BA 2ESVA 3QFDA 4G3YH 4HC1L 4YHOH 2XJLA 1JV5B 4KAQH 4KC3B 2R0ZH 5KJ7E 3RWHB 3FTGA 3P4MB 4M4RA 2OCCB 3VX0A 2VM9A 2IVFC 1XR9B 5JXEA 3QXDB 2NXZD 2OM5A 1VFMA 5GJTH 1IO4C 2OYLA 1WWBX 2Z35B 1SN5A 1BFOB 1OGSA 1HQ4B 1G6RB 1KENH 2DQUL 4EEEA 4CMHC 5AVRB 5JA9A 4AXWB 1DO5A 3ZZSA 3T0EE 4AL8L 3DX7B 1NC2A 1FZMB 4JM2A 1NIBA 3A6BH 3V79C 4HWEH 3FB8B 5AEAA 5IMLA 4GBXA 1RURL 4NQEE 5I18L 3L5HA 3UJTL 1WD8A 4K8RL 3MRKA 4MQ7A 4WW2A 3V52H 2CLRA 4U3CA 3RG1C 3QORA 4YR6B 4P59L 1CC3A 5LWYH 4OD3L 5C07A 1Z9PA 1YYCA 1TOXA 4PYGA 1RFDH 2JJVA 4L8DA 4PJAA 4YBLB 5F1IB 4JFFA 1SY6L 3C87A 4XN7A 2UZXA 4PLOB 1GKEA 5B39G 1ID2A 2AXHA 4U2ZA 4X7SH 2DEXX 4Y88A 3A23A 1CU4L 2PWHA 2R69L 4D9QE 3UYOD 3CPLB 4KK8D 3UBXG 4KK6D 1BFVL 1MJJA 2L8AA 1DQDH 2HAZA 3BH4A 3HR6A 4FQXB 3DDGA 2D2OA 2XN9A 1XMWA 1U8KB 4NZUH 2FEEL 5SWZB 3BIKB 1A4KA 3IGKA 1I3VA 2WWKT 2BP5M 3WUWG 1WT5C 3VFUB 2MTAA 2R23A 2BY3A 4GQZA 4OCSL 3L4WA 4GAGH 1IZJA 5KANI 3MRIA 2AABH 1UQSA 2EDXA 2NY1D 3ESOA 5GGTH 3RGVB 4YLCA 4M43H 2XV2A 1RULL 3QEQA 5DJ8A 2QKIC 1IGYB 4UQ2B 4JG5A 3VXQB 4UTBA 1ACYL 1OPOA 4MVBC 2ARWA 2KZWA 1KCSL 3NMEA 1IRAY 3MRBA 4YSSA 4GPVA 3KPTA 4P2OC 2BOBB 2VC2L 2IH9A 1FN4B 4FDWA 3WKYA 2FIRT 3EG9A 1FL3B 3DTXA 1KYFA 2X2JA 2CJ3A 2FEEI 5HHVH 4IYKA 1LD9B 2D0GA 2R1YA 4JM0A 4MA1B 1OK0A 3DJ9A 3OKDB 4X42A 2Q8BL 3O6KH 2VAJA 1KDIA 5BRZE 3L81A 4Q0XL 3ZDYF 4R26H 2BVOB 2WJ5A 5DJZB 1W72A 2ZCLH 1G7HA 2UY7B 3L1OH 5CSGA 4HJEA 2CUHA 2X10A 3PDDA 1AD0A 2MH4A 1J9QA 1BIHA 2ZAHA 4G11A 4PRPB 4LHQB 3WEOA 2CO7A 2HJKA 1XD0A 2FE0A 4AY0A 1NC4B 3L95A 4Q2ZA 4ZPTB 2VUKA 1F90H 2H6PA 4FABH 2VTFA 2VJ8A 4CC4C 5K9KA 1GGIL 6FABH 1BYPA 1DSWA 3D39E 3GMQA 1SN2A 1PLGL 3Q6GH 1NAMA 3VB8A 3CFNA 1F1GA 4PY7A 3WL9A 3NCCB 3RGHA 5HYSG 3JTBA 3IBEA 2GSMB 1KIQA 3KNBA 3Q7JA 2Y3NA 1NLBH 4FQHA 2PCFB 1G9ML 1KCUL 4V33A 2FR4A 1UYWH 3O45A 1JGLH 1QRNE 2JELH 3GZPA 1U2CA 3HIZA 4S0HA 3C75A 4RMWA 4X4YB 2UZYB 3O0LA 2DDQL 4F7PA 2QVIA 2AI0H 5IF0B 1HTYA 3L7FA 4Z7OF 4CJ0A 5KSVB 4RGNE 5GRVL 4DOHB 3IU4L 1XH0A 4IBZA 1DJGA 1YHPA 5ITBH 3DRQA 3V4VA 3UIYA 5DSCB 1NEPA 1X9QA 4D0BB 3ARVA 5JNYB 1YDPA 4L8SB 1SXAA 2BLFA 2WBWB 3QUYB 4WJKB 5BO1H 4LF3A 3BVNB 2ITCA 2ENJA 2HJLA 4Y5XA 1L5GA 2ZXEB 4Y4HA 5HHXL 2WZPD 5C0DB 1EXGA 2J21A 4H25A 5GGSY 5IB4B 3U6XA 3MRHA 2I85A 3DMMD 5EEYA 1HKLL 1S9WA 4FE9A 4OD1L 2IDCA 2J71A 4ZFOB 3RFZB 5EUKB 3SYAA 3PWLB 4CNIA 2OMWB 2V37A 3RKPA 3WFCL 1KLUA 4GLRI 4YLBA 5AZEH 1MRCH 3T5WA 1UZ6F 5ISZD 3ZHKA 1N8ZB 3MACL 1DLFH 3PS6A 3QEGL 5TE7L 4N2OA 5MEQA 1GCYA 3ZQWA 1TFHA 3T77B 5F44A 2NQDA 4WY7L 2KT6A 3UGEA 4AQEB 1OY3B 2ORBH 2V7NB 2QPDB 1OSZA 4QLRA 5ID1A 4JG0L 1ZEAH 4IKKA 4N1HB 2ZUTA 1A7PL 3AT9A 4PTTB 3FTXA 2FWUA 5ENWA 4P5TB 2QQLL 1DQJB 1UXMA 1MQKL 1N2RA 4JR9L 4CN4A 2B5IB 4JO4H 3VWJB 2ADJB 4APXB 4JN1H 4F8TA 4OLZH 5AVVB 3VGHA 4P2QD 4A2EA 4S2SB 3OR6A 1XGQA 2VL5B 5KSBB 1USQA 2V5MA 4OM1H 3IWUA 3FF8A 3I6SA 4NQDA 3MXVL 5GZNC 3ULUF 4EI0A 2C26A 5HHQA 5BZWA 3P0YL 4RFNC 2NZ9C 5DD6A 1KXTA 1PG7H 1KJ3H 2PYFB 1Y6MR 4XCFL 4XRCB 2XFGB 3HKZA 3O3DB 3RPIA 3T6WA 4CRPA 4DQOH 3LHPH 2LFEA 3MRGB 2R4SH 1E7UA 4NRZA 5DLLA 2A1WL 2YXVA 1VHPA 2WINA 3BFWA 2AK4A 5DMIL 2MIZA 1G7JB 3W37A 4GG6A 1KG0B 3H9SA 2CK0H 1QI5A 3CVHB 2EE0A 2ZYHA 3S8GB 3S6CA 4KJYB 4FQIH 5C0IB 1F6LL 2JQMA 2XC8A 2ZX5A 4G8AC 5L0QB 1XFPA 1DANU 4TPRH 3CDZB 1HQRB 3H9HA 2PW2A 1J9SA 2JCCF 1U8NA 3DROB 2VMFA 4EN3C 3S88H 1KNOB 3L7EA 1FNEA 5KW9H 1JAEA 2XWJB 1THCA 1IVLA 3H2QA 4HGMA 1KTLA 3V7MA 2P5EE 5D1QD 1EZUA 1QRKA 3A6OA 1A7NL 1SHMA 1TTAA 5EDXA 3VFOB 5FO2A 4XNZB 1P7HL 4TQPA 1IUZA 4RMVA 4E9QA 3IGLA 4KPHH 3FUJA 4LCCB 5CSZB 2GT9A 5FUOH 1JGVL 5D93B 1N19A 2J8HA 1G9EA 3QDHA 3QEHA 3SB3A 4I85A 5DJYA 2EDQA 2IQ9H 2AQ2A 3FTYA 3HOGA 5I6LA 4N9GB 3ARZA 2WCSA 3HB3D 2IAMA 4R4BA 1MFMA 3QJHA 2V5SA 5D7HA 4M7LT 5EPMA 2XDHA 1BF8A 4GQ9L 4ZTEA 5E8OA 2DD8H 1RJCA 4L5FE 3BRDA 3T0AA 2R56H 4P0DA 3SKJL 1BBJA 2F5AH 4JY6B 1T0MB 1FJ1A 4DP4X 2WIIA 4Z9KB 1PX8A 4PV9A 2LTQC 3V8CA 2AK1L 4YS4A 3T4AB 3SDXB 5EZPA 3MUY1 2G5UA 4NDMA 4JK0D 4K3DH 2G9HA 2B8OT 1P0SE 2J1KA 3PP4H 4XT1C 3VXUB 1XTLA 1T6VN 4F58H 3L9RA 4K71B 5EBLA 4FFZL 4DHLA 4AQ1B 2HMID 1JNLH 4U3XA 1RUQH 1U8LB 4H0IA 4A6YB 