4QTFA

Structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
349
structure length
349
Chain Sequence
VPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,d-transpeptidase LdtB
publication title Structure and specificity of L-D-Transpeptidase from Mycobacterium tuberculosis and antibiotic resistance: Calcium binding promotes dimer formation
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4qtfA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qtfA02
3TX4A 4XVOA 3ZG4A 5DZPA 4GSRA 4A52A 3TURA 5LB1A 3U1PA 4LPQA 4GSUA 5DC2A 5K69A 4HUCA 4QTFA 5DCCA 5LBGA 4LZHA 5E1IA 3VYPA 5DUJA 4ZFQA 5DZJA 3U1QA 4Z7AA 4QRBA 5E51A 4A1KA 3VYOA 4K73A 4JMNA 3VAEA 4A1JA 4A1IA 5E1GA 4HU2A 5DU7A 2HKLA 4QR7A 5DVPA 1ZATA 4JMXA 1Y7MA 3VYNA 2MTZA 3ZQDA 5E5LA 5D7HA 4QRAA 4GSQA 3ZGPA
chains in the Genus database with same CATH superfamily
4CJ1A 4LHUA 1OF0A 2FYYB 3VGHA 2EE9A 4J8RB 4XOCA 4JFFA 5LAXB 3VSVA 5AW4B 1INQA 2LLGA 1P7BA 3LEXA 3PGCA 3M7FB 3QW9A 4I3SL 4WDIA 4Y4FD 1MHHB 3G3LA 1BCIA 4MDJB 3S98A 1U8OA 4YX2L 3BP5B 3STZA 4APXB 4AVHA 1HK6A 1E4XI 2A4EA 4TL5A 5ESAB 2CLZB 5J4MA 2R7EA 4PTTB 1ES0A 3OQ3B 3QDHA 3KHQA 4D7BA 5SWZE 1QSEE 2B1HL 4LVHC 2ZXDA 5ICZB 3FH5A 2Z4QA 1W8NA 4NKDA 4WO4A 4M6AA 1UM5L 3V0AC 2W9LA 4HIHA 1UD4A 1YY9C 2FRGP 2GK2A 5IFJA 5FV1L 2DY2A 2FNBA 1AZUA 3MR9A 1ZLSL 3BGAA 3ES6B 3GXFA 4NS0A 1IAII 2E46A 1Q9KB 3RTQB 3DX9A 4BFOA 3POHA 1KTDB 1A7QH 3QZWA 1PZDA 4XX1E 3RFRA 3PWUB 1DBJL 1G1CA 3ZKND 4A2DA 1E28A 1MHPH 3QJRB 4Y4FA 1MZZA 1M3JA 2WN3A 3OV6A 2KERA 4L5FH 1I3GL 3PL6A 3LN9A 3H7BA 3HA0A 5I8OH 4PJFB 4P9HC 1JPTH 1NCCL 3ZDZB 4NO5A 4PWKA 2R1XA 3IETA 4AM0Q 4OLZH 4FQIH 1DSFL 1A4JA 4H25A 3APDA 2B4CC 3IU4L 4JFDB 3IPFA 2Y9RT 4FZ8L 4NJ9H 5TFSH 3ZIMA 4X8CA 4IBYA 5IFAL 3AB0C 3FAWA 4ONHA 4NO3B 5E8PA 4DUXA 3EGSA 3LDBB 1FFQA 4K07A 3KPPA 3L95A 1D2PA 4AH2B 3RWCB 1Q1JL 4AXWB 1PLAA 3V0JA 2GIYA 2O72A 2IMNA 4RESB 3SYOA 5I1IH 2R0WH 4Q9CA 5CD5C 7PCYA 1E3ZA 2R1YA 2HVJA 2DMGA 2GSGB 3ERXA 3N0AA 4HH8A 5EUOF 3QJQB 4L3EB 3MLWH 4RBPK 4XP6H 1YZZA 4OZFH 1NJ9B 5E1HB 3UGUA 5FHBL 1KCVL 4P2OC 2VE6B 4LPWA 3L3KA 4PRHB 1CN4A 3JTTB 3GBDA 3IMVA 4MDIA 5E8DL 2UXTA 5IOPA 3MRJB 2VC2B 1ASOA 5D7IE 1PGRB 5C07A 1PBYA 2EINB 3NTCL 1RUAH 4PRPB 1BG1A 4AJVA 3HB3B 3OLIA 2H0EA 4JM2A 2GYSA 4PJAB 4H8WL 1YJDL 1L5GB 2LTQB 4LSVH 4HOMA 2MCG1 3X3FL 5CBAA 1FV1B 3BKCL 2HPOA 3BJLA 3E0GA 1SHWA 1FFTB 2EEAA 4JFPA 3MLYL 4K15A 4U31A 3PRZA 3SJVA 2B5IC 3FTUA 1N2RB 2XY1A 4H44C 2GABA 4W6WB 5L0QB 1IM3B 3RTQD 1AIFB 4KJYB 4LIQH 5KVFH 1FRGH 2IBGA 3X3GL 2FZ3A 4MJIB 4RNRB 5LAXA 1L9MA 3EJQA 1OGAB 1NSNH 2PW2A 5LCVL 2HX8A 4AYMC 1VAHA 3WJLA 1TR7A 2J8HA 3VUAA 4XBMA 4NZJA 3NZHH 4B5EA 3VI4E 1YNKH 3QA3A 4TRPL 1U95B 2OSWA 3T6XA 1XF3B 1YMHA 1HILB 5JHMA 1ETB1 2AXWA 4KX9A 1RJLA 3ISRA 4B50A 2AKRB 4H88H 5BS0E 1A14H 3BZFA 1T7ZA 2JNZA 4NRYA 2FQGA 5D2NB 5DQDL 3U6RB 2HB0A 4LNRB 4HKXA 4YHKH 1IL1A 1PDKB 3ZDYB 2PCFB 1ZGLP 2PXYC 4LPCA 1HWHB 4OD3H 4R4NC 3LRGA 3QXAB 2ZUWA 3NGBB 4K7PX 4APQB 4MSWA 2WQSA 3TCXA 2A99A 1KN4L 3CXHK 5J1AB 4XP9L 2EH8H 3DROB 5CILH 4NAQA 5CEXA 4L3ED 4NSKA 1V7ML 3M45A 5DWUL 5DT1H 3WS6C 1FYTA 4WNQB 5AW1B 1DVFC 4JHWL 4PRHD 3HE6C 3J7HA 4DKFL 2GEQA 1HCFX 2IDUA 4NENB 5IJKA 5ANMB 5LBGA 1M57B 1TSHA 1LP9E 3TWYA 4DAGH 4J39A 1E90A 1U9KA 4PRPD 3CZJA 4KK8D 3HB3D 2BY1A 3PGDA 4LCUB 4BHUA 3SOBL 1RURH 5LN8A 4XH2B 4CN6A 3ULUF 3RU8L 1TJMA 3OKDA 2Q76A 2GY7B 1ZSDA 4C83A 1I9RH 3ABKB 1IM3D 4XC1L 5DHYA 5JHDE 5IV2A 4LAQH 4LSSH 4MJID 3WDHA 3NAAL 1OGAD 2G3MA 4M1DH 4M6NH 5IOKA 4OSUH 3GLAA 1KTLB 3FQXB 4L8DB 4R26H 1FNGB 5A2JH 4NJAH 5CZXC 3QUKB 5DYOB 2BRQA 3GJEB 3PDGA 2W5PA 3P0VH 1L0QA 1EJOH 2CK0L 2H3KA 4X6EB 1K72A 3MGAA 4PRPA 1QTSA 4M93C 5E5MA 1MAML 1U0QA 2O1AA 4LLVB 1T21A 4NN7C 4KWUA 3T3MF 4PJAA 4GW4B 5E00A 4QRRB 4PRDA 5ESVA 5HY9A 1YEWA 1BYOA 1A6VH 1IAIM 2E7MA 3HAEA 1MH5A 4APQD 2Y6SC 5FGBA 4HBCL 3WJJC 3VFNB 4TUJA 1DBMH 1QLFB 1XAKA 3EFOA 3FHEA 2FVNA 1NLDH 3B7TA 5D6CA 2H6PA 3ISWA 3ML9A 1A6ZA 1UFGA 3LEVH 3M86A 1NBZA 4KMTH 4X6CB 2MCAA 2QGEA 3LOWA 4HWNA 5IVZA 3ZUCA 2HPTA 3BAIA 1DUYB 1WA1X 3BZ5A 4OCYH 1D9KB 3NQIA 2FB4H 5TQ2H 5DGQA 1DBBL 2ADIB 1U8NB 1PPIA 4DJMA 3AWGA 5FOBB 2H8PA 3E7JA 4DP4X 1YNTA 3HN5A 5EN2B 3EHBC 3ZKMC 3RVXC 3DX7B 1Q4NX 5D6DC 1CFQA 1ZJAA 2I7SA 4YE0A 1FNEB 3A67H 2OFQA 3CHQA 4H13C 1XBDA 2WO2B 1HNFA 4P9HL 2YPLA 4GAYB 5F7DB 3PWJA 4F33B 1N3NB 3AG1B 4UQAA 5FS5A 5J3HC 1K8DA 1J9CT 3QUZC 4BWWA 1HL8A 2H4EA 5K9OA 2OBGA 2V33A 2ZWNA 3QFJE 4WW2B 1P0SE 2MHAA 2ARJB 5EUOE 3WXWL 2WQ8A 4ZOEA 2DW5A 3QQ3A 1JCKA 5J6SA 2OKMA 2O5ZH 3UBXA 3PQYB 4G8EA 1I7ZB 5DJCB 5EHFA 3QRBA 4L4TB 2JCCB 3T0XA 1EJ6A 4AT6B 1KB3A 3FQTB 2ZXQA 4M43H 5C1MB 3N0PB 5E0FA 2V17H 3ZY7A 5A2BA 4RH4A 2BS8A 2J1KA 4LQFH 4XPFL 5F7EL 4DERA 5I0DA 1QLRB 3ILQC 4EZLA 5K9QG 2PTVA 4QRRD 2RR3A 1OCOB 2CGZA 2AJVL 1TEYA 3CFUA 4BZ2H 1GIGH 2DJ4A 4G80A 4NGHL 4LLQB 3HE7A 2VZUA 5HJDA 4MMXB 3ARRA 4HS6A 4JL1A 5MEQB 3DGGA 5IM7B 4QRTA 3WD5L 3ARBC 2I60H 4LQ1A 4OZGF 3TH3T 5LLIC 4EE2A 2DWEB 4HIEA 4PWIA 4U2ZA 5FA4B 4B95C 3VGFA 1HVXA 4G72B 3GI9L 2OMVB 3W9DB 3EDEA 4XMLH 4X9GA 1MZYA 1QNZH 1AGDA 1R3HA 3IDMA 4KKLC 4DZBA 