3VSQA

Crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2 e236r mutant in the presence of ethanol
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
199
structure length
197
Chain Sequence
b'QRYVRKDGKCNVHHGNVKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVRASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G protein-activated inward rectifier potassium channel 2
publication title Coupling of G Protein Binding to Channel Gating in Mammalian Inward Rectifier K+ channels
rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 41
structure length 197
sequence length 199
ec nomenclature
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3vsqA00
5KUKA 2WLLA 1U4FA 3AUWB 3SYCA 4LP8A 2WLIB 3SYAA 3SYPA 2WLNA 2WLJA 3SYOA 3ZRSA 2WLHA 2QKSA 3VSQA 3JYCA 2GIXA 3SPCA 4KFMA 2X6CA 1P7BA 5KUMA 3AT8A 2WLMA 3SPGA 2WLLB 3AT9A 1U4EA 2WLKA 3AGWA 2WLIA 3ATAA 3SYQA 2X6AA 2E4FA 1N9PA 3ATEA 3SPHA 3ATFA 1XL4A 3ATDA 3SPJA 3K6NA 2X6BA 1XL6A 3ATBA 3SPIA
chains in the Genus database with same CATH superfamily
4XCYA 1L5GB 1YMMB 2CO2A 5C0CE 5I66A 2IQ9L 3UX9B 3ZE0B 1IGIH 1T0OA 1SJEA 5BRQA 3QQNA 5I8EA 5I19L 3CFKB 2JKJA 1LO4L 3OQ3B 4M6OL 1OT1A 4HSCX 2Z93B 3FQTA 3SBWA 2BERA 3QUYD 1ZTXH 5DU7A 4PJEF 4XB3A 1OE1A 1QASA 2WO2B 3FTSA 2P5WE 2YRZA 1BZ7B 4AIEA 3ZL2A 3DGGB 3NFSL 4L3ED 5ID0B 3PV6A 1TVDA 4TL4A 1JXGA 4AKOA 1AGEB 4P48A 1I85A 4HJJL 2Y5TB 5HYJD 1DQLL 2DQDH 5D93B 4Y5VB 3AU1A 1HOCB 3DSNA 3LNFA 1DQML 2LLLA 4XVTL 3GPEA 4FQQA 1S46A 2JXMB 1VFUA 2CUIA 3L4VA 3OWEA 3BRGC 5I1DB 1ZVSB 4NQCA 4DGYL 3UJTH 1CICA 1BJ8A 2D7NA 3NJGA 3OAZK 4R2GD 3BE1H 2I07A 4KFZC 3UO1H 1JGLH 4UOQA 2HA1A 1FE8L 4FZ8H 5CHNA 5IHLB 3O2DH 4GG6F 1I8KA 1WYJA 1YECH 4BK5A 5CEXB 1JNJA 4FMVA 1S9XB 2P8LA 5F7FA 4YWGL 4F8OA 3G6JA 4PJCE 3HR6A 3C5XA 3BGMB 4M93C 3CZSA 2D31B 4IKJA 2X1PA 5BZXA 2AK4B 3QCUL 2ZF9A 3UTQA 1AZCA 3GKWH 3MJ9H 1DSYA 1JK9A 4MQ7A 2ZSVA 1CLCA 4XP5H 2FUTA 1CU4L 5KBMA 2DWEB 1J1PH 2EUXA 2KYIA 3PIQB 4JFZH 1DR9A 1OP3K 3Q05A 4XMKH 3DYPA 2AJYL 4AENB 1M1XB 3P4OA 5KSAD 2COVD 5CP3A 2YHGA 3RZWA 5D7IE 3QG6A 5E00B 4OZIB 4MQTB 4PVBA 2GEQA 1ODUA 2VLJD 3B2PA 1AGBB 1FSKC 1A4JB 3RWIB 5G2NA 4BH8A 4NXKA 2XA8H 4Z3IA 3T2NL 4OCYL 2XQYA 2D03H 1V3LA 3NIFB 1S5HA 3D9AH 4KRPD 3FRPB 2YPKA 3WENA 1RZPA 2V7HA 4KZDH 2QMKA 3EG9A 5AW1B 2FO4B 5DUPL 2PCYA 1IKNC 2J43A 4L4TD 3UBGA 1SNRA 2EKSA 1CLYH 2B39A 4XVSH 4C4UA 4EZLA 4XMVA 1H6UA 1MNUH 2F5BL 1SY6H 4XNMB 4XVOA 2ICWI 2NOYA 4GQQA 1DBKH 1FFOB 1L0PA 5ADPH 5EUOA 3UO8B 1TQCB 3UPCA 3UACA 2FHFA 3KWTA 2WO4A 1TR7A 4QRRB 2ZXCA 4Z8FL 1M9WA 5M95B 1CXKA 5SWZA 1MLBA 4FA7B 3SDCC 1HAUA 4LLDB 4DIXA 2CMRH 3RVUC 3IJ9A 3BPCB 3D18A 1WV7T 2GHZA 3N06B 4KJPC 4RISH 2UUDH 3L9RA 4JGUA 2YZ8A 2HRHA 1J48A 4KKLC 3QEQB 4Z7WF 2MIZA 1K2DB 2RMNA 2XFGB 4JVPA 1A9EB 3V6ZB 5F7DA 1BVKA 1MHEA 3OC8A 1OWWA 1ZSDB 1I7RB 4P06A 4QXUL 3JV6A 3ULUH 1WTGT 1OXYA 5I2IA 2ZAIA 2AEWA 3IU3B 4U6YA 5AOLA 5A6IA 2FX7L 1KIPA 2E86A 4I3SL 1N59A 5C0BD 2XVLA 1KCVL 2IPKA 4JFDD 4CVUA 4RBPH 3TEUA 3VFVA 4WFFD 3B2DC 3RNQA 2XPGB 3T6ZA 4KPHH 4B7IA 1RJLA 1JFQH 2VWEE 4S1RL 2Q86A 3ARYA 4XO4A 1FFNA 5I1HH 1DN0A 3A6BH 1NGWA 1QBLL 4GNKB 2IAMB 4IEFB 1BQ5A 2WMPB 2FQGA 4WUKH 1GH7A 2VN3A 2GSIB 4PR5A 3WJLC 3WTSA 2G5BB 3MBEB 1YNTB 3RG1C 4MAYD 4K8RL 1RUKH 5JLZA 5K1NA 5GGRY 1IAOB 3LNIA 1KYOJ 5FA4A 4FI8A 5SV3A 3BZEB 1BZOA 4PM1A 4JUTA 4KKBD 1UUSA 3MUZ1 4NJAH 5DJ2A 1RJCA 5JR1L 3HG1A 1A64A 4XPHH 3RTQA 2OX5A 2WVVB 5JO5B 1PZUB 4LLQA 1R24A 1DL7H 4NZDA 5IW1A 4XC1H 4PRID 2FATL 3RAJH 3R0MA 5TF1L 1A6UL 1MWOA 3C9NA 3OSVA 1HHKB 3ZHDA 5AZ2L 2GIMA 4B6ZA 1QO3B 1A6PA 3L7FA 3L6FB 2UVEA 5D8JL 1TETH 3H3PL 4MDJB 5CD3A 1JZEA 4M8UA 1G9MC 4PCKA 4QWWD 1OSZB 1EWHA 5DA4A 1IKNA 4X6CA 1CDHA 3HRZB 4FNRA 3ARGC 1VFOA 4XP6H 3U0WL 2IPUK 3LYRA 2CHXA 4PRHE 2HTLD 1LEKB 1E28B 4NJ9L 3K0WA 3TH4T 3MLRH 3MV9B 5INCB 5GGTA 5EFIB 1BEYH 1NAKH 3LRGA 1F90L 3WMQA 5JPMC 5C86A 2X6CA 5L6YH 2A77H 4FFWC 5INDA 4LPVA 3GRBA 2N7AA 4BXVA 2P43B 3M17B 2YPVH 1IC4L 2Q6WB 4XN8A 4BDVB 1FCCA 5EWIL 1YUKB 2LU3A 4KBPA 1XGZA 3HPJB 5MI0C 2FQEA 1A65A 4DKEH 3DHMA 3F7VA 4C54A 5DQJA 4MMZC 5D70H 4OR1A 1QFUH 4PRPD 4A37A 3H7BA 3LQAC 4NUGH 4YDIH 3UPAA 1WSST 1SHSA 2VLRA 4PGCA 1CDYA 3M86A 4QHUA 3ASNB 4Y1AA 5F0PB 1OGTA 4M8QB 4R96B 4P2RA 4A2HA 5K9JL 4NPKA 2GITB 3X1BA 4HEME 3FFCE 2GBAA 3O8XD 3QJRB 2NY3B 5E9DD 2OTWB 4JFFA 4OFDA 3WNMA 4DN4L 1DBAL 4DQOL 3LDBC 4BGDA 3RDTB 1MWAL 3ARWA 3C12A 3GSXB 1SGKA 4ZFGH 5D4JA 3GSUB 2Q2LA 3MHZA 2ZWYA 3JTTB 3GGWA 3ZIMA 5M7QA 2WXJA 3FU0A 3LSOB 4L23A 3AZUA 5E4IA 3WEXB 4Z0XB 4O9HH 3V6OC 5CKAA 2ADIA 4LSDA 4Z3GA 3INUL 4ZX4A 3WJJA 4XBEL 3TCXA 1HE7A 2CGYA 3UIYA 2HLEB 4K4KA 1E9QA 3FB5A 5DRWB 2C1PA 2DKUA 3VFMB 3N42F 5AW9B 2HVBA 3HUJF 3HVNA 2RTTA 5K69A 5C0DA 4QRPA 5T3ZE 3L3GA 4HXBL 1EUUA 2NNAB 3SKJH 1HHGA 3W57A 1MFBH 2XWEA 4Q9QL 2BNRD 1SXBA 3F58H 1GAFH 1YEJH 2A7BA 3WNLA 3HC4H 4HJGB 4OKVA 3O6FA 2BVOB 4FHKA 5GZND 3X3GL 2OMXA 2YK1L 4OZGE 3IMBA 4L9DA 4FXTA 3FYEB 3TIEA 1O6SB 3ECBA 1QEWA 2ZKHH 3VWKD 2JQMA 3OLIA 1EGJH 1BD2B 1DLHB 2NYYC 3CZGA 3W37A 1BQUA 3AREB 4R0LB 4MXWL 5GPRA 4MJIA 3RX5A 3MLYL 4Z7NE 3GJEA 3TT3L 4N3TA 5DT1H 1MIEL 1YYLL 