2I5YH 1DJZA 4Y4FB 1SHWA 2WLYA 2ZT9C 1I8AA 2FYVA 4OCRL 4PJCF 4M9PA 4PCKA 5CCGE 2XWEA 4GKSA 3ZDYE 5I75B 3NFPA 3BKYH 3OPZL 4DZ8B 1TZ8A 1VPOL 1ODAA 4ZRGA 4YXKL 4E5XB 2DMKA 1H6EA 1AC6A 4XMLH 1RL1A 1ONQA 5A6MA 1IGML 4HJTA 2WQAA 4TQEL 1CICB 3BH8A 1C5DB 5D96B 4QHNA 5GHWL 1FO0B 2LU7A 3WTXA 4R84A 1E3ZA 1U8MA 3A0OA 5JOPD 4MNQA 2BSEA 4ACTA 3C60A 4XXWA 2ZXDA 3KGUA 5BV7L 1EPFA 1QUPA 1V54B 3VD2A 3TPUA 3MNVA 1GCFA 2X40A 4QHLA 4ZPVB 5EOTB 2G2RB 1QR1A 2I7OA 4W70A 1KWGA 5BMFL 2AQSA 3CV5A 1BQRA 2AQ3A 2EE9A 4HHAA 2Q6WB 4BHUA 1L6XA 2R29A 4XCYA 2VDKB 4IU2A 1P53A 1FNSH 3BJ91 1MWOA 4U6VH 4Z7OE 4NQCB 4CMHB 2IH8A 4KGLA 4G3YL 4KAQL 1MW0A 4JFZL 1EHKB 2E7CA 5TE6H 1XSOA 4ODTH 2MNWA 3G08B 3NBNA 1ROWA 5JMRA 1CLVA 1WEJH 4UB0H 4XO4A 3VFGH 5GJTL 1BCIA 4KO5A 1NFDB 1J0IA 5KSAB 3LRSA 2N7SA 5IJBC 1ZA6A 2ENYA 4UYQA 3RL2B 4JBSA 3O8XA 5EF0A 1MI5B 4YHIB 2WKGA 3Q9QA 3NG5A 4GKLA 3EH5B 3KVPA 5CJOH 1DFXA 2V3EA 3I9GH 3U2JA 2X4TB 1IC0A 1NIEA 5LAPA 1IEHA 4K3GA 4R83A 4XVJL 1L0XA 4Y9BA 1GSKA 1W0WB 1A8JH 1M2VB 2F68X 3BAWA 3QQ3A 2ENPA 4JFDA 1RP9A 1UZ6E 5I1IL 3D0VA 2GTWB 3UZVB 3V52L 1WTGT 2GJPA 2DQTL 2Y7MA 3BAYA 1UASA 4GAYA 4NFDA 3GM0A 4OJEH 4ZSOA 1GYAA 1FUNA 3NJGA 1RFDL 5BW7A 3O6FC 4HGKC 1OLLA 5CIPH 3VI3A 1DHKA 1TMCB 5KBDA 3UJIL 4X7SL 3MLYL 1WP6A 1CQYA 4AE1A 2DJUA 5AOMA 3W5NA 4V2CB 1E5CA 4KVCH 4XCCH 4WLCA 3QQ4A 2D3NA 5C0BE 3MYZA 3ULUH 4NPJA 1T1YB 4M62H 1I8LA 1FI8C 4NZUL 3AWGA 3VO0A 3ULUE 3V5HB 2C8NA 4APQB 3VQMA 1ASQA 3HG1B 1I8UA 2VM4A 3T0VA 2HYMA 2QKIB 3O2VL 4W6WB 2AXGA 5C09A 1JYNA 2FNWA 2WIMA 2YO3A 1D5MA 5HVHB 5I16A 2FX7L 1F0LA 1ZLSH 1KIPA 3BRFA 5IQNA 1CFQB 1WGOA 3O81A 1TQCC 3CZJA 3LZFH 2AABL 5AWNL 2W94A 2ETWA 4P2OB 5CCKH 5IG7A 2EDFA 5CKGA 1R5IA 1MVFA 3GGWB 5IVXA 5F7EL 5A16B 2VISB 3QJVB 3CAFA 3HN8A 4EUPA 1FIGH 3HE6A 2BNRE 5TQ0L 2WQVA 4F92B 3TT3H 5EF2A 4JFEB 3CDCA 2JCCE 4NUQA 5DEFB 2IWFA 5D55A 5E6ZA 2EEBA 4F3FB 1GZQB 3MBWA 2BY0A 4M00A 2OR9L 3B7RL 2ZCZA 2GVYA 1RSFA 3CPUA 1G84A 4J3SA 3TIEA 3SGKA 2E4TA 1A7QH 5FKAA 4ZX6A 2R9HD 3CZNA 2JB5H 4EAEA 2Y5TA 3EGDA 2BHUA 1VENA 1FH2A 1ORSB 4IEFA 1G7MA 3ECVA 3S3PA 1NDTA 1CR9L 4KTGA 1GMEA 1OGTB 3PE9A 4WSGA 1NBYA 3NA4A 2CDFB 4JJ5B 4R26L 4AYFB 1VACA 3CN1A 1DJXA 4JFTA 4N8PA 3AU1A 3L1OL 1EZSA 1YY8A 1EDYA 2XTSA 4OI9A 5FYJH 5IMKA 1SDAB 3WUZA 2DQFB 4PJHA 3U0PB 4KV5F 4QGYA 3AM8A 1NGZA 3B9EA 4YC2B 3VSQA 5KSUB 5IBUB 1G7LB 3GBNH 3V0HA 3BJLA 2YHGA 4GW5B 1P84K 5IBLD 1IFHH 3FQNA 1F90L 1VFUA 2CO4A 4HIQA 2ZWSA 3LTVA 3FL7A 4JDZB 5I5JA 1OM3H 2FBJL 2JQZA 4BFKA 2CBMA 2EIEA 1J1OL 2YFNA 3IKKA 4URTB 4YEEA 1XZ0A 1UFUA 3S3SA 5JA8B 4UV7L 4XPAH 3VXMA 3Q6GL 3OB0H 5GS3A 4TQIA 1CFVH 3J27A 2CKNA 4GXFA 5IESL 2YD2A 3ILDA 4XP1H 3SPVA 5IGXH 3C5ZB 1EDQA 3V9FA 1IGIH 4J39A 4L4VA 1NCJA 4ZMAT 5I8OH 2NTSP 1FH5H 1GMIA 1ED3B 1JGLL 4JJOA 3U82B 1L9PA 1NUFA 2ZD0A 4FJYA 3FO2A 5I73B 1HWHB 4QRRE 4GI6A 1SLUA 2AI0L 2AV1B 2NY6D 1UTDA 2F7IA 2QZ5A 4PJCE 5ILTH 3B2XA 3VA2C 1ASOA 3KLDA 1X4ZA 4L2LA 1U93A 1L7TL 1GGUA 3Q44A 1AI1H 2A6IA 5AFAA 4UNVA 2K6YA 5EBMA 3WY3A 2PXYA 1HCYA 4OZ4A 1ITCA 2EO7A 3MOBH 4NQXB 5F93C 2UVEA 3PAVA 4FNLH 1I7UB 3FUNA 1BVLB 4NYLA 4MJHA 4BXSV 4HH9A 2X0WA 3W2DL 3MODL 4A37A 2V0AA 2AAVA 5AZEL 3NCYS 1EGJL 1Z9NA 4NHUB 1S9VA 5J6SA 3UGUA 1NWOA 1WA0X 4GW4B 3HR5A 3DX9B 3GDCA 3OJ2C 3R7RA 4G9FB 1RP8A 4AIXA 5FFGA 4Y2DB 3IFPB 3AG1B 3EO0A 4NJ9L 4NSKA 5E2VH 1YEHL 4XX5A 4IBLT 3FO1B 4X9YA 1KYOK 4YHZH 1KELL 3O6MH 4NQSB 3T71A 4ZUUB 3PV6A 2GQHA 3RX9A 1E9OA 4PJ8D 2O6FA 4ERSH 2WBJD 4I48B 1BQSA 5I1LA 1FNAA 3AQDA 4F8NA 5B1CA 3RQ3A 4BQBA 2AXWA 3LH2H 4DQOL 3IGUA 2APWA 2GJJA 3T8XB 1E30A 3ZN6A 4B5EA 4MD5A 2X4UB 3VGAB 1CGSH 1NLDL 2E74C 1ADWA 3TA3D 3BPCA 2PCXA 2DYPB 2CK0L 4WUKH 3UTTB 4PGJA 1N6UA 2P5WA 1KTCA 2EIZB 1A6ZB 4KZEH 4DK3A 2P28B 3RZWA 4ZS7L 3ZO9A 4PVLA 3MV8D 3GMOB 4QJ3B 1JZ6A 4ZXBC 1SYVA 5TDPA 3I3BA 1JHKL 3C9NB 3H3PH 2XXMB 5D70L 3LIZL 3GUTB 3MRFB 3HC0B 4U49A 3EOAB 3V5DA 5ABDE 2EICA 2GUOB 2PPAA 4RGNC 4ZMNA 4JW3A 5DVLA 3ZXAC 5AVSB 5JOFA 3W38A 2X0UA 3QJTB 5FO7B 2NOYA 4QXTA 1FFQA 3SSGA 3QZBA 3LKRB 2CHDA 2O1AA 4WO0A 5G5DA 4Z3TA 4XHQA 3U4BH 2QVFB 1CXFA 5I1CL 1HI6B 4IRJC 1RZ8B 1J8HA 2FQDA 1S9YA 2UY6A 