2YPLE

Structural features underlying t-cell receptor sensitivity to concealed mhc class i micropolymorphisms
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
238
structure length
238
Chain Sequence
GITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASTGSYGYTFGSGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFTGSRRMTSGPRIGPKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-57 ALPHA CHAIN
publication title Structural Features Underlying T-Cell Receptor Sensitivity to Concealed Mhc Class I Micropolymorphisms.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2012-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yplE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yplE02
3TJHC 1OGAB 3QJFA 1T1WB 2LAGB 4JPVH 5FYLE 1ZT1B 4OCRH 4F7CA 3GJFA 4IS6A 3SE4A 4XBGA 2P5WA 1KPVB 1NCTA 5I66A 3T1WA 1DFBL 4YBQD 5EOTB 4PV9B 1MAMH 3NN8A 5JUEH 1DZBA 1CFVL 4BQ9A 2EYTA 3IF1A 1RUKL 3IKCA 1JK8B 3UTSD 3IRPX 3LQMA 1KJ2B 3EOAB 4H20L 4KJQD 4G6JL 5H2BA 4APQB 1QFPA 1U3ZA 4GRLC 2UVFA 3N85L 2C26A 3MLUH 3RJQB 2B1HH 4YUEH 4W4OA 5E7FA 2BVTA 5HI5C 1OWWA 1EGJL 4WI3A 4CN4A 2HFGH 3IJYA 1A6VH 1JCKA 2X4TB 2ZUYA 4BJLA 4ORZC 4XAKE 3NIDE 3BDXA 4U1KB 2XZCL 5JTWA 1A1MA 1KB5L 3VXSD 3NCYP 3QCTH 1CR9H 5JNYB 4X5WA 2D03H 4ZFFA 1AKJA 2MKWA 5F7UA 1ZHNA 3TV3H 5EIVA 5KOMC 3MA9L 1MCBA 1EHLL 4JZOA 1XR8A 3QDJA 1U8PB 1WEJL 1T2XA 5DI8A 5C0AB 3IETB 4ELMB 3G9VA 1EMTH 2QKIA 2NXZC 3OZ9H 5DFVC 3Q6GL 4RWYH 1KG0B 1KN4L 3ESVF 2XA8H 1T0NA 1B88A 2ESVE 5MP6H 2R29L 1IM3B 3GMNA 1JZ3A 4M6OL 3GDBA 3QO0B 3OTTA 4ZO9A 5KAQG 4MS8C 1L0XA 2W1NA 4LK4A 3BKJL 2RAMA 3SJVD 4ZTOL 5IBUG 5C0EB 2HLAA 5D1QB 2W91A 1N4XH 4PP2A 3T0BA 5KSBE 1MFDL 5F9OL 3TN0C 4A2LA 3W2DL 4N0UE 5J8OA 5ICYB 3P9MB 1P2CB 1HXYA 5IMOB 3ZTJG 3ILQC 3GZKA 4G6FB 1UGNA 4G8GD 4ISVB 4LSQH 1F8TL 5EU4A 5FUOH 3TBSA 4XBPA 2X70A 3GB7A 1S7UA 3CMOL 4J3UA 1IC4L 1NUGA 4QHKI 3ZLQC 4GW4A 4GMTH 1AQKL 1MH5B 2GCYB 4JJ5A 4U1IA 5IV2B 5D72L 5ICXB 3QJHA 3E6HB 1GOGA 5GGSA 3MC0A 3VWJC 2IQAA 2RBLA 5CP7A 5AZEL 1JHKH 3O3UN 2WWMD 3L3IB 5KVEL 4L29B 5EU5A 3B4NA 5DTFB 3R8QA 2JJSA 4EDXB 4JFQB 2LQRA 5D5MB 3D25B 3BP5A 5BRZA 2ICEA 3GBNH 2Z31C 1CICD 3FQRA 1NFDB 3ARXA 1A7RH 2A77L 1JE6A 4P5KB 2HMID 5DJXB 1YPZA 4XPHL 1M71B 5I9QC 1UJ3A 5C9JB 1MQKH 3K2UH 5JIPA 4HS8H 1AGCA 1EFXD 3KXFB 4JZNA 2Y25A 3IDNA 1W72H 4RDQG 2MNUA 1RK0A 1S7RB 3TO4D 1IQDA 1T21B 4MNQB 4XCEA 3H9HB 4UU9A 1M7IB 4XWOD 4PGBA 3REVB 1ZVYA 1CFSB 2DOCA 2EYSA 3PL6C 2R1YB 3WSQH 2IBZY 2XNAB 1JHLH 1Z9LA 3P4NB 5E2VH 5C08E 1DQDH 3KVQA 1P6FA 4PGDA 5EOCL 4GUPB 3UTOA 3KYMA 1BFOB 3NABH 4WW2B 3NFSL 4LSSH 3U2SA 1FRGL 2GUOA 4C55A 3MFGB 2HFEA 2AXGA 3ES6B 3MOAH 4YGAB 1XGUA 3LV3B 4WIQA 3SDDB 3MV9B 1Q72L 2BC4A 3VD5A 5CJOH 4EI5D 3THMH 4R4ND 4NOFA 3SPVB 3ESUF 4LSRL 4ZXBB 3NOIA 5CWSB 4G7YL 3QFJA 43CAA 2NY6B 3VFRB 2FHFA 2R56L 3IXTB 4LIQL 3MGOA 4LEOB 1MCQA 3X17A 2E7BA 3MROA 5GGQL 3IJSA 1LDPL 1QBLH 3WXVH 3QUXB 4KY1L 3TO2A 2HN7A 3QUZB 4LLVA 4RX4A 2NYYC 5FKAB 3U7YH 4O00A 4OSUL 3A6CL 4YDLC 5LAXB 2DI9A 1IKNA 3RWIB 5ACLA 4IRJA 2CUMA 4Z7UF 2HYMA 1FLRL 1U6AH 1L7IL 1T83C 2E3VA 4P4KA 1DL7L 2J4WL 4X9BA 5BOPA 5FO9B 4LLMA 1BFTA 3B9EA 2JJTA 1UQSA 2GTZB 4NRXB 3FRUA 1P5VA 3KLDA 4M3JA 4ODTL 2ERJC 1EO5A 1A6UL 3R0NA 4PJBB 3EJZD 5CJBA 5DRZA 1ZTXH 4AENB 4QF1B 3QHFH 4P59L 4WFHD 3HI5L 2X10A 4BSJA 1UXSA 1SY6L 3N9GL 5CEZD 4OLUH 1KYOJ 1MPAL 4WJ5B 2GJ6B 3MRKB 1DVFD 1C5DA 4Y5VB 2BSRA 5JHDA 1ONQA 4CBPA 4KKAC 2E7CA 4K2UL 1UWEL 4S1SH 5IQ9A 2CLZB 3DNKA 5EDXA 5J6GA 2VXVH 1AQDB 4PJXB 2AP2A 5MERB 1I7RB 2VISB 4Q9RH 3LEXA 5CUSL 5GSVA 3EO0B 2MHAB 3CC5B 1XF2B 3O3DA 3DURB 3HUJB 2R8SH 4YDJA 2E7MA 1ZMYA 5IVXB 1CYGA 1WT5A 4K8RC 3MUGB 1XCQA 1E27B 3RDTB 3IGAA 1AY1L 4UUJA 3PHOB 3PP4H 2K7QA 4EJ1C 1NBQA 4GXVL 2AK4E 3DX6B 4HH9A 4ZUVA 2F53E 4UNVA 1HNFA 1NFIB 4TN9A 4P3CH 2OJZH 2A6DA 3O45A 4HWBH 4DOHE 1QNZL 2DN7A 2B0SH 3QH3A 2YN5A 3FB5B 3MRNA 3C60C 3O3EB 4RBPH 3KLHC 1CGYA 1P84J 4LDLB 2OTPA 1X5AA 3KPOA 3QXAA 3JWOC 3VFSB 4LVEA 2VDNH 4KKCD 5IB5B 5D2LB 5HHVL 3S37H 2R9HD 1DQLL 1U8JA 1I8LC 3HA0A 1I7ZA 3O6KH 4RAUB 4ZAKB 2R1WB 2NY5H 1Q9OB 3QEUA 4LDEB 2ADJB 4BQ8A 3H9SD 1S8DB 4PY7A 3U4AA 2UY7A 4ENED 5DJ0B 4RMTA 1ZANL 4FG6D 4JRYB 1HNGA 4IRSB 5HHQB 4QXTB 3LQZA 5ICZA 3RTQD 3QIUC 4P2RA 1Z2KA 4JFZH 3U0WL 2AJZA 4GLRH 5HYQA 2R4SH 3EAKA 1XT5A 2AJVH 5JR1L 5HHNA 4LHQB 4NNPL 2VDQH 2R0ZL 3W9DB 1PKOA 3W5MA 4HMCA 4IM8A 1WZ1L 3U48A 1L6ZA 2QADD 4U6VL 3KPRB 1N2RB 1NMBH 3L3OA 4P23C 1WSST 5J3HC 1FIEA 5E9DA 3D87B 3M1BB 1RFDH 2GSIA 4KJPD 4XNQA 1YUHB 2GQHA 4PYHA 5EFIA 4FN0A 3ZDXE 4D3CH 5I73B 4L3CB 4LSTL 3NVQA 2X4QA 4M48H 2Z93A 1GOFA 2DTMH 1GYAA 3EBAA 5ALBL 1EEZB 2VOTA 3ALXA 2ZG3A 4LPWA 3D0LA 4LPXA 2O26U 2VAAB 2IF7A 4RFEB 3K74B 4IBLT 5F88B 1IC5L 5C0JA 4TVPL 2F5BH 5EOCJ 4POZD 2H8PB 3RAJH 1I1CA 1RY7B 2BVUA 4F15B 3CH8A 2E9JA 4L4TE 3NMEA 1N3NA 4PJ8A 1ERNA 3VU2A 1U91B 1H5BC 5C2UB 1FO0H 1U9KA 2HFTA 3C5ZB 5TE4H 2YUVA 2NTSP 5FGCB 4GW5A 4MWFB 1IFHH 1G9NH 1KEGL 5GGTA 2CR6A 4R3SA 1F5WA 1HYRC 1BBJB 1N8ZB 4JFHE 2GTWA 1VACB 5KSAA 1LMKA 3QPQD 1K4DA 4EN3C 4R7DA 1HHKA 1KGCD 1FP5A 1N0LA 5MI0B 1AO7B 4HD9A 4PJEB 1SYVA 2F19H 5IROC 1UH4A 2EC8A 