3VSQA

Crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2 e236r mutant in the presence of ethanol
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
199
structure length
197
Chain Sequence
QRYVRKDGKCNVHHGNVKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVRASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G protein-activated inward rectifier potassium channel 2
publication title Coupling of G Protein Binding to Channel Gating in Mammalian Inward Rectifier K+ channels
rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 41
structure length 197
sequence length 199
ec nomenclature
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3vsqA00
2WLIB 4KFMA 3AUWB 1N9PA 2WLNA 3SYCA 3SPHA 2X6BA 1U4EA 3AGWA 3AT9A 3SYQA 2WLJA 3SYPA 2X6AA 2E4FA 3SYAA 3ATEA 3ZRSA 3SYOA 5KUKA 3SPIA 3ATAA 3ATFA 3VSQA 1U4FA 3K6NA 2WLLA 2X6CA 5KUMA 3SPJA 3ATDA 1XL4A 2QKSA 2WLIA 3SPCA 3SPGA 1P7BA 2WLMA 3ATBA 4LP8A 2WLLB 3AT8A 1XL6A 2GIXA 3JYCA 2WLHA 2WLKA
chains in the Genus database with same CATH superfamily
4NOFA 4MS8D 2FD6H 4MA1C 1YEKL 1T5XA 2BSBA 4FQQB 4BH7B 5AD0A 1AR1D 5BS0A 4Y88A 2DH3A 1DSFH 5ISZD 2DD8L 3MBWA 4QTIL 5A43C 1R17A 2D7MA 5E70A 2VRQA 3JV6A 1I7RB 3PHQB 5IMKB 2M83A 3THML 4TS6A 1Z3RA 3K2IA 1SDYA 3QUZC 3GO1L 4JN1L 5CD5C 3SE3C 1DL7L 2JTDA 1DBJL 1U93B 2YKKA 2ZUQB 1QACA 3VXTA 5I17A 3MRIA 4DN4H 4OZ4A 4UT6A 2E5EA 4APQB 4Y19B 3CQPA 3WKML 4W4OA 4G11A 1MSPA 2CKBL 4BWWA 2X4NB 4KHTH 4RMQA 2F1BA 1TCMA 4FLQA 4OTXL 2PABA 1CD8A 1JSYA 1GW6A 1P1ZB 1XGPB 2DMBA 1JP5A 3K91A 5KSBF 4ANWA 2WJ5A 4EPSA 3NCYP 1QZ1A 5LUMA 3BYYA 3KYNB 4JG1H 2O5XL 1XD1A 5BZDA 4FABH 3FH8A 3WDHA 4L37B 2A73B 2NY6C 2RGSA 5AOIA 3VGHA 3GRWL 4XNQA 3RPIA 1OTSC 3B37A 3EDDA 4P2OD 1BLIA 3CIAA 4NGHL 3BKCL 4KKPA 2ZOLA 3I75A 3AREA 3CDGA 5DMYA 1HL4A 3DIVA 4FNTA 1DQJA 4GRWE 1T3FB 3MACL 3FCTB 2JMRA 2ORBL 1DQIA 1SEBA 1UEMA 4JREC 4BHUA 1CD1A 3FUKA 3T6WA 5IESH 1NPUA 3K71A 4A2FA 5JLZA 4CSTA 4AEIL 3FYIB 2VDML 3T2NL 4PP2B 5J7CC 3DBXB 3HG1B 5I15H 4TOYH 2Y7NA 4HBCL 2BCKB 3T4AC 1ZVHA 2FEDC 4X6FA 1GY2A 4AY0A 2O30A 5AKRA 2WWKO 1MG3C 4LARH 1L6ZA 5DHVA 4PG2A 1SJEB 3CVIH 4ZOCA 4ZAKB 2WZAA 1U3HB 1JE6A 5CBEB 1C7SA 2VQ4A 1RVFH 3TH3T 4RFOH 3NSCA 3ARZA 3C6LB 4F37K 1P4BL 4TULH 4Z1PA 4YXHH 1FZKB 2ZF8A 4L3EE 3NCCB 5F97E 1MREL 1QP1A 5FCUH 5BVJB 3CSYA 3PXHA 5HHOB 5IMLB 2F2HA 4BFFA 3QDJB 4S2SB 4JCMA 3TO4B 4JE4B 2A7BA 4NZJA 3O6KL 4UB0L 1IGFL 2OMUA 1ZGLB 3LRSB 3QXDB 3OKEA 4LCCA 1AH1A 1YEJL 2J1ZA 3PQYD 3D69B 2BVOB 1RU9H 3G5XA 2D0HA 3T77A 2ZX9A 1JWUB 3LKSB 4M5YL 4KRPD 2N7BA 2R56H 3EOTH 4KVNL 4G6JH 4G72B 5EMYA 3PV7A 3QGVA 3RWIB 2EDEA 1J9RA 5HPMA 3ISWA 5HI5D 3QEUA 1IGCH 3DYMA 3LCYA 3WD5H 4TNEA 4WUKL 4Y5VB 3KYOA 2R69L 3CN1A 3EOBB 4GKSB 4L8SA 2B4CC 4PGDA 1RHHA 4Y1SA 3VD3A 5JHDB 3D9AL 3ZTNL 2DBLL 4Q4EA 1SQMA 3FFOA 4N0FA 5C0GB 1KSRA 3FONB 1U8CB 3RVXC 1WTGT 4H0GA 2DV6A 4XI5C 1JWSB 3F58H 1HL5A 1TJGL 4MMZA 4XC3L 2XN9E 2BS8A 4LAQH 2P47B 3BGFB 4Y5YA 4DN3H 5CN1A 5AUMA 2MMXA 1Z9OA 2BSTB 1KGXA 2G9HA 3MRKB 3GMNB 5I1IH 1GYVA 2YAFA 3V7MA 2V33A 2EC9T 2YPKA 2EIZB 3GBEA 5DMIH 1FLTX 1QYGL 1HKLL 2HKFL 1SJVA 4WWKA 5SWSB 1S7VA 2AVFA 4N85A 4GMTH 3CCHA 1RLWA 2X2IA 5C08A 1A6UH 4PJDA 2W5PA 1K6QL 3LTVA 4G8GE 1TZIA 2NY1D 3GM0A 1HXYA 1CLOH 3BJLA 4LLAA 5C6PB 4KQ3L 1LEGA 1MLBA 1MH5A 1XAKA 4UQ2A 3HHRB 4WIQA 3TYFB 3NK3A 3QIUB 2BRRH 4NC2B 4TQPA 3MRLB 4Y4FC 4PVLA 5GS2H 1T1XB 4LPXA 3FQTB 3Q6GL 4WI2A 2G30A 2OMVA 4I3SH 2ZJSL 3UYRL 4BGDA 1ND0B 2MQGA 4JQVC 4UDUB 1DQTA 1JGEB 2XFXB 2CGYA 5DJ2B 2NY4B 2IDQA 2F7QA 2OMNA 1FNEB 4M7JL 2WVSA 4X6EA 2DWEA 5DJXB 1B2WL 1KCBA 5CP7A 3ZDWA 3GQFA 3HC0A 3BUBA 3BVWA 5FB8A 2G9KA 4HU2A 3QUZA 4AIEA 1P7QA 1J8RA 5ICZB 2V7HB 3VACA 2BIMA 3UL4A 4X6CF 1U3YA 5IHLB 1KC5H 2W0LA 3ULUH 2HVKB 3L1EA 3ATFA 2WQRA 2W9DL 5ENWA 4PCTA 3A4DA 4JFHD 3IDJA 4KKAC 4PW4A 1FYHB 4YO0B 3WEOA 2R0LL 4JY5H 1VADB 3IAPA 1W0VB 3EHBC 3IU4L 1UM6L 1U6AH 1P5UA 1HH6B 2KPNA 4P2YA 1I1AB 2PKDA 3N1MC 4U2ZA 3S7GA 4Y89A 3TBCA 5DVPA 1CG9B 4LIQE 1A7RL 3K8KA 1E4KC 3AU0A 5CILH 3MRQB 1AZVA 1PS3A 5F89A 2JNZA 5T5FL 1T22A 3WV0A 3WNPA 3B34A 1BDYA 1MCOL 2BLFA 1QHPA 3BWSA 2Y7MA 1ZLVK 3BCFA 3LB6D 2YN3A 4G6KL 1HT6A 4J6RL 4O9HL 1O5DT 1LGVA 3TM6A 2DLHA 3KCPA 4RDQF 4NSKA 1ZWIB 4GRWH 1U3JA 3O2DA 3CBJB 3NIGB 2ICCA 2VXTL 3KHOA 3PHSA 4X7SL 4XMZA 2YBRB 3HG3A 5C07A 1UEYA 3MUY1 1MWAH 4FCAA 3QQDA 4V11A 4Z7VA 3B56A 1AC0A 1N6QL 4NAJA 3MRHA 4X6DA 1RIHL 5KVMC 3IFOA 1JF5A 5I2IA 1TG8A 2OYMA 2C8NA 2ATPB 4MJHA 1K5NA 1NGYB 4JG9A 3WUZA 1JPTH 4FA8A 1OZTG 4G71B 5B4MC 5GRVL 3VVWA 3DMMA 4M4RB 3VXSD 5A2AA 1N64L 3FN3A 4QHMA 3G08A 4F8PA 5TK4A 2HVBA 4JFDD 1ZT7B 3QSKB 4URTB 3VSTA 5SWQB 2EXYD 5BO0D 3O3DB 1UCTA 1EGJA 4A6YB 1XCWA 2BY2A 2APBA 1TSRA 1RAMA 5EUKA 1RJCA 4HLZG 3G5ZA 4I18C 2OJEA 4UQCA 3VI4E 4UQ3B 1J86A 4XPGL 4PJFE 4X5WB 1D5MB 3EO0A 2NUPB 4G6MH 5I18L 3NZHH 1FHNA 3NDZE 1LWJA 4NZTL 1RZKL 3PP3H 3RHWK 2UYLA 1NANH 1G9MH 5I6NA 2YIHA 5FKAA 1GJUA 5IVZB 4PYHA 4ADJA 1KIRA 5ABAA 1U8OB 3NJKA 4OSUH 1KJ2A 4YHNB 1EHXA 1BYOA 4EUPG 1SXBA 2NSXA 4UIKL 3ARGD 4ZUTA 1FLRH 3WUWB 2UXVA 4I88A 1OL0A 2Q20A 3I9PA 3DX1A 3DYPA 3L3OB 1INEL 3MYJA 4WU5B 2IG2H 3N40P 