3VSQA

Crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2 e236r mutant in the presence of ethanol
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
199
structure length
197
Chain Sequence
QRYVRKDGKCNVHHGNVKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVRASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords G protein-activated inward rectifier potassium channel 2
publication title Coupling of G Protein Binding to Channel Gating in Mammalian Inward Rectifier K+ channels
rcsb
source organism Mus musculus
total genus 41
structure length 197
sequence length 199
ec nomenclature
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3vsqA00
2WLHA 2WLIB 2QKSA 3SPJA 2WLJA 3SPCA 5KUKA 3SYQA 2WLIA 3VSQA 3SPIA 3ZRSA 2E4FA 2X6AA 2WLLB 4LP8A 5KUMA 1P7BA 3SPHA 1N9PA 2WLLA 3AGWA 3ATAA 3K6NA 2X6BA 2GIXA 1U4EA 3SYCA 3SPGA 1U4FA 4KFMA 1XL6A 3SYAA 3ATEA 3JYCA 3SYPA 1XL4A 2WLMA 3AT8A 2WLKA 3ATBA 2WLNA 2X6CA 3ATFA 3AT9A 3ATDA 3AUWB 3SYOA
chains in the Genus database with same CATH superfamily
2DB8A 4YHOL 5HY9B 2Z31B 2JB6B 4A2FA 4U1GB 4MMYB 2LW3A 1NAKL 2ERJB 4GI9A 1HAWA 1FAIL 2IAAC 1TZGH 2V17L 5KJRH 1RJLA 3E38A 2ZUQB 5DGRA 4JFWA 4OJYA 2E27L 2XUWA 4Y2DA 4G71B 3WEXA 4IOSA 4NZTL 3KHOA 5ADPL 5D2LF 5JPNB 1BXXA 2ZWZA 4LVOB 5CJXA 1LE5A 3HZVB 3O0RL 2CGRL 1JZEA 4IOFC 3C9NB 3EO0B 3OKEB 4KXZI 1DBJL 1NUFA 1KV7A 1TTBA 1FV1B 3WI9A 3KPTA 5TE7H 3DHUA 1I3GL 2K1MA 4P9HC 1QVOB 2GABA 2FHBA 3EG9B 2GHZA 3WFDL 1E4WH 3X1FA 2CH8A 2PYEB 3O2VL 4Q9CA 4M6NH 1YPZB 5INDA 1Q94B 1J5IA 3QPXH 3S3JA 3WN5C 1LD9B 1NCHA 3IM1A 4UB0H 4KXDA 4J7RA 3SDCB 4JL1A 1ZLUK 1G7IA 2BW5A 3NH7L 3X13B 3G6JF 5BQDA 4FQXB 4HCIA 5I0XA 1KFGA 3A4FA 4KVNL 5I8CB 2BCKA 1CF8H 1KBVA 4Z7QB 4EI6B 1C5BL 4LSUH 4XXCC 4ZT1A 1WFJA 4FQ2H 1CZ8H 5I66A 1PJWA 3B9KA 1FHNA 3T3PB 3MJ7A 4EN3D 3B3IB 4KHTH 4URKA 3N2JA 3TIDA 1QPKA 1FIGL 1TQBB 1CFMA 1OP3K 5JIKA 5DI8A 5ICZA 1T83C 3OKMB 3M1CA 4L9LC 3QJQB 1M6OA 4M7ZC 2CZNA 5I19H 1J10A 2HN7A 2FWSA 2NQDA 1OTSC 2XG5A 5BRZA 4Y5YC 3DKHA 1IARB 4GG8B 5EFIA 1GGIH 2YR3A 5C0EA 3ES6B 2JQAA 2DH2A 3BE1L 5EZIL 1REIA 5IVXF 2V9TA 1UVQA 1IVTA 2P44B 2GTZA 4PJDF 4K2UL 3NP4A 1K2DB 1CGXA 4U1MB 3QDJB 3IXTB 2BNUB 5D9SB 4HEPG 4M5TA 2ADFH 3LNIA 3Q5OA 2XX1A 3Q8CA 2QMJA 2IG2H 4F15B 3QORB 3Q44A 1OM3L 3ETBJ 1TQTA 1WS8A 5CEXA 1KCRH 2VXQA 1YEDB 3DOHA 3O8XC 3TA4D 3HI5H 2WY3B 2XWEA 4FG2A 4MX7A 4YHLL 1RURH 2BNQB 5KVGE 2K6WA 3WLWD 4EUPH 1SEBA 2BY1A 4WUUE 4M1DL 3MYJA 1XGUB 4FMKA 5CKAA 5DJ2B 3RQ3A 3EGDA 3KXFA 4JM2F 1DUZB 1T6VN 1MRCH 3U7YL 2AJ3B 2DQGH 3HS0B 1YN7B 4KRLB 4OT1H 3GI9L 4G8FA 4N2IA 2CU9A 1YDPB 2BO0A 4G8GB 4D0BA 5CCKL 2F08A 3KL5A 5JW4M 1MEXH 4ELME 2DLEA 3HPJA 2PP9A 3OC8A 1FYTD 1E4XL 1F8TH 4G6KH 2RHEA 3GMRB 1JZ7A 3MLVH 4XBPB 1INQB 3SGEI 1P84J 3GMQA 4F9LC 4UIKH 4IRJB 3G9VA 4U2ZA 5ALCL 5BW7C 4RA0C 2Q8BH 5MENA 2YJQA 3ZTJG 3NCEB 5CKGA 1NH6A 2XWBB 4MJ5A 4CN4A 2X0UA 5DZAA 2FBJL 2VZVA 3ML8A 4E9TA 2XA3A 3MXWL 1WP6A 4HKZA 4GKZB 1BFOA 4XPAH 3CDGB 4HOMA 2OYMA 2HAZA 4HIXL 4RRPA 1X5KA 1EERB 5EZOL 3FOLA 5BV7L 4CDHA 1JCVA 1U93B 2YBGA 3Q2NA 1I8KA 4GQQA 1YMME 1G7MB 2R2HA 1VPOH 1UOKA 4M7LT 5D71H 3LPFA 4AE1A 5BZXA 2DQCH 5CLYA 4E9SA 1ZV9A 1BECA 3N3EA 5GGTH 1ETB1 2DKMA 2ZUTA 2HJFB 3SYOA 5HBBA 3OSKA 3CBRA 3REVA 3II3A 1A6TB 1QWUA 3V7MA 4R5VA 5JHDE 3U83A 4AQ1A 4OI7A 1YLBB 4XN9A 1QUNA 4N2AA 4OB5H 1OSYA 3ASNB 4LLMB 3D18B 3F65A 1O5DT 1MW0A 2EXWD 4DEWA 4L8CB 2AKRA 1L9SA 5DFAA 3SQBB 1EXUA 3WFHB 5I8EB 4EN3B 5DYOB 3K2KA 3EO1A 3HG0A 3WNLA 1ZS8A 5IROC 3HCVB 3ZOAA 1I8MB 3AUWB 1BAGA 4L1TA 1V8HA 2R0LL 5BPPA 5IMKB 5CIPA 1NAMA 3BUIA 2D7MA 4BQ9A 1LMIA 3BESR 1A65A 1ADQA 2YSSB 3NCXA 3CDYA 4HGKC 3KBPA 1IEBA 1TZGL 5KJRL 5F7YC 2VN5A 3PRZA 1CG9A 5DJAA 1ZSDB 5CU9A 4L1DA 4MA7H 4Y88A 4QHKJ 2LVCA 3RILA 4E2OA 2FQFA 2D3LA 2YARA 2LVEA 1OT1A 4JO3H 4OFKA 1QBLH 3RGVD 4IEFB 1FFPB 3RWDB 4ZPTA 3D25A 3HAEG 4XMWA 2V2WA 3CFIC 4LO9A 4OR1A 1BXUA 5DQJB 4KROB 5TE7L 5DTFA 4ECNA 1ZLWK 1R3JA 1E4WL 3K74B 4M6NL 2BXYA 2AXFA 5E1HB 3D0LA 3PHAA 3QPXL 1BF2A 2MMXA 3LS4H 4UB0L 2IANA 3FBQA 3DBXA 5E8EB 3CFBB 1S8DB 2ED6A 3QAQA 2E0PA 4XNZC 4LKCA 3QJHB 3N0AA 3ARBB 4WK2B 5DT1H 5GGSB 5JZ7D 1KB3A 2I85A 2R8SH 2LOEA 4RFOH 5CJ5A 4Q9BA 4GT7A 3HPLB 1CF8L 1V3KA 4WTQA 3EJRA 1AZBA 1RKRA 4LSUL 1FYTB 4FQ2L 4ZFGH 1CZ8L 1M7XA 1MQKH 4M48H 4PG2C 4GXUN 1QLEH 3KYMA 2YS4A 1F3JA 3U25A 3UL4A 1EZVY 1IGJB 4HPOH 3FTYA 4KHTL 3IN0A 4RFEB 5I1LA 3CX5J 3NJGA 3WDHA 1DVTA 3P9WB 1RJZA 1ZLUH 2JKIS 2BP0B 3BAJA 3BZ4B 4F9PA 2VDMB 2J56A 3QPQD 3FB7B 1OE1A 3OZLA 5FF6A 5I19L 4KH9A 1FCGA 3GIVA 4FAAB 2I25N 1T5XB 4JFSA 1GGIL 2DI7A 2YWZA 4DO4A 4YEEA 3O45A 4ODHH 1J9CT 2YAHA 1BX2B 2MNJB 3RX9A 1FNEA 1YEHH 5B8CB 1JWMB 4K94C 2B1HH 3RWJA 2ADFL 1NIEA 1OP3H 3UYPA 2YN5A 1XGTB 2IG2L 2Z0UA 4LOFA 3NJXA 2Q6WB 1E9PB 1KCRL 4QXUH 3HI5L 2FATH 2G0KA 4PGEB 3VRJB 1RURL 1L0PA 1Q9OA 3PAUA 2LAAA 1OK0A 4ZW7A 1U42A 1GZQB 4ZFOA 4M4RA 1L9PA 3BI9X 1QTPA 2OMUA 2OA9A 3KPPA 2XXMB 4AL8C 5EO1B 1MRCL 4Q9QH 1OZUA 2DQGL 4OT1L 3KM1A 3LKOB 5GRZA 1OCOB 1RZ8B 1XZWA 3FHEA 4IKIA 2EACA 3GTVA 5TK2A 3NIFF 1BMGA 1MEXL 3FZUD 3VG9C 4EBQH 4PJFA 4AK2A 2YXVA 5IB3B 1N8ZA 3QYCA 3U6XA 3T04D 