1LD9A 4RFOL 4BUGA 2HA1A 1CDUA 3F5WA 4P0DA 3GKWH 5DUPH 3O3BB 1A2YA 2JIXD 3G6AB 3ARTA 1OF2B 5C2BH 3AB0C 2R2BA 5BS0D 5E4IA 2EIDA 1CF8H 5H94A 3EOBA 1NKRA 1NCDH 5DD0H 2BCKA 5E6ID 1INQA 3DI3B 2ZUXA 4YHOH 2CMRH 2APBA 5IBLD 5HTSA 1M05B 5ITBL 5CLWA 3O2VH 1NPUA 4I13B 3MX0A 3CH1B 3K8MA 3DSFL 4GAGH 4BFEA 1BQLH 3VW3H 1X5XA 2PXYD 1OY3B 1GZQB 4R6UA 3KHOA 4QRRB 4J8RA 4G8IA 3SKOA 1Z3GH 1TJGH 4O2EA 4IOIB 4YHKL 4Z95H 4XVJL 4ZO7A 1IAOB 3LAFA 3R8BB 4TNVF 4KQ3L 1XGTB 5DJYA 5CBEA 3LKRA 4AH2A 4GAJL 5CZVH 3RWDA 4O4YH 1YJDH 1FNFA 3BP6B 2QSTA 4OGXL 2EEDA 4H5SA 3N50A 1NEUA 4R97C 3EJJX 3OX8A 2OP4H 2Q86A 4KDWA 2VXSH 3KS0J 4MDIB 1SMAA 4YHIB 4KUZH 1YQ2A 3QRFM 1AHWA 4G9DA 1A3RL 1G6RH 2K1MA 5HBBA 2R0LH 2Q6WA 1QFOA 4K94C 1KB5B 5AEAA 1NGYA 3JV4B 4NHUA 4WV1A 3EO1B 4YZFF 3JWNC 5KSVA 2HT3C 3Q5YA 4F8TA 3O8XC 2AXJA 1QSFD 4ZTPL 2R69L 4KRMB 1RIUH 2Y07H 1NDMA 1UZ6E 5I30H 3Q48A 2F9BT 4YC2B 3EFFA 4G8EB 3O11B 5EN2A 5FDWA 2DD8H 3MRBB 2LU4A 3AAZB 3QAZB 2YXMA 1QLRA 4QCIA 3GSXA 1P1ZA 5EPMA 2FJGB 2VLKB 4NDMB 3FT2A 2NY4B 3UJTH 2YC1B 4S0TD 3QUKB 5D1XA 4C56B 5DD3H 2IBGA 5DJZB 3EDEA 4NRYB 1R3IH 3N1PC 4QOKD 2VXUL 4DJMA 3FO1B 3FTGA 2I27N 2DLTA 2EE3A 4NQSA 4CJ1A 4FP8H 1F4WH 4JM2B 1F6AA 1FCCA 4NUJA 1HHJA 3MRJB 2EDXA 3I75B 4YDVA 5AWNH 5M94B 3TP4A 2HVJA 3H6JA 4E5XA 2GT9B 4TUOA 2VMFA 1UM4L 2Q1EA 3TLRA 5CZXC 1U3JA 3MRCA 1WFOA 1JPGB 5DJ8A 4HWZA 3SE8H 2IEPA 3HE6C 4NKDA 2NY2D 1SHMA 4MB4A 1FZMA 3NGBC 3U6RA 4JPKH 3FB6A 1HIMH 3BUYA 2UWEE 3DVGB 3H42H 3WLBB 3CFBA 2V9QA 4QNPF 3WIHL 2GKIA 2NX5B 5T3XD 2APWA 4Y19E 3EO9L 3UZVB 1WWCA 2CK0L 3ZTNH 2F54B 3HG1D 4K8RL 3ROLB 3D6GA 3NFNB 1YQVH 3EW3B 4YDIH 2DQIH 3HC4H 5JOFA 3V5DA 3KYNB 1MI5E 2W60B 5GJTH 3QEQD 4HIJB 3HNVH 2EKJA 4OD3H 5J4MA 2FNBA 1BWWA 3D2UD 1RZKL 2EC9U 2VDOH 4LQFL 3ULVE 2X9XA 1S78C 3RHWK 1MLCB 4NQCD 3SKMA 2WQ8A 4XP6L 5MENA 2DQEL 1NGQL 2ICWA 3JWOL 3RP1A 4NC1C 1R5IB 2FIRT 4K3DH 2JCCB 2P5EB 1A6PA 4FQXB 1XIWB 3KWWA 3SE9L 4HJJH 3MV8E 1QHOA 3NCJH 3VFWB 4MVBC 1E28A 1T04B 1A4KB 3GMMA 3K4ZA 2VKXA 4GG6F 2IMMA 3QI9B 5HGDA 5T1MB 5DC9B 1JMZA 3B9KA 1V8HA 3CU1A 2AQ2A 1RZJC 3GSRB 3WXWH 3G5XB 1JYVA 5FCUH 3G6JA 5B22A 3CLEH 1CL7I 3STBA 3TVMC 4EBQH 1ZGLP 5IFJB 5CEZH 1BP3B 3F65A 2FHCA 1AR1C 5FV2A 1VENA 4XMKL 2OMBA 4OCXH 5DDHB 1QLEL 3DXAB 2WAHA 1F6FB 4HGWA 5HYJD 3AREC 4MJ5B 2HG5B 5HDBE 2BFVL 3CVIL 1IMHC 4KRPB 4ZFOL 3VFNA 1CE1H 1KELH 4OZFH 2EXYD 4D9LL 5FOBA 1PZUB 3QQ4A 2HKFL 5CEYA 4JHAH 5IKCB 1PLGH 2G5BA 5FM5O 1N6QL 2NW3B 4KI5F 2APTA 3B5GA 3N06B 2E8YA 2ZOKB 3UZEA 2D31B 1INDH 2J88L 3TYGL 2CUIA 1RHFA 4ZFZA 3W11C 1MJUL 1NBYB 4U1MB 4LMQE 1ZEAL 4S1DD 3OG6B 4BH7B 1EEUA 2G2RB 1JUFA 4AIZB 2OL3A 4OZIE 1YMHB 1CFTA 4HCRL 4LFHD 3FT4B 3LN9A 4KHXL 4RA0C 3IAGC 5FM8A 3RVUD 4N90E 4CN6A 2XG4A 4MA1B 5FM5M 2HWZL 4U0RB 2C4XA 4WI7A 3VFTA 4KVNH 4H1LH 1N0XL 1YEKH 5HPMA 5I8KL 1CFBA 5F9WB 1A1OA 1F02I 3C5SA 2GFBA 3OHXB 4NQVB 2FGZA 1FNGB 1IAII 1VPOH 3NA9H 5GRVK 3ZKXC 4P2OB 5DJDA 4LGPB 3KR3H 5E08L 1O5DT 4DTGH 5SWZD 2VABB 1GRWA 2XFXB 3AXLA 1CFNB 2C7UA 1JGEA 4Y4KD 3SDAD 2GAZA 3WV0A 1GGCL 3QIWD 4MQ7A 5CEXA 3EYOB 1A5FL 4JN1H 2VH5L 5J13B 1QG3A 2OTUB 4KDTA 4M8QB 3KHQA 2JK5B 4L8BA 5F1NA 5FYKD 5F1IA 1GGBH 5EUKB 3S97C 4YAQA 4KI1A 1OGAD 3QUMH 4OZ4A 3TA3A 3KYOA 5HHOB 2C4FT 1IT9L 5C0BB 3I3BA 4U6XB 3RL1B 5A2LH 2VDML 2FBOJ 1WCBA 1ZA6B 3CK0H 1QEWA 3C6LA 1A7QL 2ZJSL 4JFXA 4MHHI 1NANI 2N7BA 1OTUC 2AGJH 4F2MA 5GGVH 2OM5A 3P77A 1X6NA 4LCWB 2FLBT 4Z0BH 1CL7H 1MELA 3DUHA 2O5ZH 5E8NA 3RI5F 4X8JB 2LFGA 4BZ2H 5EUOF 3LSOA 5IW1B 2FD6L 4APQD 2ED9A 3BN9D 4KV5F 4J12A 1KEMH 3OAUH 5LVEA 2H9GA 2CDGB 4K9EC 1D9KA 4JKPL 5JDJA 2OS7A 3BHBB 1T66D 3T3PE 2VE6A 4I18A 3BD3A 2BOCB 4KI5C 1JV5A 1Q0XL 1RZIA 5ENWA 4E42A 4JR9H 3R1GH 5IGXH 5LWYH 3TIEB 1AXSB 4F37K 1D5ZB 4FZEL 4GRLB 4FFWD 5D71H 2J2ZA 3NIGE 2FJHA 5C0AD 3EIFA 4ZNEE 5HHPA 3VRIA 2A83B 3WLWC 2KDGA 3WNMA 1V7ML 1GOHA 3DMMC 4HXBL 1FN4B 4OCLC 1F11A 5FHAL 4K94L 2HJFB 3T1FB 3LS5H 1YN6A 1ES0A 2H45A 2IG2H 3VXNB 1T1YA 3MLSL 3FB8A 4KROD 4L4VA 2WUCL 4DQOH 3C2AH 3N1FC 1U58B 3VXOA 5JW3L 4OZFG 1INEH 4R7NA 4PJFB 5BJTB 1EFQA 5IMMA 5JA8B 2YZ1A 2X1WL 5INDA 4ODSH 5IHUH 3T0EE 25C8H 3V6BR 2C1OB 5I0DA 5D96C 3E8UH 1WF5A 4G6FD 1LNUA 1QRKA 3DV4A 4H88L 5JPNA 2NY7L 1A7NL 1IAIH 3BYTA 4XVUD 5KBNC 3VXUE 5CINL 1MFBH 1BFSA 5ERWB 4B7LA 1CTNA 1RJZB 3ZO0A 2HJKA 4QTIL 3TPKA 3BIBX 1BQHB 4ODVH 2YSSB 4Y16A 2DQTL 3PP3K 4WUUE 1WLHA 1TZGH 1FGNL 2OR9H 5DJ2B 3C9NB 1Q9KA 4Y2DC 1JPTL 1JPFA 1NLBH 1ZWIA 2DJSA 1JGLL 5CGYC 3ZMRA 4PJ9D 2WP3T 5DQJB 3PGFH 3RUGA 5D9SA 4OLZL 3UJIH 4PJAA 3BEVA 3U0TA 4NQXA 3FN0H 4PJGE 3JVGC 3D48R 5EZIL 3UTQA 2A0LC 2VAJA 3DO7B 4KH2A 3VI3E 2CLRA 5DJCA 1NFKA 4NZTH 5CHNB 3SDYH 3HZVB 3U9PL 1FZJB 1LGVA 3KXFD 3E3QC 3WHXA 5IFAH 1QFWI 5JDSB 2FX7L 1S9YB 5B39B 4MNQD 4P9HC 4WU5A 1KACB 1CDHA 2AJ3B 3MLVH 5DD5L 1Z5LA 1WBZA 3OKNB 3S34H 3F12A 2DQJH 3SDXA 5I9QB 5CBAA 1YA5A 3KPMB 4Z77B 4YBLC 5KSUA 5BQ7A 3G08B 3ARGC 3SGJA 2AEWA 7CGTA 3BZEA 1B0GB 3P4OB 5LGHH 4M43L 3BGMA 5D2NC 1Z9OA 4G9FA 4AT6A 4IMLB 3STZB 1TCMA 3O3AA 3BH8B 4MQTB 3SDDD 4DUXA 3MV9D 3LN4A 3MBEC 3ARSA 3HI1A 3EOTL 4B50A 2Z8WC 4KKBD 3PL6B 3KYKL 3L7EB 2QJDA 4ZXBD 4LKXA 1TZIA 1HXMB 5FA4A 