2AHIA 4NWUL 4L3CB 5IHHA 5IMMB 3H6JA 1IRAY 1YEFL 3ARDA 2AKRA 1PSKL 4IOSD 1A4JA 2IDTA 2GJ6A 3CXDL 3DUHA 2BSRB 3O6FB 4PS4L 5AAWC 5I1HH 1K8IA 3U2JA 4FQCL 5HVHB 1KY7A 3DGGB 1UB6A 4U33A 1F58H 4XMKL 1CO1A 1C16A 4C4BA 4MDRA 1W8NA 4UZUA 4OGXL 3FUFA 4FP8L 1I9RL 5JTWA 1QPKA 5EU4A 4B5ZA 3DX9A 2DICA 3D7PA 3ZHLA 4AJYV 4UQBA 1BW8A 3FT2A 2ZF9A 4FQ1H 1IM3A 3L9YA 4E9LA 4UT9H 3P4NA 3HAEB 4XAKE 2N56A 1F2QA 5CXPA 4QXUL 1CU4H 1GS7A 2CHXA 2X1PA 2ZUQC 1BYPA 2Z7ZA 3VD2A 2XIDA 3IN0A 5J12C 3CG8A 4PS3A 3E9UA 1G6RA 2NY5C 2PW2B 3MV9A 2EXWC 4FQXB 3TIDB 3LIUA 2YWYA 4FFYA 4NO0B 3BVNA 4S1DD 3UROR 2OSXA 3EBHA 4XNYH 1UA6L 3O41B 3P73B 5DJ6A 4BA0A 3MREA 3REWA 5B38A 5EEZA 5KSVB 3NFNB 1WFMA 3QAZB 2BM3A 1WC7A 5GIRA 1F3JA 2EE9A 1JHLH 2DQDL 3BHBA 3D3VD 3JTBA 2W60A 4UTAL 5E2UH 4B9JA 4KJYA 3FTVA 1MFCL 3NIGF 4XO3A 2IFGA 3PWNB 2W94A 3CFJB 3K8MA 5FK9A 5FUOL 5C0BB 3JVGC 5E08L 2ZT9C 4KKCD 5KBPA 2LU4A 2XNAB 3E2HB 4IOFC 4WI0B 3SPVB 1AO7D 1NFIB 3EFDH 3TONA 1KXQA 5EF1A 4YLCA 3DX7B 1DVQA 4JHAL 3IN2A 4WEBL 2JIXD 3K6SA 4N5UA 3CU7A 4WNQA 1FAIL 3TNNA 2NZ1A 1H6UA 1EDQA 2X87A 4RETB 3L5XH 4PS8A 3FN9A 1V7MH 3BAKA 4NC1E 1U3HC 1F1GA 5AYUH 2KYIA 4LIQH 3TBTB 3B9VA 5KBNC 1T04B 4EIBA 5JW3L 4JKMA 2I9TB 1HNYA 3WIHH 5LGJB 2DM7A 4NKIL 1T80A 3QDMD 4RX4D 4U4IA 5DJYB 3S88H 4GBXB 3BQUA 3PGFL 4MWFA 5F0PB 2FQGA 2VLLA 4Y8AA 4I2XA 3WIIH 5JOFB 1KENH 1RURL 4PJIE 5I0ZA 3CNKA 4Z8FL 1MELA 2DW5A 4FQ2H 4OM1H 4AUJA 3V0AC 2YUVA 3TO4C 1TTBA 2AQNA 2H1PH 4ETYA 3L45A 4QRPD 3TBWA 5I1GL 4K3DH 5F7HA 2X2JA 3HZMB 3PWPB 3QZWB 1QSZA 3PGDA 2BS9A 2P5EA 1TEFA 2QZQA 2JCCE 2XXGA 3ZJAA 2EADA 4JPIB 1U8QB 1G0DA 4Z95L 1LO4H 4ODTH 3VFOA 3C8KB 3DVGA 1KTJA 4MJIB 2L0DA 2E9JA 4QCIA 1LHZA 4TXVB 3SKNB 2DQEH 5JQ6H 4BFKA 4Y5VC 3FFCE 1EEQA 4JQIA 2OTWB 1MQKL 4NRXA 3UO8B 1HSBB 2P48B 4NQEE 1EAPB 2VZUA 4JDEB 2Z7UA 1N5AA 5DHMC 1AR1B 1YJDC 4F24A 1S9WA 5TE7L 3VG9B 4U0RC 4AUYA 2BZDA 4MYPA 4XBEL 3L4CA 2UX6A 5DLMH 4IKIA 2FIKA 4WEMB 5B21A 3ME0B 3SJVD 2EQDA 4O2CB 3B1TA 2OL3H 2ARJQ 2AITA 3D39A 5DD1L 2VQUA 5HYJE 1JHTA 5JA9A 4C83B 4G7SB 1DQQB 4KZDH 1FGVH 1VACA 1YEWA 1Z9MA 4KNSA 4YDVA 1LP9A 1QLEL 2R23A 1NKGA 2D7TL 4P23A 1PZBA 32C2B 4QY8B 4O02H 1Y6MR 4MB4A 2CR3A 3FQNA 3DRTB 5C2BH 3ABMB 2F7PA 4ZJ9A 3SKJL 2PCXA 3V10A 5GS0D 1BAGA 3FQXB 4A37A 2XWDA 4X9HA 1HILA 4RZCB 5EORH 4UNVA 1AOZA 4FF9A 1JFQL 2EKSB 4OZIA 3QIUC 5KVDL 4P2OB 4BELD 4XPHH 5CD3A 2DEWX 4HC1H 1OE3A 2WSPA 1NWOA 3VH8B 1JZEA 1KBWA 3IU3A 1KXHA 4CVWA 5HJ3B 4UT6L 2XWZA 2E7LA 4JN2B 4D0BA 5JW5B 4WGVB 3W5MA 1AD9B 4MQ7A 1WZ1H 3UTZB 4ABQA 5B3JF 2K7PA 1EO8H 4Q2ZB 3RTQD 3W9EB 4MZ3A 1EERB 2EIKB 5JO5B 3VFMA 5FFLA 3PJSA 4KRLB 1A25A 4WTZA 1EHLL 4N9GB 3AMLA 5IVNA 2HMIC 2X9ZA 2NY4C 1X7SA 1EV2E 2H32A 1B90A 1S7WA 3QDAA 4LO9A 1UJ3B 5AG8A 1LDPH 3ZE1B 3QDHA 3CFBA 2XXCB 3QR0A 4C56A 3WU1A 3EF4A 4AQ1A 4N86A 1VRSA 1HDMB 3KGTA 3KLLA 1D5BA 4HSQA 2XI9A 1TNMA 4FQLH 5LHDA 4M48L 4XMXA 4G5ZL 4Z7QE 1YMHB 1NCWL 1RZFH 1FUNA 4QJ3B 4X6BA 1EJ6A 3P4LA 2VDKB 4GLRI 4X99A 3JQOB 4ICXA 5A6LA 3O9WB 2ZE0A 2F58H 1ZMYA 1LD9B 2BC4A 4C4KT 1BPLB 1VZIA 2BSCA 3Q5YA 5D1QD 3QG6B 4MKTA 2BW5A 1SHMA 4A7GA 1LO3H 5ERWB 1HX0A 1X7QA 2VN4A 2XTJE 4M29A 5E1HB 7CGTA 3EJZC 5BOJA 1I1AC 4OT1L 5DJDA 2NOYA 4OZFA 3PQYB 4LAJH 1FFRA 1QSEE 3W56A 4BKTC 4KRPB 1OTUD 1CYGA 4QGYA 3QXUA 4NPYB 1T7ZA 4B7IA 2OCCB 3ESPA 3GLDA 3DC0A 4XH2B 1DDHB 1J5DA 1QRKA 3HVNA 4PRDB 2YLHA 4ZXBC 3S8GB 2HT2D 1HQ4A 43C9B 5I73C 4WFFD 5M94B 1OWRM 3FFDB 3PWVB 5K39B 5HTSA 4YJZL 2B1AH 3KPSA 5A3ID 4UM9A 1TQBC 3EFOB 4NKOB 5ADPL 2IWFA 4HKZA 4WI8A 1XSOA 4YQXH 2ZKHH 3FO1B 1WZKA 4MMYA 4HUXB 2B59B 2R0KL 4UYQA 3SE9H 1PEZA 1J5CA 1VF5C 4EZJA 4TNFA 3GKWH 5MEPA 2R2EB 1XF5B 4XMPL 1K4CA 4O5LL 2Q76B 3L4UA 4DGYL 3LH2L 3QA3B 2Q86B 5FKPB 2BP0B 2CK2A 4GO9A 1U95B 2YK1L 3VRJA 2MRYA 4Y8DC 1R6VA 3G04B 3N6YA 1CDJA 4WENB 5JMRA 3QS3A 4DPRA 3FT1A 1KCRH 3MJ7B 4OU3A 4WJ5B 1A4AA 3JTTA 2IALA 3KE0A 2XETA 3GPEA 3IDXL 2NY1B 2BP5M 3SY0A 4ESKA 3AC0A 5DYOA 2VZSA 4HALA 2FQFA 1D6VH 3FN0L 4OUOA 3RDTC 43CAB 1I7ZB 4HOMA 1FYTE 1EJOH 1JYXA 5DHYB 4ZTOH 3SDCD 1NAMA 3I3BA 1YEHH 3AU1B 5EN2A 3LZFH 4HIEA 5DJ8A 1OB1B 4QUOA 4P4KD 3TN0D 5C9JB 5T3ZH 1OAQL 2NNRA 2YUXA 4GXUM 2BSED 2RD0A 3RL1A 1DVFC 1CL7L 3OSVA 2QJDA 3CDFA 1I3VA 1CBJA 5DRXA 2QELA 2WAQA 5DFVC 3BLBA 5DR5L 1NBVH 1ZRUA 3LEVH 2HJLB 3EYVA 4N28A 1BBJA 4X5XB 4X5RA 4DFHA 1AANA 1M05A 3SB3A 3V0GA 2VDNL 4NNPH 1HNGA 2VABB 2FIRT 2IDCA 3OWRA 2BY1A 2ZYSA 4HQQH 5FV1L 5C0CA 1RI8A 4O2EB 5HVHC 2ITCB 2ICWB 1G4MA 4PGCB 3BUYB 4G9DB 3KPTA 1C5DB 4GT7A 3ZE1F 4JPQA 3VXTB 3K72B 2EH8L 4NQSA 5T3XE 5KYWB 4OV5B 1OAXH 3LYRA 2GJZB 5DHEA 3AGVA 5LB1A 3U0TA 1FI8C 2NPLX 4OAWB 1CGYA 1I1CA 5DWPA 2XCMC 5F1IB 2AEPH 2WMPB 4BDVA 2VSCA 5KZCD 3BKJH 5CZVH 1ZSHA 2PR9A 2AJUH 3L3HA 1U0QA 3TVMA 1DVTA 3EYFA 4HLZH 3HNVL 4XBMA 3A4FA 5CEXB 2O6EA 4YE0A 4DERA 4MAYC 5DD6B 1UASA 1WFIA 3S5LB 4K71B 3NCJH 4WW1A 4QYAA 3QQ4A 3X3GH 3GMPA 4ZUUB 1QNZL 1CLYH 3HPJB 3IM1A 4FQXC 1C12A 4JLRA 2B39A 1XT5A 3WG7B 3HHSA 3QWNA 5DEJA 4HKXA 4QRTB 3RWFB 4EUPH 3ABZA 4U1MA 2OJZL 4P04A 1G7QA 1OK8A 5E9AA 1X6NA 3SHSA 3EYOA 1IQWL 3N42B 1NTDA 2DOCA 2ZX5A 1IKOP 3D0VB 2DF3A 1GYWA 1ZLUK 3ZIMA 4Y2OA 2YMTA 1CE6B 