4QTFA

Structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
349
structure length
349
Chain Sequence
VPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords L,d-transpeptidase LdtB
publication title Structure and specificity of L-D-Transpeptidase from Mycobacterium tuberculosis and antibiotic resistance: Calcium binding promotes dimer formation
rcsb
source organism Mycobacterium tuberculosis
total genus 85
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4qtfA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qtfA02
5DC2A 4ZFQA 4JMXA 4GSRA 4QR7A 5LBGA 3VYOA 4GSQA 5E51A 3ZQDA 4GSUA 5DCCA 5DVPA 3U1QA 4QRBA 3TX4A 4LZHA 4QTFA 5DZJA 4JMNA 4XVOA 3ZG4A 3ZGPA 5DZPA 3VAEA 4A52A 4A1JA 4QRAA 5D7HA 4A1IA 4Z7AA 3TURA 3U1PA 2HKLA 5K69A 5LB1A 3VYPA 4A1KA 1Y7MA 4K73A 2MTZA 5DUJA 4HU2A 5DU7A 1ZATA 4LPQA 3VYNA 5E5LA 5E1IA 4HUCA 5E1GA
chains in the Genus database with same CATH superfamily
2QJDA 2F18A 5BZZA 3UG4A 2K4AA 4DGUA 1IE5A 4LVHB 4U6YB 4C56D 3U1QA 3I84A 2UXTA 2IH3B 3QUGA 5FCUH 4BD4A 3C2AH 1OWRM 1WH0A 2VAJA 5SX5K 3BVUA 5TQ0L 5E8NB 4AW7A 15C8L 3B5GA 2PCPA 3HPLB 1ZWIA 4AYBA 2BC4A 4D9QE 1S46A 4LIQH 1QLEB 5GGQH 3L6FA 5BZDB 3HI1B 5GRYA 3SJVE 3W11D 1JGLL 4E9QA 1QNZL 1JCKA 1UT1A 1WFOA 5D7SH 3RVUC 4HBCH 1ETZA 1JF6A 1LP9A 4G6KL 5CUSL 3LYRA 4Y4HC 3PGDB 3UTZB 4DETA 4O51B 1X7TA 5TJWK 1AD9B 1CXEA 1IGML 5DS8B 1SM3H 2HSIA 4QWWD 3KXFA 1J87A 4YGVB 3M1CA 4ZFFA 1KFAL 4PJAF 5IBLC 5INCA 1I3RB 3MRDB 1BZ8A 4O58H 2DB8A 4N25A 3VXRE 4ZMNA 1PQZB 1XSIA 2WBJB 4TQIA 5KYXA 2DTML 3CBRA 3F85A 3MLVH 3B2MA 4JFDB 5BPPA 1IQDA 1XZ0A 4JDVA 3CU7A 1CYXA 5EUKB 3GNMH 3QHZL 3UBFA 2L7EA 3KPMA 3FDWA 4MAUH 4IOIA 1GL4B 5IM7A 3BMWA 3BLBA 1Q94B 3K4DA 4YFLI 1N7ML 2ATKA 4QXTB 1RCYA 3NZUA 4JFQA 1F6FB 4JLRB 5HI5D 2Y06L 1KPRB 2BNRD 4EI5A 3IT8D 3HNTH 1UZ6E 3FSZA 5L2KE 2EIBA 4YMPA 1RUMH 4YHIA 4XMLL 4Z1PA 2BP0B 4U1JA 1NAKH 5CU5A 4AIZA 3APCA 3FK3A 3GMOA 3MU3A 4PJFB 1FZJA 3X14A 5J9PA 3QE5A 1R3JB 1IAII 1T83A 2F7OA 3WL9B 1EO5A 1FFTB 5B22A 4JFFD 1EMTL 5K39B 3RUGF 4AIXA 5T33H 1HNFA 4TNEA 1N8OE 2HWZH 3MBWB 3HRZC 5K9QI 1C8QA 3S5LB 4RMBA 2WLJA 4Q2ZA 3Q8BA 1I9JL 2R51A 4IRSD 4JPIB 1ZTXE 2XTSA 3ZDYE 4AG4L 4YSSA 3BKCL 5IHHA 3U7YL 4PY8I 4IEFA 4NQDD 3ILPB 1QSFD 3VFVB 4NC1E 4HUMB 1OF0A 3KYMB 5EBGA 2VSKB 3VWKB 4N90E 1XF3B 1OHZA 4NPYA 1JUFA 2X2HA 5SWSE 3DJZA 1FCCA 3TJPA 1PD0A 2JTYA 1MH5B 5D93B 2R1YA 3VB8A 3BW9A 4HHAB 3TP4A 3A4DA 1FZMB 4OAWA 5DRNB 2VZSA 3DETC 5L0QC 5DTFA 4UYPA 2NT0A 4ZS6D 2PF6A 4MQ7B 3IMRA 2F7RA 5D2LF 1PY4A 2V9UA 5A6IA 2CDGB 1BVOA 1HI6A 2XZCH 2QQNL 5HVWA 3CTTA 2I26N 2MNWA 3B9KB 3I6KA 4PG2C 4KVNH 2OJEB 5TH2B 1C5BH 1JNNH 1SJEB 3KWXA 1FSKC 3SDDD 2AMGA 5CJXA 4J3VA 2YUZA 2Y4SA 2BY2A 2B4CL 3ECBB 4RGMC 3FU8A 5H37H 9CGTA 5LKNA 3CZFA 1JPSH 1G7MA 2B2XL 1W0VA 3S98A 1YEFL 4LP4A 4EOWH 2XKUA 3Q8AA 3NFSL 2L3BA 5ALBL 2YGQA 3BKMH 2GCYA 1DVZA 5K69A 2FD6L 4PRPA 2X42A 1CN4A 1HCYA 3MJWA 5B3JE 1FC2D 3P0YH 1EAPA 5J11C 3K5SA 5F9OH 1FBIH 3VD5A 1NEPA 5A2CA 1BLNB 1BZDA 4POZC 4NN7C 4P59L 5D71H 2Z93A 2M8XA 4LOVA 4MMYA 3L81A 4AGLA 2E27L 2QL1A 4QRFA 4MNGB 2R4SH 4A04A 1YA5A 4XOEA 3QEHB 5LCVA 1TENA 1TKWA 1K6QL 2WWKT 4PV8A 5AOKA 4Y5YC 3BPOC 2XHNA 4U1HB 1NC2B 3HS0B 2G0KA 4B50A 4FQXB 5FK9B 3DBSA 4HIJB 1RZJL 4WNJA 2AQ1A 4U1GB 3V9FA 3ZHLA 2D0GA 5B38G 5I15L 4IOSA 1Y1UA 1I7TA 3M8OL 4PS8A 2VXQA 3Q6GL 1MIMH 2X4TA 4N8CL 1G7JA 1NANH 1H5BA 4WW2B 1DHKA 2W0FB 1IB5A 2ZCLH 5I9QB 4OIIL 5AL8A 1AACA 3I85A 4FG6C 1I9RH 3EFOB 5HHOA 3U46A 3IJSA 1WWCA 2RHEA 3NIGF 3SKOA 3BN3B 4K55A 4QJ4B 4I3SL 4CGTA 1DUZA 2BS71 4PJDF 4Y16D 5IIEA 1PJ9A 3SY0B 4X99B 1X6LA 4J12A 1UWXK 4N24A 4MB5A 3TV8A 3EYFA 4P2OB 1KT2B 2QDWA 2GAZB 2SODB 5GGRB 3X3GL 3UZVB 2A74C 3QNYB 3L5WA 1RZJC 4GS7B 2ED6A 3SGJA 1OE2A 4Y0GA 1D7CA 1D5IL 4XVUD 1HEZB 1GIGL 1JV5A 1QZ1A 2WAQA 1TMQA 1S9YB 4NQTA 2HTKC 4WO0A 2BSEA 3SPJA 2DWDB 4NQSA 2E7MA 2VR7A 3DIFB 4FYSA 3ZXAC 1NWPA 3HG1D 3GRWL 2YSSA 1EAQA 1KTJA 3N2JA 3UJJH 3UMNA 4YL4A 3BZDA 5F7EH 2HX8A 3DLQR 4KBPA 4N2OA 3CZSA 4L9LA 3DX9B 4UB0L 4H7VA 3WCYA 4NNXB 2DQGH 3TH3T 4KX7A 3TTSA 1CGWA 4FZ8L 1DUYB 1M71A 3WEXA 5DZOA 3RX7A 2C9UA 2EE9A 4L4JA 3EHBC 3SD2A 3ARVA 4X6BB 2NUPA 1JPTH 1AMYA 1R6VA 2YEZA 3IBEA 3NP3A 1WFJA 3B37A 4I5BA 1FYTB 3JSSA 2G0LA 2NNAB 1UA6H 2GSIA 3UYPB 1C5DA 1KGIA 1Y6MR 4P07A 2F5BH 4PJ7E 4BHUI 3LH9A 1C08B 1KJ2A 2IDUA 4YXHH 1OQOA 3D06A 4MD4B 2OZ4H 3TT1L 4FQQB 3B2VH 3S36L 4JM0A 2E4FA 2EEBA 3QNZA 5H35A 1PSKH 5I28A 4HIXL 1DO6A 2DM4A 2V2XB 1N6UA 1BQKA 4CSPA 4ETQB 1YY8B 3MCLH 4ODXA 2GJJA 4KJQC 1GA2A 4LSQH 2IBBA 4LASL 1J0KA 4B9IA 2EH7L 4FJ6A 1YYLL 4PS4H 1YEDB 3ARGD 3ZZQA 1G7HA 4KOBA 4YOKA 3DMMB 3UTTD 3PXLA 2A9ML 2KPWA 2XN9B 5KVEL 4L8SA 3SYCA 2P5WE 1CF1A 2XICA 3RWDB 2EJ1A 1TO4A 2X4SA 2K7PA 3UGXA 5DMGC 2K3HA 3RG1C 1BGXL 1UQSA 1F42A 5LQBL 2Y23A 5A6LA 3E3QC 3TXAA 4QTIL 4HKJB 3QRLA 3TLRA 3RGVD 5DGRA 1BQHG 1U42A 2P80A 5IV2B 1UOVA 2IC2A 4AVKA 3FB6B 6TAAA 4O2FB 5IQOA 2ZKHH 4QF1B 4EO5A 5CCGE 1AO7B 1DVFB 1M2VA 4PUBL 4FCHA 2UUDK 4Y5XA 1FFRA 2YD3A 4L4TE 2AQ2A 2ZCHL 2VQ1A 4CVZA 4L0ZA 3VXOA 4G8GA 1SQ2N 2OYPA 2K8MA 4OCWH 3GSUA 2WD0A 1G1OA 2P7TA 1OW0A 1P4LB 