5EEVA 4XN2A 2ZUQB 4PW9A 3DO7B 2C5DC 1JTTA 2E5EA 3ZK0A 3K2IA 3L3HB 5G55A 3LPFA 2W88A 3KYNB 1CD9B 1SLUA 4N2LA 3M8OH 5EU7E 2ED6A 1OAYL 2A2QT 4H5SA 5CJOH 5TE7H 2EH7L 5EOCJ 4H4NA 4KNSA 2BM3A 4O51A 2ZOKB 3THML 2DKMA 4BH8A 5DHEA 4JG0H 3GHEH 4PS4L 4X80H 5JPNA 3FT1A 3QUHA 4AVIA 4UM9B 1LK2A 3IEAA 2NY3B 2D3VA 5KBLA 5JXED 5ISZB 3CDGB 1K2DA 3PQYD 4F93B 3VTAA 2IH3B 1E9PA 3BWSA 5DUJA 4U4IA 4QXGL 2R2EB 4PJIA 4OV5A 1FFOB 1NGXB 5T33H 2FDBP 5EBLB 4DTGL 3MXWL 1MCIA 4ODUA 1Y1UA 4WTWA 3F62A 5EA0L 1KJ2H 3MRBB 1PKQB 2IFFL 1FVCA 3ULVC 3PE9A 4X4KA 2RAMA 1CLYL 2RQ8A 3PNWA 1AQDA 3F7RA 3OKMA 4CBZA 3ULUE 3FRPA 4HXAH 1HL5A 2XICA 2X2HA 2BVPB 3EBHA 3MFGB 4OY9A 2NY1B 5F1NA 2FO4A 2NMSA 4G1EB 2NNXA 2CBPA 3NT0A 2QGBA 3BSGA 4ZW8A 5T3XH 2K0RA 5J13B 5E99L 3G9VA 1JYXA 3L5HA 1AJ7L 1LWRA 2W07B 2CH8A 2V2TB 5E2JA 4AY0A 2JCCA 3BH4A 4FLOA 2YD7A 2CJUH 4YWGH 4AT6A 3SGKC 2A5UA 4IDJH 3QEQE 4LBEB 3K6SB 5JW3H 3WAKA 1QFWH 3HUJB 5CD3A 1NL0H 4M9PA 4GAJH 3KGUA 3VI3B 4JFHE 2CSPA 2WO3B 3BISA 3GMPA 4Z3IA 5HSFA 3DYMA 5GQBA 2OXHB 5KBMA 1OK8A 2FHBA 3T3ME 4H2AA 3AT9A 3O0RH 2CAKA 1M53A 2FIRT 1I4FB 1EVUA 2JLLA 4ALAH 3DVGA 1J9QA 4WUUA 4Y4KC 1BVKB 1JDAA 5GRZA 3H0TB 4HUXB 4IKJA 1ZRUA 3OMAB 3APNA 3EUDA 2CMRL 2WXLA 3MKGA 3ILEA 5FA4A 4UM9D 5CJQL 2BS9A 3C6LB 1JGDB 4LCYA 5FGCE 1FJ1A 3MRPB 1G7PA 1ORSA 1HHJA 5C92A 1PEWA 1H6FA 4WVRA 3QQ4B 1KBGL 2AK4A 3IDJA 3K1DA 3RKPA 5L8LB 3SPCA 3DV6A 2CO2A 3P3SA 3NFSL 4TQIA 3JVFC 1YEHH 4TTDC 1SF5A 1A6UH 5L4IA 1WAEA 5C97A 1OTTD 1YYML 1HZHH 1MFDH 1P7QB 3P9MA 5EC1B 2GTZB 3KYNA 4Z23A 3EBAA 1P4BH 4I2XA 1LLAA 4FQ1H 4R7DA 5HDLA 2FUQA 1UT1A 2VO5A 4WKXA 1UJ3B 2E86A 3TC9A 3OKYA 3M1CA 1DBKH 1FDLH 3GM8A 3RWGA 1TT6A 3ZT6A 1MLBA 1K4CB 1SHMA 3U1SH 2R15A 3OWRA 2NY1D 3NMEA 1GGIL 2DM2A 1T83C 2Z31B 3DXAB 5GRVL 3RGBA 3W57A 3WKNA 4EPSA 1CC3A 3GRWA 1XH0A 3L6FA 4HMDA 3TZVC 4N9GA 3FSZA 4L9LC 1O9VA 1U8CB 3CLWA 4Q6IA 2CPCA 1NFDE 1NGXA 1H6EA 4LKCB 1H19A 3OM3B 2H0JA 5CINL 3NIFB 1N6UA 1QR4A 4UNUA 4YNYB 3I3DA 1SXZA 3BRDA 5TDNB 3IDNA 4KKBC 3BQVA 4GSUA 5HVHB 4NZRH 1FGNL 1VGKB 5CUSH 4YSCA 1XL6A 1Y0LB 3ARVA 4YHPB 1CR9L 4PJ5E 4TLTA 2ZUXA 1Y07A 2X05A 4NN5C 3P3RA 3GF8A 4NKOB 1JF1B 4MNQA 2GJZB 1QR1B 4QXWA 1W0WA 3C6LD 4N0UA 1SUHA 3LNHA 4OZGE 5K9JL 2JJSC 2IH9A 3VJ6B 5JIIA 1FG2A 3QC5X 2DIEA 4GKNA 2VWEC 5DFTA 4W4OA 3GB7A 4PLKD 1XTMA 1S7WB 5FO7A 3K6SA 2ZX7A 1BM3L 4J3VA 5HI5D 4KDWA 4BM7A 1CFNB 1JI2A 2WBWB 2CK2A 4PP1C 1IAOA 1P7QD 5D2LB 2WVVA 3LMJL 5DD1L 2ICEC 1IJNA 3LXUX 3WKYA 4BUGA 2AC0A 4PH8A 3FQ2A 2V8LA 4Z7VA 3AXIA 4V1DD 3N42B 2CDFB 2Z93B 5F6HJ 4XRCB 1BQSA 1WD9A 2CGYA 2ZAIA 4IHBA 1KGYE 4X5WA 3ULUL 4RZCB 4YFDB 1XF4A 3RA7H 2APWA 2E7LC 5C0GA 3ZYOA 1BBJA 3Q1SL 1TZHB 4X4ME 4PJEB 3WSQL 1DN0B 2AEWA 2VDOH 4PJXF 1ZT1A 1I3RA 3HEIB 1F58L 1TU2B 3CFJA 2PF6A 2UWEA 1UA3A 4UDTB 3HC4L 3TT1L 3EJSA 3TCLA 1YEJH 4NWTH 3UOAB 3V9CA 3CAFA 2FSEB 2G3XA 2RCSL 2X4RB 5MEOB 1AZRA 4HHGA 1T5XA 1JPFB 3QPQC 3MCLL 3UJIL 3WHE1 5FYJE 1P7QA 3NABH 5AOIA 4YHOH 1PLGL 2HSIA 3L17A 3AWEA 3GJFB 5MI0B 1OT2A 2CRMA 4V1DA 5JIHA 1T2QH 1ZHLA 1BD2A 1XWVA 3WN5B 5KBNC 2E3VA 4YHNA 3CFMA 1L7IL 1RU9H 2YR3A 1QLEB 4YSAA 3GEWB 4FQ2L 1KB5L 3NIGF 2P52A 2F8OA 3CUPB 4XO5A 4KHXL 1ACXA 1XH3A 5EF3A 2IG2H 1OLLA 3ATBA 1E9QA 1MVYA 5DUBA 5I1AB 3QPXH 3T6QC 4HQQH 5E2TH 3QNXB 4N5EC 1I7TB 3B3BA 4UQCA 4I89A 4X5PA 2FO1A 5F96L 1KTCA 2V2WA 3T3PF 4FFVD 2V4LA 4N8VB 1I7UB 2VL5A 3QIUC 1ZLUK 1VKXA 1BVLA 1QBML 4JFQA 3FCBA 2RQEA 3QK0A 5I0WA 2OP4H 3MOQA 4HX1B 4PWFA 2B59B 3BUYB 4XI5D 1P1ZA 1XZ0A 2OI9C 2G60L 3QORD 4PMEA 5CS7A 1MWAA 2HFTA 5H4YA 1WLHA 4YFEA 1RZKC 5EV7A 2MIZA 4I5BA 2AJYL 3CFEB 4K94L 3W9EB 4JFYB 2NZ1A 1QHQA 1QSVA 3GT6A 3MAWA 1KV3A 2IDQA 2JELH 1GY1A 4WW1A 4HCRH 1BAFH 5ALCL 3D25B 3OTTA 4GRMA 4K23L 3LKSB 3SKJL 4B9IA 2O6EA 5EBGA 1AI1H 4ES8A 2ZYIA 4NKMB 1UQSB 1JK9B 2XPGA 4N5UA 4K8RC 1JV5B 4JFZH 1WPCA 4WJKB 3Q05A 4H1LG 1A21A 1R6VA 2L7JA 3O3EA 3NJHA 2XTLA 1TIUA 5SV3A 4NP4L 5TF1H 4RGMC 4M6OH 3L4ZA 3H6JA 3QORA 4IS6B 3K0WA 2Y7SA 3RL1B 1F4WL 5IWLA 5C08B 4Z7WB 3CQFA 1NTDA 3GPSA 4K3EL 4V33A 4DN3L 5BZDA 3LNIA 1AS7A 1WA2X 1FF5A 3V4UL 5DMKB 1TSRA 3L3OB 1BECA 3SDYH 1X5ZA 2ZXEB 4MWFA 4JJOA 1YDPB 3ESUF 5JIKA 2ZF8A 4XMTA 4L23A 1OTUD 4AE1A 1JXKA 3JV0A 2ODHA 2BCKA 4O2FB 4YPGB 5GGRY 3MRKA 4LCWE 4WO4C 3GK8H 2HT2D 1WWBX 3EJJX 4GUPA 4LRNH 4ECNA 2KQMA 4ENEC 5BQ7A 4KVNH 7CGTA 1A2YA 3L5IA 4IKIA 4ELKB 1TG8A 4KI5D 1TTCA 1I1CA 2X4RA 1X7SA 5BO1H 3L7FB 1I8IB 4JRYE 3SKUD 1U3HD 2YPVH 4JB9L 5T1LA 1ZS8A 1WZ1L 2ZX6A 2VXUL 3K6FA 1CFTA 2BO0A 3ARDA 3DDFA 3QQ9D 4M02A 4DVRL 2ZP8A 4Y4FC 1C12B 5C9JB 3WNPA 1H9VA 4X4XA 4C56B 3PL6C 3RY6A 1KFGA 3ZE1F 3NFNA 4XNQA 4YHLL 1BX2A 5B8CA 5AAPA 3IKCB 1MCLA 1QFHA 2VAJA 2ZJSL 5HGHA 3G6JB 4JS7A 3D5OF 3ZDXF 3WEOA 4IU2B 2IVFC 4YXLH 4U3SA 5DZ9A 3V2AR 4MA8H 4Q2ZA 3HNVH 3QNXA 4WJG3 3LKNB 1DN2A 1I7TA 4Q89A 1M7DA 3CZKA 4XOBA 3EFFA 1RK7A 2UZIL 1MUJB 2CO6A 4P99A 3HI6L 1L3NA 4PV8B 2L7EA 2QQKH 5I1DA 2XRAH 5MP6L 1M7XA 4G71B 3CJJA 3MRFB 1BZ7A 1U3HA 3H85A 5DXWA 3S8FB 5H37H 1E6OH 1XD0A 3P11L 3T65B 4HS8H 5I2IB 2JKWA 1KCUH 1TZGH 2IAMB 2QV4A 3H2WA 3S5ZA 1IGCL 3Q2VA 3ARGA 2R2BB 5C08D 5CIPA 1AIZA 1YECH 