4UQDA 1MRFL 3E2HC 2LU5A 3RWEB 1D3CA 2HJFA 1K2DB 1FJ1A 3W57A 5M7QA 1FIGL 1OANA 2QSCL 4J3OD 4B9IA 5LXVA 3W37A 3O2DL 1EBAA 1DUYB 4JFDB 5AB9A 2R2HB 2WHVA 4F3FB 3KYKH 4PBDA 3QNYB 2W9EH 5D1XD 3P4OA 2CR0A 3CFNA 1KV7A 3GFUA 5IFAL 1SHXA 3DVNA 4IRSD 4PWHA 2J12B 4AIOA 1OB0A 2ZZUT 4HXBL 4QOKD 2HFFB 3R8QA 1H8NA 4NWTL 4G43B 5CJOL 1NCOA 3WEMA 5LNEA 4YGAB 4HVBA 4GIOA 1BZ7A 2DWYA 2WXGA 4GBXC 1MZZA 4OJFL 4ZXBA 4F2EA 3WFEH 3DXAE 1NGZB 1KTRL 3ZRSA 1DEEB 1TLKA 3H53A 3HZKA 4JRFA 3QEUB 3T3PF 2IAND 2BFVH 2W38A 4GW5A 1BA9A 4XWOD 4I8DA 1SFDA 4QI3A 1EGJL 5GRZA 3PIQA 4L8SB 4KJQC 4NRZA 2WZ6A 2CGZA 2DS4A 3WIFB 4RBPK 1A3RL 3QH3B 1II4E 3NRPA 4WFHD 2NTSP 4JFPA 5MEQB 3KPOA 1I8AA 4L8CA 4PY8I 3J7HA 2EEDA 1SYVB 3SGEH 3A67L 3CMOL 6FABL 2HG5B 1BD2A 1F8TH 2D3NA 2FGZA 4AJWA 1SMOA 3MLUH 3BD4A 4NQDE 1EAOA 3LZOA 4MS8C 2NTFA 2Y3NA 2CK0L 2EVJA 2YPVA 1KJ2L 1TZHB 3QHZH 3RY5A 4A7VA 2B7DT 4ZMTA 1FO0A 1AR1C 2B4CL 3CH1A 1GHFH 3RPBA 3AB0B 3P11L 3VG9C 3HS9A 2Z65C 4POZD 1M1XB 2ZXEB 2PP8A 4JG0L 3SE8L 1BWWA 2KKQA 1BOGB 4FHJA 4EZKA 4ZMWA 1LMIA 4KOBA 3RDTA 3MBED 4PJCA 3MV8A 4H40A 2YC1A 3MA7B 4BEIA 1RXLA 4EIGB 1CFNB 1F4AA 1FBIL 1MY7A 4NT6B 1LXMA 3IE9A 4APXB 1I3RB 4U3XA 4UCFA 3IVKB 2X4PB 4JZOB 1CGXA 1H3PL 1U8KB 1IGJA 5E4OA 5H94A 3HS0B 3NZSA 1DVFA 1MHHB 3RU8L 3TBBA 5KN5A 5LDUA 1HE7A 2AV7A 3TJEL 1MY5A 3BPCA 3H0TB 3O6ML 4P99A 2FB4H 2CSPA 3A4EA 3MRPA 5C0EB 3Q2VA 1T89A 3QZOA 3L5WB 1TF4A 3D3VB 4Z0BH 4ECNA 1OT1A 4KPHL 4EN2A 4P2OC 4MX7B 4QYOA 5KAQF 1PL3A 4MAUL 3PPSA 1JXDA 3BKMH 4MCYA 1NZRA 4F20A 2Y7OA 3EH2A 5DC9B 5E6UB 4YWGL 2A6KB 4YDZA 1G6RL 3MNDA 1NFDA 3GSOA 3VD5A 1AO7B 1TT6A 4CC0A 2EIJB 3N85L 5IB3A 1ET7A 4FEMA 4FFYL 3EYUL 4JMXA 2ADFL 4LEOB 3N42F 4H8VA 4HFWA 3K6IA 2VTFA 3SODB 1UJ3C 1NUDA 5J89A 5DZNA 3ET9F 5FYJU 4XR8C 5GS2D 4MD5B 3ULVF 5FYLE 1JGDB 4FLSA 4FNLH 3MLXH 3TBSB 5ACLA 4JO8A 5AVWB 4WWNA 5E23A 4W6YB 3UTSE 2DYPA 1E5CA 1F6AB 1HH9B 3KW7A 3BAJA 3QDMB 2NYZA 3H54A 4DH2A 3T09A 1SPDA 3CN3A 4ZMVA 4GNKB 5FO8A 2IADB 4NM8H 1CGVA 1JVOA 1L9QA 3QI9D 4XP6H 1CB4A 3NTCL 1HNFA 3FU0A 4QRPB 3MXVL 2JK5A 4R5TA 1XR9B 2GUOA 4LLVA 1WA2X 1SRDA 1TKWA 2N3JA 1MIMH 1K4DB 4F8OA 3EYQD 1G7MB 5ALBL 4LZKA 2UXGA 3GHEH 4ODXA 4U3HA 3VU1A 4IEFA 3VQLA 1E3ZA 4JFYB 1JBJA 1X5KA 3ZDYE 3QZLA 3SE6A 2FX9L 1RIUL 1I3UA 3TZVA 3P9MA 4KZCA 1N8ZB 4AK1A 3BH8A 1IAMA 2VITA 4YE4H 5I8CB 2ZTBA 4Z7UE 3DMMB 1QSFD 3U4BH 5K9OB 3STZA 4XPAH 1GOHA 3IGUA 3G08B 1QMUA 1SJHB 3MLVH 1MCKA 3SJVB 4KJPD 3OV6A 3I9GH 1KCWA 3HG0A 2RH0A 1XHHA 1BFVL 4JB9L 3S9DB 1JGVH 1FGNL 3HZYA 4PY7A 5HDQL 1DANT 4YVNA 3WJMA 3BN9D 3G5ZB 1SXCA 3HPLA 1NL0H 3VXOA 4JQIL 1U8HA 2CLZA 1MVUA 2X4RB 4HJTA 4M62H 5J9PA 3V0VA 3RX5A 1VZHA 3TV3H 3IF1A 3LKPB 4NO5A 4P5KA 3FPXA 1GYCA 4CVXB 1QBLH 1E4XI 1CYWA 1KXTB 3HLAA 3CDYA 4PWIA 1G94A 4QTHA 4ZOBA 4ZX6A 1F4XL 4AL8C 1N67A 1ACXA 4I87A 3X1FA 2YBGA 4LPCA 4G1MA 4Q9BA 3WNIA 5KS9A 4KTEH 5HDBB 3B43A 2BZCA 4L3ED 3S48A 2DQFA 2VQ1A 4JJHA 2C1OB 3UGUA 1M2VA 4Z3EA 1FSKB 2C3VB 3O8XD 4N68A 1FZJB 4PG9A 3CFQA 3VTMA 5K9KA 1OM3L 1ASQA 4ODHH 3FQRB 5FO9A 4HHGA 2V2TA 3ZKND 2XBDA 3TNMB 1KTDB 3ARPA 4M7LH 1IX2A 4PJ9C 2GTWA 3RTQB 1GGBH 1ZE3C 3IK2A 3E8UH 4HIJA 4MCZA 2RCSL 3NIDB 4OJCA 3BO8A 2UZYA 4RISL 1QUNA 3SQBA 2D8KA 1T83A 3BXNB 3R7QA 2YOCA 4UT7H 4BKLB 3VFPA 4XVOA 3GMLB 1OVZA 3I6KA 4KC3B 2B2XL 2VYRE 4BSWA 3KJ4B 2IH3B 3O11A 5GZND 1RK7A 4IGBD 3ATBA 2Z4QA 4Z76A 4HKBA 1LE9B 5I8KL 5DK0A 1TYJA 4ICWA 2YPLE 5L9DL 4PW3A 5DYFA 4Q0XL 2OXGA 2CBOA 4GXUN 1HZHL 4ZODA 1A5FL 3MJ9A 4AKOA 5GGQL 1WIPA 4CSZA 5AWNH 4S1QL 4L1LA 4ONHB 2A9DA 5D1QB 1G84A 1LDSA 2QADD 4IRZH 3MC0A 1XSKA 3GMQA 5D2NE 3MV9B 1AZBA 5FIEA 5A2CA 3MGOA 2FATL 3HB3D 4OF3A 4L8BB 4MMXB 4XGZA 1S9YB 2F53E 5IFJB 1RV6X 2P24A 3UZEA 4NUMA 5EO9A 1S7QA 1ZGLM 2WJ7A 2WXRA 1S4IA 2WBKA 5E6ID 1IFGA 3Q1SL 1ZVNA 1KN2H 4G8GD 3L81A 3G5YA 3REVA 3E3QE 4GSUA 4M8QA 2KLRA 1QTPA 3S34L 3MU3A 3OR7B 1U33A 4Z7VF 5JW4R 1GCYA 1OF0A 2E59A 3VSUA 5EZIH 5A2FA 2K3HA 4LLYB 1G6VK 1BV8A 4LT7A 1YN6B 1WE5A 3HR5B 4JFXA 2P5WE 4P2QA 1HHHB 2BERA 3JTSB 2J1KA 3KPNB 4GAYA 1T1ZA 3BAYA 3LHAA 5I1EL 5I9QB 1EZVX 1G7PA 1R1CA 1NCIA 4K94C 3K1DA 4QHKI 1AKJA 1CFVL 1EANA 3AGWA 4Q14A 3WFHB 3WDJA 4IKKA 3DETD 3D18A 3BRDA 2NSQA 1KB5H 3CZFB 4IRJC 4JUSA 1TPXC 4GUPA 3CZEA 3FCSB 4Z3GA 4BWTA 3WKQA 1JNNL 1P4LA 3X12A 3CHPA 1Y18A 5BZXA 3L3GA 1S7TA 4DW2L 4XP4L 5DA0B 2VZVA 5B1BB 2QHRL 3O6LH 1XIWD 1RPUA 2ADJB 3DARA 3BRGC 2R39A 1R33A 2ZUWA 2WP3O 1TO5A 1CR9H 1F6FB 4GW1A 4ZTPH 1VKXB 1Q94A 2J4WH 4NHUA 1N9PA 2IBZX 2VMDA 3SDCB 5ETUA 4PJGE 4WKZA 2NQCA 1KLUA 1CTMA 2QVMA 3TN0B 1D5XB 2E46A 5DA4A 1RZGA 5B1JC 1DQML 3VFOB 3C75A 3VFSA 1F4WH 1IGMH 4W9EC 1JI2A 1D5ZB 1I1FA 2CXKA 4J1UB 1RP8A 1WA0X 2DIAA 2NT1A 5T1KA 5MEOA 2E56A 4JR9L 3ARGC 2JB5L 2NW3A 2WN3A 4JFVA 3OAWA 2ITEA 4P9HH 3S2CA 3T0EA 4EXKA 4Q6KA 4G8AC 2X2YA 1JVKA 3WBDA 3CUPB 2MHAA 1QWNA 4OUUA 2ZUUA 5DUJA 4RMVA 3L4YA 2XG4A 1NAML 4QHNB 3DRQB 4KHXH 2CUIA 3RJDA 4HUMB 4MNGE 1JPSL 4I0PD 3F84A 4LLUB 4N90D 4AMXA 4AIXA 1NPNA 4XRCA 4U2YA 5HGHA 4CSPA 4PSPA 1DBMH 3BZ4B 1OF2B 3O3AA 2WW8A 4XP5L 3LMJH 4PRIE 3GSXB 2WLIA 2B9BA 4GKNB 4XO5A 1QWHA 2Q3ZA 4XCEB 1NLDL 2HJKA 2DQIH 3HRPA 4PV9A 3D06A 4P23B 