4DGIL 3RWEA 2NY6D 4R4BB 1TTUA 3RVVC 2AV1B 3MR9A 4DGVL 3CCHA 4JAMB 2P24A 3RIFF 4PJIE 5DVOA 2VLRB 3VI4F 2H1PL 4NZRH 2MPAL 3O0RL 3QUXD 4R96B 3IFNL 2O5YL 3ARBC 3PQYE 5E5UB 1D5IL 2GSGA 2NY0C 1HHIA 4NBXB 1EHAA 1MCPH 2NLJA 4RWHA 3QUZD 5I71B 4NQDA 3ZZ1A 5MHSD 2DJUA 5DR5H 2DKSA 1P53A 2AJUH 2B8OT 4JLRB 2F58H 4PRBB 1KPRA 3TN0A 1A3QA 2FX8H 4HHAB 1G1CA 3Q3GB 4N0CC 4NIKB 4W70A 4MXWL 3C09B 3C87A 4AMKH 1RUAH 4WEUD 4MJIA 1LEKA 1TCRA 4IDJL 5T3XH 1FG2B 5D7JB 4PRHB 2VZUA 3F7PC 4Z0XB 4LCIH 4DFIA 4YDLB 5FA3A 1LO2L 2GIYA 5AAMA 1GCFA 5I1CH 4KGJA 1A64A 3MRDA 1BZ9A 2EDOA 5HGBA 1BREA 5F3BB 2GJ6D 3L3GB 1GZPB 1JGUH 5D7LB 2NY1C 4W68A 2IGFH 3D39B 1LE5A 3VWJA 1IEAB 3UBXA 5BZDB 3QO1B 3HZKB 4JY5H 5HJ3B 5AG8A 5HVHC 2HAZA 4X5XA 4UV4H 1RK1B 3D3VE 3FFCB 3VXME 4PGCA 5EZLA 4QWWD 1H3PH 2WBJC 1J0IA 3H3PL 1HWHB 2X89A 2CIKB 3RDTD 4XVSH 3S4SA 2W0KA 4PLKC 5SX5K 4DKEH 2Z31A 1DANT 3SGDI 1D5MB 4L8SA 1ZKAA 2ADFL 1QLFA 1QFWH 3H3KA 1HHHA 3TT1L 1FORL 3CFDA 1RU9H 5DQDH 1YY8B 4LRNL 4F58H 4ZDHA 1U3HC 2ENSA 4NRZB 4XB8A 1J0JA 2IANB 4MD4A 2Y5TA 3OR7B 5DMIH 2P49B 2HT4C 1CXFA 2YRZA 5EBWA 4M6ML 1P69B 2V17L 2OJEA 2MJWA 4P2CG 4MHHG 3DX8B 3UTSE 4XCCL 3BDYH 4LLDA 1PG7H 1B0RA 4LNRA 1HOCB 1YN7A 3KJ6L 4IRSD 1FHGA 3P0VL 1W0YT 5A3ID 4PG9A 5ALCL 3NIDF 3BKYL 4OM0L 4MAUL 2DLHA 4QHLB 1TVHB 2ZCLH 3LB6C 1KCUL 2PTTB 4JFDA 2R2CA 3RA7L 3VE0B 1T20B 5E2WH 3FJTA 2CIIA 3KPRD 3VXSE 5E8PB 4RAVA 3HAEB 3MRPB 1IM9B 1II4E 4KVCH 3GJFK 5CLTA 1LP9F 1H3WM 2GK2A 1HE7A 2JB5H 4KK6C 4Z7UB 4H8WH 1JWSB 3BE1H 3LKNB 2FB4H 2QR0A 4YE4L 3FQTB 1K6QL 2FJFA 1T83A 1FZKB 4I5BA 1KN2L 4FTVA 2BY3A 2DM2A 5KSBF 1MREH 2EKSA 5GRJL 4ZFOB 2XRAH 5MEQB 4X9HA 2IADA 4PJDE 3GMRB 3REWB 4ZUTB 1U41A 2XYCA 3SJVE 1CLYL 5DHYA 4JPIA 3BWUC 3Q6FA 2WLYA 1QR1B 3D85D 1GHFH 1LE9B 5CMAA 4BKLA 3PWVB 5KVFL 4HUWB 4MZ2A 3C5ZD 2BSSB 4YHLL 1DQQB 5IP4A 5GZND 4ZUWB 5FYKH 2QQKH 3MJ8A 4G8GE 5K9KA 4HV8B 1FG9C 4CADB 3MTRA 4IDLA 5IM7B 4QRQA 4TVSa 1ED3B 4HC1H 3L7FB 1Q0YH 1QQDB 3H7BA 1AO7D 5FV1L 3OKKA 2OTWA 4U7MA 3WN5C 3KPPA 5I1JH 4NYLA 1S7SA 3SGDH 1HI6A 1EO8L 1ZT1A 4K23L 3DUSB 3IVKA 1XGPA 4NSKB 4JPWH 1AFVH 3OF6D 3S35X 1N5YL 5GRWA 1KJ2H 1PX3A 3S4SG 2CGRL 1S9VB 3MCLL 1XCTB 1FVCA 2EE2A 1R5WB 3GMLB 4G42B 4GKNB 3QCVL 3WEXA 1I1YB 5GS1C 1BHGA 1JK8A 1I8LA 1YDPB 5LBSL 1HILB 1DQJA 1KJ2A 1NCNA 4Y1AA 1QA9B 1R5VA 2HTLD 3OJMB 4TRPH 2XXMB 2B4CH 1I9RH 4UBDC 5GHWL 4HUVB 2QQQA 3UMTA 3ZSTA 3V4PL 2IH1A 1EXUB 3MNZB 4DN4L 4QRRD 2J6EL 4NGHH 2CRMA 3VDCA 4OLEA 5IOPB 5FGSA 2A74B 2AEQL 3FOLB 3FKUS 4CNIA 1U8QB 4LVNC 3WS3A 1QSEA 4OCWL 3LDBC 1NBVH 2Z4QA 1VFMA 4NNYB 1RIVH 3QEGH 4ELMA 3EDKA 1NAML 4F3FB 1FYHB 4OZGE 1QFUH 5DUMH 1KTDA 5DJ6B 1KG0A 5DRNB 4QYOA 5LKNA 4I3GA 4P23A 2W9EH 15C8L 3V6FB 1X9QA 4TPRL 5ESAA 1RUML 2CKBA 1TVBA 1B0WA 3K4DA 1IM3A 3T77B 3MACL 5L0QC 4KZEH 4GQ9L 4XCFH 3CFEB 4YPGA 4PR5A 4FMKA 4HWUA 3UJJH 2ZCKH 1FNAA 4JFOA 1OAQH 5D1QA 4D9RE 5B4MC 2VDRL 4OLVH 4X6DE 1NCBL 1MOEA 5F71A 5ICYA 1TETH 3LPWA 4G6AC 4OZHF 3QG6B 2ZKHH 4HUXB 4XX1G 1U8KA 4XTRC 5DSCA 2CO6B 5FXCH 3PHQB 4ISVA 1MAKA 3B6SA 5T1DL 2Z35A 4YK4B 2VYRE 2FEDD 2XZZA 3LKOB 1F4XH 3PDOB 3LY6A 2E9WA 4ODWB 4XP1L 1HDMB 5KOVC 1A6AA 3O8XB 4FQCL 2VLKD 3HN3A 5HYFA 2NY4D 3VRJB 3CUPB 4ZD3H 4C56D 1XR9A 4EN3A 2DL2A 4HJGA 3IDYB 2W9DL 4WFHE 4WEBH 2EECA 5HGAB 5IB2A 3LS4H 4Z7WE 3G6DH 5CEZE 3EHBD 4M03A 2PO6C 5EBLA 3S3JA 1T7VA 3PIQB 4FNLH 4X7CC 5K93A 2X4NB 4JM2D 5C07D 4Y5XC 1H9VA 4MJ2A 1XF3B 1NFDA 3IYLW 3FMGH 4XCNB 4JO2H 4JB9H 3CU7A 1MFCL 5K9OB 3V7AG 1S7VA 4DCQA 1I9JL 2BNQB 2AXHA 4WI2A 3RGVB 5JPMA 3R06B 1C12B 3JV6B 3VD9A 2BY2A 4KTEH 4NQTA 1M7IA 3I6GA 2QSQA 4XB7A 2HJLA 3REVA 1OP3K 3NCYS 1U93B 5ID0A 1A14L 1Y6KR 2BRQA 2EDYA 3FL7A 4HZAA 5T3ZL 2QV2A 4YO0A 3WJLA 4YX2H 4PLOB 1R3HA 2EIEA 2XNAA 1XGQB 2NX5D 3P4NA 5IVZA 3O41B 5FYJD 2F54D 4GUPA 4EI6A 1VFBB 5I76B 4P5TB 4GOSA 3VG0H 4AEEA 1CGUA 4NPYA 4CDGC 4PS4H 4G7VH 1EA9C 4I3SH 1P4IL 4HBCH 1A7PL 1A6WH 3IT8D 3H9SE 1B6DA 2YR3A 5CJ5A 1CDCA 5DGQA 3SPVA 5L8KB 1ACZA 2Z91A 4U49A 3FT3A 3PDGA 1DBAL 4LEOA 3NCCB 5EC1B 2CDFB 4F37F 2Q3ZA 1ZXQA 1MCOL 4UILL 4UDTB 4ZQKB 5IHBA 1I3VA 1GC1L 1JNHA 4BK5A 4XRCB 5EZOH 1IKFH 4YQXH 2P5ED 4FQLH 1HH6A 4FQXD 1XIWD 1YNKH 4BZ1H 2HRPH 3G5ZA 3ZKQD 5CD5C 1QO3A 4PRPD 3HPLB 4FXGA 4RRPA 3RZCB 4MX7B 4ZFGH 2M2DA 2ZCHL 3RGHA 5IW3A 3ZDXF 2PYEA 2VITB 1R3JB 3HZMB 4FQJH 5GRYA 2XQBL 1PZ5B 2AERT 2GTZA 3TBTB 5L2JB 4N0YH 1DBJH 2X7LA 3ZYOA 1L4IA 1QKZH 2D0GA 3LHPH 3RWJA 4NO3B 3DVNB 4JFYA 4MLSA 3DXAD 3NZ8B 1CD8A 3TNNB 4QF1A 4AENA 4YHPA 4RBPK 1VFAA 1RSFA 2Z8SA 5E2TL 2D7MA 4UT9L 5KG9B 3TCLB 5E99L 4WJ5A 1OCWL 4KRPD 4Y5VA 4WO4C 4JFFB 4Y5YC 1VEMA 5D70H 4NP4H 1D6EA 1H0DB 2CDEB 4OFDA 1AQDA 3O2DL 3KYAA 4NQUA 3K80A 4WWID 3AS3A 5MERA 4Q9CA 5DJAB 3AREB 2M26A 4X6CE 2VR5A 1OTSC 2VLME 4NZUH 3GSOA 1A7OH 1I4FB 3VFGL 3CXDL 1TVDA 5CFHA 5ESQB 1T22B 4PV8A 4JO3L 2ADGA 5DD6A 4MSWA 5FO7B 3TT3L 1EZVY 2D7TL 1IQWH 3AVEA 3DGGB 5TDNB 1KGCE 3V6OE 4QY8A 1FLTX 4Y4HA 4R4FL 4U1HB 2EE9A 2B1AH 4OV6F 3FB5A 3HE6A 2F8OA 4R2GC 1WVZA 2K3TA 3N1QC 5IB5A 5D2LA 3TBWA 2Z8VC 4HW6A 4X4XA 2GJZA 1M7DB 2AK1L 5EWIL 1YYML 4ZAKA 2R1WA 5EH1A 5BS0E 5ISZB 3BYYA 3MRGA 3GI8H 4JGMA 1J0YA 1MCJA 1XGRB 