3AFLA 4ES9A 1Q9KA 2WAHA 3IFLL 1IGFH 1KLGA 4OLZL 2W9EL 5D1ZD 3SDXE 3RZCD 3ERXA 2Y24A 4A7UA 5CEZL 5H37G 2J1ZA 3P3TA 4M7LL 1XMEB 2GJ6B 3VXMD 2WINA 2WSDA 1DVFD 1PG7X 4AK2A 3D7PA 1XF2B 2H0JA 4U2ZA 1PIFA 3E8VA 5C08D 4DVBA 2JFCA 3MCKA 4M6AA 4TNVF 2CNYA 5BVJB 1YPZB 4U7SA 3DX3A 2MSPA 3QK0A 2Z8WC 5D7LE 1SEQH 4LIQL 2QEJA 4WO4B 1LP9F 5D93C 5KSBE 2R7EA 5B7MA 5ABDE 4OB5H 5IJVA 4MMZA 4TPRL 2ZSWB 1C16A 2BIMA 4PS4L 2XN0A 1S3KL 3HI6L 4WTXA 5B39G 5I0ZA 4KVCL 1QP1A 4IU2A 3BLKA 4OM0H 2YBGA 1GYUA 4YN3A 1JDCA 2OCFD 4BRVA 3LZOA 5E8PB 4AW7A 5IHUL 3ZXAC 4YAQB 5E1GA 2JCCF 1MJ8H 4XB7A 5IMOB 2DIAA 1AANA 2V7NB 1E3XA 4A2DA 2LT9A 1UKTA 2WOYA 2JB5H 3VVVA 3NH7L 3KEDA 5L9DL 3D4ZA 1PD6A 5DHXB 1GY2A 5AG9A 2Y2WA 5H2BB 2BDNH 4CILA 3MLUH 4ES8A 2IFFH 4TULH 1ASPA 3O6MH 3ULSB 5L7XL 4YDVA 1JTOA 1EAPB 4UUJA 5SV4A 2P49B 5HI4D 5I26A 4Z3EA 3JWDL 4TVPL 5KJ7E 2ATPA 1SJVA 3ISRA 4JM2A 4OZHB 3PL6B 3F8UB 4L5FL 5D1QB 4XP4H 3ZE2E 5HD8C 4C83B 3F05A 2CPUA 4OLWL 5D7JC 1D2PA 3O3AA 5D2LF 4DAGH 1MRDL 1QA9A 2VMFA 3EKCA 1LWJA 2PPCA 1ILSA 1H8OA 2CIKB 3PGFL 4X6BB 2GK0A 3NJJA 1D5IL 3F84A 4NQCD 4PJBA 4BCYA 1G6RL 1KIUA 4H8QA 1HX0A 1CICD 1QLFA 1ZT7A 2EDBA 4UQCA 5DZNA 5LGYA 1HJBC 4JO2L 5FDWA 3KH3A 2R1XB 3DBXB 5HI3D 3GMNA 5CJXC 2WQXA 5EPMA 4TVSa 4IRSB 4A6YB 4AGNA 5FEBA 4G6AD 2N1KA 3RGHA 1AMYA 2R0KH 2W81C 3ZTNH 1M71A 4LLVA 5LQBH 3IJHB 2AEQH 1L5GA 1YMMA 3EJQA 2D7OA 1K3IA 4KNSA 2QVMA 5ILTH 1LK3L 3CFKA 4K3HA 1VFMA 3HFFA 3O6KL 2AQRA 2BY2A 3KXFE 4ZO6A 2EABA 1I9EA 3LIZH 2Z93A 5HYQB 1CN4A 1BGXH 4IRZA 4EDWL 3GMLB 1E6JH 1RMFL 3VB9A 1ZDQA 5KN5B 2EVGA 1UASA 3QAQA 1XMWA 3FN3A 2DQMA 4GT7A 3QG7L 4Y4FC 4X4KA 5F44A 1BZ7A 5FYJL 2J73A 3DGGA 2VDLB 1C7TA 1JHLH 1R33A 1YEIL 5ID0A 3Q1EA 3ZBMA 1AGEA 4ZX5A 2UXGA 2Y5TA 1UM6L 3CDZB 4Y5VA 1UGKA 3IFNH 1HOCA 5LGHL 4LLAA 2WP3T 5C97A 3JV4B 3P4NB 4R5TA 1OAQL 2APVA 2JXMA 3C6LB 2TRYA 3GB7B 2XI9A 5I1DA 5AVWB 1ZVSA 1I75A 3T0XA 3RWHB 1B3JA 1IVTA 4M5ZH 4WWKB 1DDTA 1WVZA 3G5YB 3ORJA 5I6PA 5B4MD 3RI5F 2EIZB 1BQRA 5EDXA 2XV6B 3MA7B 3QH3B 1LE9B 1P4IL 5CEXA 1S9XA 5A2CA 2H45A 4OCWH 2PABA 2VXUH 5ESQB 3VYNA 3BGMA 3KWWB 5FECB 4ZOCA 3PF2A 2D31A 1UZGA 1TTRA 3TJEL 4OFIA 1RP8A 3ULVC 2F5AL 4XE5B 3ZSSA 2IDSA 1KPVB 3GMPB 1DQDL 3FT0A 5IQLA 3S8FB 1XGTB 4FCHA 5H37H 2NSMA 4ONFL 4L8SB 2AXHA 3FO9B 4L8DB 4JG9A 4B41A 2DWEA 3MRKB 3PIQA 2O5ZH 5SWZD 1PY9A 4AENA 1M1XA 1XVSA 4JLRB 1FDLH 3NJKA 3PWVB 3EF7A 5E00A 4OZIA 1PYWB 3WFDL 1TYRA 32C2B 2WXMA 1JZ3A 1AGBA 1WT5C 1A4JA 4LSVL 3RWIA 5HVHB 4GRWE 2WZ5A 1RURH 1TMQA 4O2FB 3ECQA 2AJSL 3RGBA 2K6ZA 1SN0A 1IV8A 4XPAL 5IBUG 3FRPA 3OLEA 5DHVB 3MFFB 3R7QA 4BELD 5C07B 1EO8H 5GHWL 4G80B 2DDQL 5CJXA 1F18A 5JTWA 4RMWA 1D6EA 4YDMA 2FO4A 3VX0A 4HX1B 4URTB 3D48R 4J8RA 1H3XA 1ZGLM 2YA1A 2FBOJ 4IBZA 3CIAA 3TJPA 1H8NA 3TTYA 2PO6B 1ODAA 3ZOAA 5AG8A 3EOYG 4QEGA 2YC1B 2R4SL 1ZIBA 4HZ1A 4XNMA 2BH0A 2EIJB 2VDPH 4PBWD 2CQVA 5A2AA 1FFOA 3LY6A 5FO2A 4O58L 3MV8B 1U36A 3QDMB 2XKUA 3N50A 4QRRA 3OAUL 3ULUC 4FMFA 2AC0A 2EDDA 3CNKA 3W81A 4JHAH 4IOIB 5KBLA 3NCEB 4Y4KB 4GP5B 2OCCB 4K7PL 4BWWA 4BXSV 4TOYH 5JA9A 1BXXA 3BPCA 2K3TA 4A2LA 3HG1D 2CHDA 3RTQD 3QEQA 1K2DA 3G5VB 1OGPA 1A9EA 5E2VL 1S7SB 1NCCL 2D7TH 3V6ZA 4KKZA 1KWGA 3RHWK 3RY5A 1FZJB 1ZSDA 1I7RA 2OYKA 5EMYA 3B2MA 1KJMB 3KWVA 2NY3C 3BAYA 3IU3A 2GABA 2E59A 3S3JA 1ICTA 1U4FA 3CVHB 4LU5H 4PJGE 3V8OA 2X4QB 1TENA 5ABAA 1RZFH 1ACYL 5HYSG 2R0WL 1GTFA 2ENYA 5LXGL 5I28A 2A9CA 3PLYA 2XPGA 2AVFA 3V0JA 4D8OA 1ZCRA 5B38G 4LRNH 3ULAB 4K7PY 1UVQB 2QJDA 5IFJB 3QR2A 4IEFA 2IAMA 2ZJSL 3D85B 2WMPA 4G9FE 5HDBE 4APQC 5TFSL 1WA0X 1ZHNB 4OCRH 1MJUH 2GSIA 4DERA 3KWXA 1TJHH 4FZEL 2G5BA 3MBEA 1YNTA 4L3FA 4F1ZA 4EKXA 3QEGL 1IAOA 3L5JA 1OHZA 3BZEA 4X8JB 5AUMB 1NCGA 3KYKH 3BWSA 3SQRA 4KJPD 4H1LB 2QMJA 4WJG3 3C08H 3K6IA 4KKLD 4ZNCD 2Y2TA 2VLRD 2WVVA 3NJHA 4F15C 4Y1AD 5AAPA 2HRPL 4KK8C 3UGEA 3MGTB 5JO5A 1T03L 4P2RD 4QHKI 1NANI 5EZOH 2B77A 4EPSA 1Z9SB 4NUJB 1FYTE 3QORC 4PV1C 1Q72H 3N04A 5KOMC 1D9KB 3F62A 4JKNA 4R0LC 4JFFD 4X6DB 4AG4L 5DD1H 3TBVB 1NGXB 1HHKA 5BV7C 1PX4A 4HOWA 1OB1B 1ADQL 1I9RL 1QO3A 2R4RL 3L6FA 3SE8L 1RSFA 3THML 3UZEC 2YRPA 4DO4A 2BIPA 4MDJA 3OZ9L 1OSZA 4LNVA 1F3JB 3MACL 1UATA 2IIJA 3HRZA 3QCTL 3C09B 1FAKT 1PZCA 1G94A 2ZUVA 4X5RA 1PF3A 4JM4L 4N90D 4JFXB 4DKTA 3IDYB 1LEKA 1YO4A 1E28A 2HCZX 3OAYH 3MV9A 5INCA 3UL4A 4YIQB 3QDHA 1VDGA 4XMZA 5EFIA 3ZVVA 1DQIA 1THAA 3K71B 2F08A 5TE7H 3LZQA 1NCNA 2JVUA 1M05B 1RUQL 4MYPA 1BQSA 4QRPD 3M17A 2X3AA 5J3HD 2Q6WA 4GKLA 4BDVA 1HKLH 4TS6A 4EI6B 3HPJA 4BH7B 5I15L 1E5ZA 3QFJE 1WBZB 5D5ME 3UROR 3ZZ1A 4AVHA 1CGVA 2H3NB 1NOFA 1OCWH 3O6FD 4ZSOE 1FZOB 3VH8B 1QHPA 1ZLSH 2AW2A 4AE0A 4PB0L 3M07A 1WAAE 1GSKA 2GTZB 4R96A 1N8ZB 1SJHB 3US0A 2DF3A 1EHLL 1PLBA 4MJID 3QNZB 3N1QC 2OTWA 4M6NL 3KVDD 1J7VR 2OMUB 3RDTA 3GSXA 5JW3L 1T6VN 3GSUA 4Q97A 5K39B 2GTWB 4ENZA 3JTTA 1CIDA 3CBJB 4TNWK 3S37L 3PYCA 2X09A 3LSOA 3UYRL 1R5IA 4G6FD 2EYSB 2WLMA 3A23A 3WEXA 4Z0XA 1J87A 3BC9A 2VMDA 3BGFB 1RUML 4JG1H 4PJ9B 1M4KA 5L4FA 2Q76B 4WI2A 2DD8H 4FQXB 5IVOA 5T3XD 1MF2H 4TKWA 4A55A 4Z3JA 4LP5A 1F42A 4ZO9A 5DRWA 4M5YH 1ORSB 4FFWD 1HEZB 3VFMA 2OL3L 4G7RB 2CUHA 5D1QC 3D25B 1CPUA 2NNAA 2J57A 1FNFA 