5GS1C 1YJDL 4LHUA 4JO5A 4AVJA 2WBJA 4P48A 4CVZA 3FT9A 4G70B 1HU8A 1UADC 3IXTA 3PHAA 5FYKU 3U82B 3ALWA 3DJ9A 5JHLH 5L88H 3ILPB 2B8OT 3B5TA 3MNWB 1PY4A 2DKUA 2VDPH 3AW5A 8FABA 5F6HJ 3T1FA 3LXUX 3F62A 4U6HB 4PUBH 4X4ZA 3A3YB 3H3BC 2EYRB 5MENE 1IEHA 1KGIA 1U8NA 3Q3GA 3B6SB 1AFVH 3BT2H 3HS0C 4PJ9A 1AG0A 1YMMD 4S1DC 2I5YL 1PQZB 4X9BA 4DGWC 1NIDA 4YFLF 1BZEA 2ZSWB 3BDYH 2VC2H 2AJYH 4IJ3C 2R2CA 3VGGA 1IU1A 4PW9A 1J0JA 2HB0A 1CD0A 4DCQB 2KERA 3PY9A 4H0IA 3CLEH 1AI1L 3EBIA 4LCYB 1K3IA 4PM1A 5IROA 2VDRH 1WHPA 2G5BB 3CFBB 3CK0H 1A02N 4AQ1B 5D2LE 4KMTH 5I8EB 5HYQA 1YQVH 1JOIA 4KKCC 1B6UA 1D5BB 1MI5E 5D8JL 4YHMH 1E9OA 4WCYH 3UTTE 2APVA 2OKMA 3GUTA 1CGSH 1BQHG 4Y5XC 1IC5H 2AGJH 4WK2B 2CDEB 4ATWA 2ZAGA 1DFBL 5D7LD 5C09A 1KGWA 2A6DA 1BGXL 1QA9A 1GGYA 4N2FA 4QXVA 3V6OE 3Q1EA 3Q8CA 2FR4B 5D1XB 2AAAA 1BVKA 3KDMB 4FZ8H 5CN3A 4TVPE 2BOCB 1VCAA 4WWPA 3D34A 4NQQA 1B4RA 2DMCA 4QOKB 5F9JB 1ORQB 3OKKA 4WV1C 3FMGL 3T6VA 4GIAA 4WQOA 3B9KD 1R5VB 2QVFB 3CFDB 2FJHB 5EN3A 1F11A 3VFGL 2OBGA 2C3HA 4DJMA 5GGUB 5AVZB 4HFUL 4KGJA 2IANB 2H6PB 1FZOA 2GC4C 4GXVH 4RWYL 5C92A 3MOQA 1BSIA 1Q4NX 1Y07A 5ICUA 5BJTA 3KPSB 4G9FE 3G7TA 3GEFA 5D1ZI 2OMXA 3UBXA 2L3BA 2HRPL 3D4YA 2BOLA 1KELH 1A7OL 1N10A 4EDXB 3SE4C 4EVNB 3LQAC 2XN1A 5ACZA 5EPMA 5I6XB 3QORD 3NESA 3NH7H 1E5BA 1KJVB 4NN5B 1YPZE 1A1MB 3LDBB 1YY8B 4PP1D 3LH8A 1MFEH 1A2YA 2KBGA 2R1YB 4NUPA 1GZQA 4ONGH 2MNUA 1ZVSB 1TTGA 3POHA 4M6AA 4HOXA 3PJNA 4POYA 2W65B 3WE6B 3N50A 4YUEL 1YEEH 1D7DA 2C1PB 4IRJA 3K6FA 4WUUA 4AYSA 4XX1G 2D0FA 4I77H 1Q0YH 1KGJA 2FT6A 4F33A 2X2HA 1BIHA 1LO0L 4JG5A 1QRND 2IALB 3DNKA 1T6BX 5DRZB 2WQAA 4K7PX 4HWEH 3RKDD 3MBEB 4HMEA 4LCWA 2F5AL 2G60L 1LK2B 4A04A 2HP4A 2NLJA 2VXVL 4LHQB 5D4QA 1B4JL 1XL6A 2X53A 4XCCL 4ZUVB 3V4VH 3PWJA 4TUOA 5DD5H 3O2VH 3FRUA 3L9BA 2ESVE 5B1JA 2YPVL 3MRGA 1Q72H 1FO0L 1ZT4B 2KQNA 3C2SA 2YQBA 3PU7A 4JFUA 2X70A 3DYOA 2Y1AA 4NFCA 2P8PA 5GS0C 1EK3A 3ARGA 4ZUSA 3FQUA 2NZIA 1BM3H 1EZUA 2HCZX 5EU7E 1T7WA 4OZIF 3IFLL 3KYAA 1FVDB 4OCWH 3A0OA 1JXKA 2PXYB 2XWEA 3BZDA 1FSKC 5E2TH 1XF4B 3CPUA 4TM9A 5EO0B 3PWLB 3V4PH 3RX8A 5C3LD 3LKNB 3WTSA 1GC1H 1P84K 1SVZA 4AOFA 4AZUA 5ILTH 2NXZD 3FRPB 4YHZL 4FULA 5FM5M 2CCVA 2X42A 3F6IA 3EH3B 1RHFA 3QCVH 5TGBB 3VJ6A 4Z7OE 3H42L 3BP6B 2G2RB 2AVGA 2DJUA 3GBML 1IL1B 5C0CB 4LASL 3V5HB 3F12A 3FCUB 4PLOB 4YXLL 3L3DB 1NSNH 1UXWB 4LRIA 1O7VA 3CU1A 5DRNA 5CBAB 3UAAA 2PCPB 5FO7A 3MTXA 3ZHKA 4Z7AA 5FECB 5GS1A 2AJ3A 3CAFA 2EDHA 3UH8A 1C5BL 2K4AA 1V3KA 2PO6A 5D72L 2X09A 3KWVA 3KJ4C 3MRRA 5C3IA 1AYOA 3FFCD 4J3OF 5BRZA 4PB0H 4LVNB 4QDGA 4KROD 4NQED 4BQCA 3LPFA 2GSMB 4HCRA 2XWCA 3FHEA 4I9XA 3MA9L 2C9RA 2LABA 3QXAA 4AE0A 1A7BA 5D1QC 3QI9B 3FTSA 1GAFL 3BDXA 4U31A 1IIIA 1A1OA 5AVSB 4YXKH 2OA9A 3IS0X 1VFAA 1OARH 3U7YL 4HS6A 5LCVA 2VRKA 5CEZL 4MMXC 2P4AB 5D7KE 5IW3A 4XXDA 2GVYA 4F58L 3NCBB 1HS6A 4KO6A 4U1MB 4YDIH 4BK8A 5CEYB 1ZK5A 5CIPA 1UWEL 2EZ0D 5L4JA 1P7KA 1FCGA 3EYOB 4DEPB 2HT2C 4UUJA 3WSQL 3H6AA 1BFSA 1BMGA 1HK6A 1F5WA 1UZ8A 2AMGA 2CO7B 3MJWA 4MVBD 4N87A 4QT5B 4Y2OB 5DEFA 5A3IC 3FKUS 3L08A 3TOPA 4AITA 4Y5XA 1QSFB 2FJFA 3OMZA 1KV3A 4J12A 1ZTXE 3KS0J 1G7IB 1FH2A 1P53A 4N2NA 1IEAA 3UX9B 3RFZA 4TVPH 2D4FA 1XF1A 3BZEB 3CVDA 3HUJB 5I9QC 1ZVYA 3DVNB 4WV1A 5HDOA 4R83A 4JL2A 3W1ZA 2MPVA 3MOAL 4EI5A 1MCNA 3VYPA 3DIFB 1LK3L 4HS3B 5A7BA 4ELDA 3CSTA 1DLFL 3DUUA 5I74B 1AZZC 3MRFB 3V5KA 3WFDL 4JFFA 3RIAF 4F5CA 2UX7A 3KVPA 2AXWA 2IWKA 2KZWA 1EEZB 2CLRB 2UY6B 1DBBH 3BC9A 3K8LA 4DTGH 1UHVA 1ESOA 5K59F 3ZMEA 3FSOA 2J55A 1MNUH 3IT8D 4UBDC 2NSMA 1RIVL 3SDCC 3PV6A 2Y5QA 2ENQA 2ZCLH 1QX1A 4EQ3A 4YSTA 4QWWD 1TENA 4P4KC 3SGJC 3LSOB 3SE4A 4AGOA 4HG4J 4JVWA 3TO2A 1H3WM 4CKQA 3DV4B 2OYLA 5ABDE 1VAHA 2XTJD 3IRZA 3RZWA 2X9WA 4EJ1C 3BD5A 3RWCA 4WWOA 3R0MA 1QSED 3ZPDA 3I02B 3QDGA 5DK3A 3OPZH 2D03L 2QBWA 4UQIM 1XBDA 1ANUA 3CPLB 5JORB 3QJZA 3TJPA 2CM6A 1DVYA 2EABA 2MPAL 2FYYB 4ONFH 3SDAA 1KBGL 3IJYB 4JFZH 2Q5BA 5F7EL 2IOOA 1JPFB 3JWOC 4IGBB 4C57C 5HYFA 4BZYA 3MNVB 4HJ0D 4HOWA 2J8UA 5E2VH 4QXWA 5E9DD 4KVCH 2OMZB 3PHOA 1HXMA 3TWCH 2XWJB 3WTWA 3P69A 3L7EA 2QADB 4PB9L 2HFEB 3PFQA 3O3EB 4XX1E 1QQDB 3ZDZF 2DJ4A 2QPSA 2VB5A 3L3JA 2ZNXA 1A6WH 4LSVH 5HDWA 5JHBA 2C3WA 3MODH 4GP4B 2X12A 4C47A 2WO4A 3QIBD 5DCCA 4B6ZA 3HB3B 2YRLA 2G0LA 2OM5A 1ZPUA 5BW7A 4Z78A 1BVNP 2APSA 3T2QA 3D05A 3Q06A 3UJJH 3A6BL 5F0JB 3RNQA 4J23A 2VR9A 2VT0A 3LEYH 5E6IB 2D3JA 4H8WC 3TBYB 3IDNA 4G8GB 3MJ9L 5LBSH 4XNUH 2OX5B 4YGVB 3AXIA 3K46A 1HCYA 3MUZ1 3WO4C 4G1EA 1D9KD 3GZPA 1VGEL 4FLOA 1HZLA 5IHZA 3GSOB 4ZW5A 2BFGA 4OZHA 2E7CA 4DETA 4X8GA 4JFED 1U3NA 3O0LA 1QO3A 2OMWB 5BQ7A 1TJHH 1QKZL 1SBSH 4R7LA 5EF0A 3MJ8B 1IJNA 3VX1A 4NDMA 1LTXA 3MCLH 2CA3A 5DJZA 2Z9TA 4BQ8A 5D7JC 1PYWA 1R75A 1RK1B 3CN0A 4E41D 1KTLB 3AAZA 1F18A 2DM3A 2ZUYA 3S36H 3VW3H 3TIEA 3CGTA 2X7LB 3SPGA 1QEXA 4G3YH 2FHCA 2R1WB 2OULB 1BJ1J 4J3OC 5DZAA 3D4ZA 4JO2L 4OFDA 3LKQB 5DWUL 3U2SA 3LS5H 1WVZA 5TD4A 1ACYH 3IGLA 4RDQG 1IAII 4MXQC 3HUJF 5AOKA 1YECH 4OVVA 5KSBE 1L7IH 4M6NL 5I1KH 1XIWB 1RZ8A 3MLYH 4UOZA 4IRSC 5C0AA 1E8XA 1F3DJ 5E5UB 2JWYA 3PP4L 2Q7YB 4HJGB 4L4VE 4Z23A 5T3XD 3TXAA 1KN4L 1E2ZA 1XGQA 1Z9LA 