4QTFA

Structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
349
structure length
349
Chain Sequence
VPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,d-transpeptidase LdtB
publication title Structure and specificity of L-D-Transpeptidase from Mycobacterium tuberculosis and antibiotic resistance: Calcium binding promotes dimer formation
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4qtfA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qtfA02
5E5LA 1Y7MA 4LPQA 5E1IA 4ZFQA 4HUCA 4A1IA 3ZQDA 5DUJA 4A1KA 4QRAA 5DU7A 4K73A 4GSUA 3ZG4A 4A1JA 4JMNA 4QRBA 4A52A 5D7HA 3VYNA 4XVOA 5LB1A 4Z7AA 3VAEA 5K69A 2MTZA 4QR7A 5LBGA 3VYPA 3ZGPA 3TX4A 4JMXA 5DZPA 5DC2A 4GSRA 5DZJA 5DCCA 3U1PA 1ZATA 3TURA 4HU2A 4GSQA 5E1GA 3U1QA 5E51A 5DVPA 3VYOA 2HKLA 4LZHA 4QTFA
chains in the Genus database with same CATH superfamily
3ETTA 2IXQB 2XI9A 3MNZB 4HP5A 1ROWA 2OL3A 4R90L 4IRJA 4KVPA 1I7ZA 4HWEH 2XNAA 2IQ9H 5JNYB 5EA0L 3VA2C 3FSZA 3QI9C 2IANE 4HJUA 2MCAA 3EOBB 5ANME 4JPIA 4TXVB 3EF7A 3V9FA 4FG6D 4DF9A 3FBKA 3T6QC 1QFUH 3G5ZA 1NGQL 1OY3B 1KT2B 4QTIL 5E0FA 3C8HA 4Y0GA 1K4DB 4RGND 5MEOB 3QQDA 3LNGA 4Z76A 3APMA 2E7CA 4FTDA 4RIRB 5L7XL 5D96C 3WD5H 2VZ3A 4WKXA 3IKCA 4R0LC 4J7RA 4FYTA 4JY6B 3FU0A 3HBPA 3L3DB 5ABDE 3AACA 3O3AA 1U8PA 3QUYA 1JHLL 4QD2E 3UTSD 1FNEA 2OI9B 2LW3A 3DX9B 3ZKMC 3LRMA 4ODVL 3PHOA 4Z8FL 4P9HC 1AANA 2P28B 1RHHA 3LNEA 4ESKA 4YHLH 5E7BA 2VJXA 2VLJA 4IU3B 3WGUB 4H1LA 1FVCA 3AM8A 5D8JH 3L5IA 5FA4B 3OAUH 4YHOL 1LO0H 4AKQA 4HK3J 1CT8B 1R5VB 4XMKH 5FKPA 1QBLL 5I17B 3D33A 4Z7IA 2W9DL 4ZBJA 4I18B 1UVQA 4OT1H 5LWYL 4MFHA 3O9WC 1QI4A 1CICC 3PQYA 3ETSA 2H1PH 2OL3H 4YO0B 3WNNA 3EYOA 1EDQA 2Z8SA 4DP0X 3M45A 3M8OL 3SOTA 4BGDA 1FQ9C 3UYRH 1QEWB 5E9AA 4N0YH 1ZHKA 1RULL 3E6HB 1JUFA 1LO5B 2C3VA 3EH2A 3Q44A 4HMEA 1F4YL 4PJ7B 2BP0A 3S4SA 5B4MC 2W81C 4JVWA 5J57B 5FHBL 4BFJA 4A6YA 4OJAA 4WV1A 3ECQA 3PV7A 3F7YA 5IZ7A 2NQCA 4RBPK 3QUZB 1KC5L 4BZ1L 1IE5A 1OB1B 4NENA 1UT1A 4BIKA 3BIKB 3QRBA 5IFJB 3JV6B 3TT3L 1O7DE 5C71A 3G6JB 1PSKL 2VDPB 3MNVA 4ZOCA 2ITDA 5JHAA 2BNQE 4TVPE 5AQ0A 3OV6A 2WLJA 5T3XD 4GAJL 3PXLA 1FE8L 4WFED 3HB3B 3U0PB 5IV2A 3MCYA 3K6DA 2WIMA 2YMTA 1I4FB 2OMYA 3VXOA 5DJAA 4LT7A 5IMKA 3KJ6H 4HGWB 4PVMA 4Z7NF 4U1SB 1MF2H 4XTRC 3GB7A 3P4MA 2G5BB 3MRBB 1KLGB 3MJGX 5IBTL 6CGTA 4I0PA 2NPLX 3DX8A 5K59E 3BE1H 3BAJA 4XPTH 3RFZB 1NICA 2GSIA 4PFEA 4FFYA 3CVBA 5HI3C 2O5YL 2X88A 5DHYA 5JA9A 2QPSA 4Y4FB 3GI9H 2EZ0D 4OCYL 3HAEB 2MPVA 4X6DB 3PABB 4Y9EA 4ZPVB 5AENA 2BIOA 3ULUH 1PNCA 3S5ZA 3ILPB 3MU3A 1DJXA 3QWRD 2YEQA 1DBML 2GBAA 2LVEA 3SKNB 3FTZA 4XXDA 3KGRA 1MRFH 1FZKA 3QFJA 4GAYB 5F1OB 5JOPE 1AACA 4JFHD 2M26A 4ZOAA 4A6YH 1KDIA 1T4KA 3KPRD 4IKLA 4RGMB 3TNMA 1YY8A 4I77L 32C2A 5DMIL 3PNRB 4KXZH 3GJFA 4W1TA 5HDRA 4OZHA 4AYEC 2CIIB 3FTGA 1ZTXH 4G6ML 2VO5A 3JV4A 2VJ8A 3OAWA 4DFHA 4J23A 4XN7A 1BSIA 4PHXA 5LUMA 4R3SB 1IBGL 3SGEI 3UO8B 4K3EH 4X6BA 5D1QB 4E0RA 2RQ8A 4L9LA 4LARL 3QUMH 2HMIC 4DKFH 1I31A 5SWQB 1JGDB 4GS7C 1NCUA 5ENWB 4NS0A 1A3RL 4BH7A 1HWWA 1ZMYA 2EILB 3GK8L 4U1NB 2X6MA 1E2ZA 2YKLH 3GMLB 1ZCRA 1BP3B 3A6BH 1MCNA 2CDGA 2DD8L 4GRWF 4JJOA 4TMPA 3RGBA 1U91B 3L45A 4IMKA 1RHFA 1W72L 2IH8A 3DROB 5EZPA 4DQAA 4OZGE 3VD0A 2YD3A 2CRIA 2RD0A 2FLMA 3AUVA 3BN9C 4LAJH 1OSPL 3MRFA 4ZTOH 3WE1A 2APBA 4OGXH 3HKFA 2WK2A 3V9EA 3DX1A 3UIYA 2F54D 2BDNH 2H0FA 4FL4C 3NH7L 4HKXB 4PTUB 3TTYA 4EI5B 2HJFB 4P23B 2VT0A 4AGNA 1RK7A 1F02I 2CHWA 1C12A 4B9CA 1GRWA 3FU9A 4K8RL 4LP5A 4S0SD 4FXKC 3ZDXB 3GXUB 4IDLA 3F6LA 5IGXL 5E5RB 3K8KA 3WFEL 1YEJL 5DGRA 1JGUH 1NDGB 2MOVA 4E41A 5A2KH 3BD4A 3UMNA 4LSVL 4PJ7E 1GMIA 3QJQB 4JLRB 2VDRL 2QZQA 2QVMA 2DH3A 3CFTA 3N55A 2X6AA 4YHPB 2J71A 1IBYA 1OAJA 2K9UA 3K6OA 4FNLH 2IOIA 3PWVB 2OMVA 1CGYA 3LN5A 3L81A 4L0PB 4QCIB 2F7QA 3L7EA 4P5TD 2Y06H 4KV5F 2C3XA 3LS4H 3D85B 1EXGA 2FYYB 3PWNA 3CFJA 3G6JE 3VFVB 1M7DA 3MSPA 3P4OB 1XGYL 1JV2A 2D3JA 4XXWC 4OLUL 5L2KD 4FULA 3E1ZA 5CINH 3WIIL 5M7QA 4L5FE 3BVWA 3GM0A 2YXMA 3L5JA 4LEBA 5ICUA 1U8NB 5FO9B 1I3VA 1BQHA 3GI8L 5IESL 3AG1B 5EU6A 4Z7WF 3JQOB 3WTWA 2A9NH 2Z31B 3EOYG 1KFAL 2WCGA 2YSTA 3KS0H 2NX5D 2XVKA 2OYKA 5AVXB 1YEGL 3BEVB 3NJGA 4QOKB 3U9WA 1RZKL 2E9BA 2Q3AA 5J9PB 3LPPA 4PEEA 2YXVA 3MNDA 1S78C 1OM3L 3KXFA 4NKIL 4HJTA 3BDYH 4PJGA 3B7UX 4ZW6A 4X6DE 2BWIA 4MDIA 2NXZD 2OXHB 3DLQR 4PG2C 4E2OA 1IAKB 3BUTA 3RA7L 3E6FB 3C5ZB 1RD6A 3P0VH 4L9DA 3D3VB 1CD8A 3ABLB 4L37B 1FAIL 5ACZA 1ZE3H 2BSED 1HKLH 1J1XL 1RL1A 4OJFL 2TRYA 4UQIM 5DD6A 5J4MA 3EFFB 3O3BA 1GYVA 4WHTA 2NTSP 5HI5C 4HUWA 4LSQL 3LH2H 4KITB 3QDMA 1DJIA 2HLFD 1JE6A 1NCOA 1A7RH 1WF5A 2O6EA 4JZJA 4R2GD 4IMLA 3WJJA 3BO8A 4GBXA 4YL4A 4HKJA 3T4YA 2OMTA 3GXPA 1UKTA 1B9KA 4OD2B 1TTFA 2X2UA 5DVNA 1IGMH 4PJ8C 4OZIA 4S1RL 1KMGA 3DTUB 3WENA 3N1QC 3BC9A 5E5MB 1E28A 5BOZG 2B1HL 3H9SA 5D1QE 3TA4D 4QRTA 1Q9OA 3K72A 1XCTA 3VVWA 4E42A 1E4WH 5F9JA 4WU7A 3A47A 2J6WA 2W5PA 3GPSA 4LLYB 4PGBA 2E75C 1FC2D 3BT2H 1V3JA 1WS8A 2FD6L 1KXTA 4JQXA 1JPTL 4QRQB 3VNYA 2ZKHH 3H9YA 4ONHB 5GS1B 2QSCL 2WYZA 2EIEA 3K91A 5K39B 1UACH 4ZFOB 1S5IL 3O4LA 3K1KC 4Z95H 5IJVB 1BQKA 2CSPA 4OB5L 