1DYZA 2AEQH 3GIZL 4PIRF 2YBGA 4Y1SA 2OMUB 4L4TB 1AC0A 4LKCB 3KVDD 1IIIA 4DFHA 4U1SB 3VFSA 1E4WH 2WKOF 4X5WB 3Q8BA 4HKJB 1RXLA 1ZOXA 2YOCA 4ANVA 5BS0A 5EBWB 1H5BC 2A74B 4NN5C 3SKNB 1SXNA 1ZVHA 1YC7A 1QWHA 2WMPB 3HC4H 3LD8C 4JDTH 4X4MA 2V2XB 1T5XB 4MGXA 3UTPE 4IBVA 3J2PA 3EDEA 4M56A 4OIIL 1YMHA 3L3GA 3KLHD 4NRXA 4QTIH 2AV7A 2EDDA 2N56A 4J3TA 3UTSD 5JHDB 3UBXI 4F58L 4GEIA 5SWSE 5EO9A 3LQMA 2CSPA 2G75B 5SWQA 3S2AA 1HH6A 2B0SL 1AHWB 2LLLA 2OR8A 3K8MA 4KI5D 4F15B 5IR1B 4UOQA 2WWMD 5D7JB 3SE4A 2I5YL 4BWTA 1WAAA 1Z66A 3JV6B 3NQKA 4EN3D 4KJPD 2O4EA 1JXGA 2DIEA 2FX8H 4TSCH 3AREA 1C5BH 3O11A 5D2LB 5KJRL 4R0LC 4A7TA 5C08E 2EDBA 3NSCA 3QYMA 4PJIA 3KJ6H 2BOCA 3NIFF 2PNDA 1BAWA 4PS4L 3EXJA 5M95B 4KV5E 5DZLA 2HFEA 4L9LC 5DLMH 4OF7A 1BHGA 2Y7OA 5FGRA 4K94C 4K3EL 3CHSA 5GSRA 4XCEA 1A9EB 2NUTA 1E3XA 4GQRA 4ZOAA 4JKPH 5C3TA 1BFTA 1MCIA 4UT6H 5A43C 5GGQH 1MDTA 1OCCB 4OJYA 2CXKA 3S96A 3WEXB 4B0MB 1KXVA 3F12A 1ZANH 2XKUA 2YPVA 5I19L 3NSYA 3VMNA 2YQ3A 4YDLB 3GF8A 1HSAB 2XWTB 5IQOA 4U05A 2IEPA 4LSUL 5F9AC 1C5CL 2HXAA 2BVQA 3V0WL 5CLYA 1TTRA 5JQIB 2VXVL 3QDGA 1IM9D 4P4KC 4HW6A 5CGTA 3SGDI 3MV9A 1JZDC 1MZZA 3G6AA 4WI7A 2AXJA 3EYFA 4UANA 4HBCL 4IU3A 4D0CB 1JZ8A 2CR3A 3CXFA 2DQJL 2ZSVA 3QDMB 1S7WA 2VDOB 4JGUA 1KTJA 1K6QH 5KZCD 3NFNB 3P40A 1ACZA 4JDVB 1WEJL 4HWUA 4UB0L 4BKTC 5F9OL 3VFGL 2VIRA 4WEBL 4WZ9A 2J20A 4WJ5A 5GQBA 3HBPA 3FCTA 4A68A 1DUYA 4EI5B 3RX5A 1NDMB 4NKDB 1Y6KR 3TH3T 3UBHA 4YSUA 5KYXB 1OCRB 3EBAA 1J1XH 3VFMA 4MD0B 2Y7QA 5MEOB 4CUCA 4JPSA 4F8LA 2XBTA 1OAYL 3MCKB 3PDOB 5IMOA 2BSRB 3N44B 2J6WA 3SN6N 3N41B 3FTVA 2NY0C 4PJBB 3DIDA 3A67H 3FU5A 3F5WB 2RAMA 3C5JA 3UZEA 2OXHA 3PL6B 5E5MA 2YMOA 1ZE3H 4L3EE 1TTUA 3WFDH 1JPGB 2Y6SD 3NOIA 3VG0L 1J8RA 4DKFH 1FPTL 3L3DA 5E9DE 1HCFX 5CD5C 4OY9A 3RVUC 3D0LA 1CS6A 4P5SA 5FECB 4BQ9A 1B90A 2ATPB 5AB2A 4AIEA 3DYMA 1MY5A 5L6YH 2F0CA 4UTBH 4KVCL 3Q13A 3SDAB 4ZNEA 5L8JB 5E1IA 3FU3A 1KOAA 3ZU8A 3GXDA 1KIRA 2VUYA 4OCNC 4ZO6A 1V5JA 4TL5A 3DIFA 1CUOA 4MJ5B 3J8F7 4WEMB 3RX8A 5KYYB 5B8CB 3D50A 2MNUA 3FFCD 3GJFB 4G6KL 4XZUA 4ZUVA 2EDLA 4TULH 5FIEA 4OTXL 3LZFL 4IBTA 4IHOB 5E2WH 4WIQA 3SGEI 1VEPA 4OZHB 2A3TA 1KBGL 4DEPC 3PGFH 3MJ9H 4A7QA 4AJVA 1XIWA 1X44A 3F58H 1W72H 3GSQA 1HVXA 1N0LA 2VQUA 3EDJA 3OXSB 1QX1A 4P3CL 3DVNA 2BJML 3E2HC 1ZHKA 3IDUA 4FQQA 1MVUB 4F9PA 1A65A 4YUEL 4B41A 5EFIB 2ZOKA 3PGCB 1J5CA 2JI3A 3B3IA 4WNQB 4ADGA 3KPRA 1TZHA 5BJTA 2YGPA 4JPIB 1C12A 1R34A 4C56E 2SEBB 1U3HA 3OAWA 1ZV5A 3WE6A 4WI0B 3H0TB 1M7IA 4R7NA 3STBA 3T0EB 3BAIA 4FI6A 4U1NA 1N68A 3ARDD 4QCIA 2J6EA 3WFHA 1I4FA 3SZ6A 1SVZA 1T22B 1M7UA 2YC1A 4HUXB 2VZUA 1G9NL 3EF4A 3VCLA 1RZFL 2VERA 1GC1L 1KBKA 4ALAH 3KYOB 1JHLL 3SCMA 2OX5B 1GAFL 5J56B 1KN4H 1T80A 3NP4A 4FQ1H 3U83A 1D5RA 1EEYB 2EDWA 2OMZB 5KYUB 4W68A 3BDXA 4X9GA 4ZAKC 3ZTDC 3EYOA 2XT1B 3D52A 3QYCA 4I0PA 1J88A 3CH1A 1DVFA 5HI5D 3PU7A 3RKDC 4XC3H 4DP1X 8FABB 1C7TA 3A4FA 5F89A 3VXRE 4WW1B 5K9QG 1OF2A 1E6OL 5E1GA 2P48B 4ZMYA 4PRNA 1EUUA 1G43A 3OLDA 2UUDH 3AROA 3BI9X 3IGFA 4F93B 4FQ2H 1AMYA 3DIVA 4PRHA 5D7IB 3PREA 4PG9B 1KJVA 1FDLL 1TU2A 2LR4A 1IGIL 3NJHA 4M1DL 4L8BB 1BZ9B 1A3RH 1FSKC 3SY6A 3U46A 4PREA 3KD4A 4U4IA 4QRPD 1T2JA 2AKRA 2GC7C 5INDA 2BSCA 5LGHL 1OSEA 4DK5A 1D3CA 3HG0A 3GSUB 4YO0A 3SDDD 4MZRA 2OYPA 3C6SB 4LDCA 3RVXC 5FO8A 4O5LL 3P02A 3OL2A 4ZODA 5DRZA 1AR1C 2D7PA 4UOW0 1E3FA 1LDPH 2DQIH 3SDYL 3OHXA 1BJ1J 4PJDB 2GK2A 2WYTA 4HLZH 2FYYB 3PG2A 4RAUA 1OTSD 4HCRL 3QQDB 1YEJH 4QDGA 2D7OA 2EYRB 1EJ8A 2ICWB 2IGFH 3DOIA 1MIML 4NKQB 5IFAL 2K8QA 1UXSB 3AMKA 4H7VA 1CIUA 1UXWA 2Q3ZA 4NUPA 1M9WA 2NY7L 4AYBA 3NRQA 4LEOA 1HNFA 1HILA 4RX4A 1BG9A 1CGVA 4PG2C 4BK5A 1ZY9A 2OP4H 3RU8L 2O72A 3H2WA 5I74B 3U2SB 1ETZB 2D3JA 1O75A 3KE0A 3BH9A 2H0PA 5EOCL 2A4ZA 4DP7X 4JGNA 1IARB 1HH9A 4Y19D 3B2DC 2OQJB 2EXYD 5KYNA 4TUOA 3OR7A 4B50A 2PYED 4I0CC 3SPIA 2HG0A 4DN3H 4I3RH 2B14A 5JUEH 5DQJA 5DQ9B 3NCXA 4FULA 5E2VL 1E4KA 4RSYA 3RUGF 1XT5A 4Q9CA 2XZCH 3MFFB 4BDVB 1Q9WA 1H3VA 5F2FA 1J5IA 4PUBL 1BP3B 1UM6L 4Y16A 3LN9A 4EUPG 1DDTA 2PP9A 1U8JB 4XWGH 1JHTA 3NPSB 3V7AG 3OKMA 1MHCA 2F74B 2CHXA 5D71H 3NTCL 3GMPB 4YNYB 5I17A 