3GBNL 3PPEA 2J56A 1HZHH 4AIXA 2AQPA 3B56A 3MFGB 4HJGA 2BVOA 3HBGA 4R4ND 1U8LA 1O6SA 4IRSC 1AVAA 1BD2A 3B7UX 2XG5B 1DLHA 2KHAA 3GK8L 1E4XL 3AREA 3LD8B 4M03A 4R0LA 1CK0H 3EJZD 2EICA 3CFQA 1QSFB 3ESVF 4F91B 4EKJA 3T0EE 4NZ8A 2VUOA 5F72S 1RUPH 5FYJE 3MV7B 5C9JB 1CLVA 2FBJH 1QLEL 2G0KA 4UTBH 3ZHNA 4AUYA 4UQDA 3F65A 5EORL 4QF1B 2GJ6A 1XQ4A 5AVQB 4YK4B 5BZWB 4DF9A 2B0SL 2PR9A 4A66A 1XF2A 5DHYB 4U1NB 1Y18B 4F2EA 4N8VB 4KOBA 1RKRA 3S35H 4ZMZA 2O6EA 1LDPH 4NWUH 3DOSB 5BVJA 4JM2D 1YPZA 2EH8H 5C0FB 1IILE 1Q4NX 2CGZA 2YD9A 4ZFOB 4NQEE 3RIKA 1UJTA 3MA9L 3IVKB 4G8IB 3C60B 1P1VA 2BIOA 4GFTB 4WO4A 3DX8B 4Y2LA 4HFUH 4UF7C 5L2KE 1ZEAL 3V7MA 3BSGA 3OKDB 2DMHA 1BX2B 1W0VB 3PAVA 2ZOWA 2IG2H 2ZSWA 2BP0B 1U9KA 1IKOP 5I0YA 4WWKC 2BVPB 3FU6A 3KJ4C 2DQJL 1RIUL 5J6HB 1ZDSA 2J1KA 5E8PA 3Q5TA 5F9WB 1A1NB 1YMMD 2CPCA 3CVIH 4YAQA 5IMOA 2VZVA 1O6VA 2V7NA 3RL1B 1N4XH 2G3NA 2VQTA 1SZNA 2OPCA 3SKOB 2KZKA 3ABKB 4G3YH 1ZT4B 4JO4H 1XSJA 4P4RB 1AQKH 3R8QA 1JRHL 2ZWSA 2AJ3B 4Q74A 4KKCC 4YSQA 4XNXH 3D51A 4KZCA 2ZKWA 4LSTH 4L8SC 2QSQA 1OHQA 1FFRA 1I3GH 1X5IA 1KJ3H 5H2BA 3CU1A 1TTGA 4QOKE 5BW7A 3FS9A 4PLNC 3HI5H 5EU3B 3EH5B 3ULSA 4J5VA 2CJ3A 1LMIA 1XT5A 2FYVA 1EAPA 2FTAA 1KV3A 1F2QA 1AD0B 3FUHA 2EC9T 3C8HA 3KPRE 1RZIB 3BYYA 5DMIL 1XV8A 3UTTE 5DR5H 2NDFA 4OZHA 2H2SC 1XEDA 2O5NA 3PL6A 5D1QA 1D7FA 5AKSA 1BG9A 3UH8A 4C83A 2Z4TA 1E9PB 1QTPA 4NNPH 4NRZB 5BMFH 1A6ZB 2WLNA 1L9NA 2P24B 1EK3A 3HW7A 1MCPH 2R69L 3M8OH 4OBSA 5IUCA 5IF0B 2CIKA 4PBVC 4X6BA 5IK3B 1AI1H 1E7UA 3EAKA 2AJVL 2E46A 2MKWA 1QVOB 1NSNH 1KZYA 1VCAA 2CJTA 3A47A 4GW5B 4EQ3A 2R1XA 3DBXA 1INEL 4HWEH 2OSYA 3FNKA 2FH8A 5CSGA 5DQDL 4IRSA 4A6YA 4DZ8B 4F7CB 2NY2B 5DS1A 2F54B 4JN2B 4XH2B 3IJHA 5JXAL 3MJ8B 3CLFL 4LSQL 3ARVA 1OE3A 5CUSH 4M48L 3MUUA 5F7AA 3JWOH 3SDXB 3GINA 4YHKL 1MOEA 4M8VA 1I8IB 3EIFA 1G7QB 5HYQA 2WXHA 3O9WC 3FK3A 5D9SB 3U7WL 3GMLA 4Z7VB 5KN5A 4CKVX 1HC1A 1SYSB 4FYTA 2ZX5A 2BW4A 4W6WB 1WO2A 3V0HA 5D7LB 5H4ZA 1YG9A 5JXEC 4N2IA 5LVEA 1UOVA 1J9RA 1EANA 5KSBB 3B5TA 1G1CA 3RFRA 2XHNA 2B2XL 3CDZA 1E2WA 5FUZL 3JV4A 3KNBB 3P4NA 3QJFB 3CPUA 3GB7A 3KAAA 1GW0A 3C6LA 4LAJH 3U0TB 2X4NB 4MASA 5CEYB 3RWHA 3Q1SH 5CINH 4WWKA 3G5YA 4OQTL 1P0SE 2VT0A 3H6AA 1ZT1B 2EIZA 4TYUA 3QH3A 2FL5B 3MA7A 1LE9A 3P0VH 1NH6A 5ESQA 3VD7A 3KWWA 4P2YA 2N01B 4QXWA 5FECA 5IT2L 1SJMA 3SE4A 4NQVB 2QPDB 2EIMB 2Q20A 4DKAA 4JFWA 1AOHA 1WRFA 3CXHJ 2IGLA 3AB0C 1KPVA 2ICEC 3GMPA 1BQKA 5JYLA 2X4PB 1XGTA 1MFMA 4LVHB 5CF3A 2J20A 4PG2C 1PLGH 5EC1B 4L8SA 4QRRD 4F9PC 3FO9A 2CKBL 4L8DA 4J12A 4JNXA 4X5QA 3LPGA 2PWGA 5DO2C 3MRKA 1BJMA 2NY5L 4Y1SA 1P6AB 1U6AH 5I1IH 4X6FB 4JLRA 1BZQK 2H1PL 3PWVA 4JFSA 4Z76B 5CP7B 2FJSA 3FXIC 1PYWA 5EZIH 4GJTB 3WKML 2Y7MA 3K4DA 1GVIA 4PB9L 5FPIA 3QEQD 32C2A 4AV4A 4BD4A 1INDL 3U6XA 5HGHB 5GGVH 4Z7QF 4ZX6A 1XF5B 2Y36H 4O2FA 3L5XL 4L05A 4B9KC 1XGPB 3MPCA 3AMKA 3QHFH 1D9KC 3QIBB 3ZN6A 4XWGL 3NDYE 4LLYB 5DHVA 3MFFA 3U30C 3BAJA 4UIKL 5FYLE 5C07A 3DX6B 4G80A 3MQIA 4NT6B 2YUZA 4LSUH 5HSFA 2YQ2A 3PFUA 4K7FB 2ENQA 4HX1A 5FLVA 1A7QL 2E6PA 4ISVB 1FWXA 2DQGH 4LCYB 2QGCA 4M02A 2VDRL 2PO6A 5IJCC 3TFKC 1MCLA 2DLEA 2YC1A 4DP8X 1TUPA 2IAMD 5C3LD 4XN7A 2P5PA 1IZKA 1CFVL 3MRQB 3QFGA 4BFEA 1JXDA 3LNDA 3O2WH 4P04A 2EKJA 5EOTB 3AADB 3MBED 1T2QH 5GGRB 3H9SB 3MV8A 3QDMA 2XFXB 5IW6B 4IOIA 2Y69B 4L9LB 1ANUA 4F5CE 4Y4KA 5JIIA 4DJMA 1TMCB 1A7OH 1MIML 3APDA 3WHXB 5E1AB 3NA9H 1NICA 5JXEA 3E2HB 1JPEA 1KTJA 3G5VA 4NKMB 1F4AA 3ZDXF 1H3PL 1S7SA 3DOHA 3EGSB 5AWNL 1FZJA 3WN5B 4DUXA 5IFAH 3EZ8A 1IBYA 2HPTA 1KJMA 3NCXA 4PJXF 2COQA 2ZPKL 4YDLB 3BN9C 3CVHA 1OB0A 4AYMC 2X4QA 4HC1L 1XAKA 4KC3B 2E7LC 4IIQC 2C9AA 2RCSL 2A6DB 4PWIA 4WEBH 4GSDL 1A4AA 4ZUWB 4HS8L 5J13C 2VWEC 2B1AL 3DURB 3VI4F 5J4MA 3HNTH 5LG1A 1CT8B 1I1FB 2ARJQ 4DUWA 3CFJB 1QHOA 1A6WH 3LKQB 3NSYA 2ZYIA 1RHHB 2XKNB 3SKNB 4G6KH 3SYCA 3MV9D 1UVQA 2P26A 2UXVA 4HPYH 5IFJA 3D85A 2ZCZA 3QNFA 4FQXC 3RWEB 4JZOB 4H7VA 3QJVB 3JYCA 4DEUA 3QZWB 5DJ0B 5FX3A 2C7FA 1WA2X 2FX9L 1AG6A 3ZE1E 4NYLB 1FO0H 2G5UA 3MRIB 2WNWA 4ENEC 3IJSB 4PJ6A 4S0SD 1CI3M 4AKQA 3AXIA 3OL2A 1NCWH 4X8JA 3E8UL 2VJ0A 5AUMA 3BQUB 3NIDE 2W80C 4MLSA 4H1LA 1NMCC 3VM5A 5I30L 5AD0B 4RH4A 2ZD0A 3DI2B 3HPLB 2AJUL 1HZKA 5CLYA 1MFDH 3MGTA 3N0AA 3SOBH 2OJEB 1Z9SA 4NUJA 1TOXA 3VGGA 3RP1A 1D9KA 2NY3D 3LD8C 3MRRA 1ETZB 4X6DA 2EDQA 2MH4A 3EOBB 3MLPA 3TBVA 1NGXA 4EN2A 3ESNA 1OB1A 4XRCB 1J0JA 1O9WA 2VAAB 4DP0X 1RHFA 3DXAB 4Z0BL 2L0DA 3K5SA 3X1NA 4L18A 1CFBA 5CR1A 3W5NA 1F3JA 2PXYC 3JVFC 4NWTL 1N67A 1JZHA 1CD9B 3FN0L 1KJ2L 5CGYC 2JB6B 5KBNC 2D9CA 2J8UF 5J1SC 5T1JA 3S88L 3VD2A 1AZNA 1R3HB 1TFHA 4JFXA 1AY1H 5ISZE 3A4DA 1WCQA 4OT1L 2FDBP 1JZGA 4YIQA 5F96H 2H6OA 5JORA 1H5BB 2GBVA 3HFML 3SY0B 3K71A 1QYGH 1QFWH 4IRZH 4HT1L 1AIFB 1PBYA 4WHYG 1AIZA 2CWRA 1UWEL 5DUMH 1A7NL 3J27A 1DCEA 1TZAA 1MWAB 3C60C 3ISWA 5IVNA 4EI6A 1OSPL 3KBEA 2YUVA 1QRNE 3FBKA 3TVMC 4BH7A 2RA1A 1BFSA 4RGNE 4BK8A 4M4RB 4W4OA 4KJWD 4PP1D 4YSRA 1WBZA 4ZS6C 4FXKC 3DUSB 5JUEH 2H3NA 4KK8D 3VH8A 1FZOA 1CLOL 2CK2A 4X5XB 2DKMA 3ZO0A 5HHOB 4RGOH 4NHUB 2GTZA 4MB1A 4B60A 1I9JL 2V3EA 3EH3B 1N8ZA 1BD2D 1SJHA 3V5KB 3ULVF 3QJOA 4YVNA 4RMQA 1CYWA 