2LTQB 3QT2A 1ET5A 4ETYA 5BS0B 3UACA 3VNZA 1VFBB 2NNCA 1E5BA 4F8NA 3KR3H 1FIGH 2HX9A 5DD5H 5ID1A 3GMOA 3V5HA 4UM9B 4JY5L 3CSYA 5I1CH 1AKPA 1HHGB 1SYSA 2QTVA 4ZTPL 5A16B 3G5VB 4CMMB 4W4OC 2E7HA 5CJQH 2D31A 4JFZH 1CGVA 4HC1L 4BFNA 5IB5B 4KJPC 2ICEB 1BFOA 4ZW3A 2OXGA 1FWXA 4C59B 2AHIA 1Z5YD 3G3LA 3ZL2A 3NJVA 5MEQA 3T8XB 1DDHA 1CUOA 1I8AA 2FLBT 3BFWA 1E4JA 1G4MA 3QQ3A 5IHUH 5BMFH 2VDKL 1D6EA 4NGHL 2OL3B 2QVKA 3OL2A 2HPOA 2X3CA 2XNAB 1MFCL 3VAEA 4PRHA 2FJHA 2XRAL 3FTVA 4JPIB 1QQDA 2C4XA 4XVUD 4B9JA 5CBAB 5I2IB 3B2DC 1WLHA 3G5ZB 2I85A 5LO7A 3DO3A 4MJID 1EEZA 2VRAA 4HAGA 2VZVA 3T5WA 2JB6B 4S1SL 5EA0H 1GAFL 4ZFQA 5A2BA 3QQDB 3CBRA 4FJZA 5C0IA 3BPNC 4UB0L 6TAAA 4IBVA 5IFAL 4Z76B 4O5LL 3CN2A 4M6ML 3UYPA 4PLJD 5C70A 1DYZA 3HMXL 1NGQH 3IKCB 4ZS7L 4K94L 2HFTA 3LKPA 3W11D 4QTIH 1PD0A 2Z93A 1RMFL 2ORBH 3FUHA 3MLVL 3O3AB 1U8PB 3QUYB 5I16B 4MMXC 3P3SA 2DQCL 3QNYA 5L7XH 3NZHL 5JQ6L 4X8CA 3PHOB 1RAMA 5EEWA 1RHHB 3QIWC 4KC3B 4UZUA 1PZ2A 2HP4A 4H1LB 1YPZE 1FVCB 1JHLH 2XA8L 2HTLD 1OAKL 5I24A 2O93L 2QKIC 4EAEA 1VZGA 5C0NC 4FG0A 2CK0H 4ODVH 3D3VE 3VI3B 4Z8FH 4N8CL 4HGKC 2V5YA 5IKCA 1UVQB 2D4DA 4Y1SA 1IM3D 3PQYB 5JORA 4XWOC 4EZKA 1IEAA 3EYOB 4YHOH 3BX7C 2Y7OA 4HGMA 1QBLH 3U2IA 1ZHKB 2WUBL 3ATBA 4F9LC 1JUFB 2LGNA 3WUZA 4TVPL 5FW8A 5LWYH 4NWTL 3K71A 2F15A 2WD0A 4KUCD 2BP0B 3EW3B 3FQ1A 4RMTA 4X7CC 1FL6A 1XSOA 4G7QB 3OLGA 3M8OH 3L4TA 5DHDA 4AJVA 4WV1B 2ZNWA 2H1LM 4B9PA 2QQLL 3F7YB 1TJHL 2ZX5A 2JH2A 4NENB 1KYFA 1BHGA 5I0XA 3UG4A 3TO4C 3B9EA 1TSRA 1F4YH 1FZOA 2CLRA 4KXDA 5FHBH 2EUXA 2G60L 1F4HA 1RIUH 2BP3A 4OBSA 4G71B 5CEYA 3DGCR 3MNVB 5C9KA 2ITDB 4B96A 4ZAKB 1WE5A 1H3XA 4JANA 5C0CA 1KC5H 4BZ1H 3P1VA 2CRYA 4GG8A 4FABL 1CQYA 3DARA 1H3PL 1KYAA 3INUH 2H2SC 3AY4A 5IV2B 1RURL 2W0FB 5BS0E 3VXOB 4WCYL 4NLAA 5DJAB 4GO8A 5C08D 2D9CA 4Q89A 1X9RA 3TT3H 1RPKA 3MCLL 2X40A 4AQ1A 3N40F 4FMKA 2NR6D 1O7SA 1PSKH 3NP3A 4G7VL 1IC0A 3GB7B 3P0YL 5INCB 4GAJH 4I0PB 1FE8H 1BAFL 3AXHA 3DX8B 1OOWA 5FS5A 1TZ8A 1AQHA 4Y89A 5I1HL 2Q9OA 2GSIB 4X6CA 2AGJH 2BOLA 5INDA 3FUDA 1C7TA 1ZXKA 4J3WA 1DEDA 5DHYB 3RFRA 4BGLA 3MRNA 4JO4L 5IM7A 3UADA 4G7SB 4LKCA 4ILDA 3V8OA 4G9FE 5E2VL 2VR5A 4HS8L 1EDHA 1W72A 3MV7A 2I69A 2L04A 4XXDB 3L54A 1FZKB 2JSFA 2YD5A 2LHAA 3LKRA 3QFJB 4PJDA 5HXMA 2R69L 2DICA 1F1AA 2O5YH 2OZ4L 4BCXA 2DWEA 2Y1AA 3KWXA 1T4KB 3ARSA 4YEEA 2XXFA 3TNMB 1JG9A 1YY8B 32C2B 3T0BA 3IJYA 4IIQB 4RLDA 3HEIB 4E5XA 1DBMH 2ZWSA 5ITBL 1DTUA 3GJFB 4FAAB 5BO1L 4OZHB 3ZN6A 4XC1L 3ZOAA 2Y2WA 3FTGB 1BGXL 1CTNA 2MTPA 4J3BA 4JNXA 2ZICA 1MW2A 3JV4B 2HN7A 1AH1A 1QSFA 2PP8A 3L3GA 4KI5D 4UT9L 4AT6A 1AQ8A 4KOBA 4PD4K 4YHIA 5F9DC 4E0RB 1FNHA 3P4NA 1U3NA 2BERA 4ICXA 5EUOA 4L9LB 3LPFA 2Z8RA 5BXFA 4XNZC 4P5SA 1MKFA 2XFXB 4G6MH 1EHLL 4JREB 4Y19D 3CHQA 1A1NB 4BH7B 3JVGA 1MAKA 3AITA 4OFYD 1IBGH 1OTUC 1JNNL 2WTPA 3T3PE 2ZOKA 2CDGB 4OJYA 4AV0A 2J44A 4OI7A 2Z1PA 4LARH 3BYTA 4V1DD 1V54B 2E0PA 3V0IA 5GIRA 3Q6FB 3T6VA 3DV6A 1A3RH 4LL9A 5J6GA 3WTVA 3QQ9C 1HHKA 5HHPA 3GK8H 2MCG1 3UAEA 3VI3E 1JXJA 5DMGD 3LS5L 3X1FA 3OLDA 3PQYE 4LCYA 2X87A 1LTXA 1W72H 3P73A 3HC4L 3LZRA 2DQHL 2AXHA 4UTAA 1JF1A 5D7IF 3NH7H 4U3HA 5IQMA 2YUVA 4Q52A 2XZCH 3QYMA 4O02L 4AIXA 4L5FL 3H3PL 1XD1A 4WUUD 1UGKA 1XXDC 4MYWB 5IGXH 3QE5A 1CFTB 3KVQA 1YEJH 5E6UB 5B1JC 4FOMA 3WFEH 2X42A 3ULVE 4P3CL 1I1FB 2OMVB 3EJJX 4Z77A 1ZRUA 3LN5B 4LSVH 3I9GL 1N18A 3BAEH 4IOIA 3LEYL 2VDRH 5KW9H 4X50A 4DPCX 1PDKA 3KH3A 1M7DB 4UOJA 1BJMA 3Q13A 2X4UA 1JV2B 4GSUA 4N6RA 1XF3A 4M03A 3V5DA 4QLRA 4LVOB 4DPAX 3T04D 1OPOA 2JB5L 1EFQA 4HIEA 3D08A 1ZT7A 1BQHB 1BD2B 1XBDA 4PJIF 4PREA 1MY7A 2PYED 4ZMZA 5EU6B 5DJZA 2JKRM 3LJ3A 4OLUH 1P53A 1G7LA 4P3DB 3WIIH 3VQ1C 3O6KL 3TZVA 1KJ2A 4WI2A 2FQDA 4M7ZB 3GI8H 3LV3A 3PG2A 3KXFB 4FEMA 3A4EA 1QYGL 4PJGB 1PLCA 4MDIB 1YUKB 2BO0A 4P4RB 3NG5A 4DTGL 1KFAH 1U6AL 3WTTA 3KDMA 4HEMA 1HINL 1YEGH 2VTFA 1UM5L 3RP1A 2R1XB 1OM3H 5ACZB 1PTZA 4NKIH 2IAMC 4XBPA 5DD6B 1DANU 4AYGA 3DJRA 3K5RA 3U82B 4HULB 4HUWB 2ZXEB 5J6HA 2RCSL 3K2IA 3C5JA 1D9KD 3QDMB 4JZJB 4WFFD 5SWSD 1ML0A 4IMLB 3BO8B 4GBXB 4KKRA 4HKJB 5DU7A 1Z9NA 4OZHE 4WGKA 4KKZA 1FAIH 2OMTB 3RDTC 4R97B 1U8LA 4OJFH 3UTTD 5GRVL 4U4IA 2XQYA 2F53A 1NCGA 4OZIB 4LSQH 4RAUB 5C09A 1ERNA 2J8UA 1E28B 3H9SB 3NCBB 4E42B 4QRTB 1Q9OB 1XCTB 5DI8A 5F9JB 4WU7B 2ALWA 3KJ4C 4PGBB 4X83A 3RWEA 2PP9A 3X1EA 1E4XI 2DY2A 4L1HA 4PMFA 5DRWA 3BWUF 2VW4A 2HVBA 3MV9D 2OR7A 4P4KC 4S1RH 5K1JA 3UTOA 2B1HH 3IDYB 3MLRL 4P2RE 3PU7A 4FP8L 1T2QL 4FQXC 4GOSA 1VGKA 4BK5A 2FD6H 2OM5A 1JPTH 1E27B 3S3DB 4DFIA 4IRJC 5ID1B 1W91A 3V5HB 2QSCH 3CSYB 1T21B 1OE2A 3QJVB 1SYSB 4LZHA 1BIIA 4OLWL 3GHPA 1S5IH 5D1ZI 4OB5H 3VGBA 1QW9A 2FWSA 4JFFD 1WTLA 4DKEH 4F7TA 1NIBA 4JZOA 1CU4L 4ACPA 2GJZB 1BFOB 4JPWH 5CEXA 2AERT 2OXGB 2QLVB 4JY5H 1EEUA 3KW8A 1DDHB 1SHXA 4ZTPH 3SYQA 2DLIA 2XIBA 2YIHA 1MXDA 4JCWA 4RRPA 1GA2A 4HC1H 5F7MC 1IILE 4KUZL 3VXRD 4L0YA 1OTTD 1CDBA 4PRHB 1E43A 1JK9A 2AZUA 3DK2A 5F8QC 2FJHB 4LCIL 3MODH 4GRMA 3VO0A 3C2AH 4IOSD 1NKOA 2BPBA 4JG5A 2CMRL 4E9SA 3OGOE 3NAAL 2PXYA 5A1AA 2VDKH 4JO2H 1Y07A 1YVLA 3OKKA 4X98B 2IADA 2J72A 3PAZA 4JR9H 1MFCH 3VFRA 