4GBXC 1F45A 4OM1L 5IMKA 2R23A 3SQBA 1KIRA 2BMKA 2XN9B 2AQ1A 4JRYA 4OI9A 2AEPH 3KPSB 1FYTA 1RPQA 3UAJD 4HFWA 4GAYB 4FZ8L 1DUYB 3HNTL 3T08A 2B5IB 5TGBB 3ZKXB 2D4FA 3MV8B 3FZUD 2H32A 3LVEA 3CX5K 4ZUSB 5EZJA 2OK0L 3W9DA 1I85C 1BLNB 2HTKD 2YUZA 5T1KA 3LD8C 1NL0H 5HHOD 5C0BD 3Q1SL 2NZIA 1OB1B 4QGTA 1BAFH 1SYSB 5GGVY 1ORSB 1FZOA 4Z9KB 4UB0L 1RZ7H 1U8OB 12E8H 3Q5TA 2B20A 1OAZL 1I8IA 4EQ3A 4ZOBA 1V5JA 2DBJA 5KZCB 3OKMA 4PJAE 3CZFA 2ED8A 1J05A 3O4LA 5TQ2H 3TJHD 1S5HA 1GH7A 4JO1H 3QSKB 2ENYA 4HQQH 3K3QA 1B4RA 1ZVSB 4PJ7F 4G8FA 3MJ7A 4F7TA 5SWQA 1CBVH 1QZ1A 3IDGA 1PKQB 3I6KA 2XWTA 4RRPG 1KCVL 5HGHB 1ZHLB 3HLAA 2NZ9C 4N1EA 2UYLB 1NUDA 1UZ6F 4RIRA 1ZGLB 4ALAH 3GEWB 5DEGA 4OD2A 2AI0L 4GRLD 4MWFA 1QSFE 1Z0MA 4EVNA 4Z7VA 4N8CL 5EU6A 2DDQH 4LU5H 5HI5D 3G5VA 4L3EA 1JYNA 1S7QA 3DVFA 4JZJC 3U36B 3WIFA 1OPGL 4P46C 3MXVH 1OGTB 2VLLA 1DDHB 4PLJC 1FPTH 4WWKC 3E0GA 5JXAH 2DBLH 3S37X 4LCUA 4Z7NF 4TVPD 4F9PC 1LK2A 5FEBA 1DBBL 2EH8H 5SV4A 1ZLVH 1EIBA 1KFAH 1MLBA 4PTTA 2VQ1B 4JDVA 1FFQA 1AGDB 3O3BA 5DFVD 4AEFA 3DMMB 3O6LL 5DMJB 5GRUH 4LCYA 5TPWL 5B3JE 5KAQF 3F7VA 1AC6A 4ZSOE 1G6VK 4Z18A 4O51A 2Q8AL 4EKXA 4GKZA 5ITFB 4MS8D 1MHEB 3CFJA 2R4RL 1OAKL 2HRLA 3FQWA 3F62A 3U7AA 1M6OB 5DLML 4P9ML 1CCZA 3H7LA 3VXPB 2NW2B 2ATPB 4KJWC 4NKIH 1BECA 4U6YB 4S2SA 5IJVB 4BM7A 1CXIA 1CFVH 1O7VA 4YR6B 1P7KB 2GW5A 1RUKH 5J6HB 2VN4A 2JJUA 4M6NH 3LQAL 3ZE1E 3P73A 3F58L 2BHZA 4H20H 4G6JH 4PPTA 5JMOC 4XP4L 4HEPG 43C9A 3N85H 4XNXH 5T3XE 3HE7C 4DVBA 1XGTA 2HH0L 3Q2CA 4YEEA 1EGJH 1JRHH 3HG1E 5F6HJ 1I1AA 5EO1B 4LSUL 2UVEA 1BOGA 3BP6A 1BF2A 2XZCH 1MHCA 3ULVF 1KB5H 3QEQE 4CDHA 1M1SA 4Y2DB 3VDBA 1T1XA 2VLJB 3OB8A 3VFVB 4HIHB 3MA9H 4N0FA 1K8IB 3W39A 3JWDC 1FDLL 1WEJH 4LEXH 4OCNC 3CAFA 3S5LB 5I18L 1T89A 4NQCE 1KTLA 1U8NB 4PD4K 3I84A 3BN3B 4HKXB 3Q6GH 3ARFA 3OKOB 3W5NA 1YNLL 4WU7A 1KN4H 4DUVA 5BVJB 3C5JB 2R29H 4RDQF 3T04D 4XNMB 5GGUA 4M6OH 4NOBA 3QDMD 4DEPC 4WI5A 1NAMB 3BKJH 4MDJB 3BQUA 2ZSVB 4FFZL 5F21B 3P30L 3G5YA 1JP5A 1MFDH 3X13A 4RA3A 3W2DH 4K7FA 3T4YB 2ZOLB 3MRBA 3JTTB 2ZUTA 4P57A 3DTXA 3RKDC 3PL6D 4X4ME 5B38B 3RVWC 4HX1B 3SGKC 4YBLB 1B6UA 2YC1A 1QSVA 2ZUSA 3VA6A 5HDQL 5DHVA 5TH2B 1F8TH 2C3WA 5HYJE 5DJZA 1VEPA 3ZSSA 4N5UA 4NRYA 1EJ6A 4DW2L 1RULL 2VLRD 1MRFH 5CKAA 3CMOH 1XZ0B 1IC4H 1GIGL 3L3KA 5BZWA 1H15B 4LPVA 5GSRB 1AQKH 3ZYZA 5IHZB 4WTXA 5D72H 4HIEB 1FNLA 4PRIB 1CZ8L 5GS0C 2YBRB 3I75A 4NJ9L 4Z7QE 4M7ZB 3HB3C 5AZEH 1EH9A 5GRVL 5KVEH 2IPUK 2YUXA 1I3RA 1M4KA 2NY0B 3GFUA 5D7JD 4PRHD 1Y18A 2NYYD 5ACZA 3CJJA 2ZUVA 2D3VA 5CSGA 1LO0H 4I2XB 3IU3B 2A77H 3LZFL 1S9WA 2ZG2A 4XPHH 3EYQC 4JQVA 1PYWA 1KPUB 2VR4A 4TOYL 1QRND 3MCKB 1DLFH 5D7LD 4MJ6B 3SOBL 3ULVC 3D39D 1ACYL 1NGWB 2XWJB 4W81A 5C92A 1BM3L 3BKML 3MLYL 3KYNA 4P4RA 1S9XB 3FFCD 4HIJA 3T0WA 1TJHL 2WINA 4JRXA 4L9LC 5LXGL 1TQCC 5A1AA 1WBXB 3CVHH 2OI9B 1A1NA 5SWZE 1DSFL 1IGML 2D7OA 4KKAD 5DS8B 5EUOA 3CFIC 2YS4A 1FRGH 2BXYA 3SE4C 1A22B 4UT7L 1VKXA 3BH9A 1Q72H 3B43A 1IGYB 3CVHA 4LSRH 2WBJB 5FYKE 4QHUA 1IE5A 1OGAE 4G7YH 4HS3A 4K8RD 3QI9A 3V7AE 4NQEA 4LIQH 5E8OB 4LSPL 3RWGA 4AM0B 3VXTA 2NPLX 2IAND 5GGQH 3GSRA 4QRPD 3DRQA 4ZOCA 1JZ7A 2VWEE 2YPLB 3IJHB 5IFJA 4XHQA 1FSKB 3HPJB 3VWKB 4RSVA 1P9MC 1YPZF 4KRNA 4OSUH 3A6CH 5KVGL 3OKLA 5F6IB 3C60D 1B4JL 1T5XB 3NH7L 4BFIA 3EGSA 3WDJA 2HG5A 3ULSB 1L7IH 4JQXA 3MYZA 3MBEA 1MCHA 3HC3L 5BO1L 2J4WH 4PJ5B 3ZKMC 2OCFD 4UINL 1E4KC 1A6UH 4HMEA 1KLUA 3BPCA 3MFFA 1YMMD 3NIGF 2IALA 4P59H 4HK3N 2MFNA 3HI5H 3GM0A 4FMFA 5FIEA 1SY6H 1HQ4A 2ZOKA 3QIUD 3GRWL 1I1FB 2WBKA 4WCYL 1IM9D 5DQ9A 3KDMB 4M00A 1MF2L 1Q9LA 4K2UH 3QDGB 5C0AE 1WGOA 1UWEH 1FNSL 3TZVB 1OTTC 1I7UA 3TJEL 5ETUA 5C0FB 1YMHA 1NDGB 5CUSH 3FT4A 3PWUB 3FQUB 2DQUH 3WFCL 2DQGL 1WC7B 1BFVH 1MWAA 1PAMA 3MRIB 1JF5A 3KG5A 3FFDB 5IB1A 4GXVH 3WL9A 1F3JA 1ETZA 1MJJB 2C3HA 1MCWW 4HWEL 5BVPL 3QEHA 3OHXA 3KS0H 3OKEB 1QNZH 3WUZA 2UZXB 4CMHB 4P2OA 2AVGA 1EEYA 1EO7A 1G7LB 1J8HB 4MD0B 3ETBF 3VMNA 4HF5L 5HHVH 1DQLH 3MJ9A 2FSEA 4UDUB 4MAYC 3D1MC 1KCRL 2XTJC 4V1DA 4ZOEA 2JK5A 3MZTA 2MTPA 1E0OB 4RQQB 3TBVB 3M07A 2DKUA 2JJSC 4ETQA 1KOAA 1U8MB 1ZANH 3VXRA 5L6YL 2R1XA 4U6XA 3RL1A 4LHUA 4G3YL 2WZPD 1NCCH 4YLQT 3MA7A 3QXTA 5DFWH 4MXQC 4ZPTA 1SEQH 2CH8A 4JG0L 3QT2A 5F1KC 4PJGF 2PCPB 1UJ3C 5D5ME 1FAIL 4HJ0C 2DQDL 3LIZL 4HPOL 4WRLA 4NNPH 2YD3A 2LTQC 2R0ZH 3QCUL 2Y5EA 3ARRA 5L9DL 4LCWA 1WZ1H 3BAEL 3BXNB 1ADQL 4U6VH 3OJ2C 1A47A 1AGBA 3RL2A 2HFFA 4NBZB 2D4DA 4LHJB 1UCBL 3I02B 5C0GB 3BT2L 4DGYL 3KXFE 1R3KA 4IHOA 2BNRB 3BHBA 2GITA 4MNQE 1NCAL 4TSCL 4MZ3A 1KJ3L 3U4EB 5GS1B 4LSTH 4XVTL 3MV7A 4N0RA 5C0IA 4HT1L 4X99A 1ZLWK 1EHNA 5I75C 3PWLA 5H35A 4TNWK 5DHXB 2W0LA 5F7HA 2AABL 4TVPH 2PW2A 4PB9L 2QQLH 4HKZA 4X4YA 3LKQB 3JWDL 5I1EL 2D9CA 3QP3A 4XXDB 4EDWL 1CGVA 4NO5B 1QR4A 1YYLL 3MV9E 2D7PA 3PWPA 3KPNB 4J4PA 3P0GB 5L2KA 1AD0A 1OHQA 4LVNB 1DR9A 3L3HB 1KEGH 4PJIF 3LDBB 1LP9B 3DV6B 2J8OA 3T0EC 1CFQA 5KW9L 1IKNC 4IRJC 3TH4T 4WEMB 2IFFL 5IMLA 1A6TB 3C08H 1E6OL 4FQQA 5L0QB 4AEIH 5MHSE 2CXKA 4P4KC 4AG4L 4K71C 3EYFB 4RFOH 3S35L 2JELL 2BHUA 1RURL 2JJTC 4GKSA 4G8GB 4E41A 5FYLH 5C8JB 3HMXL 4HFUL 5ERWA 3K2MC 4HK0A 1BQHA 4ODHH 1TJIL 