1ZHBB 3QNZA 2FT8A 4BUHA 4D8PB 4PJGB 5CZVH 5E51A 4PS3A 2OMUA 1VFBB 4XC3L 1X5KA 1JZDC 2CM5A 2UZYB 2DBLH 3CSFA 4A7SA 5K39A 2FZ3B 2H32B 2GTWA 2VC2H 1NC2D 1G5GA 2WHVA 2JELH 3DNKA 3EYOB 4AL8H 4JFUA 2GJ6D 4TSBH 2EYSA 5CD5C 2ZICA 4IGBB 3TCTA 5HDBB 5DDHB 1CG9B 4PJ9A 1YCSA 4RRPA 3VFUB 2Q76A 4HP5A 2XIBA 4FQXA 5KYYB 3AXHA 3KGTA 5IW3A 4PJ7F 1EVUA 3FMGL 4TNFA 3RKDC 5SWSD 2V3FA 1ORSA 1HEZA 1ZA3B 5I8KH 1PG7H 1QI4A 4B0MM 3T3MF 3DTXA 3GNMH 3D25A 1MELA 1SMAA 4WO4D 2GT9B 1WGOA 1S6NA 8FABA 1E4XI 3SCMC 4UQ3B 5AALA 3SDYL 4BE5A 3CZFB 1NDMB 2OTPA 5DRXB 4Y9EA 4EIBA 2VMJA 2G30A 3BDYL 4QJ5B 4YHML 3CVCA 4G2AA 4G1MB 4ADGA 4OSUH 1X5YA 3DSFL 4GXFA 2DQHH 4HYTB 4KHXL 1P5VB 3U7AA 3WE1A 2AXFA 3BVTA 2XG5A 1UZ6E 1W2KT 1EQWA 3T3PF 5DHEA 1QSFA 2NY0C 1YJDH 4OF3A 3X2QB 1W80A 2BVTA 2Q3ZA 4CNIB 1CF8L 2V9UA 5KG9B 1CE1L 1S7RB 3E38A 3EJPA 5HDRA 3BFOA 3BGAA 3TASA 5ICYB 3MV7A 5C9JA 3HCVB 4RAHA 1DBJH 5HHPB 4K9JA 3UZQB 2QZ5A 4QF1A 4RFOH 2X2IA 1J5IA 5BZWA 4PJDE 1BAFL 4JQVC 3T0WA 2WJ7A 5DHYA 4U1NA 3MUJA 2E7CA 1Y18A 1LYQA 2VTFA 2DIJA 4N8VA 5EF0A 4G71B 3S4SG 4F7MB 3DOSA 2WXPA 2ZOTA 3PL6D 5D1QD 5FF6B 5C0FA 1A8ZA 3ILPB 4BWTA 4FXGC 4ZFOA 5C70A 5SX5H 1RUAL 2ICCA 3C60A 1I8LC 3ISYA 4GH7B 3DX8A 2N7BA 2YLKA 1XL4A 2Z1KA 3BUQA 5D5MB 4B9JA 5GSVB 1KB5H 3MLXH 4CBPA 1S5IL 3OKDA 3HE6B 1W0VA 1X4YA 3PAUA 2BP0A 2BW5A 3EJYC 2BVPA 4IRSD 1NINA 3GHBH 4KTEH 5EO9B 4ZJ9A 3WNIA 3O6LL 3GFUA 1TTAA 5J6HA 1CO1A 3GXMA 3VD3A 1A1NA 5FIEA 5DZLA 4IJ3B 4N2NA 3Q5YA 1ZV5A 3C75A 3RL1A 3TN0C 1KB9K 5CCKH 3GTVA 3SKOA 4BQBA 4LCIH 2LAGB 1ZT4A 1EPFA 4P4RA 2JMRA 2F53B 2AJ3A 1NLBH 1D7BA 2IMMA 4UTCA 3IU4H 2X4SB 1JZFA 2WKOF 3I2CH 3EXJA 1G6RB 1UCTA 4H0LC 3AU0A 3TJHD 5EU3A 4G7VL 5I74C 3ARBB 4NENB 1E8YA 3MN8A 1AD0A 3R4DA 4HIQA 4QNPE 3WMSA 1E0OB 1RZIA 2B4CC 2F61A 5LBGA 2R0LH 3IYLW 4LOUC 3WO4C 5TQ2L 1RFDL 1RLWA 4CJ1A 1FPTH 1I82A 1YEFH 1E9PA 3F3HA 4NRZA 3SQOL 1A6ZA 3SHSA 2P24A 3EFFB 3BKML 5IF0A 2H8PB 2QLVB 3C6LD 3RU8L 3QIBC 1HZLA 3JWOC 4MCNA 4XVUC 5IK3A 4FNQA 1QVOA 1LDSA 4GW5A 2Q7AA 4Q0XH 2PYEB 4WWKD 5AENA 2NCEA 1JPTL 2FWLB 3HN8A 1DQVA 1J8RA 1FG9C 4JG5A 3VSQA 1IGYB 4DZ8A 4F7CA 2D0HA 3RA7L 1OF2B 2F54A 4JN2A 4WAFA 4XH2A 3IPFA 2F7RA 3MJ8A 1TO5A 1X7QB 5LBVA 4KY1H 1UADC 2WOBA 4ZMVA 3AGWA 1T7WA 2PP9A 1HH6B 3SDXA 5JOPE 3IAPA 3N40F 3Q8CA 4NQDB 4PLKD 3AS3A 1BBDH 4KROB 1CUOA 3I02B 1I8IA 1MW2A 1G7QA 4QT5B 4QTIH 2VCOA 4J1UB 4DT2A 4M1GH 5D9SA 3L1OH 2XACC 2X38A 3H54A 4JPSA 4XOBA 4Z7VA 3CDFA 4EZJA 1KB9J 4FNLH 2BVYA 1EXHA 1SYSA 3OBAA 4PJ8C 2WUCL 4MAUH 2QPEB 5D7LA 2WD0A 3SGJA 3UTZB 3E2HC 3BUPA 4EMZA 4HJ0D 5J06A 5KSBA 1OSEA 4ABVA 2MTPA 4X8GA 5IGXH 1KV7A 3TEZA 2R56L 2NZ9C 3X12A 3KNBA 3QJFA 4YO0B 2A9AA 3U0TA 1VGEH 2XQBL 5C07D 3ZZQA 2X4NA 4UNUA 5CEYA 3MNWB 4W9GC 5L8JB 1OQXA 5FB8B 5BOPA 2Y5QA 1MFEH 1ZT1A 3W38A 2DQEL 5B3SB 1ZS8B 5FKAB 4FJYA 1PEZA 1A14H 1GSMA 2FL5A 5LGKA 1OOAA 1ORQB 2PO6D 1GZPB 4ABQA 3HN5A 2OSXA 5AZEH 4EE2A 4NCC1 2HX7A 1A1MB 3D4YA 4NQVA 2OK0H 3BWUF 4KV5E 4JVWA 5JIPA 2WBJC 2NT0A 1N0LB 4FTDA 2X4PA 3CSGA 1WFTA 2B14A 3MV8D 4LARL 4L2YA 4XR8C 3O81A 5EC1A 4ALAH 2A99A 1KENL 4QOKB 4FG4A 4NM4H 1DSFL 3U1SL 4QRUA 5I23A 2AK1L 2BRRH 2ED9A 5I71B 1AC0A 4X6FA 3KPRB 3BQUC 4Z76A 4K55A 3UTTB 5LGJB 5CP7A 4G11A 1DJXA 1W72H 2HZHA 5DD6B 5IEHB 2N56A 4N4YB 5DD5H 1UYWH 1D3CA 5TE6H 5JXED 1A66A 2HX9A 3PHAA 5HGHA 5T33H 1XF5A 1J0ZA 1XGPA 1QTSA 4OLVL 2YMXL 3NAAH 5FFGA 1DEDA 3QIBA 3DPBB 4LLYA 4HF5H 3S34H 3HR5B 4DZBB 2I69A 1G5AA 2DQCH 1T4WA 3DX6A 3U9UB 3NQIA 4JDTH 1DBML 4NT6A 2VNCA 4K7FA 2NX5E 1CDIA 1OP9A 2W0FB 4NUPA 3KPPB 3GSWB 4ISVA 1F13A 4LCYA 5C6PB 3IDMB 3T4AC 4YHNB 1NEZG 3QEUB 4G42B 4OTXL 3N9GL 4LVNB 4FFZH 5TE4H 3D85D 4N2BA 3V4VL 2DV6A 3MRQA 5BRPA 4CDHA 4NO0B 2D2OA 5EOTA 1X9QA 2LFEA 4WU7B 3KLSA 1EJFA 2XVGA 5GGRA 3H9SA 3P9WB 2VLKE 2XFXA 4M61B 3UBXI 1DQJB 4FQPA 3QIWC 4KRLB 3ARPA 5GS0H 5IW6A 2WLIB 4HUVB 3CV5A 4FQ1H 4EIUA 1HKFA 3I3BA 4L9LA 1AKJD 3LN9A 2PCPA 3P1VA 1HL9A 2HLAB 4OFYA 4UQ2B 4YGVB 5DGQA 4G83A 4L0PB 4P59L 3L3KB 2JSFA 3D4CA 2R27A 3UAFA 2FK9A 3WHXA 5E1AA 5C0IB 1BF5A 5DC2A 5K9OB 1E27B 3WKQA 4NKMA 4AIZB 3VU2A 4OZFG 3EGSA 2XZQH 4NZTH 3WN5A 1QBML 1D9KD 4AE1A 3KPTA 3X14B 3BZDA 1KCRH 2QL1A 3NT0A 1E4KC 1EJ6A 3CSPA 3IXAB 3O4LE 4ONGL 4IBWA 1ES0B 2A6DA 2BZ7A 1T7YA 3L16A 4ZUWA 1A3RH 3DURA 4EZKA 4GAYB 1CT8A 1I1FA 5F6IC 4AIOA 2O26U 15C8H 3CFJA 3LKQA 4G8FA 4OD3L 3V52H 1RHHA 2XKNA 4IGBC 5F89B 3SKNA 1GZHC 4MLIA 1FP5A 2GJJA 3ZDZF 3RWEA 2ZWNA 4JZOA 5LAXB 4ZD3H 2NXZC 3K1KC 3QZWA 3Q44A 5ALBL 4WENB 5DJ0A 1T0PB 4YDJB 3Q48A 4O02L 2FH6A 4DKFH 3PXHA 4NYLA 1VF5C 3I9AA 2BIIA 3MRIA 4Y89A 3IJSA 4APXB 1MY5A 3BQUA 4GXVL 4ZPTB 1C5CL 5LBSA 3VWJB 2WM0A 4AQEB 1OAXH 5GSRB 4ETQB 4A63A 5AD0A 2ZX6A 2BIHA 3EO1B 1H6EA 3HPLA 2ESVE 1TQVA 4UV7L 4XXCA 2ARWA 2ZCHL 2AXJA 5JZ7C 2HG0A 4G6MH 4GY4A 4IBUA 2ARJB 1SOSA 4M7JH 3BD5A 1PY4A 3KMDA 1ETZA 3EOBA 3BN9D 4DGVL 4F8QA 4LVOC 2K1MA 4XRCA 2ZUYA 2VAAA 4X9BA 5E4EB 1OARH 3DXAA 4NM8H 4A6YH 1KXHA 1O7SA 2VH5L 4PEEA 2IVFC 1O75A 2X4RB 4YHLL 2EEAA 1MXDA 1T6BX 5FHBL 3BSZL 2VZTA 1I8MB 4UT7H 3T4AA 1EBAA 5CN1A 4JHUA 1R3HA 4NIKB 4PJ9D 4NPJA 4HCRL 2WP3O 4FHBD 4FQXD 4BFFA 4F24A 1EO7A 1KBKA 1J9QA 3RE0A 