1F8TL 4G6KL 3TO4D 3RI5K 3UZEA 3MLVL 5CSGA 5I5JA 5IW1A 5LWYH 4UIKL 2YAQA 4E9LA 5DRWB 2IC2A 3OMIB 2Q8BL 2AV7B 5E6RB 5EUOE 3RI5F 2A6DB 2DYPD 4HIEB 1GPOL 1A1MB 3UBXG 1OOWA 2DI9A 2QBWA 4XPAL 3R0MA 3FB5B 4W9JC 4PJCA 3UIZA 3OKDB 4Y0GA 1YSOA 2ZOLB 3BAIA 4M6MH 3RIAF 4B9GA 4N8VG 5ID1A 1VPOL 3FT9A 3LN5B 5D71L 3WDIA 4AYBA 5CLZA 3JWNG 1JXFA 1H3VA 1D6EA 5L2KE 2DQCL 5TDOA 3QUKB 3W11C 2GCYB 3E8UL 3D7PA 4DK6A 5KEZA 3PWPB 5LXGH 2VDOH 2YA2A 5I6XB 1EBPA 3WLBB 5DD1H 1TU2A 3RWHB 1HILB 2CBMA 2IEPA 2UVFA 1A7OH 3C2AH 2AK4B 2HFEB 3QUYA 2JSFA 2YD5A 4OB5L 1ITCA 4IRSD 1MCPH 1HT6A 4ELKA 2VERN 1AO7E 4MJIE 3QAZB 3QWOA 4OZIE 3H85A 1JS4A 1MCNA 2Q10A 1W8OA 2CBOA 5DVMA 1ULVA 5F21B 3L9YA 4AQ1C 4MJHA 1WE5A 4XPTL 4UQ3A 1L0QA 2A9DA 1DCLA 1P0SE 4G7YH 1FAKT 4G82A 1QFWI 1H9VA 4WW2B 1X5AA 4HBCH 3WTTA 1H6TA 2AXGA 5MERA 5FFOA 1MCLA 1XCWA 3LKPB 4BXSV 1AJ7H 4MDIB 3R8BB 2EIEA 5TE6H 1SJEB 4OD3H 4RDQG 3FTGA 1T5WB 2IAMB 3H7BA 4AEFA 3TU6A 4LF3B 4WI4A 5F0MB 1AVAA 2MNUA 1U8CA 1XH0A 1J1OH 3CHOA 3DK2A 5IB5B 5E2WH 3F85A 2WBXA 3BUYB 4MA7L 2A83B 4LEOA 2OL3B 3O2WH 4JO3L 2X6CA 2NCMA 5L4MA 3PP4H 1X5XA 2WZ0A 5L6YH 2E75C 4LOUC 5IBLD 3WNIA 3ZTCC 4GOSA 4J1UB 3NEOA 3KW8A 3T2LA 2F6AA 1CI5A 2MOGA 1GAFH 3E2HB 3ZIMA 3LSOA 4N2NA 4PMEA 5AAMA 1DN0A 3BQUB 3BYTA 3LS4L 1RZIA 1TYRA 1X5HA 3CGTA 3E6FA 4H5SB 4GQPH 5LVEA 5DT1L 3BT0A 3DMMD 5A7BA 4ES9A 2A9NH 3VJ6A 2WW8A 1B9ZA 5SX5K 1UWEH 1DQIA 4XB3A 4ZFGL 3HG5A 5A7EA 1MQKL 4M48L 1ZLWH 2DWYA 2JV6A 1QLEL 3PNRB 3C5SA 2JXMA 5CZXD 2JIXD 5FUCE 4HPOL 2N4IA 3DJRA 3A23A 4N4YB 1BZQK 2X6BA 5T1JA 1WZMA 3MRCB 4H1LA 4Z3EA 1CDHA 1A6ZB 3DUUA 3QHFH 1NCBH 2VR8A 1CDYA 4CU7A 2EE6A 1DJXA 3CPUA 1FBIL 2MNWA 3FQTB 5AYUH 2UZIH 4MVBC 4FF9A 1H5BC 2G0LA 1VDGA 3IJHB 4GUQA 1IGYB 3DIVA 2EIMB 4NN5C 1AR1D 2ZUUA 5DJXB 4ODHL 2Y4SA 3PCYA 4W68A 4BGLA 1CCZA 3KWVA 5CJBA 1YEHL 1KXQA 1WAAF 3N6YA 2XWXA 2H9GB 4JY4B 5DS2A 1RHHB 4JDVA 4XE5B 2B1HL 5F7MC 4XI5C 1BIIA 4J5VA 2ZOKA 1CK0H 1EZVX 5HHQA 2EDDA 1CFSB 4QXUL 1NKGA 3BDXA 1KLGB 2FATL 3SYPA 3UP6A 3VU2A 4XP6L 4NQQA 1AD9B 2Z4QB 3NVQA 1TT6A 1K8DA 4X6EB 4X4KA 1I9IH 3BSZA 3JUYA 4KQ3H 3RWFB 1ZWIB 1BCIA 1OCWH 4Q9QL 3BFQG 4AITA 4LL9A 5I75C 1D5BA 4RX4A 2XZZA 4Y16A 3OF6A 1TFPA 1A2YA 1QSEB 3MV7B 2AW2A 3GJFA 1A7QH 2NY2C 3AMLA 1NCAH 4EBQL 1XEDA 4BHUI 1Z3GH 3NJHA 1QZ1A 1OGAA 5F1OB 1NBVH 1U8NB 2HLAA 5LWYL 1MY5A 4F92B 3GDBA 4JHUA 4YBLB 4HCGA 1HIMH 1UKSA 2IPKB 1A3ZA 2JH2A 3ECBB 3S96B 3N1QC 2J73A 1J8SA 3UZEC 3PJLA 2N3JA 1G1YA 4NO2B 4UQAA 3QEUA 3QK0A 4KJWD 4U6VH 2ED7A 2A77H 1KLFB 1CUOA 5EC2B 5E08H 5HJGA 2DS4A 2NYYC 1IAIH 5EOCH 1J0YA 1HL4A 3M17A 1AGFB 2A6IA 4M6ML 3CZNA 4UM9B 4MD5B 1ECZA 4KO5A 32C2B 4WEUD 4KZ0A 5EZLA 3EJZD 4QXGH 5CS7A 5EV7A 5F0LB 3RPIB 2GC7C 2YD8A 1U8QB 2VDOL 2BPBA 5LXGL 3SKMB 3MRLB 2RGSA 2PN5A 3V0JA 1SJHB 2DWEB 3HVDA 5DD1L 2A9AA 3BPNC 4Y4HD 5IFAH 3DX2A 2R29H 4Y1AE 4U6TA 4OTXH 1UADC 4MNQD 4GI6A 3Q9PA 1A7OL 4PJAF 3ZHLA 4XTRD 2WNKA 1P5VA 3ABGA 3NSFA 3LZOA 1EAQA 1MCPL 2NY5H 5C7ZA 4WWKC 4XR8C 3DJZA 4AQZA 4PJ5A 3TBTA 3UG5A 4OCNC 5AAWA 3K5RA 2EIKB 1BHGA 4PS3A 2HTLD 2X4NA 1FH5H 1JTOA 1UXLA 2D0GA 3QUYC 2E74C 4FQCH 4KQ4H 5SWSE 3TJHD 3VM5A 2J72A 5FK9A 4HMCA 4HIPA 5D1ZI 1E7UA 2X2JA 3BRFA 4G7YL 3PFUA 4E0RB 2W81C 2C7UB 3BPOC 3MBEA 4HBCL 4XMZA 4EIBA 3WMPA 3IS1X 4LEEA 4NBXB 1SXAA 4HJGB 3RWCB 4YWGH 1O9ZA 1AJ7L 3AREA 2I60H 4EZLA 2HFFA 3GJEB 5TE6L 4OD3L 4K7PY 2WWKT 2CG9X 5ISZB 3F7VA 4BSVA 2WD0A 5JHAA 1J1OL 2PABA 1EJ8A 4P5TD 1OB0A 2YRZA 1S7RA 3O2WL 4H8QA 4ZTEA 1JWUB 1DDHB 1PCSA 5E5LA 3PP4L 2OMXA 4Q8BA 3WIHH 5L6YL 2A5UA 4JZNA 1Z3RA 1FLRH 2F1AA 2OMVA 3IDMB 4L2LA 4LGPB 2P5ED 5E8DH 5TD4A 4C56A 1WS7A 3ZYZA 2VMEA 4AYID 4DESA 1GAFL 1ZAGA 3QEQE 1T04A 4TLKA 1Z9OA 3KW7A 3HHSB 4L1SA 3V9EA 4M5ZH 2RAMA 1HI6A 1T21A 3H3PH 4UTCA 4Q89A 5E70A 5ESVB 4NKDA 3DK0A 3N40P 3V79C 4FEIA 3L4UA 1TJGH 5AAMC 4ACPA 1FVDA 1IAKA 1TZOA 4I0CC 4WEBH 3KWTA 5ID0B 4CNIB 4YZFF 5BQ7B 5DZJA 1UWEL 5E7FA 4OFYA 1HXMB 3TO2A 4P06A 4HFWB 2XT1B 1P7HL 1G7JB 4UDTA 3K3QA 1YY8A 1M1SA 1G43A 5IHWA 3MLPA 5D5MA 3RWGA 4NRXB 1J9QA 1Z0NA 2CHNA 4JZJB 2WZ6A 3L4WA 1S7TB 2HMID 3TBSA 1LDPH 1ECYA 1VADB 5CWSA 4YIQB 1EDQA 3S4SB 3T1FA 5HYIA 3TFKD 3BP7B 3QFJE 3QHFL 2F68X 1T0OA 3TESA 1G7PB 1NCBL 4ANVA 3WSQL 4LMQI 3TYGH 4B27A 5CEZD 1Z9LA 4RGNE 4XMLH 1S7WA 2UZIL 3LNHA 5AYUL 3NN8A 2D9QB 5SX5H 4AV0A 4B97A 4IBZA 1IM3A 3D52A 3NCWA 4XBMA 3BEWB 4XNMA 4DK5A 2ZAGA 1D5RA 2Y24A 3L7EB 2YFOA 3QDGD 5DRZB 2EIZB 5CFHA 2NR6D 3FCTB 5C0FA 1A7RH 4NBYB 4XP4H 2IGTA 4WDIA 2E7LA 2P5WD 1O6VA 4OFPA 3MLXH 3MV8D 5E51A 4NO0B 4BE6A 3MBWA 2J6WA 5DRXB 5J8OA 4RMTA 4LESA 3POCA 4MCMA 3X11A 4CAGA 1CK0L 3BW9A 4MNQB 2EDXA 5I6NA 2CIKB 2W94A 4OCYH 3FU5A 1MLCA 4AXWB 3FFOA 1PKOA 3WDJA 3FQ1A 2GC4C 4KMQA 5DC0A 3WHE0 3UAAA 3IDNB 1I9IL 5BJTB 3O3BA 1JGEB 3F83A 3MR9A 3N1MC 4KQ3L 4DUVA 4YDIH 1HHKA 3ILEA 1OCWL 5EIIB 3RIFF 2FWOB 5DMKA 3O11A 3FH8A 3M1BB 1MDTA 2VAJA 4KDTA 3G5YB 2D31B 1NCAL 3VFNB 3D5OF 3N5AA 3VXMB 1Z3GL 2BX5A 4HUVA 3MHZA 1KIQB 4IK7A 4Y16C 5LQBH 1DJZA 1NBVL 1S9WB 2BNRA 2ZX5A 1BXVA 5TK4A 2IWFA 4X42A 5C0BA 5SWQA 1HIML 1YRKA 2BHFA 3ET9F 4FI6A 4M02A 2P80D 3GEFA 5G5DA 1CGSL 1A4KB 2E86A 4IRZL 3ESNA 3WKNA 1U95B 