2DM4A 2DTMH 4O00A 2PYEE 2XIIA 3JUZA 4GJTB 4X7TA 2DQUH 4XBPA 3U0WH 2B0SH 4XHJD 5LGHL 4RMTA 4WNJA 4W4NA 1JV5A 4YAQA 5I71C 5I1LA 1UT2A 4U1IB 2JB6A 4KTDH 4XCNB 5I1JL 2VERN 1A1NB 4QXTB 2WLJA 3BH8B 4UINL 3QCTH 4F57H 1WEJH 3QUMH 2LLLA 2GBTA 1PZAA 2ZOUA 2V2WB 1NBYB 4U6VH 4YX2L 1WBXA 1O75A 4ISVA 2Z34A 3UACA 3U7WH 4BUQA 4M9PA 3NJHA 4KDWA 1J87A 2QDWA 2ADIB 2ZCZA 5D7IE 4J4PA 2AQPA 4OKVB 1IO4C 1PDKB 5I6XC 3IGAB 2HT3D 4I0PB 4NN5C 2WQ8A 3LDBC 1H0DA 5C0FA 3H1ZA 4FZEL 4PREA 1FQ9C 4ZW7A 3UJIL 1J5HA 3FU3A 1QZNA 3QFJE 1XMEB 2MOGA 5HI4D 1TU2B 5L2KE 4DP2X 3G6AA 1FFPA 4S1SH 3S2AA 4X8JB 2CLZB 3EGSA 1XGRB 3TURA 4HIHB 1ZLVH 4POZC 4KNQA 1TQSA 3ATEA 3CVHH 1I9JL 1Z3GH 3DSNA 4CADA 4AYDC 5IJVA 3HC2A 1P4IH 2DDQH 4FQJH 2XTLA 4PJCF 1WG3A 2DWDA 2JKJA 3LRGA 2NX5E 3S96B 1WAAA 1NFAA 2QKIA 1WH0A 4HUVB 4XE0A 3OZ9H 5KS9B 1BQUA 2YFNA 5E8NA 3VRLF 3OKDA 4KY1L 3SGJA 1E7VA 4EN3A 4Q6YA 3TCLB 5GISH 3HN3A 1G7JA 2A74B 1S5HB 2F54A 5C0IB 4PRPD 5FO9B 4LBEA 1KTBA 1YMMB 3G5VB 5GZOA 1AGFB 1IAOA 2YD1A 4F2MA 2VH5H 1P6AB 1YNTA 2X3BA 3VI4B 1D7BA 1WFNA 2IDSA 4M9OA 3E9TA 4PJFB 2VDOH 3M1BA 4PJ5E 4AL8L 3X3FL 1CF8H 4I5BA 1QVOB 1YC8A 3O2WH 2I27N 4PRHE 3IGKA 3DXAD 3OG6B 2WCSA 3VFPB 2A9CA 2NY2D 1H8SA 2KL6A 4IIQB 2K0RA 2B9AA 1MJJB 3F5WB 4MXWH 5IMOA 3VTTA 3KPRE 5F1OB 2V8MA 2Y6SC 3PUCA 5ECJE 5F0LB 3L3KB 3RWJA 2E6PA 4JRLA 1XV8A 3CFEB 3NZ8A 1XCTB 3QO0B 5AVQB 1OW0A 5I8OL 2BJMH 4DOHB 5D7LB 5ES4B 3WTVA 4RWHA 4UV7H 5F3BA 1MDAA 5E8DH 2WB7A 3GBNH 5HGAB 1PG7H 1DBKH 1A8JH 2HKAA 4P0DA 3GC3A 5JXAH 3EDEA 3QUXB 4N8VB 4AXWB 3MGOB 4Y19E 5IG7B 2FUQA 4JM4L 2P45B 2E27L 4LVNC 2OSYA 1OD9A 2WIIA 1I7TA 4MD4B 3HC3L 2R0WL 3CQQA 4DVBB 1LMKA 3B9KB 4J39A 2DQTH 2CKNA 2K4WA 5TE6H 4NJ9L 3LPGA 2JI2A 2PTTA 4JRWA 1ZHLA 4LLWB 1AZCA 2FEEI 2EP6A 1N26A 1K8DB 3G5YB 5GXBB 3FQ2A 5TQ0H 3WFCL 2M26A 3MRMA 3WL9A 1PJWA 3HE6D 5F9AC 5EBMB 1U8MB 5JPNB 2JQMA 4M43L 2NNAA 3D25A 1JPGA 2ZXDA 5D7JA 4JFXB 4N0UA 3GS0A 5GRXG 5TDOB 4DEPC 3P0YH 5KYYB 4X6CE 1KXVC 4BHUI 1M57B 4N0YL 4ZMPA 4ZDHB 1BBDL 2OCJA 2Z93A 4BH8A 5T33H 1ZPLA 3CBKB 3HG1E 2I9LA 2HSIA 1FG9C 1GH7A 5AB2A 1GJIA 3D18B 3M1CA 2YXVA 3JWDC 4F7TA 5CWSA 1YO4A 3QQ3A 4E42B 1Z5LA 1PY0A 2X4QB 4W93A 4KI5E 1M9WA 1PNCA 1WFJA 1P4LB 2DQCH 1TJXA 1QRNB 3OF6D 4ZQKB 4KJPC 2XZQH 3HI6L 4CU7A 3L3GB 4IRSA 3GB7A 4KZ0A 4K9EH 1A6TA 3WY4A 2Q9OA 2J3SA 4OD1L 4P9ML 5HHOE 2OR9H 3NZUA 4JPWL 5DJ0A 1RUKH 4LKCA 3ROOB 5JR1L 4AC4A 1Q94B 3BN9C 4NHUB 4NYLA 3QIWD 1G0XA 1D5RA 1UA3A 4H88L 3RIAK 1CI3M 6PAZA 1PTZA 4GEJA 5FYLD 4AH2B 3J8F7 4FD0A 3WUWG 4S0TD 4YNYB 4R4BB 1C08A 1YYLH 1RMFL 4WHTB 5CN2A 2Q8BH 3UTSD 2BIOA 2XQYK 5JIDA 1EZLA 5KS9F 4ZYKB 1K3ZA 2VL5B 3BSHA 5HVGB 2Y5TB 2H0PA 1RZJC 2YFOA 2NW3B 2X1OA 3NP4A 3EGXB 4AQEA 4GFTB 3VXNB 2ADGA 3O8XC 4OB5H 4NCC2 4PJIB 3CFCH 2E4TA 4PTUA 4HXAH 2ETWA 4TVUA 3EJUA 1LEKA 3UZVB 1N5YL 2NXZB 5IF0B 2R4RL 5B8CC 3ZKNC 4JM2A 4WJKB 2FO4B 4OJEH 1THCA 4JHWH 5DD0L 1RZQA 2EE3A 3IPFA 4XWGH 5DXWA 3C5SA 4AYBA 2LAGB 3BEVA 3NSYA 3AG3B 3CWGA 2D31A 3WNMA 2JCCB 1AHKA 4F7PA 1HHJB 4LEXL 4UDTB 4M3HA 4LLMA 4DKEL 1E4XH 5FM4A 3C08L 1NCCL 3BPOC 1AS6A 1H3XA 5GZNC 5IBTH 3FFCB 3JZYA 3DDFA 4OM0L 4XP9H 2E0PA 3W0WA 3GZOA 3HRZC 5SWZE 3U30B 4LOFA 2H6OA 2EVGA 5IV2A 4KROB 2EVIA 4NQCE 4AM0A 1CL7I 3BWAA 12E8L 2HTLD 1SVCP 1ODAA 2AXFB 4YBHA 2CIIB 4ZNEA 3I3EA 1YAIA 4ZFZA 5IB2A 2YGQA 3MRNB 4FL4B 2DQHH 2IOMA 3OM3B 2X89A 4IKJA 5KSAC 4F15C 4GKZA 1MHPH 3FTYA 2XWBB 4MDJA 3RY4A 3KG5A 1JTPA 5GRWA 3Q3GB 4L8DB 5HHXL 3ARSA 2YSSB 3HB3C 2R29H 1RPQA 5I0YA 5ICXA 3BFOA 3PLYA 5DQDL 4Z77A 4WW2B 1OCCB 3RGVC 5I5RA 3IDYC 5AEAA 2H2SD 1IAKA 4WJG3 2ZYRA 4HCRL 5DSCA 2J73A 4CMMA 1UWXK 5I23A 1QFHA 4C55A 4P59H 3RKPA 3EJYD 3BWUF 2P8MB 5E5MB 2QFPA 1BXAA 2HFTA 4NJAH 1KCSL 1HHKB 1XZ0A 2Z31A 4P2RE 1IKFL 1M7IA 4QO1A 3V0WL 3KXFA 4R96A 2NR6A 2YARA 4DP1X 2Y7QA 4YHPB 5LCVL 3DOSA 4KXDA 1RZ7L 4TSBL 1A6AA 4W9CC 1W6WA 2JELL 1ONQA 4L9DA 3W3BA 3WLBA 2DQJH 1AC6A 1T4WA 3P3SA 3TX4A 5CR1A 1FG2A 2AK1H 4UILL 3NSJA 1P5VA 3BFWA 5HD8D 3TBVA 4K9JA 5BUGA 1TCRA 3EGDB 1NCBL 1T4KA 3QR1A 4D0DA 4Y16D 5J57B 3GSRA 4K5OA 1S9VB 4LF3A 3DETC 5F71A 3HOGA 3ZL1A 1UM4H 5DO8A 2EXSA 1RFDH 3RWHA 5CUSH 2D9CA 4HJJL 5J1AB 1N2RB 3T8XB 2H3NA 2WUBL 3I50H 4DGIH 1CICA 2WQUA 1T21A 1KOAA 3FOMA 2NCEA 5E94A 1BAFL 4QXGL 4U1HA 3QZWG 3BH4A 4X4MA 5C0ND 3ZSTA 4ZMYA 4YDNA 1F45A 1XIWC 2N0MA 1KFAL 2WUCH 3PWUB 3IWVA 4M1DL 2YPLD 3I3DA 2B20A 3WHXA 4U1KA 5AW5B 4CKVX 4TPRH 3VCLB 5FW8A 3MV7A 4JX0A 3FB6A 4MJ6B 4R97B 1QWUA 3HMWL 3NIGE 4MA8H 4A7QA 4WY7H 4DUWA 1KJ3H 1AZNA 2XTJB 3VG0H 5AW3B 5EPMB 2GG1A 3C2AH 3IDGB 4ODSL 1QSEB 1GRWA 4CW1B 5EU6A 1OAYH 4QD2E 2F53D 1AGDA 3L6FA 5GSVB 3EO9H 1N8OE 1QBML 2JQAA 3UFIA 1C1EL 2ENJA 1HEJC 2IH1B 2FGWH 3GPSA 3LXBA 4U6XA 1W91A 3K2UL 3DVFA 2XRAL 3L7FA 1SUHA 5L2JA 1T2JA 3PUUA 3OJDA 2FSDA 4L29B 4X50A 3T2OA 2ZSVB 1KY6A 3TTSA 2WBXA 4OCRH 3FTGB 4I0PC 1F4YH 3LQAL 5EZOH 4ZMNA 1Q0XL 3GMRA 3GTTA 1MWAA 3GMMA 2Z35B 3R7RA 3UXFA 3KBFA 5GGVL 3NEOA 5DUBB 5E03A 5E9DB 3GGWB 2NLJB 3RJOA 4HIQA 4YHLL 3IKCA 4K23H 3K5RA 1UWGL 3GSUA 4ENED 2P5WD 5IT2H 2FWLB 2C7FA 4HW6A 1I1RA 3FB7A 3PWJB 4HT1L 1MRDH 2A9MH 3T8VA 3FRUB 5L7XH 1Q9OA 1A7NH 1IC4L 3MRDA 3P30H 