3WMPA 4N2DA 4QRTB 1H5BA 1CL7L 3SY0A 1F02I 2QQLL 3B9EA 2OZ4L 3TXAA 1EVTC 1AIFA 4N20A 5DEFB 4ENED 3HKFA 3LS5H 4MGXA 3EFOB 2VN7A 3GXIA 1F0LA 1MWAA 1VADA 5IESL 4JN1L 3S6CA 1CFQB 4GG6E 1W6WA 2VDNL 3F12B 4M4RA 3U6XS 1U3YA 4PJCF 1S9YB 1VEOA 2FWUA 2VDLH 3DUSA 1MCEA 3HE6C 4TF4A 2EXWD 3UP6A 2BSDA 2VO5A 4M43L 5I75B 1NBCA 1J05B 4X5XA 4XPBL 5HHOA 3GS4A 2WUBL 4AEIH 1Y07A 3OLDA 3V5KA 1QKZL 1IKFH 4D8PA 1NFDE 1QSFD 4PJGA 2V4LA 1J10A 2VQ1B 2GY5A 3EJCA 3NIGE 4NUMA 4ELME 1VFBA 4H8HA 3AQDA 4I89A 2UZYA 2VB5A 2AABL 3BKCH 1NIDA 2FZ3A 2H32A 1MFCH 1D5ZB 3K81A 2PXYD 3MV7D 4FG6D 4JHWL 3BIKB 3VTTA 5TTRA 1HU8A 1N7ML 3EYOA 5D7IF 3PJLA 1OTTC 3BPNC 4IGBA 4EUPG 1GZHA 3OD3A 1CG9A 5DDHA 3VFUA 2EDMA 4KDTC 3N1GC 3KGSA 3HLAB 5KYYA 3ARBC 1TJXA 1QW8A 4JQIL 5MHSD 3SDDC 2NQCA 1ZA3A 3JWNE 4ODVH 2F7QA 3FTWA 3C60D 1A9VA 4YE4H 3UG5A 2H6PB 1YDPB 4N87A 2NTSP 2GT9A 4IK6A 2WZ6A 2OSWA 4PVMA 3LS4L 4WFED 8PAZA 3Q2WA 4UQ3A 3CZFA 3ZKQD 1NDMA 3UTPE 4K23L 3S36H 5DRXA 1QLEB 1A0QH 4MVBC 5F7EH 2JJVA 1OOWA 4Y7MA 1XR9B 4CC1A 3D05A 5AOJA 3MCYA 3I50L 4G1MA 4NI6A 1A1OB 3RYMA 3UGXA 4NKIL 1P5VA 2APTA 4M8RA 4XCFH 3NTCL 4N1EA 1GC1C 5DHVH 1MAKA 3T0EC 1R3IL 5E5LA 4X7CC 3W2DH 4CNIA 2OMZB 3HEIB 5KG9A 1ID2A 1S7RA 5ICYA 5DI8B 4R8WH 4YLCA 5JPNC 1R0AL 3EUUA 3HCVA 1W8NA 3G3LA 2AI0H 4P2OB 1UJ3C 5HHPA 3UZQA 5CD5D 2X4UB 4JFQB 1XB6A 3MLSH 1MJ7H 2XYCA 4I87A 1V27A 3QA3B 4Z7WE 4RRPG 4YSOA 4AGLA 1GCYA 3TYFB 1OPGH 1T1XB 3UJIH 2CH8A 3HI1B 4DO5A 2GEEA 1X9RA 4WI9A 4B3EA 3NJLA 4F7MA 4K3GA 4G6JL 2XZCH 4IOSA 2RR3A 2R2HB 3U4EB 5IVXB 5FF6A 4HIJB 4DQAA 3ILPA 2PNDA 4GEJA 4K71B 5F3FA 3CQPA 1CVSC 1LM8V 1PEWA 1QRNB 2ED6A 3EFDL 3J07A 4R6UA 3KLHC 5D71L 5TDOB 5D5MA 2XIDA 3CHSA 2AQNA 3CWGA 1NWOA 3H2PA 5GSVA 1I8UA 3SZKC 2QTEA 1TJMA 3HE6A 1D6VH 3SDAB 1T7XA 1T3FB 4BQ8A 1WAAA 3OAZH 3GSNL 1BREA 1MREH 4OIFA 4X2UA 3TO4C 2VQUA 4W9CC 5EO9A 4UINH 1MFNA 5FYKU 5D1XE 2F54D 2HT4D 2L3BA 2VRQA 4K7PX 4HIXH 4AMKL 4UWQB 2ZTBA 1BJ1J 1XSOA 2I60H 3T2OA 3HS0B 2CCWA 1I1AC 5AOIA 2IPUG 1BQLH 3DK0A 4M9OA 1QMUA 1RVFL 3MYJB 1VZGA 1OAJA 2FD6L 2F53A 3BH4A 3WIHL 2X4SA 4UCFA 1G6RA 1NUNB 2FX8L 4KDTA 4S1SH 1OP3H 3UEZA 4XAKE 3RBSA 4YXHH 4OLXL 5CFAA 3ARBA 4NENA 2NQ3A 4CC4A 4UNIA 4EXPX 5EA0H 1GZQB 5JQHC 4WO0A 4DNLA 2YFOA 2VOTA 3LPFA 5D7LD 2RHEA 1GIGH 2G3ZA 5BVPL 1S7TB 4XOCA 5G4MA 3CFCL 3EFFA 2Y2YA 2QHLA 4GAJH 2H8PA 2JJTC 2MMXA 4GAGH 4J28A 2LU4A 4QTFA 4DPBX 4I1PA 1CBVL 3O3DB 3CTTA 1MRCH 2X42A 2PYEA 2CRIA 1QUNB 1LO2H 4H5SB 4H8WC 4MFHA 4PPTA 3M7OA 2MPVA 4FAAB 1IGYA 2GUYA 2BOCA 1A25A 3BZFB 1OF2A 3Q9QA 4DH2A 1HQ4B 2A6IB 4KKPA 1IT9H 3EYSH 1CZ8L 1LO0H 3BKJL 4GW4B 1X7QA 3C5ZB 2EE3A 2HSIA 1FIGH 1HH6A 1KN2L 2X2HA 1U8PB 2E9WA 4NQDA 3QSKB 4PJFF 2YFNA 1SHMA 3I02A 5KS9F 2X0WA 2P48B 4QT5A 2EE0A 4EUPH 4J1UA 3WI9A 1EX0A 4QDGA 1YYML 3DROB 3UG3A 3GRWL 3H42L 2J6EL 2V5RA 4OI8A 3FB8B 5DO8A 3S5LG 3BN3B 2CE6A 5A43C 3UTZA 1F8TH 2AEPH 4J3TA 2OFQA 1N2RB 4AOFA 3QIBD 5FYKH 1L9QA 4P23C 3B2VL 1AJ7L 4I18B 4YO0A 3BAKA 4Z9KB 4FA8A 2CO6B 1GYAA 1MCWM 3D1MC 4GKOA 1A7RL 3K0YA 3MNWA 1KDJA 1NC4B 1FORL 5FB8A 3EXLA 4YHYC 4YPJA 3WFHB 2X6MA 1ZS8A 5EIQA 4JPVH 5FKAA 2DZEA 2FNWA 1ORQA 1GZPA 3HUJE 4UQBA 3I74A 1QFHA 4QIRA 1A1MA 3GI8H 2FR4B 3IPBA 4XNBA 4WI5A 3WDIA 3J8F7 2XTJE 4CGTA 2OP4L 4HUMB 1N0LA 3H9SD 1AR1C 1OAYH 2Z31C 1OT4A 4JDVB 4MKTA 4H88H 1WFOA 3DDGA 4QOKA 4YVUA 4HJ1A 4JFOB 2DLFL 3MUY1 3UTOA 2MNWA 4OZGF 4OFYD 1RY7B 4LSSH 4GKNB 2GI7A 3KPRA 1ETJA 1ZVNA 2WN2A 4P46B 1L7IH 4PJ8D 1HYSD 3UTTA 1G9NL 2FQDA 3W82A 3FU9A 5LGJA 5DD6A 3KHQA 3S37X 5IEHA 1BWWA 4Z7NF 3P3RA 3B7YA 2XXMB 2VDRB 4NI3A 3VFOB 3QJHB 4KH9A 1TLMA 3GWJA 4XN2A 3O0RH 4ATTA 3F7PC 1QEXA 2NZ9D 1PZAA 1ZV9A 2LQRA 4XMPL 1HIMH 4Y4HC 3DPBA 4JHZA 3HR5A 3MRJB 4DZBA 5F8QC 4MXVE 5HDQL 3KH4A 4PWJA 4YUEH 2XZAH 5E4EC 3U9UA 2M1KA 2NY7H 4YXKH 1YRKA 3O2VL 3WHE0 4JRLA 3CMGA 4BSWA 2W0FA 1X4XA 3KPPA 3GSWA 4HZAA 5ANME 2CRZA 1SMDA 3P4LA 3IDMA 4CKQA 1EXUB 2IEPA 3EJRA 4YHNA 3QEUA 4G42A 3RX9A 1WWWX 4TNVK 4M1CD 4MJ4A 4IDJH 4FQJH 5CZXD 3UBXB 3IAQA 4EI5B 2FGWH 2DMGA 4P5TC 4NO0A 5AVZB 1GS7A 5CZRA 2DYSB 4WU7A 1WWBX 1QPKA 2WNXA 3ABMB 3FTZA 2FECL 4M61A 1DQJA 2EE6A 3QDGE 4KQ3H 2WLIA 3HKZA 4HUVA 3OHXB 3FQXB 2XX1A 5K1JA 5KVDE 3BQUD 4YGVA 2HLAA 5F8RC 4UQ2A 3PABB 4LCWB 2P3YA 4BUQA 5DLLA 4PWHA 1NIAA 3MODH 3L3KA 4L1TA 3T65B 1X6NA 1IBGH 5J6SA 2IPTL 2Y6TE 3ZKXB 5C0IA 3A3YB 5K9OA 1E27A 4K9EH 5I75C 4JGMA 4Y5YC 4AIZA 3BEWB 2B1HH 3JWNG 2BVEA 1BDYA 4U4IA 4TQEH 4X9GA 1RI8A 5F7UA 3X14A 3C5SB 1RERA 5FV1L 3BRFA 3DXAD 3IXAA 2QTVA 4NZRH 3QYNA 1ES0A 5JQ6L 3NFPB 5IEKB 3IJYB 4GAYA 3OVUB 4Q9RL 5HDOA 3LPPA 3ZE2F 3AWGA 4R26L 5EIVA 5F89A 5D2LE 4AEHL 4U3HA 3E3QE 5LAXA 3KPNB 3HB3B 4YGAB 5IREA 4RZCB 1VENA 2G2NA 2PWFA 5KUMA 5EF1A 4YDJA 1S78D 5F7HA 3QEHB 5E23A 1YMHB 4R5XA 2CRMA 1ADQA 4MXQC 4APXA 1ZV2A 3DWTA 3NJNA 1KC5H 4ZPTA 3VWJA 3AJ7A 4AQEA 1G43A 5GSRA 3BP4B 4ETQA 3ZDYB 1NMBH 2IH3B 2GVYA 1NOAA 3MBXL 3EO1A 2IQ9H 3CDGB 4HK3J 2K6YA 1EA9C 1ITCA 5HHOD 5BRZE 3T4YA 12E8L 2VM9A 2ARJA 1IGJB 3GZQA 3TBYB 1LO4H 3D4GA 3QRLA 4JRXE 3VGHA 2A6KB 1VJSA 4X7TB 4GUQA 2Q7YB 4LDLB 2KBGA 3WNNA 3TTSA 5GGTL 5AKVA 1J5CA 4ELMB 3DJZA 4BE6A 1KTKE 2X4RA 4NBYB 4DHLA 