3VSQA

Crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2 e236r mutant in the presence of ethanol
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
199
structure length
197
Chain Sequence
QRYVRKDGKCNVHHGNVKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVRASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling of G Protein Binding to Channel Gating in Mammalian Inward Rectifier K+ channels
rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords G protein-activated inward rectifier potassium channel 2
total genus 41
structure length 197
sequence length 199
ec nomenclature
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3vsqA00
2WLKA 2GIXA 5KUKA 2X6CA 5KUMA 3SYOA 1U4FA 3AGWA 2X6BA 4LP8A 3AUWB 3K6NA 3SPJA 3VSQA 1XL4A 3ATEA 2WLIB 3JYCA 2WLLB 1XL6A 3AT9A 3ATBA 3ATDA 4KFMA 3SPGA 1P7BA 3SPCA 2E4FA 2WLJA 2WLIA 3SYQA 3SYAA 3ZRSA 2WLLA 2WLHA 1U4EA 2WLNA 3SPIA 3SYCA 3ATFA 3ATAA 2QKSA 2X6AA 3SPHA 2WLMA 3AT8A 1N9PA 3SYPA
chains in the Genus database with same CATH superfamily
2BRRH 4IBVA 5F7UA 5LB1A 1N4XL 3O6MH 4NO0D 3KJ6H 3U2SA 5JW4Q 2E8YA 1MHCA 1Z9SA 4K94L 4YVNA 2OW7A 3QH3B 4CSPA 2AANA 1M56B 1JDDA 3DMMB 4CBZA 4WJ5B 5GRJH 3CPUA 4MX7B 1NEZB 1XCQB 2EEXA 3LKOB 3UBXB 2W0FB 1I8LC 1MLBA 5DZJA 3TL5A 1I3UA 3FQXB 5IM7B 1CG9B 4G7VL 4LLWA 4YSUA 3T2PA 4XNZB 4FFYL 4U2ZA 1KUMA 2EC9T 1D7BA 1J9TA 5E99L 1BWWA 4HJSA 5IHBA 5HDBB 1CL7I 2FLMA 4N0CC 2XWJB 3OM3B 5KYUB 4MHHG 5ILTH 1KTLB 3MFFB 5E9DD 2Y36L 1ZHNA 3V52L 3UPRB 4NKOA 1F4HA 3VXOA 1JRHL 1M05A 2SEBB 3CHRA 3UYRL 4E5XA 3GHBH 3L3KA 3CHOA 3EUDA 1U2CA 3TBSA 2GUYA 4AQ1B 1A5FH 3FB6A 3RIFF 3G6JA 3ZKND 3OV6A 2TSAA 4BK4A 3I6LE 1IM3A 3WJLA 3FT0A 5DR5H 1HVXA 3WUZA 5FK9A 1P5UB 1PZSA 1HWHB 1IGYA 1DVFD 4HIHA 5C0CA 5AW9B 3LRSA 3SJVA 3VFTA 1ZD6A 1Z66A 3W0WB 4ZW3A 3VXUA 1LQSR 2AEWA 3WFHA 2X9WA 3ZMNA 4BFRA 2OAAA 1TZGH 3GHPA 3Q8BA 1MFMA 3K0YA 3MLYL 7CGTA 2ZICA 4OB5L 4FLQA 2GJ6E 6FABH 1U41A 3RWJB 5EO0B 1BYOA 3OGOE 4X5XB 5AZ2L 3FTYA 1UA3A 3UTTE 1M7XA 3GKWH 2PPAA 4S1SL 4ZAKA 1HTYA 3PWVA 2W60A 5FA3A 3MRLA 1I9IH 2ZSWB 1YY8A 3S37X 4RZKA 2TAAA 4MDRA 4HJEA 1CCZA 3P0YH 5JHDA 1MCBA 4NZRH 1Z0NA 5C0IB 1N59B 3EHBB 3GSVB 4WSJA 4A2DA 2RGSA 2WVVB 2J21A 1LO3H 2D0HA 1N9PA 2CLZB 4FXGA 3QG7H 1KYUA 1MNNA 4PJHE 4HS8L 2BC4B 5F7NC 3U46B 2PCPA 2HJLB 4PPTA 4PIBA 3VFSA 1M7DB 3OXRA 1BBJB 1J0HA 2PP7A 4XPTH 4B9KC 5IHZB 1NCDH 2O5YH 3PHOB 2J6EA 4CKVX 3IDIA 1T5XB 3IJ8A 1HAWA 4NRYA 3SPGA 3SO3C 2E46A 4QD2E 3HN8A 2HLAB 1J5CA 4U6XA 3WEXB 2DWEB 2ROYA 2H32B 3QWOA 2EVIA 1GTNA 4GBXA 4L4VD 5KEZA 2OLDA 4NEHB 4ZYKB 4NKIH 4OD3L 4AZUA 3HMWH 2FHCA 1KJ2L 1JI1A 1NGXB 3NABH 4NQCD 2OTPA 4TUUA 3RA7L 3WIIL 5DJ6A 2UUDH 2RHEA 3GBLA 1RP9A 2IWGA 1PU0A 4M8RA 5BZXA 1YUHA 2AJ3B 4KFMA 3IGAB 5E2TH 4RGMC 3GSOA 4UWQB 2EE3A 3TA3D 3O6KH 2W91A 3CC5B 4HK0A 4UT6L 2XQYA 4EUPH 3NCEB 1ZV2A 3QYNA 2YOAA 3ESUF 1P4IH 1KEGL 3UC2A 3E9UA 3P9LB 4E9TA 5C9JB 2ZKWA 1O5PA 5HHQB 2AABH 2HLFD 3DUUA 3S8FB 3UIYA 2YK1L 4LSSH 1GMEA 2J20A 3S2CA 1CK0L 3QE5A 5K5YA 4H26A 2DLGA 3N43F 1U92A 1MW3A 2YS4A 5JOPE 2EUZA 4U0RB 1P7QA 3EBGA 4ZMWA 4UTBH 5CD3B 2CBPA 3QHZL 3QHTC 4HOMA 1YMMA 4YSTA 1ACZA 5GQBA 1YNKH 3KLHC 1JPSH 4W68A 4E2OA 5CU5A 3RGVD 2YAHA 1UFGA 3CFQA 3SDCB 1R3IH 1OTTD 4G3YH 4WGVB 5GGRA 3HR5B 2EDNA 2AVFA 3KBEA 3KPSD 3MOAL 2F8OA 5BXFA 4JKNA 2JI2A 1QEWA 4Q0XL 4KK8C 1TVHB 5F96H 4UU9B 5A2BA 4A2EA 4A38A 2PYFB 2H0EA 4POZD 1MWAB 3P9MB 4J12A 4XC1H 3O8XD 1C5DA 5BZZA 5J13C 4XOAA 3E3QE 3QA3B 2Q76B 3ARPA 2H2SC 3KL3A 5DI8B 4JANB 4IOFC 4OZIA 1YDPA 4OLXL 4MD0A 4LKCB 3RVXC 4QO1A 3VU1A 4IHOB 2V7NB 3FHAA 2B3RA 4NM4H 4KROC 4Y88A 5HI3C 3TBTB 5I75C 3DX6A 3KHQA 2L3BA 3D33A 5J6HB 2DTMH 5SWQB 4G83A 1ZTXL 4H8WL 1U3HD 2ENYA 3G3LA 2ARJA 3F7RA 3B1UA 3HW7A 4ZMZA 3GMOB 4GO9A 4K5LA 3G5XA 3OAZH 2Z0BA 4KJQC 2WK2A 2NNFA 5BV7H 4KVNL 4OZHF 4LSUL 1BZOA 5D1ZB 2D03L 2G75A 5E6ID 5C07D 4AJYV 5IVOA 1BLNA 4FXKC 1VFUA 3ULVD 2BWDA 1LEGA 5JUEL 2JE8A 2GCYB 2EIMB 1MEXH 4GIAA 1L3NA 3EFFA 4PWIA 1N7MH 5FYLE 1MWOA 4JMXA 4ABVA 3U0WH 3UBXA 3KYMB 4LSVH 5F2FA 2FX9H 1T1WB 2V17L 3HOGA 1B0IA 1JZDC 4JQIH 1J48A 2VDRL 3DPBB 2UY6A 2VRQA 1PZDA 2CNYA 3IETA 2D3LA 2Z31D 5CAYB 1P9MA 1OKEA 4W9DC 1NFIB 1JPTL 1PD1A 1AQDB 2FEEI 3IS0X 3IN0A 3NT0A 4ZXBA 4NRZA 4BUHA 1D5MA 2HPTA 3OGCA 1JRHH 5L8LB 4R97B 4MNQE 2X4OB 4APQD 1G1OA 2JQAA 2L04A 3L13A 1YSOA 3HZVA 3O4LE 5J5EA 1WAAE 3CX5K 3UZEA 2IPKA 2P4AB 3FONA 5DYOA 1CMOA 2VZ1A 2JJTC 3BFWA 1AFVH 2X4UB 2ZSVB 2YRLA 3TCTA 1C5CH 1NIBA 2VDPB 3NUKA 2ITFA 2YZ1A 1PGRB 1IBFA 1XD0A 5SWSB 4YHKL 2VDQL 2R2EB 4P9MH 5GS3A 2JTDA 2K45A 4I2XA 4JZJA 3OHXC 4LK4A 5DZOA 1G7QA 2X4SB 1RK1A 4AV5A 5KN5B 5J11C 2WJ5A 1JUFA 1UXWB 1RI8A 1ZLVH 1I9EA 1AQMA 3GNML 2WGXA 1U42A 2BOBA 5HHVL 1FGVL 1SVCP 1MI5E 1TOXA 2GVYA 4BXSV 4LSRL 5IB2A 4UDTB 5DLML 1AD9A 1ZVYA 2XPZA 4CA4A 1BBDH 5EO0A 1P2CA 1ZGLP 5I6MA 5CEZH 3A5VA 3KH4A 2BRRL 2X7LA 4Z3FA 2VR6A 4P46B 3GT6A 4ZAKB 3QXDA 1BW8A 4NP4H 3GSQA 2W60B 3UAJC 1GZHA 5ICUA 3JSSA 1D9KB 2AEQH 2FWUA 4H0GA 4I2XE 2ZAGA 4L29A 1U3YA 3GZOA 5C09D 4XP9L 3ARVA 1F4XL 5KOVC 3F8UB 2IALB 3FRPA 2OR9L 4PJBA 1R33A 4F7MA 1YPZF 4BH7A 1UH2A 1IAKA 2WBJC 2Z91A 3FQRB 