5LQBH 3SE3A 4JFYA 2J5LC 4HIXH 3MUJA 3CFDB 2M2DA 3UPAA 5E23A 3X14A 4Z7QB 1NMCC 5CEZD 4MD4B 3RUGF 1BOYA 3MZGB 1YQ2A 4L8SB 2OCCB 4X9IA 5LAPA 1QFOA 3TBVA 1L9RA 1TEGA 4PS7A 3NH7L 1ZTXH 2KS0A 1B4TA 1KV7A 5TE6H 1ETJA 4OT1L 1QBLL 4PJXE 3FHAA 4JM2C 1LO2L 2PWFA 3FQNA 1AFVL 2O6CA 3HMXH 5E0QA 2ICWB 4WEMB 1I7RB 1JGVL 1G9HA 1ZE3H 1KELL 2X4TA 3VG0H 4KC3B 5A2CA 3TBYB 1QUNA 3MOAL 4X98A 1MKFA 3QRLA 1JHKH 3QXVA 4U6VL 2XYCA 3U7WL 3VWKB 4GQRA 3GMRB 4XVSH 5GGQH 4GW1A 3H55A 1E8YA 5IIEA 5EEZA 4WRLA 2X6VA 4IJTA 3WJLC 4F2MB 3QISA 2X9WA 4C56D 4HKZB 2ZKHH 1UCBL 2BIIA 2GFBB 2I25N 4WFEE 2AI0H 4Z7UA 1P7HL 2O61B 5DS8B 3O3DB 3GMNB 3DA0A 3QJSB 3X2QB 4JKPL 1QD0A 4AKOA 4F3FA 1VPOH 5IF0A 2RH0A 3OAZK 3NIGE 1Z9PA 4YZFF 5KVDH 1MCFA 4PRIE 5B39B 4FLRA 1CFSB 3HN3A 3LS5L 2VXVH 3ECWA 1A3QA 3MLUH 3HS9A 2JLPA 5AYTA 4HV8B 1N68A 4WK2B 4BUHA 4X4YB 5LUMA 4Y8DC 2GT9B 3LNFA 4BFEA 3PWNB 2DTSA 4LSRH 2GTWA 2ZCLH 4QRSB 2YEQA 2BJML 4K71B 1K3IA 1T0MA 1JGLH 4PY7B 1YN6A 4HUCA 3EADA 4WTQA 5I6NA 3T3PE 1AKPA 1KGUA 4LFHD 3WTUA 1EHAA 1NWOA 4F5CA 2PUQT 3BO8A 2IAMD 1VGEH 4WI8A 4H0GA 4YDJA 3FQYA 4R8WH 5B7EA 3BOVA 4F37F 2FEEL 1IC5H 3DARA 4MA7H 4M8UA 3K2KA 3OAWA 4AM0B 1R5VB 4G6AC 2W94A 1P1VA 1UB5B 3GMLB 1KWKA 3BLPX 3BZ4B 2RACA 5DLML 3WMPA 6PCYA 4RAVB 3F7PC 1SJEA 4MAUL 4YIQB 1JRHI 3S9DB 4LEEA 1YY8A 3BESR 4HUVB 3SQRA 5FYKU 3DHJA 3HS0A 4L1DA 3FUJA 4PGCA 4OTXL 4P2QE 2H41A 3SDDA 3SDXF 2JJVA 1BWMA 2CO7B 4K5LA 3SYAA 3ZQWA 3O2DL 4ZQKA 5FXCH 1R24A 3FTZA 4HD5A 3VWKD 3QEHB 1PYWA 4IRZL 1YPZA 1J8KA 2BCMA 1NWPA 3VXTB 3M7OA 4HUUB 2XIIA 3MKKA 1HH9B 1NEUA 4OW6A 1W72H 1B3IA 4MXWH 3SGJA 4WKZA 2WP3O 2YBRA 3G5VA 3MRCB 1X9LA 4UT9A 3WLWC 4PJCF 3KLDA 4Z5RB 2O93L 4U1MB 1M9SA 1DVQA 1PIGA 4R7XA 4KK8C 3WXVH 1G9NC 4JO4L 2LTQC 4MYPA 1FL5A 3PIQA 1I7RA 8FABB 4HLZG 5T5FL 3T2NH 3P30H 2YJLA 3PYCA 1KGXA 1KGJA 3KDMA 4ZW3A 4NC2B 4G5AA 2J7LA 2R9HC 1BBDH 3HZMB 5FGBC 3N43B 4DCQB 3F5WA 4J27A 5LO7A 5INCB 1JFQH 3R8QA 3GMRA 5CKAA 3WTTA 1TVHA 4KNQA 1AQKL 5TK2A 3GO1L 1N8ZB 4JM4H 2A77H 1OAZH 3ASNB 3H9HA 3KLQA 4QGYA 4HWEL 4Y9BA 3AT0A 1S4IA 4PD4J 3HN8A 2GFBA 3C9NB 3E3QC 5KTEL 1VCAA 4JG1H 4F8NA 2O61A 4MMYB 3VD2A 3FNKA 1KPVB 3O3DA 5LGJA 4EIGB 5AAMA 3RURA 3ZE1E 2DQFA 1WC7B 4DPRA 4F7CB 4UQ9A 5B39A 3UTZA 5FFLA 3RQ3A 4WF7A 4LZKA 1XGQA 2CR0A 4GG8A 5L4JA 1RLBA 3LEYL 4DQOH 2ZX9A 3PWNA 3UBFA 4OZFG 4KK6D 2WSKA 5DMIL 3NGBC 5C6TH 3S4SG 4APQC 5DK2B 3OGCB 1XMEB 1R1CA 3SO3C 2CBOA 2YD1A 3HG3A 5CJ8A 2OSLB 1G6RA 1NANI 1K8IA 4LSUH 4P59L 2FLBT 2JQZA 4QXTA 2NQDA 4MVBD 3U46A 1PU0A 1NMBH 4YXKH 3D85A 3GZQA 5GGUA 3BZ4A 1B3JA 1URZA 4DHLA 4ZMWA 4P5MA 1UJTA 3PWVB 3EF7A 3CIAA 1U2YA 5AENA 3KPNB 3RUGE 3CC1A 3R0NA 3STLB 1T1ZA 1DE4A 3I02B 2F1AA 2JJUA 1X4XA 3BKJL 3PHSA 1XEDA 1EMTL 4RMBA 4C47A 3S5YA 5IJDC 3VXNB 1NUNB 2OV0A 4MB3A 1YEFL 2OULB 4DGIH 2FR4A 4U3HA 2VDPL 4P5KB 5HHME 4Z77A 4HP5A 3VXUB 3O6KH 4XNDA 1Q1PA 4X6BB 3LRSB 3HE7C 1S2EA 2AVGA 1M1SA 3OZ9L 4FXKA 5G4MA 3V6BR 4E2OA 3VXSA 2OQJB 3Q1EA 2IPUG 3C75A 1A9EA 4LCCB 1YEIL 5SWZB 2OJ1A 3ZHFA 5DGRA 3B7YA 1HH9A 4CBPA 4GAFB 2GBUA 4HUWA 5AVYB 2JB5L 3QR1A 4KXCA 4NN6B 4UU9B 4EZMA 4K5MA 4AEIL 2CGRH 2JKSA 2ZQKA 2HAZA 3N1QC 4FFTA 4K9EL 2OK0H 3FU3A 1TFPA 4A66A 3CMOL 1K9TA 4J3OF 4BSVA 2V2XB 4YZFE 2KLSA 4RIRA 2BDNL 3MLRL 4FDWA 1LK3L 3DSFL 1OE2A 1XGPA 3X1NA 2E0PA 4Q7DA 4RA3A 4U1IA 3GS7A 3PAZA 3IFLL 3B5HA 3EGXA 4LEXH 2QHRL 3HZMA 4HKBA 3UJJH 5INCA 4ICXA 3ZDWA 4UAOB 4RFOH 1KN2H 4ZK8A 3Q2LA 5IW6B 4PG9B 3R4DA 5CKGA 2CZNA 5JPNC 4K5OA 1EAOA 4HIIA 2VH5H 1WT5A 2K7QA 2NLJA 2KT6A 2Z3FA 3BVUA 4Q58C 5CLWA 4GW5B 1AXIB 4MNHA 5GZOD 4IOIB 2EIMB 3TNMA 5CSGA 2GBTA 3E38A 1WC7A 4ZUUB 3NA9L 5EF1A 1FA4A 3VB9A 2ENSA 1H8NA 2DM3A 3FQRA 5A6IA 3INUL 1Y7VA 4QD2E 5CGTA 2WAQA 5MERB 1UWXK 4OQ1A 1CXFA 5EF0A 4PGEB 1HZKA 1IARB 4TQHA 4EOWL 4CA4A 1ZA3B 3SDXE 4HYTB 4FS0A 4X0NA 5FA3A 1KPUB 3VXUD 3KJ6H 4RWYH 2CDEA 3GBEA 4N86A 4NPJA 1Q9WA 1WIPA 4M5YH 1GYCA 1D5IH 2LABA 4XR8C 5ID0B 5J7CC 3VQ2C 2K6WA 3G5YB 4PRNA 3FONB 3D87B 4GRLA 2AEPH 4YL9A 5J1SC 2O5XL 2UY6A 5KW9H 1BFVL 3TBWA 5I76B 2F19H 3I02A 1ZIAA 3DVIA 4PJCE 3SYPA 4I9WD 4ZUWA 2YRZA 1RUQL 1UXWB 4GEJA 5ALBL 4QDGA 4Z7OB 5G4NA 5F1IA 1Z6JT 2Y22A 4D9RE 1XCQB 5LHDA 3RGVB 1NGZA 2BY0A 4MD0B 2NUTA 5F0LB 3B9KB 5KAQG 4PCTA 1GVIA 3VXUA 3QCTH 3OAZH 3Q5YA 2WZPD 1J9SA 1Y6KR 5T1JA 5DFVC 4NRXA 3CK0H 2VMDA 4LCCA 4XMUA 1EGJH 1LM8V 2CIIB 1ZA6B 4W9IC 2WTRB 1M42A 5IMKB 4PJ7B 1H3VA 4UU9A 4O9HH 1RSYA 5JNYB 2FBJL 4JDVA 4DIXA 3GSNH 5GS1B 2RD0A 3SCMB 1NDGB 4DGWC 1P2CB 4EIZC 1MQKH 5DVOA 4A7GF 2ZUQC 1S9YA 4ZMQA 2VISB 4PVBA 2ADJA 3CZGA 3RL2A 4OVVA 1B9KA 5E2UL 1BA9A 4BCXA 4GQPH 2C7UB 3V4VB 4OB5L 1A1MA 1Q94A 1Q0YH 4ODVH 4F8TA 4JG5A 3KM1A 5HI4D 4AYID 2COVD 5AB9A 4RLDA 1RUML 2WZPA 4K3GA 2QSQA 2IPKB 4KY1H 4F7PA 1TO4A 5CHNB 2FX7H 3F64A 3CVIL 1A1NA 3M1OA 1E2VA 3PV7A 5KG9B 1MFCL 4MXVF 1H8LA 1D5XA 2XVKA 4AYSA 3MV01 4J1UB 2FSDA 4MJHA 4M7ZC 1NBYB 2XHNA 3QZPA 3Q43A 1GZHC 4OAWB 4OV6F 1RZIA 3A24A 4NFDA 1B90A 1T5WA 1G9EA 2ESVE 5T1MB 5BNXD 2JI3A 1ZLSH 4MQSB 2L3BA 3TO2B 2JKNA 1R5IB 4PGEA 1P5VB 1V7NL 3B2UC 4OIBA 3TESA 3RGVD 2YUWA 2VLME 2ZCHL 5HHNA 3B9KD 4JFEA 5HYJA 3UYRH 