3OXRB 3NPSC 3O8XD 3UTTB 2R2EB 3VCLB 1YECL 3W0WB 2YKLL 4IEFB 4PJBE 3OB0H 1VCAA 5B8CC 4BSVB 4NKOA 4G5ZL 5ITBH 1FVEB 2IBBA 2EZ0C 4HS6A 2GJ6E 3L3DA 2Z8RA 3L95A 1WT5C 3OV6A 2ADIA 4FQ1L 1DEEB 3VD7A 3SKNA 4PJXE 2ZSWA 2W0FA 5I1GH 3QFDB 4YHKH 4F8QA 4XVJH 5A40E 2CD0A 3HUJE 1BBDL 1EFXB 1FZJA 4KQ3H 5IVXE 2PO6B 4P2QB 4LHUG 2BNQD 3T8XB 5JDSA 1GGIH 3RGVD 5B39A 5DEZA 3BZFA 1QHPA 3HFML 4Q2ZA 1OW0C 4OGXH 2VL5B 4CVZA 3S96B 2EIZA 3MMEB 1MUJA 2IMNA 4C57C 1G7JA 1KUMA 4NM4L 5C0CB 4LLYB 3UYPA 4U1NA 3RIAF 2PW1B 1A3RH 2Y06H 3G08A 3CPLA 1B0GA 4P5TD 5L8JB 1A8JH 5CSZB 3PHSA 4IMLA 2ESVA 5C70A 1N7ML 2KBGA 3RY5A 1X44A 3B5HA 4ZTPH 2L7JA 2FH6A 3LKSA 4PRNB 2XTLA 3BPNC 1P7QD 3RNQA 4JRYE 3RZWA 3VFUA 4BZYA 5IT2H 4JPVL 5F7WC 2YA1A 3BWAB 3MOQA 2J5LC 4N0UA 5CIPA 1ZK9A 3WO3B 4OUUB 5FUCE 4J1UA 4YNYB 4XPAL 1ZLUH 4YGVB 5AUMA 1MAML 1NC4B 5JUEL 3DSNA 2J8UB 1S78D 3ZHDA 3DX9A 3K7UA 5SWSB 3RJDA 1WIPA 3RRQA 3Q3GA 2C4FU 5IW6A 3KPRE 3RZCD 2X1XR 4OZHB 1X5GA 3E2HC 3GIZL 2VXUH 3INUL 2D0HA 4Q6IC 4P3DB 4P99A 5HI4C 5IB3B 4X4ZA 4KMLB 1G0DA 4YUEL 2WIMA 2V2XB 4OLYH 3D18A 4PJDF 3SCMA 4UOJA 1UM5H 2K9UA 1MVUB 4NN5C 5FAAA 1AGEA 2E9BA 1NGZA 2BJML 1T5WB 1Z0NA 3SBWA 3QCTL 3TVMD 1W2KT 1GZPA 2D03L 1XH3B 2FX9L 4JFFD 1FC2D 2FBJL 3IDJB 2HKHL 3BP4A 1MIEL 2DICA 3DWTA 4HMDA 4XPTH 5ANMB 3QO1A 3HZKA 1CLZH 1BQHG 1LO5A 1EMTL 4I0PA 4EUPB 5KSAC 2GHWB 4JQIL 4TUJA 3ARED 3HZYA 1ZS8A 5FGCE 3WIHH 3AS1A 4WHTA 2SEBA 4R90L 5DF0A 2YRLA 2A6KA 1G9NC 1JIBA 2CK0H 5F9AC 2HVKB 4Y5XA 1DUZA 4K8RH 3PGCA 4JHBA 1DBML 1C16A 5BXFA 3F7YA 3U0PA 2DMBA 1N4XL 5DEFA 5JORB 1X4YA 1I9IH 1AO7E 3UDWA 1YY8A 2P7TB 1RZKH 1UA6L 3IDIB 4PJEE 4LQFH 2IPKB 5C1MB 2C3VA 4NRZA 2VIRA 5C08A 1ZA3B 2DYPB 4YHNA 2ITDA 3W11D 4XP6H 1K85A 4KMQA 3JWOH 1JTPA 1RUPL 5TF1L 4KJQC 5B39G 1C8PA 5FECA 3SE9H 3UC0H 2XZAL 4PJHB 4NCDA 4XI5C 1GXEA 4Z76B 3QBTB 3GMQB 4U1JB 3DX8A 3LRSA 1DN0A 2XN9D 2H2SD 4R2GB 1JYXA 5JIIA 2ORBL 4M3KB 3BPLC 3KPSD 1IEBA 5ADOL 4MQXC 3BOVA 1JFQL 3O4OC 2IQ9L 4OGYL 1PY9A 3HAEH 2BXZA 4ZODA 1TVHA 3WUWB 4GBXB 1QVOB 3VD3A 1PFCA 2YK1H 2PTTA 5C09B 4QRRE 1IL1A 1QLEH 5EO0A 2P8PB 4I4WA 1X4ZA 3U46A 1ZLSL 5F3HB 3GMOA 4OZGF 1CQYA 5E00A 5IHLB 4FXKB 1G9EA 2BFVH 3CVIH 3D0VB 5T5NG 4D0BA 1CXLA 2IH3A 4JG1H 4JDZA 5FHBH 1F3DJ 4LAJH 4J3XA 5KZCD 1JWUA 2MCPH 1WIOA 1X5LA 1YJDC 3LEVL 4MNGB 2HKFH 3M17A 1BD2B 2BVOB 3LD8B 3NFPA 4JANB 1U8LA 4X83A 1N6QH 4WV1C 4HLZH 4N8PA 5JOEA 3PGDB 1K5NB 4X6DF 5TF0A 3TM6A 4D0CB 2J88H 3TYGH 1NMCC 3GGWB 4LKCB 2V5SA 4KAQL 1LEGA 1OTUD 4CMMA 3ROOB 4MB5A 1JGVL 2YEZB 4X6EA 3V0WL 1RZGB 4HCRH 2HLFD 1OP5H 5EBMB 4R0LC 4WHCA 4KHXH 1UWXH 4X6CB 4CVWA 4ZUWA 3G6JF 1UXWB 1JF1A 2HWZH 3GSQA 3VGAC 1C08B 3WFZA 3DJ9A 4FQIH 1N0XH 1IAKB 4K3JL 8FABB 1XGYL 1A4JB 2X1PA 3T2NL 4KPHL 5IM7A 2AK4A 4KI5D 5D1XC 5I8KH 2F53A 5FO8A 2CLVA 1CDYA 3L9RB 1QQDA 2BVPB 1QBLL 4XGZA 4O02L 2DJ4A 5E08H 2VLKE 3I3EA 1DJSA 2KUTA 3U7YL 4C56E 3WLWD 1GGCH 1I8KA 1HZHL 1A5FH 2JIXB 3DMMD 2VH5H 5SX4I 2YZ8A 4P46B 1HSBB 1IILE 1MCSA 1R5WA 5KS9B 4G42A 4WWKB 4GKNA 4LVHC 3EZJB 5IIEA 3BEWB 3BGFC 4QHMB 1PG7X 5C07E 4TSAH 3TO4C 4DUWA 1IT9H 2DRUA 4ODUA 2X4OA 1OSPH 3DUUA 2AJYL 4J3VA 4Y8AA 3SKJL 3VGFA 3RPIA 3QHFL 2AV7B 1A7QH 1LO3L 2PXYB 4XC1H 3NTCL 1JZ5A 3KNBB 1C1EL 1JHTB 5FK9B 1I8MA 2F74A 2FD6H 4YIQB 4U3CA 3BO8B 3MREB 2VSCA 4E0RB 2WANA 1W0VA 1XAUA 2NX5E 1UKQA 5T5FL 3RWHA 4G80B 4JKPH 2F54E 2X4PB 3UYRH 3BMWA 1Q0XH 5DJ6A 4GH7B 1A0QL 5DRNA 3QIBA 2H3NB 5DZLA 5D7IB 3L5WB 2VRAA 3D69A 2FYYB 4PB0L 2VZOA 3ILPB 4Y2DD 5I8EA 4FZEH 2VLJD 4O2CA 1DLHB 5CGYD 3LN5A 3BPOC 4Y4FB 3HE7B 3X14B 4WW1B 2BNUA 3QUYA 4UOW1 2D0FA 4DKAA 4FA8A 1DP0A 1V7MH 4PJ7B 4HXBH 1DANU 3B9KC 4L4TA 5JLZA 3GSUB 4GRMB 1Q9WB 2JCCE 4K94H 5FHAH 2P5EE 2A0LD 4F7EA 1UENA 3VGGA 5BMFH 3CFCH 3OKYA 3ZYIA 5D8JL 4NO0A 3TPUB 3OAZH 1FL3B 3C2SA 4PRPE 2WUCH 2ZP0T 2I07A 3VXQA 1B2WL 3EJZC 4XCYA 3EDDA 5JW3H 32C2A 1CG9A 1UM6H 5IK3A 1HDMA 5A2KH 4AQ1B 1IGCL 4JFZL 3EFDL 1AP2A 3AC0A 2R4SL 1D5XA 1DVFC 2ARJA 4DFHA 1BX2A 2E5EA 3OAYH 4LIQE 1KXQE 3CUPA 2H2PC 4H88H 4JZJA 5ID1B 3DXAE 3ARGD 2NY7H 1D6VL 2C9AA 4D94A 5I1DA 3DROB 5IFHL 3CFKB 2CUHA 4UOW0 4JO4L 4QOKB 2EYRB 2X4RB 4QTIH 1HHGB 4JHZA 1A9EA 1RHHB 3PIQA 2FR4B 1KCLA 2FO1A 3GHBL 4DN3L 1RFDL 5SX4H 1FGNH 1CD1A 4LQ1A 2V2TA 4LPCA 3RVVD 5J9PB 5D6DA 1JPTH 3SQOL 1JGLH 3DBXA 2B2XH 5IBUB 4KC3B 3G04A 1J5OL 3ARBD 4U0QB 4OLZH 4O9HL 2NY0D 4MA3B 4QXWA 5DRXB 4V2CB 5I2IA 3ZE2E 1AGFA 1EJOL 1RZ8B 3U30C 4KJYB 5GGTL 4KKCC 1KT2A 4Y7MA 2R9HC 4KFZC 4N0CD 4S1RL 2I9TB 1YEEH 1FFNB 3U9PH 2KQNA 2XWBB 4GMSH 3WO4C 2FX7H 3L6FA 2I60L 5EA0H 1G9NL 4MXVF 4ENEC 1MCNA 3GBLA 4JVUA 3PWJB 3PWNA 5DD5H 5DT1L 2UZIL 2DQFA 3RTQC 3QQ3B 2AKRB 4J3TA 2OSLB 2CRIA 3LKPA 3QNYA 1IGTA 3TCXA 1U0QA 2R0WL 3MRLB 4KDTC 3MRMA 4FQHB 1F2XK 4U6HB 4PP1D 1K8DA 4OCMC 1VADA 4ERSL 3TA3C 1XF5B 2BVQB 4KZDL 2X6MA 5BV7L 5GISL 4Q9QL 1S7TB 3IB4A 3EYSL 3QISA 5T3ZD 1JN6B 5I1LB 1SJEB 4TNWF 1HSAB 1NMAH 3GKWL 4ODBD 2XPGA 5I1AA 1WBYB 4GSDL 3OSKA 4L9LB 1UH2A 2WBJD 3KYKH 1YNTB 1TQCB 2O5XH 4X9GA 3C6LC 5HHOE 3RUGF 3BESR 5C0BE 1Q8MA 5CCKL 3QJFB 4PLKD 1V3MA 2DWEA 4DGVH 4PJAF 4YHOL 4UQ3A 3GJFB 4IS6B 3H9YA 2MPAH 3H9ZA 4XBGB 2P5WB 5I66B 3A67H 1GGYA 