1I8IA 2E7MA 1FIEA 2EYTA 4OSUL 4AZ8A 4F91B 2OZ4A 2J57A 4LARL 3ZZSA 4UM9B 4DQOL 5LJYH 1L9TA 2KZBA 3BPLC 4PV8A 5EB9A 4N9OB 5JA9A 3VG0H 1FZJB 3O6FD 1SRDA 1MIMH 2CSPA 1LK2A 4N0CD 2YAMA 5DJDA 1OO2A 4G6AC 2PR9A 1WEJH 5DGRA 3V0EA 3DSNA 4XPHL 4GRLA 1G87A 1B2WL 3WEXA 3TX4A 5E1GA 4AV0A 3FB8A 4MRBA 1CFTA 3H9HB 4JFVA 3T2NH 1I1YA 3UABA 2Q8BL 2FJHA 3WTVA 2HWZH 3CFUA 4F58L 5BZDB 4CW1A 1MCFA 3ZL4L 4ZMAT 5K93A 4W4OC 3ULUD 2A83A 4A7GA 3M1CA 4HHAB 2AJXL 4X4YB 4FLHA 2DIEA 2P49B 2NZ9D 2OBGA 5DJ6B 4TUKH 2WUBL 3ZKXB 4XWGL 3BP6A 3Q8EA 3CDZA 5DR5L 3KWTA 2Q3AA 3Q3GA 2QSCL 3U36B 4Q6IA 3WN6A 5I15H 2ZKMX 1CLYH 3P2BA 5ACLA 2D7NA 5E08L 1Z7JA 3AB0C 2HFGL 4N2HA 3AWGA 3FHQA 5IFHH 4RESB 3TWYA 1RY7B 4YHNA 3O4OB 5KW9L 4H8UA 3D3VB 4JKWA 4NJAL 4P2QA 3ZGHA 5LNDA 1J1OH 5CP3A 4H44C 3GXPA 3EFDL 3GSNH 3IFNH 4ZUUB 3N42B 4XVTL 3DUUB 5IVZA 1ZA6A 4QXGL 3X14B 5FECB 3T1WA 1XGZA 3LKNA 3SPHA 1Z32X 1UD4A 3FNKA 4N1EA 4CN6A 2JB6B 5IHUL 2QFRA 3H85A 3FN0H 4S1QL 1XEUA 4BFBD 4UTAA 3B5TA 3EZJB 5CEXA 1FAIL 3FT3B 1TTAA 3WD5L 4NFCA 4WJG3 4E9XA 1NCGA 2WNWA 5CKGA 4QRTA 5AZUA 2OMYB 4Z78B 2VDLB 1SYVA 4XX1E 4XNQA 4N4YB 1SXSA 3MO1B 1NIAA 4JQVC 3LDBC 4MXVE 4Q4IA 1VKXB 1BWMA 1BQ5A 1QZNA 3L3HB 1AE6H 3KVQA 4MXWL 3N40F 3LS4H 2HKHH 3ATFA 1RXLA 3WGVB 4AXWA 3TA3C 2EEAA 1GZQA 4MS8D 3IBEA 1Z5LB 5DI8A 5LLIC 2XA8L 8PAZA 4WHDA 3IRPX 5D7SH 2X6UA 3S4SB 2VQUA 4GG8B 4KJPD 4ZMYA 2Y5TA 1K3IA 1UWEH 1NUGA 2V7NA 3HLAB 1A0QH 1JXDA 4HEMA 2B2XL 4K8RH 4ZXBD 3RTQA 4A37A 4BQ6A 1JK8B 5JMRA 3WEAA 1HSBA 5AB2A 1TZHA 2I9TA 2EIBA 3O4OC 4K23H 4PRPA 2OKMA 2AV1A 4U1KB 4YZFE 2K70A 4DCQB 5HYJB 1TPXC 1GGBH 1BAGA 1Q9KB 2CKBA 4YDLB 4NO2A 1RUPH 4PN6A 3F2LA 3T0DA 4NGHL 3WFCL 4RMQA 3HTLX 3B1TA 5HHOA 3TVMD 3H4FA 2E8ZA 1E7VA 4DEWA 3U0WL 1EHNA 3WFBH 4HD9A 3L8QA 2Q7YB 3V0AC 3SDAB 4S1QH 3BZFA 4KXZH 3UCRA 5LBSA 4NQQA 4IW4C 4EAEA 4M93B 3CFNA 4KKLC 1OM3L 1OP5H 5KSAC 1MPAH 4R5TA 1NUNB 3BFOA 2XDHA 3IFLL 5BS0D 1XCTA 1GOHA 1Y0LB 1YEHH 2FBRA 1SFDA 2D7QA 2YRBA 2UY6B 1RIHH 4TNWF 2UX6A 4GSDH 3U30B 3QZMA 4PY8I 5IJDC 2A99A 4W9ZA 2P46B 1T89C 3L3DB 1J8HA 4ZXBB 3Q7JA 3V8OA 3HZYA 3TO2A 1A7QL 2A77H 5AW3B 5JQ6H 2HRPL 4FZEL 4WWKA 5CWSB 3AS3A 4U3CA 4E9QA 3L5IA 4JKPL 1TJHH 3S3SA 1DR9A 5A2CA 3CV5A 4I4WB 4YLCA 2F54A 3O3UN 3LEYH 5MI0B 3ULUH 3KR3H 5F8RC 1YEEL 3ARDB 5AWNH 2WLHA 4BSWB 4OQ1A 5F72S 5EBWB 4GPVA 3F7PC 5KS9F 4R4ND 2R2EA 3I2CL 1OGAE 3L9BA 3LQMA 5E6YA 3TJHC 1HZKA 1S7SB 2ZD0A 2WB7A 5BS0B 3QHZH 4J4PC 4W81A 4PJDA 2GHZA 4XO5A 1PZ5B 4KTDL 3KAAA 2CGYA 2GEQA 1C16B 2AAVA 3V0JA 2HRGA 4GXFA 3PNWB 3ZKNC 1FDLL 5C0BD 2KYIA 3QORC 5A43C 5I1HH 4B53A 1PLCA 5KAQG 2BIIA 3PUCA 2Y1AA 5ERWA 1WC7A 2G5RA 3L17A 3H42L 1EFXB 2WLMA 3L4XA 4JFFD 4ZS7H 4MHHI 3NH7L 1H3XA 7FABL 2DBLL 1B4RA 3DK2A 3LN4B 1Q0YL 1YCSA 3R4DA 2OK0H 2DQEL 3I6GB 3EJUA 3EGDB 2FR4A 1X7TA 2CWRA 4GAGH 4G43A 4BHUI 5I17B 5I73B 5FGRA 4MB3A 1PPIA 4TLKA 1XGPA 3EO9H 3AG4B 4S1RL 3Q43A 2NZIA 3B37A 5HP5A 3KPQA 4YE0A 3ISWA 4DGIH 1R9FA 3FRPB 4M8UA 1DEEA 1YC8A 2M26A 2VKXA 2DTSA 1RULH 3HB3D 3CVHA 4Q89A 4JCWA 4BCYA 4G72B 4OD1H 3D07A 5B22A 1SOKA 2NTFB 5DZVA 4AQ1C 3BMVA 3D06A 4H25A 4M1CC 3WNMA 2PTTB 4KVCL 3CLFH 4NI6A 4FG6D 5I18H 4UM9A 2K8MA 3B5GA 3HS9A 4ZFOB 3IFOA 5FS5A 2G2RA 3DX8B 3SDAC 5DHYA 4RZCB 5IV2A 5ECJE 1E2VA 3RIAF 4OZGE 3UJJH 4X4XA 5IW6A 4NHCL 2DS4A 5C7ZA 5HDLA 3RZCD 1BXUA 4LHUB 5LBSL 3WIFA 3ZL4H 5LNGA 4QT5B 2CCWA 1IC7H 1JVOA 3NCBB 3QIWD 4OY9A 1OP9A 1W80A 1Y6NR 4EBQL 4HC1L 4YDNA 4ZOCA 1KIUA 3VXQA 4Y4HA 2QV4A 3MXVH 2F15A 4F7PB 2QKIC 3MV7A 3T08A 1JJUA 4J8RA 1FZOA 4IDJL 4LSQH 3FMGH 1JPGB 4Z7QF 2EYRA 5BUPA 3Q3GB 4NQDB 4FNQA 4J3UA 1F6FB 1LK3H 5DSCA 3QZPA 1BLIA 2FX7H 4HMDA 4PJXF 5L9DH 1NEUA 5AOZA 4MSWB 3ME0B 5IVXE 2XTSA 3HMWL 5E00B 3W5MA 4N0UB 5AG8A 1MCOH 1WBZB 4UMSA 4XVTH 2J6EH 4QWWC 3TN0B 3MV8B 1Q9LA 2VDLL 4HWUA 4DGVH 1RVFH 1A4AA 4AE0A 3ES6A 4JB9H 5ANMB 5IB4B 1KXTA 3EH3B 1X5YA 2A6KB 1X4ZA 2G2PA 2WIIB 2XZCH 3D34A 4P23D 3DARA 3P3SA 3T0EC 2AV7A 5I66A 4NB7A 1ONQA 1FAIH 3HS0A 1I7ZA 3KWVA 5GGVH 8CGTA 5A7BA 2Y36H 1XB8A 4PRNB 3L7EA 3LHAA 5IMLB 4LPXA 2XOTA 1N8OE 5GISH 4YC2B 2QPUA 1ILSA 5TDNA 1UT1A 3BXNB 2BMKA 4MB4A 5D7JD 3GMPB 3QWRA 3V5HB 1IVLA 2OFQA 2K7PA 3DTXA 1U8QA 4JRLA 1QATA 3MO1A 4P2RA 3QBTB 4LQ1A 4RAUB 2FQFA 1JZ4A 3QO1A 2P80A 3V6BR 4NC1E 5ALCL 3RNKA 3RIAK 3QUGA 2IOMA 5E6IC 2AEQL 4M5YH 3KL0A 4XPGH 3U48A 2DEXX 4F24A 3O6LL 4OZ4A 4KKCC 1IO4C 4F9LC 5DK2B 4I0KA 3IVKB 3SE3A 4W9LC 4FFTA 3A4FA 1NQBA 3ETBJ 5A1AA 3SOTA 1PF3A 5CINH 1EJFA 5DHVH 3MLYH 4TQPA 1JV2B 2CJUL 1CDGA 2BIPA 4TLSA 1IGFH 1I1RA 1HK6A 3ARRA 1SLVA 3REVA 4JBSA 2I9TB 4H88L 4TM9A 3UDWC 2ADGA 1HL9A 3V5KB 3SIKA 2R83A 2VDKH 4CKQA 1FG2A 3PDOA 5FB8A 5JHLL 5FYKE 4KZDL 3PXLA 3C8HA 1IUZA 5CMAB 5HDWA 4GKSA 3TVMB 1XZ0B 4WIQA 4XN9A 3RX5A 1XSIA 3A6CH 4HXAL 4P3WA 3P77A 3A3YB 5KYXB 4LPCA 1AQ8A 4XRCB 4Z3HA 5J06A 2G0LA 4G8IB 2FT8A 1TUPA 3PGDB 1XH0A 3PABB 1C7TA 1T5KA 4WAFA 4HDIB 3WBDA 3WIHH 5HXMA 1UOKA 3NP3A 3MA9L 2CNZA 1XCTB 1Y0LA 5KJ4A 2YMXL 1RPUA 3G7TA 2A6DB 5AUMB 5TH2A 1NL0L 5LGKA 1EV2E 3AW5A 3EGXA 1GJUA 2VE6B 2ZPKL 4WWKD 1NMBH 3UZQA 1E5UI 1CL7L 4Y19E 1BPVA 1A7QH 4XHJC 1HHJA 1RHFA 4JPKH 3DGGA 4NNYB 1HI6A 4KV5F 3CVCA 