5C0IB 3ZL4L 2L3BA 2CUAA 3QEQA 2XRAH 3AM8C 6PCYA 4J2XA 3ZHNA 5I76A 3UYPB 4M1GL 4R8WL 3HI5L 1MRDH 2APFA 4HHAB 4PJEA 1TCMA 2NY2C 1BD2E 3ROOB 3ZY7A 4XMLL 1DJSA 5G5DA 1FNSL 2Z93B 4XCNA 1CLYL 4JCLA 4UOQA 5EU6E 1S9XA 4GAGH 1GAFH 3CVCA 3AQDA 4M9PA 2WXQA 4UB0H 4O5LH 2R9HD 2YD9A 4MTMA 4M6MH 5T1MB 1JN6A 2XN9E 3HMXH 3ULUC 4ZS7H 1XO8A 4JKPL 3KXFE 1RMFH 4PJGE 4NQVA 5FV2A 5HDWA 3C60D 3MLVH 1J5DA 3SDAD 4D3CL 3MLSL 4KY1H 3D39E 1CDYA 1N5AA 4YL9A 5E56A 1LEGB 5DZLA 1RPQA 4NPYA 3NZHH 5JQ6H 4QEGA 2EXWD 1DEEA 2K78A 2Y6SC 3IETA 2WQ8A 5IKCB 1P4LA 2RALA 3Q5OA 1L9OA 1TTBA 3IGFA 5CJ5A 5H35A 4WNQA 1UG9A 2BSTA 4HUMB 3MXWL 3REVB 4N1EA 2XA8H 1OAKH 1IEAB 3CG8A 4OLVL 3T3MB 5CKGA 1DVQA 1FG2A 2Y5EA 3AREC 4L2LA 4PWGA 4P2OA 3UGXA 3KCWA 1MEXL 2ZT9C 1DQIA 5JA8B 3ULSB 4N8CH 4A7TA 4Q9BA 4HOWA 3K71B 3OPUA 3MGAA 3RG1C 5LB1A 4PYHA 4X5RA 4PMEA 4PQXA 2UVEA 1WBZA 1FL6B 5AW0B 3KYKL 1CK0L 4FERA 3O2VL 1F2QA 3H9SE 3EG9A 3PL6A 4JX0A 4ADIA 5EZJB 1CL7L 3X3GL 2WUBH 3VGHA 3E3QC 4MB3A 4IRSA 4TVPH 4NWTH 2D2OA 2AJUL 1FZOB 2LLNA 2BIHA 1NIEA 2CLRB 4UQAA 3LKNB 5EIIA 1AJ7L 2OZ4A 1KTJA 3CMGA 5DURD 4X9FA 5CEYB 4AIEA 3OVUB 3DSNA 4JS7A 2QQLH 5CIPA 5CN2A 1T0PB 5I74B 4YSUA 5C0CB 1TJHH 3F8UB 4GG8B 1N6QL 2BVYA 3ARBA 1XSKA 3IDJB 1WGVA 4BUQA 5JIPA 5EF3A 2CR0A 4GI8A 4R7DA 1NUGA 2G60H 5D2NA 3TC9A 1LE5A 3QIUD 4AQ1B 4P5MB 4HIQA 2A0LC 3NA9L 2G2NA 4UT9A 3F05A 2ESVD 2XYCA 3FULA 3N0AA 2F7OA 4FABH 5CJ8A 1RURH 1XT5A 1UWEL 2BOBA 3D4ZA 4WCYH 4G7RB 4MD4A 3W0WA 2FRGP 1TVDA 4X6CB 5INDB 1NC4A 1F6AA 3MCLH 4XRCA 4Y4KA 5HJ3B 3QCUL 5BNXD 4G7VH 3MVSA 1ASPA 1P5VA 5C2BL 3MRNB 5IM7B 3P0YH 2EO1A 4LKCB 4MQSB 1BAFH 4Z7VA 1M05A 4RFEB 2G2RB 3MV7B 5G4MA 1M9SA 5I1HH 3VQ2C 2HRHA 3LKRB 3S3SA 1OOAA 4PRHE 2YRLA 1IT9H 3LIZA 5EEYA 4CSZA 2L7QA 1WAAF 2DWEB 3EGSA 4JO4H 5E1AA 1W6WA 4GQ9L 5BUAA 1OWRM 2EXYC 3FKUS 5E2VH 4E5XB 1KTRL 5AVYB 2ITEA 1JZ2A 1BZOA 2DL2A 1PCXA 3TNNA 2DM3A 2R69H 2FWUA 3COOA 3IU4L 1X4YA 3GRWL 4NZUL 3QJXA 2OZ4H 4YXHL 5KYUA 5FB8A 2HN7B 4QXWA 1QSFB 3AB0B 4JQIL 4XO8A 1MCPL 4AT6B 1M9WA 5CIPH 4C56D 5DHXB 2Z4TA 4YHIB 1DVTA 4FQ1L 1DQML 3BKMH 5ITBH 4AGQA 4OUUA 5EUOB 5BXFB 5BO1H 4XC1H 1EFXD 1BGXH 2AEWA 3G7TA 3QZMA 1VCBC 2W95A 4JRXB 3QDJA 1TZAA 1KBKA 2HJKA 1FYTD 4UT9H 5FYJD 2WO2B 1U2YA 4Y4HD 3W9EA 1I9JL 2YJQA 1KCKA 4ZMVA 3TH2T 3WU1A 3T0XA 1QO3A 1T1YA 1YEFL 1AIFA 4JM2A 2XACC 5DVOA 1AS7A 1ZE3C 1BQRA 4M4RA 5J6GB 5B8CC 1HHKB 4TVUA 1P7KA 4K3GA 4Z7UF 4FNTA 3QJUB 3OF6D 2YMOA 3EJSA 1JNNH 5TD4A 1EHAA 3R0NA 4MJ4A 4HUCA 4LCYB 3P73B 4NO3B 3C6LA 4GLRH 4PJAA 4QKXB 4QRAA 3U0WL 1KBWA 3LEVH 1NEZB 4AVHA 4YHYB 1N6UA 5FDWA 2NSMA 3RU8L 1JF1B 2F7PA 1J0IA 2ROYA 1XVSA 1HHIA 3LS5H 5F1NA 2CM5A 3NIDF 3OAZK 2V33A 3WNLA 3QUXD 2FSDA 2R8SH 2ZX7A 3SJVB 1OK0A 4LCWE 3HC4H 3ZTDC 2DQHH 1NBYA 3Q7JA 5I5JA 5C0AD 2WW8A 4L1SA 1IQDA 3BAKA 5I26A 1T04B 5DK3A 4Z77B 5LG1A 2X1QA 2Y5QA 4KJQD 2IC2A 1ZVNA 2JCCF 3OQRA 4IOIB 4O02H 1AXTL 1AI1H 4CJ1A 2WBJA 3H3PH 4AGPA 3Q2NA 4PLKC 4GUQA 1PDKB 4TUOA 5EC2A 3FZUC 5I15H 1OANA 4UINL 4EN3C 2X4UB 3V5DB 4P3CH 1XF3B 2FL5B 2FATL 2DLHA 1KIRA 2WXFA 2VKWA 1ES0A 1YMMD 3I9GH 1L5GA 3OSKA 4HIEB 1RJLA 1WUNT 1ZT7B 2QGBA 4J1UA 4N0FA 1R3KA 3HN8A 3QI9D 3PGFL 4PP1C 1JDCA 3T6ZA 2Y3NA 1T7WA 4JRYD 5DJZB 3MRPA 3ARFB 4GQZA 3QULA 3X13A 3GMRA 1TEGA 2JB5H 2PPCA 2OR8A 5G4OA 1KJ2B 3TZVB 1D5IH 1S7WA 2K1MA 1B0GA 1SEBA 2DOCA 5KYYA 4JZJC 3LV3B 3O2DA 1TQUA 4LLUA 2H47C 2VAAB 3F85A 2BM3A 2K70A 3EKCA 2VQ1B 1NANH 2X1PA 1TQWA 3B2MA 4RZKA 3KDMB 1FG9C 1IGYB 3FQTB 3MV7E 3UROR 3O6KH 4P48A 1PG7X 1W6LA 5KVFH 2A6IA 1HNFA 3JV5A 4UCFA 1FF5A 1SLUA 5DS8A 4OF7A 5I6MA 3K7UA 1WITA 3ZKMD 3V6ZA 5IF0A 2WXRA 4E9LA 2EDWA 4DTGH 1U6AH 3C5JB 2H26A 4LOEA 3FUJA 3JT2A 4JQXC 4P57B 1HINH 1VZIA 2D7TL 1UM5H 4EVNA 3CFIC 2BZ7A 4I13B 4ONOA 3WYRA 1U8LB 2P44B 4XX1G 2DWXA 3K0YA 4JG9A 4WDIA 5E1GA 5CXPA 2F53B 2NY6C 1MY5A 1MCBA 2RCSH 2J8UB 4YDVA 5C09B 3WNJA 3F7VA 1IGJA 5HYJD 4LAQL 5EUOE 5KVGL 1CICD 4GNKB 5ESQA 4QRSA 5T3XL 3VD5A 2BHYA 3NOIA 4JRXE 3H3BC 1U8JA 5EDSA 1U8HA 3CHRA 5DRWB 4AUUA 3HUJA 2OMWA 1T20B 4LU5L 1WVZA 4CUCA 3Q8FA 4BQCA 4I88A 5E6IB 3TGXA 5B4MD 4UDTA 4CU6A 3ETBJ 4A68A 1R3HA 2FZ3A 3NN8A 4OIFA 4LVNC 2C7FA 2IH3A 3WNKA 1AQMA 1M3IA 1DJWA 4EPSA 1L9RA 1BG1A 2HRPL 3MLRH 4QRRD 1BIIB 1JF6A 4FP8H 1T2QH 3VTMA 1NCBL 2AJSL 5ISZD 2KQMA 3EDEA 1KJVB 4OQTA 2CGZA 3LEXA 3QR1A 3CVHL 4F7TB 3SDCC 2IDSA 3NBNA 1S4IA 1MSPA 4J3SA 4JZOB 2AV1A 4FZ8L 5CEXB 3DVGA 1IFHH 1S9KC 4LHUA 4OLWH 2B2XL 1H0DA 2EKJA 3TT1L 5C07D 3SJVE 4F92B 1X5XA 3QZNA 2CR6A 9PCYA 1U3HB 4M3KB 3VXME 3FFCD 1CD1A 2RBLA 4XTRD 3ZSTA 1CU4H 3CZUB 1JK9B 1V55B 2I27N 1YZZA 1AE6L 3BRDA 2AQ1A 1KLFA 4GRMB 1MZZA 3KMDA 2WLYA 5DJYA 1GZPA 4P49A 3EHBB 1PKQE 1RH8A 1EA9C 2IALA 2PXYB 3GEWB 4F7EA 3OKKB 5AW8B 2IADB 1ZHNA 3EF4A 3L08A 1U3JA 4KUZH 1KG0A 3A3YB 2VRKA 2VZUA 4FRWA 4LDLB 3ZK0A 1CD0A 1KXVC 2VISA 1L7IL 1SBSL 1W15A 3DECA 3PAVA 4J28A 4LCIH 2VDML 5I76B 1G84A 2BWDA 2EE0A 5DFTA 2CMRH 4NX0A 3M07A 3NAAH 3N42B 5G5DB 2LFGA 5JIHA 1N7ML 4XCNB 1VB9A 1S9XB 5JIDA 1LLAA 4AG4L 2DJMA 3ZL4H 2Q8BL 5KS9A 1RXLA 3D12B 2VGLM 1JN6B 4M1GH 3CX5J 4R8WH 3HI5H 2JJTC 3QUHA 5DEGA 4D94A 4XBEL 3H7BA 