1CL7I 4UV4L 1BXAA 3IFPB 2ZQKA 4P2OC 3K2KA 3WNOA 4Z77B 3N2JA 3NCWA 4JBSA 3SO3B 2FJHB 4IGBD 2ZXGA 4ESKA 3CZJA 3VFGL 4XHJC 3BT2H 4MMYB 4HJJH 2NXZD 4POUB 3AACA 3MJGX 1DQLH 4QRTA 2BFGA 2OSLA 2BP8B 1XH3B 4XB8A 4HS6B 1DQMH 4TXVB 5CMAB 1U21A 3ZYZA 1SVZA 2P5EB 5DEFA 2WXNA 2CLVB 3EFOA 4OF7A 3D50A 5B1BB 3CX2A 3VA2C 4PLOB 1C12B 1PKOA 4RGNC 1CFQA 1FE8H 4WHDA 5HP5A 4WW2C 1CXFA 2HG5B 3F12A 1DVSA 4UT9L 1S9YA 2Y06L 3F7QA 4YWGH 1SN5A 1FV1B 1J05A 4JB9L 5JZ7D 35C8L 3QCUH 2XICA 2CAKA 4LPUA 4DPCX 3SPVB 2VQ1A 3SO5A 1L9PA 1N64L 3HS0C 3N1PC 3MRDB 3VI3B 4E42B 1CU4H 4U1JB 2FJFB 1P7KB 2YKLL 3A24A 3Q01A 3LKRB 5E4AA 4KHTL 4M56A 4CGUB 4NQSB 1D5ZA 3D12B 3WTTA 2AJYH 3Q7JA 3MR9B 3BIKA 1MVYA 2VABB 1JFHA 5FS5A 3MZGB 2G4EA 3FB7B 4POZD 3BSHA 4GRWF 2X9XA 1DLFL 2N1TE 5FFOA 3T2NH 1XB3A 2GIXA 4OCYH 4IOSD 1IAIL 1Z3GL 3GQFA 3AWFA 3QCVL 1JZ2A 3L3IB 5B1JC 3L4WA 3BFWA 2H6PA 1YDPA 3E6HB 3IGAB 4G7YL 5DUPH 3VG0L 3QJSB 4U05A 3HE6D 3MXWH 3VACA 4FF9A 3IDNB 1PG7W 3N5AA 2QFRA 4LHJB 3ZT6A 1XR9A 1G9ML 4KMLB 1L9MA 5DJ6B 1A1OA 3PS6A 1HCFX 3NFNB 2V2TB 2DYRB 1JPSL 4E9SA 4N0CD 5HHME 2W9LA 3I9IA 1BYNA 3RILA 4B9YA 4HUWB 4PJEB 2AAAA 4TVPD 5EHFA 3PGDB 3VXNB 1U8IB 5HHQB 2VE6B 3M1OA 4NIYE 2OMZA 4Z8FH 3QDJE 5T3XL 4OV5B 1MCDA 5IJKC 2WWMD 5DI8A 1CFNB 4XVJL 1F4WL 5CJBA 4JG0L 2F53D 1SXCA 4P2OA 2OTUB 2V8MA 2X4UA 4JFQA 2FCBA 2XY1A 2ZCLL 1H3VA 1R1CA 1UKSA 4U1LB 4X4YB 3TYFA 1SXNA 4A2EA 3FTUA 4F7PB 1T1XA 3ARBD 3HI1A 3QIUB 5A6MA 5I73B 4KX8A 1OF0A 2K8QA 5GJTL 5LN4A 3EO0B 2NY1B 2XTSA 3IDGB 2TAAA 3LQAL 4ODUB 2QSCL 4P57B 4QXUH 3TYGL 2R2HA 3U4EA 5IVXA 4HIJA 2FX7H 1ZGLA 3BX7C 4I3SH 1KCVH 3MOAH 2IJ0C 3IJEB 2X44D 1MCHA 1QRNA 1M3IA 5E94B 2VDMH 3NZHL 2J71A 3P4MB 3CSBA 4F7KA 3T2LA 4FQLH 3UADA 1AYRA 1FNSL 4J3UA 4MVBD 3BIAX 3T8MA 4S1RH 2PCFB 1JHKL 1T20B 4BRJA 2PYED 3SDAA 3D3VB 1T3FA 1JVKA 1I7ZB 4RMUA 3H1ZA 2XYBA 2IGFL 3CHQA 4JO8A 2HMIC 5B22A 3VE0B 3LHPH 3SPCA 3L1FA 1Y6KR 3CZEA 5KWYC 3HS0A 2QVTA 4RX4D 5FYJD 4K8RH 2HRLA 2XQYK 2YPLE 4ODWB 1AZZC 4NQDD 3MYJA 4KROD 3BESR 3VDBA 5MERB 1YA5A 5GRZA 1R9FA 2R69A 4A38A 4N2HA 3CN3A 1A3LH 3HBZA 4B96A 5JR1H 3GM8A 3DECA 1BHGA 1TCRB 2BP5M 4JVUA 4FRWA 3BMWA 4KAQL 4YJZL 2YD4A 3FCUB 1GZQA 3MTXA 1A6UH 3PWLB 5I6NA 3C2AH 3FW6A 1ZHLB 3GI9L 4HK0B 5AZ2H 5B1JA 1S7TA 4GLRI 3KLHD 4D3CH 4G1EB 5D8JH 3H3PH 5HHXL 1TO4A 1Q1JL 4PMFA 5JW5B 4OGAC 1F1GA 2GHWB 3O3DA 5LCVL 3BVVA 1A6TB 2WQSA 3ZT5A 3UDWA 4EN3C 3U0WH 1QUNA 1SVBA 4XNZC 3APNA 1CD8A 4W9HC 3CQFA 3FSVA 3DHJA 3APMA 3BZFA 1F90H 4IBSA 1HQ4A 2A6IA 3VNYA 5IB3B 3MJ6A 1QI5A 4GW4A 2O6PA 1C9SA 4PD4K 1CMOA 4MJ6B 2CDGB 2V9TA 1RIVL 1U4EA 2Z92B 1IC4H 3MU3A 4JQXC 1BVNT 1CGSL 1U8PA 3C6SB 5EWIH 1WG3A 4BCZA 2OYPA 3QISA 4Z7WB 1XSIA 2F1EA 3AUVA 3SIKA 3VFNB 2GG1A 4QOKD 4JMNA 1RK1B 2KPWA 5E6UB 1A6VL 4K2UL 4LKCB 3CZLA 3DROA 1GCFA 3KPRD 4GIPD 1VEPA 1ITBB 4EEEA 4OQTA 3UTTD 5K9JH 3ZTDC 25C8L 3FB8A 4HWNA 1DVYA 4H0GA 4GAFB 4S1DD 1MHPL 4DN4H 3ZKXC 3S48A 4DQOH 2UV3A 3L3OB 1TQWA 4I13B 1MWAH 4M7KL 4AQ1C 3BVXA 3O45B 1JYNA 5DVMA 1N2RA 3K6FA 1IE4A 1HXKA 4I18A 4FFVC 3LZLA 2C4FU 2CO6A 3D0VB 2O5XH 4PRAB 1BG1A 2WXOA 4JO3L 1NC4A 4KI5D 3INUH 2CCVA 2V17L 5ALCH 3WFHA 3V5HB 1B2WL 1MCBA 1BVOA 4HPHA 5AL0A 2JKIS 2YD0A 2H32H 3EHBB 3ESOA 3WFCH 2FR4A 2YSSA 4NO0D 4XCEB 4HXBH 4LB8A 4UMGA 2EDHA 1Z66A 4Q9QH 4JDVA 3TX4A 1E40A 2C9QA 3V0WL 1U3HB 4PD4J 4JFOA 4OIAA 1TVBA 1Q9LA 1E4WL 5I8OL 3X3GH 1EUTA 4GKNA 3SGEH 3FU3A 1RULL 2E75C 4P46A 2YXFA 3WAJA 4U4BA 4MXWH 4R5VA 3CSYB 2FEEI 4J3OD 3MLYH 4UT6L 3VFOA 3QJHA 3UJJL 3TT3H 4QR7A 1LEGB 1Q90A 1MIEH 1YYLH 2X6AA 4BQ9A 1Z9MA 4PJHB 3IFLH 3D39E 4PV8B 2B1OA 2W9EH 5GZOC 2BNQE 3MRJA 5CEZH 1AXTL 4M7LH 2VLJB 2CGRH 4FLRA 2DQDL 4ZT1A 3BISA 5DC4B 2FECI 4MNQB 1KFGA 4PIBA 2NY4B 1Y7VA 1EXUA 4PBDA 1V54B 1R3JB 4W93A 3QUMB 3BE1L 4JPIB 5AAWA 2WNGA 3Q43A 3UBXA 4EI5A 4LIQH 1JGLL 4FZ8L 3CHPA 1IUZA 4JCMA 4K9EC 1YECL 1AR1D 2L7EA 2Z31D 3Q5OA 3FQUB 4J23A 1ZS2A 4P4KC 5FYJU 5K5YA 1F6LL 2H26B 4TPRH 4PS4H 3HI6H 1S3KH 4LP8A 4MA3B 4KVCH 3OHXA 3FQXA 2AP2A 2DQTL 1C7SA 2LTQC 2V5TA 2L04A 1FAIL 3PABA 4LCWA 3VWJD 4MMXC 3T65A 2EDWA 1YVLA 1IEHA 3BDXA 5IHUH 5DVLA 5LQBL 3LPOA 3WU1A 5ITBH 1BPLB 1FUNA 1OD9A 2PWHA 4UANA 1J1PL 4JFZL 4R90L 2MOGA 4CMMB 2J25A 5E4OA 3BEWA 4NXSA 4ZTOL 4KU1A 4X80H 2OAAA 5FYLD 2WQVA 5L9DH 1S7QB 3NH7H 1WZ1L 5E2UH 3C5SA 1UHVA 2DJMA 3ULVL 1UH3A 3UYOD 2AXGB 4WNJA 3JVGC 4QD2E 4O02B 4R84A 4XMUA 5DUJA 1NKRA 1UH2A 5E6ZA 1OW0A 3VFPB 3WO3B 2XV2A 3NFPA 3N42B 3FT3B 4S1QL 1GL4B 4BHUI 1RZKC 3HUJB 1L9SA 3IJYA 2D03L 4DPRA 1KTLB 3QFDB 3G04B 4GMTL 4JFDB 4L5FH 5DJAB 4OLWH 1IFGA 2YQ3A 3Q6FA 4TL5A 1PY0A 3MAWA 3KPNA 4GO6B 4MD0B 1MRDH 1AMXA 3MYZA 4RZCA 5E0FA 2NXYB 5DLML 2WTRB 1EO5A 1WD8A 1D5IH 2NW3B 1I7TB 4MCYB 4PJIE 1G6RH 4CBZA 1YNLL 3I75B 3QEHA 1YMHA 4JO2H 4Q2ZB 5H35B 1SY6L 4L29B 4ZQKB 3Q13A 1GJUA 4AJVA 4HPOL 3M88A 4WGVB 1I53A 4CVZB 3R1GL 3BP4A 4Y2OA 2IH3A 1RZ8B 4I77L 3WDJA 3CDGA 3KS0H 2GC7C 2K9FB 2PMZA 4OUOA 1X5XA 4N8UA 1LK3H 1TTUA 1IGJA 1D5RA 3BLPX 3TBYA 2CMRL 2A6KA 5GZOA 4X7TA 4JX0A 2Q7YA 2BWIA 1F58L 3P77B 4HQQL 4PJ5E 4EDWH 4LBAA 1PLCA 3VFTB 4WLCA 1RMFH 1UEMA 3IFPA 2ITFA 3ULUL 3KBFA 3X13B 4Z77A 1CCZA 1YNKH 4K0OA 4YMPA 