5IFJA 2JTYA 3BP5A 3BH9B 2C8NA 2HFEA 2F7IA 2F53D 2OCFD 1XHHA 5KS9B 3JUYA 1IGCL 1XTMA 3CDGA 1KIQB 4NKMA 4N2NA 4UV7H 2Y6SC 3GM0A 4DOHB 3DVIA 3NFNA 4IEFB 3R8QA 1R5IA 1YZZA 1FNEA 5DFTA 1SHSA 4TNEA 1PW3A 1NGWA 2X4RA 5MEOB 4JAMA 3QEQE 1GS6X 4NM8L 5E8PA 4XO8A 5K9KB 5ISZD 5IFAH 1FFNA 3LS4L 4AQ8C 1EA9C 1T7WA 3PWUA 4B7LA 2BNRA 1KWGA 2R2BB 1HHGA 4HWBH 3LS5L 3O0RH 1A6UH 4GUPA 2OMVA 5FYKH 2E7LC 1BF2A 3SN6N 4NQEA 1J0JA 1SVBA 2WYTA 3EFOB 1U58B 1FYTB 4FE9A 5IKCB 2NCMA 3HAEB 3PWPD 4G5ZL 1R3HB 3WIHA 5C86A 1CGVA 1G9MC 1MCJA 4AGMA 5BQ7A 1RZGB 1G9HA 4H4NA 2ZPKH 3SB3A 1EJOH 1U2YA 4HYTB 1UADC 5HHPA 4OT1L 4RISH 1BQHA 3HI1A 1Q9WB 3SBPA 5F0LB 2AXGB 4UQ2B 3MFGB 3VCLB 1XGPB 4U6HB 1T04A 4QHNA 3C60D 1RIVL 4ZPTB 4OV5B 2QDVA 4K23L 2VDRB 1NOLA 5DVPA 1ZLDA 3CG8A 3CH8A 4FTVE 5J3HC 4W6XB 1IJ9A 4GAYB 4PWHA 2VLRB 1BFOA 3QCUL 4PMFA 4P49A 3QIWB 3T77A 4MJHA 4ZFOA 4NRXB 1DJXA 2HG5A 5HI4D 3A6BH 3MACH 4Z1PA 3C60A 4PI0A 4PGZA 1MI5D 1KFAL 1LE9A 3KBHE 3RZCB 1RP8A 2C7UB 4RAVB 4U1JB 3SY0B 3FQNB 1KJVB 1L0PA 4QT5A 1GKOA 1WGVA 4X98B 1FVDA 1ZHLA 1R5WA 3JVFC 3E80A 4OLZL 4ZMOA 2AF2A 4JZOB 2NXYD 2VW6A 2UXFA 1NUDA 1N67A 3X12A 1MJ8L 2E7CA 1JPST 2YQ2A 3QEGL 1WEJL 2ZXBA 4L05A 4YBLB 3QDGD 4Y4FA 4OCNC 5I16A 1X5ZA 1NFDE 3JUZA 3G9VA 3G6AA 2ENQA 4OB5H 4NQDA 5AAMA 4NBZB 3NN8B 4X0KA 3UMNA 5A2FA 1OOWA 5DO2D 5FA4B 4B0MB 3WS3A 1FYTE 1FHGA 2UUDK 4HPYL 4HBQA 2OZNA 4N8CH 4YL4A 4Z18A 4Y5VA 3ZZ1A 5AENA 3NRPA 4B95C 1TVDA 2ZUSA 1K3ZA 3NFSL 3O2DL 2J88H 4R0LA 2WTRA 1WZKA 4AQAB 4TYUA 1QUPA 2YJQA 1OSEA 3U0TA 2Y9RT 4QF1B 5EULV 3TWCL 4X6BA 3U6RB 4UDUB 4BQCA 5E5RB 3MV8A 5ID0B 4EKXA 4LDLB 4I1PA 1H3UA 2EC8A 1QWUA 2FBJH 4J3BA 1JZ3A 4XR8C 3B9AA 1MCNA 5L7XL 3ZU8A 5D7JB 4J39A 4BZYA 2HFGH 3O6LH 3CVDA 3LB6C 4Y16C 5I24A 1TU2B 5I66B 2FIKA 2Z92A 2C26A 3HS0B 1MFCL 2Z34A 3V9CA 1KCRH 3QDJB 3SQBB 5LGHH 4WI0A 1YEFH 2WBKA 1FN4B 3NQKA 4J3OH 4N86A 3V4LA 5JXAL 3TOPA 1ZE3H 1LO0L 2YGVA 2H45A 4I77H 4YHOL 4JPQA 3RVVC 1U8CA 3PWJA 2VLJB 3Q2CA 2VDKL 3RWHA 4GP4B 4JJ5B 3AREC 3FCSA 3AGVA 2Z65C 2DKMA 4PY8J 1R24B 1F4WH 4N2KA 4NAJA 2MNJB 2LABA 3VXSA 2NYYD 3LPPA 4RFNC 2GHWB 2HVJA 3VI4F 3U2SB 3VWJC 4N90D 4W4NA 2VZUA 3VWJD 3QH3A 2P7TB 1KLFA 2Y5EA 4NUJB 1RZIB 3DGDA 3WJJA 3OPUA 4XP4H 3V52H 1QFUH 5CZVH 2CGRH 1A4BA 3OKLA 4JM2C 2YD3A 2EE6A 1WJ3A 3G5YA 1R3JB 1CDCA 2JIXA 3QI9B 5GS2H 3QB7C 5BMFH 1HCVA 1BBDL 1I8UA 1S3KH 1S9YA 3O4LB 4YSQA 2ZUTA 4EI5B 3AZUA 4JN2B 5KG9A 2D2OA 4LE8A 2AEOA 2WZ5A 3NAAL 1RURL 2MHAA 4PV1C 2VN6A 1R17A 5GJSH 4P4KD 2YHGA 2DH3A 3IPEA 3F3HA 1XZ0A 3J27A 1MN4A 3SYAA 4FYRA 3IDJB 4YHLL 2DV6A 2VH5L 4X8GA 5IB3A 1RSFA 3ML8A 4G8IA 3OXSB 1ZS8A 4LASL 2WMPA 4L0ZA 5AW8B 3AAZA 1QSEE 3VXOB 5G55A 3K80A 3G5WA 2VOTA 1WISA 4NX0A 2CU9A 5IWLC 1RZ8A 4QGYA 3UMTA 1V7ML 2PTUA 2X28A 4GS7B 4PU2A 4U0RC 2J6EL 5HGHA 2BHYA 3H53A 3G6JB 4TMPA 4D8PA 2CR3A 4DGYH 1I1AA 5AZEL 1NC4D 3KYOA 3L2NA 5T3ZL 2ICEC 4LCIH 2YN5A 5FK9B 3NBNA 4M8QB 5K1JA 2N0KA 4WUUB 1T4KA 2VDMB 3IMVA 2ZOKB 3N1FC 3IDXH 3NIGF 3KXFE 4FTVB 4IHBA 3VXUB 2PCFA 2RQEA 3GPSA 5CJQL 1J18A 1JOIA 2ERJC 1FFRA 3FOMB 4UZGA 1GGUA 1J5IA 2OTUA 2HWZL 4F58H 1TLKA 1F5WA 4KI5E 3Q6FB 1G94A 2JJWA 3AUVA 5IQ7H 5FUZL 3WG7B 3T04D 4AKOA 3L08A 3GSXA 5EPMB 2IAND 3ZTCC 3TIEB 1G4MA 2YD4A 1EJOL 3AS1A 3I85A 4GMSL 1CLOL 4MCYB 1XXFC 4B7IA 1JHTB 5FA3B 2XI9A 3LIZA 4OZHB 4EOWL 2ID5A 3STZA 4IIQC 4FG0A 1CXHA 3KBPA 3UIZA 2JKIS 1NCTA 1JHLH 2LU4A 4PRDB 2F2HA 3L3OC 1FYTD 4FD0A 5K9OA 3O9WA 1S8DA 1TQWA 3FTZA 3LZLA 3SODB 1A3LH 1BM3L 1DFBL 2GI0A 2GUOA 3VGEA 4Z0BL 2WXRA 2WLLB 5JHAA 2J3SA 3HAEA 2BNQD 3B2VL 3RWDB 2VDQB 5EHFA 1HDMB 3BUQA 1N7ML 4G1EB 4C4KO 1YMHB 3KPSE 1RZGA 1PEZA 5FIEA 4M6ML 4Y4KC 4P2RE 4WZ9A 2I69A 3BPNC 4JFDD 3U6XS 3TYFA 1DL7L 1L7TL 4XH2A 1BQHB 3HHSB 4IGBA 5AVYB 1UZ6E 4GG6E 2NX5A 1E4JA 4HOXA 2R0WL 4U3SA 4EI5C 3DGCR 2OXGA 1NBQA 3QPXL 3QWOB 2VRAA 2R56L 5ICXB 4WO4D 1RUQL 3O8XC 5K59F 1DQDL 2YMOA 3TJEL 1TSRA 3KWUA 4OZFG 4TLTA 5E8NA 4DKEH 3BRDA 2ZYRA 1ID5I 5FUZH 1WUNT 2AQ3A 3TGXA 4M93C 3IJEB 3HC3H 4FFYA 3QJTB 1UUNA 3ROOA 5JXEA 2AQNA 4PQXA 3F7QA 3T2LA 4NRXA 1CFQA 3LRLA 3KWWB 4PEEA 4NIKB 3M8OH 4G8EB 5DA4A 4IRJD 1PD0A 2Y06L 2X4NB 4JEGB 4Y1AD 2XVGA 3BT2L 3ULVE 1QP1A 1OB1A 1TEGA 2NNXA 2P44B 4KHXH 2VWEE 1OT1A 5INDB 1Q8MA 1IEBB 3SPJA 1TYRA 3VSQA 4YHYB 1IE5A 3MOAH 3WFEL 2Y6SD 4LVNB 3FUFA 1MW1A 1JF6A 4PJAE 3RL1B 2FYYA 5FO7A 2DQDL 3VWKD 3AVEA 4LEEA 1L5GB 2FYVA 1OSZB 1I3RA 2DYSB 1TYEB 3O8XA 3V0HA 3X2QB 3I50L 4Z7AA 5HSFA 3HVNA 5ABAA 3F7LA 4RDQF 5IR1A 1JPSL 4JS7A 5TK2A 4HLZH 4JFPA 4Y5YA 5BOPA 2V9RA 4HSCX 1EAPB 3BDBA 4YK4C 1N5YH 1YMMB 1AAJA 4PJGE 1A6PA 4WFGE 5F9AC 3UTPE 3UBHA 3T9WA 2HT3C 4IDJH 1NBCA 3BD3A 1HOCA 1JXGA 2PW2A 4OZFA 3OTTA 1DANU 4QYOB 3UGXA 3P9WB 2PYFA 2PWGA 1KJMB 4CVXB 4OI8A 3H3PL 5EU5A 1AKPA 3MLTB 2AJVH 2VXVL 3CDYA 4NQSA 1E2WA 3UTTA 2KQMA 5B1CA 3D8MA 3M8OL 4EZMA 4IQHA 5HI4C 3HLKA 3G6JE 2VABA 3L3OB 4PV9B 4QO1B 3E6FB 5D1ZD 3T6VA 2WXFA 3SBRA 4ALAL 5SWQA 1WZ1L 2FH8A 4QXUH 1T80A 4XBEL 1XSJA 2YRZA 4RDBA 4F8TA 3Q06A 2W0KA 1PY9A 1SLXA 4KJWD 4ZO6A 4C4KT 2DBJA 4OCYH 4AIOA 1RURH 4ANVA 1XCXA 4CGUB 3VXUE 1B0GB 1ED3B 2AEPL 3BUIA 3GI8L 4G70B 4OKVB 5AYTA 4ORGB 4ZMVA 1SDAB 3BVDB 