2DBLH 4U6VL 3KS0J 2A77L 1JYXA 5F88B 4LPCA 1EX0A 2FT7A 5D7LD 5E08L 5EOCL 2OSLA 1IAIL 2WP3O 2CCWA 2X28A 4PN6A 4ZMXA 5FB8B 5IQ7H 3WIIH 4XVJH 4YDNA 4HAFA 2VL5A 1IL1B 3VD3A 5FYLE 3KM2A 3CU1A 3UBXI 5LKNA 4EOWL 1U6AH 3CIQA 1H0DB 4QXGL 3S3BB 4YJZL 2M2DA 3V0DA 3VFPA 1D7CA 3EBHA 5HI3D 5C9JA 1NKOA 3LRSB 1SQ2N 3GT6A 4S2SA 5FM4A 3RWIA 2VTFA 3S3PA 1G0DA 5IFAL 1VB9A 4W93A 3NDZE 5I28A 2WCSA 2BWIA 3KYNA 1ZA6B 3DHMA 1JZHA 4QRPA 3MRMB 1B9KA 4K4KA 4DP4X 2EVFA 1PD1A 5BRZE 1D6VH 4P46D 2NY5L 4TVPD 3GD1C 3ZHDA 1VKXA 2VDNH 4A7QA 1E8ZA 2FLMA 4G9FD 1IEAB 2A7BA 3TL5A 1FH5L 4FQCL 3AUVA 4HAKA 5J06A 5AWNH 4Y2OA 2RALA 3OKLB 2N0MA 3W81A 3VFMA 3QULB 4A2MA 4BSWA 3L4ZA 2B15A 4WW2F 5AAWC 3AS1A 2WLYA 3TBWA 2WVVB 3AROA 4JKNA 4KZEH 5T1MB 3H6JA 4NI6A 5C3IA 4FE9A 2G60H 1PNDA 2WUCH 4YWGL 3FO1A 2I60L 3DX6A 3ECWA 5KSBB 3NP3A 3DO7A 3MBEC 3GLZA 3KXFE 3GSXB 3FRPB 1JPSH 4HGMA 2GJ6D 3CFJA 4TLTA 1IAOB 1KYOJ 4BA0A 3K0YA 4LCWD 4BD4A 1ETA1 2J43A 1XF3A 2OZ4H 4G7RB 3WO4B 1JG9A 3FJTA 3WIHL 2K4WA 5E8DL 4DGVH 4G1EB 4L4VA 5MENE 3MNWA 3FUMA 2CE6A 1FL5A 4JPKL 2VL4A 4LSSL 4RRPG 5KANG 5GZNC 5HYJD 5LDUA 1BQHB 2BVOA 4J6RH 2JKNA 4M5ZL 1WZAA 1DR9A 2C3HA 3WIAA 3H3PL 3K6FA 4HJ1A 3QYMA 4U1KB 2QHRH 4EXKA 4OZFB 4N2LA 5LG6A 5EO9B 2Y1VA 1TJGL 4E41D 4TUKH 4WEBL 1NOAA 5DVNA 1CL7I 3AQXA 4DN4H 3SGKA 1WO2A 4PJIA 3APNA 3V0HA 5AG9A 1ND0A 2FEDC 4PB9H 3UMNA 4PGJA 4FXGB 4IHOB 1V3MA 2TSAA 4N5ED 3HLKA 1Q1PA 3NIGB 3OD3A 4DEPC 4X6FA 4LBEB 3HBPA 4I1NB 4NHCH 8FABB 1TLMA 4ONHA 4OU3A 5FO9B 4TSCH 1L7IH 1F58H 1LDPL 5D1XA 5DK2A 4X5LA 1NFDF 1ZGLB 2EH8H 4W9DC 1Y18A 4HWUA 4A7SA 3P77A 3TYGL 3L08A 4PJBF 1CE6A 4XMLL 4Y9CA 6FABH 1I1AC 5LXVA 5FDWA 1FZKA 2F8OA 4Y19D 4J28A 3HNTH 3PNWA 4OVUA 2JKJA 1WBZB 1A7RL 4XP4L 3DVGA 3APCA 3RWEB 2Z92B 4F33A 2XWJB 3MLXL 4JEGB 1YYMH 4HWZA 1BD2D 2IADA 3WFZA 1O7SA 2MOVA 2WMPA 3QG6A 2E7LC 2V7HB 3TYFA 4F27A 2HUHA 2WXIA 4OCYL 1TZAA 5I5MA 3ARXA 1QO3A 3GTTA 4B9JA 3QR1A 4CU8A 2ADGA 1IGMH 1P2CA 3GWJA 3MUJA 1HYSD 4FLSA 3HE7B 4JFXB 3BMVA 3EJTA 4PJXB 1UD6A 2FJGA 5IW3A 3ZX1A 4YDIL 5I2IB 3CSTA 3NJMA 3SGJA 1HHGB 3GGWB 3ZJAA 4LLQA 1U8PB 2Y6TE 3N85H 3BP5B 3D69A 3RVVD 1AGCA 1E5AA 5H8DA 2NY0D 4HH9A 3LV3B 4KKZA 1RUAL 2H3NB 4ZX6A 4YPGA 5FA3A 1N2RB 1MFVA 2GT9A 4CMMB 5LQBL 1VFAA 2WKOF 3MLRH 3O4LD 3PHOA 2X2UA 3UG3A 2IANE 4U3SB 4AKQA 2PWFA 1RIHH 4ODSH 1G5GA 3KD4A 4PRNB 4NUPA 3QB7C 4H7VA 4DOHB 5C0JB 1H6UA 1J8KA 2ZOTA 2FGWH 1UZ8A 2DBLL 3NIDB 3E9TA 3NFNA 2PTTB 3MRKB 3DVNA 2F5BH 5I8OH 3WIIL 4GO6B 4XVJL 4I5BA 5TE4H 3FU7B 3F7QA 2A74B 2PPAA 1U6AL 1EIBA 4EF3A 3P54A 3VXSB 3QO0A 2I5YH 5I30H 5A3ID 2DLIA 2FEEL 5GRUH 2EXYC 3IETB 4Y5XB 5AVUB 1AGBA 4HKXA 3DO4A 4X6CA 5ANMA 3LNFA 2X4SB 2OYKA 3CMGA 3FUIA 2VXSH 3QRGH 3ZR6A 1MWAA 4I9WE 2YZ8A 3FMGH 3JQOB 5TH2A 1RZKH 1KB9J 4PREB 5J0BA 2ZF9A 4HIHA 3MFGB 4QJ5B 1R5IA 3VCLA 4GAYA 1D6VL 1QSZA 2X4TA 2QEJA 4QRFA 4A38A 4GG6B 1IZJA 2W65A 3VX1A 2VDNL 5GGSY 1EK3A 4XCYA 1YEEH 2XV6B 1WFNA 4QF1B 2OCCB 4CKQA 4Z7OB 1SN5A 3CSYA 3DIFA 2CUAA 3WS3A 2VZ3A 3A3YB 3ARVA 3QUMA 1HXYA 5AWNL 4KY2A 5IVOA 3L7FB 2DYRB 2QVIA 4ODXA 5DC9B 5K69A 5KYXB 3SODB 2NX5B 3PL6D 2O5ZL 4AIXA 1OW0A 3KPSB 4KZEL 3PGCB 5JO5B 2CO2A 2G60L 5I0VA 2WUCL 2JQMA 3QQDB 1PW3A 3VSUA 1QUPA 2YLHA 4PS7A 5MEQA 2E7DA 4NYLA 1VENA 3PREA 2R23B 3PXLA 5SWZB 4UOQA 1X9UA 5BVJA 1VFBA 3IKCB 4OGAC 1JPSL 3KLAA 1RY7B 3HFMH 1HE7A 1KTDB 1INEH 1FZJA 4LCVA 3FQWB 4UTBL 3ROOA 3IAGC 4KKLD 2ADJA 5IHZB 5DLMH 2F54A 3I9AA 2H32B 1FJ1B 2BY2A 1JGVH 1E5ZA 3IGAB 4PJFE 2JJUA 5BS0B 2OZ4L 5GGUA 4UQCA 3LZPA 3U30B 1FO0B 3UJTH 1T7YA 3KJ4B 4DGVL 3J7HA 2I7SA 2TAAA 3ISYA 2X09A 4M9OA 4PLOB 4RIRA 3WE6B 2BOBA 3GMNB 3MV9B 4BKLB 4F2MB 2N1KA 3MLYH 5JYMA 4P2RB 2ICWB 3CVHB 5E8NB 5HPOA 5L0QC 1JJUA 1HDMA 4J6RL 1V5JA 3VDCA 3EKCA 1L6XA 4GO9A 4MXVF 1WISA 2VM3A 2VT0A 2DQJH 3EGSA 4OFQA 2ITFA 4PJCE 2QHRL 1T1YB 1MHPH 4PG9A 4MYWB 4TUKL 3HFFA 4WUUD 3DTXB 4IDLA 4DN4L 1NANH 5HDQL 1RP8A 2VC2H 4PB9L 1U92B 2ADYA 1J8HA 2YRPA 4A2LA 2GIYA 1KYUA 3OJ2C 5EDXA 1P7QB 2Z6FA 5K5YA 4NHCL 2RIKA 2XFXB 1L7IL 1F58L 2DWDA 4TSCL 3UTTD 3DC0A 4FDWA 1B88A 2EH8L 1VESA 2YKLH 5T5FA 4BIKA 2EEXA 2GBAA 1LEIA 1R3KA 4LCCC 2VLKB 3S5LA 2E5EA 3KYOA 3P2DA 5D1XC 3TNMA 4RH4A 1JZIA 4X6DA 4DF9A 1SMDA 2Z8WC 3HNTL 5AW4B 5D7JC 2UYLA 1M71A 4L3CB 1BYNA 1U8OB 3W56A 1NICA 1I7ZA 1SVCP 1YYML 4HDIA 5E6ZA 1XB3A 3B4NA 4CSSA 5JR1H 3GRGA 2HRLA 2QKIB 5FS5A 1JK8B 3KLHC 2P52A 3QFDA 4AGMA 4YAQB 5F7DA 5GS2D 5I73C 3PHSA 3LEXB 1XDTT 5FIEA 1DEEA 1FFQA 1IGML 4TUOB 1LM8V 3P3SA 3HE6A 2F7OA 2UX6A 1I75A 2GI7A 1QI3A 3SKOA 3V8CA 2IMNA 2G9HA 4KRPD 1MUJB 1DQQB 1GOFA 4QWWD 1N59A 4L8BB 2FYYA 4NRYA 2F9BT 4RZCA 2JJTA 3BSHA 3QZNA 4YDVB 5FAAA 5JHDD 3B8SA 5I1GH 2VMDA 1JTTA 2APTA 3CBKB 1DSFH 3FU6A 4JG1H 1WV7T 3N85L 4OLUH 3UTOA 1FH2A 3CG8A 5HI5C 3SGJC 4LASH 1LHZA 4HAGA 1U3HB 2J8UA 4GI8A 3QUZA 3V7AE 2MTPA 2X6MA 5I0DA 3MLRL 3UP1A 4HD9A 1IE5A 1RIHL 2JI2A 3MACH 4ODSL 3QZLA 1PX3A 4FTVD 5D1ZD 5IMLA 1XGPA 3L9BA 2AAAA 3RLSA 2FGWL 1L0XA 1YUHA 1AD0A 6PCYA 2WB1A 4EZKA 3DLQR 1AC6A 1ZV5A 3CN3A 3CVBA 3VFVB 5I8OL 4YN3A 4JO8A 5DURD 5TE4L 4H1LG 3VTTA 3FAXA 4JVPA 1NDGA 3ZZSA 4EXPX 1MZYA 4UMSA 1Z0MA 2I5YL 2OTWA 1UB6A 3HN3A 5F6IB 5IWLC 