2FH6A 1RZGA 3X12A 4IIQB 4F9LC 1H3WM 5CZRA 3ULVD 2O6DA 1UWGH 4WUUA 4YH6A 5I71C 2XQBH 5JLZB 2OI9B 1EAJA 2ED8A 4HX1B 3WLWD 5HYJD 1QHOA 2XXCB 4FFWC 3ESPA 4K23H 5E6IA 2GK0B 3Q8AA 4JAMA 1AGDB 3F7LA 4MLSA 5J1AB 1XGUA 2EQDA 1A1MA 5I6OA 5HXMA 2CR0A 3GLZA 4XN4A 5JOEA 4WUKL 3UP6A 2P8MB 4GBXD 4TVUA 4UNIA 1AZCA 1JPFB 4NZTH 4YSCA 1MJ7H 1IEAA 3EUUA 2NY3D 1IBGH 3VFTA 5EEVA 5K9OB 5E23A 2XN1A 1G1YA 4HPHA 5IUCA 1QHPA 4LT7A 5C07D 5C86A 4OLEA 3D34A 3RZCA 1KJ2L 4XP5H 3U2IA 3S5LB 4DWHA 2Z8VC 1PJ9A 2XPGA 4HSQA 2C3WA 3CC1A 3ROOA 5DQDL 4GRLB 1ACCA 4UWQB 4LDOB 1YYLL 4HWZA 3ML8A 3JWNG 4FXGA 5IM7B 3ROLB 1J05A 2H1PH 3QNZB 4EVNB 1RUMH 4GUPA 3DBXB 4PJ9A 5DA0B 1REIA 3C09C 3B7YA 5AALA 2Q2EB 2AEOA 2VR5A 1YY9C 5EIIB 3WJMA 3CSYA 5IEHB 4NN5B 5TH2A 1LTXA 2G2PA 2IJ0C 3L3JA 4PGCB 4X9FA 2AEQL 4HGWA 1A4JB 3QDJB 4UDUB 4AG4L 4IMKA 2N4IA 1PSKL 5DUMH 1U58B 4Y4KA 4NNXB 3TT1L 3MRLB 2R2EB 2WWNA 4IOFC 5DEZA 2XWBA 4OLUH 1QBBA 5IVZB 4AENA 4AYMC 3T6ZA 4I18B 4K73A 1FYTA 5F7UA 1AGBB 3BQUA 2GHZA 3K1KC 1Q8MA 4GUCA 3NDYE 4W6XB 1JERA 3GSXA 2MPVA 4OLYL 5LXVA 4AI7A 3EFFB 3HHRB 3QEQD 3ZPDA 2EH8H 5D2NA 4X8GA 3LS5L 1AOHA 1NDGB 3MRRB 2IPKB 4RNRA 2FSDA 4EF3A 4YPGA 1CD0A 5KVEH 3KXFD 1HCVA 1PZSA 3B2UC 5CWSB 3P77A 1N0XH 1MJUH 3QJFB 2AEPL 3MRMB 1JV2B 3QULA 1IIKA 5EUOA 4KDTA 4NXKA 1A7RH 4ODXA 3RTQB 3RB7A 4TSCL 2FX8L 3MUZ1 4GIPD 3DHUA 4HKXB 1FHNA 3BIAX 4GKZB 5DWUL 1KT2B 3U7WH 1MPAH 3RJQB 4EXPX 3IPFA 3CQPA 3HNTH 3KCPA 2XZAL 4JCWA 3GB7B 3HJ0A 5CINH 5DD1L 4LCUB 3RIFF 4AEIH 4WO4D 4MHHG 4N1CA 3ZL2A 4LEXL 4AQZA 4QWWC 4HFWA 2NLJB 4W9ZA 2PO6C 2YGNA 4JRYB 4OGXL 1RIHL 2CUIA 3QRGL 3A6CL 3BP7A 5GGQL 3I6GB 1R5WB 4HYTB 4XBGB 4IJ3B 3ULVL 2GEQA 2J7LA 5FLVA 3DI3B 5ISZE 1LO3H 2IWKA 3V4PH 1Z7JA 1I9EA 2PMZA 5FYKH 2WUBH 4JGJA 4H26B 2P5EB 2JK5B 5GS0C 1IBDA 1GRWA 1S3RA 3RDTD 5I9QC 5LN8A 1WIOA 4NZFA 4RWHA 2A6JA 5DK0B 1E28A 3OHMB 2L7JA 1AGFA 1NAKL 4Z5RB 1ML0A 5D1XD 2NNRA 3B5GA 3TF7C 1DJIA 3BHBB 4FNUA 3WS6C 1RAMA 1LQBC 5DHYA 1A66A 5JIQA 1SFDA 2FECL 4BZ1H 1TJXA 3BN3B 1OT2A 5AENA 5CEZL 4P2QE 3MCYA 4X7FC 3ZE1F 5F9JB 3MJGX 3L54A 4W4OC 4F2MA 1T2QH 1I9JH 5EA0L 5IP4A 2WUCL 3RVWC 5A3ID 1QLEH 4J6IA 5ECGA 3PABA 3GHPA 4JO2L 3ETTA 3IRPX 4HKBA 2FSEB 3ZO0A 3QO1B 5E8EB 2FO8A 1OAXL 1P4IL 4PRID 2IFFL 1JDCA 4UYPA 1KTRL 3QWRD 2Z7YA 2O5YH 2DWTA 3S4SA 4GSQA 4OGAC 2ZZUT 4BH7A 1A6TA 2WNKA 4NPYA 3K4AA 1CIDA 3INUL 2J1XA 1Z6JT 1ZSDB 2WO3B 5DMJB 1ROCA 3P1VA 1IAIM 5FM8A 2D7NA 5ETUB 3OAUL 4JO8A 2VDNH 1JK9A 5KVMC 2Y1AA 1ZWIB 4J2QA 4TQHA 4P23C 4NKIH 2XTJD 4AGLA 2B2XH 3ZDYB 3LQAC 5DZPA 5DHMC 4PP2B 5D1QE 3QUXB 2NMSA 3RUGE 5C0CA 1JMXA 3FQUB 2DLFL 4LARH 1AKJA 5JORB 5BQ7B 1PKOA 3F7PC 1J86A 3CVDA 2VR7A 3G6JA 4LGSB 2NY5L 1SYSA 3IJ9A 3TEZA 3FONB 4FXKC 4G1EA 5DMGC 4G6MH 2WO2B 1MF2H 3KBPA 2HH0L 4NKOB 1E27A 1VA9A 4FGMA 4IGBC 5DZOA 5F7KC 3TCXA 3HS0C 1BX2A 3VSTA 1CXLA 1PKQE 1DL7L 2ATKA 4P9HH 4KY1H 3WYRA 3U0WH 3U9UA 1I9IH 3T2PA 1NOFA 4JFWA 4PW4A 4BE5A 1UH3A 5C0ND 3T6VA 2WSDA 2JKSA 4HJSA 2X2IA 5K1JA 4PV8A 3VWKC 1BD2A 1RUAH 3U0TA 1A6UL 4TM9A 1ZT1B 5CU5A 4Z7OB 1R3KB 1MWAH 3FOLA 2AK4D 4M6NH 1G0XA 3UX9B 1F86A 3QH3B 5BXFB 4PJ7F 1OCWH 2V5RA 4WI9A 2C1OB 1RU9H 1T04B 2L7EA 2G4EA 1LEKB 2VLRD 4WEUD 2KC0A 2ZPKL 4X6EA 1Q1JH 2OMBA 2APFA 4M61A 1UVQA 1D5IH 3QO0A 5DRXB 1B4RA 1MFCL 2YA1A 3DGGA 4F7CB 3MREB 1VADA 5C0AB 1D5XA 1BQKA 3JWNH 1NAML 1AOZA 2HFGH 3QI9D 1AXTL 3GSWB 3FCSB 3MUGB 4FCHA 3JT0A 3QNYB 4KUZH 4UT7H 2WXKA 5SX5K 4KROB 1X4XA 3DDFA 3VRLF 1U8CA 2EE6A 1NCBL 5TPWL 3W11C 1M6OB 3FPYA 4PTUB 3L4UA 5JPNC 1UJ3A 4HKZA 4KQ3H 3NFSH 2F18A 2X0VA 4Y5VA 2C9QA 2ICWJ 1PZ3A 3V4VL 4CJ1A 1C08B 2GITA 3J07A 4WFFD 1TVHA 3JZ7A 5IQ9B 4ZFQA 1CTOA 2X41A 2QPUA 2HCZX 2BMKA 5FYLD 1MCOH 2EDRA 5CIPB 5T3XH 4CBZA 4XBPA 4PLNC 1T83A 4FQ2L 3DPDA 3UG4A 4NNPL 3TN0D 2D31B 1I3GL 3AQYA 3DLQR 1N3NB 4HVBA 2Q7YA 4J3WA 2KDYA 2N59A 5HY9A 3ZE0B 5C0BB 1B2YA 3RWEB 4UILH 3WS3B 4AUUA 4FZEH 3STLA 2QADD 5B7EA 3T65B 2YEZB 3AC0A 4MMXA 4IRZH 1A9VA 3HCVA 1SN0A 4PRBB 5T1KA 5J11B 1U95A 2VXSL 1FVCB 2G5BA 4GINA 4OZFB 3SBWC 1M3JA 4AL8C 1V3MA 4RZCA 3HE7A 4YHNB 1Q9LB 2CJSA 2VLKD 1LDPL 3DO4A 1EAPA 1JPEA 4H8VA 5EBGA 1YJDL 4XE0A 1W0YT 