3BXNA 1KXVC 3L2MA 1UKTA 3T0AA 1IKNC 2R9HC 1D5XB 3KDMB 5GGSA 3VRIB 3WUWB 3HI6H 4LEOA 3UZEC 4BHUA 4R2GB 5IT2H 3NJKA 4LHUD 4KNSA 5E7FA 1WBZB 2WIIB 4HV8B 2HT2D 3FN0L 5AVYB 3C08H 4BFEA 1INEL 3I75B 1OAYH 2NDGA 3P77A 3EUUA 1IC5L 5J1AB 2J73A 3DBXB 3MJ9L 4LCYB 4FXKC 3G3LA 1K5WA 3D2UB 1NCBH 2L0DA 4A6YA 3TESA 5BS0B 1CDUA 3QUML 5KSBA 1OAZH 2K7QA 1DQDL 2VDQH 4KX8A 1ZDQA 2QKSA 4TQEH 2BHYA 3WFCL 4QXVA 1RKRA 4ONOA 3MLXL 5AG8A 1YMME 4GG8A 2Q10A 3EGSB 1RJZA 3F7QA 2EKJA 4BH7A 4FXGC 4OZIA 4HETA 4N9OB 3MFFB 3QJZA 1DBBH 4OKVA 3QDME 3GSXB 4HT1H 3QUKA 3CJJA 4OZGF 4WFED 1AR1C 1TU2A 1X6NA 3IB4A 4UI2A 5JPMA 2GABA 5B8CC 4NWTH 3L3IB 1R75A 3FYIB 1BSIA 1JHTB 1PZBA 4GRMB 4JRYE 4V1DD 3ZDZB 4U7KA 1WF5A 1MRDH 4M8QB 3FUNA 4OJEH 1KCUH 3MR9B 1SXAA 2IPKA 4MDIA 4QI3A 5CFHA 3LXBA 4URKA 4KRMB 2EDHA 2VR5A 1TJGH 4JY5H 1FIGL 1UWEL 3GI9H 5GPRA 4Z76A 1NCCH 2PPAA 4XNBA 5I73B 1NCWL 1HWGB 1WFTA 2R29L 5A1AA 5I1DB 4PCKA 5D7JA 4EMZA 3SBRA 3FFOA 2ARJQ 1BQHB 5EDXA 3OPUA 4YXKH 4LRIC 4RFOH 4QPEA 5I5RA 2DTSA 4Y9GA 1RMFH 3MKGA 2IXQB 4PH8A 3MXWL 5HDQH 1DP0A 2V2TA 3N0PB 2BX5A 2AGJL 4OCXH 2XQYK 4Q6KA 3V10A 4TKWA 5IHUL 4UV4H 4XZ4A 3O2WL 3PWNB 1JHLH 4FRWA 4MZIA 3AS1A 4X8CA 3IFLL 4Y2DC 4R4BB 4MXWL 1T4KA 3QR0A 4HJUA 2QLVB 3C6SA 1BF5A 2FJHB 1TTUA 4Z7WF 1QSZA 3KNBB 1PYWA 3VFOA 2MKWA 1N0XL 4F2MB 2JMRA 5BQ7A 3WTTA 3TU6A 4XPAL 32C2A 5E6SB 5FWQA 3VXUD 1ACXA 1VFOA 3AGWA 1DFXA 1E65A 5DJ6A 3QQDA 5EFIA 5AFAA 4PJDE 2DQMA 3HMXH 3QUXB 2XG5A 2BJML 4LLYB 5DJXA 1EEZB 3CHRA 4YWGH 2A4EA 1NDMA 2A1WL 5IB4A 1J9RA 3SODB 3P73A 4GRWH 1I8IA 3DV6A 5AW6B 3UROR 1T1ZB 3O81A 2JCCA 5I17B 4BK5A 1E4XH 2O61B 2J8OA 2JI3A 3A4FA 3W56A 3A67L 4QTFA 2ZF8A 5FOJA 4HWUA 3BD3A 1XZWA 4J3XA 5EU4B 3ZE1F 2L7JA 4K94H 4NZUH 3ME0B 3L9YA 1F97A 2XBTA 1KG0A 3N3EA 4CVXA 1GRWA 3NFNB 1GZQB 4NYLB 3D18B 4E41E 3S0PA 2AV1B 4X5PA 3APNA 3V6FA 4OZ4B 1XGTB 1D6EA 3B3BA 3GS7A 4OZFG 2FYYA 4Y2OB 5BRZE 4PJ8C 1RIUL 2EUXA 1KYUA 2WBJD 3GMPA 4G7YL 4KV5F 4N0RA 3SDXA 3NTCH 3MUY1 4JFDD 5KSUA 1ET5A 4AXWB 1A4CA 4DPAX 2CHWA 3L13A 1QP1A 4JDTL 3I6SA 4ODTH 4XTRC 4Y4FC 1CK0H 4OQTA 2ZWSA 5ENWA 3RE0A 1B3IA 1WC7B 2NY6D 1JWSA 3A6CH 2FQFA 3QG6A 2WTRA 1KYAA 5CEYA 2XKSA 2CHZA 4PRIE 1OANA 2R59A 3RKPA 4DP1X 5CF3A 3VD0A 1EHLH 3CIAA 5FW7A 3CLFH 5FWRA 4M93C 1KV7A 3QCTL 2B1HH 5EORL 2H2PC 5INDB 1A6WH 2UZYA 2VXVH 3RX8A 3QFJB 1IKFL 3AREC 5C0RH 5LHDA 3HS9A 1QUNB 1ZRUA 3FOLB 3RWHB 3PJSB 1U21A 1SOXA 1FGVH 1O6VA 2J8HA 5ABZA 3ZYIA 1CCZA 1RJLB 1HAWA 1TCRB 4JPQA 1YUHA 1DZBA 3MLUL 2P24A 3ZE0F 1AZCA 3MJGX 5F6IB 4JRXE 2J3SA 3FB8A 2N56A 1EJOH 1CD0A 5E8EA 2B5IC 5ICUA 3NQIA 1MWAL 4D0DA 4B53A 4DGWC 3DX0A 3JUYA 3N06B 4LQFH 3D0VB 4OJAA 5LGHH 4LHJB 3WHE1 3L3OC 3MRIA 4M7ZB 1JHKH 5DRXA 1I7ZB 3T0VA 3WKQA 2DD8H 5F0MB 4K3HA 4CMHB 4PJAA 4HLEA 3M1OA 3V6OA 1BF8A 3JVGC 5E7BA 5K59E 4LU5L 3VWKD 1Z7JA 4ZTOH 5BO1L 2FX8L 4IGBB 4BZ2H 4FFWC 1OPGL 2EXYD 5JPNC 4Q58C 3IN0A 5E5MB 3P3TA 1YEEL 4IOFC 3L9BA 3ZRSA 2OMXB 4N2AA 4GW5B 3VJ6B 1R9FA 1MOEA 4HWBL 1K2DB 3DUUA 5GSRA 4X9GA 3CHPA 2FO4B 1Q38A 5IGXH 3QSKB 1RP8A 2YN3A 2O6DA 2QPFA 3HZVA 4CN6A 3B3IA 1TG8A 1G7LA 4M6OH 1R5WA 3B9KD 2NY2C 4P5SA 4ZX6A 3TC9A 1H6EA 1CQYA 5BCAA 2KS0A 1MHPL 4G7RB 4PJEF 4XNMA 4NC0B 1EEYA 2DQJH 1MI5B 2HLAA 3UPRB 3D30A 2FGZA 3PWPA 4W9KC 4F91B 3U7WH 3WYRA 1AC6A 2O5YL 3VFSA 3GRGA 5CGMA 2UYLA 2IANB 5LB1A 1RHFA 4Z7IA 5D1XD 4RMRA 5DJ2A 4GUOA 3OZKA 3O45A 2AQRA 3CSPA 3VFGL 3RL2B 4C4BA 1HVXA 1BDYA 2WMPB 4F92B 2H47C 1ZSDA 4TPRH 4K7PH 3UYRL 1TFHA 4O00A 2H26A 1PZSA 1DJZA 4AUYA 1N6QH 3P3RA 2PXYA 4J23A 3UH8A 4PEEA 4QTHB 5AQ0A 5JQIB 1KYOJ 1H3XA 4OZGE 4H20L 3NSJA 2M26A 5D5MB 1DE4B 1NCUA 4YXLH 4LB8A 1BOYA 1WPCA 4GO8A 4XP5H 1NC2D 3OHMB 4DKFH 4IMKA 3KGTA 5HHVH 1UM5L 3HA0A 5T3XH 2EIZA 2YAFA 4FQXD 4Z7QF 4Z0BL 3X3FH 2ID5A 4PJGA 1XFPA 2C1OA 1NL0H 5DD3H 4X5XA 5D7LA 3TTYA 2VLMD 3BVNA 1UZ8A 4M4RB 5C0IB 2VDRH 3BP6B 3BPCB 4ZUVB 3FQRA 4Z0XA 1KOAA 5D2LA 5HVFB 4IRJA 2ILLA 2PO6A 3CBKB 2HJKB 4Q9BA 5IB1B 2YLHA 5T5NG 1T1XA 3G5VA 4PP1D 4HJJH 4XCEA 2O1AA 5FUCC 4K73A 4TUUA 3HCVA 3KR3L 2NX5B 3Q13A 1ZCRA 3POCA 3QZWA 1P5UB 4ISVA 4F7MA 3TASA 4UQCA 2BK8A 5AZ2H 2A6KA 2F8IA 3O4LB 2WZPD 3EIFA 3RZWA 1JRHH 3LZOA 4NERA 4FTVB 5IVZB 3D33A 3SO5A 3ULSB 1ODAA 2XBZA 2JK5B 3CFJA 1JXJA 2DKUA 2D31A 4P2OD 4LLVB 2EKSB 4J3OH 1K8DB 3G6JF 3MACL 4WUUB 2FUQA 1PU0A 3VI3F 1KIRA 1RZ7L 2E76C 3VD1A 4J5VA 4G3YH 2OI9C 3QHFH 1SN2A 4A7VA 1ACYH 2BSSA 5DMYA 3DX7A 3P4LA 2AXWA 4FADA 4GSXA 3RWEB 4GRWB 1A02N 3F7YB 4CC4A 5ISZA 4H1LG 4QGTA 5A2IH 3K71A 4AZUA 4ZMAT 3TBVA 4G9FA 2VMJA 4UTBA 5IFJB 1JPGA 2KKQA 3DECA 1UVQB 2HB0A 3DURB 3WNPA 1Q9OA 4DN3H 4OY9A 2YMOA 4ABUA 2Y3NA 1HH6B 3NAAH 4X0KB 3MMEB 4ZNCD 1W72L 2CA3A 4BEIA 2CHNA 1YPZE 2ZXWB 2YOAA 3KJ4B 4NAQA 3FPXA 4K7PX 5DVOA 3I9PA 3IDNB 4ADGA 3OLIA 4NX0A 4MZRA 1RPKA 4MMZC 1J7VR 2ZPKH 5CD5D 2NY4C 3CXFA 3IKCA 1FYTD 3P4OB 1JIBA 3AROA 3WN6A 2QSTA 5F88B 3RKDC 3IVKA 1A4JB 2GHZA 1BVKB 4R7NA 2VT0A 4ABQA 4N8VB 1DANT 4H8PA 4QWWC 3QBTB 3HAEG 3S3CB 1MFAL 4F7TB 2Q86A 5JLZA 5LVEA 5CJXC 4LLQB 1N3NA 1VEOA 3TEXA 1N18A 2N0MA 3RVXD 1CVSC 1Y6NR 5BUGA 5T1DH 3QFGA 3M7FB 3R0NA 5T1MB 4NRXB 4XMTA 1DLHA 1K8IB 1X7QA 