3T9WA 5GRUL 2X1PA 2YD3A 4HV8B 1OAYH 2BIIA 4WTWA 2AQTA 2CHDA 2EABA 3GQFA 1ZD6A 3VFTB 3QXDB 1TVBA 5A40E 1F97A 2VXSL 3QRGL 3HC0B 4R4BB 3FMGL 2ZYHA 3VI3A 1RZKL 4RLDA 2G3ZA 4HZLA 2AJXH 2VR7A 4OLWH 4H8WC 3FW6A 2BSDA 2G2RA 2XXGA 4DKEH 3CFKA 3VFUA 1YEEL 4D0CA 1KXQE 3MJGX 3ZTEA 5FUZH 1HE8A 1B6UA 2B77A 3X14A 2A9BA 4NKOA 3C8KB 3L5WA 2GFBA 2ARJA 1OLLA 4FQQA 4DVBB 5IIEA 3FPYA 4XVSH 4OGQC 4W9LC 4WHTB 4M43H 4KZCA 1WJ3A 4NQCA 5M7QA 4N2OA 4MD0B 2WXRA 1FVEA 3OR7B 1SYVB 3W9DA 1XIWC 2VLLA 3HFML 5HDBE 1INEL 2P8PA 3IJYB 2X4UA 5DLML 3IFPB 3ATFA 5JIMA 1JGVL 1HQ4B 1KOAA 2G5BA 3C5XA 3B34A 4TNFA 5B38B 3IPBA 4HPYH 4PY7B 2GK0B 4E9VA 5EU6A 1YMMB 1Z5HA 4X5WA 2H2SC 3UJTL 4OM1H 3NJJA 1OGAE 2OMYB 2DL2A 1H3PH 1JNNH 2XV2A 1OHZA 3B7TA 3MLYL 3SDAA 2WLLA 3RTQB 1U8HB 1U58A 3QHTC 1J9SA 1Q9LA 5HGAA 2C4FT 3MRIA 4FKEA 4PJ8A 2XZAH 2DQJL 5JHDB 4PJEB 5IG7B 3QDHA 4PRBB 4XP9H 5KSAD 3QJRB 5KANI 1MHPL 1CPUA 3BAKA 3L3IB 4JCMA 1X5MA 1GYUA 4OCXH 1A6AA 1VGEH 4FA7B 1WFIA 4S0TD 2EDOA 4MJ6A 4PLJC 1OPOA 3Q05A 3S8FB 2VC2L 2VIRB 3QS3A 3WUWA 4IBVA 5AFAA 4ISVB 5MEPB 3VVVA 5TF1H 1XBDA 1QTYT 1XCQB 4JFED 4KGLA 1OOAA 4Z0BH 4KDWA 4BK5A 4ZMWA 1R75A 3MRBA 3DPBB 2CA4A 4FA8A 1ZT1A 2Q86A 2P8MB 5EULV 5GIRA 4HLEA 2CO1A 4JHZA 1FDLH 4K5NA 5E00B 3PUUA 1P1ZA 4I2XB 5DJYB 4BSJA 2YKLL 2GJJA 2JKLA 3KLKA 4HT1H 1EANA 1QA9B 4ZUUA 4TXVB 2EO7A 2EC9T 1EEUA 4P23D 2O93L 4PJ5E 1FFTB 3MNZA 2Z3FA 5T3XD 4GSRA 5HY9A 1G9EA 5HHOA 2JB6A 3QVAA 3F12B 1S9VB 5T3ZH 1TQCC 3UOAB 2WC7A 4MMYA 4FXLA 4JFHD 5JR1L 1A6PA 5J11C 4J3OC 4IMLB 4S1QH 2OI9C 3GSUB 4OZ4B 1IRAY 1GA2A 1TETH 3V9FA 3I6LE 4W81A 5FYJE 2XTLA 2L04A 3C9NA 3F62A 3EO0A 4JY5H 2CO3A 4MAZA 1LE9B 5DQDH 4KXZH 3V4UH 4DP2X 3L4XA 1K3ZA 1QVOA 5T1LA 4F3FB 3O3DB 4HWBH 3HE6C 1BM7A 3SBPA 1YPZA 1P7KB 4JR9H 1HOCB 2BOCB 4OLUL 1DSFL 1E3XA 2H47C 3BCDA 4JG1L 4P5MB 1KB5A 5I17A 2ZZUT 3NRPA 4C56E 1RUPH 3TEXA 5EC1B 3ULSB 3NCMA 1AO7D 4LB8A 2XJKA 3FUEA 4LASL 4MJID 5ABDE 4K7FB 3FKUS 4K71C 1BLNA 3C60A 2EZ0C 2IPUG 5DD3H 5EU4A 5I8CA 1QP1A 3O4OC 1HZHH 2BRRL 3VH8B 5DEJA 4L29A 4P05A 2OJZH 5EHFA 5DA4A 2EUZA 2YC1A 3PIQA 5C09D 3ARGB 4S1DD 3B3IA 1T0PB 5E23A 1RZFL 3FUFA 4BFGA 4KPHH 2QT6A 4OUOA 2FX7H 2NTSP 2V3FA 2XN9A 3QIUA 2BC4A 5D5ME 5C6PB 2VLJB 2FX9H 5C0CA 3GLDA 1VFUA 2C9RA 2SODB 1OAYL 3SOBH 5A43C 4EEEA 3BQVA 4N2MA 4U0RC 5T5NF 4XMTA 5KSAB 3BKMH 4GG8A 1D5MA 2E56A 3L4YA 3ES6A 5ENWA 2ICEA 2IQAA 1D5ZB 4PRPA 4LNRB 5KUMA 4R4NC 4CADB 1KJVA 4CILA 2F53B 4R2GB 3AY2A 2AJXL 2K6YA 3BVXA 5AW7B 2F7IA 4OLWL 4G83A 4U1MA 1DANU 3QDJA 2NY1B 2BNUA 4GRLC 5D9SA 4HETA 4DKEL 3SDXF 1DQVA 4JGNA 3G08B 1G7QB 4Z7OF 2N01B 4FFWD 1PY4A 1YEDA 2YUVA 5LBVA 3T65B 2JMRA 2LU4A 4XP5H 2BNQA 2J1KA 3N1PC 3HOGA 3TC9A 3E8VA 4A2GA 4PJ9A 2RB8A 5DJ2A 2X0VA 4XVSL 5I1AA 1DQDH 4M43L 2XNAA 1OB1B 2OTPA 1YN7A 3IT8D 4CL7A 2QL1A 4KC3B 5EUOB 4M1CD 2Y7LA 3RTLA 4AYDC 3EZ8A 1RZPA 1KBGH 5AW6B 4RMSA 4BFIB 3GMRA 1TUPA 4A6YB 4D9QE 2AS5M 4A7TA 5CEZH 1PZSA 1KJ2H 1QHPA 5D4QA 4HMDA 4OW6A 1A7PL 5AVYB 1J0JA 1UXMA 1NMCB 3OKNA 4HPYL 3SGEH 3BT2H 4DZBB 3TIEB 1AHKA 5C2UB 2XWBA 1E0OB 2YN3A 4BZ1H 2F19H 2GTWA 2XXCB 4OM1L 4UZUA 4PJ7A 1OSZA 2BNRE 5CMAA 4YBQC 4YXHH 4ATTA 4GKZA 5L2KB 4POUB 5DS1A 1JNNL 1KGXA 3KVDD 5C0BE 4KJQC 5HI4C 4FG6C 4PUBH 1QFPA 1U93A 2XZAL 3B9VA 3JV4B 4N0UB 4XP9L 1Z7JA 3FN0H 2EYSB 2AJYH 1V55B 2AZAA 2EDRA 4OCXL 5BOPA 4L18A 1J0IA 1VGEL 4IOFD 3RJOA 3ARDD 4OZIB 1AO7B 2OMTB 4MJIB 4Z3GA 3ZYJA 1U3ZA 1A6TA 1CF1A 5HPMB 2FJFA 4PJHB 3VWJD 4A63A 2YKKA 2XXFA 1SHSA 4JREC 5TF1L 5LB1A 5E8OB 1QQDB 4Z0BL 2WN2A 3N91A 4KO7A 5DEGB 2NQ3A 2J1YA 4LLMA 5AVXB 1FDLL 4I1PA 2DH3A 2NTFB 3RIKA 3WO3B 1F56A 2CK0H 3IMRA 4QRPE 4BK5C 5DYOA 4X0NA 1BBJB 4HT1L 4ENED 3L1OL 3WKYA 2ZXGA 2FZ3A 2YA1A 3HCVA 1N18A 1I8MA 1C16B 4Y4KA 4OJFH 3O3AA 3UABA 4P48A 3VQMA 1F4YH 1RK0B 2YSSA 5IMMB 4JRXA 4ATWA 1UH2A 2YZ1A 4PVNA 5CN3A 1QHQA 2FT6A 3UPRB 4S1QL 2XBDA 2ZCHH 4UILH 4PYHA 4Y9EA 4YUEH 1ZSDA 4LSQH 3QZWB 1WUNT 5D96B 4Z3TA 3DOIA 1TETL 1NCGA 5K59E 5DF0A 4ZAKB 2G4GA 4L37B 1A47A 3CHQA 2DICA 4MQXD 2VQ4A 4JY5L 4PCKA 3RWDA 4JFOA 3HG1B 5DQDL 4F93B 4L5FE 1B90A 2PO6B 3V4UL 4YFLF 3NSCA 4HWBL 1KIUA 1PAMA 4QLRA 2DJSA 3O9WC 5A16B 3KVQA 5LBGA 2IBBA 2OM5A 4JR9L 1SPDA 4R97B 5AVTB 3V6ZB 2NNCA 2CMRL 2PR4H 1R5WB 4X9BA 4LCIH 4TVPH 5C0AA 7PAZA 4L4VE 1MG3C 3SD2A 1RUPL 5E8EA 3CFBA 1S8DA 3MO1B 3QJHA 3ARBA 4XX5A 1J48A 2R0WH 4OI9A 1EFXB 3RDTA 2NY6B 5DD3L 5SWSD 4PRIB 3GNMH 1Q0XH 4FABH 3TN0B 1DANT 3V0WH 2C9PA 3SIKA 2OJZL 1EEZA 3C60C 3HI1B 3BGFC 2Z9TA 3ML9A 2A4ZA 4OCWH 4D8OA 3LDBB 1IO4C 2ITCB 5ICUA 3MGTB 4BFFA 3L6FA 5JNYA 4KPHL 1KYOK 2I07A 2MQGA 1UD5A 1XGZA 4PJIE 3LZRA 4PI2A 2FX7L 1ED3B 4JNXA 5B39G 2HKFL 3TCTA 3D85A 2BP0A 3BZ4A 4M7JH 1C7TA 2FX9L 4MAYA 2B59B 3CSPA 5HGBA 4G6AC 4GBXB 5F97E 1EGJH 1A22B 1KCUH 5D1XE 3SOBL 1WA1X 3QIUC 1T5XA 3U4AA 4OCLC 3BKML 3IDJA 2ILLA 4K15A 5K1JA 4PVLA 3UACA 3D12B 1S5IH 1T20B 4NZ8A 3J07A 1W8NA 3BIAX 1RU9H 4UIMA 4OFDA 2N7BA 3AZUA 4U3XA 3FU9A 4X0KA 3DOSB 3C12A 3H55A 2ESVD 5B8CA 1JWMA 3ULUE 3D39B 1G9NC 3IRCA 3QEQD 4A7GA 1KXVA 4FI7A 1HHHB 2ICEC 2Q6WA 1E9PA 3T0DA 2ATPA 5GS3A 3CLFH 4S0SD 4MKTA 4FD0A 1ZHLA 2Y69B 4XP5L 2J4WH 3QCTH 4XMVA 3WN5B 1G6RA 