3MRGB 1UXSA 3QIBB 2YD7A 4JHVA 3FAXA 4FC3E 4JHZA 4XO9A 4HZLB 3S37H 2HVJB 1CF1A 4Z3FA 4DK5A 3VH8G 3K2MC 1KYUA 5G5DB 4L3EA 5LG6A 5HYSA 1MXDA 2JLPA 3UC0H 3GDBA 3A47A 3O8XA 1EFXD 3UG4A 2Y4SA 3ZRFC 5JDSB 5KYNA 1J5OL 2MOQA 3B7SA 3QB7C 5IFHH 3INUH 1MCDA 5B8CA 5C0DA 4HPYH 4AV5A 1C9SA 2O61B 1TQCB 2A74C 3SSGA 3L4ZA 3WS6C 4NPKA 5EU5A 5FDWA 3RVWD 1INDL 4WW2F 3D48R 1SLXA 1NKRA 4L0PB 2VLKA 3EYSH 4JQXA 3VWJD 4JFEB 1HI6A 4P5MB 3FU7B 5DRNB 1HL9A 3BFQG 1NCDL 1BVLA 2F68X 1OAKL 2E9WA 4K8RL 3AXLB 2ZICA 4MZIA 4PTTA 3RB7A 1HHIA 1JTTA 2J8HA 2AJ3B 2DIJA 3ZDXB 1T2XA 4E41B 1ZHBA 4IIQC 5D7SL 3VXQB 4XMTA 5I6OA 3QZBA 2PPDA 4MD0B 2CDGB 4A1RA 4FAAB 1LNUA 2GCYB 3IRCA 2HKHH 5IEKB 4NLAA 1SMAA 1XQ4A 2NCMA 5KSAA 2XN9A 4DAGH 1JK9A 3T4YB 1R3JB 2GBAA 4FMFA 5M95B 4RAUA 5LVEA 1DR9A 3NA9H 1OPGH 3BP7B 3BN3B 4IHOA 2DJSA 1U8IB 4JDTH 2A3TA 1VEPA 4PV8A 4PRID 4AC2A 4LQFH 3RGVA 4XXDB 4DO4A 4FXGB 3H7LA 5JUEL 1P2CB 2EIDA 2EO7A 3B9KC 5F1KC 4RNRB 3FO9B 1QFPA 4PJEB 4Y1AE 3KLSA 2CG9X 4L4TA 4MLIA 1TVBB 4LVEA 4OF0A 1X9RA 4UT9A 3WKMH 2UZIL 3VXMA 2FJSA 3LH9A 5B3JE 1BPVA 1T0MB 3SEPA 1G87A 1UD2A 2Y72A 1CK0L 5C6WH 5K5YA 3TT3H 5J5EA 1FC2D 2VXSL 1EHAA 1ZHKB 2WTOA 1A9EA 2BVYA 3QUGA 1MCWM 2BSSA 5HI3D 2VMEA 5C8JB 3MLRL 4ZSOB 2GTQA 2VMFA 3EFFB 5C0BE 2Q8AL 5JPNC 5CCKH 1KACB 5F7AA 3QRBA 1IGTA 3EOAB 1NGXB 4PGBB 3N0AA 3QORC 5DMKA 4WLCA 5HHNA 3MUHL 2R7EB 3DROB 3UYPB 1RL1A 2YMOA 2V5TA 5E51A 5EC1B 5E6YA 4GYBA 2BNQE 3MGTB 3NDYE 2YD8A 2YEZA 4A67A 1OTTD 1SMDA 2BP8A 5E99L 1YN7B 1N0LB 3O0RH 2VR4A 2YD2A 4H5SB 1P0SE 2BNRE 5CSZA 2EINB 2AQQA 2BWIA 3UTTD 4DZBA 2YRPA 4ZW6A 5E8PA 5INCB 5ID1A 2CQVA 2W88A 3FUNA 1I7UB 2CNZA 2VJ0A 4CBPA 2CLVA 4FHBD 1T20A 1QI4A 4TSAH 1WBYB 4B41A 4PRPB 4U1NB 1M53A 3FUEA 1ZLUH 2WKLA 3Q7JA 2WC7A 4ZRGA 1JRHL 4FJYA 4NC1C 2ZPKL 1BQLL 3W39A 4K3EH 1WGOA 3CE1A 2HZHA 4Y4HD 1JF1A 1G1YA 3MX0B 3WIHA 4XMLL 3QDGB 2X4OA 2CIKA 4RIRB 5FWQA 4GAAA 4LSTL 1MJ7L 4MJIE 3US9A 4J5VA 4PRBB 1OSPL 2VN7A 1DQDL 3LKRA 2NY2B 3QUKA 2XU9A 3ZYOA 2A4ZA 1BX2A 3GXIA 5EU3B 3H3PH 2QPUA 3QHFL 2NXZC 2O6PA 2H26B 1NM4A 3QEQE 3INOA 4YDKL 1KGYE 1RSFA 2NW2A 1NDMB 2O5YL 4G9FD 1SXZA 3FUDA 4ODVL 1PCXA 4MJ5A 1GKOA 2R4SH 4ZT1A 2O5NA 3CJJA 4R90L 4AEHL 4HS8H 4TUJA 4TUKL 2FZ3B 3ZDXF 4A6YH 1TEGA 3S35H 1HOEA 5HGDA 1QLFA 4OCYL 1M71A 2A9NL 3LQZA 1X5HA 4WO4D 4ELMB 4JO4L 4NXSA 5C7XL 3DX8B 4N2IA 1ZANL 3S5LG 1E5ZA 5ADOL 1UT1A 2OP4L 3JWOL 5SX4I 3U30C 2MKLC 1UATA 3L9RB 1F56A 4ZS6D 2QGBA 3HKZA 2NY3C 2H7WA 4LDEB 4RBPH 3QG7L 5EOQH 3V5DA 4ELKA 5KAQG 5LGKA 5AOMA 3VGEA 3B7RL 3S36X 1CXLA 4BRVA 2OL3A 4W9DC 3QC6X 1TXKA 1UZGA 2ENPA 3KPLB 2QV2A 1A9BB 3CMGA 3F00A 4QRRE 2CO6A 3QRLA 3CSFA 2QQQA 4AVHA 1ZA6A 3HE6B 4U3SA 1AHMA 4PJEF 4ZO9A 3V6FA 4WW2C 4N2EA 2FD6L 4O02A 3SCMC 2K9UA 1X4YA 3BCDA 3A23A 1DSFL 3RE0A 2HN7A 4JDVB 1PYWB 1CTNA 4FLRA 1JZDC 1OP5K 1V05A 1O6SB 4IS6A 3DTXA 1DO6A 4ZK8A 3IJHB 3MO1A 3TPUA 2L8AA 2QQLH 5FEBA 1FVCB 4NNXA 4YLBA 4NB7A 4HC1A 3B5GA 5I0VA 1CI5A 4DN4L 4KK8C 1H5BB 1R0AH 4LL9A 3HAEH 2G2NA 3FQWA 4G5AA 3B2DC 3QJTB 4KHTL 4Y9FA 4JANB 2KC0A 1R3LA 2GK2A 4HAKA 2PCFA 1PLAA 2WXPA 2ZOTA 5A6MA 2WB1A 2QSTA 2IIJA 2OI9B 3CFKA 3IJEA 4JG1L 5E8EA 1NC4A 3QIWB 1QAWA 4FABL 2FO1A 1XGQB 1JDDA 3BAXA 3HMXH 4MA3B 1BF8A 2WXOA 1KPUA 3OB0K 2VL4A 1J05B 2R0LH 2VM4A 1H8LA 2LU3A 4PJ7A 3UTSB 1I8IB 3T6ZA 1Q9WA 3O3BA 1PKQE 4LPVA 4UU9B 5DDHA 3TH4T 1P1VA 2SEBA 5FLUA 1IFRA 1S7SB 5J3HD 4NQXB 1T6VN 2XTSA 1LO2H 4R7DB 4F91B 2PWGA 5IESL 2Z7WA 4P5TD 1AIZA 4QWWC 2IAAC 4PR5B 4R97C 1INQB 1WBXB 1IMHC 5I15L 1DJXA 4TOYL 1S7RB 3D0LB 2XTJC 1G4RA 4PAZA 3NEXA 4G83A 3I6SA 4ACTA 4LARL 5G4MA 4L9LB 2WOBA 5D7KD 2W9LA 3CVIL 4ZUWA 1RVFL 3FZUD 3G9AB 4RFOL 1DN0B 2JFCA 1RUAH 3DKHA 2VXTH 1Y7VA 4TULL 4YXHL 2OLDA 2KZBA 1QABA 1T1WB 5FCUL 1X7TA 3L48A 4DF9A 4YBQD 5LLIC 2IFFH 3AS0A 3SGKA 1G7HA 3BEWA 1B0GB 2GTZA 3NIFB 5DF0A 5KYUB 3UIZA 1ZOXA 2VLJD 2AK4E 3CDCA 4ZMLA 3OKNA 3QJFB 5FDYA 4FNPA 1VFBA 2DL2A 2EDQA 4G42A 4HWBH 5HGBB 2AANA 1RU9L 4CGTA 1NC2D 1E3FA 3O4LD 5AW2B 5GGSA 4BSVA 4ELMF 5J6GA 2R56L 1ZIAA 2ZOOA 3EOTL 4YSDA 1YRKA 5EO1B 1Q9LB 2WOYA 4G6JL 4CN4A 2JJTC 5J1TC 3T3PE 3EW3B 3N43B 3QIBC 1OAUH 2NNXA 5I75B 5DI8A 2DI8A 2P44B 3B2PA 1BZOA 1IGCL 3VFUA 3WD5L 3C6EA 2EDWA 1GYAA 3II1A 3FO2A 2HRGA 2AW2A 2WXIA 2VLRA 4P05A 2G5UA 1AACA 3PABA 3P77A 4PFEA 4LFHD 4JY6A 4N8PA 3VYOA 3GSNB 5HYIA 4NPJA 2F9BT 3ASNB 3F58L 3PL6D 2WZPD 1UWFA 1LEIB 1GOFA 4NZRH 4OZHF 1D9KC 4LAQL 4DN3L 1EZVY 1JUFB 2VM9A 3C6SA 5IQMA 5E1GA 5I1IL 1R4XA 3IMBA 1J8HA 1ACCA 1H3VA 3LNIA 4KKBD 3MROA 2UY7B 4W70A 3SDDD 5DMIL 5EBLA 3NN8A 1U2YA 1CC3A 4MNHB 3SKOA 1PX8A 4ODWA 4F7EB 4GMTL 1CS6A 4ORGB 1A6UL 1UXLA 4JFQB 4YR6B 5F7DB 3E38A 5D93B 4PI0A 4Y16B 2AJZB 3PNWB 1W2KT 4MYWB 4S0HA 8PAZA 1CLOL 4Z5RA 4NZUH 2ERJB 4XE5B 2DKMA 1E9QB 1E6JH 3D4CA 1MHEA 1S6NA 1HEZA 2IBZY 3MR9A 5PCYA 4F7MA 4YBLB 1S7UA 2BRRL 1JGIA 2ZX7A 3B2MA 4OIIH 2BHYA 3DJRA 3IPBA 4U1LB 5DS8A 5DGQA 2Q6WA 2WYTA 1ZKAA 5HYJA 1OIOA 5IWLC 1R5IA 2YPLB 3WTTA 2MNWA 3BYTA 1NBZB 4B9YA 5KSUB 4GS7B 3UOAB 4U6YA 5FYJD 1PGRB 4PVMA 4Y2DA 1T7YA 5F7NC 3ZYJA 3ARWA 3MRMB 3UP1A 1KWKA 3SCMA 4KK5D 3KYMA 4UANA 4FXGC 1S8DA 4JFOB 3TA4D 4YIQB 1WAPA 4FYSA 2J5WA 