3TASA 1BYNA 2PPEA 1I3GH 4UT7L 4IBVA 1E4WH 2P1YA 1U6AH 2WVTA 4FJZA 1EXUA 5F7BA 3SDCA 3VTTA 2ZSVB 1DSFH 1SUJA 4AMKL 4HJIA 5HHOE 3BZDA 1WFJA 2EDKA 1IGYB 1SBSL 3E8UL 4TMPA 2H3XC 5IFAH 2Q86A 3EDJA 5EU5B 3LPPA 5F9JA 4KAQH 5CZRA 4MRCA 4PBDA 5J9PB 4HALA 1YYLL 3MX0B 4NO2A 3R0MA 1Q1JH 4B9JA 3VFSB 1XSJA 1RLWA 1LO5A 3NCJH 2F18A 1MDAA 3UZVA 5CU9A 1NEZB 4AMXA 4OCSH 1BIIB 2WW8A 4XAWH 2NW2B 1GZQB 3L4CA 1B9ZA 1A4CA 3ECVA 4UINL 3DSNB 1RUPL 3F12A 5DJZB 2LT9A 4PAZA 5FHBH 1II4E 1KF9B 1KCVH 3KWTA 2LHAA 2ZICA 1JS4A 3WEBA 2BY2A 5AZ2L 5E8DH 4D9LH 2F0CA 5DA4A 1TZOA 4YQXH 3QDJD 5H35B 3VQLA 4PJDE 1VSCA 4MKMA 5A7EA 5I82A 5CWSA 4G8FB 3MN8A 1ODAA 5I0ZA 5IVNA 1EJFA 1TVBA 4DP1X 5GS1A 1Q90A 3OHXB 4PHZA 4PLKC 5CJXA 3D69B 4A2GA 4HD9A 4QF1B 4YSOA 2VLLB 1V3JA 4X6DB 4B53A 3BKCH 3ENEA 1S8DB 1TQBC 3MLYH 4AGPA 4CC1A 4TM9A 2WWOA 3ELAT 4E9QA 1EAQA 1Q9OB 5JIQA 5EDXA 4LL9A 2C7UA 4QXVA 5D93B 4OZIF 1AG6A 1U91B 1IUZA 1PZ2A 1T4KA 2OR7A 3MNVB 4LLMB 2HFGH 3KW7A 1UM4L 5LCVH 5SWQA 1MELA 1UJ3C 3BH9A 3LY6A 4L1BA 3MRGB 4XNMB 3NRQA 1F56A 4X99A 3ZUNC 3DRQA 3QR2A 5KWYC 3UXFA 4FKEA 3VXRE 1GPOL 5KG9A 3N1MC 2J1WA 3QDJA 5T1KB 4KJWD 1SQMA 1R17A 4M62L 1NGPL 4N2CA 1J0HA 4DF9A 4Z95H 3CVBA 4G8IB 1VFOA 5KS9F 4J1UA 2C34A 3TH4T 2Q3XA 5JO5A 3QE5A 1TITA 4NAMA 1NBYA 3OKNA 4F91B 2X4NA 2WKGA 2XN0A 1NC4A 1EO8L 3N9GL 1RHHB 2H32H 2EC8A 1FH2A 1CYWA 2X1PA 3TO2A 3SO5A 4JN2A 1A0QH 4FXGB 4NEHB 5I8KH 2LGNA 4BZ2A 3B7RL 3UYPB 5HVHC 1UADC 1DQVA 4OUOA 2XA8H 3FOLB 1OAJA 5FV2A 4E36A 4KNTA 5F7UA 2F6AA 4WEUD 2DQEL 4HHAA 3T1WA 3UAAA 5GJSH 4WI7A 3HFML 3KD4A 4P23A 1YEDB 3IDXH 2FK9A 3DI3B 2CKBB 2GJPA 4JHWH 4F9PC 5D70H 4PLJD 2UV3A 4OKVB 3BWAB 4GINA 1AG0A 4ZDHB 1RAMA 2UZYA 3PWLB 1BEXA 1H5BB 4YBHA 3D52A 4AIZA 1CVRA 2ITFA 4ANXA 3EOBB 2CUMA 4OFYD 5LGHL 1FZMB 2V7HB 3ROLA 3ZHLA 3VDAA 2FYVA 4FCAA 5GRVK 5CXPA 5ES4B 3QFGA 2AXGB 3F8UB 4OF8A 3RVWD 1NGQL 4BFBD 2WGNB 3FW6A 5HDRA 3QUXA 3HPLB 1NIBA 4XI5C 3FQWB 4N25A 4HJTA 3BKML 3H9SA 3QORC 5PCYA 1GZQA 1HXMA 3EYSL 2XWBB 1NKRA 3NAAH 1KJVB 4DGYH 2X4UA 5IWLC 3PJLA 1JJUA 3F6IA 5AVSB 3EOAB 1XF5B 4GRWF 5GIRA 1OVZA 5IEKA 2CM5A 4WIQA 4NQEE 4HZ1A 5FWRA 5DUPL 2FX8H 3P3UA 5T1KD 1UWXH 2QQLL 5CJBA 4HT1L 2A6IA 5GRUL 2VDLB 4E42A 2QLYA 2Q7NA 1AGFB 1M6UA 3ZKXC 2V9RA 1P6FA 1H8SA 4MXVE 3VO0A 4WUKL 4GLRI 1MAMH 3BVXA 1CE1L 1UH4A 4ABWA 1GGBL 1TTFA 5DZJA 4UTCA 2EEBA 2A9CA 2Y5QA 5G2NA 3CGTA 1MW1A 5IB2B 2XFGB 4U1LA 1W16A 5G5DA 3L54A 3GPEA 3QAZB 2BHZA 5I0VA 1KJ2A 1D6VH 3KYMA 1MIML 3QDGA 2OMWA 4NBXB 9CGTA 1AANA 3ARDC 1IFHH 4U6TA 3GRWL 4KQ0A 3D0VB 1MJJA 4DW2L 1QYGH 6CGTA 2F5AH 5F3BA 1OAKL 3LVEA 3MRGA 3RY6C 1EPFA 3CLFH 3IM1A 1H15B 5DEGA 4LF3B 2HVKA 4L2YA 1M2OA 1J1PL 4Y5VB 1GTFA 3VFOB 2VSKB 4GKZA 3H8NA 3IT8D 2BSED 1IGIL 1DBBH 3MRNB 4Y4HB 5CN3A 2DIJA 4KKNA 3KPQB 3VGAB 2J8UA 4XGZB 4KI5C 3WIIH 1RHHA 3MO1B 1JN6A 3M17A 2FJGB 4LLUA 1V3KA 5HJ3B 5I9QB 3T8XA 1EZUA 25C8H 3QYMA 1U3HC 2D3JA 2R1WA 3UO8B 4FXGA 5DD0H 1ZLWK 1D7BA 4DFHA 3QQ9C 3UYPA 2AXFA 4S1SH 3ZYJA 3ARGC 5HYSA 2EQDA 3SE3C 3HZVB 1AYRA 1CIUA 5EO1A 2YEZB 4GXUN 4RRPG 4I85A 3IJ8A 5EOCL 5EIQA 4F15C 3WTSA 2YSSB 1UXSA 4MX7B 4NQDE 4HW6A 1E5ZA 4WI5A 3PWLA 3S3SA 3ULVF 4UB0L 4ONFL 2BSEA 4LSPH 3TS8A 3A22A 3BGMA 3T1FA 5CZKA 4BH7B 1LMKA 3IFPA 2V7HA 3B56A 2JK5A 4XPFH 4KJQD 3ECBA 3BSZH 4LZHA 2ADFL 4LDEB 4WTZG 2DYPB 4CMMA 2WN2A 2BHUA 3LPGA 2IQ9H 3DX0A 2AJVH 4Y5XA 1H3UA 3MA7B 2OMYB 3K6NA 4G7YL 1X5GA 4R4FL 4JZNA 2P3YA 4JHZA 5IHBA 3IJHB 3B2MA 5KSBA 4UM8A 5IB3A 4OZIE 1M05B 3W81A 2X4SB 3IDIB 5HGBA 3U4BL 5BV7B 4NBYB 4KKCC 3QEGH 5JIMA 2NY5C 3A21A 3OKEA 4NKIL 2L7QA 2O5YH 5DZNA 3FUIA 4ELDA 2Y7LA 2Y25A 3GI8L 2VDRB 3IS1X 4AK2A 4KTYA 1ED3B 4Y4HD 4WI9A 1EZSA 4FTVE 3WUZA 3INOA 5DI8B 3SB3A 3QXTA 4X8GA 1MEXL 3P0YH 5I1JL 3BAEL 5KS9E 4NQXB 4L3CB 3ILPB 2OW6A 1PF3A 3L3IB 4P06A 2APBA 2VAAB 4JRXE 2OTWA 4NHUB 4OIAA 3TBBA 1NCHA 2PNDA 5EU6B 4L4VE 1OM3L 3CFKB 4PG2A 2W9EH 1P4LA 2EH7H 1ZGLA 1NCWH 3FN0L 4J3XA 3TNNB 2X3CA 4OI9A 2X1OA 5EUKB 1VFAA 4PJ5B 3JTSB 4XB3A 5F6HI 12E8L 1D6EB 3D0VA 1AC0A 4LBAA 2VR6A 4PS4H 5SWSE 3GLEA 3GUTB 1PZAA 5DTFA 4HWUA 4NWUL 1CK0L 2XVBA 1G0YR 5D1XA 3RPKA 1JNNL 2YXVA 2NYYC 4B96A 3IVKB 1NBVL 4URTB 1OP4A 5GS2H 1F6AB 4E9YA 3FFCE 1HI6A 4M3KB 5E8OB 2AQPA 2DQIH 5H2BB 4URKA 5C2BH 3VQMA 2BNRA 4HUNB 5ACLA 1NGWA 1JV2B 3WFBL 4GO8A 1WQVT 1MWAL 1BREA 2KPWA 4FADA 4DTGH 3AMLA 3SDDC 3APFA 3BWUC 3DC0A 3G9AB 3HG4A 5HJ3A 2HTLD 3WEXA 3IRZA 4ZO7A 2DYPD 2D9QB 4HPOL 4BK4A 2BVOB 4XZUA 1F2QA 4XXWA 1CLYH 1AR2A 1T1YB 3SKNA 2P8PB 2I9LB 4ZYKA 2CO4A 3PGFL 3MV8B 2UYLA 3IRPX 2QELA 5T3ZE 4UOQA 4FEIA 1UG9A 1MIEL 3QUGA 4PRAA 3VG9C 3S3PA 4Y9EA 3OX8A 5CLYA 1N6QL 1OGTB 3RIAK 2X1WL 3CXDH 3UTSB 1XGUB 1XR8B 3IDYB 1OSEA 2QVMA 4MBRA 5TQ0L 4F8LA 2K6YA 3MV7A 3SGJC 4GRWE 2WZ5A 4XPBL 3V5KB 1Z3GH 3FTVA 3RYMA 4DZ8B 5IUSA 3AS3A 3TV3H 5DEZA 5GGVH 4W6XB 3X1EA 4M8VA 3CZFA 5B1KA 5CU5A 4R96A 3UGEA 4F24A 4TVPE 4F7EB 4BH7A 3VA2C 3C5ZB 1NIDA 2B1AH 3CZLA 4GXVH 4P2RE 3TLRA 4L8BA 1A7RH 1T1WB 3CDCA 1SEQL 3MRIB 2HA1A 5EU6D 5JOPD 1Z5HA 1INDL 3WFEH 2ZIDA 1YN7A 4JRLA 1TJXA 3H42L 1C5CL 2Q0ZX 3Q8CA 4WFHE 3T5WA 3IJHA 2XWCA 5CAYB 3FRUA 3LH2L 5FECA 