5HD8C 2EVHA 1KGCD 4MNGA 5JPNC 4P0DA 1X4YA 5D1QE 2Q8BH 3RKPA 4Q9QH 3LSOA 1F3JB 1CWVA 3QZOA 5JOPD 4NUJA 3PP4L 3RIKA 2UYLA 3OX8B 5BMFL 5LNEA 2IMNA 4FABH 2EDKA 1VFBA 1TQCB 3QUYB 5F0PB 5C0EB 5IR1B 4KRPD 4OFQA 1WZLA 1NAMA 4TS6A 5D5MF 3IPBA 2APWA 4CJ1A 5L2JA 2W9DL 3EYSH 3TASA 2WLIA 5FCSH 2ICES 2X3CA 5KSUB 2PMZA 2Z31C 4GQ9H 1EHXA 3ZW3A 1QRNB 3BKJH 3KMDA 1QFHA 3N42F 5I30H 5MI0C 1IBBA 1TO5A 4HEPG 3Q2VA 4NZTH 2QMKA 2JH2A 3LNHA 4N2LA 3OXSA 4O2EB 1EBPA 1RMFL 3FONB 5DYOB 1AIFA 4DEPC 4QWWD 4NHUA 3V9EA 4YBQD 4C83A 4R26L 2QVFB 2AVGA 3OKNB 1FVCA 3IGUA 3I3EA 4GG6B 4BUQA 2OSYA 1INDH 2DWTA 3FT9A 4FQXC 4KX9A 4IRSD 4ZW7A 5ILTL 2QSQA 3IJSB 4Z7OB 4FN0A 3GPEA 1QLEL 1NGQH 1QBML 3OHXB 5F89A 5DMGC 1DLFH 1T4KB 4LHQB 2AKRB 5CN1A 5HHXL 3VB9A 3CXDL 4OV6F 4KXBA 2XJKA 5DLMH 3ZTJG 1WWAX 3MKKA 4Q4EA 3PQYA 3IGLA 2IQAB 1MJUH 1A64A 4UAOC 1PY4A 1P4BL 4P5TD 4ZTOH 3RWFA 2QPEB 1LO0H 1OHZA 1I8AA 1B9KA 2G4EA 3NMEA 3OQRA 3E3QC 2Z4QB 3BOVA 3GMMB 3CFDA 4ESKA 5KVGE 1KCVL 5IBLC 4Z7NB 3MXVL 3BQUA 2IANB 5KYYA 1J0YA 5I76A 3WUWG 3TPUA 6CGTA 4Z8FH 4LPTA 4P06A 3W5NA 1BGXH 4V2BA 4YXLH 1QHQA 2Q7AA 5D71H 1MIML 3BZ5A 1P84K 2A4CA 2Q2LA 3STZB 4K9EL 1E28B 1AHWB 3LN9A 5EU7C 4BH8A 1MRCH 2BNQA 4JM4L 4OF0A 3EBIA 4HEME 4O02H 3EUUA 4UQCA 2CDEB 1AZVA 1J87A 3EJYD 4LKXB 3BVWA 2FDBP 3VD1A 4XX5A 1NGZB 2EKSA 1U91A 2CPCA 4IBLT 4NGHH 3WFCH 2FNBA 5F88A 1BZDA 5T1LA 4MDIB 3D25A 2H9GA 1E40A 2F53A 1MFVA 2IPUG 2G0KA 4X9YA 3U7YH 1QUNB 2I07B 5C0GA 1KGYE 3AU1B 2EYTB 4PCTA 3RB7A 1QTYT 3QXTA 2B4CC 2NW3B 5F7EH 3KYKH 2ZX7A 4K73A 5I6NA 1MIEL 2FAUA 3J2PA 5D2NB 1BA9A 2BSBA 3OD3A 1CICD 1P9MC 2GI7A 4GRLB 3L5HA 4D3CL 3R18A 3D69A 1AC6A 4LL4A 2NSQA 3ERXA 3OB8A 5ICXA 2XC8A 1ZLUH 1S7WB 5JUEH 4D94A 1KBWA 3LVTA 4WHTB 2BIOA 2XN9A 4QTHA 2GC4C 4LAQH 2P5EA 4JPIA 4U6VL 5AOKA 2X87A 2G60L 4Z8FL 4V11A 4HZLB 5IG7B 1F3DH 2ZWLT 5HVHC 3CDZB 4ZRGA 1B6DA 1AQHA 2ODIA 1A4JB 2ICEB 2EVGA 2G9KA 3DDFA 4E9VA 4AGLA 1Y6MR 1ZT4A 4X4ME 2YEZB 2X4NA 3HB3B 4JO8A 5FOBB 2R1XA 3BSHA 5FYKU 3ARBB 4F7CB 2X1WL 3ROLA 3UERA 1ZT7B 1EVTC 1DO5A 1T0NB 1AR1C 4GRWE 1NAKH 3QGVA 2Q6WA 3VI4E 5KYNA 1S9WB 2FIRT 4JFUA 2YPLB 3FFCD 4DGUA 1ZA6B 5KUKA 4NUMA 3X14A 1YEJL 2YD1A 3UO1L 3TIDB 5FM5O 5HPMA 4HBCH 4TNGA 1GOFA 3DYMA 4LDEB 1MFBH 1G7IB 1EAPA 4UF7C 4MD5B 3BEVA 5IJVB 1RK7A 3L4TA 4BSJA 2P26A 3FT3A 2WW8A 3HI6H 2CBOA 3W11D 4TRPH 1OAYL 2GAZA 5BPPA 4MZ2A 5L2KB 1FE8L 2Z31A 4LMQE 3VFPB 4OZFB 3T0EE 4YHIA 2X42A 4WRLA 3E8VA 1FAKT 1PJWA 4LAQL 1HIML 4PLJC 1JRHI 2HH0L 2VAJA 3QAQA 3GIZH 4MX7A 3EH5B 1U9KA 5KANG 3VMPA 3QUMB 1KJMA 4CVXA 3OZKA 3VE0B 3BCDA 4Q7DA 4JHZA 5C0DB 3WY3A 2Y7QA 4M7JH 4OM1L 5FKPA 5LUMA 3SHSA 1G7LA 3SDYH 3MRMA 2Y7MA 3BO8B 3DJSA 1ZT1B 1A3LL 1GGBL 1YO4A 4ONGH 1HFUA 2WWMD 1VFMA 4LL9A 3B2VH 3PV7A 3WTWA 1FHNA 15C8L 3CN1A 2Z7UA 4F1SA 4DCQA 2YGQA 5GS0C 3JBG7 4HHGA 4LNRA 3OL2A 1NUFA 4BINA 4QCIA 4TTGA 5T1KD 4MS8C 4LCWA 4P5TC 4P2OB 1YAZA 3FYIB 1SXNA 2QDWA 3VXMA 1FI8C 5H4ZA 1KTBA 1UZGA 2IQ9L 4FFWD 3KLQA 4YDVB 5D1XB 1A9BB 5DMGD 5IOKA 1WFOA 2QQLL 4WV1C 2FL5A 1OVZA 1JK9B 2XYCA 3BWZA 4XCFL 2GFBB 3QYMA 5IOPB 5GZND 5KVDH 3SE3C 4LCWD 1KV7A 5B1BB 1TCRB 5DMKA 3CSPA 4F8QA 2ZYSA 25C8H 1S9XA 3VXMD 2R23A 3VU2A 4OZIF 1ACCA 3V6ZA 3HNSL 3M6DA 4AUYA 4Z7OF 2F61A 1RJCA 4LNVA 5HDBF 4UV4H 2QFPA 1VFAB 2FGZA 2PXYD 3V9FA 3QCTL 3AG2B 1B3JA 2ZKHH 3SBWA 1T7ZA 2VM3A 5FWRA 1XR9B 4WCYH 5C09A 5I8OH 4WI2A 5EO1B 4ZX3A 1ORSA 1MCRA 4ZO9A 3FCUB 4X5XA 4YH6A 2HB0A 2WWOA 3SYCA 4OZFH 3U4AA 1LDSA 4OGXH 2WBJD 4FFZL 3DVNA 3IB4A 1T2XA 4PJDE 4ZO8A 1EZLA 1NGYB 4X9HA 2DQMA 1IM9D 4KKNA 4RRPA 4FNRA 2MQCA 3D0VB 1TTFA 5EN2B 5BOJA 3QJRB 5JHDB 1LLAA 3HG4A 5C0IA 2EE9A 4PJCA 3TCXA 4BHUA 3OKDB 1KCSL 2PNDA 2VWEC 5G4OA 2E27L 2H26A 1GGIH 2EECA 4MJ2A 1MG2C 2YKKA 5HJ3B 5IIEA 1N18A 4FZ8H 4LVEA 2HJLA 1D9KC 5EZIL 1R75A 1AKJA 3VH8B 4Y1AA 5HVWA 3QO0A 3H42H 2RBLA 5AYQA 3NIDF 3BRFA 4FKEA 4AUJA 4RGNC 1Z9MA 4FP8L 2E56A 5DYFA 4LIQH 1TNMA 3NCYP 4R5XA 3IXTB 5SWZA 4DZBA 3QRLA 4IOSD 2BOCB 4BZ2H 3VGDA 3DX9B 4S1RH 4MJ5A 3GMRA 4ZYKA 2C1PB 1TFHA 3VI4B 1DJZA 2GSIB 1UUSA 4HUUB 3EDKA 4L3EB 5IF0A 2XQYG 1RK0A 2B1OA 1E50A 3TWCH 3T4AC 1SN5A 3TFBA 5JNYB 1Z5HA 3O11A 1WBXB 3HFMH 4KVCH 4JHBA 3HG3A 4G59C 1JZFA 3U1PA 4ENZA 3CVHB 3C6SA 4NT6B 3T65A 1DN0A 2HVKB 2JB5L 4X9FA 2Y69B 1IAIM 3JV0A 3GSOB 3DECA 1N8ZA 5HY9B 1AR1D 4ZMQA 1PKQB 4LEOA 3VVWA 4WI8A 3FUDA 3ZQ9A 3RG1C 1HH6A 2JKSA 3ELAT 2Y25A 2C9QA 2RIKA 2Y7NA 5TE7L 3WFDH 3S98A 2B0SL 1BMZA 1PQZB 4Y5XC 4QJ5B 3KEHA 4PGEB 3SD5A 2R8SH 4LHUA 1NMBL 2R4RL 4KZEL 3CHXA 3ZTJH 2WXIA 3UJTH 4ODWB 2CKBH 4XNXH 2JF1A 4G8GE 4PLJD 1BZ8A 2JXMB 1FVEA 3NJKA 4A6YB 1H5BC 2X4PA 1MCIA 1KIUB 5BO1H 1KXVC 2GSMB 1UCTA 2HJKA 4TN9A 5A16A 2EDFA 4M62L 5E6IA 5C07A 2ESVA 4JFFE 5I30L 2EE2A 3C5ZD 4JVWA 1HEHC 4X6CA 2IFFH 3L54A 4HVBA 3KPLB 2OL3A 4K7FA 3UOAB 5H35A 1JNNL 1DCEA 3OJDB 3K1KC 1YYLH 4UU9A 1O5DT 4F7CA 3GUTB 2CDFB 4IS6A 5F9OH 4JFHE 4ZBJA 4PREA 3U25A 4QHLA 2BK8A 2DD8L 4HXBL 3EG9B 4WFHE 5T5NF 2Q6WB 4KMQA 4U1HA 4HMEA 4NP9A 2AK1H 5ESVA 5E94A 4KGJA 1NFDF 2D3JA 3QCVL 5SX5K 4WEEA 4XMWA 4Z3TA 4J23A 2KKQA 4JE4B 1PSKH 2ADJB 3ULUL 1FZKB 4HUWB 4AGNA 1P84J 4YO0A 5CINL 3ZTNH 1MCHA 4CVUA 3QZWB 