3R4DA 5G4NA 1NPNA 4XMLH 1MRCL 4DOHB 1FNSH 3LY6A 1CLYH 4NQVB 4C83B 1XGPA 4PJHF 4NN5B 1OLZA 1N5AB 1IAIL 3UJTL 5LBSL 1KOAA 4FDWA 4NPYB 3TF7C 4DP5X 4ZI8A 1DEEB 3IE4A 1J5IA 2HMID 4JKPH 4G6KL 1P4LB 2UWEA 1WWBX 1UQSA 4DW2L 3UEQA 3A21A 1F58L 2PTVA 1NA8A 4WNQB 5EC1B 1UXWA 1KGCE 1NDMA 4D3CH 2X4SB 3DX4A 1FG2B 3VD9A 3SKUD 1KCVL 1SDDA 4B0MM 4N0CC 2VQ4A 4P2OB 4X5LA 2DJUA 1GKOA 1GMEA 3EDJA 3BN9D 2L7JA 4NM8L 3MXWH 3BP6A 5AZ2L 3MQIA 1U93A 1WBZB 1N9PA 3AY4C 4M5ZL 4YSTA 4OLVH 1G0YR 3V0WH 4NBYB 3T0DA 4JO5A 2YD6A 4APXA 2WKGA 3PL6B 5E8OA 3VI4F 4AQ1C 1MEXH 2XCMC 3FN9A 4IRSB 2FJGA 2EC9T 3STZA 1J88A 2N0MA 2O1AA 1D2PA 2ZAGA 3LQZA 5EIIB 2HAZA 3VSQA 2E46A 4FNRA 2FEEL 3KYKH 1CK0H 3FONA 4GKSA 3HG1B 3DSNB 3LN4A 3QWOA 5FGRA 2Q7YB 4XXCA 3SBWC 5CIPB 2N1KA 3AABA 1CL7H 3B7TA 3X3GH 2VN3A 2H2PC 5LNDA 4N9OB 4F93B 2LU4A 1WBXA 1QSZA 5E95B 2WBXA 3ARBB 2CO7A 3OKMA 4ZX5A 3CTTA 4FQPA 3GSXA 2R7EA 4R7DB 5D2NB 3WHE0 4A2MA 1H8LA 1LE5B 1IGCL 4QGTA 4UTBL 1JZ7A 4JQIA 1HFUA 2X70A 1GHFL 2FX7L 1FH2A 1NIAA 3ZT6A 5KVMC 4B9KC 1OGAA 3BRGC 2HT3C 2BOBB 1CGWA 1TOXA 4OSUL 4MD4B 4ZX4A 3DO7B 1NEUA 4K8RC 1WISA 1NC4B 1F6AB 4XRCB 3OAYK 3NA9H 3SODB 2ZOWA 2V5SA 1XX9C 2BY1A 4WFGE 5HYFA 4Z7VB 1M05B 2B14A 4UDUA 4E9QA 3TCLA 1UWEH 1DJHA 3HG0A 1F90L 2OR9H 5CEZE 5HGHA 1XGRB 1N68A 1JERA 2X5PA 5T3ZE 3QCUH 2HX8A 1BMZA 1F3JB 1WZ1H 2W92A 5C2BH 3D69A 5E1AB 4Y7OC 1MFBL 2BH0A 3JVGC 1TQTA 4HPYH 4K5MA 1NH6A 3MLXL 3TNNB 1CXEA 1RJCA 1FHGA 1OGPA 3RVWC 3FAWA 1B88A 4F91B 3L3OA 3UZEA 5FB8B 1G87A 5DZAA 3QRFM 1FBIL 1KELL 1LO3L 2WWOA 5AOMA 4AJYV 4KKQA 1LDSA 4M8VA 4MMZC 4AM0A 4EJ1C 4OUUB 4PY7A 1U58B 4BYHA 3MUHL 3VTTA 4YQXL 4YSEA 3VJ6A 1X7SA 2GUOA 1ET7A 3IU4H 3GRWH 4NZUH 1Z32X 4HT1L 3SE4A 4YXHH 1FORL 3QDJB 3KHOA 4I1NB 4YZWA 3WUWG 4JQIH 1MCPH 3D4YA 3W9EB 4XO4A 1A9BA 3ETBF 4FQ1H 1DQMH 3TPUA 4NQQA 5A2CA 1QO3B 1AIFB 1RZKC 2ZUWA 4DGIL 4NC1E 4KY2A 5IT2L 4G2AA 1HNYA 3UTSA 1P7KB 1BG9A 4PJ7F 4AYID 3NEOA 1IC5H 3IBEA 1I9JH 2E9JA 3L5WA 4A7SA 2OLDA 1YEFH 3C6LB 4PJAB 3UXFA 4QHNA 5BOPA 4HYTB 1JNHB 1AHKA 5FDWB 1MHEA 3PCYA 4QHUA 5F1NB 1ICTA 4RETB 4JG0L 2VRQA 5GS2H 3G6JF 3MNWA 4BWUA 4Q6KA 3U0WH 1NBYB 3SY0A 1INQA 1PVHA 4BZYA 3E38A 4M62L 3RU8H 5DJ8A 5E8EA 2CUHA 4O9HL 5I6PA 1U2CA 3QQXA 2VN7A 5MI0C 4KJPD 3FXIC 4TUOB 3HG1E 4MB5A 5EC2B 1JPFA 1AY1L 4HU2A 1LVEA 2RJMA 1SHMA 4HBQA 5CKAA 4DHLA 5E99L 2KYIA 4BQBA 1LHZA 1KIRB 3LHPL 1R3IH 5TF1L 3SZ6A 5AAWC 1L5GB 4UUJB 4TQEL 1SMOA 1R3KB 5D2NE 5JW3L 4I87A 1C5BH 4X6DF 2YAHA 1GYWA 2ZXBA 3CLWA 2OMZA 3WY3A 4UINH 2J8HA 3V0HA 3PREA 3ZRCC 1X9UA 3K2KA 5J11C 3D25A 1D5RA 2J1YA 2JXMA 5IWLA 4BEIA 2FATH 3QULB 2I9LB 1IX2A 4LP4A 3X13B 4PM1A 1ZJBA 2HUEA 4JHWL 5F7EL 1S7WB 1B0GB 4NO5B 5KYYB 1M2OA 4TL4A 2B77A 3PGFH 3G6AA 4LLUB 4X6EA 3V10A 2DQIL 1F97A 1MPAL 1O6TA 4J6RL 3L95A 2JJWA 1UH3A 3QFDA 4ZO6A 4GUOA 3AT9A 3D2UB 2A6IB 1DBBL 5CGYC 4Z3JA 2FT6A 5DS8B 1BX2B 4PB0L 4WSJA 3WY2A 3OR6B 4U6YA 3HRPA 1PD1A 3V6ZB 4FS0A 3U4EA 3HE7C 4NQTA 2Y7QB 2YSSA 3HPLB 1HS6A 4X4XB 3SGKA 4FFWD 2H26B 3VFMA 3QIWD 2EE2A 2EDFA 5LN4A 1OCOB 4RNRA 2VL5A 3QWRA 5ETUB 1D7FA 4G8IA 1AMYA 3RQ3A 4EVNB 2IOOA 3IMVA 5B21A 3B5TA 2HUHA 1TEYA 3BCFA 4CADB 4R7VA 5C0ND 4WDIB 4M7KH 1QR4A 5J1AB 1FL5B 2WMPA 4MDRA 1LDPL 4YDVB 1SEQL 1IGJB 2MEJB 5HJDA 2D7TH 3KPRA 2VLRE 1T83A 4WFHE 4BE6A 5ESQB 4QRSB 5JXEC 3IJ8A 3HKZA 4K94C 3UAFA 1I7UA 4QGYA 2UX7A 5GS3A 1HNGA 1U8HB 1MH5A 2VLKD 4IU2A 1UM4L 3Q9PA 1BZEA 4PRPA 2A83A 2OMWB 3HUJB 3O4OC 4L8SA 4OF6A 2WQXA 4L3ED 3U9UA 3MRHA 3QQ4A 5ADOH 1DQKA 4Y5VB 2XQ0A 3ZDXF 3LZFL 4LAQH 4JW3A 3ARWA 5KVGH 2GPZA 5DJ0B 1FI8C 5T3XH 2EE9A 1HE8A 2R0WL 1L9SA 1R3HB 2FZ3B 1E3ZA 2UXVA 5E8DL 1UB6A 3DBXA 5CCGE 1KBPA 2EIMB 2E4TA 3RTQB 4RX4D 4LU5H 4H20H 1MLCB 2YKKA 3BAIA 5B1BB 2VR7A 1CFNA 4PJAE 5C7ZA 3QARA 2AQNA 3WMPA 1I3RB 4TYUA 3LEXB 3AZUA 4IGBC 1MOEA 5JHDA 2MMXA 5EO9A 3ZW3A 3V4PL 3QISA 4OF0A 3DXAD 4FLHA 3DVGB 2HRPH 4LHUB 2H2SD 4JK0D 3KD4A 1TG8A 2F54A 4YAQB 1NCBH 2AJSH 1FNAA 4UV4L 4F2MB 2WYTA 1EAPA 1CD1B 5IHLB 1U4FA 4LLWB 3CVHH 1XIWB 3BD5A 4ZTEA 2JJSA 4IDJL 1HILA 2HFEA 3BD3A 4FZ8H 1PX4A 5LBSA 3TP4A 2OYLA 2LOEA 3EJUA 1TCRA 4V33A 3HR6A 5DJYB 2B2XH 3TT1H 2IALB 1RJZA 4J3TA 1U0QA 4F7EB 4UV7L 3PWLA 1CVSC 1NQBA 2V9QA 3CFBA 2C9QA 1HEZA 3NRQA 3PWJB 2QDVA 1DVZA 2GHZA 3ZT7A 1SBBA 3AG4B 4D9RE 1AE6H 2VISB 2WLHA 3NPSB 3BYYA 4Q2ZA 2HFGL 5J13C 5FCUH 3A4FA 4XNBA 5I0DA 3S35L 4XBGA 4P5TA 3Q3GA 4G7YL 3V4LA 3HPJB 3MA7A 1WA2X 3CZFA 3PNWB 1OPGH 2QPDB 4LCCC 3RHWK 3ARRA 3H55A 4G70B 4N2FA 4Q6IC 1IVTA 1SBSH 1L7IH 5I1DB 3X3FL 1KBGL 2VDMH 4APQC 3KW7A 5ICZA 1XZWA 5L2KA 1X5GA 2YC1A 4WNSA 2BS9A 5AL0A 3H2WA 5T1KD 1XGPB 3US9A 1HYSC 2P43B 2YPKA 4XWGL 15C8L 5C1MB 4AG4H 4AVJA 3MC0A 4UOW1 2Q8BH 1G94A 2C26A 2B5IC 3RVUD 3SD2A 2ATKA 1BXAA 3EOAA 1MVFA 4NAQA 4XBEH 1JP5A 2XN2A 4M8RA 1MRCH 2UWEB 2PLTA 1UQSB 3QPXH 2XWCA 2Q3ZA 3ZHDA 4G82A 5I1GL 3LCYA 1UXWB 2YFNA 1NDMB 4UTBA 4ECNA 3ULAB 2EDHA 1IAIH 3UJTH 4WHYG 1OTUD 1SDDB 4JHUA 4X9HA 3B2VL 1RUAH 5LBSH 3ZKXB 5KYXA 2PNDA 1SXCA 3P3TA 1YCSA 2VABA 1FIEA 4G6KH 3LNDA 4DW2H 5LLIC 1F58H 4YFLI 3EIFA 3BP6B 2JFCA 4OLXL 4UQBA 5KVEE 5L6YL 2BSEA 4KDTC 3RX8A 1S9VA 1KCVH 