3UL4A 1L9QA 2DWSA 5JQHC 4G70B 5ICXA 2YAFA 3O6LL 2CMRH 4XNUL 1QEXA 5I1CL 4W9HC 4WHCA 3EYQC 3UO1L 1X4ZA 1JPSH 4FMFA 5GISH 5L88L 5AAMC 2JKRM 1U8LB 4G6ML 4TLUA 2R0ZL 3E6HB 3U2SB 1QQDA 3AY4A 2LU4A 1T1XB 2XQYG 3AACA 4PJ8D 4U6XA 5C0CE 4C59B 3NFSH 3T04D 1EUUA 1TQCB 3ZO9A 3W0WB 1FZKA 4NQXA 3FTSA 1YYMH 5ACZB 1VADB 4OD2B 1A5FL 1IGTB 1FGVL 4DN4L 3GSRB 1BQHA 3KAAA 2B1OA 2XFXA 3CFKA 1AP2B 3JV4A 2X2JA 2CA3A 3QXWA 3TNNA 4E0RA 1N70A 2OW7A 2HT3D 2FATH 2BVEA 2VLJB 4OJCA 4XO9A 5GSRB 5ID1B 1S7XB 3QRFM 1J1OH 3MV8D 3RB5A 4P0DA 1E4JA 4QHMA 2YZ8A 3NVQA 1B4JL 1GS8A 4WHTB 3TOPA 1ZKAA 4BXVA 1GGIH 4A7QA 4IOFC 3UTSD 3DK2A 5DC9B 4A38A 2DMBA 3EG9A 2CRYA 3FH7A 4HCRA 1F90L 5IUCA 2VITB 1QTPA 1RFDL 2DQMA 4HIQA 5I6MA 3PFQA 3AZUA 4PJ8A 1HE7A 3BDYL 5CSBA 1JI1A 3L5XH 4N8CH 1EFXB 3C5ZD 2HJKA 4ZUTA 3ULVE 1AY1H 1C8PA 5J06A 1TETL 2VKWA 1Z9OA 2X0VA 4QYOB 5ELIA 3MLZH 2CDGA 2OZ4L 2FEJA 5DSCA 4KK6C 1WAAF 4X7SL 5ENWA 5DJXA 2D7MA 1T1YA 4L8CA 5FYLE 3T4YA 1SDAB 1FO0H 3OSVA 3M1BA 4RFEB 2VDKH 1QW9A 3HNSH 5KVEL 5KSUA 1CR9H 3D3VB 3QFDB 1TNNA 1TYJA 4AGMA 3GRBA 4LCWB 1ZLDA 1JHLH 1QHOA 5ADPH 2P5EE 4AUJA 5D7LB 3PXLA 2PPCA 2W80C 5K9JH 1Z9SB 3QCVL 1DEDA 1RIHH 4M4PA 1IC7L 1UACH 4QCIB 3MBWB 4NNXB 2A6JA 4R7VA 3HHSA 1BQLL 2I69A 3A6CH 2YIHA 3F7LA 1FVDB 4JRYB 2BHYA 4OVUA 4F7EA 3OPUA 3ZL1A 3C5ZA 3W0WD 4EI5A 5HDBB 4XO8A 2LLLA 2CQVA 5TE4L 3MNMA 1LILA 1KYOJ 1AH1A 1A6AA 5KYWB 1T04B 1PS3A 2V5MA 5CMAB 3MRLA 2F8IA 3ZTJG 3ETTA 2YPVA 3RZCA 1EHLH 3HR6A 3L7EB 4Y2LA 2XZCH 1O9ZA 3N41F 2VLJD 3D18B 3ULUH 4M6ML 3RVTD 1FBIH 1B2WH 2VJ8A 2CR3A 4B0MB 4G8GA 2UY7B 1KXHA 3WSQH 3S88L 1WT5C 1RK1B 1AHWB 2HJLB 4Y1AB 5IB5B 3X11A 3I50L 3D1MC 1LXMA 2BP3A 1ZY9A 5CM1A 2G5RA 4JO8A 1DQMH 4U2YA 3HC4H 3ZE2F 4JR9H 2IH8A 3U2SA 2HH0L 4RSYA 2XWXA 5C71A 4R7LA 5BMFH 3QRGL 5I1EH 5EZIL 3DX2A 1BXXA 4XWGL 15C8H 1EFXD 4PB0L 3ABMB 3MCLH 3LYRA 1WP6A 1YAIA 4X9YA 1NDTA 2MNWA 4TNFA 3Q44A 4ELMA 3MV9A 4WWID 4H20L 5H37A 2E4FA 4Z3FA 1KYUA 4XMPL 5KYXA 2XWDA 5AUMA 4IBUA 1A9BA 1UD6A 1ETA1 3RHWF 2Y2TA 3IF1B 3B3IA 1FN4A 1KB5H 2CJ3A 1NIAA 2AJZB 3D3VD 3LKOA 3ELQA 3MLVH 3S37H 4ATTA 2YXWA 3N1GC 4ANWA 3JYCA 2IANB 5C0IB 5KSAA 4XVOA 1UC6A 3APCA 3UTPE 2A9ML 3FOMA 3S34L 1NUDA 5D7LD 3G08A 5GZOC 2PYED 1DJIA 3QHZL 1WBZA 5F88A 1KXQA 1F8TH 1ECYA 1ZMYA 1HQRB 5F96H 3ARTA 4FI8A 4X8JA 3P4MA 4UBDD 3A0OA 3QEUA 2VQUA 3EO1A 3MLTA 2E7DA 2PTTB 2XYBA 3HMXA 4HFUL 1HN1A 4F9LA 3SKOA 1MJ8L 4IGBD 4R9HA 2FIKA 2XN9E 2WBJA 2G9HA 2VDQL 2EP6A 5DK0B 2DDQH 2DZEA 4UT9L 1CXKA 3P4NB 1QSZA 1J5DA 3W82A 1QFUH 2YRPA 4HK0A 3LQAC 4OIIH 1JZGA 4U7SA 3KL0A 1I8AA 4G2AA 3GINA 4LCCC 1CYXA 4I48B 5TH2B 2NPLX 2WYIA 3NIGB 4B27A 2VWEE 4FXTA 3CHRA 4Y1AD 4M3JA 3QWRA 3U7AA 1UM6L 1EEZB 4PP2B 4TNVK 1Z3RA 2PYEA 3SKJH 1D5BA 1QWUA 5F9OH 4N8VG 5I8EB 2E27L 5D9SB 4UV7H 1N4XH 1RMFH 1FVDA 2ZCKL 5F2FA 4E41A 2X70B 3TX4A 1BFOA 1DFBL 2DEYX 2EXWD 2BP8A 4IGBA 4MZRA 4IIQA 3W11C 3HRZA 1R3KB 3GZOA 2EKSA 3Q9PA 3HI1A 4A6YL 1GKOA 1P4UA 3BHBA 1J1XL 3DMMA 1EFQA 4OZ4B 4DN3H 2XOTA 3DX3A 4KKRA 1CJYA 3QUML 4KTDL 3V4UH 3U79A 3I2CL 1QRNB 3FF8A 3KS0J 3SQBB 1E5YA 3O2WL 4N4YB 3CH1B 2IAND 4PS8A 1WCBB 4OUUB 1RIVL 5BRZE 5C0NC 3W5NA 4M7JL 2E47A 3MBED 1GRWA 2R2HB 3P4OB 4LVEA 3NCXA 1BVZA 4UMGA 1ZVSA 4XTRD 1M71B 3NCCB 4HLEA 2W1NA 4UIMB 1A64A 5EZLB 3EDDA 1AXSB 3RX7A 4NUMA 3D2UB 4JB9H 4MHHG 4XBEH 1WZ1H 5C09A 2XWJB 5HI4C 3KVPA 4CN4A 4OZHA 5GS0D 1WAAE 2JJTA 3IF1A 2LE9A 2DTML 2ZJSH 3SDCC 3FO1A 4D0DB 4P46A 4W9KC 4LASH 2CBQA 2HLAB 2AQSA 5FYKL 4WAFA 4AW7A 5I75C 5E1IA 3B9VA 2FQDA 1DVXA 3MBEA 4EI6B 4N6RB 1PD0A 2IADA 3BVNA 3L9RA 3O4LA 4XMXA 3ZE0B 2P7TA 4L37A 2D7NA 3REWB 2X7LB 4CRPA 2BK8A 3UFIA 1I9IL 1QA9A 4FLSA 3EYFB 1C7SA 3EGDA 5FYJH 4OM1L 3BKYH 3P11H 3NPSB 4I1NB 2VZTA 1RZPA 2YPKA 3QWOB 2FEEI 4O02H 2YUZA 4NQVB 2NDFA 2CIKB 2ZSWB 4X7FC 4CVZB 4EIBA 4YHIB 1F0LA 5EIIB 2P46B 5SX4I 2F54A 2ICWJ 3CCHA 1PLCA 5DC0A 4F7TA 3OQRA 1QRND 3ETBF 4U3XA 3ZE1B 4G9FE 3BFWA 1SEBA 1L7TH 2P5WE 4OCRH 4YK4C 2IH1B 2PO6B 4MMZB 3ZDXB 2EUWA 3IWUA 5KUKA 3C5SB 5DVNA 1QBLH 5GS1C 2FT7A 5CJXC 5C7ZA 1U4EA 3FZUD 1A7QL 4C4UA 1AFVH 4AVKA 1EAPB 1I9EA 2Y3AA 3PUCA 2R8SL 5D9SA 4JFSA 3TURA 4DOHE 3Q8EA 5CGYD 2P8LB 2VZSA 4JFFE 4LFHG 2F7IA 3QR0A 2BERA 3MOAH 3NJNA 3SGEH 5E6IA 4L5FL 2APTA 3TN0A 3D2UD 5ITBL 4HEMA 2F61A 3L5WA 5I8OL 2DLEA 3IGAA 1HHHB 1JPTL 3U7WH 2X4PA 2FEDC 1DP0A 3L4UA 2GB2A 4FQIL 2FECL 2BOCB 4OLZL 5TFSL 4POZD 4NJ9L 3V4PB 3ESVF 1AD0B 2J1XA 2VSDA 1MCWM 1UCBH 4PJAF 3FO0L 3OKKA 4IRSD 1HEJC 1OF2B 5GPRA 2QPUA 2X10A 4JKPH 2HVBA 3QZLA 1E9OA 1FWXA 3RIFF 1EA9C 3Q7JA 2CWRA 2H26A 3GSQA 3KPSE 3PABA 4CJ0A 4EJ1C 2GPZA 5I1IL 4QMEA 4KKAD 4CW1A 2UXFA 4JCMA 3P4OA 2ISDA 1XF1A 2NW3A 1M71A 2AQRA 4QHLA 3ZPDA 1XGTA 5HHMB 1MRDH 4XP6L 3LKPA 2XG5B 2WHVA 4KHTH 1XAUA 3L81A 2Y7QB 1KBWA 4Y88A 2NXYB 2JVUA 2JE8A 3CPLA 4NB7A 5KVGE 4TUOA 5E2WH 4CADB 2Y1VA 4JG9A 4QOKA 2EC9U 3MMEA 5KYYB 2BP0A 3GSUA 3MBXH 3VW3H 1JZ2A 1HHKB 4XE0A 4P23C 3RWDA 5F0JB 5HP5A 4AKPA 2BNUB 4UQEA 1RUAL 3GIVB 1LE9B 1WAPA 2NT0A 4IRSA 1N6VA 3QJFA 4YDNA 3JYBA 2GSIA 4LSVL 5B39G 2EDTA 4LLYB 4K3JL 4MAUH 3FTXA 1ROCA 3UX9B 2PO6D 1NFAA 5L6YH 2OJZH 1GAFH 2OYPA 