3QC6X 3KHQA 2GT9A 5I16B 5ICYA 1AIFA 5GGUB 4QYAA 1FE8L 1WBYB 4LVOB 4U6HB 3T0WA 1GS6X 1T6VN 3G5YA 4P4RA 2Z31C 2CXKA 2G30A 3DMMD 4HJSA 5I19H 2XN9D 1ITCA 5C07A 1NAMH 1TVHA 3EDFA 5DUPL 4GG6E 2H1PH 2JE8A 3QO1A 4MLIA 3LRSA 1CS6A 3KH3A 3LQAH 4X6CE 3WN5B 1C5CL 3JWNG 3Q44A 3BVVA 4GQQA 4OFYD 2WZAA 1MFEH 5FF6A 1Y18B 1W2KT 4XP9L 5FUOH 1AO7D 1DVFD 3MRRA 1FO0H 5KZCD 4D2NA 2J6EL 3F58L 3VYOA 2N7BA 3VFWA 2J20A 3WTXA 5AZEH 5A16B 2FIRT 4AQ1B 3ZE0E 4TL5A 4H2AA 2P45B 2OCJA 1E3ZA 1KXTB 4JZNB 1QI5A 2YD5A 5FYJU 1EH9A 3MTXA 1PDKA 2DBLH 2E86A 5LDUA 3DI2B 1MFMA 3B5HA 1U41A 3IDXH 5IQLA 2EDKA 2XWXA 3WKMH 1U3HA 4MX7A 4X6DA 2YGVA 3VXME 2HJLB 4R2GD 1MCRA 4LPCA 5GRUL 3MREA 2VN3A 1DN2A 4LNRA 4Z3IA 4FULA 2O72A 1XH1A 2CUIA 2DAVA 3VGHA 3F05A 3QCUL 2VDMH 3L9EA 1FZOA 3JV4B 3D2UD 4JFYA 4BUQA 4KAQL 1U33A 2NY1B 5D2NB 5BS0D 2Q9OA 1UB5A 5EC1B 3H0TB 3FONA 5LXGL 2KYIA 2W0PA 5C6WH 4AYDC 5JHLH 4UINH 3SGJC 4D3CL 2YPVL 5GZNC 4IS6B 1N5AA 3EJCA 4FI7A 4NUGL 4PJEE 2CK0L 5D1QB 2ISDA 2OQJA 4GAJL 4WI5A 1RJYA 4PJCB 1S9XB 4WSGA 1KDJA 3BJLA 3KBHE 4RA0C 1XCTA 2XSKA 1A64A 1ET8A 2IAMA 3LN9A 4L9LC 2A77L 5H2BA 3UAJD 4GIPD 4YHNB 3GI8L 4XVSH 4HWZB 1CFVL 3B7SA 5MHSD 5E2WL 2VISB 4H8QA 1P6FA 2CKBA 2ENSA 4P5MB 3CD4A 2DQEH 4FNPA 4OBRA 2VZTA 5IMKB 4CMMA 3WFDL 1A0QH 4DEWA 4U3CA 3JV0A 1V55B 3HBPA 3MO1B 4ZUWB 4BFIB 1MJ7H 1LO0L 1NH6A 2W60A 3L7EB 2CGRL 3LVEA 1OOAA 4DFHA 3T2NL 3K6OA 1H3PL 5KVGH 3ZKMD 4Y4KB 3WENA 1EHAA 1CDGA 1BJMA 3WKYA 1PG7W 1Z32X 1MJJA 4WWOA 4NFDA 4L5FH 1A3LL 3CG8A 2W95A 3V4VA 4UT9H 3P4NB 3D4YA 4ZNEA 1ZE3C 4I1NB 4U1LB 5HGDB 4M7KL 2QLYA 2I07B 2QADB 2ZAHA 3VI4B 3ASWA 2Q7YB 5K1NA 1EANA 2QELA 4AYFB 5L4JA 5C0BE 3GB7A 2AK4B 1XSOA 1FL3B 2E7DA 2FECL 3U9WA 3RWGB 1GHFH 4NQXA 4NP4L 4AGMA 2NLJB 3GSNL 2WHVA 4MQSB 4PGDB 4EDWL 1S7UB 3FTGB 1GSMA 3NIDB 4WEMB 4K7FA 4ZXBD 1BM7A 2FHFA 5EH1A 5FA3A 5E9DE 4M61A 5BVJB 4NENA 2X4UB 4DVRL 5AAMA 1OCZB 3CDGB 4BSJA 3MCYA 2Z8WC 3KL5A 3GKZA 3QUXD 4ZO8A 4FZEH 5C0JA 3KPTA 4TUOA 5C0EB 1YMHA 2WV3A 1WFMA 3T2PA 1E5ZA 3FRPA 1EEQA 2YPLE 2PPEA 1X9RA 4P23B 2WQWA 1QO3A 1EO7A 2X0WA 4L3EA 1MVYA 4ZW7A 4HYTB 4JZOB 5IOPB 2IBGA 2FEEL 4LLUB 4LSSH 3WUZA 3CFEB 1JYWA 5JUEL 3MLSH 2J25A 3NABH 3Q05A 4P0DA 5GRVK 2V0AA 1OW0C 5TFSH 3NK4A 4JFXB 5JNYB 1EXHA 4FXTA 2CO1A 1ND0B 1WITA 2WJ7A 5MENA 5I1IL 2IOIA 1VZGA 2O5XH 4P2AA 1YDPA 4OJCA 1KCLA 4MD5B 3FQWB 1JZIA 2QPDB 4GAFB 5CINH 1KLGB 2NXYC 4CC0A 3KGSA 3OQRA 1CU4L 2WKOF 1WTGT 4JO2H 1RULL 4L1HA 5C09B 3ZHKA 1B6UA 3UG3A 2A6JA 4U1NA 3ULUC 1CC3A 1PAMA 4UIKL 5FUCE 5AWNH 3WV0A 3AQXA 1MAJA 4ZYKA 1EGJL 4A7SA 2CO7A 2XQBH 5EOQH 5SX4H 5L9DL 4BH8B 2UZXA 5HHNA 4M7LL 3PHAA 5DMKB 4Z7WA 5F3BB 2K70A 4QT5B 3T0EB 5GIRB 5TTRA 4PG9A 5D7IB 2HXAA 3MV7B 3ZIYA 2A6DB 1ZVNA 5T5FA 4FTDA 2G2PA 1YCSA 1NFDF 2F54B 4P4KB 2K3TA 3CXDL 4N9GB 1GS7A 3GINA 1LNUB 3BAWA 5SWZE 4LSRL 4PIBA 3UO1H 3QFJD 2MMXA 2GJ6A 1HOCA 1I7UA 1AGCB 2R0KH 4NQQA 3TBTB 3CFQA 5T8IA 4DQOL 3MJ9A 5LWYH 3ARGC 5F89A 1DR9A 1ULVA 1N10A 3VQLA 4NIKB 5HYJD 3CSFA 3EO0A 3ESUF 1JDAA 5CU9A 3N44B 4F80A 4HPYL 4NO3A 4D9LL 2FO1A 4ODUA 2Q76B 1Q0XH 1WCBA 4Y1AA 5D7KD 2ED7A 4XP6L 2ZOKB 2JB6A 4Q9QH 5D7JC 4XOCA 3WO4C 1BIHA 3FTSA 3QIWC 1QBMH 5HHXL 3MLRL 2YXFA 3LQZA 2VO5A 3Q8EA 4JQIA 2VSDA 4ZQKA 2MHAB 3O6KH 2V33A 3IMTA 2EP6A 3UPAA 2E3VA 5DD1H 2J44A 1FNSH 4I0CC 5EUOF 1WBXA 4IGBD 3KW8A 1G9ML 1R5VB 4W70A 2VQUA 5F1SA 4B9KC 4ENEC 3S37H 4U6XA 4LNVA 3KPRA 3GEFA 3GMQA 2X4OA 3SDAA 3W38A 2ZIDA 1KBGH 3JV6A 3K4AA 5I1CL 3RNQA 1CD1A 3TF7C 3UJIH 3QIUA 4N8UA 3RTQA 3X1NA 1VZIA 3PWVB 3MLPA 4UQ3B 5E8PB 3HVDA 5AAWC 3LZLA 2BOBB 1E7VA 1OGTA 2VDMB 3QUZC 1PX4A 4MNQE 4U0RC 2DQFA 1RU9L 2BSRB 3GMNB 1TJXA 4N20A 3BQUB 3CHXA 1TETL 4Q74A 4ZS7L 2XJLA 2H8PA 4PJIE 1MI5D 1KTCA 1U2CA 3O2DL 1ASQA 2VNCA 1QA9B 1DL7L 2OXGA 1WFNA 1BVNT 3FQYA 2AJVL 2YRZA 3QDJE 2IAND 1BZ7A 4U1SA 4KITB 4TV3A 3F62A 2AJZA 3TEUA 1L0XA 2LHAA 4M5ZH 5GGTH 4BE5A 4H5SA 3X11A 1QPPA 2JQZA 5ICZA 2BNRE 3WNNA 1QR1A 3BUIA 3MLZH 1XV8A 1X5LA 4F7EB 5JW3H 2V5RA 4NJAL 1A2YA 3GSRA 1EXGA 2VAAB 5D70L 1V7ML 5E1QA 4GIAA 4NFCA 2HRPL 4GKZB 4PV1C 1AHWB 1SLUA 5G5DA 4ODHH 4JFFE 1CL7L 1E2ZA 2APXA 2X2JA 4GOSA 2OMUA 3CDYA 3OKYA 3QEGL 5ECGA 2A9BA 4M03A 1QHOA 2YC1A 3PP4H 1A21A 1XX9C 3BWUF 4MRCA 4O2CA 4ZPTB 4NQDE 3HKFA 1MCQA 4GAGH 1GPOL 1QSFE 2WNKA 1QI4A 3MA9L 5DS2A 3RBGA 4RAUB 2HKHL 4FCAA 3ABLB 5I1HH 1E27A 5E1IA 3L3JB 3GHEL 2QPUA 3VD3A 3GS4A 4EE2A 4JR9L 4JM4H 3FTUA 3IFPA 3WY2A 2Q6WB 2QV4A 3DUSA 2EH8H 1HC1A 2NX5D 4G5ZL 4N1EA 4X5WB 2JTDA 1GJUA 3GSWA 3ZTCC 3HC0A 2F19H 2HFEB 2HP4A 4W9FC 4GXUN 1PD6A 1SY6H 1XQ4A 3O4LD 4AV5A 1N26A 2EDEA 3ZDXB 5L8KB 3EJJX 2BSCA 4FL4B 5D6CA 5DD0H 2C3VA 1QRNE 2ED9A 4ADJA 3BWAB 3TO2A 4K9EC 2P5EA 3VYPA 1OD9A 2WANA 3SQBA 4NJ9L 1R47A 2VDPH 1DVUA 1FFOA 5ITBL 4WUUD 1Y07A 3QYMA 4C58B 4YE0A 2JKTM 2EEAA 1JERA 4HUWB 2B1AH 3LKPB 4X5LA 2XI9A 4PD4K 1XGQA 2YAPA 2ZP9A 3OJVC 4ELMB 2ORBH 4DGYL 3OJ2C 4N5ED 3G6AB 3KYNB 4OZFA 5IROC 4MXVF 4C47A 3U1SL 2JJSC 4JQXC 3THMH 4LESA 3AG2B 3ATDA 4APXB 3U2SB 1OTUD 2CO6B 3S9DB 4R90L 4HKXB 5E08H 3WIIH 4P5KB 5B7FA 4YUEH 1UJ3C 1KPUA 4TXVB 4JX0A 5EA0L 2H32A 4Z7VE 2V37A 4C8XA 3L1EA 4RMUA 3OL2A 3ETBF 