5AAWA 3BUTA 4N0RA 1FRGL 5IJVA 3C75A 3KZ8A 1CLZH 1LP9B 1X5AA 4JRFA 4KNTA 4LVOC 4XCEA 1JN6A 2P5WA 1PKQE 5F7YC 5AVTB 3FBKA 3ULUC 15C8H 3V5HA 1V3JA 2XBZA 3DSFL 2YZ8A 4KDWA 1YYML 3OF6D 2YR3A 5TTRA 4J3XA 3RU8H 3KDMA 1WQVT 4UIKL 3U4BL 4LCIL 3O41A 4R90L 4Y1AE 3CQQA 1VERA 1ND0A 1MHCB 1Z9SB 3GC3A 2I27N 2IAMC 5K39A 4BFGA 5CR1A 3SEPA 5LXGL 2CJUH 4PRBA 1MRCL 1T1WA 4G8AC 2IDUA 1ZK9A 4HETA 2H6UA 1A7NL 3U1SL 5DFAA 1QSEA 3VXPB 1H3GA 4FQIL 5FAAA 1D2OA 5EOQH 1YYLL 3A0OA 4W1TA 1GC1L 5HYFA 5IQ7L 5C70A 1CFVL 1DBJL 1ODUA 1TEFA 2M1KA 3P4OA 5EF2A 5L88L 2NY2D 4B9CA 4M43L 2UZPA 2Y07L 1FG2B 5HI3D 5HDRA 1DDHB 4H5SA 3RFZC 2I7OA 1N26A 5CMAA 2G60H 3MV8E 3P69A 4R7VA 2QQNL 4P2OD 5IVXA 1YEGH 3RVWD 1U8NA 3BH8A 3GK8L 3H9YA 3PGCB 5IW3A 2ZKYA 4HSAC 4PWFA 3VNZA 4AVIA 1AC0A 1QFWH 1N0XL 5AYUL 4G6KL 1JHLL 5FYLL 3CN3A 4YSCA 1AZNA 2VZ3A 3PGDA 3WN5A 1UFUA 2R29H 4DP1X 3UEQA 5KSBF 3D3VE 5D5MA 3KXFB 3DURA 5JOEA 4WI4A 2RFXA 4ADJA 4XVUC 4LU5H 5CZRA 4WK2B 1NOAA 2FGWL 1KN2L 4KMTH 3RI5F 3D85B 3EGXB 3QXWA 3T0ED 3MV9B 5BRZB 4JGJA 2ZWYA 5C2BH 3V0FA 3NESA 2HX7A 3CC1A 3FO2A 1LP9E 1TMCB 3HS8A 3VJ6A 5CEZL 2ZUVA 4ANUA 1IB5A 2JJSC 3II3A 1JYNA 4FNLL 3DRTA 2D7MA 4J2QA 4IOIA 1NGPH 3MRQB 3WFHB 2QZ5A 4FQ2H 4GO8A 2AI0H 1IBDA 4A2FA 1ORSB 1QO3B 4IMKC 3NIDB 5D7HA 2WQUA 2C3VB 3NEOA 3SGEI 4AMKL 4DF9A 1KTDB 2DI8A 4XPAL 2OX5A 1RLBA 2WP3T 4KO6A 4JAMB 2EDYA 3VGAB 2W8CA 3VRIB 3FH7A 3APFA 4APQB 4N2OA 4B5ZA 1ITBB 1BQKA 2HMID 2YD6A 4JY6A 2WXPA 1GOGA 4G8GB 4M6NH 3VX0A 5AZ2H 4A39A 2EO9A 2VO8A 3TBVA 4DP0X 3D87B 3GXTA 4LVOB 2NY6B 4MJID 1IAKB 4RFOH 3ZYIA 4XO9A 1AQKH 2PTVA 1EUTA 2V9UA 1M2VA 4ZMPA 3ESNA 1CFMA 3AGWA 5IQ9B 1Q0XL 4MQTB 2R29L 3AWEA 2XHNA 4NOFA 2JB5H 5IGXL 3ZLQC 1MFDH 2HZHA 1XGYH 5CBEB 3U46A 1BVZA 2BSTA 2L0DA 2MOVA 3K91A 1LK2B 3DRQA 4NQED 2QBWA 4Y4FC 5FHBH 1EZVY 2XXCB 3KCWA 4P23C 2A1WL 3S48A 2PYEE 5D6DC 5HHXH 5IHZA 2YD0A 1B4LA 1RJLA 2Y1YA 3MACL 4Y19D 1CD8A 3P73B 4UB0H 1PIGA 1J1PH 1AD0A 2C1PA 3VRLF 4PJAF 4NUQA 1UOWA 5I8KL 1G9NC 2FJFA 5AW0B 4HIJB 2MKLC 4ODUB 2I26N 3GFUA 1NBYB 1WA1X 4K94H 3DVFA 4JHWH 1RERA 4UILL 1NCCH 1C1EH 1NCWH 3O2WL 5EU3B 4XN2A 4UNIA 2X9XA 5TDOA 4DOHE 1N8ZB 3MODH 5HY9A 5MENA 5I73C 3TV8A 4BWTA 1SN0A 2NQDA 4PJ5A 5DZNA 2PPCA 3UG3A 4P46C 2BHZA 2UZXB 2B7DT 2QSTA 4PRAA 5IROA 4JRYD 5E2JA 2ZUWA 5D1ZC 2VLLB 1CGSH 1WHPA 3FB5A 4Z7VA 1UGNA 2C7UA 4RAVA 4OF8A 3RUGF 1AXTL 3SQOL 4PGEA 1ZHBA 1P6FA 1HT6A 5GXBB 2VDQH 5EO9A 5IVZB 1FVDB 1ZHLB 3DIVA 5LBGA 5GRVL 3MJ7B 1NCJA 3WO4B 4X5WB 1YMME 5GRUH 3JZYA 3P0GB 1OTTC 1AOHA 3NTCL 5F9JA 4GRWH 3S37H 2WCPA 4TVSa 2Q3XA 2WLJA 1C08B 5AVWB 3WL9B 1IILE 3LCYA 4PRIB 3WTSA 1VFOA 4MQ7A 2EIJB 3HMXH 3KPPB 3KPSB 3HCVA 3HAEG 3O6FA 4PJEA 5BS0E 2E9WA 3NCCB 3BGFB 1COBA 4TULH 1DQMH 2OL3B 4K7FB 4KU1A 3S3JA 5J89A 4AMWA 2R1YA 1UWYA 5CGYD 3WTUA 3EXJA 4A63A 1BZEA 1J8SA 4JPKL 3SGEH 4PJHF 4DZ8A 3H9SB 3QDMD 1QEWB 1JVKA 1VHPA 3WKPA 3QAZB 1LEIB 4XBGA 4LQFH 5CHNA 5GS1A 3OKMB 3PL6A 5KBMA 3F7YB 2V2XA 3JWNE 1EEYB 1F0LA 4LHUG 1JV5B 2YQGA 3D52A 3RX7A 2JKJA 2WN3A 3QDJA 3SQBA 5CCGE 4WI0B 2H4EA 4HAFA 3VFUA 3F00A 2JSFA 3PUUA 2J8OA 2YD9A 2AV1B 4P59H 2F1BA 3BLKA 1AS8A 2NTSP 4MYWB 3A6OA 1IC5L 3BKYH 3GEFA 1U8LA 4UIKH 3U4BH 2YKLL 3V4PA 1WGOA 2XJLA 4XP6H 5K59E 1UURA 3DX1A 5E5UB 1J10A 4JMNA 3F01A 2C9AA 3RPKA 4CUCA 3B2XA 4HWZA 4N2FA 3K72B 3VUAA 4TSAH 3VWJB 5DJZA 1FZMB 1SOXA 4HUCA 2DIBA 5IB5B 3UTSB 4BWUA 4M6AA 5CS7A 1QSZA 4PRBB 5E8OB 5L0QB 1A1OB 4CC1A 2R0ZL 3N9GH 4BDVB 1DUZA 4XMPH 5GS1C 2ETWA 3VG9C 1JF1B 1SXCA 3AABA 1CLCA 3ARGB 1QMUA 4PLKD 1ZTMA 5D7LD 5F3HA 4CVZA 5F7AA 3RGHA 3F12A 2XG4A 3A21A 3EYFA 2HUEA 4Y4HC 5AD0A 3QIUD 1VJSA 1QASA 2GK0A 2ILLA 5CBAA 1J8HB 1QBBA 5GIRB 1QR1B 1MAKA 2LT9A 3MRJA 3KPRE 2WNXA 3O3BA 5DJXA 5EUKA 4N9GB 5KBDA 3D18A 1ASQA 5DLLA 4OJYA 3MCKA 2V17H 4JQIL 4WWKB 5CWSA 5I6OA 4BKLB 5ADOH 3IDXL 5EORL 2B0SH 3IYLW 3OGCB 3PGCA 4KO5A 2MTPA 5E1AA 3V4VH 1ZEAH 4BFEA 4AG4H 4DKFL 4A7SA 1F4YL 2LGNA 4HJIA 3BZEA 4WHCA 2O5XH 3AAZB 3QZWG 3DURB 5M95B 2EDDA 2FO4A 4K2UL 3MGAA 4WWKC 2APXA 1NCAH 2EIZA 4H8WC 2YD8A 4LRIA 3TO4B 4HFWB 2FHBA 4I18A 4ES8A 4NSKA 1PYWA 3BWAA 5EZOL 1U93A 3F58H 3FFOA 5SWSA 3N0PB 1BQHG 1CLVA 2D7OA 2WIMA 3QQXA 2ADIB 2CUIA 2GITA 3FQTA 4Y8AA 1C16A 1KACB 2XPGB 1KC5L 4W9JC 5KN5A 3JTSB 2VDPH 4FTVA 4IOIB 4K7PL 1NIEA 5L0QC 5CSZA 3FU3A 1JHKH 4LOUD 2H1PH 2ISDA 3TZVC 3V6OE 2OTUB 3CZFB 4PJFA 3X3GL 3MROB 1H8LA 1XGYL 5CLZA 3LHPL 5DWPA 5CLXA 3SDCC 1X4XA 3I84A 4U4BA 4A55A 1OZUA 4MMZC 1AYOA 4YEFA 2K6YA 4XX1G 5EPMA 5T3XH 4RGMB 3S9DB 1F97A 3BGAA 1EANA 4TQEL 3VFRA 5CFAA 4YLBA 2G30A 2VXUH 3K81A 3QQ4B 4RFOL 3THML 1PMYA 2FWOA 1SJEB 1MXGA 4G9FD 1EVUA 3U2IA 2GBVA 4JFYA 5E4EB 5EEYA 4FQXA 3LN5B 4O58L 3ORJA 2YPKB 1JD7A 3HE7D 5L7XH 3BUYB 2V5SA 5D4IA 3S97C 3TBWB 3T4AB 1A6WH 1V27A 2D8KA 2DQCL 4F7MB 1ETB1 4KZCA 2HYMA 2A1WH 3MLVH 4O4YH 5HHNB 1YQVH 2RB8A 1Z9PA 1XZWA 4LCUB 2CO7A 4LPVA 4QIRA 1XF1A 2WB1A 4KV5E 4M1DH 1MQ8A 2G3MA 3MREB 3QDGA 4KKQA 4Y4FD 1L9PA 1WAAA 2DLFH 5JXED 3GEWB 3GSUA 1KOAA 3H2QA 3KLSA 5DQ9A 1J11A 3K1DA 4OCLC 3T2OA 4I13B 5IMKB 2WZ6A 2P47B 3BZ4B 1I1YB 4TVPD 4XNBA 3FSAA 5F7DA 1HL5A 2NX5D 5GPRA 1DBKL 5FFLA 4XN4A 3TPKA 2NXYB 4M9OA 