3P9LB 4PJGA 3D0LA 1OZUA 5DU7A 3NZUA 4OTXH 2QSVA 3QH3B 4LIQL 3QARA 5KVFL 3HBZA 1LEGB 1NFKA 1DUZA 3VXMA 1FYHB 4LRIC 3KPOA 2WXGA 3NZHL 2BVQB 2WLHA 3Q9QA 3GSWB 3CSFA 5C0AA 4UOW0 1JE6A 4LNVA 4MRBA 1GJWA 3MRDB 3GUFA 1T5KA 2NY7L 1JERA 3QJHB 1R3JA 2B8OT 3GZKA 4P3CH 1BWWA 4H88L 4J4PD 3NIDB 4I18A 2YQBA 3R06B 4Q4IA 3RX5A 2DRUA 4PLJC 4XT1C 1KT2A 4DPAX 3O9WB 3T6ZA 4QRAA 1QSFA 3FU0A 3GTNA 2IH1A 1T2XA 4XNYH 1HOEA 1D2OA 2ZUSA 3UTOA 2XWZA 4OD3L 1R19A 4TQ8A 2DM7A 4AYGA 2VZOA 2B9AA 3WIHA 1KXTB 4Z3EA 5I5MA 4XPHL 3FU7A 3RVWC 3AROA 2DH3A 3ARPA 5T5FH 3AXLA 2QR0A 3LRKA 3H4FA 2AF2A 2HKHL 2R29A 1Z0MA 4FNRA 4YO0B 2NXYD 4N2KA 4WSGA 3C8KA 2ETWA 4MQXD 2N3JA 3WJMA 1SN5A 3DUSA 4P4RB 3GO1H 5JOFA 2O6DA 1XCTA 4DAGL 4J4PA 4JDZA 3V6FA 1EHXA 2WCPA 4F7MB 3HMWH 3NCFB 1GA2A 2OA9A 5HI3C 3VFTB 4G83A 3VDCA 2NX5B 4MB5A 3VWJB 1SLXA 3DTXB 4W9JC 2V8MA 3C12A 4X6FB 1J0JA 3KPRA 4RGOH 4PJCB 5EPMB 2UZPA 4ZI8A 1I9RL 3SPJA 2DQUH 4G82A 4MGXA 4U1NB 3HG2A 2Z1PA 4LSSL 4S10A 5F8QC 4NYLB 3VD0A 1GGUA 2EEXA 4IQHA 5L8KB 1S7SB 4X6CF 1LWJA 4OSUL 3LXAA 5DMIH 3PP4H 4KXAA 3U0WH 3KNBA 4R26L 1GXEA 4FXGC 2VERN 1E6JH 1A4KB 1NM4A 2AV7A 2EDJA 5JQIB 3C09C 5BRQA 3FU5A 3NJKA 3ZHNA 3P0VL 2JKJA 4P59H 1EJOL 4Q52A 3VXPA 4A2HA 4ALAC 2WXIA 1HSAA 3IFOB 4PGZA 1JP5A 1EGJA 2N7BA 3WS3B 5EBMA 5DEFA 1UWEL 1X44A 3JV6B 3C8HA 2OX5A 3CLEH 3U82B 3O9WD 1M6OB 4R3SB 1H0DA 2FL5B 1Y7MA 4WK4B 5HGDA 5SX5K 3RFZA 1A6VL 3GSNA 3ZT5A 4J2QA 4MNGA 1BOGA 3BKJH 1N10A 3ZG4A 3DO3A 1DBML 4PYHA 1EMTH 1NLDL 3G6AA 3PG2A 4IMKA 4WW2F 3D9AH 3LEVL 1J8HA 2VDPH 4L3EE 4Y5XC 4LGSB 1HAWA 1OE1A 3OJVC 4XXDB 2IC2A 1UEMA 3L3JB 4FKKA 5AL8A 5EH1A 5B1CA 1B0RB 2JCCF 3MXVH 1XL4A 4PRHE 1C1EH 4OCYL 1UD3A 1VEPA 2VIRB 1OTSD 5HPOA 4BHUI 4KXDA 2FB4L 5TQ2L 4GBXB 3QJXA 1YEIH 5JR1H 3GHBL 4DPBX 3VRJA 1UENA 3I9PA 3DDGA 4PRPE 5DD6A 2G2NA 5HVGB 3MRHA 3N44B 5DFWH 2DIAA 3FQ1A 3HG1A 4PJAE 5ABAA 2NX5D 1QASA 1LEKA 3VWJD 4XP4L 4LPQA 2X0UA 4Z3HA 2X6MA 3HS8A 3A67L 5DJAB 4TLSA 1RJZA 3V6ZB 5FK9B 2ROYA 1NAMH 3D09A 3DSFH 3FT9A 1SZNA 3VCLB 4JHAH 2IWKA 1JOIA 1K4DA 3ARYA 4MJIE 5BOPA 1OGAE 5EZJB 3MYJB 4PG2C 4EQ3A 3US1A 4YSDA 1ZD6A 4JKMA 3PLYA 3QYNA 3TT3L 2EE0A 2E8ZA 2XACC 3JWDH 4KBPA 3E3QE 5EBWB 4P4RA 3DOSB 4S1DD 5JUEH 4LGRB 1E2WA 2HUEA 4D7PA 5E8NA 2D7OA 4M43L 1P9MA 3BYTA 4PGBA 1RZ7H 3BDBA 2V17L 5D1XC 1OOWA 4LQFL 1UURA 2MKLC 3NZ8A 5D2NE 4GXFA 4FE9A 1VA9A 4HIJA 3ZDYE 3U4AA 1ZPUA 5KANI 1HHGA 1KPRA 1NC2B 2FGWH 2HN7B 2C9PA 4AL8H 5E5LA 4EKXA 3MRMB 1DQJA 3QNZB 5IGXL 4N8UA 4ZPTB 2E9GA 4HG4J 4EUPB 2EAEA 2JF1A 2I60L 4XXWC 1QO3B 3CC5B 3BW9B 4ORGA 5BJTB 2AFNA 4M29A 2R39A 3U0PA 1O9WA 4CUCA 4XMLL 3V52H 2W0FA 1NICA 2NUPA 4D8PA 2IV9A 5ANME 4GBXD 4ZX4A 1CUOA 2A73A 1G94A 2VR4A 1GZPB 2ZOUA 3FT4A 3AABA 3JV6A 4JL2A 4K7PY 1NANH 4MAZA 2W60B 2BOBA 5AEAA 1R0AH 3GFUA 4XCYA 4AGOA 4OQTL 3U2JA 3MGOB 4JFXB 1DLHA 3WNKA 4NUJA 1KC5L 1FFNA 2EDOA 1RUQH 3LHPH 1KBBA 2HTLC 3X13B 4ZSOA 4BWUA 4JG0L 1MCPL 3UBXI 3GHEL 2DQDH 2DI9A 3CHPA 3JWOH 1GKEA 2W0LA 5IJVB 2JSFA 3L3JA 1NCUA 3CSTA 4KUZL 4R7NA 5L7XL 1U93B 3M88A 4LVHB 4QHNB 3UZQA 5LCVA 4ZFOA 1G4RA 1F3DJ 4NQCB 3VD3A 3BN9D 2AANA 3HUJF 4L4JA 4IBZA 2A83B 1E42A 3VI3F 1YC7A 3Q01A 5EU3B 5T33L 3B8YA 5GGRB 3K71B 4UTAH 5DR5H 2EIJB 2Z0UA 2BW5A 1LNUB 4NAJA 5AVWB 4Z78B 4DESA 1BZ9B 43C9B 1MCHA 1OXYA 4PEEA 4QRRE 5CP7B 4UZUA 1L3WA 2F53B 1NC2D 2H32A 4ZMAT 5E2UH 4XCFH 4HXAL 5AKSA 1ZHKB 3FB8B 4MD5B 1KYFA 4AE0A 5FO8B 1EO5A 3ZJAA 5JLZB 5E08H 3PWPB 3PV6A 3NSCA 5EZJA 1NCJA 3MYJA 1MG3C 4PCSA 3WFHB 5I1LA 4WJ5B 2XTJB 5ITFB 2EVJA 5T3XL 5CFHA 4X6CE 2AV1A 3VX1A 3ILDA 1J86A 4NM8H 3T71A 3AB0B 3RJOA 4YGVA 3WEAA 4XN7A 3CVIH 2B9BA 4YWGL 2CJUL 4OBSA 1HT6A 1RJYB 2Y7MA 2YLKA 4IDJL 4IKKA 4JAMB 1OIOA 1DL7H 1QFWL 1I1FA 1LO0L 1Y6MR 1A1OB 1MHEB 3TIDA 5DJ2B 3IAQA 1I82A 5I16A 4NQSA 5EB9A 1FPTL 1MCCA 1QSEA 1BM7A 3CSGA 3AJ7A 1AYOA 3FB7B 4PJ8C 1N0LB 2ATKA 3O0RL 4RDQG 2X4OB 1ET7A 3D0AA 3DJ9A 4N2DA 5I5IA 1D7FA 4IHOB 3RI5K 2W0PA 4YDLB 1U3NA 4B9CA 2DQCL 1UXMA 4P2OB 5KBPA 4XMWA 4ZPTA 1S7UB 3O8XA 4HOZA 3U36B 5DMGC 1P7KB 1CG9A 1U8QB 5I23A 1HU8A 4J3SA 1J12A 3FPXA 3NSDA 3O3BA 4WSJA 1S9VB 2NY2C 1OSZA 3A4AA 4PREB 4M61A 3CSBA 3PS6A 4I13B 3PQYE 1AO7B 4NQCD 5L2KB 1YY9D 3IXAA 2JCCE 4QTIL 2VABA 2CXGA 3C6SA 3U9UA 5KOVC 1IQWH 1YEHL 3VQ1C 1HKFA 3PDOA 3V95A 3E8UH 1A6UL 1SBSH 2P80D 5H94B 2VM4A 3RGHA 3JZYA 5IROD 1C16A 5LB1A 1HZHL 3GBML 4FQ1L 4ONOA 1YYLH 1KXVA 3TFKD 1XGYL 1YRKA 2AQQA 2F53D 3C5ZC 4RMRA 3S96A 4MAYD 2HG5B 4YBLC 1FDLL 3H3BC 3D7PA 2QMKA 35C8H 1IU1A 4B9GA 2WWNA 4LK4A 3PWPD 4Y7OC 3GSXA 1GH7A 3TU6A 1ACZA 2XTJD 1JZJA 4K7FA 1EANA 4ADIA 4EI0A 4I3GA 4OKDA 3VFPA 1QABA 4JO1H 3RWJA 4JANA 5A6MA 1SVZA 1IBFA 4BQ8A 1UWGL 2YK1L 2PXYB 4OFDA 4HUMB 5D2LF 4GP8B 3F7VA 3FTYA 5IROA 4Y2NA 3U1QA 5D7IA 1JUFB 1WITA 3N42F 3R19A 3GD1C 4K3HA 1ZVHA 5CP7A 4NZRL 2F53A 3TA4D 4G6KL 4UV4L 5GGTH 4LPXA 1NEZG 5HHXH 4MAYA 2JB6B 5AOKA 3C5JB 4BQ6A 3WHXB 3FB8A 4P2OD 3ZTEA 2ZOTA 3IB4A 5I1HH 1DVFB 3S35L 3HE6B 3RWHB 4HJSA 2JI2A 1SJXA 3RVTC 4IDLA 5SX5H 1WH0A 3WUWB 3W1ZA 1KY7A 5L2KD 1MAKA 1XO8A 2R56L 2HFFA 1AO7D 1SJMA 4M4RB 4NQDB 3RWFA 1TZAA 2DQTH 3UEZA 5KSAC 5I26A 2FUTA 