4WGWB 5E8OB 4WI8A 2G3ZA 1ASQA 3VG9B 2KPWA 2FJGB 3STZB 4UYPA 4JMXA 3F6IA 4NM8H 3O45A 4GY4A 2CO6B 5AZ2H 4M5ZH 3FL7A 5CHNA 1Z9LA 5FUZL 1KENL 2JIXD 3FONB 3DDGA 4GKSB 3KL5A 3MACL 3CSGA 3DPDA 3QWOB 3ARDD 4FHKA 4HHGA 4Y4KC 3RPKA 3ET9F 4EIZC 3RZCD 2MTAA 4KZDL 5HVHB 1WBXB 3IDMA 2C9SA 4G8GD 2CO7B 3OKMB 2E5EA 3UTZA 1CE1L 2R7EB 5D4JA 3AXIA 5LGJA 4FZEH 5BRZD 1TTAA 4JKKA 2CXGA 5A2IH 4MXVE 4G59C 4JQVC 2C1PA 1H6UA 2FNWA 4EMZA 2J12B 3K8MA 3IJHA 3OZ9L 3ZE0E 1Y1UA 5MEND 5AKRA 1IGCH 1N64L 4UTBH 3OKOA 1GHFH 2FX7H 2XTSA 3BUBA 4QPEA 1RJYB 1UYWL 4F2ME 4UDUB 4F37F 3TCLB 1X5JA 3FT9A 3MRKA 3H9HB 1GH7A 4MXQC 4AGLA 3SGEH 4EQ3A 4WJ5B 4XP1H 2CHZA 4FQJL 3KL0A 4H5SA 1ETA1 4LF3A 4MB1A 1SJHB 3R19A 3DRTB 3D69B 3N1MC 3GSRB 1UUSA 5ACLA 1SY6A 1A65A 1LWHA 1NGXA 2G75A 2P46B 4UTCA 5DXWA 3UH8A 4FQCL 2R29A 4RRPM 1F90H 4Z0BL 4ZG1A 2E9IA 1TTGA 4ZNCD 5C3IA 3GDCA 3L3OB 4JM2C 3HG3A 1CGXA 1MFBH 3SPVA 1J12A 5IVZA 2X2YA 4HIIA 4RA3A 3ZZLA 2IAMD 4P5KA 3MLXH 4PY7B 5HGBA 3TJEL 3VJ6B 2GUOB 2IQAA 4A39A 2X0WA 4MJIA 3S88L 4O58L 3ESMA 4W6YB 3RWFA 3VI3F 4JFED 4RGNB 2ZXQA 5K9QI 3L8QA 3GUFA 1FBIH 1KELH 1LO3H 2P49B 5ELIA 1A9BB 3TPUB 3RDTD 1IC1A 1AGDA 2CLVB 4YWGL 3RVTD 1N0XL 2ZWZA 1I1AA 4MHHG 1GL4B 5HHQA 1WAEA 2D7PA 3HLAB 3MRGB 3TIEB 1PG7W 1S7RA 1XGQA 1AD9A 3UTSB 3ARXA 4MD0A 3EYQC 2CGRL 3GGWB 2UWEE 1MJJA 3O8XD 4HLEA 8CGTA 3K6SB 3BLKA 3L5WB 2FO8A 4KXZI 1LEKA 2V37A 2Q2EB 2PPEA 1PZSA 3V5KB 4JCMA 3D50A 3OMZA 4DGIH 2EIDA 5LXGL 4QHNB 5CJXA 1S2EA 2BK8A 3NSXA 3Q6GL 4YNYA 3KPLA 4U6HA 2WBJC 3BKCL 4X4YB 3ULVF 3DX3A 4G1MB 1ETJA 1MHEB 2A77L 2P45B 5IBUG 4FQXD 4JG1L 1RCYA 5I9QC 3FN0L 5IFHL 1YG9A 1SY6H 4N68A 2XWJA 5K9OA 3DUUB 2J5WA 4FE9A 4K5NA 1IBFA 1BZ8A 4BXSV 4N24A 1D2OA 4XNYL 3MNWB 1IM3A 3SY0B 1T66D 1INQB 2EEAA 5DJ8B 4RMBA 3MJWA 1Y6KR 3VA6A 1T0OA 2DLTA 3H54A 4JG0H 5TPWL 1D7CA 3KHQA 2J4WL 2OK0L 4MAYD 5D70L 2ARJQ 3JZYA 3ZU8A 1D5ZB 3ZKSD 3ZYOA 4M62H 2LABA 1CBJA 3V0FA 1A4AA 4D9LL 4OCXH 3REWA 2GC7C 3NYKA 4AMXA 5C3LD 3CGTA 1AO7D 2CKNA 5FUOL 1B4TA 1E4KC 2NQ3A 4KH2A 2RFXA 2OMZB 1GKEA 1NWPA 3MFFA 4QT5A 2N56A 5DC4B 1AY1H 2J57A 1JSYA 3CSBA 5HHOB 5EEZA 1PQZA 3D25B 5E99H 2JXMB 1DR9A 3OXSA 3RWCA 2W65B 3LHPH 1JS4A 1MFDL 2DKUA 3QJZA 5TF1H 4HUVA 2VE6A 4Z1PA 5C7XL 5CSZA 1LO4L 4U3XA 4NQDE 5JW3H 1Q1PA 2DRUA 4JFQA 1GJUA 3G6AB 1A6VL 1E3XA 1S5HA 2H6OA 4KRLB 4TL5A 5T1JA 4UQ2A 1FNGA 5C08A 3L95B 1ULVA 3ZX1A 1DVXA 2NY2D 2YGPA 1G7PA 3QFDB 4OZHF 4F57H 1BQLL 4JHWH 5F7EH 3FT2A 3NUKA 4G3YL 1XCWA 1ID2A 3FU7A 5IOPB 4YSDA 4F8QA 4U6YB 4OD3L 1ZANH 1A4CA 3OM3B 4OTXL 4W9FC 3CFDA 3ZE2B 2DQIH 2N7AA 4N2OA 3U4EB 3B3BA 1MPAH 3R4RA 1JTOA 2YSSB 3ULUD 5DK0A 3N3EA 3V0VA 2E4FA 5DD0L 3VFMB 2EUWA 1X5AA 1TDQA 3WKYA 2E8ZA 4U6XA 4HWNA 1DBBH 2VL5B 1KTLA 3ZYJA 3MHZA 4G8IB 4QUOA 4AZUA 4GJTB 5BJTA 1RUPL 3QGVA 4PB0H 3SDDC 2N7SA 4AGOA 4DEUA 5E4OA 2Y6SD 4PGZA 2EEBA 4ENZA 1NCNA 2DMHA 2XX0A 1I8KA 2IEPA 5GXBB 3KPRB 1MCCA 1FDLL 5F0JB 4W93A 3UPRB 4NBZB 3V95A 3N41B 3HZVA 1FO0B 1I7UB 4XB8A 3WS6C 4IU2B 1MH5B 3ARED 4PRPB 2MOGA 2DDQL 4L8SB 3IFPA 1LDPH 2FX8L 4HAFA 3MRHB 3QQ4B 3U9UB 1SEQH 2TSBA 2WKOA 3FT3A 5DS1A 2FB4L 3IDGA 1I8UA 3I84A 3ZYZA 4DKAA 4YGAB 4LDCA 1UB6B 2OSLA 3MRIA 1UM4H 3SGJA 3Q43A 3FRPG 3E9TA 4UU9B 4Y19A 3WJMA 3QB7C 4POZC 3D09A 5GHWL 1HK6A 3LZFH 4NUJA 4OFYA 3TA3C 1AD0A 1UD4A 1CFNB 2PCXA 4FQQA 5T1DL 3ILQD 4JDVA 5E8DH 1BDYA 5JHDB 4V1DA 2MCPL 4S11A 4PB9L 5JHLA 1A6AA 5LQBL 1NEPA 2F54B 1QNIA 2CAKA 4IK6A 4NN6B 3QORD 3HE6D 3UTPE 1A9EA 3FNKA 2HFEB 3TYFB 2XTJD 4ZYKA 3L4VA 1ORQA 1TCRB 4O51A 3IRPX 3HS8A 4Z7OB 1A5FL 2X41A 4AKOA 1RJZB 4UV4H 3MV11 1MHPL 5JQHC 3DMMC 3KPSE 2PR4L 3CDZB 3CFBB 3VFUA 1HEZB 3NIFB 4IDJH 4WUUA 1JNLL 4WK4B 1ZLVK 4J12A 4Y7MA 4U1LA 4Q2ZB 1BMGA 3UL4A 4NBXB 1USQA 5BV7H 2P5WA 4GUPB 4PJGF 3DOHA 3V6OA 4DGYL 1AQKH 1JTTA 1P5UC 2B1OA 2DLEA 2WOBA 3FQXA 3MJ9A 4P5TB 2P8LA 4UV7H 1G9NH 4XBGB 5HHOE 4YHKL 5EZIL 2VUYA 4YGVA 4GQQA 2HKLA 1KTCA 2EXYD 2OMXB 4B3VA 2HFGH 4DETA 5ICZB 3HS0A 3CZEA 2FECL 3L3IA 2XWTB 3S35H 2GBUA 1EBPA 4G7YH 1BVNT 2YPKB 1EPFA 2CQVA 1U3ZA 1X5LA 3CBKB 3NABL 2PYEA 2BHFA 2E9WA 3WLBA 5KVEL 1NLBL 4JHZA 3X3FH 1KBGH 3IMTA 3LKOA 4GKZA 3EOAB 8FABA 4UI2A 3QH3A 5JOEA 1GGUA 2K8MA 2JI2A 5IMMA 4M1DH 3IGKA 3WIFA 4XMVA 1RUKH 2KPNA 2E27L 1AXSA 3HJEA 4PW4A 4OZIF 4XWGH 3DHPA 1A4JB 2BJML 3MCKA 4OU3A 2OW6A 4NKDB 4X8JA 1SJXA 4FI6A 5DLML 4WSKA 5FEBA 1YYML 1E0OB 4B9YA 1JV5A 1XAKA 3CLEL 2NXZB 3WLWC 3PUUA 2UZIL 2VABB 3QEUB 1FGNL 5G55A 5ID0B 5L8KB 2M1KA 1Y18A 5I1GH 3S8FB 1FGVL 5IB2A 4KZEL 2IJ0C 5EN2A 2VXUL 4TNGA 1R17A 1S9VB 2X2JA 3TN0D 3B2VH 1KCUL 3KPRE 4JGUA 2ZXCA 2QTEA 5AVRB 5BRPA 1D9KA 2A74B 5SWSA 2B4CL 4R2GB 1IV8A 4N3TA 1TLMA 3O45B 4N2GA 4PRPE 5L6YH 2ENPA 2ZSWA 2O5NA 2F0CA 1G9EA 1K5NA 2XDHA 4DZBB 3UTTA 1K8IA 2XG4A 4IM8A 1VHPA 3ES6A 5E1HB 3JVFC 1HXYA 2NMSA 4HCFA 3ZHLA 3LDBC 2JELL 3UTZB 4NFDA 1GJWA 1NFAA 1U2HA 3GRGA 3NJHA 5LGJB 1KENH 2C8NA 3LZOA 1AZRA 5HDQL 3WO3B 2W8CA 4I0CC 1R3LA 3MACH 4OGZA 4LP8A 3I6GB 3ZKNC 1DSFL 5LHDA 3MV9A 4KZDH 1YEEL 5CCJA 2CCWA 2FJFA 2UX6A 2G5UA 2Y22A 3V4VA 1MN4A 4PLKD 4D2NA 3PF2A 1IC7H 1CE1H 5JHDE 5HVWA 4EN3D 5K1VA 1JYVA 4ELDA 1DVSA 1B4LA 