5JTWA 2FT7A 1AGFB 3DXAB 4OT1H 4L8SB 1P7QD 1NKOA 3OKKA 3WJMA 1JXKA 4Y2DD 2PXYC 1EERB 2OJZL 4LMQI 3KWWA 2YPLE 3U36A 5AB0A 1GGYA 3RGVA 5DMYA 5M94B 1DQQB 4FCAA 1UD3A 3TCLA 4GSXA 3SE6A 1KPVA 2F58L 1M9WA 3VH8G 4R2GC 2W80C 4RA0C 3QNFA 3P02A 3SPCA 5INDA 4HKJA 2BH0A 4UQIM 5IESL 1WUZA 1VADB 4NNXA 4Z5RB 5C6TH 1CU4L 2OSWA 4PJ7B 2DOCA 2CO3A 2XWTA 3BAJA 4X7EC 2JKXA 3LQZB 2IPTH 4X6CE 5J9PA 2VSKB 1OW0C 5KSVA 3U4KA 3GRWL 3BW9A 2B08A 3CFBA 3B6SA 1T22A 2DEYX 4FG2A 4AI7A 5T33L 4QXWA 1OP4A 3DC0A 1NCDL 2O5YL 4HIEA 4P5SA 1AHKA 1JGVL 1BXXA 4QXTB 2UY7B 4HH9B 3D51A 4R8WH 1MCCA 1U8QB 4P2RB 1W72L 4FXGC 2DLIA 4AMKH 2MQGA 3RNKB 5JDSB 3BKMH 35C8L 1GZHC 1BDYA 1RJYB 1SYSA 3V6FB 2AC0A 2WBWB 2PW2B 1NKRA 3IVKA 3VYOA 7TAAA 2VM4A 3HZMB 2H3KA 3QEHA 3C2SA 1IGJB 4DNLA 5CHNB 5GS1B 4PRPE 4L8BA 3PL6B 5JZ7D 2VJ8A 4BE6A 5EV7A 3GDCA 4Z3IA 1Z5LA 4FYQA 3FFCA 2XTJB 3GBNL 1D6VH 3TONA 4QAMB 2AZAA 3FKUS 7PAZA 4GG8A 1U8KA 4PTUB 1DBBL 1TTCA 4PV9A 4XN7A 5DWUL 2DMCA 3T2QA 2MRYA 4GMSH 5DRXA 3HPLA 4DKTA 1JK8A 3EJJX 2K0RA 2H47C 2H32H 5D1XE 4PJ8B 3V4PB 4J3OF 1EJ8A 9CGTA 3LNIA 1HHIB 5KVEE 1ZKAA 3RWGA 5KYXA 3BKJL 4GRLC 4XP9H 2DWXA 5EUOE 2F68X 4PS4L 5I5IA 1YQ2A 5JO5B 2VLKD 3C60C 2OP4L 5JXAH 4NKOB 3PABA 4DVRL 4AEHL 5IB5A 3FOLA 1F3JA 3NEEA 1WO2A 4Z0BH 3L3KB 4J4PD 1OAJA 3S36X 1HWWA 4NJ9H 3HNVL 3EDDA 5FYJH 2FB4H 3ARGA 4ZJ9A 4F5CE 2Z6FA 4F7EA 4M3JA 4MAYD 3DVGB 1IGYB 1WYJA 3DGGB 4NNYA 4Y0GA 2CMRH 5KSUA 4I3SL 3FZUD 4JO1H 4G7RB 1MVFA 1BVOA 2J2ZB 5I0ZA 4JY5H 4ZW5A 4NQDE 1KENL 5JIKA 1DFXA 5ALBH 3O0LA 4JFTA 3T3ME 2ATKB 2VGLM 3FT2B 2CK2A 4JM0A 4PJGF 4OLXH 5LCVL 4PGDB 1BP3B 3DYPA 3RAJL 1EGJH 2PYEA 4P5TA 1QEXA 2N0MA 4HG4J 4HWBL 3ULUF 4NLAA 4ZMNA 3T3PF 2ZSWA 5CILH 5E6UB 4WHYG 4BA8A 1S7RA 2OCCB 4U31A 1QG3A 1WZMA 5D7IE 4XMTA 4L4VB 5I1KL 2BINA 4IK6A 2GB2A 4NSKB 1G9NL 5H37H 2F7RA 3LPGA 5KVFH 1G9EA 3PPSA 4B0MM 3KM1A 4U1IB 5C0JB 4Q6KA 1C8PA 4GUPB 4KKRA 2ADIA 3QNYB 4EN3C 4ONFH 1MI5A 2PCXA 3SPVA 3TZVB 1FORH 1RZKL 4NDMB 5AALA 2D31A 2DDQL 1OALA 4ABQA 3EFDH 1C5BL 3GSNL 4KK6C 3PQYB 4Q9BA 1KCVH 5EBMB 5CSZB 3LKSA 5C0BA 4TUOA 4MA1B 2QHLA 4KROD 4XHJD 3VD3A 3MUZ1 4TNWK 2IF7A 4DGWC 5ITFB 1B9ZA 3RDTA 3VFOB 3C8DA 5CLYA 3CVIH 4FOMA 4LLDA 3GB7A 2VR9A 3O9WD 4MNHA 2EIKB 3FB7B 4I3RL 1IFGA 3IU3B 3TF4A 5B3JE 1EO8L 2GC7C 1W8EA 4ODHL 2ZX8A 1MQKH 4N8PA 5HYIA 1IGFL 2VB5A 3QQ4A 4PRHD 5DRZA 2FECL 4U6HA 4WEBH 2OMTB 2VISB 1S9KC 2B1HL 2F7PA 4QY8A 3RY6C 3BLPX 1AHWA 5T3ZD 4TVPH 3LMJL 2CXKA 1TZIA 2YPKA 2CIKA 3BSZH 5E2TL 1BJMA 1KCKA 1I82A 3MV11 3UJIH 4HW6A 3B9KA 4XP6L 5F88B 1MXDA 2QMJA 1QABA 4QAWA 1FJ1A 2OTWB 1GY1A 4JRXE 3BMWA 3D25B 1JPEA 3K8KA 3B9EA 3C5ZC 2IGFL 4PG9B 1G7HB 2GJ6A 2WO3B 2DM3A 1IFHH 2VIRA 5C3LD 1UWEL 1XF5A 3SY0A 5BVPH 1VA9A 2P5EE 3UP6A 1JBJA 2J73A 4X98A 3VFNB 3B9KD 4ONFL 3ZHDA 5JPMA 5DQ9B 3RX9A 2ADFL 3UACA 5HHQA 3FH5A 3K71B 1F8TL 4HIPA 5I1IH 3UYOD 3VD5A 2PN5A 4HIIA 2BZDA 4X7FC 3LQAH 5C0BE 4EF3A 4I0PC 3PWPA 3N5AA 2XN9B 3NN8A 4X0KB 3BISA 4FABL 1AJ7H 4L8SA 1A8JH 1BXVA 1T7XA 4QRUB 4BFFA 3EO0A 2ZNXA 3HNTL 2BVYA 1E8YA 3WUWB 2KUTA 5FXCH 5JIIA 1G0DA 1DQQA 1ETZA 3H3BC 4UDUA 1MCQA 4L8DA 3MLRH 5FYJE 2XN0A 4XI5D 4BE5A 4JFQB 2XWRA 2PWHA 5BUGA 4FG6C 2EAEA 2JK5A 4UM8B 3IDMB 4ZUVB 4ANXA 2BM3A 4YNYB 2Q76A 1J9RA 4RBPH 3MLUL 1QA9B 1UZ8A 2KZKA 3GMLA 1ESOA 1LNUB 3H0TA 3MRBA 3L3IA 5GGUA 5T33H 3RVVD 3S35L 1ZVNA 3UAJA 3O3DA 1HNGA 3VYNA 5J9PB 2A6KA 2O1AA 1I1FB 2ZQKA 1BZQK 3M45A 1ONQB 4M7JL 4EXKA 1UENA 2ALAA 2Z8RA 4H0HB 4JM2F 5I1JL 4JGMA 3BKML 4RETB 3MUGA 4NO0B 5FHAL 2Y23A 1L9NA 1U3HA 3V4UL 3ECQA 2PP8A 4JRYA 1SY6H 5C0RL 4C56A 3CAFA 3GXUB 1I4FB 5GISL 3HMXL 3GINA 1I9JL 1R5VA 2NY0C 3EDJA 3O45B 5C2BL 3IEAA 2YSSA 4DO6A 3EFFB 1YPZA 5KSBB 2R1WB 5F0MB 2FD6L 2WCSA 3PY9A 3IM1A 2DJ4A 1N5YL 5C0DA 3BD4A 3HZ3A 1S9YB 5EUOA 1JYVA 1SBSL 2XU9A 4DEUA 1G7LB 4WI3A 4L4TA 3OJVC 1NDTA 3LNFA 2WN2A 5J4MA 5DUBA 2XN9E 1T6WA 3MUY1 5KBNC 2E4TA 2W07B 3L95B 3ZHNA 3ZJAA 2ZXDA 2MHAB 2NY0B 1VPOL 3CZSA 3NH7H 4HSQA 4LPWA 3RBSA 3MOQA 4FQJL 2QADB 1Q0YH 2WHVA 3OC5A 1HEZA 2W0PA 2ADGB 3V5KA 5D1QA 1OD9A 2X1QA 4LEBA 5J1TC 3MCLH 4FQHB 4U1LA 3CZUB 4PYHA 4NKQB 4JQXC 2ITCA 3DI3B 3FN3A 5IB3B 2H5UA 3NIFE 4UV4L 3VD7A 3LZNA 2QEJA 3QDMA 1EO7A 2ZYHA 3NSDA 1K8IB 1L4IA 1UCBL 2LFEA 3EO1B 3PHAA 3VXMB 1E5BA 1FA4A 1RLWA 1KTLA 1T0OA 1WAEA 1XV8A 1YA5A 3MFFA 4WF7A 2QKIA 4HKXB 3KNBB 1OEZW 1BQSA 2XY2A 1KULA 4KUCF 2CMRL 2NY6D 4MJIB 4Z7WE 5KYWB 1L0QA 4PJEE 2OULB 4HJTA 5DMKB 5F7KC 2BOLA 2G5UA 2YD7A 4QRBA 5EEXA 3FUNA 4NQTA 4XVJH 2NY4B 3DKHA 3B43A 1AI1L 4UT9A 1E9PB 4CJ0A 1FNGB 2XNAA 1UJ3C 4E9LA 1XF4A 4KHTH 4TNVF 1M57B 2DWDA 4M6OH 2OL3L 1RUML 3Q6GL 5A6LA 3QEUA 1KIQA 4P5TB 2F19L 4NWTL 12E8L 2EILB 4ZAKC 1F2XK 4MCYA 1JHTA 1IRAY 3FRPG 1J5OL 1QFWI 1AY1L 3KGTA 2AMUA 3QQNA 1PZ3A 5C0AD 4H2AA 1CTMA 4FL4C 2X12A 4XC3H 2IH1B 3KGRA 4DN3L 3N41B 1P7KB 1WCBB 4E68A 1FO0H 2Z4TA 4I3GA 3ZDYE 4CN1A 2BNRB 2N56A 3L3GA 4KBPA 5JPMC 1PEWA 4HKZB 4RCAA 3RWCA 1HHGB 3LXBA 3W9DA 5IJBC 2DPKA 2GUOB 4LLQB 1WD9A 4YGVB 2FVNA 1IEAA 2Z91B 1N59A 3GSVA 1I8IB 2BNUB 3F84A 3VRJB 1JL8A 3LKSB 1AKJB 3VH8A 3KLAB 4AZ8B 4OTXH 4E41A 3LS5H 3O0RL 3Q1SL 3MOBL 4G6FD 1F90H 4J6IA 4LLDB 3GB7B 1MFBL 