1KB5B 1GS8A 5CP3A 3P4MB 3ECUA 2PYEB 5FYJL 5KYWB 4MJHA 4NNYA 5I6XC 1ZXQA 1AOZA 2CIIA 4Z7AA 4WSJA 4KC3B 1PIFA 3AUVA 4YAQA 4FQ1H 4HUXB 1Z0NA 1ILSA 4FQHB 3GBNH 2VM9A 4AENA 3II1A 3CZLA 2YK1H 1H8SA 1MCJA 3ES6B 3LKRA 5CLXA 1T1WB 4O2EA 3UBHA 1BLIA 4KQ3L 1NGYB 2P49B 3O41B 4HFWA 4BDVB 1J05A 3T77A 3UADA 4OLZH 1W8NA 5GGRY 3MKKA 3TVMA 3UZQB 1E3FA 4MS8C 1R5IA 4JHUA 2AJSH 2BP8A 4R4NC 3TNMA 2NY6C 3KPSA 3G6JA 1OAUH 1XH2A 4KHXL 2XZQH 3GK8H 4LGSB 4M7JH 4OJFL 1EA9C 2BZDA 3D0AA 5JIQA 2GK0B 2PXYC 3B1TA 3SBQA 3BSZA 5CBAB 2ZAGA 3OXSB 4E9RA 4EUPG 5TDPA 2X09A 1W9XA 2PETA 1EZSA 1NFDE 5IB5B 1KGCD 4TTGA 3MV8B 3EDKA 3STZB 3QG7L 1BQLL 1YECH 1RERA 4IMKC 3LB6D 4QRSA 4RX4D 4YNYA 5DYOA 1SRDA 1HEHC 3QK0A 2DJMA 2XA8L 4LLDA 5DEGB 4Y88A 3DA0A 2EXSA 3RJDA 2AJXH 2IQ9H 1JZ5A 3DYPA 5T1KB 4I77L 4RSYA 4ZW3A 4YN3A 4JFZH 4G7VH 1KTDA 2K9UA 4HIPA 5IESL 1WT5A 4YHKH 1SEQH 4IRJC 3GMRA 3U0PB 3F00A 1T1YB 1PKQA 5LO7A 4OCYH 1HAUA 2WPGA 3DPBB 1ZVSA 2R7EA 1NPJA 2FX9H 3ULUE 4M6NH 1DQQB 3TOPA 2X2UA 4L8DB 1BW8A 4I4WB 5KSBE 2PCFA 2CIKA 5LUMA 4IU3A 4NQCA 5EUOE 1RZFH 4FFVC 3MXVL 1S5HA 5ANME 2BVYA 2DMKA 1EAJA 2JXMB 2D7MA 5DUBA 1OCCB 1AD0B 2XPYA 5EBWA 5DJAB 5EWIH 3VXNA 2YUWA 1HHIB 4HUVA 2JKRM 1K85A 3BAYA 1A6VH 4R7DB 3E6HB 3O0LA 4ZMZA 2F58H 2NY1D 3IAPA 4IRZL 1S7WA 1S8DA 3N5AA 4KVCL 4ZOCA 5AL0A 1OP5H 1UWFA 4C56A 5BVPH 1GGUA 1FV1B 4GFXA 3TZVA 2PP8A 3MA7B 4NRZA 4B6ZA 5C0DA 4G6ML 1AGEA 2WINB 4PJFF 3QR2A 4CC4C 4NKOA 1UUSA 3AXLA 2CBMA 2NNCA 3MV11 5D1QD 4XB7A 4DEPC 2Y36L 2OXHB 2XG4B 4NP9A 4A63A 1FJ1B 5I8CA 1IC4L 25C8H 1I1YA 3BO8B 1YAIA 4GP5B 3LPGA 3BSHA 3UBXI 5D1XC 1Y0LB 4G8EA 4QKTA 1AVAA 4C4UA 3G5XA 1BCIA 5DA4A 1GSKA 5DC9B 4QYOA 3KYKL 4JUTA 5I30L 3WU1A 1CFBA 1KN2H 2VITA 2ZKMX 2IALB 4B9GA 2EZ0C 2OMBA 4OIFA 2WYIA 5KSAB 4ICWA 4M62H 1TZGH 2B3IA 5EU3B 2CBQA 3E6FB 5GRZA 1NCHA 2V5YA 2Z4QA 5T3XD 3FO0L 5JO5A 2D0HA 3IDJB 3RIFK 3AB0B 2K9FB 5ID0B 4A2GA 4TVUA 4Y4KD 3TFKD 1XGYL 3ARBA 3KWWA 3NP4A 2V2WB 5D1ZI 3CHOA 1X5MA 3G08B 3IDGB 1LK3H 5JMRA 1NEZG 1FWXA 1HH9A 1VFAA 1YNLL 4QAWA 1M56B 2LQRA 4RMSA 2CBTA 1TNNA 2X6MA 1ZA6B 1YNTB 2PPCA 3TA3C 3MRMA 4RDBA 3LH2H 3RWJB 5EBMA 3FU7B 1JGUL 1FH5L 1QPXA 2BSDA 2JFCA 1AGFB 3HZKB 3I6GA 3NUKA 3H9HA 3DX4A 3SOBL 3LPFA 4M1DH 1E5YA 2X9ZA 2AK4D 4DK5A 5E8OB 1N4XL 3O6FC 1KPVB 2IH1A 3VW3L 3QB7C 5EO9A 4P5RA 2WQVA 5TE6H 2G4GA 3L1OL 3EAKA 4KROB 3CFUA 5ALCL 1U91B 1QVOB 1WAAF 1JZDC 2V9QA 1NGWB 5EZLA 1MELA 3SGKA 2Y2WA 1FN4B 2BSTB 2NOYA 5IHZB 2ZAIA 1MZYA 4BUGA 5L7XL 3HZMA 3OB8A 3IJYA 3K6IA 1L9TA 3UBXA 4PR5A 3GBMH 5LDSA 2XV3A 4HZ1A 1U8JB 2MFNA 4TULH 4N5UA 4QRUA 5DHVA 1GVIA 2J1WA 5CWSA 1UOLA 3SZ6A 4ATWA 4XH2B 4KKBD 2VZ1A 2VL4A 2XV2A 3BIKB 4R5VA 4NOFA 2C1PA 3TIDB 4HGWB 5L6YL 3CN4A 2DI7A 2WZ6A 4HEMA 4A6YH 4EZJA 1X44A 1CICA 3CFBA 3TN0C 4V1DE 1L6XA 3GIZL 5I24A 1JD7A 3LEYH 1F1AA 4EIBA 1C8PA 5I74C 4G6AD 5JXEC 5T3ZD 1HCFX 3ZQWA 3REVA 4N2FA 5D1ZA 4M9PA 4KI1A 1ZTXH 3NCCB 4OF0A 1G87A 3DROB 3ISWA 1S9WA 4XODA 4M5YH 4WW2F 3REWA 2X6BA 1ILUA 4PFEA 4PJHE 5C09D 3LJ3A 3ZTJH 2Z65C 4DUXA 2HT3C 4W9HC 4PMEA 3MRGA 3VGEA 2TRHA 1G6RH 3EBAA 1VKXA 3SDDA 3SGDH 4YX2L 2EVJA 2VB5A 4JDZA 4A2HA 1ZTMA 4I3RL 3QQ4A 3NZ8B 4GP8B 1EFQA 1GC1L 3BAEH 4I2XA 3SE8H 3GQFA 3L9RA 4B60A 3D25B 5IVXB 3W9DA 2GFBB 2D9CA 3T0ED 2DWSA 4FYRA 1A5FL 2I24N 3DJSA 3IDMB 2E6PA 3MV7D 3LOWA 3SCMC 3OKLB 1GGBH 4HQQH 5FO7A 3GSOA 4JZJB 4HCRL 3K0YA 2F54D 5AG9A 4NKIH 2KC0A 3B43A 3JQOB 4P4KD 4LQ1A 3QXUA 4TNVK 3DRQB 3G5WA 3K80A 3OR7A 5AOLA 4IBUA 1G9NL 4I0PB 1W91A 1MNNA 2K6WA 4OLXL 1OHQA 4EPSA 3U82B 3X12A 1BQRA 1J5DA 1FAIL 3PP3K 5DQ9B 4IKIA 4TUJA 1XL6A 1Q90A 3JZ7A 3ALXA 4HJTA 4RGOL 1I8MA 3P3YA 1HSAA 2YMXL 5EEXA 4PMFA 1KLFA 2B08A 2AEOA 3A23A 4UTAA 3IXTA 3I6LD 4FE9A 3K3QA 3AAZB 2DM3A 1RK0A 4YBLB 4J39A 3O3BA 1EBPA 1J8KA 1DEDA 4XVTL 3IEAA 4FFZL 1FIEA 1UH3A 2E59A 2JQMA 2OL3A 3BT0A 3L5XL 3AQZA 4GMSL 2ENYA 5HGBA 2AHIA 3VG9B 2L04A 5DJ8A 5CHNA 2CRIA 3OMNB 1QFWI 3AFLA 4MAYA 1OAXL 4WTZA 1J1PH 1A7OH 2AABL 3MRCA 4GUPA 3R1GH 1Z9NA 2WKOA 2DYRB 3QDGE 4NNPL 3V5KB 1E9PA 4XHJD 3BZ5A 3DGGA 2AS5M 1CLZL 1S9KC 3CSGA 43CAB 1DO5A 4EN3A 5I71C 2ZSWB 2IGTA 3PG2A 4XWGL 2ZUTA 4BUHA 1N68A 2LVCA 5F72S 3T08A 3GFUA 4WO4A 3CFMA 4UQEA 1NUDA 1U95A 3O9WB 3A0OA 1BEYL 2G5BA 4WNSA 5B1JA 3OZ9L 1MHHA 1VB9A 3JV5A 3US9A 2EC9T 6FABL 1QLRA 4L48A 2X4PB 2AITA 4RZKA 1I1FA 5FO8A 1MQ8A 3BQUD 3BZ4A 4Q6IB 4TNGA 4IKKA 5AAMC 1A7RL 2FJGA 3GHBH 3VE0A 1FFPA 2KQNA 4QXUH 3SIKA 2PWEA 1BG1A 4KI5C 5AKSA 1WWBX 2ZOLB 4I9XA 2VDKB 4AWJC 4HS3A 2JELL 1OO2A 4OSUH 3K6SB 4LT7A 5HHMB 4H26A 4XP4L 3BUPA 3BT2H 3U79A 5KYNA 1OB1B 1QKZH 1UM4H 1A7PH 2A9CA 3DHJA 3GBEA 3SKNB 2M2DA 4AL8H 1YEHH 4MCZB 3WFHA 1HEJC 5FYJE 3HUJB 1E4KC 4KO5A 1ESOA 3IDIA 3OM3B 4PREB 2VLLB 5CSBA 5E56A 4NO5B 1KIPA 1ADQH 4A2MA 3AY2A 5JW4N 1M7XA 4S0TD 3RJQB 1U8LA 3PXHA 3ISYA 1T5WB 2N1KA 4PCYA 3C75A 4O02B 1QBBA 3G6DL 1LLAA 1RZIB 4XI5C 4S1SH 1MCKA 3II2A 3LZFL 5LBSL 2Y69B 1A6AB 2AP2A 3VH8G 3SJVB 5AAPA 1OM3L 3LIZH 5GRVL 1AE6L 4UV7H 3IJEB 4ZOBA 2IBZY 2BIOA 1CT8B 3IF1A 1VGEL 4BFBD 2NZ9C 3DSFL 3EYVA 3HI5L 1AI1L 1SVZA 4NZFA 4GYBA 3KLSA 4LDOB 1M9SA 3BAKA 1C12A 5FGCB 4JKPL 3NJVA 3V0AC 