4ELMF 4RMVA 3H8NA 3KWWA 4PSPA 1DQMH 5IMOB 1DQDL 4TN9A 3I84A 2NY3D 3LKOA 3T77A 4PJ9C 1RZ8A 2DMHA 5IF0B 1J12A 1K72A 3OPZH 3VXTB 1TF4A 4J4PA 3LQZB 1DVZA 1BVNP 2VM4A 4XHJC 1ZOXA 3CZUB 3QFJD 4PTUB 2FO4B 1GJIA 1K5WA 3NFSH 4HUXA 5CEZL 4W9CC 4IKJA 4RGND 5DRWA 3TCXA 5IROD 1UTDA 1N6UA 2M8XA 2AV7A 5JDSB 3BT2L 2A6DA 4TQEH 4BZ1L 2F19L 4HIEA 3QNYB 3K0WA 4YXHL 4NZFA 3Q1SL 4IU3B 1OSEA 4M7ZB 1WWCA 4U6XB 4S11A 2JQZA 3V8OA 3RP1A 1TSHA 3I6SA 4PUBL 4GIOA 1Q90A 4Y5YB 1A9EA 4ZODA 3B9EA 1NEZG 3VSVA 1N0LA 4CU6A 5IUCA 3B6SB 1VF5C 4Y1AB 1D7FA 1WD8A 3FN0L 3VXNA 3QUKA 3KPQB 4R3SB 1C12B 4OM0H 3O6FA 4AZ8B 5HTSA 3PWPA 3DRTA 3QZMA 4Y2DD 2AAVA 4ZZFA 1BIHA 3DSFH 2Z8VC 4MQ7A 3O8XB 3K71A 4QXWA 3EJYD 3NZ8B 5SWSB 5ANME 1S7SA 3EOAA 4X6CE 1S78C 4WO0A 3VVWA 4BWTA 2AK4A 2ZT9C 2HFEA 4KAQH 1HH6B 1ONQA 2B3RA 3RAJH 1L3NA 3V0GA 4W4NA 3W39B 4TTGA 3MJWA 2UY7A 1T4WA 1ACCA 5I0YA 1UQSA 3ZTNH 2CK0L 3MQIA 4BBWA 1OAKL 4HKBA 1E4KA 2VRQA 5DFTA 4FYTA 2J1ZA 4LCYB 4JX0A 1IBGL 2WAHA 2X7LB 4HF5H 4OKVA 3WOVA 2G75A 2GJRA 3C5ZC 3TOPA 1B0GA 2X4RA 3LEVL 1HX0A 4XO8A 5D7KE 1JYWA 2EXTA 2BVYA 2HX8A 4OJFL 5I6LA 2L7QA 4OLEA 1WD9A 1QFWH 1NCOA 1SDDA 4CVUA 3LKPA 4GXFA 1F4YL 3MCKB 4XZ4A 3QI9C 4Y4KC 1Z9SB 2CLRB 1SJEA 4N2DA 5DWUH 4G7QB 1ET7A 2IAMA 2ZCHL 3LN4A 4UILL 3BWAA 3B9KD 4LSQL 5IB5A 4LIQH 3BUYA 1XV8A 1EEYB 2BFVH 4IKKA 5DQ9B 4BKTC 3QEQB 5EF0A 1KB9K 1AS7A 3APMA 4EE2A 1NBZB 1DCEA 1CJYA 4P3CL 3M7FB 2XQBL 4W1TA 3P40A 5DJ6B 3MZGB 2F54E 4X4MA 2K45A 2NOYA 3B1UA 5DUBB 3LPOA 5DD5L 3S34H 4PLNC 1I53A 3WIFB 1N26A 1J1XH 1YN6B 3ABKB 3QJFB 1KZQA 5F1IA 2PR4L 5B7FA 5BRZD 1KWKA 1I1FB 3C6LA 4NBZB 4NT6A 4TVPL 1KPVB 3JWDH 1U33A 3HBGA 5F8RC 1DFXA 4YLQT 2IFGA 2WSKA 3H3KA 2R0WL 3BIKA 3UIYA 5BUPA 5FWQA 3P2BA 3WY4A 4TQHA 4Q97A 4QAMB 1PD0A 4ZQTA 1G7HB 1Q0XL 1RZJH 2C9AA 3GNML 3KHQA 3QFJB 2FK9A 4FABL 5EEVA 3BWZA 5EF2A 4AM0Q 5C6TH 1ROWA 3V0WL 3WEMA 1OCZB 2R1YB 3RDTC 1TEYA 3X1GA 4NC1C 2ZPKH 2B9AA 2J1XA 4TNEA 4N0FA 1NGWA 4PP2A 3II1A 3M88A 2X88A 3MRCA 5BO1L 1J8HE 3V4PL 4M7JL 5GJTH 3GRWH 3GSNB 4NN7C 4ZO7A 3BKCH 2KZKA 3FQTA 1EGJL 1KCUL 3VG0H 3NJIA 3FTVA 1IGYA 4G43A 1QHOA 1X44A 1C8QA 4MAYC 4NNPH 2NMSA 5DJXA 1PF3A 4MDJB 1S5IL 1RJLB 4ZXBB 4FNSA 1RU9L 5A2IH 1CWVA 5T8IA 2BS9A 3WEXB 2H9GA 4WJKB 3QNXA 6TAAA 1JZFA 1RHHA 3B5GA 4X6DE 4AX3A 1OK8A 4PS4H 1HJCA 3KLDA 4J23A 3SYCA 5HHVH 1LE5B 6PAZA 4Y1SA 2C9QA 1CFSA 4AZUA 3WTVA 3CLFL 2Z4QA 2WSDA 3VD2A 4JO1H 2J4WL 2ZNXA 3T0AA 4GRWB 5KVGH 1BEYH 1YNTF 5ITFA 4FLRA 5GS1C 2YO3A 4XNZB 1DQML 4F7CA 1ZWIA 1MCIA 1WWAX 2APXA 3ZE1E 2HTKC 4LPVA 4ZD3H 3WBDA 4A66A 1VZHA 5AVSB 3LPWA 4XGZB 3D34A 1GS6X 1SM3H 1UM4H 1QSEA 2WBJA 3M46A 3OPZL 4M8RA 5E9NA 4U6HA 3ZL4H 2KQMA 5J3HD 3D33A 4ETQB 3OTTA 3NFSL 2BCKB 2UUDK 4ZUWB 1E28A 1HHJA 4HJ0C 4QY8A 1E4JA 2IPKA 3S96A 4TQEL 1V27A 3DX7B 1T5KA 4POZD 2J8UE 4EPSA 3MJ7B 4YSQA 4UMGA 1BSIA 5EH1A 1C8PA 3OB8A 2BVPA 5B1AB 1TSRA 1ZS2A 1AGFA 2WHVA 5DI8B 5ICZB 3N50A 2BINA 3AB0C 3QA3B 4MD5A 4FNUA 1ZIAA 3ZZLA 4F7PB 32C2A 5IQMA 1BFVH 1KN2H 2HN7B 1U0QA 5IT2H 4UQEA 3HRPA 4OM0L 1TIUA 1NQBA 5C0EB 5CJOL 1HHIB 3RPIA 1U8QA 1J11A 3DSFL 5B4MC 3MRLA 3RZCA 4TSAH 3AG2B 2OYLA 1NPJA 2XTSA 1UVQB 1SJHA 2DWEA 1U8KB 4PHZA 3P1VA 5I8KH 2IPTL 3OLGA 3O6FC 3DVFA 2CBTA 3CMOL 4ZO8A 5KZCB 4KAQL 3EYQC 3RAJL 1YAZA 4NQTA 4Q0XH 4AT6A 4Z7AA 3SE6A 1S7UA 2O61B 1SOKA 3EYFA 3VI3E 3ZUCA 4FQLH 4MX7B 3ZTNL 4IBQA 2GPZA 2P5PA 1MHEB 3TM6A 2DQDH 4NRZA 5I6MA 1DBBH 1SEBB 1ZA3A 5I24A 4HF5L 2DWSA 4S1RH 4DP9X 5TDPB 3UCQA 1TG8A 1FNHA 3QIWA 3EGDB 3KXFB 3OM3B 3VG9B 3MLZH 4E0RA 1IFHH 1QFWL 2R1WA 4M00A 4LSPH 4ENZA 1IZKA 4G8FB 4RDQF 1DUYA 3RFZA 1E5BA 2BDNL 3CFTA 3E0GA 2WB7A 4WGKA 3UGXA 3GJEA 1P4UA 3ATAA 4M61B 3NOIA 2VM9A 3HPJB 3BAXA 1O5PA 5DWUL 2OKMA 1J9TA 4N90D 5ISZA 3WU1A 5DMJB 4XCNB 3D4ZA 1GSKA 3GMQB 4LIQL 4XC3H 5MENB 4NQCE 3EDFA 2DM4A 2BFVL 5EN2A 4LLUA 1DDHA 4FNLH 5JW3H 1DL7H 4JLRA 5DXWA 2HWZH 3IDMA 1CYGA 4FFTA 3MCYA 4D8PA 3AXLB 2DQFB 5I5IA 3S34L 3PYCA 5DZPA 4HSAC 4BYHA 2VYRE 1J1XL 4AIEA 2FUTA 1UJ3C 4MSWB 4JKMA 5EU6E 3HHSA 3L2LA 3FQNB 3HAEH 4UQ9A 4WV1A 3JWDL 4I3RH 4XI5D 5KS9A 1MNUH 3B9DA 4NOBA 2OXHA 2XKSA 2AQRA 3M7OA 2ZP0T 4OJCA 5J12C 1SOQA 2Z0BA 2YUWA 4ODBD 3C6LC 5ID0A 5FV1L 4F91B 2Y0SA 1DQJA 1H6FA 3WMQA 5ALBH 1RZJL 5AVRB 2V2XA 4YH6A 3Q9QA 3B9AA 4HFWA 5C6TL 5E9DA 4AQ1B 4M93C 2VSKB 5AD0A 1QUNB 4AYFB 4TL5A 2ZPKL 4JZJA 1TCRA 1MREH 3BO8A 3CZLA 1CMOA 1MQ8A 2YPLD 1EXUB 5HYQA 1L9TA 4QRRD 3BP7A 1GYAA 1X6NA 3EO1B 1YHPA 1AZCA 2B4CH 2VUOA 3D51A 4YS4A 1G7PA 5GJTL 5DVPA 3BKCL 4NS0A 1TQWA 3O2DH 3B5TA 3VTMA 35C8H 2DQHH 2VDQH 5CIPB 1ZK5A 3V4LA 3VG0L 1SY6A 3GK8H 3VNZA 4EI5C 4TRPL 3GIZH 5DZVA 2GK2A 1VFOA 5DEZA 2XETA 4NNPL 5DRZA 2EIZA 2IH3A 3JXAA 1IEBB 5IQ9A 3FCTA 1KPUA 1IUZA 4EUPA 4YFEA 2RA1A 5CM1A 1NOLA 4HX1B 4BQ6A 4NO0A 3DXAB 2DQUH 4AEIH 3JZYA 5DJAB 4FZEH 2DEYX 3HUJA 5HHOE 3QRFM 1CLVA 1LNUB 2FSEA 2HB0A 4PAZA 3UAEA 3LNEA 5HHVL 3FDWA 1IBYA 3BUBA 1G1KA 2QR0A 4MD4B 3CK0H 2CIKA 1XSJA 2W9EH 2WJ7A 2V2WB 1RZ7H 1NTDA 4JO1L 1LP9A 2A73B 5E4AA 2ZTBA 1CGVA 5KVGL 1BEYL 1W0WB 3IDNA 1T1XA 1BF8A 1R3JB 3GSVA 1JGEA 4MS8D 4Q9RH 1DVFB 3AJ7A 1UHVA 1CE1H 4ZD3L 1KJ2B 3D0LB 1MCWW 2OR9H 3EBIA 1SM3L 1UM4L 