4JKKA 2O5ZL 4WK4B 1WBYA 1YPZF 5I1EH 5LHDA 1NA8A 2RALA 2YRZA 1CF8L 2ERJB 4K8RC 5KYWB 1E2VA 2CD0A 2BNRB 3INOA 3M6DA 5DURB 3M17A 2XV3A 4G6AD 4N5EC 2JCCB 3ARRA 1WZKA 3LEXA 5JTWA 1BPVA 5FGCE 1F3DH 3FQTA 5FO9A 4JQVA 5IB2B 4AQ8C 5B38B 1NCWH 1ZPUA 2J8OA 2BZCA 4XOAA 4XOEA 4PJGF 1TVDA 5LBSL 5IHUH 3NCBB 3U9WA 4XNMA 1PZ5B 1ZT7B 2P52A 2H1LM 1WCBA 4AYSA 4HS3B 3TVMC 4BUGA 3IDIA 3ARGA 3UO1H 2WC7A 3HBZA 4KDVA 1NFAA 2RCSL 3PAZA 4WENB 3RL1B 4BSWB 5ESQA 3C6LC 3ILQC 3QIBC 1ZS8B 1H8OA 4JPVH 4KKPA 2NT1A 4WHTA 4Y9GA 5JUEL 4AT6A 4ENED 2Z31A 2WXMA 3QW9A 2XZCL 3FQRA 1RVFL 1V10A 2VLJD 4ISVA 4NM8H 4WWKA 3S34H 1PY0A 3ZE1E 3W5MA 2J8UF 3OJDB 4H8UA 1RZPA 4XNAA 4PRAA 3G5ZA 4CVUA 1B3JA 3OVUB 3HNVL 5JHMA 4BCZA 1R0AH 1C8PA 3P3RA 3VD0A 4J23A 3SDCD 3ELAT 5LBGA 3FU0A 1UWGL 4DCQA 3CWGA 3I02A 4GXUM 5HGDB 2BRQA 3RVVC 3ZJAA 1YEFL 1XF1A 2O61B 1AY1L 1OTTC 3HRZB 3VDAA 3V6FB 2MKLC 2ITFA 3QZNA 3PHOA 5IT2L 3MUHL 3R4DA 3WD5L 3EJYD 2O93L 4GP8B 4OAWA 1HL8A 2HRGA 4XPGH 4PJCB 4UQAA 4HZAA 4IM8A 2ZJSH 1JV5A 1DBBL 3RWHA 3P4MA 4KNUA 4TVSa 4X5XB 4MZIA 1XR9A 3QXDA 5D7SL 1MELA 4KI5F 1NCUA 3GBML 1EFQA 4LPTA 3GUFA 2Z35A 3QXAB 1BFOA 3EJSA 1G6RA 4GEJA 3QWOB 4H8PA 4LSVH 5IW3A 2NXZC 5HGHB 2H1PL 3CN3A 3DX7A 4LSDA 1FZMA 1PZAA 3H7BB 4LASH 3S48A 3K8LA 3GSNA 3FB8A 2YBRB 2F7QA 3REWB 5JQ6H 4FC3E 4IK6A 4OCLC 3JUYA 4LCVA 1ECZA 4NKMB 1IL1B 3M8OH 4GYBA 4JFUA 5CZXD 4BE6A 5HYQB 1DJSA 4BELD 4Z3JA 3FT0A 4Y1AB 2E4FA 4YR6A 1E9QB 1A1NB 2X4QB 1TTBA 2YD3A 4FL4B 3S5YA 1DBKL 1G9MC 3MGOB 2LU5A 5CM1A 4JN2B 1UM5H 5EZIH 3FKUS 1T4KB 1L9MA 4PJ7E 4LPWA 2CDGB 1MCBA 2X4NB 3MPCA 2IADB 3T04D 3CPLA 5KVEL 5DO2D 4CSZA 3MUUA 4FQXA 5AW3B 3SD5A 2VN6A 1OGPA 1F8TH 1KGIA 3BSZL 4BCXA 1JGDB 3B1UA 1U8KA 5SWZA 4RESB 3BIKA 5T1LB 4KK6C 2JKWA 1IV8A 4X50A 5AW0B 5F1OB 2A77L 3D9AL 4Q4IA 3QWQB 2XZQH 4G71B 5I5RA 4HZLB 1OAZL 3U7WL 4LP4A 1RZJH 2R29L 2VDMH 4XWOC 3WNIA 2K7QA 1MRFL 1ZTXL 5BNXD 1XEDA 3DSNB 3RGVA 1B4LA 3BO8A 1IGYA 3BLKA 3E1F1 4UQ2A 5HGGS 3VXQA 3FRPB 2B9AA 2GPZA 2NY1C 1U2HA 2BIHA 4QI3A 2VXUH 3O6LH 4I7ZC 1E0OB 1D9KD 1KN2H 2EEFA 1ORQA 3ARWA 5ES4B 1J9CT 2PWEA 1X5LA 2WNXA 5I15H 2BOBA 2YLHA 1FN4A 4KK9C 2OCFD 4ABQA 3VXTB 2IO5A 4HXBL 1AQMA 2ZKHH 1FL3A 1MW3A 4ELKB 1QSVA 4BA0A 4DVRL 3VXMD 1IKFH 1WZMA 2IPTL 4K7PL 1LD9A 1OE1A 4RWYH 4QD2E 4KXZH 1UJTA 1D2OA 3CLEH 1NQBA 4TSBL 1OK8A 3RWJB 4L4VD 3WEMA 4LNRB 3W0WD 4K9EL 4BHUI 2BVOA 5DJZA 4LVOC 4M7KH 5EU7E 3V6OC 4M7LH 2UY7A 1M7DB 4EXKA 3UTOA 1WLHA 3FQ4A 3LZLA 1ANUA 5I1JH 4PRPA 2FTAA 3K0YA 3TONA 5F1NB 1YPZE 1S9KC 4J27A 3WN5B 1KBWA 5H35B 1NC4A 4ZPTA 4AEFA 5E1AA 3VYOA 2W0PA 1LMKA 3MRQB 2O5YL 1KJMB 3F7YB 3CVIH 3IETB 4PGDB 1OL0A 4J4PC 3VB9A 4TS6A 3EHBD 5SWSB 5E2TH 2N7AA 2BDNL 4S1SH 1DDHB 2PCFA 5ACLA 4JRWA 1MLCB 1P9MA 1ETB1 1MQ8A 2VZOA 4MXVF 1T3FB 3MV8E 1IVTA 3KWTA 1EJOH 4X4YA 2UZYA 5IF0A 1F00I 5KSVA 4IOIB 3ZTCC 5C08B 5HI4C 4PB9L 3IK2A 4MXQD 1DFBL 3A3YB 3FUEA 4N8CH 2B3RA 1BWMA 4D0BA 5JNYA 2J8UE 4L8SA 1C7SA 3QUYA 5DR5H 1XGYL 1IGFL 3HS0B 3BVNA 1YZZA 3I2CH 3P11H 5C0DA 4LOUC 3H8NA 1H3PL 3QFDB 5IB4A 2OK0L 2DM2A 1N4XH 2F7PA 4Q9QH 5GXBB 1JWMB 3GBEA 1ZVNA 4ZFOA 1MF2L 1KFAL 3VSUA 1SJEB 2CK2A 5EUKA 3TBVB 3VWKB 4BKLA 3BVTA 3PWLA 3ZOAA 2OMWA 4X4KA 4HUNB 1E90A 2JIXB 1NL0H 3DMMC 4UQ3B 1IAII 3TPKA 3SE8L 4O9HL 3QYNA 1N8ZA 1VGKB 1T5KA 4TL4A 5BUPA 2MNJB 1XZWA 2DJMA 1SDYA 4LAJH 3WNNA 4YXHL 2EO1A 4NRYB 3T77A 1JCKA 1SQ2N 4MS6A 4AQEA 2V7NA 3KR3H 2FNBA 4AUJA 3EJTA 3VD9A 1OEZW 4PTTA 2X4OB 2ZX9A 1F97A 5KS9F 4Y8AA 3UTSE 5E2UH 4P5TA 1N8OE 1D7CA 1XBRA 1LJMA 2P5WD 3TC9A 1L6PA 4X0NA 3VWJA 1LL1A 2ADJA 1RPQA 2ICEC 4APXA 1SLVA 4KI5E 4MZ2A 5C0JB 3MAWA 5HD8D 2GAZB 4PJAB 4S2SA 3WEAA 1CGXA 2VERN 1E5YA 2VL5A 3NZHH 4LHUB 4HDIB 5DJXB 4HU8A 5KSBA 4FS0A 2FK9A 3HA0A 4HF5L 1NBVL 4HCFA 3X1GA 4DKAA 5E8DL 5AW5B 4DF9A 5JMOC 2YKLH 5DS8B 5F7AA 4NHCH 5IHWA 5DF0A 4DW2H 4QPEA 5D72L 2PYFA 4V1DB 4XRCA 3O3DA 1HS6A 5HI3C 4QY8B 5IREA 3ARPA 3MRGA 5BV7C 2WP3O 2XN9B 2XV0A 3ZQ9A 5DUPH 1JE6A 2BCMA 2YARA 4L3EB 4M7JL 5KVGH 3KS0H 4XO3A 4R4NC 5MERB 1KG0A 1INEH 3CVHA 1OW0C 4UCFA 1CCZA 1X4YA 1NUGA 3TCTA 4BQ6A 4KJYA 4NERA 2ZWKA 3RVTD 1UT1A 2LABA 3EAKA 5E9DB 3WLBB 