4M62H 1NGPH 1KCBA 2IO5A 1ID2A 3JUZA 32C2B 1BVNP 3CMGA 1D5RA 2E9IA 1PZUB 1AHMA 5BS0A 2XXGA 1EO8H 4QT5A 1FHNA 3NACH 1M2VB 4NM4H 4BDVA 1UWFA 1SYSA 1PKQE 2F9BT 1RZJH 3OVUB 4OF6A 3LXCA 4KQ3L 5F7YC 4CC4A 2IGTA 1IBZA 4L05A 4GXUM 4XHJD 5T1DH 4IHOA 4TVSa 3QO0B 1ILSA 2V9TA 4N2MA 5CSZA 5ACMA 1U4FA 3AM8A 2WBJC 1S7UA 4TVUA 2OLDA 1U8QA 2GSMB 2VDOL 3MACH 3EFDH 1AOHA 3TA3A 2ZWZA 5JZ7C 3CXHJ 1ASPA 2C9XA 3ME0A 1KCWA 5D1ZA 5ETUB 1QRKA 4N0UE 4KI5F 3K4ZA 4M93B 5L2KA 4DKEH 1THAA 2X3AA 3QAQA 2GHWB 4FFZH 1YEJL 4NWTL 4Q6YA 3T4AB 4MA3A 4F7KA 4PV9B 2DBJA 4XBGA 1IV8A 1MDTA 3QPKA 3HUJE 4BQ9A 3VXQB 5KS9B 5LGHH 3VI3E 1LP9A 3NABL 4BYHA 1UGNA 4YHOL 1MW3A 5IKCB 2BMKB 2BNQB 3MNWB 4JRXB 4AQ1A 4UBDC 2XBZA 5E94A 4BK8A 1ZV2A 2Q7AA 4U0QB 3H9ZA 3QG7H 1UUNA 1RU9L 4PRBA 2EO1A 2HG5A 4IGBC 2VDNH 3SSGA 3D4CA 4IIQC 4ZUVA 3HRZC 1JGUH 1DVFD 1PJWA 2QPEB 3W39B 3CBJB 2P49B 3HE6D 1F4XH 4PW3A 2ZTBA 3V5HB 3VM5A 5C7XH 2IG2L 4QY8B 1E50A 1S9XA 1E67A 3QPXL 1NCIA 3SBRA 1MY7A 4B5ZA 3RNQA 4AK1A 3HJ0A 3GSOA 3BPNB 3FFCB 1IGMH 5HHVH 3EHBB 2QQLH 4HT1H 5B38B 2KLTA 5FKPB 5CCJA 3DNKA 5IMMA 1G7HB 3WO3B 2I85A 3CQQA 2OP4L 2YWZA 1TO5A 4FX5A 5MEPB 4B3VA 2IV8A 3ARFA 1GGBH 3ESOA 1FH5H 3N3EA 4FA8A 4FQLH 4Z7WF 3OJMB 4I4WB 3OPZL 1T3FB 3QUZB 2FJHA 2DH2A 4V1DE 5KJ4A 4M3HA 4OF7A 3IE4A 2EXWC 2XWTA 4JY4A 1CCZA 3NCEB 4OJFH 2Z92B 1WFNA 3BQUB 1QI3A 5CZXD 1P5UA 3ZMNA 3RWHA 3WV0A 3GMOB 2G2RA 2JELL 4WFGD 1KLGA 3EDFA 3RVUC 1DQIA 4WGWB 1HEZB 4GRWB 2EECA 3KYKH 1S5HB 1JK8B 2P24A 2CO1A 3P77A 3U7YH 3LN5A 3MROA 1J1PH 4PY8I 4HC1H 4P46C 4JFZL 1MFBL 4KOBA 3ECQA 2P8MB 2VUOA 2D7PA 3C08L 4S0TD 3V0WL 3DVNA 4HS3A 3MBEC 1J8RA 4UUJB 5TF1L 1OD9A 2WJ5A 2Y6SD 3B2VL 3P2DA 4ZBJA 4M6OL 1M2VA 2BNQD 1JD9A 2I5YL 4YGAB 3DUHA 1E40A 4DPCX 4G9DA 4KV5F 4CMHB 1HJBC 2Y1AA 1A7OH 1WFTA 1AHKA 4ABQA 3ARBB 1EEYB 3L48A 5EWIH 3G6JF 3OXSB 3UMTA 3FO9B 5LGKA 2KQNA 5D7HA 4ZMOA 1N5AA 2DI7A 4F8OA 5GS0C 1UOVA 5F9WC 5IHHA 1E7VA 3LRHA 4LRNL 5EUOA 4KVNL 5EOCH 1NCDL 2DL2A 1X7QA 3T4AA 3EHBD 1RERA 3HR5B 1UA6L 2FWOA 2OMTB 5C0CB 1L4IA 5BO1L 1BP3B 2XBDA 2YPVL 4XVUD 3CFCH 5DZVA 1ZVNA 1O7DE 1YPZF 3B83A 3FN3A 4I0PD 4UCFA 4U1SB 1L6ZA 5D2LE 4XCCH 5IQ9A 1VFBB 1U42A 2ADFH 4E5XB 4B9YA 4AGLA 2JFCA 1QATA 3MCKA 3QUZD 1DCEA 2GJJA 2IBZX 4HF5H 3QBTB 2GHZA 1XTLA 2V5SA 3TN0C 2JV6A 3US9A 2P45B 5LXVA 1Q9LA 5A2IH 4R4FH 4PYGA 1QW8A 3BQUD 2OMZB 4DP6X 5D71H 4E9WA 4PJEE 2C9QA 2OMXB 2C1OA 1N18A 3F7YB 1ETZA 1AZZC 4YXLL 1RZ8A 2CCWA 2ATPB 3MZTA 3QB7C 4MA8L 2HLFC 2B4CH 4PJBB 1F4HA 1A6WH 3I9AA 3BRFA 4ICWA 3UAFA 3PPSA 4FG2A 3RBSA 3O2VH 5C0BB 2COQA 3TBSA 4D0CB 4WFFD 2Z7WA 2QQKL 2XZQH 1LGVA 1R46A 4CSSA 2FBOJ 4ADGA 1BLIA 1E6OL 3FDWA 3DBSA 2E76C 4I0PA 1KCUL 1TZGL 2C7FA 5IK3A 5AYQA 3AG3B 3GMQA 4H0IA 3K6DA 1LEIA 4TUKH 2EVIA 5CGYC 1JPGA 3HPJA 6FABH 1YECL 4PW4A 2K9FB 3ARBD 3MRQA 4F2FA 1FAKT 1L0YA 1XQ4A 1G4MA 3OZLA 4MA1B 4BSWA 2KYIA 3ZYZA 1DEEA 1FO0A 4POZC 4U1KB 3LPWA 3WY4A 1I1YA 1ZTXL 1EH9A 5TE6L 1HQ4A 1CK0H 4IEFB 4IRSC 4JX0A 4QIRA 1JNNH 1RIUH 3IJ7A 4AYFB 5FKAA 4I0KA 2WLNA 1T89A 2EZ0C 4KI5E 5TDOA 4W9EC 4QTFA 1SOQA 3VRLF 3DPBA 3CVHH 3WFBH 4UUJA 1XIWA 1JHKL 2ED7A 2PWGA 5MENB 1KIPB 4P3DB 3NN8A 2N01B 4PVNA 4AEEA 3OF6D 3AUVA 4BQBA 5LKNA 4XVSL 4UNTA 1MOEA 2YO3A 1B0GA 2EIZB 1YG9A 4Y4KB 5E9NA 4ZUSA 5E24E 1JZFA 3R8BB 1EEYA 2DLGA 3NRPA 3OSKA 1OP5K 2ZKHL 3OXSA 3NPSC 3NA4A 2QV2A 4U1JA 3PGFH 2VN6A 4L0ZA 1HTYA 1IMHC 1VPOL 5E8EA 4H2CA 3K5RA 3TO4D 3F7QA 4BRJA 2H3NB 5A2LH 1U92B 1N6QH 4I18C 4ODWB 2VXVL 3U30C 5IR1A 3KW8A 5FCSH 1X6NA 1TJGH 4OI7A 4XPBH 1IEHA 5C0BD 1MY5A 2R4RH 3BAXA 4J3UA 4LSRL 2PO6C 2ZCLL 2WCSA 3AAZA 3QXDA 3KWUA 3VD1A 4HJGB 4AOFA 1JGLL 4FQHA 4LL1A 5LNEA 3IDGA 3I6GB 3WTWA 3AC0A 1HX0A 3QS3A 4YLQT 3QEQA 4MJ5B 3A5VA 3KPLA 4EO5A 5CR1A 4GUCA 4M7KL 4R8WL 3L3GA 3GHPA 4JDEB 4H40A 5C08E 1IC5L 3CFTA 4Z7WE 2XV2A 1GYAA 4MA7L 2HYMA 4Z3GA 3B6SA 1O6SB 4MQTB 1ZIBA 1C5CH 2JXMB 4KU1A 3TZVB 2OZNA 1ZCRA 5CEZE 3LH2H 4L9LB 5D96B 1ZANH 5IY5B 3TO4A 3ALWA 3CFBA 4PJBA 4J4PC 1KB5A 3O6LH 1IAKA 3GIZH 4OBRA 4JPIB 3UO1H 5HHQB 5IG7A 1TNMA 2FBRA 4A2MA 4Y19B 4LCIH 1KTBA 4JQVA 3PHQB 4ETQA 2R0ZH 5EO9A 3UAEA 2Q10A 1O5DT 2G4GA 4MHHI 1F11A 3N43F 4GI9A 5IQLA 4JDTL 4HISA 1FL6A 5MEND 2P48B 5INDA 5FYJU 5AWNH 1NLBH 4LVOC 4AITA 2J2ZA 4N20A 4GIOA 2ITCB 4F5CE 5FPIA 4N3TA 3QIWA 3G5XB 3QIBB 1BZ8A 4Y4KD 1KACB 4S2SA 5C0FA 5KYUA 2ERJC 4LSTL 4NN5B 1MCKA 1W72L 4KV5E 1XXDC 3FB6B 4MQXC 3BIBX 4C56E 4XCEA 3IJEB 3PF2A 4GP5B 3G6JE 3QNYA 4LXFA 4WU7B 1AGCB 3WIFB 4KZEH 2E6PA 3KXFB 5DRZA 5IW3A 5MEPA 1I9JH 3JWNC 3WXVL 3NCYS 1NCOA 2Y36H 3UERA 4NPKA 2AEQH 4TTDD 3FT3A 4YAQB 3X1FA 1F90H 1H6UA 2OL3H 1JMZA 1QP1A 3IK2A 3ZRCC 4WI3A 1D5MA 1F4YL 4JPKH 1AXTH 2ICEB 3P30L 1BPLB 3RFZC 1IIKA 3BDYH 2C1PB 4UQDA 3ULSA 5MENA 3OL2A 4FQPA 1NFDA 3RPIA 1JFQL 1C08B 3KLHC 2B20A 1BLNA 2D0HA 5DVMA 4JM4L 2OZ4H 3AU0A 2X6BA 2A77L 1JCVA 1W2KT 3AS2A 4X7SH 1BXVA 1SVCP 1QLEL 4BFIA 3DK0A 4Z7QE 3TZVD 2YC1B 1EZVX 1PAZA 2WOBA 3FCSA 5DWPA 1O7SA 1CXLA 2LVCA 5DJ6B 4ODXB 2A38A 2JWYA 1WISA 1DYZA 1ONQA 4M48H 3OKOA 4Y19D 2J3SA 2YKLH 3O9WC 1IC7H 2Y5TA 1GJIA 3OR6B 2HRPH 4KFMA 4OZGA 1KIRB 4ADJA 2F7OA 5B1JA 1UGKA 1D5ZA 