3VXRB 4JAMA 4LP8A 1SBSL 1BZEA 1XGRB 4OTXL 4MKMA 4KXZI 5B1BB 4BZ1H 3PHQB 1SLWA 1IEAB 3IFOB 4KKLD 1KB9J 4JO4H 5DU7A 1J1XH 2JNZA 4OF6A 3VG0L 3QXDA 1PZAA 1EWHA 1QFOA 1SOKA 3FUKA 2GHWB 3RZCB 4XCNA 4KNQA 2YD4A 1U8HA 1V3JA 1JJUA 3QISA 4FQJL 4CDHA 4L1DA 3FS9A 4Z3JA 4YR6A 1M7DA 5C08B 5E00A 5D1XE 3MZGB 4J1UA 3D39D 4XZUA 4MMXA 3HFML 4ZXBC 1HXMA 4PJ9B 2WUCH 4ZDHA 2J5LC 2UY7A 4UT6H 1A4KB 3BP4A 3ZDZF 5FHAL 3GYRA 4ZOEA 1OV8A 1MCPH 2O6CA 1E6OL 1IGFL 5JHDE 5E2VL 1JV2A 2FBJL 1Q8MA 5HXMA 2NUTB 3EZJB 3LV3B 4F33A 5I1LB 4CJ1A 2IFFH 3R18A 2DW5A 3MDJA 5DCCA 4WDIA 4WJ5A 2F2HA 5IF0A 1UENA 3FAXA 5J1TC 1A1NB 5J13B 2D9QB 4I0KA 4DGVL 3O6LH 1RD6A 4PGCA 1UB6A 3BD4A 3QIUC 4E0RB 4X4ME 4LHUA 2BZ7A 3RTQC 3ZDYB 3D4CA 3JTBA 4P5TB 2AMUA 1D5ZB 3VGDA 2GTZA 2PYED 4ETYA 2X53A 2R69L 3WJJC 1R3HB 2DQTL 4N2LA 3SDCB 1UHVA 1T7VA 2VLME 5FYKD 3O2VH 4FMFA 5L8JB 1G6RB 3T0XA 3PAZA 1T2XA 2QKIB 4UDTA 1NMCB 2K6YA 3OAZK 1U6AL 1AGBA 1EBAA 3L4CA 3GSVA 4K23H 3BHBB 4TVPD 4AEIL 3CC5B 1AAJA 3QEQB 1CFNB 1UEYA 3HC4L 4KK9C 1AQMA 4XRCA 1YQVL 2B9AA 3SO3C 5TQ0H 1FNLA 4NM8L 1TQSA 1CGSL 3LRMA 3H9ZA 15C8H 1E9OB 4LK4A 5DO2C 3NPSC 2XWBA 3DYMA 4R96A 5KANG 3WIFA 4PYHA 2X1OA 3QI9A 3EBHA 3LHPL 1QYGL 2UXGA 2WLLB 1OT2A 3NJMA 1CR9L 1JGLH 3RU8L 1QNZH 3B2PA 3SBWA 3MV8D 1FC1A 3VFRA 4G6KH 5CUSH 2VRQA 2NY3B 3QJQB 3P54A 3Q6FB 3KPOA 5IB3A 3NFPB 1GYCA 2KDGA 4E42A 3ESOA 5BZXA 1IGMH 2J2ZA 4IMLB 4GI8A 4JN2B 1ROWA 2JWYA 2QHRL 2W94A 4X83A 3QIBB 1JGDB 1KFAH 5IMOA 3TBYB 4HC1L 5T1KD 5KTEL 3FHAA 4QMEA 4JJHA 4B9PA 3E8UL 4JFPB 1B2WL 2XETA 3HE6C 1UTDA 2DTMH 1T0MA 1L6ZA 5E2JA 3VD2A 3TBSB 1M1SA 1AY1L 5A3IC 2GI0A 4XCCL 5A40E 4GFTB 3QHZH 5J12B 4RDQG 4K71C 5IW3A 3A6OA 1DBAL 1DEEB 2C9VA 4EI6B 2ZUQC 1D9KB 4PRHA 4Z95L 1WP6A 2A73B 4FEIA 1N7MH 1DQJB 1UKQA 3OC8A 5AYTA 3A6BL 1GGCL 3OGCA 3JVFC 4TLKA 2E75C 5C2UB 2Y06H 4N0UA 2OK0L 3MUZ1 5GS1C 3I50L 1HL5A 2NTFB 3PGCA 3ABMB 2F68X 1G0XA 4ZO7A 1LL1A 3VXUA 1I3GL 4AYFA 3TS8A 4XMLH 3FQNA 1NCTA 1IKOP 4U6YA 3G7TA 5E99L 5A7EA 2IH3A 2WXGA 1JPST 4QGYA 5E2TL 3OG6B 1KJMA 1EMTH 1SJHB 3HC3L 4V11A 2P8PA 4DQAA 3GRBA 4OFVA 5C7XL 4OW6A 4S0SD 5EOCL 1P7KB 4H13C 1I9JH 5TK2A 3KWUA 4OT1L 2FH6A 5GJTL 3ZL4L 2XN9E 4AG4H 4AGQA 5D55A 2E7BA 3BKCH 3KPPA 1I8AA 3L5JA 3IXAB 2XIDA 3U7YH 2Y1VA 4L8BB 2CLZB 3FCTB 2OYLA 4Z77B 4HOMA 3PGDA 5J1SC 4O51A 2BNQA 5KSAD 1AD9A 1LDPL 2L8AA 3VD7A 4K3GA 2XRAL 4YGVA 5DGQA 1NZRA 5HDBE 2P28B 1J0ZA 1I3RA 1LHZA 4NWUL 7FABL 4OV5B 3L3GB 3QO0B 4K3DL 3LS4L 1S7QA 4DKEL 1PQZA 2FNWA 2WBJA 3EH5B 1CF8L 4JFDA 3V4PA 1ZGLM 2UY6B 4RIRB 5EUKA 2QQNH 3MUJA 1PIGA 5CAYB 2OMYB 3RVVD 3NCFB 1L0YA 2GSGB 1JZFA 1KYOK 3Q8FA 4L37A 1Q94A 3P1VA 2WXPA 1XEUA 5H4YA 3V4UL 4Z18A 4QXTA 1KB3A 2B4CH 4WGVB 5HYQA 2Y72A 1M42A 2J12B 3HB3C 4WIQA 1DLFL 4JLRA 4XGZA 2GJPA 3N1FC 5TDOA 3PAVA 2L4OA 1YEFH 4HF5L 1PLGL 2CKNA 3ARDB 3NFSH 3QC5X 4YH6A 4F15C 4PJ7B 5ALBH 4Y9EA 1DQIA 4KROD 4CKVX 3IK2A 2FD6H 4PB9L 2AAVA 2BP0A 3FZUD 4GSDL 4K7PY 4KI5E 4OKDA 2YA1A 5AALA 3FB7B 4KRPC 4PJFA 2MSPA 2XYCA 1R3JA 2BOLA 3D7PA 4GQ9L 3WL9A 4L9DA 1J5CA 4P59H 2FB4L 5I1EL 4LO9A 4DESA 3DTXA 3T4YA 3F7VB 4GI6A 5JIKA 2PR4L 2DN7A 3FT2B 4DT2A 4IBSA 3LZNA 3SOTA 2DMGA 2E27H 3MBWA 1A7BA 1F4WL 2I60L 3S5LA 3BN9D 4HH9B 3O8XB 5E6IA 5KBLA 1K6QH 2IJ0C 3DGCR 2FR4B 1OGAE 3UOAB 3MUHL 1BVZA 1NKGA 2MOGA 3QQXA 4DCQB 2VJ0A 3CN1A 1AQ8A 3ILPA 4U1IA 2P5WB 3VFVA 5D5MF 5CP7B 1RZJH 4RMQA 3KYMA 4OI9A 4M4PA 4UOQA 1XF3A 3GJFH 4D0BB 5CKAA 5I15H 3QRGL 3F7PC 5BRQA 4QCIB 3ZSTA 3M8OH 5MHSE 3Q6GH 1HZLA 3U4EB 2I9LA 1MEXL 1XB3A 1HILB 4UM8B 4HHAA 3RYMA 4N8CH 3PABB 2GIMA 1R24B 2HX9A 5GRWA 12E8H 1QSEA 5JIPA 1MFCL 5F9WC 4OIIH 1V3LA 2BHZA 3V52L 2QSQA 4Y4HB 1F45A 1HINL 1B4JL 1M7IA 4HD9A 4YQXL 2J1YA 3B9KA 4I3SH 4PS7A 2OJEA 1NICA 2Y2TA 5TH2A 1SJEA 2AXJA 5F2FA 4HLZG 4PI2A 1LO4L 3DO3A 2O30A 2HMIC 5L4FA 2W8CA 4PWJA 5FW8A 4PWEA 1WS7A 1I4FB 2J6WA 3PWUB 1N5YL 3KLAB 4WWKA 2GITB 3AQDA 4PRAB 4W93A 1WAAA 2EXWD 2Z8SA 1JYXA 2IWGA 2X1PA 5I2IB 2CH8A 3S34L 3X3GH 3WS6C 1LO3L 1QHQA 3G04B 5F1NB 4OZHE 5DUJA 4KKCD 4CSTA 5KEZA 4DP5X 1RVFL 2FTAA 2IGFL 4FKKA 4LVEA 1D5IH 1GIGH 3F6LA 3V9EA 3C5SA 4P3DB 2YWZA 5FYKU 4GBXC 2GY7B 4IBQA 1P53A 5KOMC 1CLOH 3GRWH 4MNGA 2PPDA 3EYOA 4GRWF 5ES4B 2MQCA 3VFUA 4PY7B 5JYLA 1FQ9C 4UB0H 3CH1B 4U1HA 4PY8J 1Q9KA 5E4OA 4HG4J 2HFGL 3LN4B 3LTVA 4FZ8H 1EERB 3HR5B 2AKRB 3E9UA 2OR9L 3CVDA 3QDMB 4FI8A 4FQXA 5FK9A 3C9NB 4B9ZA 4ODVL 9PCYA 3ARBC 2VLJA 4H8VA 5I8EA 4U7MA 3NSFA 3ZBMA 5FYLD 5LGJB 2H41A 3V0IA 3HRZB 1BXVA 2LU4A 3PV7A 1BVLB 3BEVB 4U3SB 1OAQL 3MROA 2NQ3A 1K5NA 3FF7A 4G2AA 4JRYB 1NIFA 4F7CA 4WW2A 1IGTB 4PW9A 2LV4A 3KWTA 3EFOA 3TT1H 2GG1A 5HPOA 3S36H 2QGDA 4Z3TA 4HJEA 1MFUA 3NEEA 3L3KA 4HKBB 3MFGB 1T0NB 4I9WD 3F83A 2V3EA 1ZVYA 3PRZA 4HIXH 2X87A 1ZDSA 2OLDA 2X10A 4JG5A 3SPGA 1HN1A 2WZPA 3O9WD 3SY0A 1VEMA 4X99A 4LASH 2GVYA 3N42B 1I7RA 4M43L 1BBDL 2EH7H 5JQHC 2WP3O 1P0SE 5FA4B 1YYLH 3FT0A 3WS3B 3UTPD 4LMQE 1N6VA 5L0QB 3NJNA 3V0VB 2A9MH 4HAKA 1KT2A 5JDSB 1NFIA 3VNYA 5KVEH 5KW9H 1AXTL 1LVEA 2GAZA 2YOCA 1AKPA 1NA8A 3UZVA 1BGXH 1HHKA 5LQBH 2WJ5A 3K1KC 4QTIH 5DEJA 8PAZA 5TK4A 3V5DB 1FSKB 5B39B 1HEZA 2O5ZL 5E6ZA 4RGMB 3B56A 