3L13A 4P07A 4FJZA 4YSUA 1YEIH 1LP9B 4MMYA 4D0CB 3IMSA 4HH8A 3H6JA 2N4IA 5I73C 1UM6H 2BP8A 1XH3A 5KBKA 2HYMA 4HS6A 4UNTA 5EB9A 4HHAB 5IBLD 5CMAA 2UZPA 1OAQH 1JFQL 3EJSA 3QDGB 4YDNA 2I9TB 2ZUTA 1QZ1A 1T2XA 2P5EA 4N0UE 2CLVA 4XO8A 3QUKB 1SVCP 4PIRF 2G2PA 1UQSB 2VUYA 1C12A 4Q52A 1GRWA 2K8MA 2B59B 2HG5A 2JCCB 1SXSA 1P4IH 3VGAC 5I1LB 4P2QB 4PMEA 2DI9A 3S3DB 4WKXA 2RACA 4TSAH 1FV1A 4FL4B 1MZZA 4OD1H 1YSOA 2F5AH 1E3ZA 7TAAA 3TPKA 2EAEA 2ORBL 1E4HA 3I9GL 3GBML 3QP3A 4JFHE 4NJAL 3TOPA 3SPVA 3VI3A 3MRDA 4E42A 5AEAA 3GC3A 3FF8A 4U1JA 2FJFA 1P7KA 2GIYA 2Y3AA 3LZPA 3LKRA 4ODTL 4BV1A 1BCIA 2WANA 4NQSA 4OUUB 3FC8A 3FBQA 3SGKA 3OMIB 3MR9A 4P2OD 3MXVL 2EDXA 2OYMA 4XC1L 2VABA 3RAJL 3FB7A 4QYOB 4KX7A 3O4OB 4PY7B 4E5XB 5D2LB 1TZIB 3BIBX 4XHJD 1X5LA 4Z5RB 3B9KC 4Z7QE 3U4BL 4LSVH 4X83A 2CHWA 4I4WB 2AJSH 3BWAB 1JIBA 2JJSA 1AGFB 1PD1A 2JI1A 4WDIB 1AKPA 2J2ZB 3JWNC 2UXFA 2DM4A 2QQQA 2ZWKA 4XPAH 1U91B 3L3IA 5GHWH 1PZ2A 1QRND 4PCSA 3LKSB 2DDQH 3MLRL 1AHWC 3E6HA 3IGAA 1TZHB 1EJOL 5BV7L 1EZSA 1CTMA 2X41A 1M9SA 1CWVA 5L6YL 4F3FB 1P6FA 2NR6A 5GGQL 3SDAD 2RIKA 2R29H 3IDNA 5FOBB 2E5EA 3NRFA 4YBLB 1VHPA 1L9TA 5DJ6A 2AFNA 3T77B 2R4SH 4UOJA 5AVYB 2YPVL 4NUQA 2X2YA 3NUKA 1AQHA 3NFNA 2V2TA 3DVNB 5T8IA 4EF3A 6FABL 5ADOH 2W9DL 2A1WL 2LAAA 2FSEB 4LK4A 4Y9FA 4X5LA 1FF5A 2BOBB 2XIIA 3PP3H 3IMTA 4HUWA 4OJYA 4PJEA 4O58H 3UAEA 4GSXA 3PGDA 3VXNA 1QFUL 1U8IA 1Z5HA 3QI9B 2VE6A 4OM1L 5EU7E 5HHQA 3OAUH 1E2VA 2ENSA 4OV5A 2H1LM 4JZJC 1CFNA 2QKSA 2CG9X 3AQXA 4K7PH 2OMYB 1KEMH 1U2HA 1QPXA 2OTUA 4AH2B 4RQQB 3VXUE 4KTDH 2VDKH 4X4YA 3MZTA 4U1LA 3ZDXE 1MPAH 1RZJC 2E76C 3QJXA 1M2VB 4F7PA 3GSNB 3QIUA 3EO0A 2DN7A 3IDGA 4TLTA 4P57A 5D1ZB 4NQUA 2NMSA 2KMWA 4ODUA 4B95C 4HJUA 3ZHKA 2NY6B 5J12B 3II3A 1WCBB 4C8XA 4O9HL 4XP1L 3IJEA 3ZKMD 5FK9B 5E94A 1ACYH 4FA6A 2R0WH 1TQUA 3P4MA 1W91A 3KG5A 5DJYB 3VI4E 5LXGH 1OY3B 3F01A 3GO1L 4GMSL 5LJYH 2XJLA 4MA7H 2W94A 2PCFA 1T20A 3EBGA 2J88H 3CBKB 4J3OH 3D3VA 4Y19E 1I7ZA 4JKKA 1HJCA 5IROC 5D1XC 3RVTD 5IB1B 2ZJSH 1AD9B 2DY2A 3DV6B 4K73A 2OW7A 5TFSH 3VE0A 5DK2B 4X4MA 3CK0H 4LHUG 1T80A 1KBPA 4FZEH 5DC0A 1YEJL 4RLDA 1OCCB 3ZE1F 1K85A 4LFHG 4DP9X 1JPST 4PCYA 3QEGH 3WAKA 4ODWA 3R18A 5F70A 3NIDF 9PCYA 1XCXA 4U1KB 1ZTXE 5MERA 4Z3HA 3TCLB 4BQCA 7FABH 4HU2A 4Y8DC 2ZOLB 4K07A 4E41E 3T8VA 4AQ8A 2YUXA 1A9BB 2Z4QB 1T03H 2HRPH 1TCRA 3I6SA 1U2YA 2Z7YA 3D52A 3UIZA 4D9RE 1AGCB 1KCUL 1QWUA 4R4FL 3ZX1A 4AG4H 4BFNA 1DFBL 3PWLA 5E7BA 1AS7A 1ZHLA 1ADQH 4HK0A 1I9RH 2J4WL 2R4RH 4FEIA 3SE8H 4G1EA 1AHWA 3SEPA 1JZJA 1UT9A 4KVPA 3PE9A 3OZ9H 3MACH 5JW5A 2EDNA 3STZB 3ZMNA 2Z65C 3ZZLA 3QCTH 1R19A 2J8UE 6CGTA 2HT3C 1A6TA 3NGBB 2BK8A 3MKGA 1NC4D 1EDHA 2CO3A 4JM4H 2HUEA 1QR1B 1MCSA 4WRLA 4KJQC 2HMID 4BM7A 2UXTA 5CBEB 1HVXA 3GPSA 1IJNA 2Y0SA 4OB5L 3RKPA 5IB3A 2NY4C 1JXFA 4MJ6A 2CDGA 2VYRE 1GMIA 1H6TA 3QHZH 2Z92A 2PPDA 1MCIA 3WIAA 3C6SA 4OM0L 1MG2C 2XJKA 4FI7A 5I15H 1Q9WB 3KBPA 1GTNA 4Z7WA 4WW2F 3VFNA 4G8GE 1MJ8L 1RK1A 3L2NA 4ADJA 1S9KC 1RQ5A 2GTQA 4LKCA 5AB9A 1FL3B 4PB0H 4HUUB 4P46D 2OJZH 1LVEA 3SPJA 2J7LA 2JB5L 3N43F 4OCXL 1S7XB 4M6NH 1JBJA 2FRGP 5T1MB 3L3OA 2BDNL 2G75B 4U1SB 3O45A 1AP2B 2AV7B 2IF7A 2BS8A 4OGAD 5IB4B 4XNYH 2CXKA 4PI0A 3CGTA 1F56A 4EN3D 3D0VA 3SPGA 1A3QA 4PRAA 5HPOA 2DBJA 4PRNB 1GJWA 1I8AA 1RUMH 1OANA 4PJ7E 1BP3B 3QPQD 3CFIC 4KK6C 3V5HA 3U7YL 2E47A 3CPLB 1V5JA 4ZPVB 3C6EA 2OL3H 1QW9A 4J3BA 3T3ME 2D0GA 1BPVA 1OO2A 4EI5D 2XTJC 4N2FA 4F7TB 4XCEA 2Z34A 5DYFA 2W65B 4TSCH 1L9OA 4RWHA 4J39A 4KDWA 4K5OA 1U3HA 4KUCF 3IPEA 5ILTL 3ZYOA 3ZR6A 4LCWD 2L4OA 2IADB 3WY4A 3GK8H 3SPIA 2CBTA 5HI5D 5KVEL 2UUDK 3CFBB 3CSYA 4JPKL 3T71A 2WYIA 3LRMA 4PJAF 3ULUE 3D69A 2WB1A 5JHMA 1LEGA 5F97E 2EEXA 1CGTA 2H6UA 4WK0B 3D30A 1KBGL 2ZCKL 3PDDA 4PV8A 5E5MB 3D18B 2BFVH 3CVDA 1QLEH 4KX9A 4R9HA 1T7ZA 1ACXA 1ML0A 4G70B 3GSVB 2CCLA 4OGXL 3FN9A 2ZXEB 4JRWA 5EORH 2V9RA 4PJDF 2VLJA 4OJDH 4D7BA 3MUGB 4FABL 2B0SH 1GGYA 2VJXA 3QQ9C 4GQPH 5DHDA 2EZ0C 2JIXB 5IQ9B 3OJ2C 4YC2B 4OFQA 3AS0A 4MNQA 5K93A 4U6YB 2MRYA 4Y5XC 1BIHA 4MJJA 1JN6B 1R3JA 4P3DB 4DOHE 4WV1C 4F93B 3QUMA 1Q0EA 1FC2D 3MA9H 3MRLB 1ZE3H 3W11D 5F71A 2XXGA 3HB3D 1JHTB 4PTUB 5C0JA 2QADB 4LEBA 4PTTB 4EZMA 1QPPA 3FQUA 1ZEAH 2JQAA 4LOEA 4OCWL 2H26A 4M93B 1N8OE 1QSEE 3TZVC 1CGUA 3KVQA 1HT6A 3CIQA 2XBTA 3L48A 3HG5A 4MA3A 1LWRA 3NESA 1TJIL 2HTKD 4O2CB 4IHBA 5CSBA 5B7FA 5KEZA 1XF3B 3HMWL 3M45A 3JZ7A 3ALWA 2DQJH 1RIUH 3CVHL 3IDUA 3QHTC 2DTML 4AI7A 3MV01 3N3EA 1PL3A 2ZXAA 1AXSB 5JHBA 5I0WA 4LRIC 3SYPA 1OL0A 3GZKA 1SDAB 4CMMA 3KCWA 4N3UA 1FDLL 5GZOD 3KPSE 4D9LL 4RFNC 2E6QA 1JRHH 1S7QA 5C7XH 5GGUB 1NLDL 2IMNA 3DIVA 3BUBA 2OLDA 3L4ZA 1JI1A 2NX5D 5BPPA 2AXGA 3E9TA 4HKXB 5DEZA 4LLQB 5DEGB 4O02A 5L8LB 1ZK9A 1P7HL 1J11A 4I3RL 4HFWB 1G9HA 4NHCL 4CSSA 1P69B 5BO1L 2QSVA 4IJTA 3VFPA 1QACA 3MLVL 1WGVA 2OXHB 3FT3A 4PWKA 4E9RA 4WUUB 3IETB 3HUJA 3QQDB 2W91A 5DMIH 4AGOA 4JL1A 3GIVB 1KTLA 3QFDA 3G04A 5DJAA 5TPWL 5LB1A 3PGCB 2RD0A 1M57B 3E3QC 2H4EA 4HUNB 4ZMYA 2YEZB 4HA1A 5CILH 2A0LD 5T5NG 5AW6B 4MD0A 4MCZB 4DP5X 2R69H 2VLKD 3JV5A 2WTRA 2GSMB 1R5WB 5DFWH 1I7TA 2P5ED 4HZLB 3I75A 4P0DA 3MV11 3KM1A 4FKKA 4Q2ZA 5H35A 