2IANB 1OGSA 2V9UA 1SNRA 3ZL4L 3IGLA 4F8NA 2BSRA 2WWOA 1M9SA 2ARJQ 3LZFH 1YPZE 5IFJA 4UNUA 1QRNB 2WBJC 2IDSA 4U7SA 1KELH 3D6GA 4M6OH 5T3XH 3KGRA 4N2CA 2EICA 5SX4I 4MRBA 5D1QA 3RKDD 4WGWB 5CSBA 5EBLA 5FO2A 4BWWA 3BAWA 3CH1A 5GGTA 5BV7C 1H5BB 3WD5L 1F41A 4Z7QE 2FR4A 1RJZB 3IE4A 5FB8A 2NUPA 1QD0A 2X4PA 4NN5B 4YSRA 1FFNB 1NGQH 3FL7A 3T3PE 4Z3FA 3WTUA 1RP9A 1S4IA 3SD5A 2VDRH 1SDAB 1BFVL 1KN2L 2YWYA 4XMUA 3GIVB 5IT2L 3ATBA 4B9IA 2UUDH 4DTGH 4XH2A 1UT9A 1PZUB 1Z32X 2XN9E 3O45B 3PS6A 5HHMB 3LRSA 4N9GB 4Y4FC 4TSAL 5AQ0A 4UZSA 5C0CE 3CZEA 1HL8A 3G5XB 1RUQH 3JWNH 1KIPB 5I8KL 5JOFA 4XWOC 4XMXA 3MRMA 2WWMC 3RZCC 1AYRA 4APQD 4Q0XL 1TLKA 3LZQA 4PRPE 3ULVD 3VDBA 2WN3A 4FQLL 1PQZA 4FOMA 2DQDL 3US1A 1IEAA 1DBBL 43C9A 2AQ1A 3QDJE 4S1RL 1HCFX 2PW2B 3AXIA 1J86A 3OKLA 4M4RB 3TASA 2NY2B 4PEEA 5CD5C 3MLZL 1S7QB 1VEPA 4O00A 1USZA 2X9YA 1IFHL 5AZUA 4CKVX 5T1MA 4LSPL 2R27A 2BNQE 2Z1KA 5KVMC 3QIWC 2BXZA 1AY1L 1NCIA 4WFGE 1WIOA 3TZVA 1GGYA 1MH5A 2V2TA 4YNYA 3F00A 3T4YB 1WWWX 1CFTB 1N8ZB 4CVXB 3GSXA 3QXUA 5EIQA 1RUMH 4K8RD 3UX9B 1ACYH 1FQ9C 5LO7A 4NAMA 4XC3L 3RFZC 5CR8A 4MMXC 3S3SA 4NI3A 2V5YA 1IAOA 1EDYA 5EWIH 2K70A 4PWHA 4FNLL 3SCMB 4ONFH 2HH0H 4YBHA 4ANXA 4DEUA 2ZONA 4YLCA 5JW3L 1DL7L 1ZLVK 1G84A 2WCGA 1CS6A 2J8OA 4HIQA 3RE0A 4G1EA 1DDTA 3LIZH 4BCZA 2Y25A 4NNXB 1BQKA 1QWNA 2QZQA 2A6JA 1TTCA 2Z35B 4KO9A 5A1AA 5ID1B 1AH1A 4ES8A 4PJ7E 1GTFA 4MJ2A 5EU7C 3BPNB 2E59A 4I3RL 1ZVYA 1MNUL 2GEEA 3DSNA 1FZMA 2ZX9A 1PZCA 3HJEA 5E7BA 4JZOA 4B6ZA 4WV1C 5D6CB 4WWKB 3O3EA 5ALBL 1TU2B 2AQ3A 3Q06A 4AGNA 1CL7H 4ZMZA 3QUYB 4C8XA 5DDHB 4ELKB 4PYGA 2XWTA 3PXHA 1ITBB 3HNVH 2YLKA 1MCEA 4LBEA 1MREL 3QWOB 3UAJD 5HYSG 2NXYD 1J7VR 3BPOB 4V1DE 1HKLH 3DYOA 1T66C 2Y3AA 2H6OA 4JHWH 4YDZA 1MCKA 2B4CL 1NGZA 4UQ3B 4MJJA 4F1ZA 2V5RA 3L81A 1RFDH 3WNJA 4F2EA 1WIPA 3O2DL 35C8L 1SHMA 2DQHL 2GW5A 3GHPA 4XNDA 1EJ6A 3GK8L 4PBVC 5F1NA 5JDJA 1JVKA 4C4KO 2ZUYA 1N19A 4P4KA 3RWEA 2ZCLH 3FTGB 4Z7NE 3KLSA 3H7BB 2XWJA 3QS2A 4UBDC 4P0DA 1X4ZA 4R5XA 1NIFA 3SE4A 4AEIL 4CUCA 5AZEH 1HJBC 1MW3A 1U8CB 4FZEL 5AVQB 2EECA 2EXSA 2K7PA 3TBCA 4LEOB 2ZX6A 3LXBA 1BAFH 4MNGA 4JRXE 3UO1H 2W9EL 4F8OA 3U2SB 5AAPA 3IMWA 1RZ7L 3HE7A 3Q2LA 1GY1A 3BWUC 4JFXA 4WHDA 4PW9A 2EO9A 5K39A 4PGCA 2K0RA 2EUVA 3FQ2A 1WFTA 2H0FA 4N1HB 4GYBA 5I2IA 2B5IB 4MQSB 4Q9RL 1CE1L 3LSOB 1HHGA 3GHBL 1OWWA 3BUQA 2X9ZA 3MV11 2OR9L 3O6KH 5F9DC 1JPST 1RZIB 1U8PA 3BP5A 3VXRA 4X8JB 3KAAA 5ECGA 4NZDA 2XPGA 3JUZA 3TBVB 4K07A 3BUDA 4KNTA 1Y1UA 2H3NA 5FGCB 3VJ6B 1N2RA 1SN0A 5JHLH 1AZRA 4FI8A 3FK3A 3RUGF 2XPZA 4TLUA 3HB3C 4WFHE 4MB1A 5C0AE 2DQEL 2PP8A 1KELL 4U3SA 5TJWK 3S35H 4EZJA 4M6OL 4PJ5D 5T3XL 4PGZA 1AFVH 3MV01 2JXMB 5AYTA 3Q2VA 1MI5A 1OARH 3TTSA 2FWLB 4ICWA 5DD6A 4NC1E 4ZS6D 4OV6F 3IJ8A 3DUUB 5I1DA 3MBED 5D1QC 4WO4D 4I9XA 3OXRA 1MAMH 2A74A 3DDFA 1NGQL 3TEWA 2QGCA 4GKOA 5GSRB 3VXSA 2E9GA 2VDRL 3ARED 1D2OA 4N2KA 3LKQA 4FQ1L 5H35B 3I6LD 4DTGL 4MYPA 3EF4A 3AMKA 3VGDA 3H53A 2K6ZA 2X4SA 4ZYKB 1J5HA 3SKNA 2EEAA 4EIZC 5IGXH 3MZTA 3X1EA 1RUQL 3N0PB 2HVBA 4EKXA 4MKMA 4NXSA 4M5YL 5D4HA 4JDVB 2YBRA 2ZOKB 2FAUA 3F58H 5HHQB 2TRYA 3MJ8B 1FNSH 4MXQC 4N2HA 3RX5A 4IQHA 3RDJA 4C56D 2YAPA 4L0PB 5G2NA 5BCAA 1K8DB 1VLXA 2UWEA 3MXVH 1G6VK 4I87A 4OFVA 5KYXA 4IYKA 2JB5H 2QSTA 4Z95H 2NX5A 5HDBB 1D5BB 3VXOA 2QMKA 3KPSA 3KEDA 3VI4B 4BDVB 4Z7VB 4Y16B 5AOLA 2JCCA 4LCUB 5D55A 4ZNCD 2I7OA 3LZLA 5JO5A 5J5EA 3GJFB 5EEYA 4IGBA 1FRGL 3H7LA 2O5YH 4RBPK 5SWZA 4XC1H 1T1WB 1OAJA 2VXUH 4OFYD 1RUML 2EUXA 3QJTB 1OGAB 1ACYL 1WGOA 4NLAA 2HLAB 3ARRA 3TZVC 3C09C 3AT9A 4PVMA 5EWIL 5DHVH 1ESOA 2Y2WA 1HCVA 4LXFA 4ONFL 2HH0L 1ASOA 1KCKA 3QEUB 5JORA 4HD5A 4DCQA 4EQ2A 2FH8A 5HDWA 2NY7H 3WE6A 1KPRB 3V5DA 3LIZL 5EU3A 4F2MA 1IM9D 2X1QA 3NCCB 3NGBB 5E8NA 1IM3D 2VN3A 1ZDSA 4WK0B 1N0XH 4BUHA 3IRZA 5EZLB 3HMXH 2R51A 1MCOH 4PBDA 1AXIB 2DJMA 1DVSA 3QQ3B 1T1YA 1F1DA 2W60B 2CXGA 2MWCA 4H2CA 2WK2A 4WSGA 4WI7A 1ZLVH 1ZHBA 3W5MA 3SKJH 3DTXA 5E24E 4N6QA 2NW3A 3C87A 1U92A 4AYMC 1TJXA 1P5VB 4JRYD 3RY6C 4WNQA 3W0WD 1JPGB 3F3HA 3PWPE 1P7QA 3HNVL 1CD8A 4LPTA 5KVEE 3TBTB 4XPBL 2XFXA 1I8LA 1BQSA 1HKLL 1ZPUA 3V4VB 4JHWL 3K6IA 1QAWA 2BW4A 2W5PA 3JBG7 3R0NA 1YG9A 2AK4E 5B7MA 4YDKH 2VLKA 1IKFH 3V6FA 4M29A 1F3DH 5F7AA 2P49B 3IBOA 4NQEA 4O2FB 1PZ2A 2XU9A 3QIBD 2HFFB 1CFNB 5TPWH 2UXTA 1J18A 2BNRD 2C26A 5JQIB 1U8OA 2ZCLL 4WTZA 3FPXA 2CJ3A 3S37H 3F7VB 4EVNB 4KJPC 2YOCA 1IT9H 1UA3A 2QVFB 3PY9A 4RESB 5IEKB 2MKWA 1BAFL 1S7RB 4FHJA 3IMSA 1BZEA 1W72L 3Q8FA 4P4KC 1WBYA 5AKSA 3UO1L 5JXAH 4PRAB 5FKPA 1RH8A 1MELA 2D4FA 3NPZB 4TUOA 3V10A 4IHBA 1XQ4A 1UASA 1NDMB 1MUJA 1DQQA 4FLHA 4GSQA 1Q9WB 2MH4A 2ZG3A 5IJVA 4YDVA 4MFHA 3ABZA 3HE7C 4Z3JA 3O6KL 5E6IA 3P3UA 1OAUH 1YY9C 2GSIA 3EYOB 5K1NA 4NKDB 4X4ME 1EZLA 2CUMA 4X6BB 4ZMOA 1IAKB 1UXWB 1U3HA 4ZFFA 2HT3D 2MQ3A 5JHLL 4AMWA 4QRPD 3MJ9H 3OWRA 4DEPB 4JN1H 1A9BA 3QQNA 3TO2B 5B21A 1R5VB 3S35L 2ZOOA 5C3TA 2J20A 1IMHC 3RWGB 1FNGB 3NPSC 1AFVL 1A64A 3M8OH 1OARL 1Q9KB 5CWSB 3UTQA 3ZL2A 1I1AB 4GEIA 4G3YH 1RJCA 2ZWLT 2NZ9C 3ESUF 4DGYH 4OGAD 1MAML 1PEZA 2WV3A 1WICA 3MNMA 4G2AA 3VSTA 3ATEA 4OF8A 4PJGB 4QNPE 2R29A 4KI5D 3NN8B 3IK2A 2VE6B 