1NMBH 3OKOB 5J7CC 1E65A 3AS2A 4HS6B 2F54E 4PWHA 3X2QB 4OFVA 1FVDA 4GMTL 3VRLF 1CGUA 4PP1D 4CC4C 3OZ9H 1RERA 2AXFA 4DEPC 2V2TA 5BW7C 5HYIA 5BCAA 1JPGA 4FG6C 5CBEA 4H5SB 4JFFA 4LF3B 4E36A 2JKSA 3ZL1A 1O9WA 4KKBD 2FIKB 2WAQA 1JGVL 1UYWH 2B0SL 2GBVA 3FMGL 5FF6A 2ZXAA 4CMHC 3F7PC 4X8GA 1U30A 2NXYB 3QYCA 4I5BA 1A7OL 3NIFE 2YMXL 2BS71 2MQCA 1JZDC 4FQJH 1CO1A 1NIFA 4L29A 5I5MA 4KMTH 4M8UA 1H5BA 3VXRA 1J1OL 3SPVB 2ZWLT 4BSVB 4OLYL 4JVPA 1L9PA 4FQCH 4HIIB 5TDPA 4F5CE 3D4GA 4IOSA 4P5KB 4R83A 1WWCA 4TNWK 2EYRA 1D5XA 4Z0BH 3U7WH 5LVEA 4DKDC 3BGAA 3O2WL 2QADD 1IAMA 2JKNA 3RWFB 2C9XA 3VXPA 1HX0A 2FSEA 5GGVY 2H0PA 2CPUA 4N3UA 1PEWA 5CSGA 5HGAB 1FAKT 1ZSDA 2Y24A 1QBBA 3O6FD 4UT6L 1AGDB 2X28A 3CHXA 4MA8L 3T3MF 3TJEH 1I1AB 3VRIA 3S88H 1IFRA 4O58H 1CFQA 3AWFA 2VDOL 2YWYA 1LXMA 3MOAL 2X05A 4MD0B 3WKQA 4NRZB 5KBPA 1MJJB 1OP3K 1LEKB 3A24A 3F7QA 1SGKA 4YWGH 1N0XH 4JFYA 4YNYB 4U6HB 3C60A 3MBEA 3SDAA 1N12A 3VD1A 3DBSA 2GJJA 2DQEL 3EFOA 3IMWA 2X7LA 4QLWA 1V3KA 2V5TA 2CGRH 5KJ7E 3RURA 2EQDA 5K9OB 1JNJA 4NO2A 5FUCC 4OW6A 1A4BA 2J1KA 4TNVK 4PJBA 5LXGH 5E4EC 5GGTA 5HBBA 2PWFA 3BP4A 2ZUVA 3Q6GH 1NM9A 1IM3B 1F18A 1LP9A 1RQ5A 3BKCH 4GRWE 5DUPH 1UXSA 5DZVA 1HH6A 2A77H 4NWUL 5L0QC 5IFHH 2Y69B 4BV1A 1WHOA 5IWLC 3ARPA 1ZIAA 3GXMA 3QDHA 2WINB 4XNYH 4TVSa 1VEMA 1TQSA 2ZOUA 3I3DA 1BBDH 4ES8A 1I9IL 1XQ4A 4ODUB 4JMNA 5GZNC 3REWB 3TV3H 2MQGA 4GIOA 4GG6A 4X6CF 1FN4A 1MAML 5TPWH 4FHJA 2J4WH 3T65A 2OK0H 5D70H 3FCTA 4AYFA 5B7MA 3ROLB 1OSEA 3GEFA 4LOVA 2RFXB 3JWNE 4AQ8C 4QT5B 1EZLA 1KPRB 1RFDL 3TEYA 2YFOA 4CW1A 2G9HB 3OXSB 4D9LH 3RI5F 3RWCB 1NDTA 2MKLC 2UVFA 3S36H 4M9OA 4HUVB 3MNMA 2VE6B 3E0GA 5CSZB 4AJWA 2EZ0C 5FUOH 4H25A 3IMBA 4JFQB 4YSQA 1QW8A 3FU5A 4PP2A 2Y25A 4LRIA 1FNGB 2WVSA 3QIUA 3NJMA 4UQ2B 4KV5E 3VSTA 4EIGB 4WY7H 3KBHE 4JUTA 1G7PB 1MFDH 4HJSA 2CIKA 4N0UE 5FECA 5C7XH 2ESVA 1VAHA 2H4EA 3QA3B 1LO4H 1K5WA 4KROD 1TQBB 3FU7B 5HYSG 1A6VH 1CR9L 1SLWA 3IAQA 3LPOA 1BM3H 3OGCB 4YK4B 4CNIA 1E6OH 1DVFD 1P7QD 2X1WL 2YA0A 1S8DA 3RL2B 5EUOF 3V0VB 2NQDA 4M02A 1VJSA 3NTCL 1BQLH 2XV6B 3L9EA 4Z7WE 4U6XB 5GGRA 4ABWA 4ENEC 2OFQA 4JBSA 4G3YH 1KTLB 4G6FB 4H13C 1J0YA 1NLDL 3NK4A 4OD3H 5DRXA 2BHZA 4OTXH 2JKJA 4OZFA 4ZO7A 4LQFH 3TASA 4YX2L 4LHQB 3U9PL 1AAJA 2Q5BA 2YLKA 3N43F 1JFQL 4ISVA 1I8KB 4UMSA 3GMPA 3V0EA 1QSED 3JTBA 2QPUA 1RUPH 2YQ2A 2F2HA 5C0DA 3HZVB 3CVDA 5EPMA 5KZCD 3RWGA 4UAOB 3IFPB 1JL8A 2OMUA 2O5XH 5A7BA 2EDOA 3FT3B 2J20A 2LVCA 5D72L 5BV7B 1FDLH 4C56A 2XY2A 4JKWA 5I75B 5T8IA 4P05A 1XF5A 4AZ8A 3BZFB 1EFXA 1W2KT 2DDQH 3I6LD 2FX8H 4LSDA 1KIUA 3TBYB 4Y19B 4YPGB 3WJMB 1G5GA 2JJSC 4JO3L 1W8OA 5T5FL 1N10A 1OSZA 4Y4HA 2ZTBA 1I53A 4FQQB 3U4KA 1A6UL 2HSIA 3BVUA 4W68A 5KSAD 1HEJC 3AW5A 4PRBB 2WXIA 3FQUB 1L9QA 3GBDA 1WT5C 5FYKL 4K2UL 3EAKA 3NQIA 2H2PD 2XWXA 4AH2B 5GHWH 1UKQA 3QZOA 5IHBA 2PN5A 4ZUSA 3Q0HA 1R6VA 4H4NA 3OF6A 3F58H 5EOCL 3QNXA 2YGQA 1VA9A 4FXTA 3FPXA 3SSGA 1E4HA 5H2BA 1A9EB 4P2YA 1IJ9A 1X5HA 2A73A 2MCPH 5D7JD 3MX0A 4PB9H 4ZYKB 5LQBH 1OAQL 1ORQB 5GGSA 3GC3A 3P54A 3FH5A 4O51B 5ACMA 2HT3D 4HPHA 4BJLA 1N0LA 4NC2B 4XI5C 3O3UN 4K8RD 5IY5B 2AJYL 3QUXA 4BZ2A 1SF3A 2BY3A 5IMKB 5A6LA 3ZTCC 5KBDA 4XNAA 5I8KL 1YUHA 3VFUB 2VQUA 4WUUB 4F15C 2QHLA 1AGEA 2W91A 5C0AA 4YJZL 5DTFA 1A5FH 5EZLB 2P5WB 2PWDA 1N6VA 4X5WA 2WO4A 1MHPH 2J2ZB 3A4DA 4NNXA 2NCEA 1HCFX 2P8LB 2PR4H 5EEXA 3CN1A 5SX4H 5KYWA 4YGVB 1JNLH 3JZ7A 1VKXA 1RZIA 3QJHA 1JYWA 1CDHA 3HS0B 2BCKA 2AV7A 4LFHG 3L3IB 4DGYH 1YMMA 5FYJH 2V6HA 4X9YA 5KOVC 3NCYS 4P2QB 5EZIH 4CKVX 4CDHA 4TQPA 3PPEA 3QI9A 4QRPD 4AL8H 2PYEB 3WLBB 4PS7A 3V7MA 5FW6A 4I8DA 4CJ0A 1TQCB 4WF7A 3LKOB 4GKZB 3SO3C 4JRYA 2DYSB 8FABB 4FXGC 2Z92B 3E2HB 4D0DB 1K6QL 1RUML 5IMMB 4XHQA 2HKHL 2J8UF 1F42A 5E8PA 2HLFC 3NABH 3SIKA 4BH8B 5CZRA 4X8JB 1A6PA 1NLBH 1CS6A 3OBAA 4OFKA 4KK8C 3NGBC 1JV5B 3L9RB 5C0RH 2FQGA 4R0LA 2DJ4A 4Z23A 4JO8A 3QCVH 4GB9A 2DM7A 4PV9B 2E27H 5TDOA 4RMSA 5CUSL 1NCHA 1WFTA 2BJMH 3PXHA 1XDTT 5DLMH 1B6UA 3VXUA 5KOMC 1DUYA 2ICWJ 3BGFB 5CZVL 4K7PX 3CLEH 2WQRA 3AVEA 3RAJL 1D9KB 2UZIH 2KUTA 3GXTA 1FGNH 3NSDA 3DURA 3LVEA 5SWSB 4DZ8A 1N59B 2Y0SA 4FQHB 5D6DC 1EQWA 1S46A 1FGVH 4KZEH 3ME0A 4PJXA 3B83A 3CLFL 1K5NB 2VXUH 1BJ1H 5AYUH 3UTTB 1K8IB 3IWUA 2XG4B 4R5TA 3ES6B 1KCUH 1F0LA 2WVUA 4IIZA 1PLGL 1MFUA 3HA0A 4YLBA 2B4CH 5HYJA 4NDMA 4ZPTB 3UBXG 2AITA 1CICA 1L6PA 3FC8A 3GNML 3II2A 4LPCA 3SPGA 3OKYA 4L8DA 2B15A 1JZJA 1OT1A 1R3LB 3VWKD 3BAYA 5E9DD 2BW5A 3C09B 2PPAA 2C4FT 3MV9B 4N9GB 4K4KA 1JWSB 3MJ8B 2FJFB 5CO1A 4ZMLA 3V4VB 2R0LH 3MGTA 2JELH 5D7SL 5CN3A 5DDHA 3N40P 4FG2A 1OD7A 1MJUL 5IB4B 5DD3L 3O11A 2JLLA 1J0KA 5HDQH 3VMPA 3QXUA 4NOFA 4Q9CA 1QVOA 4TLUA 1Q9LB 1U8MA 3LRHA 1DSFH 4HV8A 1YEEH 3PP3H 4RGOL 4UT6A 3WCYA 1SOQA 2WXMA 5C9JA 4QRRA 2R4RH 4PJ9C 3KYMA 3X1GA 5CFAA 5ISZA 2V2TB 1AVAA 1UD5A 3LD8B 4XVUC 1CI3M 1JPGB 3Q2LA 5CBEB 4RMVA 4IBUA 4JFFB 3SDXA 4ADGA 3N42F 4NHCL 2IAND 1JZIA 4NFBA 4Z5RA 3HNVL 3WO4C 2GC4C 2Z0UA 3QAZC 4GMTH 2AF2A 4NNYA 2BCMA 5C07A 2Q7AA 1LE9B 1GZHC 4PLJC 4NZFA 2WXHA 2BNRD 3DTXA 1IAIM 3FFCA 2A6DA 4WTZG 4L29B 5EBLA 2EP6A 2B3IA 2YEVB 3W11C 1H5BB 5AZEL 2PWHA 