2DI7A 4L29A 5HTSA 1INEH 4F8LA 4ZQKA 5DQDH 2VW4A 4ELKB 1ROCA 5KZCB 3QR0A 3EDJA 5DK0B 4CVZA 1QD0A 4U3CA 3OKOB 3CVBA 3IFOB 3QB7C 3BSZA 1RZ8A 5JXAH 1AHKA 4ZMLA 3AUWB 4KDVA 2AGJL 2ZP8A 3CLFH 1KLUB 4LSQH 4TNGA 4JHAL 1J1OH 4M48H 1GGCL 3ASWA 2OW6A 3SDCB 5EU6E 2WBXA 4GQRA 2APSA 1YZZA 2X0VA 2AHIA 5BUAA 2IDQA 3HZVB 4NAMA 3P77A 1XH2A 2XETA 3BP5B 3CXFA 5J7CC 3U9PL 1U8MB 3U7WH 3VFTA 5BS0E 1KUMA 2CIIB 5ANMA 1D5XB 2YO3A 4KRMB 3INOA 4ZTPL 3X13A 1A22B 3DMMC 3EW3B 1E5YA 1LO5B 1V3JA 1XR8B 1DFXA 4JDEB 3SBRA 3SJVE 4KVNL 4LU5L 5IY5B 4HSQA 4JPWH 4LSPL 1LP9A 2I26N 3GSQB 3WV0A 3MDJA 1W15A 2A4EA 4D0CA 4X7DC 4J8QA 2B2XH 4HAFA 1XD1A 4HHAA 4UM8B 3QDGA 2I9TA 3QNXB 5F9AC 1PPIA 2XG4B 3QUKA 4OQTH 2H0PA 2XWTB 5FOJA 1KGCE 4L3EE 2B59A 4OCRL 2JCCA 1AH1A 2FLMA 5HYJE 5I1LA 4P2QA 5CO1A 1G4MA 2G3MA 4QRPB 5EG6C 5IT2H 1UACL 4G8EB 1X9UA 4FD0A 3KYKL 4HEPA 1T1ZB 3ARRA 1WD9A 3VD4A 5I1EH 2E0PA 4P2CG 4JQIA 2E9GA 4M6ML 1OCZB 1UWGL 3KYMB 1HEHC 1YEKL 2CKBH 3HZYB 4OI9A 2NY5H 3II2A 3V0IA 4OUUA 3WLWC 3LQMA 4Z18A 5F3BB 3DGCR 3MX0B 4OF6A 4PY7A 4E5XA 1H15B 3WKMH 3U36B 4MWFB 4PB9H 5D2LA 4MD5B 1TZIA 3KDPB 2HH0L 4Z5RA 3QUHA 1INDH 3QIUD 2VSDA 4XMLL 5EO0B 4GBXC 4I4WA 3L5XH 1KCSL 3BWAA 1YAZA 2PW2B 3L54A 4WQOA 1AGFA 1EAJA 1T0NB 1ZPLA 3ARGB 4X4XB 4WDIA 4B97A 1PJWA 1LO3L 2J2ZA 4ZNEA 3TEYA 4XHQA 1G6VK 2IQAB 4XWGH 1U91A 3TBWB 1ZSHA 2VLMD 4UIKH 4HGKC 1KBBA 1DUZB 3LKSA 3B1TA 4N9GB 2MJWA 4Q4EA 1Z32X 1ESOA 1TZHA 2X9WA 4LKXB 4W9KC 5JPMB 1XWVA 3QUZC 2WKGA 1A7QH 4F3FA 5FOBA 2D4DA 2D73A 3D3VD 1MEXL 2VDRH 3TBSB 4NRYB 5EOQL 3FCTB 3T77A 3P02A 5E2TL 2IALB 4AQZA 2APWA 3G9VA 4CA4A 2OV0A 3DVNA 3OX8B 3BPOC 3T0DA 1CFVH 4OGZA 1PNDA 2FSEA 4U33A 5DF0A 5TH2B 3RURA 3WS6A 2BOBA 4PJ5B 3WKYA 4N2OA 3ECVA 2XU9A 3RIFF 3QI9A 2Z3FA 3PU7A 4L4TE 2ITCB 5AVSB 1ZLSL 1GPOL 1I3VA 4W81A 5J1AB 2JKWA 2OMYA 1MIMH 2A9BA 4AH2A 4ODHL 4RQQA 3LDBB 3ILQC 3DX2A 2VL4A 2R2CA 1IBFA 1BEXA 1O6TA 3OAWA 3GHEL 1M2VA 3GSNA 5F3HB 1IGCL 5CU9A 2C5DC 5AWNH 1UXLA 5D1ZA 4MZ3A 1NUGA 3RL2B 5CIPB 4N0UB 3BEVB 4O2EB 2ZPKH 1WCBA 1AS6A 4HC1H 4AZUA 2DL2A 3EOTL 5FK9A 4LPTA 2YD2A 3LEXB 2RCSH 1J1XL 1F1DA 5DJYA 4GSDH 4ZFQA 4HS8H 4HJEA 4HJSA 2FEDD 2B1AH 3L4XA 4J4PC 4EDXB 1FLTX 1QFPA 2ZG3A 1J9SA 3WEMA 5CBAB 3WIHA 1BQHB 3B6SB 2PN5A 1U8QB 1Z0NA 2BMKB 4U3SB 1QA9B 2EILB 4Z7UE 5IB1A 1AD9A 3DV6A 2AKRB 3DIDA 3PCYA 3OPZL 5BNXD 3U82B 5DK2A 1OCOB 3VYOA 4WFFE 1WAEA 1V3KA 4F7EB 1RIHL 2MQ0A 2DL9A 2MPAL 3DARA 4GRLC 4BKLB 2IOOA 1GS8A 3HJ0A 4QUOA 2QZQA 1U0QA 5AW7B 3NP4A 1BZEA 4WZ9A 3D2UB 3E8UH 4H44C 4U1KA 3T0BA 1UC6A 1LD9B 5T3ZL 3TCLA 3VXTB 4WSGA 3DDFA 3ZTEA 5I30H 3CMOH 2JK5B 2ZOLA 4Z7QB 1T66C 3GLZA 3F6IA 2AJUH 3NJIA 1A9BA 2Z4QA 1RUPL 1SQ2N 1KCKA 1N68A 1ZXKA 5HPMA 5DXWA 2EECA 1NKGA 1Y6NR 1AGCA 5E6IC 1BSIA 5AOKA 2HPOA 2EEFA 1JJUA 3IEAA 4GG8B 4CRPA 5F21B 3DVGB 5H4YA 3BOVA 4H40A 3AY4A 4Z0BH 4MDIB 1KGIA 3PREA 2EYRB 2Y25A 2YAOA 3NCJL 4NWUL 5FCSH 2HKHH 3STZA 3ZR5A 3FN0H 1QSZA 1KJ2H 2EH8L 2QVIA 5DRNB 4PRIE 3S88H 3S3SA 1QR1A 4X5WB 3NJVA 4UILL 3FPXA 4OT1H 3ZRSA 2WXLA 2FYYB 3VRIB 5BO0D 4OVVA 2GUOB 2P8PB 2V3DA 1LL1A 4YC2C 4ICWA 4JREC 5CBEA 3OSKA 3GRWA 3HFMH 4FGMA 3EYUL 1KYUA 2J6EA 7CGTA 4HT1H 2VZUA 5HBBA 1PGRB 3EHBD 4N85A 4DTGL 1UWEH 5I9QB 2J5LB 1A7NH 4DETA 1KYDA 2QVKA 5IG7B 1IFHL 3QPKA 1OSPH 4KO7A 1P9MC 2QADC 3VXUB 1Q9WA 4JGJA 1N26A 3CVIL 4YFLF 2OXGB 1U3HD 3ZDXB 1QRKA 4XAKD 4MBRA 4XO5A 4D7PA 4YBQD 1CLOH 1FL3A 2Q0ZX 1J5OL 4QYAA 4HUUA 4X6EB 1I9JH 3BD4A 4G3YL 5HGBB 4PJXB 3N44F 3FQ4A 1CS6A 3CDYA 1NFDF 2CUMA 2KL6A 1KTRL 1YQVL 4XNXL 1EEZB 1S7XA 2ZKMX 3NIGF 4ELMF 3AXLB 5T1MA 1KJ3L 5TK2A 4F2MB 2G75A 2YRBA 4XC3H 2J5WA 4U1SA 1MN4A 1SDYA 5T1DL 4MQSB 4DSYA 4CSTA 3HI5L 1AP2A 4LAQL 2AV7A 3MSPA 1BMGA 2D3LA 2ICWJ 4PRPE 5ITFB 2BSCA 5IB4A 1TZGH 1V7NL 2C7UB 2HJLB 1QFWM 1DSWA 1HSAB 1WAPA 1YEEH 2HT3D 4KGJA 3V6BR 3WYRA 2V0AA 1E65A 5DR5L 2UZXB 1U3ZA 3LJ3A 4J2QA 5GS1C 5I82A 4KJQD 4PRNA 5D7JB 3FONB 4LSRL 4QRBA 4MNQD 1WIUA 3FMGH 2NY4D 1WEJH 3CPLA 4ZPVA 2VW6A 3BRDA 4KQ4L 1WHOA 5IFHH 3AM8A 2MNUA 4B5ZA 2EVIA 1D6EB 4LOFA 4IBVA 1BBJB 4HWEL 3ULUF 2E8YA 2B4CL 4J8RB 4F7TA 3V55A 3EYQC 2W65A 1CXEA 1NCDL 4K3EL 3PWPB 3SDYH 3FUJA 4E41B 5CM1A 4JW3A 5AVVB 1KYOK 3BDYH 4YHMH 4PLJC 1VKXA 3IXTB 1DEEB 1B0GB 3R7RA 4X4ZA 5GJSL 3QAZC 4FS0A 3DSFH 3TM6A 1QTYT 3JWOL 1BIIB 2IADA 4KHXH 3LVEA 4MDRA 1X5ZA 1A3ZA 3BJLA 1AZUA 3BKYL 4ZAKC 3FAWA 3CFBA 2VN4A 2BNRE 1CF8H 3VSUA 1CE1H 1MJJB 4H13C 4QO1B 3RNKB 3ZKNC 4IOFD 2EXTA 5IJBC 4Y4FB 3OXRB 5E5MA 3JBG7 4MQXC 2J8UB 5L0QB 1FHNA 3GSVA 3KR3L 5I6LA 1JWMA 1L7TH 2FHBA 1FH2A 2NNCA 1UWXK 5CU5A 1ZKAA 3E80A 3MUGA 2C3XA 1F11B 1BAFH 2APXA 3FL7A 1V8HA 4AEFA 1GHFL 2JIXA 4V1DB 5IQ9A 2FBRA 2Q8BL 4RFEB 2XWCA 4MS8C 3WUWB 4PY8J 3WXWL 4N2CA 3DETD 4XO9A 5LNGA 4GINA 1E30A 2WW8A 1U8CB 1UEYA 2D2CC 1JN6A 1WTLA 1AO7B 2X0UA 3NJFA 3JYBA 4P3DA 4KK5C 3BO8B 5KSVB 3EO9L 1H3WM 1N6VA 3MRLA 4K94H 2WWKO 3II1A 1RUAH 1JHTA 4PTUA 3ATFA 4PTTA 2NXYD 5C08E 4IK7A 1JNHB 1KLFB 3MRNB 4GXUN 5J1TC 3HVDA 2JKRM 2BX5A 2LVCA 2E74C 1T89C 4O2CA 2NPLX 2WLJA 1SQMA 1XF3A 5FGCE 3F6JA 2DQIH 4EVNB 2GQHA 3CSTA 3EBIA 1ZVHA 4X5PA 3PQYB 4Z7AA 2YXWA 4Z7OB 1MAJA 4Y2DC 1PLGL 1TU2B 1AXSA 1BFOB