3FUJA 5AFAA 4XHJC 1UT9A 2AJVH 3ZTDC 5KW9H 2VZOA 2F6AA 2F53B 1OGAA 1QFWM 4DUXA 4LQ1A 1UB5B 5FR3A 2ICEA 1KC5L 3ULUL 3KZ8A 2A77H 4Z7WA 5E00A 3OPUA 1IAIH 1UACH 4H25A 1ITBB 1J1OH 3ULVE 3D2UB 4KXAA 1QW8A 3OGCA 3GEWB 1O6VA 2HT3C 2VDKH 3Q6FA 4UTAH 4PJ6A 5DLLA 4EUPA 1BEYH 1U6AL 2BDNH 1JXFA 4PRAA 1OD7A 4ZX3A 2WLZA 1D2PA 1N19A 5C0JB 1EA9C 3SY6A 4ZFOA 4R3SB 2P5WB 5CILL 3DTDA 2B3IA 5B22A 2WXNA 4XCYA 4A2EA 4P06A 3NIFF 4A39A 1JXJA 1JI1A 2I7OA 2X6UA 3NVQA 4D8PB 5FM5O 3BWZA 1KLFB 3VGAC 4XNXH 4L1SA 3NACH 3N9GH 4R0LA 4JGMA 3OWEA 1H9VA 4HWZA 1EFXB 2CDFA 2YUZA 1MWAL 2EIBA 3N43F 2YXFA 3WS3B 2R27A 4P3DB 1SM3H 3BUPA 1KUMA 1YNTF 5KVGE 1W72B 1QUPA 3OBAA 1W0WB 2LHAA 4Z8FH 1JNHA 5A2KH 4L4VD 5HVWA 1JPTL 3VWJB 3H7BA 4PJGB 1CQKA 1S9XA 5CLXA 1S5IH 4ZW8A 1BHGA 3KNBA 2PYED 1QEWB 2K7QA 4Q6IA 3VXPB 2EYTA 2E4FA 4J3XA 2NY2C 3IETA 3TT1H 1U42A 3C09B 3NCYS 5HJGA 5ELIA 3ZE2B 4AEFA 5IEHB 1JD9A 4ZMZA 1U58B 1RK0A 4Z95H 1YEIH 1BZ9A 3FAWA 5IW6B 2P8LA 4I3RH 4WI5A 4Z18A 1GXEA 3A21A 2NQDA 1CDUA 1XSIA 4HLJA 5F9OH 4HEME 1JMZA 1F1DA 5FX3A 5C08E 2R1XB 2LVCA 2OMTB 1IILE 3FH7A 4BQ6A 4G6ML 5DC4B 3NZHL 2FL5A 1O7DE 2BMKA 2PN5A 1XH2A 4MNGB 4NENA 4GKZB 2VIRB 4MDJB 1G9ML 2N1KA 3RRQA 4UNTA 1A4CA 3NJFA 3QO1B 4KDTA 4OSUL 3RY6C 4A2HA 5IVXA 3QFJD 4PRIB 4ANVA 1D6EA 1JV2B 5L2KD 1KIPB 3BP4A 4CDHA 2Q0ZX 5T1DH 1FLRL 3WEXA 3FB5A 5K9QI 2LLNA 4HJSA 4I48A 3L2LA 2YD5A 3WJLC 1ZE3H 2IG2L 3IXAA 1A22B 3BMVA 5DUPH 3RZCC 4O51B 3SD5A 2LU7A 2NX5D 2JKRM 5I1HL 4I1RA 3VGDA 1FYTA 1JWMB 2H6UA 4JVPA 5EIIB 1XR8A 4AYMC 4LVOB 4OLWH 3HE6C 3HE7A 4HAGA 1F58L 2G4GA 1VHPA 2ZKMX 5IHBA 2ZG2A 2HX8A 2YAOA 4BFGA 1AO7E 2R15A 3STLA 4X0KA 4B9KC 1GS6X 2H8PA 5IB4B 3EUUA 3TESA 4I13B 2X0WA 5CR8A 1QR1B 2VUKA 4JZJB 1GZPB 4IKLA 4PJAA 4FQ1L 5F1SA 5L4MA 4UT9L 3GHPA 4PJ5D 4K7PY 4IDLA 2XOTA 2O6DA 4ODBD 1SF5A 4PRHD 2EE2A 1CU4L 1XCQB 2HLAB 1H5BC 3LPOA 5EBWA 5KOVC 1NLBH 1AGEA 4N6QA 5KANI 5IKCA 2TRHA 3WDIA 2EICA 1ZS8B 3KPRD 3UYOD 3MRBA 1A4KA 3QVAA 1DCEA 3QDME 4XVTH 3UTTB 2AERT 2PPEA 4XN4A 1PLGH 4BFBD 4IM8A 2G3NA 2IJ0C 4XNYL 1G1OA 2WNKA 3QNXA 1HHGA 2H4EA 5FA4B 4BFNA 3GSQA 3VFWB 4QHPA 1JHLL 4DK3A 3OAZK 3GI9H 4G8IA 2FBJH 5DVKA 4GXFA 5E2UL 4IBUA 2Y06H 3BUIA 4APQD 4GI9A 5C07E 5BUPA 1FN4A 4MKMA 1NOFA 4Z7VE 4Y4HB 1J0KA 4NO2B 5I6LA 3DUSA 2JKNA 2JE8A 3EFDL 3NAAH 4NRYB 5HHME 1KIUA 2ITFA 5LGYA 3ULVH 2ODIA 1RCYA 4JM2F 1AQKH 4K94H 3VXUD 2QLVB 3C5XA 3OQRA 1VPOH 1HCFX 2DIBA 1RJLA 5ID0B 4PJGF 4G9FB 3L5XL 4E9YA 3ZTJG 1WYJA 3F7RA 2BVTA 1V7ML 5AYUL 2XKNB 4LIQL 5I76A 4G7YH 3SJVE 4JJ5B 3S98A 1FNFA 2V0AA 1JNLH 3ZE2F 1A7QH 2Q2LA 3WIHL 3S88L 1WICA 1S3RA 5EZJB 4FKKA 2JJUA 3GIZH 3BRFA 3WIIL 1I85C 1KENL 2OSWA 5BVPH 3TA3D 4FQ2L 4OM1L 5C6TH 3U2IA 5L8KB 3R4RA 5F72S 3MRJA 1ADWA 2H1PL 3Q5TA 4P9HC 3LH2H 4K3DL 5T1LD 2BIIA 1XDTT 2HTLC 1A3LH 3OJVC 4CJ0A 2GFBB 4KI5D 3ZZSA 1FFOB 1RJZB 4NQVB 1A8ZA 4QHUB 1PZUB 3BH9B 1CQYA 1WDAA 2VJXA 1J1XH 1FRGH 1LO4L 1MG2C 3CFTA 4ODTL 5GJTH 5KVGH 5F88A 1S7XB 3MLSH 4RAVA 1ZXQA 3OLGA 5JQ6L 2DQEL 1OEZW 5KJRH 4QF1B 3HKFA 3U9UB 4FQHB 4HKJB 3Q9QA 2WLYA 3DXAA 2GJ6E 5IVOA 3OHXA 2H2SC 5FYKD 2UXTA 3CN2A 5FF6B 4J3OG 2H9GB 5JNYB 2NDGA 4ZMAT 1OO2A 3B5HA 4NQTA 5DLML 3QULB 1YAZA 1PZ3A 2GSGA 2JH2A 2J1XA 2OL3L 1EX0A 2YO3A 2XWRA 1CT8B 3OKOB 4KZDL 3EO1A 1EXGA 1FGVL 4MCNA 2B77A 1WUNT 3V4UH 4DP9X 1JJUA 3ECUA 4X98A 1IIKA 1FA4A 3JWNE 3IDMA 3GIVB 1CXKA 4L2YA 4YHKH 2V8LA 4O02L 4Z7OB 3WHE0 5C2BL 4N5EC 4NQDA 5HD8C 4XVUC 3RG1C 2BINA 5JXED 1L0PA 4M1GH 5D93C 1OALA 4L0ZA 3UABA 3KLQA 2E8ZA 1UD3A 3UC2A 4F7CB 3ARFD 3GSVA 3MV9E 4GG8B 5EORL 3Q48A 3VWKA 4DWHA 2J57A 3RZCA 4XPHL 1IV8A 4HC1L 3WN5B 5C0NC 3RWGB 1BG9A 1E40A 4JEGB 3QARA 3FBKA 4HCFA 1KEML 5SWZD 3NP3A 3EJPA 1MCEA 4NQCD 4MLSA 1WZ1L 4GS7C 2IPKA 1EO8L 4IMKC 2F74B 3P4MB 4P5TB 5FXCH 2XPGA 4IRZA 4I4WB 3ZHFA 1KYAA 5D2NC 4UQAA 5CAYB 3ECBA 5JIMA 1LDPL 5DJCB 4IHBA 4KKQA 4EOWH 4OQTH 3GXFA 3QFDA 1FZMA 3CXHK 4PLNC 5DMKB 4EF3A 2F1AA 1KXQE 3B2XA 3FB8A 2OJ1A 1JDCA 3FT0A 2KQMA 4FQLL 1IFHH 2W1NA 3AT8A 2GIXA 2FX7H 3UBFA 1RZFL 4OH2A 4WDIA 3VD7A 5EDXA 1T6WA 4MQTB 4OZGA 2F58L 2X0VA 1O9VA 4IBWA 3NOIA 3E3QC 3B83A 1OT2A 4KXCA 2XQYG 4TTDC 3GK8H 1LO3L 4Z0XB 4P2RD 4PCSA 2VLJB 4JJOA 2VE6B 4WHDA 2DWSA 3IJSA 4FTVD 4MRCA 1JHKH 2FSEA 1NC2B 3O4LB 4ENEC 1YNKH 4X9FA 1L5GB 2FLMA 5L4IA 1L7TH 4GUQA 2CLVB 3OKLB 4N3UA 3UG3A 2ISDA 2XDHA 3LKOA 4GQ9H 3QWRD 4X83A 5TPWH 4WEEA 3X1BA 1RZIB 2NYKA 2ATAA 5CP3H 5AW8B 2E9IA 3E6HA 2P5EE 3B2VH 2B1AL 1B9ZA 1KB5A 1R3HA 3VFRA 2RAMA 4HZ1A 3FRPG 4W9HC 4YQXL 4DP7X 4O4YH 2ZKHL 1X5LA 4JZNA 5T1MB 2X40A 2FCBA 3BAEH 3SE9L 4N9OB 4O58H 2CUHA 3GKWL 3GM8A 3PL6B 4M8VA 1L0YA 2O93L 2DEXX 4S0SD 4N2DA 1KEGH 2N01B 3SKMA 4AJ0A 1KB9K 5CGTA 5D1ZD 4J3UA 1VFMA 2P5PA 3GXMA 4Z9KB 3VWJC 4EI0A 3SDDB 3MCKB 1J0IA 1MWOA 5HHVH 3SYPA 5ESAB 1TETH 3V8OA 3FU8A 5HGDB 4EO5A 4QMEA 1MVFA 5JDJA 3FOLB 3EJSA 4LXFA 5KVEE 1KCRL 4I3GA 4JRYD 4R4ND 2D7OA 2WVTA 4M3JA 3DA0A 3DX4A 4Z7UA 3QCUH 1D6VL 4QRBA 3A67H 1NIBA 2ZWNA 3N44B 2TSBA 3H9HA 4GRMA 5JIKA 1EJOL 5AW7B 4ZTOL 5GS0H 1D5IH 4Z7OF 1GC1C 1YEHL 2IAMA 1UOKA 3LZFL 4RH4A 1FL3B 4AZ8B 5T3ZL 1N68A 1VB9A 2VO8A 2A0LD 4NZDA 2XVLA 5A2LH 4D0CA 2XSKA 3ROLA 1WD9A 1ADQH 