5HHMD 4PCTA 5G4OA 3MHZA 3LRLA 3WY1A 4PUBH 2C4FT 4J3OG 3FAWA 5F9AC 4OFDA 2ZCHH 1CICC 3CVIL 3Q2NA 3E2HC 4TOYL 5DZJA 3ZT7A 1UD2A 5DZVA 2ZSVB 3DX9A 4X4XB 3F2LA 2DM7A 2MH4A 1Z9SA 3FTWA 5J11B 2C9PA 3U9UB 1NEZA 2AV7B 4YSDA 3SY6A 5HYJE 2HG5A 1INQA 1M6OB 4MVBC 3TEWA 4NN7B 5D1ZC 2ZWYA 5F44A 2BZCA 5JW5B 2ZOUA 2CQVA 3KWVA 3H4HA 1FYTA 5DQDL 5JIHA 4M8VA 3CFNA 3EYQD 1NLBL 2HVJA 2NNAA 1QX1A 4N0FB 3AMLA 4D9QD 4F5CE 4YFDB 1SQMA 4IW4C 3U4BL 2B59B 3VMNA 1YJDL 3OZLA 3AG4B 4Y5YB 2QSCL 3WTVA 3FN0H 4UMGA 3BPOB 3SJVD 1INEH 1LEIB 3O3DB 1RPQA 2WLMA 1NEUA 5J7CC 4FQQA 1IC5H 3MJ9H 4KK6C 1KXQE 4U49A 4YVUA 4W1TA 4YDLC 3TFKC 3QUMH 5IW1B 4DP9X 1CBJA 1DQDH 2NW2B 4E41B 4EVNA 5KAQF 3WFCH 3PWLA 3L5IA 3MLXH 5KWYC 3GTVA 1JNHB 1YEDA 5IUSA 5EO1B 3R7RA 1OAJA 4ZO9A 4QHNA 1PZDA 1YNKL 3DMMA 3VXPB 3TWCL 3SE4C 3RWDA 2HLEB 3L4VA 4ES9A 3S36X 1DVYA 2EIEA 4LZHA 1IILE 2WXQA 3WSQL 3BH9B 2VC2B 2FT7A 3RZCD 4ANXA 5T3ZL 3BX7C 4KJPD 5B4MD 2EUWA 2X0UA 5IV2A 3R4RA 4PJCF 4PRIB 5C6TL 5C08D 4O2FA 1G43A 1AO7A 4PJ9D 1YJDC 3F12A 1JFQL 5DZNA 2UWEE 5IG7B 4ZFOB 3FT3A 3SN6N 4XT1C 3Q0HA 1KUMA 1OKEA 3OHXC 2XQ0A 3IS1X 3AXIA 3M07A 5E2UL 8FABB 1JZ7A 1FIGH 1UWEH 2A74B 1EFXA 3PJNA 2YGNA 4MAYC 4HCRA 4FFYL 1IGYB 1J48A 3VQ2C 5FGBC 1NCWH 2R29H 2X70A 3QH3A 4KTGA 1BOGA 3GJFB 5IOKA 1P4LA 3FH7A 3GBDA 3LNIA 3QDHA 2VTFA 3NEXA 1JWUB 5CIPH 4HX1B 4AK1A 2G75B 2WQ8A 1D5XA 3MXWH 2IWFA 3WUWA 4X8JB 5CM1A 3D6GA 1I8LA 2EO7A 2AGJH 4WO4C 3CGTA 2KZ1B 4RGNC 3A4AA 5IHUH 1URZA 3C8DA 3CX5J 3O2WH 5EF3A 2EEXA 4P5TD 4Z7UE 3I75A 1DJSA 2TAAA 3IFLH 5AW5B 3ARYA 1HXYB 3VI4F 3VFPB 1S7SB 4MXWH 5J1AA 1AXIB 4LARL 3EHBB 2G9HB 3D2UA 2BFGA 2BWIA 4GO6B 3HMWL 4N90D 5BS0A 1HS6A 5DRWB 1N0XH 3BGFC 4LLAA 5CR8A 5M7QA 1E2WA 3IJHA 5H37A 1LJMA 4XPAH 1MG3C 4Y9CA 1KIQA 4NAMA 3WTWA 3K72B 2VE6B 1EHKB 3EGSA 2HAZA 3FQXB 5ACMA 1TJMA 2E0PA 3NIDF 3FH5A 3MFFA 3QEQD 1U8MA 6PCYA 4NDMB 3W5MA 4WEUD 5KS9E 2BJMH 4L4VA 4MAZA 1YN7B 1BEXA 2Y22A 3ROOB 3KLHC 3ILQC 4MJJA 1X7SA 3O4LE 3F04A 5MP6L 4R4FL 4XXCA 1Y6KR 2NT1A 3TX4A 3UAJA 3ZG4A 3VSUA 3L3IA 3FSOA 4FC3E 4AVHA 4GRMA 1NC4B 3A67H 3W57A 3ZRCC 3H42L 5F93C 3MNMA 4G59C 3FSAA 4XB3A 1AANA 1F4XL 2KUTA 4ANWA 1MFBL 3IRCA 1ZHNA 3D07A 3V0HA 2NY3D 3FSVA 1UFGA 2YPKB 4X80L 3RGBA 1KIUA 3WNKA 5AOZA 4D7BA 3QIBD 5I1DA 1NCJA 3Q1SL 4PYGA 2D7OA 1SBBA 1DJYA 3MNVB 4ZUUB 4XPBL 2Y1YA 1RIUH 4G7YH 1LEGB 2TSBA 1JK8B 4V33A 4XO3A 1RSYA 4E5XB 2IXQA 2HPOA 4NQCE 1ES0B 2WZ5A 2V7HB 3DIVA 4JDTH 5ITFB 5H94B 3ZJAA 2J1KA 1FFNB 3AVEA 4HUUB 4OGYL 2UZIL 2CLVA 1DN0B 1EJ8A 3PWNA 1C16B 2EYSB 3JWOL 1D9KD 4R4BA 5CEXB 1CG9B 3QORC 2QFPA 1PMYA 4PJ5A 2FLBT 3AS3A 1NIDA 3EO1B 4UAOC 1WUNT 3KNBA 2O4EA 5KVDE 1U8CB 4F2MA 5D7IF 3QCTH 4JY4B 5EORH 5HJDA 1MJUL 1EO8L 1KELL 1IKFH 3QAZC 3CFKA 1BM3L 1U8NA 3I74A 1TLMA 3QWQB 3KPQB 4UU9B 3CK0L 5I0WA 3QUXA 4GIOA 2HN7B 5FOBB 4FXKB 1EEZA 2J72A 3W11C 3MLUH 4HK0B 4W6XB 1KCKA 2R1WB 2F15A 3EADA 4NO0B 3WLWC 1JN6B 2F5AL 3CN0A 3K0WA 1MWAH 1T1ZA 4DO5A 4F8PA 3TA4D 5DT1L 2V5MA 5TPWL 5I17A 2DS4A 1TT6A 1UWGL 5EU6A 1Z5LB 1T22A 1JL8A 3N44F 3OF6A 4FXGB 4IBTA 5LAPA 5C0AE 3AGVA 4NHCL 4OLVL 5MERB 2BIQA 3L2NA 1XCWA 1Z5HA 5CR1A 5EU4A 2WXIA 1RI8A 1NMAL 4R8WL 2CCLA 5LG1A 1F0LA 4WHYG 3TBBA 1GKOA 1UGNA 3QWOA 1KGCE 3N55A 3N9GL 4LU5H 5ESVB 5BO1H 1GZQA 2FX8H 1XF4B 1WZAA 4ZO6A 1OPGH 3V7AG 2F53E 5B8CB 1D5BA 1FNGB 3GUTB 1UASA 1YEEH 4OZ4A 5GISL 2UX6A 4U1KA 5B21A 4ZMXA 2NYKA 1JZGA 4Q6YA 1ET7A 1AG6A 3HHRB 4HWBH 2EIMB 4AXWA 1ZT1A 2FGWL 4P48A 1X5ZA 5AW1B 1B4TA 4P8QA 4DOHE 4ZQTA 2F1BA 3K7UA 3ZUNC 2CE6A 2OZ4A 1TTFA 2ZOOA 1YPZB 2YS4A 3R8QA 4MFHA 4GY4A 4HOXA 4L3CB 1MCLA 4WCYL 1MHPH 5DD5L 1P84J 2OV0A 3QUMB 4JVUA 2OM5A 1SFDA 2ZUVA 5GZOC 1SDAB 1TYEB 1MREL 2O5YH 1QQDB 2QHLA 3OAYK 1XB6A 5HI4C 5EC2B 1IL1B 2EYRB 3FSWA 4DGIL 5IJKC 3H9SA 4H0LC 5INDA 3ARDD 1ZXKA 1U8QA 2CDFB 1CGYA 1XVSA 4QAMB 3QFJA 5EOTA 3VFGH 1QUNA 3FOLA 3RWHA 1F5WA 4Y2DB 5HJBA 4N2EA 1GZPB 3UYRH 3OX8B 4QLWA 1RJLA 3UYOD 1TCRA 1BREA 1WIOA 2VW4A 4WEBL 5D2NE 3SBWC 5FECB 2J1ZA 1A7QL 1JF1B 3UCQA 5IEHA 3B8SA 1KB5L 1FL5B 4DKAA 4NB7A 1NCDL 4D8OA 1KTRL 3O8XD 5ETUA 4H20H 4QRPD 5FYKL 3H3BC 4M1GL 4P2RE 5D1QE 4PVNA 5SX5H 1UM5H 2F1AA 4Z0BH 4DPCX 4IU2A 2P5WD 3IGFA 3NN8B 4AZ8A 4GG6B 1ZA3B 2O93L 2XX0A 2YHGA 4PV9B 3IAGC 3WDIA 3RPIB 4XBEL 1N0LA 4TVPL 3U9PL 4KZDL 3LKSB 2DWXA 4X6CB 1F41A 5CIPB 5E5MA 2OX5A 2W81C 2OMXA 4GW5A 3VJ6A 1G9EA 3VD9A 1MUJB 3RVUD 4JHZA 3QPQC 1H15B 4PP2A 2XPZA 4AQ8C 5C0FB 2XY1A 1VADB 1UGKA 4OGXL 3KR3H 4Y4HD 1F8TL 3ZL1A 1ZK5A 1JWMB 1QOKA 2M83A 3Q3GB 4OGAC 1F6AB 3KPLB 1ODUA 1JPEA 5IBLD 43C9B 4HC1A 2IADB 3JWNE 4DJMA 1OLZA 1XH3B 3OKDB 1F56A 3RY6C 3JTTB 3NCJL 4PJ8B 1VZHA 5ERWB 3HNVL 4MTMA 1U2HA 3OGOE 3SQOL 2ICEA 3FN3A 5CJOL 3MGTB 3ZDXF 3S3PA 4EJ1C 2IANA 4GRLC 5HGHA 3FT9A 1NCOA 3VFNA 3MACH 3RA7L 3VWJA 1E28A 2C9RA 4Y4FB 3OKKA 1MCNA 1M6UA 3U6RA 3FU9A 4ZMYA 1RUQL 1RZ7H 5KYYA 5IMMB 2WMPA 2P3YA 3PYCA 3T3MB 4RISH 2LR4A 3BEWB 3J27A 4XVOA 4B9CA 4OLYL 2X3AA 4ACPA 3T6QC 4Q4EA 4QTHA 1BV8A 4M93B 5C3TA 2Q7AA 4ELMF 1MCWM 1O7VA 1E4XI 1IM9A 2SEBB 1F3DH 2OMZB 2YEVB 3AREB 1M4KA 4ICXA 4JDEB 4GT0A 1W72H 5D5MA 2BVOB 3MRNA 4J27A 2AANA 5IK3B 5AOJA 4PVMA 