5DT1L 5DJDB 4ACPA 4GSUA 3D05A 1BBJA 3U1SH 3ZT6A 1RH8A 5BQ7B 1O9ZA 3AS0A 2WYZA 5FOJA 2NY3D 3QS3A 5C6PB 5DHMC 1MVUA 2XVLA 4AVHA 5T1DL 3IDIB 1CFVH 1DBJH 1P4BH 3DX9A 5CJ5A 2IWFA 4DVBA 2WXGA 3MN8A 1EXUB 3JTTB 5FM5M 5HDQH 3CFKA 4UQ2A 4JFSA 1FO0A 3UJTL 3NSJA 2H3NA 1YEIL 5FYJL 4XPGL 1CDHA 4NQUA 5AOLA 1RSYA 3BT2H 4BELD 1SQMA 1YEKL 3BEWA 3L5XH 3PP3H 4UNTA 2OP4H 3IS1X 4XGZB 5TE7H 3WFDL 5E6RB 1OB1B 3VXSE 1J05A 1BFVH 2WOYA 2X44D 4RFNB 4OLWH 1GZPA 4P2QB 4R5VA 2BVEA 3TESA 3DPDA 3NG5A 1DSWA 1S9VB 3MLSL 4NNPH 4JFED 4IBWA 3IKCA 4RGNE 5EOCL 4LL1A 5EUOF 5JOFB 5IHUH 3T0BA 1V55B 3PAYA 3TTSA 1U8IA 1UVQA 3D48R 4JZOA 3MBXL 3VSUA 1OAUL 5T3XD 2ZCZA 2E7DA 1NCUA 1XB3A 2BRQA 3GKZA 5K1VA 3C6EA 4HUKB 5H2BB 4E9SA 2CLVB 3ZKXC 1F42A 4FFZA 2G5BA 4MMYB 4PRHE 3BAEH 3AXHA 3SCMA 1HYSC 5T5FH 3AY2A 3VXTA 4YS4A 4DAGL 4WW1B 5HJDA 2H6OA 3PHSA 1ETZB 3SZ6A 3U0PA 1NPNA 4BZ1A 3MJGX 3MRGA 9PCYA 1X5IA 1IMHC 4WO4A 1GYVA 2HT2D 2CPUA 3Q2NA 4BZ1L 5AW5B 4HFUH 2JK5B 4UM8A 2QPFA 4ZUVA 1Z6JT 1GSKA 4K8RL 1PSKL 1PX8A 4Z3GA 1FL5B 2MKWA 2OJZH 1IGIH 3A4DA 4JQXA 4QXUL 4U1HB 1OP3H 3Q5TA 4HIXL 4K8RD 4ODVL 1VSCA 2A6JA 4BFJA 4BXVA 2Y5TB 3ALXA 5LQBL 3W9EB 3ZGIA 1CGXA 1TU2A 4XXDB 2W5PA 1QSFA 3ZUNC 3HBGA 3PDGA 2F9BT 5CM1A 1I8MA 1U33A 2OJEA 4B60A 2GPZA 2RA1A 5AOMA 1CU4H 4NO0A 4MA3B 4HISA 3WNIA 3VW3L 1U3HB 3T8VA 2WQRA 4G7YH 4DQAA 4ORGA 4KQ3L 5E7BA 3O2VL 4PJ8C 3AY4A 1UKQA 3G5XB 5F1KC 3CBKB 3SJVE 3BH4A 1R24A 2NNRA 2ZUUA 5E2VH 4CILA 2XWCA 1ZJBA 2R27A 2LE9A 3QPQD 2YLKA 2KLTA 5AW7B 3QPKA 3SDAA 3LTVA 3TNNA 2HRLA 3OF6A 3KPRB 5IVXF 1A6ZB 2ZOWA 4GIOA 4AGOA 4Y16D 1CIUA 2WKOA 3IKKA 4OCSH 3FF7A 3AG3B 4G6AD 2C3HA 1FBIL 4U1MA 4YPJA 2AS5M 4OUOA 3G5VB 3G5ZB 4YC2C 1J5DA 1XBRA 4FEIA 2JIXB 3ZYJA 1UWGH 3P4OB 1S7VA 2BNRE 1MCOL 1E5AA 1YYCA 1CD1A 2V4LA 3HZYB 3TO2B 1RHHA 2IBGA 5TF0A 1AIZA 2V8MA 3IDYB 1QFWL 2BNQE 5JW4R 4TSCL 3D4YA 3FFDA 4FNLH 2YA1A 1Z3GL 3FF8A 4OZGF 2HX8A 2NY1D 4GQRA 4X5QA 4MXQD 1UYWH 2DMGA 2H0PA 2EYSB 4DETA 1QLEH 4XBPB 3P54A 5TQ2H 2IPKB 3UTQB 2JLLA 5EBWA 1YECH 2EJ1A 4YSAA 1CDBA 4P5KB 2K6WA 2VDNH 4TVUA 2IH9A 3OB0H 2QT6A 4NENA 4FJZA 3NJFA 4NJAH 5AW6B 1KB9J 5HGAA 2C3XA 3ATAA 4YN3A 2Q5BA 2IQ9H 4ENEC 2DLEA 1TZAA 1CE6B 1RD6A 2XNAB 5DMJB 5G2NA 3RPIA 1RPKA 1B4JL 2B4CL 1YNLH 1ASPA 1JUFB 3GMMA 4Y2NA 5D8JL 1CICA 5IBTL 3UTOA 5D71L 1H3PL 2BSSA 5DS2A 2BOBB 3KDPB 4CVWA 3N41F 4H2CA 2NQCA 4P3DA 3PDDA 2LU3A 5DA0B 1ZTXE 4LP5A 4KDTC 1FFTB 1MSPA 2FO8A 4RGND 3MRCA 2QL1A 4P2QE 5DEZA 2CM6A 1DBML 1MZYA 1URLA 2EDXA 2HKFH 3D39A 3RZCC 2F1AA 2CHWA 2VW7A 1ZK5A 4AQZA 4P46A 5ITBH 1I7TA 4YDJA 4PJ6A 1SEQL 3OR7B 2DQIH 3HRZB 3CQPA 3S36H 4OGXL 4KI5F 4M1CD 2FBJL 3VNYA 2R59A 5E95B 4QRRA 4RMWA 1NBZA 4EOWH 4HJGA 1P4IL 5AKVA 2VMCA 3QFDB 2OSLA 3C5XA 1WK0A 2GEEA 4A6YH 4E41B 3JWOL 4DT2A 1BOGA 2EH8H 4ABWA 5DHYB 5IV2B 2LV4A 1WD8A 5DJAA 3NACH 5DJ8A 2ZWNA 3ZKSD 1MLCA 1HKLH 1BM3H 1DFBH 2H8PA 3Q0HA 2EDRA 1RJLB 4NCDA 1CL7H 1MVUB 2Y7LA 1RZJC 1H3WM 4JY4B 5IROD 1YEIH 4XTRC 1ASOA 1D6EA 4WV1A 4IGBB 2QQKL 3NGBC 3RUGA 4JO5A 1MRDH 2D3NA 4OBSA 3VTAA 4QTHB 4Q74A 4HCRA 5L8JB 4F7PA 1MCKA 4IRZL 2OW6A 3FTGA 2CBTA 1P6WA 3SDDC 1JPGA 3G6JF 4FDWA 4CW1B 2EYRB 4UNVA 5I0XA 4B97A 2HLFC 1AMXA 1XH3B 5E8NB 4A68A 3JWDL 4AL8C 3DUHA 5EU3A 4XC1L 2XRAL 2YEZA 1MAMH 1AACA 4ODSL 1OTUD 4DIXA 1F4YH 4IRJA 2X2HA 5T5FL 1S7QB 1SEQH 5E00A 5C3IA 4X83A 3ZO0A 5EWIH 4PWGA 1UKTA 3QQ9D 2B59A 1ZT7A 1GZPB 4XWOD 4Z7VB 1XIWA 3QJFA 3UEZA 3ES6B 4F33A 3MBXH 3HHRB 5BQDA 2RCSH 5FUCC 1M6OA 4XP1H 3HBZA 1AGCA 1KY7A 5EA0H 1QBMH 5E5MA 3CE1A 1WLHA 2DI9A 2FYYB 4X5RA 4UOQA 3L4ZA 5JHDE 4AQ8A 3LXUX 3WNNA 3N91A 2D03H 1T83C 4GKLA 4KFZC 3N55A 4OJFH 1I3RB 1ZSHA 1T2JA 2J5WA 1OF2B 4ZQKA 3P4LA 3LKNB 2VMJA 4AH2A 2FLBT 4KQ0A 3BGFC 4DWHA 4ACTA 1N0LB 4GXVH 2DJUA 2XKUA 5ICZB 2ZJSH 3QQ3B 1IC5H 4JRXD 1NWOA 3QO1B 3I6LD 2R1YB 3AROA 3QWRD 4OZGA 3HZKB 4XAKE 3JV4B 2YAEA 1XGUA 3V7MA 4GH7B 4FKKA 4KNUA 5KSAD 1WSST 4R3SB 3ZMRA 1FL5A 2EXWC 4JGUA 4M4RA 2P5ED 2WQVA 4FQ1H 3FT4B 1YJDH 3H6JA 4FC3E 3B8YA 1CZ8L 1JV2A 3W9EA 1A6WL 2CKNA 2DQCH 4B3EA 5IEHB 2EVJA 1AE6L 3P3YA 4UOZA 4NQSB 4Q52A 1E67A 3UTTB 2XIDA 1I8MB 3US0A 1KELL 4WO0A 3NSXA 3FQUA 4EZJA 1F41A 1WFJA 3HLAA 1OP5K 5FB8B 1QNZH 5F7LB 2AJSH 3SE9L 4QLWA 5ICYB 4QRPD 1UWGL 3VFMA 1IKOP 1B0WA 3BAWA 4W9IC 4GKSB 2FQDA 1CPUA 1UQSA 4F57L 1NCNA 3CZKA 1JGUL 1E6OL 2ZP0T 3CFJB 1G0XA 4TSBL 1VZGA 2IVFC 5D2LB 2JV6A 4Z7VE 3PFQA 3ZE2E 4N6QA 4NO2B 2GY7B 3NA4A 5F1OB 1LD9A 1GHFL 1OQXA 4LF3B 1Q38A 1BOYA 4HKBA 3LDBB 1M1XB 1JK9A 5IGXH 3UTSA 1T5WB 5C0RH 5D2NE 4XBMA 2CK0H 3CLEH 4WKXA 1HSAA 3BZFB 2WCGA 3QZLA 4V1DD 4R4FL 2R23B 1KGWA 1YEWA 1F1AA 1QTPA 1CDIA 3KL5A 2XG4B 3EYFB 2LFGA 3VI3E 4NC2B 4FQCL 2CIIB 3IDYC 5E2WL 3TYGH 4YE4H 1NC4A 2YGPA 5I2IA 1O7SA 2XV0A 3L9EA 1E3FA 4I9WD 1U4FA 3VSVA 3ASNB 4L1HA 1RHHB 1A6VL 1IAII 3NVQA 5KS9A 5HYSG 1U3JA 1TJIL 1OP3K 3FFDB 4U1NA 5DD6A 2NY6C 4AX3A 2O5XL 4ZQTA 1UG9A 1ACYH 4UILH 3DOIA 3K74B 4WI5A 5BW7C 1YEFL 4F37K 1NCOA 3PG2A 1NOFA 1R6VA 1HCZA 4OF5A 4KY1H 1MH5B 3UTQA 2AZUA 5HJBA 5AL8A 4JJHA 1XH2A 3ARDA 2VZVA 5DO2C 4PB0L 5GS0D 4IRSA 2HT4C 4QRRD 3SJVD 3UH8A 4JNXA 3TO4A 1QOKA 2OMWB 2VDLH 3FJTA 3ZTDC 4S1SH 3WYRA 5HJ3A 