5C0IA 3CDZA 1HQRA 2ZX6A 5D5MA 3VYPA 2YD9A 1NWPA 2KZKA 2Y07L 3KBHE 3DROA 4ETYA 2ZG2A 1SMDA 4H5SA 5DD0H 2FHFA 2IGTA 1TYJA 3NYKA 4LOVA 7CGTA 4MVBD 2HJFB 2WVVB 1EFXB 2AJYL 2XWJA 1NBZB 1QKZH 4HQQH 4LDEB 4N0YL 2VB5A 1U0QA 1JZFA 5C6TH 3S4SG 3DJZA 4AV4A 4V11A 3VFOA 4ZOEA 3WKQA 3TO2B 1AZNA 4LCCA 5CSZA 5FC9A 5D1QC 1UCBH 3ZBMA 4RFEB 1FL6B 2ZKWA 3NEOA 2AJZB 3LKPB 3EO1B 4MAYB 4N9GA 3LPFA 3L5IA 3PY9A 4A63A 4L37B 3GMRB 1U33A 4IS6B 3ULVF 3ARED 1MREH 4KKCC 2FCBA 3HB3C 3QUZA 3WIIH 2BH0A 4H2CA 1NSNL 1T0MA 4WK0B 3CBJB 3K6DA 3BPOB 3IS0X 3T4AA 3SDXA 2F8OA 4K7PX 3MLUL 4ZMTA 3V4UH 5FA3B 1SFHA 5G4MA 4LPVA 3VXUA 3F7QA 4Q7DA 1JWUB 3QHZH 2E7DA 4U1GB 4D8PB 3BUTA 4C56B 4AQ1A 2H3XC 5K9KB 3OB8A 4JEGB 5D4QA 1TETH 3BUDA 3L2LA 4XN9A 1U8LA 2Q76B 2VW7A 4A6YA 1S6NA 3D18A 4Y4FA 5EOQL 2VQ1B 3QC5X 3STZB 2J4WL 4AQAB 5IB3B 3C2AL 1YEIH 2M1KA 2ZQKA 2BRRH 4B97A 4DZ8A 4HOMA 1UWXK 2AZAA 1MNNA 3F04A 4E5XA 5LLIC 4QRAA 1N26A 4MHHI 1KCLA 1U8HB 1U8QB 4FP8H 3UDWC 1GTNA 1J9TA 2E9BA 1KB3A 1CICA 1XEUA 3REVA 3CLFH 5KBLA 1C5DA 4UAOC 5DA4A 3VXRB 3ATEA 1FO0A 3K71A 2DM3A 2AJSH 4OFQA 1QLFB 1WYJA 1SNRA 1A5FH 4FZ8H 1UFGA 5TF1L 3FFCE 3LKOB 3SGJA 1A4CA 1VFBB 4I13B 4LBEA 1U92B 3HMXH 1P5UC 2LAAA 3ECBB 1ETJA 4S0TD 4ZPVA 5EOTA 1HE8A 2G2RA 1YG9A 4DEUA 4ZFFB 15C8L 4E9XA 4LLVB 4BINA 2IBBA 4NGHL 2Q6WA 4MBOA 1MFEH 2I27N 4Z8FH 1WK0A 2EJ1A 2ZXCA 4NWUH 4MXVE 4FYSA 3AB0C 3QA3B 5E51A 3FB5A 3V8OA 4NQCA 5HHOD 1K8DA 3NSFA 3BP5B 1BLNB 1W6LA 1JDDA 2MQ3A 3G08A 3NIFB 5HGBB 1TENA 4CSPA 4MBRA 1NFDA 2YK1H 3ETBF 5KSAA 1AFVH 3RL2A 1Z3GH 3IDYC 3MU3A 5C9KA 1MI5A 1MOEA 4YHIA 4LSVL 1A21A 2DQGH 2DH3A 7FABH 3QHTC 2X4TA 2VSDA 3CFQA 5KUMA 4U7KA 2WK2A 4U3HA 5GIRA 1NCAH 4LASL 5GZND 2QTEA 3D69A 4C58B 2R1XB 4LOFA 4Z1PA 4DN4H 4OZGB 3K6NA 1W0WA 1M2VA 3NEEA 2NZ9D 3F8UB 3WU1A 5IFJB 2ZUYA 1FFPB 4DESA 3IMVA 4GKOA 2GTWA 3UZVA 3M8OL 4O02L 2PTUA 4B96A 1OAKH 3WTVA 2KI6A 1AMXA 2Y9RT 2Z8WC 1F3RB 2Z92B 2COVD 2WZ5A 2AVFA 1WS7A 4GRMB 4UTAH 3ZE2F 4ZFGL 2R7EB 5EZIL 5KS9E 3K7UA 4XNBA 5FW6A 4JVUA 2C3VA 3RIKA 1XIWD 3ZT7A 2Q10A 4ELME 2E76C 1DQLH 4QRPE 1WJ3A 3H3KA 2FJUB 1IKNC 1UZ8B 3OKEB 2A9AA 3VQLA 1T1YA 2YPVL 4JY4B 5F7YC 3QRFM 3B9DA 4Z0XB 3QIUB 3RBGA 4DKEL 3SEPA 3V5HA 4H0GA 3KPRD 4APQA 1HXYB 3HG1A 5C0GB 2WY3B 3CQQA 2QKIA 2XZQL 4W9KC 4JRLA 1ESOA 2V6HA 3QJRB 2ZWNA 5TDNB 4DP5X 3RNKB 1QFPA 4UAHA 4YSOA 1CFQA 5T5NG 2OJZL 4NS0A 1A6WH 4IDJL 3V0FA 2D7QA 3NRFA 4P2OA 4FF9A 3AZUA 3BRGC 4G6FD 2DBLH 4JKNA 3WKPA 3GGWA 5A16A 2BO0A 2VISA 1NGYB 1ZKAA 4AGOA 1FIEA 2Q8AL 1AE6H 3MX0B 2FBOJ 3NCFB 4PWGA 2IAMB 4HWNA 1HINL 5HDBF 5F7FA 3IDMB 4JFEA 1NANI 5DEFA 4BSJA 4LIQH 1KN2L 4LSPL 3WY4A 3NSDA 1RIVH 1Q9KB 4N0UA 1ZVSB 3H2PA 2RFXB 1GZQA 3BAXA 2ED9A 3HZMB 3IMRA 4F3FA 5I1KL 2GC4C 4Y19E 2GTQA 5DZ9A 2OCJA 2PYEE 2W38A 1J5HA 2NX5D 3OGCB 3SYPA 4NJAL 1ORSA 4YSPA 1TNMA 2ZXAA 2YEVB 4PV1C 3FUMA 2R9HC 1OGTA 4JJ5A 4M6MH 2CDFA 3HI5L 2V4LA 3L9RB 4BUQA 1F6FB 3TP4A 4G9DB 4QRUB 2P42B 1JF5A 1YCSA 3MC0A 1V55B 2DQFA 3U0PA 5J13C 2F1AA 2MEJB 3KYAA 3M7FB 3X3FH 1X5XA 5JIHA 3ULVE 1G7LA 1FLTX 4RDQG 2CIKB 2XKNB 4GW5A 4Y5YB 4BEIA 4TRPH 4D3CH 4JDZA 2A4CA 5HYJE 1OOWA 2EC8A 3BEVB 1T20B 5IBLC 2QQKH 5LUMA 1CFNB 4YPJA 3PIQB 1YRKA 4PVMA 5C0EB 1UKQA 3TYFB 4F7KA 1CFTB 5E2TL 5GRXG 1NBCA 4K2UH 4PJ5B 4K3JL 3L16A 3WNOA 3MV7D 1ED3A 5T8IA 3W39B 1OQOA 4I8DA 4RGMC 5JW4M 2AV1A 5E6SB 5C07E 1N6VA 3WNKA 4FLSA 3EF7A 3WDJA 3N0AA 4U6TA 1ILUA 4HEMA 4JCLA 2YXMA 1N9PA 2L3BA 3JVGA 2NY6C 3PHAA 3SZKC 4A7GA 1HEJC 1MY7A 2R8SH 1HX0A 1EHNA 2J72A 1BM3L 1X6LA 3GRGA 4M5ZH 1BZOA 2VRKA 3WAKA 4Z7NF 5JW4N 1JPST 1XXFC 3U25A 1J7VR 4NQXA 1URIA 1VF5C 3P2TA 3ZHLA 5DHVA 1PZUB 1C9SA 3I74A 3Q2CA 2HZHA 1I7UA 1BVLA 1CVRA 1IJNA 2DLEA 2PUQT 3ELQA 4QOKD 2CNYA 1LK3H 5E8NB 3V4PB 5L7XH 1SBSH 4K4KA 3BWZA 4ONFH 4NHUA 2YEQA 1QSFA 2VMCA 3OTTA 4PJ6A 4PCTA 4JQIH 4CGUB 4I2XE 2K0RA 2J6EL 4OLWH 2EACA 3RA7L 3OZ9H 5AOIA 4MA8H 2X38A 1ZGLP 3AT0A 1CTMA 4G9FA 4HPOH 4M5TA 3QEQE 1MH5A 4Y2DA 3IFPA 4JFDB 3WTWA 5E2UL 4G8GD 4P2QB 5B3JF 3KXFE 1IC4H 4HHWA 5B1JC 3O6FD 1TZAA 4ZUSB 4EMZA 2NY4C 3KL5A 4NQSA 5A2CA 4NN7B 4ZUUA 3S3BB 1QLEB 2VT0A 4HCIA 3RZCD 2DQDH 3OKLB 4I48A 3GRWL 