3LQMA 2D0HA 3FQXA 1QMUA 4LHUB 3SPJA 3FO9A 5C0FB 5E5MB 3VFTA 3QXDA 4U1SB 5IGXL 2JK5A 3A47A 3HC0A 4JFQB 2YAMA 4IW4C 3MBWB 1BQRA 3PLYA 5DJ8A 1E4HA 3F58L 3BW9B 1FNSL 1F5WA 1OO2A 4DQAA 3EYUH 5T33L 1MLCB 2C1PA 4HP5A 1U3NA 3JYCA 4L4VD 4U1JA 3SJVA 1N6VA 1TCMA 4H4NA 4HWEH 1PZ3A 2ZX8A 1BWWA 1TO4A 3RG1C 2IH8A 1PG7L 3WJMA 1S9XA 3MXVL 3CQPA 2MEJB 3C8KA 4Z95L 2JB5L 4TKWA 4DVBA 3IRPX 2PXYD 5DCCA 3VRLE 4RA3A 5JMRA 3QWQB 1E90A 3AY4A 2W0PA 4WHTA 4L4TD 5EO0A 4XT1C 4PJFF 2C9SA 2O5YL 1JWSA 2PNDA 4MD0A 2EKJA 2Z64C 4HUVB 2VXUL 2LV4A 3OR7A 2EYRB 4OLZH 2CKBH 3WL9A 1KCVH 3EF7A 3IJYA 4IGBC 2ZWYA 1QSEE 4XN1A 5C0BB 1M7DA 3IFPA 5ETUA 4QRUA 5G5DB 5B38A 2CR3A 4PY7A 5E2VH 1FGVH 1B2YA 4HUKB 3GO1H 3KJ6H 4PJCF 3JVGA 1Z9MA 2X42A 2OMYA 5F6HI 3NCYP 2NY7L 2WXLA 4N0CD 4QRSA 1QR4A 3LB6C 4O5LH 4RBPH 3RTQA 1U8HA 5A6LA 4ZS7H 3ULUD 1QKZH 2FEEI 4YEFA 1N0XL 5C0ND 2OMWA 1I3VA 3HMXL 1MCOL 2WQXA 3EJJX 4JPWH 4PJEA 3VFPB 5IG7A 2PYFB 4U4BA 3P0VH 3L3IA 4CA4A 1JZ8A 4L3AA 2R2EB 4S2SB 5DHYA 4HGWB 4GB9A 5JMOC 4R96B 3SKJL 4GAGH 2P4AB 3LXCA 3ZRSA 3WKMH 4ISVA 3CVCA 5FYKH 3KE0A 2CCVA 2VDQB 4HBQA 4PPTA 5MP6H 1HZLA 1VKXB 3SDDD 2OTUA 2QVTA 2XFGB 1GGCH 3KPNB 5E00A 3SYAA 4JO2H 4I2XA 2B2XH 5DJYA 3BRDA 2ITDB 4M7KH 5G4NA 3NESA 4YDKL 3WE1A 4BSWB 2ICES 5EORH 1I8LC 1IKFL 2GUYA 3I9IA 3TBWB 3QH3A 1UATA 4LT7A 3LJ3A 4QHNA 3RJQB 1PLCA 2BHYA 4KK5C 3MRHB 1BEXA 4R7NA 5I0ZA 1HC1A 3F12A 5TPWL 4K55A 3V95A 5AZ2H 2HA1A 2VDLH 4G8IA 2MIZA 4GP4B 1BV8A 3S37L 1OM9A 2GTQA 4A7UA 1MJJA 1WWBX 2X70B 4LPXA 1FL6B 4XAKD 1SBBA 3S35X 1IT9L 4OZ4A 1NAMH 3N43B 2O61A 2HRGA 3FUNA 1OF2B 1V10A 2ISDA 1CIUA 4JRFA 5JXAL 1QABA 1ZY9A 4ZK8A 5ISZE 5FV2A 3VACA 2XX0A 4R7VA 3MDJA 3ZTDC 2BFGA 4JFYA 3EXJA 3MNWB 4HUNB 2I9LB 1FL5B 2AERT 3VWKB 5L8KB 4MWFB 1M1XB 5EZJA 3IU4H 4F3FA 4CC4A 3O3DA 2VO8A 4WU5B 2XI9A 4LDOB 1HOCA 2BOCA 3EHBC 1PS3A 1F1AA 4K5OA 1UD2A 5EU7E 4GIPD 1LWRA 3ULSA 1EH9A 4KX8A 2NQCA 2P1YA 3T5WA 1MFDH 1NIDA 4K7FA 5E6IC 4Z7WF 2WLNA 3MJ9L 4RMQA 1PD6A 4NC2B 3ZKXC 8CGTA 4PJIB 4DAGH 1ND0B 2Y72A 5KS9E 4G80B 4P2OD 4HOZA 2FIKB 2VW6A 3IDYB 3IXAB 4QIRA 3M8OL 4LRNH 4M56A 4LCCB 3TVMD 1PG7X 2E9IA 4AW7A 5I6OA 4U1HA 4IIQA 5D1XB 5DK2B 3MCLH 1GKOA 3L5HA 1ZTXH 4G3YL 3S4SG 4F8PA 3K8LA 4BZ2H 5E9DE 4DGYL 4CBZA 3CWGA 3P77B 3V52L 5D7JB 4X99B 3QT2A 5EOCJ 4B7LA 2VLJA 1KBBA 1MHCA 3OC5A 3AABA 3QJSB 4X83A 5FM5O 2WVTA 5JW4N 2CJTA 1WA0X 3FSAA 5FDWB 3WNOA 1JZ2A 2A2QT 2YOAA 3SZ6A 2ZKXA 5T1KD 3EDJA 1WHPA 1BF5A 1E3ZA 1HSAA 3PNWB 4AW4A 1E9OA 1JDDA 2G3XA 1MNNA 4F33B 5I73B 4X4XB 1NC4D 4HWZB 4CADA 1G0YR 3GF8A 2IADB 5C92A 2NY5C 2F53A 2C3XA 4G5ZH 1GVIA 4QGYA 2WMPB 3ELAT 3QG6B 3BP4A 3QWRA 4Q14A 2P48B 4V33A 5IB2A 3TYFB 3U46A 3ZSTA 3EYUL 2DEXX 1QO3B 1UB5B 2EIBA 1G7QA 5DVKA 1P2CB 4HWEL 4FTDA 1KT2A 4JN2B 3T65A 1IAIM 3SO5A 4L0YA 1SBSH 3HUJE 3HJ0A 5D8JH 3NQIA 1TJHH 3R18A 3TNNA 1MG2C 5J1AA 4PLJD 5HDBF 4P3DA 4LGSB 5EIIG 1T2QH 1KTJA 4LLQB 4ODUB 1LP9E 1E5UI 1UA6H 4XCEA 1ASQA 3D69B 3SN6N 2EVGA 4BCYA 1DVXA 2DQTH 2OZ4A 2H0JA 5EUOA 4HH9B 5AW0B 4ETYA 2V37A 2UXFA 2HSIA 2J44A 4YPGB 3AY4C 2GT9B 1O75A 2CKBL 4OLZL 1BJ8A 1VFAB 3MSPA 1KCVL 4M8QA 3E9UA 5FECB 4A6YA 2KMWA 3T1WA 1Z66A 2Y6SC 5E2VL 2VWEE 1FGVL 4OCRH 1SDYA 1S3RA 3GO1L 4PRDB 5DR5H 3KJ6L 3NFNB 3NTCH 3QWNA 3VGFA 4ERSH 4KKAC 5EF3A 4O5LL 4I5BB 3PDOB 2W0FB 2N1TE 4XMPH 4X5QA 4ZS7L 5D1QE 2JVUA 1QKZL 4JM0A 4BH8B 3QO0B 2H4EA 4TTDC 5DK3A 4N0UA 4JPWL 4X7DC 1ET8A 1AGBB 1HYRC 4HKXB 4P3WA 5ANMB 2QLVB 3P0VL 2QVMA 4WWID 4X6CB 3HS8A 3I2CH 3N42F 3A22A 3S37X 5TH2B 4JKWA 4GAGL 4P2QA 4GINA 1I8AA 1PU0A 5KVDH 5C0RH 4PJHA 3WKML 2D7OA 1R5IB 5FYKL 1E2WA 4GAYB 4MNHA 2X4TB 5E8OA 3GLEA 3ZQWA 5MP6L 4JQXA 5CHNA 3QQ9D 4FKHA 2W65B 5FGRA 1X5FA 4TPRH 3S5ZA 5CLXA 4FG4A 1GGCL 3BFWA 3CSYB 1CVSC 1JHTA 3WS3B 3UTSD 2B2XL 1HXYB 1M7IA 4M7KL 5HJDA 4QKTA 2QGBA 4X5RA 5EA0H 5EORL 2IBGA 4F24A 5ICYB 3LKRB 1Q0EA 1C16A 1CD9B 4F37K 1XIWB 1F4HA 4NP9A 3FONB 2WQ8A 3JV0A 3DETD 5FFLA 4LVNC 2VCOA 1W16A 5MEQB 4NYLB 1R3HA 5AZ2L 3QUZD 2VDLL 1GOGA 1VFBB 4RMBA 4IBSA 1DLHB 4PV1C 5JHMA 3HG2A 1FZJB 3FRPG 4FNQA 4HK3N 1NAML 2ADJB 2F54B 4M3KB 4DZ8B 1QSVA 4ZAKA 4KK9D 3BD5A 3O6LH 3LRKA 4K3HA 3HG1A 2CGZA 2PO6A 3IU4L 2YFNA 1FGNH 1HDMB 4TQIA 4URTB 5DHEA 1LEGA 3I6KB 4ADIA 3CVIH 5A16A 1QNIA 1BQHG 1IKNC 4Y9BA 2E6PA 4FZ8H 1PZ5A 5AOKA 3V6ZA 2IPUK 3EGSB 1R5WA 5DZOA 3ULVH 3MRFA 3KYKH 3ARFC 4OZFG 1CXKA 1MFDL 1NANI 1PZDA 3MPCA 4G6FD 4KK6C 4P5RA 5HGHA 3RVXC 3TV3H 1EFXA 2WIMA 4QTFA 3FB8A 4BFOA 4PRIA 1PZBA 4TVSa 4DAGL 5D5MF 2K3HA 5D7EA 1YQVH 1J8HB 3KR3H 4FLOA 4UOW1 4HWNA 5FO7B 3TN0A 3GUTB 1QR1A 1IC0A 4XMKH 4LRNL 3HI1A 2AQQA 5EU5A 1EO7A 2HVKB 1WF5A 2DWDB 5IB4A 5J13C 3RGVA 4MASA 2KL6A 3MCLL 1ZTXL 5JW5B 2AJZB 1KXTB 4ABWA 4LSVL 1EEQA 1DBKH 3NFPA 1R3KB 4K8RH 2CDEB 1CGTA 1TQCB 3NIGE 4G5AA 1KTLB 5F3FA 2B59A 1QASA 2XN0A 3KYOB 3S5LB 2GAZB 4GBXA 4IIQC 4RMUA 4Z3HA 4DO6A 5J11B 1JP5A 4WK4B 4X6DB 1M2VB 4YHOH 3D2UA 2OI9B 5JPMC 2LLGA 5K93A 1M71B 4J8RB 3ZL1A 4HDIB 4YBQD 4WSKA 1T20A 3L5JA 2BP3A 5I1JH 4IKLA 4G5ZL 2EDWA 3DOSA 3VD0A 4KJQD 5HI4D 3PGFH 1R4XA 3D39A 3UZQB 4KKCC 3WEOA 5TDNB 4H0HB 4OIFA 4JFDD 5C6WH 5ADPH 4G6MH 5F7DB 1HHHA 3CU7A 2WOYA 3Q5YA 3O0RH 3W9EA 