3MGAA 3S4SB 4OZIE 2R83A 4K7FA 3QJHB 1NBVL 4GH7B 3LEVL 3R06A 1DJSA 3ISYA 5H35A 1T1YB 5E7BA 1HTYA 3UTQB 1Q8MA 3E6FA 3MN8A 1IGYA 3KAAA 4NNPL 3LZQA 1OP4A 2VSMB 5JHLA 1I1YB 5H8DA 4F9PA 1IUZA 5DK2B 4HQQL 2Y07H 1NINA 4Q58C 1MPAH 5EC2A 3E8VA 1HSAB 4LVOC 4C56E 4NNXB 1BLNA 3APNA 2XQBH 3C9NB 2AZAA 5LO7A 2XJLA 2D73A 1OAXL 4N2LA 2CPUA 2X38A 5F7FA 3KWUA 5FGBA 4DKFH 3KL5A 3P9LB 1ERNA 4XNMA 5FGCE 3KWWB 2WKOA 3DK2A 3TEYA 1IB5A 1DQVA 3PDOA 1R3LB 4PJBB 5F6HI 2AEPL 2WYIA 5EOTB 1AXSA 2P80D 5CZVL 4X9YA 1CN4A 1LJMA 2AJUL 4A7TA 1O7SA 5D1XE 4GRLA 1DTUA 5D6CB 2KHAA 3LNFA 1IVLA 1J10A 3ZOAA 2C9PA 3AQXA 1G43A 4FKEA 3M7OA 2YR3A 15C8H 2XG5A 4FXKB 3S5ZA 4ZS7H 1OTTC 3K4DA 3NCJL 5HHQA 4OFQA 3QWOA 3X11A 3X3GL 2WN2A 1CLYL 3ZT5A 3H9ZA 2A83A 1VJSA 5EUOB 5FPIA 3WY1A 1U92B 3RL2B 2ODHA 3QNZB 4IMKA 2GUYA 2YJQA 4O2FB 1YNLH 2P28B 2XXMB 5L0QC 3V6OC 1MUJB 1BVZA 1NCTA 5D2NA 1OCZB 4ZFOL 2IGLA 3KPSE 2GHZA 2JVUA 3N5AA 2YRZA 2X4TB 3RP1A 5I1CH 4QRUB 3BZFB 5FM8A 4KK6D 3QUYA 4L4VB 2WTRA 3ESVF 3GMOB 4HUWA 4WFHE 2XN0A 2EYSB 4HHAB 5TTRA 2LFEA 7TAAA 4YHOH 1CUOA 2PYEB 4G7RB 1WBZA 3U6RB 1H15B 5KBLA 1AHWA 4Y1AD 5CCGE 2DQGH 5BV7B 1L4IA 2HXAA 1UVQA 2YKLH 5DHXB 4ZPTA 4PRNA 4IU3B 4HWUA 1JZ7A 3KYKL 4GMSH 4ZQTA 1PG7W 3QZMA 4HETA 1DHKA 2I32A 5HYEA 2W9EL 2NUTB 5ANMA 1UD4A 3OMIB 4JNXA 4NKMA 5DU7A 4RVBA 3GS7A 1J1PH 3O81A 3AQZA 1XF3B 5C0BD 2CO3A 4HK0A 3VU2A 2IPTH 3HNSH 4W9IC 5D7IB 2Y7LA 4E9XA 2FJGB 3UPRA 4WO4C 1WWWX 3T5WA 3WFEL 1G9NC 1YUHA 2LAAA 2XA8H 4IKNA 5CJXC 4BFIA 3VE0B 1RY7B 3F65A 1ZV2A 2BFVL 1FNSH 1CFQA 5L2KB 2BNQD 4MNQD 3HI1B 2PMZA 4ZS6C 4HUKB 4MSWA 4W9LC 5TDPA 1C8QA 4NO3B 3P77B 1NDGB 4CBZA 3QQXA 4QRSA 4AG4H 1XGUA 1I4FA 1ED3A 1MJ8H 3NEEA 2BNRD 2NX5B 4ALAH 4OR1A 2GI0A 2VAAA 2AV1A 1F8TL 4EIUA 3V4VA 1AIFB 5J8OA 3MLUL 3WY2A 3L8QA 1IQDA 1J8HB 1E90A 4FFZH 3QHZL 4IOIA 4UIMB 4XTRC 4FQIH 3LXCA 1GHFL 2PWFA 3G6JB 2VDQB 5C70A 2HUEA 4FEIA 5C0CE 5KVEH 4BZ1H 1M4KA 4A66A 4LNRB 1MFNA 4X7EC 2IMNA 1IBYA 4LCUA 4DGVH 5IJKC 2DMHA 1P6WA 2ZUSA 2YQ2A 4PJ5B 5DQJB 2V7NA 4AQ8C 5E0FA 5EU7C 3ZTJH 2AXGB 3LV3B 3S3DB 1VGKA 4PRHB 5DD3L 3VFTB 4IDJH 3V4PA 3ZDZE 3WNOA 4JM0A 4IU2B 2C9QA 2OSLA 4IMLA 3QEQD 3KPRB 4PJBF 5EZPA 5HJBA 2IH9A 2WXLA 2YZ1A 3V0FA 5SX5K 2W8CA 3WNLA 2GK0A 2VXQH 3QAQA 3MRCB 5TDNB 3C60A 5INDA 3ETBJ 4H8WH 5D96B 5KYXA 1NBQA 2FB4L 3TEZA 5AB0A 5CMAB 1VFOA 1ZT1A 3BP5B 1PZ2A 4XCFH 1NMBH 4CGUB 3P3RA 2WAHA 4Z0BL 3WAKA 1M3IA 4X5QA 5KVFE 5DURD 4PJ7F 3UZQB 5EUOF 1CWVA 2PPCA 1NPJA 5AVRB 4MXVF 4PJ8D 5AW9B 3BKML 5DJAA 1EIBA 2E3VA 5AZ2H 1FVEB 1TDQA 1M1SA 1BG1A 4KNTA 4U1JA 3MUUA 3I84A 3OXSA 2CRYA 2F8VA 1KNOA 1QFOA 1JZGA 3HFMH 2GY7B 4P5TC 3LN4B 5MENA 2PW1B 5E00B 3VXUB 4JKPH 3WNJA 3DWTA 1HJCA 1NCUA 1TJIH 3D85D 2BHUA 4J3OH 2QLYA 2WLLA 3DVIA 4QIRA 4FFVD 3ZE0B 1QSFE 3DHPA 1IC7H 4L18A 2BRQA 4FNLL 3MLXL 4H20H 4QRRD 4G8FA 1MEXH 2FNWA 4GKOA 4KXZI 3FZUC 2E7MA 1ACZA 1AY1H 4HEPG 1FFNA 3HUJE 4QJ5B 4I9WE 3RUGB 2OMBA 2XWTB 5D2LA 5C7ZA 4JPKH 4X6CB 4NM8L 1E8ZA 5HY9A 1MI5A 3TA3B 4XP6L 4Q9QH 5DQ9B 1AQDA 3ELQA 2BSDA 4QHLA 5T1LB 1E4JA 2V3FA 3L1OH 2YUWA 1BECA 4GQZA 5D7IF 5AVTB 1AP2B 4OKDA 2QMKA 3V6OA 1MIML 2CBPA 2BNUB 2E9BA 3K74B 2WINB 3GHEL 3DX0A 4E5XA 2NY0B 3FQYA 5EIVA 3BJ91 3NPSB 1MCIA 3O9WD 5FHBH 3LIZH 3COOA 3R1GH 3NQKA 3K81A 5DUMH 1BXVA 3EADA 1OKEA 1CDCA 2VDLB 4TQ8A 3VI3B 1YC7A 2N0KA 4LOUD 5CHNA 1O6TA 4YE4L 3CDZA 3ZL4H 2CA4A 1HQRA 4XPAL 1BD2E 4PS7A 1B9KA 1X5YA 4BA8A 1NUFA 2WWMD 3MLVL 4FI6A 4QRQA 3PL6C 3RNKB 3DPBA 3OHMB 3ZZLA 1KFGA 1Q38A 3I9GL 5E4IA 3HC4H 4H26B 2DIEA 4P46B 2X4UB 2VMJA 1JGVL 4Y4KD 2A1WL 2Y23A 3DX6A 4KKBC 2QV4A 3G6JF 4X7DC 3SDDC 3DPDA 4HDIA 1B0IA 4I85A 4N8VG 1NGPH 1NL0L 3BIBX 2OXHB 4M62L 2W0KA 2J43A 1E43A 3ZUCA 1YPZA 3TV3L 4LP4A 1DUZB 5IQNA 4LKXA 4N1EA 2OW6A 4PJCE 5CJXA 1ETZB 1CIUA 1QBLL 1VFUA 5TFSL 5KJ7E 3ZW3A 4F9LC 4W6XB 2OQJA 4LP8A 3WIAA 5IVXB 3VRLE 1SLUA 2FT7A 3ARFB 2CUMA 5LAXB 3QFGA 4KTEL 1H19A 3BISA 1BM7A 3WEXB 2FT8A 5ESQA 4ODHL 4ZX5A 4JL1A 4K15A 4OFYD 2Q1EA 2LQRA 5SWZB 3BPLB 2P46B 1TQVA 2CCWA 4M7LL 2WM0A 2AK4D 4NQCB 5D5MA 1ZA3A 1EQWA 4EIZC 1GGBL 3E8UL 4WHYG 4HH8A 3VXRD 2WO2B 2L7QA 4KK5C 1XFPA 2ESVA 3OXRA 4J8RB 3CC5A 4NNYA 1CBVH 1EVUA 4JO3H 3ESUF 4UT7L 4ETQB 2MJWA 2DQMA 2JKLA 5IB1B 1WISA 2IOIA 4HH9A 1EXHA 5DEGB 3NRFA 1J9TA 1JCKA 4LSDA 1FV1A 3PYCA 4HUUA 2C7UA 4Z7WF 4JY4A 2X2UA 3DLQR 5JZ7D 5CEZE 3I2CH 2CRZA 3ZE0F 5AAMC 5AWNL 4PGEB 2CKBB 3UDWC 5IKCB 4IRZL 3V55A 2IBBA 4P2RB 5IM7B 2X05A 1N7MH 3IRPX 4FJ6A 4FTVB 1NFKA 4Z7IA 3KPMB 3U4EB 1M6OB 3SE3A 3FT3A 3RUGF 2WCPA 3H85A 4KO7A 1O9WA 3ZO9A 1YSOA 2JJSC 4UM8A 3QQ9D 4PBWD 5KVFH 1YZZA 5I16A 2RBLA 2EIEA 4MQSB 5IQ9B 1UWXH 1QI3A 3RI5F 1KN2L 3WY3A 1AGBA 3VFVA 3ZQWA 4NKDB 4KI5F 4YSQA 1XD0A 1JL8A 1HCZA 1VLXA 5EDSA 3QC5X 1AGCA 2WVUA 4IBYA 2VISA 1XH3A 3WEAA 4WWID 5EZIL 4G80B 3FMGH 2VDMB 2W0FB 4LLQA 1N3NB 1JZ4A 3AZUA 3O3UN 4C58B 2BVPB 3IJ9A 1Z5HA 4M6MH 4K9EC 1E30A 3F8UB 1OGSA 3JWDH 2DY2A 5D1ZB 3VI3F 1RP9A 1U8PA 3U1SH 1Q9KA 1EPFA 3WAJA 2H0JA 2Z0UA 4MBRA 4GI8A 4XN7A 5I76B 1SXSA 3CLFH 2YGPA 3ARED 4XZ4A 4W9JC 1Q1JH 1KB5L 4N90E 3SDXA 4OCXH 1BIIB 3IMRA 4Q4IA 5BZWB 5BV7C 1R3KA 2FWOB 3MLTA 4FQPA 3T04D 3TWYA 4JRYB 1FL5A