2YPLD 1D5IH 5DUBA 3VWKD 3OR6A 1WFTA 1T0MB 3NN8B 1D9KC 1U3HD 3MLTB 2G9HA 3CSPA 4LCWE 3VW3L 4I18C 1D7FA 3NZ8A 2EYTB 3IF1B 3IKCB 3GJEA 4GJTB 1N59A 2ZUUA 4PIRF 5CGTA 4MXWH 1Q94A 5F7EL 4GW1B 3PNWA 4U05A 3W81A 3B5TA 2HT4D 5BW7A 1U42A 3CZJA 3MGTA 3P4MA 4KKLC 4PJ5D 4IDJH 3SGKA 2VSDA 4JFFA 5F1SA 3TNMA 3BP7B 2O93L 1R24A 1LO2H 1BVKA 2R2HB 2DWDB 4C83A 5CJXA 2ZWLT 4NM8H 2IWGA 1A1MB 1GGTA 2OP4L 4XPFH 3OJDA 2VXSL 4QRUA 4X5WB 4ZFFB 1AKJB 1YY9D 1ZHNB 3VG9B 4QXGL 1UWGL 3QDGD 4N68A 4KUZL 5ACMA 3LB6D 4JZOB 1TQBC 1LHZA 3TZVD 3QDJB 3DGGA 2UWEA 2R0LL 2KL6A 2MWCA 1T0NB 3H3PH 3QNXA 4TVPE 3KAAA 3GMNB 3BVNB 5KANG 4J6RL 2Y07L 3AM8C 5KVDL 4HG4J 1D5BA 4TYUA 5C6WH 3X3FL 2ADFH 4LOUD 4PJFE 4PP2B 5ISZA 1MI5A 1FORH 3OPZL 5H8DA 4U1SA 5DZNA 1HXYB 4HKJB 1H8NA 1J8HD 2XN9A 4Y16C 1G7PA 3SDAB 4ZUUA 5HI3C 4K55A 4GAYA 5DD3L 5EU4B 3O6ML 3TBSB 2XY1A 4M6MH 1OAYL 3ZE1F 2X70B 3GB7B 2V17H 4YXLL 3A0OA 1S7UB 3MV8A 4PREA 3SDCA 2DLFL 4OF6A 2PN5A 4CKVX 5HDLA 2YD8A 1H3XA 4GW4B 4OFVA 4FP8L 4JJ5B 4XCCH 1F4WL 4U1IB 2VZVA 1G7HA 3QJHB 1T7ZA 5GGSB 1NCUA 5LG1A 5ALCH 5CP7B 3BKYH 4OM0H 4MAUH 2IPTH 1LDSA 5L88L 3TIDA 5EU5B 1KCUH 1KXTB 2N7AA 1CU4H 3U7WL 3SE8L 2FIKB 1G7MA 2W38A 3BP5B 1ZVSA 2X1QA 4PUBH 1J11A 5BRZB 2ICEB 3FQRB 3BI9X 5EBGA 1Z6JT 3H42L 4K7PH 1P9MA 1YPZB 4U4BA 1UJ3B 3LOWA 2BNRD 1AGCB 1CD9B 2LTQB 5HGHA 1QYGL 1RK0B 4O2FB 1IQDB 3ARDA 3SGJC 4XCEB 4YE4H 2WBWB 4D8PB 1UB5A 2UYLA 1K6QH 4UU9B 1T6WA 4ONFH 4PGBB 1KN2H 1ZGLA 2DQIL 3HC4L 1DN2A 5GRJH 4A6YH 1ZSDB 1T7WA 1JZ2A 1GAFL 1E4KA 1CLYH 2EYSB 1MCKA 2VDLL 3O6FA 3FHQA 2FEEL 2VN7A 3BX7C 1BQSA 3NCFB 4PGDB 4ZS7L 5I1HL 3BZDA 4OZIA 5JQHC 1DDHA 2A38A 3U2SB 4WFGD 4A6YA 2AXGB 5LJYH 1OLLA 4K3DL 4ZPVA 3L5XL 3GK8L 3HNSH 3HC0A 3WJJC 4HJJL 4KROB 5I16A 1IEHA 3X12B 2BVEA 3AY4C 4LSVL 1FIGL 3QFJB 1AGDA 43CAB 4UIMB 4HXAH 4H25B 2H26A 2VLRE 3MGOB 1TTFA 1UVQA 1OSZA 3MROB 3WXWL 3IJSB 5FCUL 1KJVA 4X9FA 3CLEL 4LDOB 3TO2B 4X0KA 3UTPD 2HN7B 1EO8H 1WTLA 4LLVB 1K2DA 2VC2L 5C3LD 4QXUH 2NY2C 4L5FL 1KYOK 1CGXA 4M02A 2ZUQC 4LGRB 4HPYL 5B4MD 2AJSH 4OCXL 4IRJB 3S36X 3VXPA 2NW2A 1N5YH 1CGWA 1F4HA 4XMLH 2H6PA 2CGRH 4G6AD 4B5EA 1LK3L 4YR6A 4PRHE 3QCVH 4P4KB 4KTDL 3UTTD 4K71B 3W0WD 4LLMB 3UP1A 3I50L 3W9EA 1UQSB 4HAGA 1V3JA 3FRUB 4MAYA 5LBSH 1R6VA 3V5HA 4JHAL 4Z78A 4HGKC 5DRZB 2DTSA 4HSQA 5D1ZA 1CI5A 4PJ9B 3NAAL 2OL3L 5EG6C 1UXSB 5D7LE 2X1OA 3NPSB 4XNYL 5I8CA 3D39E 5FYJL 2BSRB 5JHDB 1ONQB 1JJUA 2J6EH 5IQ9B 4NKQB 3O9WA 3QPXH 4CW1B 5J6GB 2AEQH 2PTUA 4PGZA 3FFCE 1L0QA 3SE3A 1P84K 1KC5L 3HR5A 3QWRA 4L8SC 4RNRA 2DAVA 1FGVL 4H26A 3MO1A 4OCWH 2PF6A 3LEXB 3V6ZA 2PO6D 4OGAC 3O3DB 4P2QD 2QHLA 1MNUL 4YDJB 1NAMH 1UYWL 1X5FA 5C9KA 2AXFA 3AROA 1XCQB 2X9WA 3OKOA 1FL5B 3IGAB 4UUJB 3FB7A 4OKVA 4TPRH 1RUMH 1MHHB 4HH9B 4PRDA 2PR4L 1W72A 2A6DB 5C0CD 1NAMA 3X11A 3QH3B 4WFFD 2QEJA 2DQCH 4ZNEA 3MRNB 2FCBA 2XI9A 1FH5L 2IANE 4GRWB 5T1LA 1NCBH 2Q76A 4QRPE 3KPOB 3IDXH 3QXAB 4JM4L 4O58L 3B2VH 4XWGH 5EOQH 3T4YA 7FABL 2ZOLA 1JNJA 3JTTA 1U8JB 4U7SA 5FUZL 1I7ZB 5I17A 3VRLE 5JXEA 3QEUB 4OJFL 4PD4J 3T2PA 4YEFA 3BD5A 1J0HA 4PY7B 3VJ6A 5DMKA 2EXYC 5TH2A 1BZ7B 5T1DH 5HHMB 4J2XA 1XZ0A 3LQZB 5ICZB 5JW4M 1KENL 4XP1H 3RI5K 4P2RB 2WUBL 2AJZB 5HYQB 4FQCH 3T0EA 1NC4D 3GNMH 4PRIA 1WWAX 4JKKA 5GIRB 4F7MA 5HHNB 4Z5RA 5SWSD 2V7HA 3NZHH 3BPNB 2VNCA 5D6CB 5DK2A 2O61A 4S1DC 2W9DH 4ELMF 4LCCB 3VXUA 1MIML 2J5LB 3L3OB 1HKLL 2RJMA 2V5YA 4U1GC 5BCAA 4MCZA 5E9DB 3TYFB 4WUUA 3BRDA 2GSIB 4KK8C 4Z7UE 2YMXL 4XNQB 4FFYL 5CD5D 4XAWL 1I7TA 5F6HI 3FAXA 5EU7C 5EFIB 2CJUL 3VFPA 2F8VA 1NC2D 5FKPA 1CLOL 1MFCH 3P0YL 3E2HB 2ICWJ 2IAMA 3D0LB 1I9JH 5CD3A 4RMUA 5D71L 3EKCA 3RY6C 5C0JB 5HVFB 1NGWA 2XWJA 5B8CA 4Y4KC 3CDGA 4PJGA 1ZGLM 5CZKA 1A14H 4NJAL 3QIWC 5T3ZH 1VGKB 4NN5B 1N3NB 4CL7A 3MUZ1 4PJ8B 3MRFA 3E6FA 1WBXA 3TF7C 3HRZA 2EC9T 1A9BA 1U2HA 2VQTA 4WO4D 1E4WH 3IXAA 4RMRA 3EJYD 4R3SB 4YHYB 4G6ML 5DO2C 5DWUL 2OYPA 1T2QH 2GTWB 2WSKA 1BVLB 1KSRA 1HH9A 1K4DB 1EBPA 3AU1A 4R7DB 1OTSD 1HHKB 1TNMA 3UROR 1KIUA 4PTUA 1G9MC 4H0HB 4WDIA 3MLPA 2DYPD 1DBAH 1AE6L 1OW0A 5D5MF 3SHSA 5GS3A 1LD9B 2VUYA 3F5WB 2FZ3A 1GC1H 4HWBA 4I48B 1TPXC 3S5LG 1CE6A 3LH2L 1A2YB 4APQC 1NJ9A 5E8EA 1NFDF 2FDBP 2R2BB 3O81A 2L7UA 1UZ8A 1MJ7H 5H94B 4AIXA 3OBAA 3L3JB 5BV7B 4R2GD 1KLGA 2FL5A 2GK0A 2BCKB 1INQB 4MNHA 2ZCHH 3VH8A 4PJIA 2KZWA 4NCC1 2B4CC 5HYIA 3PQYA 3I9GL 2XQBH 4GBXD 4U1LA 1NGPH 3OGOE 5C09D 4ZS6D 3UJIL 3K1DA 2XG5A 2L0DA 4LLWA 1ORQA 4GAFB 4J8RB 4JRWA 4G8IB 3DGCR 3H8NA 3NIFE 4O2EB 4FQPA 3O4OB 5E99H 1OCWH 1YEJH 4NZTL 1MEXL 3SDYL 1F00I 3CLFL 4H0IA 5CBEB 5C0DB 3LKRB 3X3GH 4AH2B 2VJXA 2X2YA 4N9GA 1BD2D 5D1QC 3O2DH 3RWDB 4QRTA 1J1XL 4BH8A 3GSWA 5IEHA 1CGTA 4H5SB 4Q6IA 3S34L 3OX8B 2Q86B 2P44B 3VFGH 3CXDH 1LWRA 4UAOB 3V7MA 4OV5A 2FH8A 4Q97A 3MRIA 4YHML 3FFDA 3MYJA 2C5DC 3TT3H 2VXTL 1AHWB 3SO5A 2OQJB 3D85B 4G9DB 3WFHB 2CQVA 1MY5A 2V9RA 4HUKB 5LGHL 3D3VA 3DYPA 4R4FH 2YPKA 1VHPA 2Q6WB 3T2OA 3OKEA 3VXMA 1NGYB 4WV1B 4NHUB 3RIFK 3CX2A 3VFMA 4WGWB 5KSVB 1NMCB 4N5ED 1XFPA 3A6OA 1N6VA 5A2FA 1U8IA 5KVMC 2E7LA 4LPTA 1HQRA 2AK1H 5EWIH 1YYMH 2NZ9D 1OAUH 5KTEL 4HEME 2ICES 5AG9A 1FO0A 4UNTA 4JFHD 3B2UC 2PYFA 2CKNA 3TBYA 4OM1H 