3CCHA 3D18A 3BUDA 1JGVH 1VFAB 2B0SH 2P5WE 3FMGH 4LSSL 5D55A 3T0AA 4Y16B 5TDPB 4M3JA 4F7MA 4AITA 2EYRB 1D5XB 5BVJA 1A7OH 5I19H 3O3EB 1NSNL 5B38A 1JDDA 2DQ6A 1ASOA 3PWPE 2FSEB 3ALXA 4GQRA 4K71C 3LZLA 1QASA 4QWWD 2Y36L 3EH3B 1J1OH 2JK5A 4OLYH 1KZYA 2E3VA 4NQED 3NRPA 1M7IA 1ZSDB 2D7NA 2HTLC 3MXVL 2DMGA 4P2QE 3O2WH 2PYEE 1CFQB 1JF5A 5J8OA 1M53A 4IJ3C 4BFFA 2NDGA 2Y4SA 3ENEA 3AY2A 1SRDA 1A6TA 5DR5H 1SN0A 5JXED 4UT6H 5EU3B 1FH5H 3CFEB 4FFTA 4G8FA 4MA8H 4AOFA 1WK0A 4P46D 1XGUA 1YAZA 3QZWG 4HJ1A 1I1YA 5JPNC 5F96L 3D48R 1KIQB 3C60B 3EGXA 2VDOH 3KCPA 1JVOA 3MBEB 3SDAB 4OKDA 3EFOB 3MOAH 4NNPL 5FYJU 4GRLB 1AOHA 3FB6A 2MTZA 4M29A 3WFZA 5DZJA 3TURA 2V3EA 4NO2B 1K8DA 4I85A 2B08A 1AKJD 4PJBB 4ZUWA 2A6KA 3BP5A 2VSMB 1S7SA 4LSRL 1D7DA 5I6OA 3B9DA 3ZDYB 1LP9B 5C8JB 3H2PA 4E9YA 2VDQL 2APVA 2DQEH 4JFSA 3EH4B 3DYOA 3QJFA 1QLEB 3F6JA 1BPLB 4EOWL 3HG4A 1BVOA 4IGBD 1QPXA 3T6XA 3ARGD 3O6LL 3O6ML 3RIAF 2VUOA 1CJYA 1F41A 4N1HB 3RB7A 3UTTE 4X5XB 4Q9QL 3MUJA 2D2CC 3IMRA 2D7QA 4NWUH 2B3RA 3F7KA 5KSBA 4YUEH 4Q8BA 1KTKE 1FN4B 5TE7L 3P3YA 1DQQA 1U8IA 4TVPD 3T65B 2NR6C 1NJ9A 3FCTB 1XBRA 4FXKA 4AYFB 1FV1A 4W9LC 3NSYA 5D1ZB 3UYOD 3INOA 3CH1A 4HS3A 4U1GB 3UTQB 2V2XB 4Z7VF 3ZIMA 5GJSL 4BFOA 3EOTH 3R1GL 1WZMA 1FCGA 2Q8AL 4OM1L 1MAMH 4JGJA 1SUJA 2AANA 3BVNA 3OAYH 35C8L 2DLGA 4H25B 2KC0A 2YS4A 3SCMD 4R6UA 5E94A 4KVCL 3RVVC 1D6VL 1RFDH 4PP2B 1NCDL 3ZR5A 4LVHB 3IWVA 3QIUB 2YAPA 4X7SL 1E42A 1JFHA 3L5XL 3VFOA 5FECB 2CLZA 2ESVB 1WWAX 2VL4A 1KJMB 2MQ3A 3ILEA 4ACTA 2BSDA 2XJLA 4OQ1A 1XMWA 3GSWA 2WNWA 3AWGA 5DZNA 4B9ZA 4CNIB 5JOPD 1S8DB 4XXWA 4HBCL 5T5FA 2DIBA 2EDEA 5L2JA 2YUXA 5K69A 1Q1JL 5GGRB 1HYSD 3VU1A 5JUEL 3BZ5A 3TEZA 4EXKA 2Y1YA 4ELKA 4JN1H 5KVDE 2PTTA 1CR9H 2WZ5A 5DRXB 4JFPB 5JOFB 3LX9A 4OZFB 1A21A 4CSSA 1G9NC 4O2FB 3ATAA 5GRJL 3FW6A 4ISVB 3A6CL 1T5XA 2NSQA 1AP2A 3FQ2A 4NPKA 5F3BA 3NJXA 3DK0A 1NLDH 5C0DB 2OX5A 4KX8A 2VIRB 4KNTA 3GTNA 5EPMB 2ZIDA 1NANI 1MFEL 4H0GA 1BFVL 1QTSA 4YX2H 1CMOA 4U1KA 1COBA 4PG2A 3U9PH 1VRSA 2YWZA 1JFQH 4PJAF 4W9HC 3DUHA 4HCIA 4OI8A 3ML8A 3P30L 4C56B 3V4UL 4RDQF 1NBVL 3VWJB 1TJGL 1XF5B 5DMGC 5B39A 1IZJA 4AZ8B 2GI7A 2YD4A 1TJMA 1EFXB 5GSVA 3TU6A 1EAQA 1S3KL 1NUDA 1MCWM 2VN6A 1KIUB 4RH4A 3DV4A 3SYCA 5JIQA 1OSZB 4QXUL 4UIKL 2EO9A 4B9FA 4DVBA 3WUWA 1TTUA 2DKMA 1CG9B 4FQLH 4NN7B 4XNMB 2ZUYA 2OTWA 4X9BA 4JO3H 5T5FH 3BH9A 3HI6H 1KXQA 1IAOA 4PJBE 1R47A 1QFOA 2EC8A 3QNXB 1A6UH 2WJ7A 1F11A 4MCZB 1ILUA 5GRXG 3CWGA 5IQNA 4A1IA 4QHPA 3V6OC 4D0BA 1B2WL 5FYKH 4BELD 2A73B 5JIMA 3VGFA 1E6JL 5JHMA 5IVNA 5JXAL 4KFZC 2EIBA 2NY1B 1N0LB 1J0HA 4N20A 5B7FA 3FH8A 3QUXB 4G43A 5SWZA 4GEJA 2C9VA 3KGTA 1MIMH 1YLBB 4NKMA 1CF8L 2VLLA 3CU1A 1XR8B 2DQUH 3PHSA 1ACYL 2CJTA 1DO5A 1OAQH 1DBJL 2W1NA 1N3NA 4N4YB 5IP4A 5D71L 2YN5A 5DTFB 4MXQD 4DVRH 1TQCC 4X5WB 3ZGIA 5B3JF 2AJYH 4KOCA 1UZ6F 3A67L 2AZAA 1CXKA 3DRQA 1GPOL 3OMAB 4EBQL 5BQ7B 5I8KH 5KYWB 3VXQA 4OCMC 1VKXB 1NAMB 1XFPA 3QJHB 4W9ZA 3B56A 3EBGA 1IO4C 4M56A 3GYRA 4PIBA 2AV7B 3KL3A 1E9QA 1UGNA 4IRZL 1R34A 2EINB 1YMMB 2ZD0A 5I0ZA 3HAEG 1O5DT 1WEJL 5H37G 1NFDE 2DEYX 3N1FC 1HJCA 1ESOA 1X5MA 2CDEB 1SXAA 4XPFL 3QI9B 4Y4FD 2Q86A 3FFOA 3KLAA 2ESVE 2F8VA 3IKKA 1YNKH 1LQBC 1OKEA 3JYCA 3UGUA 3NFSL 5AB0A 1VGEL 1RY7B 3EJZD 4JFOA 3U1SL 4JHBA 4M7LT 2PCPA 2Z64C 4YH6A 1CIUA 4G1EB 3GLEA 3OB0H 3K4ZA 5E8PB 1BFSA 2DQTH 1MVUA 3HRZC 4KMLB 3F04A 2OMBA 1UEMA 3RGHA 4ONFL 5D96B 5KAQF 4R0LB 1K6QH 4HSCX 1SN2A 1KGIA 2HKHH 1A3LL 3HUJF 5BZDA 4MNHA 1OZUA 1GZQA 1NC2B 1NCTA 2IDCA 4MMXA 5C92A 3EYQD 3ZRFC 3OHXC 3VXUB 1N4XL 3ZQ9A 1DUYB 4OF8A 3NJLA 2VXQA 2XICA 3WN5C 3CQPA 3ZTNL 3ALPA 3QIWA 3DURB 4DZ8B 5D1QD 4WW2C 3L13A 5EOTA 2RH0A 4PRIE 4GIAA 4QKTA 5CUSH 1GYCA 4BSJA 4QAWA 3ME0B 4N90E 4ZOBA 4MXVF 2QKIA 3UGEA 4FKHA 4XZ4A 5CZVH 2FJSA 2V7HA 2DZEA 4LGSB 3RAJH 4MZIA 4RSVA 3B8SA 3ZE0F 5AAPA 2A5UA 3O9WB 3A4AA 3SN6N 1CICB 4L4TD 5GGUA 4A1KA 3OX8A 3CLFH 3PJLA 4L8DB 2DMCA 2UZYA 5HP5A 4WO4C 4L3EA 4EI5D 5CF3A 1PLGH 4F33A 1J9TA 5D7HA 4P23D 1XZ0A 3MGTB 5DDHB 4PRNA 3EO9L 3GNMH 3GSQA 5I6XC 3CHPA 3O11B 3P2BA 3FUFA 1QVOB 2FUQA 5I23A 5B7EA 1U8MB 4RX4A 3II3A 4GKOA 1G0DA 5JW5B 3CSFA 4FFZL 4QRRB 1O9VA 4N86A 1MJUH 3OG4B 1KGYE 2IGFL 5LNGA 1R75A 4WHCA 3SDXB 2XV3A 1DCLA 3DI2B 3DXAA 1CL7I 4FNQA 3GRBA 4YBHA 5EOCJ 4J3UA 4RGOH 2AJVL 4U05A 3CX5K 4GSRA 3UG3A 4LPVA 1QFPA 2Y1VA 5C07B 2NRDA 2QSTA 1TITA 2GJ6D 3DTXB 3FFCB 2A6DB 5EBLB 1R5WA 3NACL 4LPQA 1UJ3C 3SDYL 2Z91B 1RZ7L 4NHCH 3N0PB 3D18B 3HNVH 2LU3A 3IDNB 1OM9A 5FYKU 1FFQA 4U1HA 2WYHA 1L7TL 2WXNA 3T2PA 5EMYA 3VM7A 5FOJA 5B38B 4HCGA 1JWUB 2YAFA 7PCYA 2AXJA 1PZ3A 5AZEH 2Z31D 2UWEF 2CBTA 1FNLA 2J5LC 2JK5B 4LSSH 4I9XA 1Q9WB 2NY4C 2IOMA 1YMME 1T7VA 3SDDD 3SB3A 1G4RA 1IKNC 1HTYA 1UH4A 1MWAL 1GYAA 1NSNH 5FFOA 1HOCA 1V7NL 2AQPA 2WIIA 3QHTC 3F62A 3JV0A 5CGTA 2N0KA 4RWYL 1T1WA 2VDLL 2Y36H 3SQBB 1MQKL 3EJYC 2EO7A 3BSZL 2NT0A 1A6TB 4L8CA 2ITCB 1F00I 2WYIA 3MXVH 2MOQA 1MNUL 2K45A 4G8FB 5I1JL 3D3VD 1XGUB 3VFSA 5GRVK 1S7UA 2OTPA 1I1YB 4LLMA 1CF1A 1CLZL 5AYQA 4D0CB 2CA3A 5T1KA 4JFDE 3KCPB 3DJSA 1T6BX 4GRWH 4XE0A 2DKSA 2G2PA 2YGVA 3FB6B 3T0VA 3V6FB 1HCVA 2BSBA 