2FGWH 2JJSC 4YE4L 4JHAH 5E99H 4QGTA 2IV8A 3DX3A 4D9RD 4HLEA 1AH1A 3ZUCA 2JKRM 3T8XA 3UPAA 1FRGH 1OXYA 5DUPL 2WQ8A 4ANKA 5J0BA 4HUCA 2DYPA 5IWLC 1GOGA 2VDNB 2P8LB 5CO1A 2EIZA 2Z1PA 1A6ZA 4MCYB 4NO5B 3ZE2E 4RMUA 4XO8A 3TA3C 5D1QB 5ERWB 5DD0L 3RUGB 3GMOA 3NH7H 2OMNA 2EP6A 3C9NA 1XGRB 4BQ8A 3GUTA 1QKZL 3MRFA 3HC0A 3WNPA 4AIOA 3T2LA 4RFOH 3EOAA 3LB6C 2C3GA 5D1XE 1Y6NR 3HE6B 3E8UL 2GUOA 5GRUL 5EZOH 3GJFK 4JS7A 4HIEB 2R4RH 3FB7B 3QHFH 4IBSA 1UCBL 5FO7A 5BZZA 5JPMB 1QPPA 2WLIB 3O2DH 3LKRA 4FKEA 1DVYA 4AEHL 4ZG1A 2VR3A 3D51A 5GRYA 5D9SB 3CZKA 1PKQB 1HI6A 3K4DA 5IW1B 3TO4C 1RZ8A 1BDYA 1TQUA 3ZK0A 2Z93A 3EGDB 2YSSB 2VWEE 2VMJA 4KJQC 3UMNA 2EDMA 3RAJL 1XCXA 2YZ8A 1HOCB 3LPPA 3OD3A 5IEKB 4PRIE 4TTGA 1FORH 4ZBJA 2MCPH 2OMUA 4L4TA 4LKCA 1JRHH 1FQ9C 4U1SA 4X5WA 3WIIL 2ROYA 3N1PC 4GFXA 4HKJA 5EN3A 1Q0XH 2ITDB 2DYSB 4JFOB 4K7FA 4TVPD 4PW3A 5EBWA 5I0DA 3ML9A 2A74A 2F8IA 3SKNA 1ICTA 5HDBE 3BVXA 1MWAB 2WMPA 2ZYIA 4OUUB 2V2XA 1T5XA 1F4WL 5DU7A 4LU5L 3N9GH 3V4UL 3V0VB 3IYLW 1M3IA 1RKRA 2HRPH 4YSEA 5MEPB 3TJEH 2G75A 1J0JA 1XX9C 4M8VA 4NM4H 3KLHC 2XTJE 1ZDQA 4AOFA 5IR1A 3VD1A 5D7JA 5GJSH 3JV6A 3KYKL 2VXQA 4MA7H 4UM9B 1MFAL 3MRCB 5D2LA 3QAZB 4KI5C 2WWMC 3S8FB 4AQOA 1KBPA 4LRIA 2OW6A 2X89A 3UERA 2H45A 1IBYA 4H1LB 4CSTA 1DQML 4F33B 1V8HA 2DTMH 4DO5A 12E8H 4ATWA 3ARUA 2B1HL 1J5OH 3IMUA 2CLVB 5T5FH 4JREB 1A9EA 4N8VB 3ULUC 4X4ZA 3IS1X 4OM0L 4U1IB 5D8JL 3O2WH 1JFQH 3HNSH 3WEXA 2ZICA 1CL7H 2H41A 1WIUA 1U93B 4Q6IB 1I8MB 1MEXH 1BFSA 1O6VA 1IX2A 3OF6A 3B9KC 3CXDL 1HSAA 2XWTA 1JZ4A 3FH5A 5HYIA 1Z0MA 4IHBA 5IROA 4BK8A 4AW7A 4FNSA 5KOMC 5D6DA 1NJ9B 4O58H 4PGBB 5EORL 3GSNH 4OJFH 3VFRA 4Z8FL 2AK4E 3T3MF 1D7DA 4JHZA 5GGRB 3GZKA 1FFOB 5EO1B 5IFHH 4D0CA 4PJEF 2R0KL 2VLRE 1Z3RA 2W80C 1T1WB 4PVNA 1SGKA 3QDMA 2W9EL 1BVZA 4CKVX 2DQEH 4L23A 4HAGA 3NFNA 4JDVA 3UC2A 3C8KB 1G9NC 1U30A 1GC1C 3WKMH 2VZ3A 1M4KA 4F2EA 1CB4A 4Z7NE 2SODB 4EI5A 4OU3A 3ASOB 1BAFL 1FZKB 1NDMA 4NKDA 1EMTH 1JI1A 2XWZA 2HFFA 2DW5A 3NIDF 5KYXA 2Y5EA 2H6UA 4MD0A 5MEOA 1Q0YL 2CGRH 1KEMH 4JM4L 3PDOA 5HJ3B 2GIXA 2BSRA 1KC5H 4YE0A 4PJBA 3B9AA 1AHKA 1SJXA 3F5WA 4N5UA 3PL6A 4HEPG 5CN2A 2Q20A 1QTSA 1N67A 1OAKL 4WFFE 3MRNA 1JPGA 3L13A 2YAFA 5FYLE 1NKOA 3RTLA 3FAXA 2XRAH 4NQQA 3EUDA 3L3HB 4LAQH 3N6YA 3KLSA 2EINB 4RISH 2NXYD 3NZUA 4I0KA 2Y6SC 1CFMA 1K2DB 5IZ7A 2OSWA 5FECA 5B3JE 4NIKB 4L3FA 3ZE1B 1XH2A 3NVQA 2ATPA 5ESAB 3LXCA 4BFNA 1DQLL 1ZXQA 4WRLA 3M86A 3SDAA 4ZXBD 2YSTA 1QFUL 1BG1A 1BOGB 5LB1A 5HDQH 2JH2A 2CWRA 4NO3B 4HFUL 1H3XA 2PTTB 3VYNA 3N06B 3UZQB 2D8KA 1DQKA 2D9QB 2EDKA 4FQLL 5LBVA 4DP2X 2VLKE 3LXAA 1X6NA 4MJ5A 3O3UN 3WJLC 3FB6B 4P2RE 4ZMVA 5KYYA 1WFOA 2OAAA 1U4FA 3U6RB 1F45A 3GJFA 2APBA 2N0KA 2RBLA 3TYGL 5KVFE 3W1ZA 3BAEH 2DAVA 4OZHA 5C0RH 2AQ1A 3GC3A 3FUHA 5FCUH 3BWUF 4E5XG 3D05A 1WFJA 3OXSA 4EBQL 1JGUH 1GSMA 1MVUA 4NUMA 5FAAA 4AIZB 2C7UB 4X5PA 5EFIA 3PGCA 4WNQA 3CFJB 5BS0B 4M93C 4XB8A 4M1CC 3TFBA 1MJ8H 5FW7A 4JPIA 1BMWA 4N6QA 1J87A 2SEBA 3AG2B 4GMSH 4Y1TA 4WI0A 3H0TA 1PNCA 2D3VA 4JZJC 3T0EA 2GABA 1RIUL 1NGXB 2TSAA 2VLJE 1ZTXE 1T22A 2GBUA 4HUXA 4EDXB 1U6AL 4OJDH 4PYHA 2PETA 3KYOA 1HH6B 1L7IH 2NY2D 2OX5A 1JTPA 3BEWB 3KBFA 4MRBA 4R3SB 1EEYA 2OMZA 2JI2A 5KYUA 3KYMB 4WHYG 5T1KD 1TSRA 4MJJA 4UT9L 1FE8H 8FABA 3EH3B 3TASA 2JJWA 2A99A 1A7OH 4WW1A 1P4BH 1MHPH 4RMBA 4PBXA 4X7EC 3KJ4C 4IMLB 4NCC2 3UJJH 4H13C 2C4FU 4LCYA 2JF1A 5HI5C 4PJ7B 3ARFC 1BXUA 2NQCA 2I69A 3CBRA 4ZW8A 4FNTA 1LNUB 4N3TA 1WWWX 5D7IA 3WJJC 4PG9A 4FKHA 5LDSA 4H20H 4L8BA 2OA9A 1BZ9A 3N42F 1ID5I 2WXNA 3C6SA 2WXPA 3SYOA 2R0LH 3HMWL 2I60H 4ELDA 2D03L 2PWGA 4FQCL 4FTDA 4G7VL 1VGEH 3QSKB 4AK2A 3EIFA 1A6VH 2X1QA 4W81A 3VI3E 2VDMB 3ABKB 4GSRA 2G60H 5B4MD 4M5ZL 4PJDA 2FYYA 5KAQF 2QQNH 1TPXC 5GGTA 3QQDA 4ZO9A 4KKQA 4IBYA 2EYRA 4JQXA 4H8WH 4JX0A 4KO7A 4NI6A 1UXSA 2IDSA 2ID5A 3ARBC 3GBLA 4XP6L 3U79A 2ZCKH 1YC8A 3BFOA 1PX3A 2MPAL 5I0ZA 2B4CH 1SBSL 4XAWL 4UQDA 2BWQA 3FAWA 4YHPB 4J3OG 3OXRB 4TUUA 3U2SA 1ETZA 4QO1B 1ZVYA 3MLVH 1UD6A 1BJ8A 2NY0D 3OZ9L 4CGTA 2QDVA 2OQJA 3B5TA 1OP4A 3BUIA 3MA7B 3T3ME 3VG9C 3WIAA 4C55A 3ET9F 4NN6B 2FJFB 4YXLH 4OV5B 1WE5A 3DBSA 