4AYSA 4R7XA 4NZJA 1U93B 2CO6B 2HVBA 4QRSA 2ADYA 1WWCA 2NOYA 3BAEL 2AK4E 4P9HL 5MEPB 5D9SA 3WLBB 4XMXA 3N1PC 3KWXA 4XNMA 5HHME 5TD4A 4BWWA 1LMKA 2VLRD 3RHWF 2X4TA 4BSVA 3QORA 4HA1A 3LH9A 4EDXB 5I1EL 1WIUA 1R3HA 3L9RA 4HWBA 1CFNA 3UTSE 3CXDH 2Z4QA 5CO1A 1QW9A 4P5MA 4JFEA 3FQYA 4KTDH 5BW7A 2QVKA 3EJRA 1I9IL 3LB6D 5ERWB 1CGUA 3HUJA 3VFRB 1S7XB 5D93B 3HI1B 5FYJU 3NZSA 1UM6H 3HNTH 1I7TB 4YDJB 1RUMH 3ARDC 1A7RH 3JTBA 4F3FA 1T04B 1JPFA 4N2AA 1GGTA 5KBKA 1KPUA 3R7QA 4JPVH 4WNSA 1NGXA 2WLZA 3OAUH 4Y7OC 5T8IA 3C5ZB 4ENED 4PTTA 3FTWA 4MZIA 5JA8B 1DJWA 2ARWA 3FU9A 2NY7H 3SDCD 4MVBC 1S5IH 1R0AH 2BIHA 2R9HD 2DLFL 2Z35B 4GS7C 5C0GB 4XAWL 1KIRB 3VSTA 1RZ7L 2CO2A 2GJ6D 1LE5B 1X5LA 2ALWA 3FQNA 4ZS6D 3ILPB 2UXTA 2VXSL 6TAAA 1OGAD 2B1AH 3FCGA 4K3DH 1ZSDA 4IIQB 3QJZA 4PJXA 1XFPA 1SXBA 2X4PB 4BA0A 4LLYB 3I9AA 2LAAA 1F90L 5B1JA 5C1MB 2XLLA 3D69B 2VQ1B 3LEVL 2ERJB 3PQYE 4ZT1A 1QI3A 2XRAH 1HXKA 5MENE 3DBXB 3DX2A 4GW4A 1S7WA 3TT1L 5I5JA 1JD9A 3G6AB 1JI2A 3IDUA 4EIBA 2WLYA 3NCFB 3NFSH 4RWYL 1SXZA 1U92B 2V2TB 5T1DH 1Z1WA 3D2UA 5EEVA 3OLEA 1AGFA 3DXAA 1YG9A 3MV7B 4XMPL 4XMKH 3L16A 3R0NA 1EHLH 2FX8H 4A7VA 3WMQA 4R0LB 2EDLA 2OCJA 3GUTA 2DQFB 1QNIA 2I5YH 2VLKE 4XP1L 3MTXA 3OMIB 4QGTA 5DHVA 3U6RA 2CA4A 1MHPL 3ME0A 5IMOB 1OLLA 3KPOB 1XIWB 4MYPA 4KJQD 3BUDA 1JNHA 5EEUA 3EYOB 3CSTA 4ZK8A 3HC2A 4OLYL 3SGKC 2VDOH 5DDHB 1Z9NA 1KGJA 4KJWC 1MFAL 1CYGA 3PIQB 1ZAGA 1NEZG 4LSTL 2Y3AA 5F7MC 32C2A 5F93C 1UXMA 5IB4A 1V7NH 4PP2A 1IAIH 4NO3A 4XCNB 1LJMA 3SE8H 4IOFD 3VI3B 4XCEB 5H94B 3VX1A 3GBNH 5J6HA 4RRPG 4FNUA 2ZCHL 2EDJA 4R9HA 3REWA 1SF3A 2WO2B 3IE4A 2F1EA 4POZC 1EIBA 4J27A 1EHAA 4L8SC 1G7IA 3RYMA 3W82A 4F9PC 4KNQA 4X5PA 2VMEA 1BD2D 2R0KH 3L1FA 4XXCC 5DD1H 5I1CH 3RP1A 1ND0B 4LEXL 1RUQH 1BLNB 1INEL 2QVTA 2XA3A 4YDZA 2IH8A 1EZSA 3QG7L 3RVUC 3VXSD 1KLFB 1S6NA 4KJPC 4IMLA 4JM2B 2X3BA 4FLOA 1KELH 3VXPA 4TUKL 3K6SB 1G6RB 1CJYA 3BAYA 2DMBA 2ENPA 3EDEA 1BZ7B 2KZWA 3NJVA 3S88H 4G7QB 4Q14A 4EI5A 3EBHA 4O2FB 3NPSB 4H7VA 5C7XL 1BGXL 4A2GA 1RFDH 3F65A 1NFIA 5DD0L 3NDYE 5GJTH 2AK4B 3IJHB 5DVNA 4N87A 2DM2A 5MERB 1GRWA 4IRSC 1MCDA 3CHQA 6PAZA 5HHMB 4PWJA 4KRLB 2VDOL 3WXWL 3QC6X 3FYEB 3WU1A 2CHDA 5AKRA 2FCBA 3PHQA 1HNFA 5BV7C 2M8XA 2R4SH 4K55A 1INQA 3F6JA 1CFSB 3FPXA 4WFEE 2O6PA 5BRPA 2VJXA 1NANH 4GQZA 4LO9A 3G6DH 4KZDH 2MTAA 3A6BL 3K4ZA 2X09A 5D7JC 4IRZH 4OLUL 3MJ9H 3MKGA 1QKZH 1TKWA 2BCKB 3OMZA 4Z7QB 5I8CB 1BEYH 3RDTC 5GRXG 2NNCA 5C2UB 4UQ3A 5JHBA 4OFKA 5DEFB 5BV7B 2GTZA 2IAAC 5F1NA 4M8QA 3QUXD 4BBWA 1H19A 2QHRH 4F15B 4N3UA 4B9PA 2GQHA 3QFJA 2L7QA 4KKBC 2F18A 5JW3L 3DX7A 5G4MA 4KRPC 3CSYA 3RY6A 3CDFA 3NA9H 5D1QC 4KTEH 3Q6FA 4KH2A 2BFVH 2Z93B 3BP5B 3QHFL 3T3PE 1RIUL 5DJYA 2NZ9C 4PW3A 4WK4B 3PAUA 5D7SL 1KLUA 3W81A 3ZDYB 1F11B 3P1VA 3CDGB 2ZOUA 2Q8AH 2VL4A 1BG1A 2I32A 1HWGB 4FL4B 5ANME 3GSQB 4PBDA 1RJZB 1FNEB 1URIA 3RDJA 5HGGS 2WJ7A 1S7TB 4KJYB 3ZVVA 4L4VA 2CZNA 5MEND 1QHPA 1EZVX 1FWXA 4HUNB 2C4FT 1NCBH 3ZSTA 2FJGA 4JR9H 3F5WA 3QNYA 3QVAA 4Y2LA 2IIJA 2IALA 3WLBA 1EO5A 3FTXA 3IRCA 4Q6YA 4GI6A 4FMFA 2OYPA 1BM7A 5EBMA 3AQXA 4JDZA 2P8PB 4QHKI 3SD2A 1JWSA 4YSRA 5FLVA 1QKZL 3EYQC 4EI6A 3IAPA 4N2MA 4L3CA 4ZFOL 5J1AB 2BP3A 5KWYC 3S5LA 4MNQD 1MHHA 3RDTB 4OD2A 4F5CA 2BDNH 3DV6B 4WUUD 4MNHB 1K5NA 1IKNA 5BVPL 4JDTH 1S7XA 3JWNG 3MRHA 1DLHB 5TJWK 3DI2B 4HIJA 3DDGA 2BSED 3N85L 3OAUL 4ODUA 3FB8B 3M88A 2OMTA 3UBXG 4CC4C 5DEGA 2IXQB 1YRKA 4XPHH 3K6OA 4M43H 4PIRF 4JFXB 4KTEL 3BPCA 1AR1B 1HAUA 1IBHA 2D2CC 3US1A 3AT0A 1T3FA 2A83B 2AJSL 2F53E 3N3EA 2WZPD 4AYMC 1ULVA 3HE6C 2CIKB 4Y1TA 1DVYA 3K8MA 1DBMH 3DX3A 1H8NA 3I02A 5LO7A 3AFLA 1RMFH 5ETUA 3VQ1C 2VXUL 5HD8D 4NQCB 1AXTH 3SQOH 1IGIL 2XKSA 3QG6A 1X9LA 3A67H 1DN0B 4KH9A 4G8EA 4XMKL 4ZUSB 3GBML 3S3PA 2COQA 5B8CC 1W0VB 1VDGA 1U8MB 3JQOB 1LE5A 1N5AB 1HESA 4X8CA 5LBVA 2CAKA 3FO1A 5E8DH 4PD4K 5DD3L 3MV7D 2OS7A 3V4PL 3QJOA 3N2JA 3VDCA 1TTBA 5FO7B 1KJVA 4PS4H 3K71A 1L5GA 1G84A 2OZ4H 2CGZA 1C08A 3WE1A 1JCVA 5CZKA 3BDYH 4FLRA 4HIIB 2ZXGA 4U3XA 1JNJA 4GW4B 2XN9D 5J1SC 4PB0H 4MQXC 1PKOA 2ZONA 3ZO9A 3QNXB 2V2TA 1R3LB 5L6YH 1E6JL 4E36A 2QQKH 3KGSA 4X9GA 3WEBA 4F20A 1HXMB 4FQPA 4YQXL 4N6RB 1MZZA 5KAQF 1F4AA 1P69B 3KPLA 1X7SA 4OLYH 1F6AB 1HL8A 3FH8A 4Y5VB 3X1NA 3PLYA 3GNMH 2MQ3A 4ZUWB 4JFDE 3BQUC 1U30A 1OCOB 4FNPA 4JFQA 1FL3A 4N25A 5FWQA 4PGJA 4JY5L 1JIBA 4IK7A 3F7VA 5ACMA 4AM0Q 1LEKA 4YNYA 2V2XB 4P05A 5D2LF 1N3NA 3U7YL 3CZLA 3S34H 1LHZA 3MGTA 3S4SG 4TSCH 4JO2L 5D1XC 4M5SA 5IB1B 2EDEA 3KVPA 2Z0UA 3CXHK 4MXVF 4AY0A 2XN1A 5H94A 1DHKA 1QW8A 1BMGA 5TE4L 3CGTA 3REWB 4WGWB 3QRGH 1I8KB 2XETA 2LHAA 4A1RA 1CVSC 4L0PB 3NIFF 1QTSA 2P43B 1TETL 1BXAA 4LLMA 3LQAC 3WTYA 2CQVA 3RWHB 3BDYL 2OSXA 5DJZB 4P07A 5T1KA 3TJHD 3IMWA 3SYQA 1A1OA 4BDVA 4YSEA 2YSSB 4UOJA 1GYUA 3LZFL 5KSBA 1U0QA 1UJ3A 4UQ9A 5K39B 1T03H 4KVPA 1YNLL 3D5OF 2P7TA 1A0QL 2CG9X 3IDNA 4MWFB 5C0AE 5IBTH 2XQYK 1JWUB 1T4WA 1KJ2B 2KQNA 4AEIL 5GIRA 3D0LB 3O3BB 4D9QD 2DYPB 2WWMC 5EUKB 1HINL 3AG1B 5LXGH 2IV9A 3SE4C 1S5IL 4Q9CA 1Y1UA 4MFHA 2YD5A 3O4LA 2HXAA 1PCSA 4G9FE 2CALA 2CHZA 3DUSB 5D1QB 2SODB 4DPAX 4FADA 3KS0H 4FQLL 1F3RB 1VIWA 1HILA 1D6VL 2FH6A 2QKSA