5EN2B 5FDWB 1FJ1A 4WFED 4QCIB 2UY6A 1P1ZB 3GSXB 4GXUM 5EPMB 5DR5L 5TFSH 1XF4B 2F5AL 5IG7B 1RUQH 2BVYA 2F58L 5D1XB 2KKQA 3P9WB 4FOMA 4P46D 3HNTH 2VDKL 4OD1L 3BMVA 1T1ZA 4WWKD 4AMKL 4D9QD 1RUAL 5TDPA 4OFYD 3FTGB 2OBGA 4ODXA 4YWGH 3LPFA 4NQSB 3HUJF 3MLRL 5IVXF 3UTSA 3Q1SH 1JNNH 1F6AB 1MJ8L 1ITBB 1HHJB 4UB0H 4YDVB 2HVJB 4E5XB 3KPLB 4TUOB 3WJLC 3V95A 1CQKA 2EDTA 1OAZH 2BNQE 2FGWH 4WTZA 4CN1A 2N56A 3AMLA 4LVHB 1RMFL 3BGFB 1P6AB 3MRCB 4OFIA 5DJ8B 4HWZB 1JGUL 2XY2A 3B8YA 3FO9A 3H0TB 4NKDB 3Q0HA 5INCA 1FZMB 3U6RB 3VXSA 5D2LF 2Y7QB 3FB6B 1CD0A 3BUYB 1NSNL 4UV4L 3SDDC 4KJWD 5TDOA 3CFBB 2QSCL 4PJCB 1AI1H 3TEUA 4EIZC 2I26N 3EZ8A 1Y6NR 1T03L 3VH8G 4LVOB 4HLJA 4XPBL 1HWGB 1OARH 4X6BA 1PEZA 5EC2A 4DKEL 3RVXD 4Y0GA 3IAPA 3QNZB 3KPNA 2AI0H 3V5DB 3L3HA 8CGTA 4PJDA 4Y4FD 1OAXL 3HE7D 5F96L 4G6KL 5A43C 3SJVA 2Y36H 5CJ8A 4TSBL 1TIUA 1O7SA 4HKBA 1OPGH 4M93C 5HYSA 4BUHA 5MENB 2ICWB 2DM3A 4JFED 4UTAL 1NAKL 5I74C 1DBBH 3BPOB 3KWWB 1G6RA 4G8GA 1F90L 1E28B 3GMMB 1CXHA 1SM3L 5HGDB 4WNQA 4NC1E 3O6LH 1PG7L 4R0LA 5TPWH 3WBDA 1PGRB 3F8UB 3HMWH 4YDKH 5L8LB 3G6JB 3BSZL 2Q8AH 5FF6A 4YJZL 4TQEL 5CJQH 3NBNA 3ALWA 4Y5VC 2R2EA 2A6IA 5IB4A 1ZHKA 4BQBA 2R4RH 1OAKH 3MLWH 5DLMH 1JGDA 4P9MH 4PG2A 4AJ0A 4HGWB 3DETC 4N1CA 4X7TA 5MEOB 2WV3A 2A6JB 1UFUA 3TGXA 4JFFE 3RVWD 3JUZA 4KVCL 5C07B 3RDTC 3GI9H 3VFNB 1DEEA 5F7DA 4WVRA 3LQAH 4Z7VF 1X7QA 1CICA 5DRWA 5FOBB 4LLQA 3F58H 3QQ4B 5CEYB 4XP4H 2G5BB 1AXTH 4Y4HC 1EFXA 5A16B 4C54A 4N8VB 3TO4A 4XP9L 1DTUA 4LSUH 2ARWA 1MHPH 2X4SB 1S7XB 1CIDA 2XKNA 1BIHA 2EDKA 3FQNA 4L8DA 1JUFB 4ZAKC 2OL3B 3C8HA 1CFTB 5E95B 1X6LA 1FDLH 2PW1A 5I18H 3T3ME 4Y19D 4MA7L 2FATL 2QQKL 4OZGA 4OCSL 5EIIA 3EYVB 1K4CA 3U30B 1V7NL 5CSZA 4YFLF 1YNLH 4WTZG 3VFTB 2A73B 1CS6A 5ISZE 1BEYL 3MRRB 4EI5A 3EYQD 5DD1H 2GFBB 5FUCC 2D2OA 4FFZH 5D7KD 1RJLB 2XN9E 5DJDB 3P30H 1G9ML 3WE6A 1W0WA 1LILA 3FONA 3KPSE 3AXLB 5CKGA 4X6DA 1X5ZA 3JTSA 1FNHA 2GAZB 1V3LA 1AFVL 2A9ML 5CEXB 5IJKA 3IFOA 1KJ2L 2D9QB 1T80A 2ZPKH 3C8KA 3P9LA 5LGKA 4L8BB 4WENB 5F1NB 4GG8B 4OT1H 5HDQH 4PRPB 3GMPB 3UXFA 4YAQB 4OZ4B 4RGNC 3KYOB 5I73C 3FCTA 4DW2H 1RULH 2Y23A 5CILL 3TWCH 2P5WD 5AYUH 1DE4B 4XNUL 1GIGH 4JFPB 2YD4A 1MSPA 4BSWA 1IVLA 1WCBB 1CDIA 4XZUA 3RWFA 1N6UA 5HYSG 1QEWB 1MFEH 4NJ9H 4JFXB 1ZVHA 4WI6A 4QTHB 4F15C 4F2MB 3P77B 2VB5A 3ZE0F 4EUPH 4UQ2A 3UTZA 5E8NB 4Z7WA 3LSOB 4AYFA 5AD0A 1PKQE 1DVFA 3BKCH 1XH3A 2CKBL 4LARL 3IDJA 1VB9A 2H9GB 1OM3L 1NBVL 2X09A 1D9KB 4XXCA 3IFPA 1BGXL 4MQSB 3LZFH 1MRCH 1JV5B 1RZIB 5ENWB 4E42B 3TFKD 2W9EL 2I25N 4TOYH 5MI0C 3RWCA 4OZFA 1FFPA 2HVKA 1AKJD 3ZKMD 3SOBH 3UJJL 3QDJD 2RIKA 2ZCKL 4KI5E 2FJHB 1JTTA 2ZUWA 1BM3H 4LF3A 5HHPB 3VRIB 3IDMA 4XNZC 3BKMH 3MLYH 2OR7A 4TTGA 5JORA 1F4YL 1NGXA 3FQXA 5E2UL 3N0PB 1TJHH 5LXGH 1EX0A 2P7TA 5K33A 1TETL 1I1RA 2RQ8A 4M62L 1ES0B 3M45A 3SO3C 4DZ8A 1S5IL 1DSFH 5E6YA 2ZKHL 4XP5H 1IBGL 5AZ2L 4MMZC 4ZO8A 4MLIA 2M8XA 1T1YB 4NFCA 1KBGH 3RBGA 3FB8B 4XBEL 2IBZX 1C5BH 4L4VB 4HAFA 1F58L 4UT7H 1AIFA 3QA3A 3H9SA 4R7NB 1J1OL 1F4XL 4LAQH 4HZLA 5IMMB 4OAWA 3FOMB 4H1LA 1CIUA 4MB3A 5INDB 4LSPH 5FGBC 1RQ5A 2ATKB 5E70A 4L8CA 2EO9A 1LNUB 3RTQA 1RJYA 3DV4B 2XA3A 3PV6A 1BIIA 3BIKA 1AD9A 1T3FA 4OF5A 3V4UH 5JPNB 4R9HA 1VFOA 1UKSA 5IWLA 1QVOA 3LS4L 5KVGH 1OP5K 4WY7L 3NH7H 4RGMB 1I1AC 4Y16B 1ITCA 3SGEI 2VERN 4PYGA 2EDFA 4NN7B 3WD5H 3VMPA 2EIBA 2J1KA 1NEZA 3HC3H 3LEYL 1Q9KB 3FMGL 5BO1H 1GJIA 1JPFB 2XTJD 1ZWIB 2FO4A 3VGHA 3QUMA 4K7PY 4UINH 3RUGB 5D9SB 3V4VL 1JTOA 1T89C 2W65A 2ID5A 5B21A 3U0TB 3KLAA 4NQXB 2APVA 2Q3AA 3ARFC 4QHNA 5BRZD 4MXQD 2VLJE 3UTQB 4D0CA 3GRWH 1J12A 4WCYH 2CLRB 3F7QA 5DJCB 1MF2H 4LKCA 3F6LA 1FNSH 4HJ0D 5K59E 3WHXB 4J3SA 3BQUC 3TJEH 3AGVA 3C6SA 2CXGA 2YEZA 4AY0A 1ZT4A 4WU5B 2COQA 3T0VA 4YC2C 4E9LA 2PTVA 2CSPA 1Z5LB 4G7VL 4PS4L 4X6CA 1YEIH 1GL4B 2BERA 5DYOA 3F12B 2DQGH 4HBCL 4JEGB 1A6WL 3SDXB 3E3QE 3FO0L 4XC3L 1NBZA 2P8MB 1KXVC 3DIFA 5TQ0H 5JQ6L 4Y2OA 2NY4C 5KSUB 4IIQA 1IAKA 2EXWD 1CGSH 5DA0B 3BZEB 3BGMB 3WFDL 3V6OA 2APXA 2BVPA 2EDLA 3ET9F 4G9FB 3GSNL 4I77H 4AT6B 3EHBC 1R3LA 3O3AB 4QRSA 3HI1B 2Q7YA 3DX7A 4F7PA 4LKXB 4HF5H 4HUMB 1BVZA 4NWTL 1TZIB 5FA4B 3QFJD 2NXZB 2I9LA 5D2NE 2JIXA 2JTDA 4DAGL 2EDBA 3MR9B 3WFEH 5BS0A 3CCHB 2P24B 4QEGA 5E8DL 4ZFGL 6CGTA 4QHMA 1IGIL 4CJ0A 2GSGB 4PRIE 1HHIB 2NLJB 3AM8A 5E6IA 4RX4D 5L6YH 4NQDB 3MODL 3T2QA 1I3GH 4G3YH 4UZGA 1FFRA 1QTYT 4M7KL 1QKZL 4IRJD 1KPRB 3TN0B 3RU8H 4S11A 3EDJA 5E5MB 2C3XA 4JQVC 3LIZH 4HPOH 3CSYA 2PXYA 1LEKB 3QCUH 4MJIB 4P4KD 2FWOA 3WHE1 1TCRB 3BAEH 1JHTA 4I2XE 1ADQH 5FA3B 1IC1A 3OAZK 1UCBH 5LQBL 5L7XH 4DGYH 2E6PA 4H1LG 1OT1A 3ZT6A 2ITCA 5EULV 1N26A 3MRDB 5DVMA 3B3IA 2X4PA 1A7OL 1BZ9B 1NCAH 2Z92A 2E27L 5HGBB 4TSCH 4ONGL 5AYQA 1RI8A 3M8OH 5JHDD 4XVTH 1LE5B 3VWJB 5IF0A 3UBXB 2BDNL 3WUWG 4PGEA 3QXUA 2YA0A 4HT1H 1IQWL 3OAYK 3CXHK 5F93C 5F72S 4UV7L 1NANH 1UG9A 1XIWC 4PGCB 3QXDB 5I19L 4WW1A 1IGFH 2AABH 4PB9H 3BW9A 1A02N 1TNNA 1C7TA 3VGEA 1JWMA 4HDIB 3JWDH 1S7WA 5I1EH 3QI9C 1NEZG 2XQYG 4XT1C 2UUDK 1URLA 2RFXA 3S4SB 4AIOA 5T3ZE 1YYLH 2Z31B 5EU3A 3WHE0 4L8SB 5T33L 4ONHA 4HH8A 2QTEA 1QSFA 3QDMB 4M1DH 1M7XA 1HHHB 4OKDA 1IGJA 3CFDB 1FL3A 