4I0KA 2VSDA 3SDAD 3HE6B 4MRCA 3PQYD 2QPEB 3QXTA 3SKOB 1DBJH 1SBSL 2G9HB 3OKKA 2NY1C 5D8JL 3WN5A 2EDQA 1N59B 4PJ8D 4MNGE 2FYYB 4NRYB 4RZCB 3WFDH 1KLUA 5F0JB 5IMOA 2AVFA 1JZ6A 1O6TA 1T2QL 5KBMA 1ZKAA 4K71B 3NQKA 1NC2B 5JTWA 3TA3A 4FMVA 1UA6L 2C4XA 5IF0A 2DQTL 3O4OB 4CC0A 5TQ2H 3LPGA 2DV6A 3RGBA 4L3EB 1LMKA 4LK4A 1A3RL 3NH7H 2J8UB 1ZSHA 2HG5B 1IGCH 4GUPB 3CZKA 4AJWA 4ZQKA 3TJPA 2ODIA 4KVNH 4XAWL 4KITB 4L2YA 3ECVA 3VXRE 5GRWA 3G7TA 1H6EA 2NXZD 5IMLB 2XVKA 1XGPB 4OCRL 5KOVC 4J12A 2YD7A 3J2PA 5DR5L 1YUHB 2NDGA 5CP3H 3NTCL 4BFJA 4ERSL 2JTDA 3IAQA 3NABL 1EQWA 1S46A 2CBPA 3TXAA 4XMPL 4U0RB 5JIPA 1YC7A 4Y5YA 4LARH 5CU5A 4WWNA 2DM7A 2OTWB 1MI5E 1IQDA 1L9MA 1UB6B 2Z31D 3POHA 1RV6X 3B6SA 3V0AC 3WLWC 4JG0H 2WNGA 3TWCH 4HG4J 3AACA 3DJ9A 4JDZB 3ZDZE 3NA9H 5F7EH 1AIZA 4GRLB 4AZ8A 2WO3B 3REWA 1NFAA 5T5NG 3VI3B 3VXSE 3IJSA 8FABA 1HH9A 2PCPA 1NBYB 2W95A 3ORJA 5C0RL 3O8XA 1MKFA 4HZLB 4XOEA 4K2UH 1LQSR 2J12B 5DVLA 1IFRA 3NZ8A 1DFBL 4FQIH 3ZE0F 2JNZA 2MKLC 3W39A 3UBGA 1J0ZA 5CZRA 1JK9B 1JXDA 3MAWA 3EBGA 1KN4H 4F7TA 4N8UA 5ABAA 3FSZA 4OF6A 4JHBA 4K9EH 4JQXC 1KY7A 5DUPH 4NKOB 5EA0L 3X14B 1P5UC 1A1OB 3DUSA 3L5WB 4FQQB 4O02H 4PJBA 4B50A 2QKSA 4B9PA 4NQSA 3MRNA 4KI5F 4WVRA 1KMGA 3WTWA 5K59F 4NQCB 1URZA 4ZW6A 2UWEE 4FQXD 4TNVK 3D4CA 2Y5TB 2FQDA 3QC5X 2CLRA 4PU2A 4PGBA 3J8F7 1BVLA 2NX5E 1XSIA 4TNVF 2P8PB 3ASOB 3KPSE 4AQEB 2X4UB 2JCCE 3RURA 4EO5A 5BXFA 2A0LD 5I71C 1BYPA 2H3KA 1CICA 2XV0A 3FQUA 4I85A 3MFFA 2P8LB 2G5BB 2UY6B 2H2PC 2KQNA 5SWZE 5DQ9A 4TQ8A 5EU6B 1K6QH 3IU3A 3O6LL 4X5WB 4IBWA 1NBZA 2EEFA 3B2PA 3QARA 1V3LA 3NDYE 5DJ6A 2X6AA 2WLLB 2ZNWA 4UQ2A 5KVFH 1FGNL 1Q9LB 2EDNA 3SKUD 3AQZA 5HGAB 5EZOH 1YN6A 3CVIL 1AXSA 3NAAH 3QJFA 1URLA 4FZ8L 4NUGH 4C54A 1I1FA 2WYHA 2YQ3A 2IWGA 3ULVL 2LGNA 3KYKL 3L95A 4JREB 4YVUA 4F2ME 4HXBH 1A6AB 4DETA 5CCJA 1N3NB 4MJ6B 2VN6A 2XOTA 3TV3L 3QDJD 1YNLH 5IFHH 1A4AA 1WK0A 4QAWA 3WUWB 4BFNA 1G7HA 1PIGA 3BGMA 5FYJU 3MYZA 3QORD 1HXKA 1YQVL 4LLWA 3ZKMD 3KR3L 4FX5A 4XMKL 4NQDB 3TTYA 2WP3T 4OQTH 2BNQD 2Q86B 5GIRB 1HOEA 1U3YA 3L54A 2O72A 1P1ZB 4Q7DA 3UGEA 3TN0C 1W15A 4IOIA 3MJ6A 1BVZA 1DBKL 4K3EH 4K8RL 3GBNH 1WHOA 5AL0A 5F9JA 5AOZA 3RGVC 4MS6A 1OCCB 3ULUF 5DJDA 3QDMA 4UYPA 1KV3A 4G8GD 3EYVB 2Y1AA 5HHOB 5FWRA 1RZKC 1KCWA 5ACZA 3W38A 1EAPA 1L6ZA 2B20A 1MN4A 5GZOD 4GBXC 4MDJA 2X44D 3ABLB 2VLKE 3DMMA 5E4EB 4DN3H 4WTZG 3AT0A 4ZXBA 4KBPA 4GS7C 4IRJD 1M56B 1PYWB 3WNMA 4UOZA 5I1JL 4ZMLA 3RB5A 3PGFL 2O6DA 2X1OA 4NQEE 1HFUA 2BVQA 2G2PA 1PGRB 4G6ML 5JZ7C 3VMNA 2DF3A 5KW9H 3O9WB 2JIXA 4HMEA 3BJ91 3PDGA 2Z34A 3I75A 2CKBB 3ZVVA 5T1LB 3BLKA 5E56A 2X87A 3UPCA 4F8TA 2Y7MA 1JXGA 3T6XA 3WEBA 3MRQB 3N41B 3TT3H 2R7EA 3BX7C 5I17B 1KB5B 3IYLW 4XGZA 5TQ2L 3S8WA 1SRDA 1QWHA 4Q52A 1OP4A 5IHLB 2IMMA 1BLNB 1IGCL 1FSKC 2EE3A 3C60B 3HZKA 3BGFB 4PG2A 3TA3C 3U0TA 3UJIH 5EU4B 3VE0A 5KBLA 4ETQA 1KEGH 3PGDB 4PW3A 4UQBA 3JTSB 3WFCL 2GB2A 4ZUWA 5JLZA 4DPRA 4L29B 2G9KA 4DERA 4N8CH 4K5PA 5AVWB 4YFDB 4OIBA 2YC1B 1NPNA 3DX7A 1CC3A 3PIQB 4Q6KA 1KYAA 4KK8D 4NLHA 4OY9A 3UADA 4WJ5A 5E1AB 3P4OB 4QYAA 3DTUB 2XN9B 3QIUB 2BC4B 3NZHH 4LARL 5HDRA 5C0CB 4W9HC 3QA3A 5EEWA 3T0VA 1Y6NR 3P4NB 4BJLA 1BREA 1UYWH 3MUUA 4F7PA 4ZX5A 5BO0D 3MUGB 4X6CF 4JG0L 3TWCL 4JRXD 3EOYG 1NCTA 4BFRA 3NA9L 5F7EL 2EDMA 1D5MB 1HHIA 4TYUA 5ENWB 5LN8A 4H44C 2ICEB 2QQKH 2IQAB 2BIPA 2OSYA 4PRPB 2OS7A 4PWJA 1ZLSH 3NACH 1I8IB 4FXKA 1KJVB 5AW8B 5IVZA 1U8KA 2EINB 4AG4H 1O9VA 1JAEA 2MQCA 2VUKA 3L3DB 3SZKC 4FQIL 4XNAA 5F71A 1SF5A 2ZKMX 4KXAA 1KN4L 4KROD 4MA3A 4WFFE 4FKKA 1MHEA 4K9EL 1MCCA 4PMFA 4PJ9B 2WXOA 5DUPL 3DROB 4V2BA 4HZ1A 4O02L 1NL0H 5TDPA 1CN4A 4IBUA 3GZOA 4HHAB 4WFHD 5I1AB 3SJVE 2XNAB 3OQ3B 5AKTA 4R84A 3ARBD 2L7EA 4GEJA 5ABZA 2KT6A 3WY2A 2CO4A 2VZTA 2M1KA 3T2NL 3ESOA 5E5RB 4D9RD 5ICXB 4PWGA 1Q4NX 2HRHA 4M61A 5GGRB 5ESAB 4PLKC 1WPCA 3ZDXE 3Q2CA 3BFOA 4UT7L 4XCNA 3TH2T 3S9DB 5I6PA 2DIEA 3VGAC 4LOEA 1T0NA 2DLFH 1BP3B 2GSGB 1RULH 4FQPA 4L3FA 3OKNB 5GRXG 2ITEA 4BKSC 3BZ5A 5LUMA 3R1GH 1THAA 1K6QL 5B38G 2NDFA 2GTWB 4PJ7B 2X9XA 3QSKB 1OSZB 1GPOH 5I18H 5CMAB 1FA4A 1SXSA 1YYCA 1CICC 4E5XB 4YMPA 3H2QA 3SDYH 2DL9A 4MAYD 1K8IB 1GJUA 2DQFA 3AXLA 4LBAA 5KVFL 2B14A 3DYPA 4IRSC 3NAAL 4MSWA 1A25A 4NUGL 2XQYA 1CBVH 3PP3K 3ARPA 3FQNA 3II2A 4WJG3 3N44F 4MHHG 3E8UH 4HXBL 4LDEB 4N9OB 3BUTA 3ILQD 2IFFH 3MBXL 1B0WA 1J9RA 2I26N 1YNLL 5IFHL 4V1DB 5IR1A 1ZEAH 2DQIL 2FJFB 3RRQA 3LN9A 4PJEE 3MRRA 4FFVD 2Q8AH 3DPDA 5DRNA 2GG1A 3VAEA 3QRBA 2HTKD 1SOSA 1X5GA 3C5ZB 3I9PA 4OQTL 5HP5A 4AYFA 2OPCA 4KUZH 5E1IA 1OVZA 1L6PA 3ZE2E 4PGDB 4I3SH 1AGDB 4K3EL 1PKQA 3EBAA 3GBNL 4XPTH 2FZ3B 4Z7NB 4AENA 1VIWA 3QI9B 4Y4KB 3VRIA 4HXAH 4J3OF 4HS6B 4X6DF 3O3AB 3QNZB 2YEQA 4XNQB 4J4PD 1CO1A 2YGVA 3MRJA 5IBLC 4HALA 1VACA 4I2XE 1V3JA 4FJZA 1YC8A 2ZUVA 4JRXB 5EBGA 4DN3L 2YEZB 3MLWH 1QI5A 3MUZ1 1VA9A 3CLWA 4DFIA 4HX1A 3DXAA 1X5IA 1AZVA 1A7NH 3ULUH 2YMTA 4UV4H 1QEXA 2DI8A 1LNUA 4KH2A 2YMOA 3ZE1F 5CCGE 3DMMC 2MJWA 2GJZA 4ZXBC 2QPUA 4MD4A 3CFNA 5KW9L 4ODVH 4JFOB 1RZGB 2PP7A 5IV2B 2A73A 3VD7A 2FB4H 1WCQA 4WIQA 1NFIA 1W0WA 5D72H 5C0IA 3V55A 5I1EH 2ENQA 3JWOH 1KIUB 2BSSB 5HYQB 1ML0A 2AQ2A 5CZXC </