4KKBD 2F58H 5C6TL 1JZ8A 3X12A 3L4TA 4LVNC 2WQXA 4UTBL 5DQ9A 3I3EA 4H1LH 2XWEA 1PSKH 2H2SD 4BFGA 5IHWA 3NQKA 1IQDB 4ZD3H 3QIBD 4ZPVB 5HYQB 3CE1A 1CGXA 5KJRH 4NX0A 2YGVA 1NMBL 3LQMA 4YXKL 4F2ME 1S7QB 4PD4K 3NCMA 1THCA 5T3ZH 1OTSC 4KQ4H 1A6PA 1UT9A 1P9MC 2UUDH 3NEOA 3KXFD 1ZJBA 4MLSA 4JPQA 3QVAA 5BOJA 3I50H 1XH1A 1MCWW 4XMZA 3QIUB 3WAJA 3QG6A 3TYFB 3BMWA 2VTFA 4LOUD 4EVNB 5J6GA 3QZBA 1JFHA 4PP1D 5E1AA 4A04A 4DGIL 1MCSA 2HH0H 4HH9B 4P4KA 2OI9B 2AJ3B 2IALA 4YPJA 5D5MB 1I8KA 4TVPH 4XWGH 1TTUA 3O6KL 3CX5K 1U2HA 3SHSA 4MS6A 1TCMA 3VRLE 4Q9RL 2ITCA 5ICYA 3DHPA 2PYFB 3G5XA 3QIBA 4RX4D 4XNZC 4BBWA 3D6GA 1I1AA 3WFCH 1PNCA 5JW4Q 1DZBA 1AAJA 3GBLA 4LPUA 5GGSA 2XIBA 1E5CA 4LLWB 3L3DB 4ZXBB 1KIUA 3RWEA 4O02A 2ITEA 3IJEA 2OXGB 4Q6KA 5K9KB 4WGVB 4S1DC 4G9FB 5C86A 1OW0A 1VESA 4O4YH 3Q2CA 2WVSA 5JDSB 4BUQA 5B7FA 2OK0L 1WBYB 3QULB 1U8JA 1U8KA 3HIZA 3SPVA 3T2LA 3VVWA 4Q74A 3QPQD 1GYVA 4J3TA 4FNPA 4UDUA 4LHUB 1M9WA 4Q9QL 3DIFA 4RGMB 3CN2A 1FSKC 3ZE2B 3VFWB 1INQB 3KDPB 1YJDC 3FTGA 3LEXB 3PGCB 4KKQA 2VQ1A 4WDIB 3DO4A 3UJJL 5FEBA 4HFUH 5B3SB 1U8OB 3QHFL 4RFOL 4DETA 4KY2A 4QRFA 4XMKL 4LDLB 5ILTH 2VDQH 1X4YA 4H8VA 2R7EB 2DV6A 1E27A 2ZONA 4K4KA 3RLSA 2VH5L 4XBPA 2WUBH 5EEWA 1HXYA 2Z4QB 3AREA 4HEPA 4FHBD 4NKDB 5H4ZA 1DLFH 1IZKA 3BYYA 4RMWA 2HRLA 4HIHB 4KRMB 3DGDA 4QTHA 5IFJB 2QKIA 5CCGE 1W0VA 3QIUD 1UM6H 3MR9B 4MKTA 1QOKA 4Z7OF 5AVZB 3RILA 5TDPA 4O58H 3DX9B 2D0GA 1UD8A 3DECA 3QZWB 3HLKA 4MLIA 2VJXA 1JYNA 1Y1DA 2Y06H 4WWOA 1E28B 4KZDH 1IFGA 4ODBD 1MVUA 4Y4FB 3NJGA 3KJ6L 4JLRA 2Z4TA 3ULVH 1DVTA 4C57C 43CAA 1CIDA 1UVQA 4M5YL 3PL6B 1MVFA 1F1DA 2BS71 1IQDA 3H7BB 3LH8A 3ML8A 4A6YH 4GSXA 1D5IL 3FQUA 4IKNA 1CE6A 5HYQA 3UJTH 2R1XB 3IETB 3VSTA 4PJ7F 3MLPA 2WY3B 4H25B 1A4JB 5FYLH 5A3ID 1S7QA 4DO5A 2QDWA 1NMAL 4ZXBD 1XVSA 4XB8A 4ONHB 3QUMH 4EZJA 5E8PB 2QVFB 2AEPL 3BN9C 1OGPA 2FWSA 3H7LA 1MLCA 1M56B 5L8JB 4GMTL 3L95B 3O2WH 5AYUH 3TBTA 4AGQA 2F19L 4RDQF 1LD9A 4G42B 4MXQC 3UYOD 1JWMA 1M4KA 4UIKH 4QGTA 1ORQA 3V5DA 2I07A 5DHVH 1NKGA 1MCJA 1NA8A 4Y5YB 3QJVB 4LHUD 1A3RH 2R1YB 2HVJB 4AGNA 1O6TA 1HJCA 4Q4EA 5ESQA 1MFUA 3DX1A 3QCTL 4IYKA 3TVMB 4WK0B 3N50A 3NJJA 5DZPA 3FU8A 4TSBL 4NNPH 2GBVA 3L3KB 3CK0L 4HLJA 1NMCB 2FECI 4N68A 4HUKB 1EGJL 3MJ7A 4MDIB 2W91A 5IOPB 1TKWA 4EN3D 3C60A 1DR9A 2Z6FA 4UILH 2WWMC 5C07B 3NSXA 3ZL2A 4LEOA 4EDXA 5BVPH 1J0IA 5K9KA 4FABH 3U4EA 2A74A 3WO4C 1UOLA 3GSNL 2DTMH 4JM2B 3P02A 4FFYL 2WYHA 3HC2A 2W65A 1DJWA 3HHMA 5JDSA 1WBYA 1MQKL 5DJYA 5CBAB 5IIEB 2AQ2A 1OARL 5FYKH 3DRTA 3SJVB 2Y2WA 3UPRA 1S6NA 4M1CC 1I8MA 4ODVL 1N0XL 1Q0YL 1T0NA 2FZ3B 1KXVC 2LU5A 2XXFA 2L4OA 3K0YA 3VFWA 2PW2B 4TNWK 1A7PH 1KMGA 1I9IH 1KNOA 1HXKA 3VXUE 1B6DA 4KY1L 4OM1H 5T5FA 3PL6D 3NCWA 2RA1A 3E1ZA 4P2CG 2FX7L 4KTEL 3T0EB 1UCTA 2G9KA 5AB1A 3QA3B 2P43B 2BSBA 4G5ZH 3ZVVA 3NFPA 1YMHB 1BQ5A 1AR1C 1JWUA 4EN3A 2ZUTA 1RJLB 3ORJA 4L3FA 4ZMYA 4KK5D 2WXPA 3BZFB 4WWPA 4NRYB 1KEMH 1U8MA 4HKXB 4CDHA 1IL1B 1HWGB 3VD9A 4AEHH 2W95A 5IROC 4WSKA 1OP3H 4D3CH 3ZN6A 5FM5O 5IJBC 4I9WE 4XN8A 4N0CC 4FYTA 2WLMA 4Y16A 4MSWB 5FR3A 1G1KA 4J3WA 1LHZA 2FT6A 3QJZA 3TFKC 3BUQA 4PJXA 2R8SH 5CEXB 5B7MA 1ICTA 1VZGA 4NSKB 1KZQA 5F89A 2OM5A 4HLZH 1CZ8H 3UYRL 3VE0A 4K9JA 3TVMD 4MAYC 3OD3A 3K4AA 4OIFA 5CGBA 5ITBH 1E4WL 1FYTB 2MTAA 2V5TA 1HIMH 1U6AL 1QACA 4HMEA 1OWRM 5CCHE 2LV4A 2XTJC 2HKAA 4LKXA 1B4LA 2CJTA 5EIIG 2E75C 5C07D 4O2CA 3FO0H 5JORA 5D1QD 4X6DF 4KAQL 3PGDB 4JM2D 4J3BA 3APMA 1DBAL 2O4EA 2G0KA 5EC2A 4G42A 3IPEA 1NDMA 1TTBA 3S8WA 5BZZA 3SJVD 4KJPC 3ZXAC 4UANA 3OKDB 2Q76B 3NCJL 4G7VL 4OCLC 1ZSDB 4Y5YA 1W6WA 5DHYB 2PKDA 4LDOB 4OCSL 3ABGA 1URIA 4C83B 4XAWL 1SM3L 2A9BA 5IV2B 3FYEB 4CC4C 4GG6A 3TVMA 1MREL 4YDLC 2BXZA 3T0ED 1E8XA 1WYJA 2PCYA 4D9LL 1NGYA 2UZXA 5DRWB 3OGOE 4YQXL 3DX8A 3TA3C 4DP0X 4B9ZA 5AW8B 1ADQH 2J8UF 1A6TB 2QVIA 5E5MB 5HGAB 5D1QA 1UH3A 4UOJA 1T21B 2GK0A 4X7DC 2X4QB 3EBGA 4H8UA 4XCNA 5AG8A 5B21A 4GO6B 1CLZL 1G7LA 4K3JH 5E00B 4PRDB 1WWAX 5ESVB 5HY9B 2H6OA 5JMRA 4KTGA 1HYRC 3HAEB 1MH5B 4M00A 1PQZA 2ZT9C 3PDDA 1J10A 4TUJB 4ODHH 4Z7OE 4XHQA 3EFOB 1OANA 1HL9A 4OCXL 5D6CB 2DD8H 2HFGL 1Z9MA 3G04B 2H6PB 4P2QA 3UG4A 1NAMA 1A6ZB 4XHJC 3T6WA 4ZFOL 1UZGA 1NBZB 3SGDH 1Z2KA 3MUGA 4JHVA 5CN2A 5IVZB 1FYTD 4G6AD 3T0EA 2NNAA 3OJDA 4J6IA 4ZMPA 4Z95L 2NY7H 4JVUA 3KZ8A 3GNML 3JWNG 3WKML 5JPMA 2XG4A 4X5RA 5F1KC 4LO9A 4PJ7E 1PLBA 3IMRA 5I73C 1E4XL 2H8PB 4ZO9A 4CVXA 1AZNA 1YNTB 3MCG1 3MI6A 3PP3H 2DM4A 1BAGA 1T6VN 1XD1A 5AOJA 1CFQB 5KN5A 5BUGA 1WFUA 3K72A 3SDAA 2YPLB 3ARFC 1A0QL 3CWGA 4YBQD 3GTVA 2V9QA 3SO3B 3PWJB 2DMHA 5I8KL 4NZUL 4XPHH 1RCYA 1K8DB 2XA8L 5K9OB 5GSVA 5D4QA 5GJSL 2HKHH 1IAIL 3B1TA 2MHAB 3IDXL 2ENQA 3QQ3B 3L9EA 4AZ8A 3TIEB 4H26A 1P5UC 2DICA 3UBXB 2Q5BA 3P3TA 4G8EB 5A6LA 5I6LA 4FRWA 5D70L 1UOWA 3LV3B 4KO7A 1IC1A 3BP7A 3WLWD 3QDJE 2GI0A 4ZZKA 4GUOA 1CT8A 2GJRA 3BAYA 4M8RA 4BSJA 3X1GA 4GAGH 4EMZA 2XNAA 2A9NH 2EIEA 5IVXA 3VVVA 1EK3A 1GOHA 2XJKA 2JMRA 2HWZH 2R9HD 3HCVB 4G80B 1U8IA 5E6YA 3HE7B 1BFTA 4DGYL 4ENZA 2I7OA 2SODB 2XQBL 4J23A 5F71A 3MNDA 4GT7A 4HS6B 3DGGB 4QRTB 3ZRSA 4A2FA 1BXUA 2MEJB 4JNXA 1X6LA 2IXQB