4N9OB 4PBVC 4FFVC 4KRLB 4Q0XL 4ZDHB 4JJHA 3WKML 2WIIA 1WJ3A 2IFFH 4Z8FL 4MD4B 2P8LA 5LGJA 2Y5TB 4JQXC 2YPLE 3VGBA 4OI7A 4OCYL 5TE6L 1E6OH 1EAPA 1FNEB 4KRPC 4AG4H 1NLDL 5EBWB 3S36L 3S35H 2JELH 1RURH 2OJEB 4CVXA 4LLUA 4ELKB 4LASL 5HHMD 2P4AB 1NL0L 4LLDB 4QOKA 1B0RB 1SJXA 4LNRB 1BAFL 1YN7B 1RZJL 3STLA 4ZSOA 3ZKNC 4PJ5E 4P2RD 1TJIH 4PG9B 3WJJA 5SX5H 3IU4L 1V3KA 1K3ZA 1H3UA 1YECH 3AY4A 1YEFL 3WCYA 4KMTL 1HINL 5TQ2L 3ULUF 4JFDB 1C5CH 4G5ZH 4M61A 4WUKL 4OF8A 1G7QA 1EAJA 2CIIB 1ZT7A 3RVTC 5FB8A 3MLZL 5IQ7H 3CD4A 4RAVB 5DRXA 3QDGE 5E9DD 5GXBB 1KNOA 1CT8A 2OXHA 1RZ8A 4P5MA 4FQ1H 4KJYA 4U0RC 3GO1H 3LRGA 2QR0B 4M1GL 5D7SH 4QT5A 3VA2C 2FJFB 1A6ZA 4I5BB 2KH2B 2B7DT 4FTVB 1F3DH 1QRNB 4PJFF 4P2OC 1IARB 2EKSB 3VDAA 5HI4D 2IADB 5JZ7C 3HG1A 5MEPA 3PWJA 3ARZA 5DHYB 2ERJB 4H0GA 4GKOA 4HK3J 3Q6FB 3QEQA 5E1AA 4BKLB 3D2UA 5J13C 4PJ8D 4B53A 4NM4H 4POYA 1FPTL 1J8HE 1RVFL 4KGLA 3CIQA 3ZKSD 3K4AA 5I1KL 2DBLL 3LMJL 4NQCA 4X98B 1H8SA 1LO4L 3MJ8B 4MD5A 4JKMA 4HUUA 3RX8A 4BFGA 4MCYA 5I1LA 3RX7A 1EEQA 1HSAA 5LCVL 4QRQB 3GJFH 5KSAD 2BRRH 1G7IA 4X80L 1PSKL 3MNWA 5IVOA 1JNLH 4OUOA 1KIQA 3T4AA 3H7BB 1Q38A 3SY0A 5H37H 1VESA 2OZ4H 2OTWB 3KPPB 4NYLB 1S7SB 4RZCA 1HI6B 1RIHL 5C86A 3IVKB 4QRPB 5FYKU 1XGPB 3T65A 4X7DC 4DK3A 3BUTA 4XPAH 1BOYA 5GGRA 4NKIL 1T0MA 1KJMA 4X4MA 2OZ4A 1FVCB 2V9TA 3C60B 3MLTA 1DBKL 1KIPA 3S98A 1KLFA 3WEXB 5HYJA 2NNAA 5IESL 1UACL 4GW1A 4M6NL 2P42B 3GIZH 3OWEA 1TPXB 1DQJB 3FO2A 3INUH 4KXZI 3PABA 4Y1AB 1R5VB 1WWWX 1NUFA 3MRQA 2BNRE 4XNXL 4XI5D 2P48B 3BP7A 1IAIM 3ULUC 4B0MM 2Y9RT 5F9JA 3NA4A 1JRHL 2R2HA 2DWDA 1XF1A 2IH1B 4M4PA 1YMMB 3HCVA 3T0AA 4NWUL 5ILTL 3GBML 4MQXD 3QIUB 1YEGL 2BJMH 2X5PA 4J4PC 4U6TA 4CNIB 1LEIA 2GY7B 2FX9H 3WS3B 1QSEB 2FBJH 2HKHH 1MIEH 3UCRA 5F7KC 1YC7A 3DRTB 4K9EL 3UO1L 3U9UA 2Z4QB 4LEXL 1HN1A 4YBHA 1MRDL 5T5NF 4JQIH 4WFGE 1KTDB 4UMGA 3HR6A 2DMKA 4KHTL 3V0AC 3GUTB 3L5HA 3QRGH 4NHCL 4P23B 4NNXA 4QYOB 5C6TL 4UTBH 5ESAB 4R90H 2CKBB 1TVBB 1LP9E 1U92A 3BVNA 4HBQA 5C7XL 4YPGB 4PR5B 5F89A 1DBMH 4JFOB 1PQZA 4X6FB 5AAWA 5E6ZA 1L0YA 4IRZL 1J1PL 2DM4A 1FFOA 3DYOA 2NQCA 1UA6H 3ZL4H 2GYSA 3GIVB 3UTPE 4HKJA 2G75B 3I2CL 5SWZA 3RY6A 2YD2A 4OLWL 3CMGA 1U8KB 3EUUA 4Y4KA 5DSCB 3SDAA 1WFUA 4NKMB 3QIWA 1RUPH 5TF1H 4JY4A 3B6SB 4OF7A 2Z35B 3ECBB 1H5BB 2XZAH 3OXSB 1MRFL 2EDRA 3UTTE 3QZWB 1OGAA 1A6AB 1T1WA 3W0WE 2ORBH 4RGOL 4HC1A 1KPVA 2OXGA 5ADOH 3ZDYE 3QXVA 5D1XD 5GRZA 1JFQH 1XR9B 4GS7C 5EOTA 4EN3B 1QBML 2IQ9H 4PV9A 4OGYH 5CP3H 4HJGB 2V5MA 5IB2B 2G60L 3L1OL 4LPYA 2Y72A 5EBLB 4FRWA 2FIKA 2R0KL 1U3YA 3EOAA 5CP3A 1ZLSH 1LO0L 4APQA 4OB5L 3AB0B 4P2QE 2AJXL 1S7VB 4DCQB 4X7EC 2X4TA 2YPVH 3LEVH 4O2FA 1DLFL 4HULB 5JPMB 2JKXA 4U1KA 4D8PA 1CVRA 4KXZH 5DURD 3I6GB 5H37G 2HJLB 4EEEA 5JNYA 5ID0B 1OOAA 1CXEA 1ZSDA 2WWKO 5C0CE 4YO0B 4HIIB 1R3HB 4WFFE 4S1QL 1U8PA 4KAQH 2DI8A 5C0AA 3IETA 4OTXL 5IVZB 3CVHL 2XXCB 3VRLF 1JGVH 4M7JL 4EI6B 4LGSB 4P9HL 3MOBH 3V0WH 1A7BA 3V8OA 4NPYB 2Q8BL 2XOTA 3QO0A 3ARWA 3WIIH 3CGTA 5I8OH 4ACPA 5I71C 5GJSH 5C0EA 5CGMA 3X12A 2DQHL 4GLRI 2Z91B 4K3JH 1XGYH 3H3BC 3T2NH 4KPHH 1FBIL 3FT3B 4PY8J 4UIMA 4H25A 4D9RD 4R97B 5MEND 3P9MA 1P2CA 5IMOA 3C09C 4R26L 4O02H 1JNHB 1VGEL 1N64L 1Y6MR 1HH6B 2QHRL 2J8UE 1OP3H 5D7JC 3TESA 2RGSA 5SWSE 4LFHG 4NC0B 3G5ZB 1QFWM 3SCMC 1QO3B 1HZHH 4DKFL 4FXGB 4OZHE 5IR1B 3GSNB 3B9KD 4M93B 4Q9BA 1WCQA 1MH5A 1OQXA 2GCYA 2PYEB 1KULA 5GS2D 2BSTB 2DIJA 4L9DA 3SBWC 5IV2A 3D9AL 5I74B 5ICXA 5BOZG 3E6HA 4I0CC 1CK0L 3V0VB 4IMKA 2X7LB 2AJYH 1Z9MA 3RWJB 5F7YC 3L3IA 4JFYB 4I0PC 3SKJH 3CDCA 4YHPB 4PJ9A 2W59A 4L29A 1VFAB 4NUGL 5DTFA 1JYWA 4EDXA 4JFQA 5D5MA 1LO3H 3D25A 4HGMA 3ZHKA 4K3EL 2YD7A 3NTCH 5ANME 1EDQA 1MWAL 2H2PD 1C1EH 4CW1A 4K7PX 3OL2A 4D0DB 1D6EB 3P2TA 3QHZL 4P5KA 2FLRT 5DJXA 1M71A 5C9JA 1JI1A 4IJ3C 1TENA 3GHEH 3KXFA 5T5FH 3UDWC 4W6YB 1S7RA 3GSOB 4MJ4A 2DQUL 1T21A 4MNQA 1BFVL 3H9HA 1SBSL 4DVRL 1J8KA 4PV8B 2ADGB 1L9MA 5DD6B 1Y0LB 4MSWB 1A0QH 1FL5A 3HS0B 3QDAA 4GRWH 1G0XA 1MHHA 1KTKE 1F2QA 4PB0H 3MJ9L 4XHJC 1CFSA 2R1YA 5C6PB 1RZKC 4QY8B 4Y4HB 3MZGB 1KCSL 4S10A 1ZAGA 3HE6B 1BFOA 2UZYB 2VL4A 3V9FA 4WW2A 3NGBB 3TBWB 1SJHB 3ES6A 3CDYA 4X4XB 3LV3A 2GJZB 3SDDA 3MV9A 2VDPH 4PJHE 1BJ1J 1FVDB 4KUCD 4RISL 2VTFA 4ZXBA 5D8JH 3U4BL 3MRGB 5CWSA 1MFAL 5IMKB 2NR6C 1WV7T 2R23B 3VFRA 3IXTA 1BZ7A 1P7QB 1KIRB 5J1AB 1B2WH 2BMKB 3PXHA 1NCCL 1UADC 2ARJQ 1FYTB 1QBAA 3QUXA 1SEQL 2RCSL 4HFWB 4LL9A 1IGCH 2EH7L 3EFDH 3QUZA 5FKAA 4I0KA 4L1HA 5GIRA 5LAXA 3NIFF 5C09E 1S3KL 3RWIA 2H32B 3WNPA 3FHAA 4F80A 3PF2A 5EZJB 1D6VH 4HIXL 5D6CA 3TA3D 5T1KB 5IFHH 2A1WL 4PFEA 4LCCA 4JO4H 35C8H 1FZOB 2YA2A 5FO9A 3GHBH 3TYFA 4DN3H 4NRXA 1I8IB 2Q20A 2XZQL 4MNGE 3C6LD 1BD2E 3OKMB 1RZFL 3CZFB 4PJBA 2YUWA 3ULUL 1J05B 3O4LB 1S5HB 3IS0X 4RGNB 3SQOH 4JGUA 2I5YL 4G8FB 2XV6B 1J5OH 1MCWM 2GJ6A 3MRKA 4YXHL 3TVMB 3MJGX 4O9HH 3MJ7B 4KDVA 4F7TB 5SWQB 4M5ZH 5ADPL 4FQ2L 3IDGB 2CLZA 3I6KB 1EJOH 1D9KD 1BZQK 2XWTB 1UEYA 3ALPA 5GGTH 2QQLL 1WISA 4PJXA 2W07A 1I7RA 2VISA 3HLAB 1VGKA 4S1RH 1XF2A 3EO0A 2MHAA 3CC5A 4NZJA 3DURA 3HUJA 4RIRB 5IVXA 2VLMD 5DEGB 4OD2B 3MUGA 4KKLD 1E27A 3RDTA 4U31A 2I60H 2C1PB 4EVNB 4Z7VB 3PHOA