1P4BL 5FCSH 3PHOB 2Z6FA 4TNWK 1ZHBA 3PUCA 5FGSA 4NZDA 1UD5A 3JBG7 4XO8A 4ZMTA 1TZAA 4XWOC 3UIYA 1CDJA 2XWJA 1U93B 2B14A 4M4RA 2B8OT 1IARB 1JTTA 3ARSA 5C0IA 3BPCA 2B5IB 5K9JL 4ZUVA 3UDWA 4RGNE 3MRQA 2C7UB 4XBPA 1HQRB 3T6ZA 1MFAH 4JRYD 4AV0A 4X7SL 3D3VA 1ZHLB 2JKLA 3L3OB 4C55A 4DZ8A 5IB1A 2MCPL 2VERN 4N2CA 2PUQT 3N6YA 2WQSA 3M46A 5G55A 1E5UI 1F4AA 1OSYA 2NX5A 4ORGA 5T3ZE 3TT3L 5J6HB 2DLIA 3ARZA 3D48R 1HHJB 3D51A 2LVEA 5JPNB 4PJBE 2B39A 2K45A 4BFJA 1ZMYA 3HOGA 4M3HA 1EZUA 4FTVA 1FE8H 2RTTA 5IVZA 4ONFL 2WIMA 4N85A 5L8LB 5AUMB 4WI4A 3DETD 4XMUA 1OE1A 1PNDA 3OB0K 5T1LB 1YHPA 4LLVA 2EKSA 1K8DA 4WUUA 1CUOA 1H3WM 5DUPH 1ZANL 2BIMA 3HMXA 3HBQA 2QPEB 4FYQA 5B1CA 1KTBA 3GKWL 4TF4A 4N6QA 3QT2A 5E6IC 5KVMC 2NY2B 5C0BB 1SVBA 5D7IE 2CM6A 1C5CH 2KZKA 4XC1L 5E5RB 1NTDA 4LSTL 1KNOB 1DBJL 3F7YA 3NA4A 4ANVA 4LSUL 1LTXA 1EDYA 4XP9H 4HW6A 3VMPA 1MAML 1FL6A 1RFDL 1UVQA 2J6EH 3F58H 5CZXC 4XN1A 5KBDA 1P5VA 1HH6A 2BCKA 1ZOXA 2B0SL 2ZP8A 5E9DB 3QDAA 3UFIA 3L6FB 2FEDC 3PNWA 3OTTA 5AVXB 4Z5RA 5MEQB 4POZD 3VACA 4XCYA 1A8JH 2YPLB 3LNEA 5C97A 2VRAA 2H9GA 3P4OA 3PF2A 2XWEA 4M48L 4MJID 2OSYA 5F88A 4B95C 3KXFB 1BVKA 4ONHA 2IQAB 4JBSA 1IGJA 5GRUH 2E8ZA 3FUHA 4F7TA 1JG9A 1P2CB 2ERJC 2BCMA 2D7TL 5DLML 2RBLA 4APQD 4LLQA 2N59A 3AS2A 3QCUH 5I0XA 1BFOA 4WWKC 2BS9A 3BVXA 4KDTA 2OCFD 1ZLDA 2VLKA 4KAQH 4U6TA 4IKJA 4OVVA 1K8IA 3CZGA 4E41D 4I87A 4DO6A 3IJ8A 5AW0B 5LXGH 5GGUA 1WBYA 4M9OA 2FQEA 4U6HA 4D3CH 2YPVH 2YQGA 4BK4A 2ATKB 4U2YA 1CXFA 4XAWL 5LLIC 2CUAA 3O4OC 4FG6D 5K9QG 3FOMB 5AW8B 4R26L 4MBOA 5MI0C 2QQLL 4GAJH 3IRZA 4NQEE 3WTUA 3ZN6A 4U33A 3NZSA 2QVKA 3V9CA 2A0LC 1UWXH 4BSWB 2Z3FA 1A3QA 5IKCB 4YHIB 2A77H 1GTNA 2FVNA 3GI8H 3PREA 1WFIA 4PRID 4ZW8A 4PGZA 1CFVH 1Q0EA 1Y18A 4RX4A 1FZJB 5J9PB 1VIWA 1U8KB 5AB0A 1CMOA 1IUZA 1KY6A 5JXAL 2CO2A 1JS4A 2MPVA 4TTDC 3WFDH 3OC5A 5CSZB 3VNZA 1Z6JT 5A16A 5LBVA 2D3LA 4R3SB 4AQ1A 1ETA1 4PS3A 3ZR5A 1HDMA 1LO0H 2OBGA 1KULA 2CGRH 2OI9B 4J7RA 3T2NH 1IGIL 1U8PB 2VQ4A 1H3PH 3H6JA 3EF7A 3MRLB 4LFHD 3W9EB 2EO1A 4ZK8A 4IEFB 2VMDA 4BZ2A 1A3LH 2HTKD 5HPMB 5EULV 5F7DB 1EUUA 1N8ZA 4YLCA 3RY4A 5C3LD 1YAZA 1AZZC 3HE7D 2OR7A 2N7AA 2AQSA 4GKOA 4M7KH 1A9EA 4DERA 1EUTA 1I53A 3A22A 4FI6A 4NPYB 4AEHL 2WK2A 3CCHB 2AJ3B 1E90A 4KK8C 2Z7ZA 2NDFA 3BP7B 1YNTF 5DRZA 2AZUA 3CN3A 4KTEL 5FO9B 3JV4A 3S8WA 3EHBD 4NP4H 3GSNH 2BWDA 4MMZB 2X41A 2NY4B 1HI6B 2BP3A 4L3AA 4MRBA 3OJMB 4EDWH 5E6YA 5EC1A 2WKGA 3H0TA 1JRHI 3RWFB 2E46A 2HRHA 3I6KB 3L45A 3ASNB 1MCIA 1RL1A 4DVRH 3EW3B 1AXSA 2ITDB 1TCMA 3P2TA 5FYLL 1IQWL 2IFGA 2BVTA 4X98A 4WJG3 3CZFB 3Q2CA 1G7MB 3OXRB 1W0VB 4G6JL 4PJCA 1S9XA 3RIAF 1X9QA 3OMIB 4MNQB 4CU6A 3ZDXE 5IJBC 2XTJC 2R23B 1SHXA 4KJQD 3K74B 3DV4A 1LO2L 5I6PA 1I85C 4WTXA 4PJIB 5JUEH 3IKKA 1NC4D 5D8JL 2VISA 2WBXA 2Z31B 1UOWA 3CLEL 2KT6A 4HFUL 3TIEA 5MEOB 3QDJB 3X1GA 4P5MA 1W72B 3Q5OA 2VLRE 5T33L 5DMGD 3FL7A 3D39E 5I1IH 1ED3B 3MO1A 4G11A 4ZUWA 4ODSL 3L7EA 2NPLX 2VCOA 4HIIA 4NT6B 4LOEA 1I1AA 4UF7C 3FTVA 1LWRA 4I85A 3U6XA 1A4AA 1FVDA 4XMKL 1CU4H 1XR9A 4ZFZA 2VN4A 3AACA 2UUDH 1RULH 4S1RL 5AZUA 2X44D 1IM3A 3QEUA 4UIKH 2ZUWA 1ZV2A 4HHWA 5HGDA 3H3PL 3DRTA 1EGJH 2VDKL 3VI4A 2DMBA 3OPZL 2Q7YA 5L9DH 1I7TB 4XMZA 2ZXGA 4QDGA 4M7LH 4DKTA 1SHWA 3MJ8A 1N67A 1G7JB 2AK4A 5CZVL 4IRSB 1FL3A 2GTWB 4J6RL 3RWGA 1MDTA 1BJ1H 4UQIM 3T3PB 1AZRA 4X7FC 2NLJA 4NQDB 2PYEE 3IJSB 4LSPL 5IVXF 5IJCC 2R9HD 4PGDA 4DVBA 1S7UA 1XIWC 3FTGA 2WXLA 3S97C 3K91A 3CXDH 1QTYT 1TQBB 3SD5A 2M1KA 4LSRH 4A37A 2DEYX 5BVJA 5IIEB 3WLBA 2X4UA 4JHWL 3GLDA 4RFEB 1KWGA 4O02L 5D6DA 1CLCA 4XXDB 4HZAA 4DQOH 4ZW5A 4IKNA 3JTSB 1F58L 4TVPE 4OIBA 5C0EA 4UAHA 4AYMC 3ZTDC 1A1MB 3FCSB 4Y7OC 4A55A 3FFCE 4K9JA 1CFQB 4F9LC 3EDJA 4P23A 3S5ZA 4NO0D 4HPYH 1MQKL 4D9LH 2PW2B 3FO9B 4LLUA 2Y25A 3CFEA 3HLAB 4XP6H 5KUKA 5EIIB 1QRNB 2DM2A 2WXHA 1JV5B 5HHXH 4QHMB 1KV3A 2J4WL 3FFDB 3GZPA 3MLRH 2JIXB 5I1AB 4JFXA 4NQSB 2B20A 2IWKA 1KTLB 5FDYA 4NRYA 2K8QA 1E6JL 1AR1D 2YSSB 1LE9A 2IPTL 4NQVB 3VCLB 3DX8B 4KXZH 1G9MH 1I8LC 4MD5A 5D4IA 4L9LB 1KLGA 1Q1PA 5DJDA 2WXMA 2ZZUT 2C7FA 3H2WA 4F9PA 2ZXAA 5I1CH 3DSNA 5C09A 4ZOAA 1HFUA 1AKJA 3M1BB 3IJ9A 3QXVA 5D96C 3FUEA 5AW7B 1LM8V 2YEZB 3RNKB 1O6SB 3D08A 4I5BB 1RH8A 4J3WA 5GSVA 4OF5A 4BH8A 2A4CA 1G1YA 5BV7L 1MIML 4S0HA 1C5DB 1RU9H 5KSVB 1MRCL 3OJDA 4E36A 1E42A 2AZAA 5F3BA 1TETH 4ZS7H 3IGLA 3T0EA 5GIRA 3MBEA 4Z7VB 1CXKA 3MV7A 3O2DH 2A6DA 1NCAL 5IJVB 1DL7H 4ZTPL 1A1OB 2AJVH 2VRKA 2F54A 4JMNA 2FSEB 4MZ3A 4P4KA 2D73A 1HOEA 4B3EA 1JGIA 4ODXB 3AS0A 1QABA 4WWID 1NAMA 2QZ5A 2RACA 5AW4B 4Y2DD 1D6VL 1AGCA 5AOIA 3TBTA 4NJAH 3ZYOA 3QPXL 2Y7SA 1SXCA 3GMLB 5D70H 1V7MH 3KLKA 3SE9L 3HS8A 5JW4R 2X4SB 2HRPH 2ZX6A 4I1PA 2NNXA 4JPVL 4ZAKA 1UURA 1UQSB 1IT9L 1HE8A 4HIEA 3HUJF 4NI6A 1CL7H 2ZOKA 4W9IC 1FO0A 4MNHA 4AMXA 1IX2A 5I6NA 3KS0H 5EF2A 3OMZA 4NCC1 3GT6A 5HD8C 1BYOA 3QEGH 5ESAB 1OZTG 2VERA 5E8DL 2MHAA 3N40F 5BV7C 1EXUA 3V0DA 1PX8A 4N2IA 5C92A 3SYPA 1GPOH 2VQ1B 3MA9H 3QGVA 4JVWA 3UC2A 3VXOB 2DQGL 2BRRL 1SDYA 2HKHH 3GSUB 4J3UA 2ATAA 2J57A 2P7TB 3WEAA 1UYWL 3BXNB 4XX5A 3LKOB 3GHEH 3S5YA 2LU3A 4JR9H 3PWVA 5J4MA 4UQ3A 2A9AA 5E8PA 