4JRXB 4KHTH 1PD6A 4PJEE 3NJFA 1AO7D 5DQ9A 5CF3A 2P47B 2EXYC 4OFYD 2QHRH 4YFDB 5E5MB 3MFFA 3V7AE 4BDVA 1MCPH 2FEJA 4PJ8B 4MB1A 1A1OB 3RVUD 1U8JA 2VN5A 4Y7MA 5DUJA 1YPZB 2WBJB 3IXTB 2F74A 1GL4B 2K3TA 3GMPA 4YNYA 4DGVH 4JPWH 3QJSB 5HYSB 1I9RH 1UH4A 3NIDE 3D39A 3BLBA 4GT7A 2FGWL 4HPYH 5JLZA 2VDQB 4JHAL 5E99L 3ZIMA 3E80A 1RMFH 2ZSWB 1T7VA 1B9KA 1SMOA 1WQVT 3O4LD 3EFDL 2KKQA 4HX1A 5HGAA 3ULVC 5JXEC 1EEQA 4PJGB 2GK0A 3SHSA 1AGDA 3ATAA 5J1AA 5EF1A 3MBED 3WLWC 2BVYA 2VYRE 3HZKA 1QRNA 1E8WA 3MV8B 2P8MA 4UV4L 1JSYA 1B4JH 1JPFA 5DZNA 2R2BB 4JM2C 3CK0L 5KBPA 2YXFA 3F2LA 5J06A 5K9OA 4XZUB 1NCNA 5IBUG 4GBXC 3BWAB 1WFMA 2HRHA 2NY3C 4DP0X 1D7BA 1R33A 2J8UB 3S5LA 3MRDB 3VXME 4WW2C 2B7DT 7PCYA 4ECNA 3QORC 4GRLA 4N22A 2P46B 2YQ2A 4L4VE 1I3RB 1DVUA 2PPEA 3W0WE 5IM7A 3ROLA 3QNZA 4EVNA 1G4RA 4XN8A 5ECJE 1TO4A 1U8OB 3DBXA 4FYQA 5I0VA 3ERXA 5F7WC 5I6PA 5FHAL 5EIIA 3RBSA 2BNQB 4FADA 1J0HA 1LWHA 3S37L 4AVKA 6CGTA 5IEHA 3MZTA 2TRYA 3GK8H 2PP8A 5D7LD 4PGCA 5AAMA 1AS8A 4R7NB 4M3KB 1A4JA 2VSKB 1F11B 3QDJA 4UDUA 5EU5B 1FLRL 1ULVA 1U58A 4NNXA 3MRLA 2R2EA 3O3AB 3WO3B 4F8PA 5IVZA 4I18A 3RURA 1XTMA 3SCMB 1AGBA 2VDLB 1BBDL 3RKDD 3WCYA 3EYUH 3FSWA 3RGVD 3KMDA 1E8ZA 3EFFA 1OAUH 2VRAA 2RJMA 3I50L 1NDGA 1Z5LA 3MRRA 2NTFB 4I0PB 4P2YA 1JZ5A 3N1QC 4IBQA 1MXDA 4X7DC 3T3PF 4W9FC 4XPTH 1MG2C 1JZHA 1ZA3A 2KQNA 4M5YL 5E4IA 4EN3B 2EIDA 1S46A 1Y18B 5CWSA 3O3BB 3U9PL 1BIIB 5JIKA 4I1PA 4J3XA 4JO3H 5EN2B 1JV2A 2NY5C 1JYXA 2ITEA 4PRHB 3RTQA 4MA7L 2BXZA 1BXVA 3WHXB 4HIIB 4PR5B 2ARJQ 2QHLA 4HKXA 4GKZA 3FMGL 3LMJH 1KT2A 3A4DA 1KUMA 4ANUA 3RVXD 5FB8B 1CDHA 2BVEA 3K0WA 3MNWB 4WI3A 3GB7A 4LCUA 5AKTA 1AR1D 4I9XA 3KLQA 4EZKA 4DT2A 3TH4T 2XACC 4DVBB 4WHYH 1Z9OA 3X3GL 4JFPB 1R3JB 4DSYA 4QHMB 5DDHB 1MCWM 3I6GA 5T33L 1R5WA 4XBGA 5TFSL 4PRPD 4NWTL 1PD0A 5AOLA 5GPRA 3Q6FB 3ZTNL 1PVHA 1F3DJ 4HJJH 1NC4D 1G6RL 1U41A 1SM3L 5L4FA 2WLKA 2IANB 2P5EA 2JK5A 1NMCC 3F00A 3TFKC 5K93A 4GMTL 3KG5A 4LB8A 2R51A 4KTDH 3WO4C 3OBAA 2JJTA 4OJFL 4XMVA 4UQEA 5J12B 4JRFA 4HIHB 4Z5RA 4P5MB 2ED7A 3BHBA 2P26A 5KZCB 3IM1A 4JCMA 3TGXA 2P5WE 3GI8H 2CHWA 2QSCL 1QUNB 3BUBA 2E0PA 4YIQB 1HHJB 3MRPB 3BH9B 1TITA 2K4AA 3EYVB 1G7QB 2F6AA 5F9JA 4ZX5A 3RY6A 3TM6A 1AXSB 5E08L 1ZS2A 2K9FB 2OZ4H 2YJLA 4Y7OC 4P49A 3OR7B 4OQTA 5EC2B 4F2FA 2BZ7A 3LN4B 2FSEA 3QO1A 5E8EA 4DKTA 4M3HA 3EDFA 4JMNA 3GSOB 3PWVB 5C2BL 2RMNA 4XVTL 4HIPA 4Y16B 1OALA 3GNMH 3CQFA 4KXDA 4CC0A 5AVZB 2CG9X 3DUUB 4GS7B 5JYMA 5A2FA 4BGDA 1MHCB 1ZSDA 3FPXA 2Q0ZX 3T0XA 4Y5XC 4Y4HC 4ZQTA 4FFWD 2WD0A 4TNWK 3TBTB 3UCRA 5ETUA 2OTWB 4BH8B 1INDL 1RD6A 2X2HA 3UAAA 4FXTA 1ZWIA 1SLXA 2XRAL 1QZ1A 3DJTA 4XC1L 2HPTA 4MJ4A 5EU6D 5EDSA 4O2CB 4PBVC 3FTWA 4ZI8A 4PP2A 1M56B 1QFWM 3DUHA 3MCLH 3QG7L 3QUXA 3VACA 4OLXL 3QVAA 2XTJC 5JORA 3KPOB 4D0DB 5BQ7A 2NZ1A 3EDKA 1IT9H 3D4ZA 1O5PA 4PS3A 4PB0H 5HDQL 1YJDC 4UUJB 3OB0K 1KCWA 3FONA 4Y9CA 4N90D 3L4TA 3OC5A 1MIEH 3H7LA 4P4RB 3TBYB 1VEMA 2Y22A 1JFHA 3HI6H 2J12B 1JZ3A 1P6WA 3K46A 4E9SA 2XWCA 4NKOA 1ZAGA 2Q3XA 3AU0A 4HWZB 4BQCA 1L3NA 1JWSB 5CMAB 1ZLVH 4AVIA 4M48H 4XPBH 4W4NA 5EZJB 1HEZB 4QRQB 1J0KA 1V3LA 5BVJB 5D6CB 1ZHLB 4JFHD 1DN0B 5FCUL 5AW7B 3HG3A 1ZT1A 5C0NC 1BQHB 1OT1A 1PIGA 1R3KA 3L1GA 3ENEA 3MKGA 3L3JB 4IOFD 3SE3A 3U7AA 3FHAA 3QH3A 5B22A 5BXFA 2BNUB 2C1OA 1T04A 1LEKA 1G7PB 5MENB 2B20A 4D9LL 4MMZB 4BCYA 5DRXA 1R47A 3U1PA 1MJ8L 3S37X 3V0EA 3ARDB 1I1FB 4F80A 4FFYA 4F7CA 3MREA 4WCYH 2BFVH 1RUPL 3FFDB 1XAUA 4QTHB 1TNNA 2IG2L 3P3UA 2X05A 3LNIA 3B2UD 3FCSA 3GSWA 4N2KA 5L2KD 3MUGA 4FHJA 3QXTA 5AW2B 4YPGB 1F2XK 1DE4B 3QNYA 4AK1A 3L3OB 4NAMA 4FXLA 3BFQG 4JDEB 1JNNH 2IBGA 3BKCL 2CA4A 3ARTA 3NUKA 4YHKL 5DD5L 2VCOA 4OI8A 1M6OA 4ABWA 2VR4A 2FH8A 4PTUA 4ODXB 3PCYA 1FE8L 5E03A 3SYQA 2V8LA 2PWFA 4QWWD 1C08A 1KJ2B 4K3HA 3NZ8B 5IQ9A 5I26A 2PO6D 2E3VA 5AL0A 1ZHNB 2FT7A 4NLHA 4WWOA 4E9WA 4HT1L 2NYZA 2A9NL 5E7BA 4ATTA 4EZLA 2D31A 1C16B 4QRPB 1N3NA 3NP3A 2ZIDA 5DHVH 3OMIB 1WZ1H 3T3PE 4MJIB 1LE5B 5KTEH 3SDDB 5C0BA 4ZFOL 1J1PH 2OMTB 3RWEA 4FMKA 1PF3A 4DEWA 5C7XL 1LO2L 1KYOJ 3KWUA 4F37K 3WS3A 4JANB 4GXVH 2W07B 3GHBL 4QT5B 5HHOE 4IJTA 2HWZH 5ICXB 3T65A 2YEZA