1TVHB 2EDRA 2VWEE 1QR1B 3W38A 3UAAA 1K8DB 4BXVA 4NT6B 2A6KB 3BP5B 4KJYA 5F96H 1S7SB 4GS7B 4XN2A 1MHHA 4G6AC 2ZNXA 5FYLE 3AU0A 4AXWA 4I1RA 3VXUE 1EJOL 2EDJA 4OFIA 4POZD 1C5DA 3NSJA 4Y5YC 5EU5A 4E9VA 2P26A 4H8PA 4NHUA 3TA3D 2X0UA 3KPPA 1U8OA 3QJFB 3TO2A 3TOPA 3GTVA 1T0MA 4URTB 3D87B 4U0QB 1VERA 4XNDA 4Z7UE 4LSRH 4L05A 1JGEA 3LOWA 3U46A 1SHWA 2QDWA 3BIAX 4MCNA 2GW5A 1YA5A 2Y6TE 4FL4B 4F8TA 5KSBB 2IGLA 4EOWH 4J3OF 3A5VA 1DQQB 1U8IB 1NJ9B 4FXKB 1GXEA 3R06A 3O6LH 4HEPG 2D3NA 4C4KO 2CWRA 3MGOA 3NIDE 1VESA 4HS3B 4Q9QH 3QG6A 2JIXA 1S7QB 1KF9B 1EO8L 3AU1A 3MTRA 1LM8V 5HGDB 4QJ4B 5TE7H 5JMOC 1URZA 2FJUB 3BVNB 3CDGA 4OIIH 3RZCA 4G8GA 5E94B 2O61A 1X5ZA 1I1RA 3S9DB 4YE4L 4HWBL 2WZ0A 5B1JA 2ENJA 2X4RA 3APCA 4M5YL 1HL4A 3Q5TA 3R1GH 4WENB 5BRZA 1ZKAA 3T0EE 2Q8AH 4DO4A 4OM1H 4QRRE 2J6EL 3ZZ1A 2DBJA 2ZCKH 3WJLC 4DEWA 4G9FD 1IVLA 4KVCH 3VGEA 2H32H 3GSWB 1NCDH 5KJRH 5MENA 4QR7A 2YPLD 4AW7A 3U4AA 2N4IA 5DJ6A 3SKMA 4FMFA 2W9EL 1SXSA 4X7SH 3SYOA 3J7HA 3L5XH 5DA4A 2ADIB 5DGQA 4G5ZL 4WEBL 1HSAA 1S9YB 5C07E 4QYOA 4ELKB 1GC1H 3EYFA 3NCFB 2PTTB 4M6NL 2WLLA 4WHYH 3WMQA 5EZOL 2CCVA 2XKNA 4X99A 4ODXA 1GY1A 3NIGB 2BHUA 3N04A 3P4LA 4ZS6C 4BINA 1AP2B 2B1AH 1Q1JH 3OLEA 4OF5A 4PLOB 2V8LA 1BM7A 2OX5B 3KWUA 4Y4HC 2CBOA 3VFGL 1HSBA 2Y7MA 4U1KB 4YN3A 5GRJH 2BIMA 4EZLA 3A6CH 2XG5A 1PYWA 4R7NA 2H9GA 4H1LG 4Q4IA 4JY4B 4PJFA 4P59L 5DA0B 4IBTA 2IAMA 4B5EA 4M6OH 4GFTB 5B39B 1KFGA 1PX8A 1ZHLA 1MFEH 2OQJA 3WI9A 4CBPA 1BFVH 3KLLA 5C6PB 2CUMA 1MNNA 5HHNA 1L9NA 3DV4B 4JFEA 4K7FB 3BPOC 3FT4B 4HLZG 2EEFA 1U8KA 4KNQA 3STLB 4M93C 1KB5A 1O6VA 5CMAA 3V4UH 2W80C 3RDTA 1NBVH 4FI8A 4DVBB 2D7OA 1TJGH 4H8VA 4KNSA 4DGVL 4DO5A 4EE2A 2OJEA 2YRBA 1YQVL 3OKEA 2R1WA 1TMQA 4PJ8B 1S3KH 3IF1B 4JDZA 4BKSC 1TZGL 4DPRA 4IRZA 2VMFA 3BH9B 5MP6L 2LLLA 1IAOB 4KTDL 3E7JA 3S34L 3O8XA 2JI1A 3PHAA 4RESB 2IH1B 2XKSA 6FABL 4DCQA 1DCEA 4D0BB 2WJ5A 5E2WL 3ZKND 2ICES 3GXNA 1AIZA 5E03A 2ZP8A 4KZ0A 3QEHA 3EYSL 4HU8A 2DM2A 2CGYA 4FQXA 2ILLA 4Z3IA 3ULVD 4MX7B 2MPAL 2WQSA 1GJIA 5SWZB 3AGVA 4JHAL 2B4CC 4MCMA 3WV0A 5AFAA 1TKWB 4NKMB 1B2WH 3SE6A 2VLLB 1E6JH 4LQ1A 5KSBE 1X4XA 1RPUA 2B16A 2EXTA 1N3NB 5JXAH 4ZAKD 2VR9A 2Q20A 1WIOA 4UM8B 5LCVL 43C9A 4E68A 4JB9L 1M56B 1ECYA 4DT2A 3OPZL 5EIVA 1DQDL 1I8MA 5EUKA 2JKWA 2K9FB 3UJJL 1RZGA 4MAYA 4QXGH 4F37K 3BISA 3DRQB 1CF8H 3WSQL 1ACYH 5F88A 3VXQB 1VPOL 4GT7A 4I48A 5DEFA 2D3VA 1KCSL 4NC0B 4YDIH 5D71H 3BVXA 3CFKA 1PEZA 1E9QB 4I0PD 2NTFA 3ZE2F 1KB5H 4NJ9H 4S2SA 2YAQA 3CVIL 1KYOK 5I1EL 1JGLL 1ADQL 1AO7A 1H8SA 3TF4A 3A67H 3CZNA 1G1YA 1GPOH 1HQ4A 4AIOA 4EBQH 5I0VA 2Q86B 3S8WA 2FT7A 3KLAB 4GUCA 3G6DL 1N2RA 4QTHA 4IRZH 1U92A 4LO9A 4EN2A 3I3BA 1WEJH 1UEYA 3CPUA 4MJ5A 2FUTA 1QLFA 4XPFH 3BPNB 1T4WA 2WWMD 1JZ6A 1IGIL 2QFRA 2X9WA 3PAUA 2W88A 3IDIB 2OSYA 5KSVA 1BLNA 3QDGB 1CLVA 5EORL 4R5XA 1VGEH 4ZDHA 4PY8I 3U1SH 3RPIA 1QUNA 2V9RA 4PI2A 5BZDB 1TYEB 4MNHB 4QHMA 4UT7L 1GZQB 4MMXB 3MMEA 2UUDK 3NIGE 5ESAA 1Z6JT 3DKHA 5GISL 1UXLA 4NXSA 4ONFH 4QF1B 2O4EA 4PJHE 2XTLA 1X44A 4LPTA 4UILL 2GJRA 3FCSA 3QIWB 3IM1A 1A3LH 4BWTA 5DRNB 5EOTB 3VFWA 3MREA 1MUJB 4BFBD 4XVTL 2AK4E 2QKIB 1II4E 2UY6A 3RIKA 1N4XH 1OWWA 2WQVA 1P69B 2V7HB 2AVFA 3TEUA 3WKNA 3ZTNH 1FLRH 4P2RD 4J27A 5GGUB 1H15B 3N5AA 3OX8B 4RAHA 3FPYA 1SJMA 5LN8A 1IAII 1AHWA 2CE6A 3X14A 1ZS2A 2P9RA 3AREA 3OMIB 4KO5A 2VO8A 1XTMA 3GIVB 5H94B 4CU8A 5F7NC 4CU7A 4XNUH 4F33B 4YS4A 3AAZA 2CU9A 4Y5XC 3CUPA 1A3QA 1EANA 4ATWA 1UHVA 4LBEA 4AEHL 3GSQB 3VI4E 5DD1L 3QUMA 2DEWX 4JE0A 5GZND 2CHNA 4Z7OF 1EVUA 2ZUUA 3NFPA 4LSUL 5FR3A 3GSNL 1V05A 4OCLC 1QABA 4MBOA 3SBQA 5F0MB 3NIFF 2FH6A 3TO4B 1E5AA 5HHXL 3FRPA 3EO9H 2VC2L 1L3WA 4BDVA 2CG9X 3FB5B 3TFKD 3LRLA 3PUCA 2PW1A 4D9QE 3DXAB 3RY4A 3L17A 4HF5H 4HJ0C 2J55A 4ANXA 4MBRA 2K3TA 4FFZH 5C86A 5SWZE 1G7QB 1Y7MA 4ODBD 1ZLVH 4M48L 4OIAA 4JGNA 2FEEI 3QORA 3HE6A 1K3IA 3HFMH 4MSWB 1LYQA 1UFUA 2VXVH 4XO3A 4Y9BA 1T7ZA 4YSAA 4YR6B 1ECZA 5L4JA 4KHTL 1N26A 3U4BH 3C6EA 4JRWA 5E1QA 4U1HB 2V17L 2LU5A 2GBTA 1MDTA 1EEYA 4BQ8A 1BD2D 4C55A 1URIA 1DZBA 4YDLC 1FJ1A 2EDTA 1LK2A 5EU6D 1EWHA 1QEXA 3SDYH 3QS3A 4BK8A 1RZ7H 3M1BA 4ENED 5CD5D 3QXAB 1EDYA 4MB4A 3FBQA 3Q05A 2VZOA 1L7TH 2XN9D 1G7JA 2IMMA 4HSQA 4I3RL 2HX7A 1CI5A 3ZMNA 4NRXA 3OZLA 1HOCB 2WIIB 4NYLB 2WTRA 2F7RA 3LZPA 3PFQA 5GGQL 3FS9A 3D39D 1UOVA 4L8CB 4M3HA 5DFVC 2APSA 1FSKB 2VM9A 3VFSB 1FC1A 1MWAH 1S7UB 2W60A 2E6QA 4LLMB 1MFAL 2X4QB 5T1KB 1V7NH 1MREL 2AJZB 2CJSA 4RWYH 2VDLH 1MQKH 1GGCL 4BFIA 3QDGE 1UD3A 3FCGA 3ASOB 4GXVL 3BSZH 4J4PC 4LK4A 5AVTB 4C47A 4F1SA 4PJIA 1I7RA 3ZUCA 1TJIL 4FNPA 1MNUH 5GS0D 3DUSA 1ZJAA 5I1JH 2IFGA 4XNZB 3C8KA 2RQEA 1CLZH 3KYAA 1MHHB 4HWBA 5EU5B 1C5DB 1BMWA 3RWDA 3PJSA 3KPPB 4YHNA 1W0YT 1U8OB 4AV4A 1EBAA 2FBJL 3CH8A 1NM4A 4HIHA 4FCHA 5EU7E 4B53A 4NCDA 2E59A 4AJ0A 1K72A 1YEHH 3P9MA 3HCVA 5D2LA 1HQRB 1EJOH 1IC4L 3U46B 2OCFD 4AQZA 5B8CA 1T3FA 1UXMA 4G9DB 4KXCA 5EFIA 1J1PL 3HBQA 1M1XA 3TN0A 2EVJA 1UH2A 2GKIA 2XPZA 1QPKA 3FHAA 4TLSA 4K07A 3OWRA 5FFLA 5T33L 1F8TL 2NNFA 2I25N 4JDEA 5ERWA 2DQDL 3R06B 4XPGL 2LAGB 3MGOB 1IZKA 3AQZA 3QNZA 1BQSA 3CZJA 3QG6B 2ZSVA 1K9TA