4G5ZH 5JW4Q 5EZJB 2YA2A 5TE7L 2BOBA 1BXXA 1E9QA 1B3JA 2BSRA 3DO4A 3GMNA 1ACZA 2NXYB 3GSNB 3N41B 3CQFA 3CFCL 4YSEA 2MCMA 4PJ8D 3P77B 1PCXA 3HNSL 4AV4A 4XMXA 4NJ9H 1FFQA 5E70A 2KZWA 5ITBH 2CDEB 3CE1A 3P9MA 1N59A 4XTRD 4Y4FD 5KSBB 5A2JH 3ZVVA 2RQ8A 3R06A 4CN1A 4WENB 5ANMB 2NYYC 2VXTL 1RJZB 4F7EA 4ZSOA 3RRQA 4WUKL 4YBHA 1MY7A 3BH8B 2P8MA 2OMTA 4G5AA 4ZUSB 2WWMC 3BYTA 4DGYH 4X7EC 4LKXB 3QUKB 3TWYA 2ZXCA 1RHHB 4JJOA 1AHWA 1INDL 1VF5C 3U1SH 1UZ6F 2BM3A 1CXIA 2VLJE 2H2PD 1CTOA 3NESA 4UTCA 3WIAA 4HOWA 4Z7OE 3ARED 4MBRA 1X5KA 1AHKA 4KDVA 3FO2A 4R90H 3L3DA 4YSQA 1PZ5B 4F20A 1YEWA 1TR7A 3K1DA 3ML8A 3QZOA 3W0WE 5EA0H 3ARGB 1IC7L 2WUBL 4BFNA 5HYSB 1NLDL 3JXAA 2YGPA 1A9VA 5FYJH 4FNQA 4Z76B 2BINA 3QHTC 4UT9A 3UGEA 3EGXA 1UUNA 3ZDYF 4OH2A 1QRKA 4K5OA 4RAUA 5D7JB 1MHCB 3QIWB 3WO4B 1GXEA 2WO4A 3FHEA 2DWEB 1ZV5A 4KMLB 4AQEB 4JG9A 3L3JA 4AIEA 3ZZLA 2ICWB 5SX4I 2Q6WA 3ECWA 4KQ3H 2W5PA 1IFRA 2V2TB 1AZVA 3AT8A 5TDNB 3ESNA 1LWHA 4FFWD 3S2CA 1LE5A 4IOFD 1ERNA 4QHUB 5G2NA 4CDGC 3PDGA 1KEML 3PL6C 4KHXH 1HHGB 2NZIA 3LEXB 3D9AL 4OJFH 5T1LD 3DVFA 3EG9A 4ALAL 1HZKA 5IW6B 5BQ7B 3EYUL 3N1MC 1AOHA 3FCGA 3QUZB 4U0RB 5IVXE 32C2B 2NY2D 2XTJE 4LPXA 4W9DC 5C0BD 3GTTA 4F8NA 3QG7H 1BQLH 1U4EA 5DJ6B 2H6OA 4ELMA 5EFIB 1ZS8A 3HHMA 3D8MA 2FHCA 5DMJB 2FLMA 3KH4A 1X5GA 3WIHL 2XA8H 3B4NA 3KYNA 4LCIL 1GZHA 2XXCB 2HYMA 2Z7WA 3MNZB 3D69A 3OKMB 4X50A 1NDMB 5D4HA 1QW8A 4I77H 2AQTA 4HPOL 1I8IB 1MPAL 4GKSB 3DV6B 5E9DD 4APXA 3CDZB 5B3JF 4PHZA 5IESH 4HKXA 3I02B 1L7IL 4P5KA 3K2UL 5IR1A 4GSUA 2Y1ZA 5SWQB 1BX2B 3A4EA 2IMMA 2PWGA 2G3MA 1KB5A 2VIRA 1KG0B 4CVXB 5KYWA 1A14L 1H6FA 3KXFD 4MYWB 1A3RH 1QBAA 4Y5VA 5EZOL 3C8KB 2WBKA 5FYLE 3V6FB 3MXVH 4ALAC 4EZKA 4HUXA 1DDTA 1OZUA 2J8UE 2FYYB 1AQDB 2WB1A 4RBPK 3I2CL 3QQ3B 4A39A 3GMPB 4KHTL 5ACLA 4M29A 4V1DB 4P2YA 1P1ZB 1T1WA 2ICEC 2WWOA 1NGYA 2IDTA 4E9SA 3WI9A 2V8MA 4BDVA 3TH4T 3VWJC 3EUDA 1QATA 1NBCA 4IRZH 4KVCH 3WXVL 4FKEA 4RWYL 5FEBA 1GJWA 3QG6B 3FC8A 2WTRB 5ABDE 2NY7L 1WRFA 1RP9A 4PJHB 5CEYB 4G6MH 4W4OA 1YG9A 1S3KL 4EQ3A 5I6KA 3MX0B 4FG4A 4AGPA 2RA1A 2Y36H 5CBAA 2Y7QB 3OXSA 1G0YR 1IC4H 1S7TB 3BPLC 1JMXA 1SYVA 4TS6A 1HKFA 3MV8A 4G42B 5FB8B 3STZA 3SPVA 5I30H 3KYKH 4DPRA 4YDZA 1DJGA 1XAKA 2WCGA 5LAXB 4IBZA 5EU7C 3QJRB 1T21B 2XACC 5DEGA 5C0CA 5AD0A 3AY4C 4HMDA 5T1KA 4FABL 4ZBJA 1ZIAA 3FO0H 4N2NA 3UDWC 3TYGL 2Y5TA 2NRDA 3CNKA 2R2BB 3U0PA 3O3EA 1XGYH 3MRIB 3BE1L 5DRXB 2OJZL 2RIKA 3QZWG 4JE4B 4OM0L 3DPBA 5L2JA 3N85L 5CLZA 1ZIBA 4QRRA 4Q0XL 4L8DA 4LCUB 1JZ2A 1WD9A 1UC6A 1BZ9A 3BYYA 3BUDA 1JGUH 1FH5H 1DVQA 1XGZA 3APFA 1OIOA 2JXMA 1UJ3B 1AD0A 2R56L 4RNRB 5DJAA 3RAJL 4I3GA 1N4XH 1URIA 2J21A 3EH4B 5GSRB 3DUUB 3E6HA 3H85A 3NQKA 3VW3H 2DICA 5I8KL 1KY7A 2WNXA 3L1OH 4L4VE 3DJRA 3ZO0A 5ALCH 2NY4D 3QDGB 3U0TB 4PVBA 3RKDD 2WOYA 3NSCA 1U2YA 1JZ6A 4HSAC 4IDLA 3WDJA 3WO3B 4BINA 5I6XB 1PW3A 4PJ7F 2RFXA 3BMVA 1NOAA 4Q14A 4LDEB 4UQDA 1GKEA 1S78C 3MA7A 5FW6A 2LABA 1RZGB 4HVBA 1EEYB 5FGCE 2OTPA 5GGTA 1T0PB 2OSWA 5L7XH 2OXHA 1JI2A 2XG4A 4Y7MA 1FJ1A 3VFSB 3HG3A 4FNLL 1FG9C 4P2QE 3MV9A 4MNQD 3O45B 4OD1L 1Y0LA 5GS0L 4QD2E 2ARWA 3L5HA 2B9BA 3EOYG 4UDUA 2NY6B 4K94C 4JM2A 1GYWA 3LH8A 3I9IA 4OLEA 5L6YH 2Z31D 2H26B 1Z9PA 2D7QA 5I8OL 2WXOA 3ESVF 1SUHA 3QDJD 2C9SA 2PXYB 5EU3A 5C08E 3KD4A 4IJ3C 4WWNA 3GIZH 3GWJA 3P0VL 3RJOA 2PW1A 2QTVA 3CFIC 3SKUD 4O9HL 2XA3A 2G5RA 4OLWL 3HZYB 3VXQA 2VXSL 4PJXE 2WSKA 5ID0A 4BQ9A 1C1EL 2DF3A 1MAKA 4IK7A 3VTTA 1ASOA 3G08A 2JJWA 2WN3A 4WEEA 4PJGB 4JKMA 1T7XA 1QACA 4KH9A 3A21A 4PJ5E 1A66A 2D8KA 1A65A 4KDTC 2Y5QA 5D7LB 3ATBA 1ZA6A 1UZ8B 3INUL 5DVPA 4TUKL 4YX2H 1MCDA 1F3DJ 4IOSD 4MGXA 4I3RH 5J56B 2XBDA 4ECNA 4YHOL 2CZNA 3HZKA 4RRPA 1IJNA 1AGFA 3FQRB 2BIPA 4Z0XB 1DVTA 1GC1H 3BFWA 4BGDA 2FIKB 4IRJB 4RH4A 4JB9L 1JGVL 5E8OA 3C6LA 3QULA 2R15A 3UJTL 1KPVA 3BUYB 4GO9A 3KBEA 1A5FH 4H4NA 5GS0C 1SY6A 4F7KA 1T1XB 3F5WA 1U91A 3HCVB 1DQLL 1QVOA 3QZWB 2ZXEB 4HCRH 1L9NA 5FIEA 3C09C 4F7MB 2Y6SC 2P44B 1WIPA 3DWTA 2R8SL 1NGWA 2LTQC 1G9NH 2A6KB 2X28A 5JORB 1SFHA 4OLXH 1YLBB 2WY3B 3FT4B 2G2NA 1FN4A 1FAIH 2BSTA 5IHZA 1BG9A 5EU6E 3STLB 1TYRA 2XLLA 4RGOH 5DXWA 2VR3A 3FNKA 4NBXB 3ZIMA 3DO7B 5I6LA 2NR6A 3QEQE 2YMXH 3RVTC 4XX1G 3ZRFC 5CCJA 2E6QA 4NKDB 5L4MA 3CU1A 3MJ6A 1USZA 4YDIL 1RJCA 5EEWA 2WTOA 2J88L 4XH2A 4LCWE 4XVTH 4KVPA 2YKKA 4FFZH 3ZKQD 4YSAA 1QRND 5FKAA 2PPFA 1KJ3L 2YQ3A 3L5XH 5GZND 4GMSH 2Q2LA 4POYA 4C83A 3NH7L 2JIXD 4DEPB 2BSED 1OAXH 2A9DA 2X4RA 4Q4IA 1JK9B 3WEMA 4ANKA 2AABH 1TXKA 2GBVA 5TE4H 5D1XB 4NNPH 1HT6A 1X5YA 5HJ3A 1DTUA 1TQVA 2HCZX 3D1MC 1JCVA 1CLZH 3GJEB 4ZZFA 2AQNA 3DXAA 3EO9L 4H44C 4XWGH 2CXGA 5JHDB 2VC2L 2Y7LA 1XWVA 1SXZA 1BEYH 4KWUA 4A2FA 3OZ9H 3IKCB 2VABB 2VM3A 6FABH 3UG5A 4R7NB 3NZ8A 4XMWA 4JFEE 4YSPA 2VOTA 4TSAL 5F71A 3N42F 2IG2L 1NKRA 2XIBA 1OTSC 3D25A 5LGYA 4ZFOL 5JLZB 3JWDL 1A7RH 1NGZA 3TFBA 1TZOA 3IDMA 4APQC 2BMKA 2EDOA 2AEIT 3OKLA 1OP3K 4ZX4A 4DN4L 4XO5A 2ZWKA 1JAEA 2HRGA 1YEKH 2ZNWA 5K1JA 3MZTA 3TA3B 4I0PA 2JELH 2J43A 2HTLC 3EJZC 4YC2C 4XP4H 5MEPB 4PBDA 2DWYA 5DQ9A 3O6FB 2Y7MA 1CE1L 1HHHB 2IOMA 4Z3EA 5DFVC 3KM1A 2I5YL 4H0GA 3MNWB 3TPUA 4L8CB 3NACL